data_1P0P
# 
_entry.id   1P0P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1P0P         pdb_00001p0p 10.2210/pdb1p0p/pdb 
RCSB  RCSB018872   ?            ?                   
WWPDB D_1000018872 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1P0I 'native structure with a butyrate bound to the active site' unspecified 
PDB 1P0M 'complex with a choline molecule'                           unspecified 
PDB 1P0Q 'soman-aged structure of the human butyrylcholinesterase'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P0P 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nicolet, Y.'            1 
'Lockridge, O.'          2 
'Masson, P.'             3 
'Fontecilla-Camps, J.C.' 4 
'Nachon, F.'             5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of human butyrylcholinesterase and of its complexes with substrate and products.' J.Biol.Chem.   278 
41141 41147 2003 JBCHA3 US 0021-9258 0071 ? 12869558 10.1074/jbc.M210241200           
1       
;Engineering of a monomeric and low-glycosylated form of human  
butyrylcholinesterase: expression, purification, characterization and  
crystallization
;
Eur.J.Biochem. 269 630   637   2002 EJBCAI IX 0014-2956 0262 ? ?        10.1046/j.0014-2956.2001.02692.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nicolet, Y.'            1  ? 
primary 'Lockridge, O.'          2  ? 
primary 'Masson, P.'             3  ? 
primary 'Fontecilla-Camps, J.C.' 4  ? 
primary 'Nachon, F.'             5  ? 
1       'Nachon, F.'             6  ? 
1       'Nicolet, Y.'            7  ? 
1       'Viguie, N.'             8  ? 
1       'Masson, P.'             9  ? 
1       'Fontecilla-Camps, J.C.' 10 ? 
1       'Lockridge, O.'          11 ? 
# 
_cell.entry_id           1P0P 
_cell.length_a           154.924 
_cell.length_b           154.924 
_cell.length_c           127.909 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P0P 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Cholinesterase 59713.512 1   3.1.1.8 'N17Q, N455Q, N481Q, N486Q' ? ? 
2 branched    syn 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ?                           ? ? 
3 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ?       ?                           ? ? 
4 non-polymer syn 'SULFATE ION' 96.063    1   ?       ?                           ? ? 
5 non-polymer syn 'CHLORIDE ION' 35.453    2   ?       ?                           ? ? 
6 non-polymer syn 'METHYLPHOSPHONIC ACID ESTER GROUP' 79.015    1   ?       ?                           ? ? 
7 non-polymer syn '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' 190.326   1   ?       ?                           ? ? 
8 non-polymer syn GLYCEROL 92.094    1   ?       ?                           ? ? 
9 water       nat water 18.015    337 ?       ?                           ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acylcholine acylhydrolase, Choline esterase II, Butyrylcholine esterase, Pseudocholinesterase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   ILE n 
1 6   ILE n 
1 7   ALA n 
1 8   THR n 
1 9   LYS n 
1 10  ASN n 
1 11  GLY n 
1 12  LYS n 
1 13  VAL n 
1 14  ARG n 
1 15  GLY n 
1 16  MET n 
1 17  GLN n 
1 18  LEU n 
1 19  THR n 
1 20  VAL n 
1 21  PHE n 
1 22  GLY n 
1 23  GLY n 
1 24  THR n 
1 25  VAL n 
1 26  THR n 
1 27  ALA n 
1 28  PHE n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  PRO n 
1 33  TYR n 
1 34  ALA n 
1 35  GLN n 
1 36  PRO n 
1 37  PRO n 
1 38  LEU n 
1 39  GLY n 
1 40  ARG n 
1 41  LEU n 
1 42  ARG n 
1 43  PHE n 
1 44  LYS n 
1 45  LYS n 
1 46  PRO n 
1 47  GLN n 
1 48  SER n 
1 49  LEU n 
1 50  THR n 
1 51  LYS n 
1 52  TRP n 
1 53  SER n 
1 54  ASP n 
1 55  ILE n 
1 56  TRP n 
1 57  ASN n 
1 58  ALA n 
1 59  THR n 
1 60  LYS n 
1 61  TYR n 
1 62  ALA n 
1 63  ASN n 
1 64  SER n 
1 65  CYS n 
1 66  CYS n 
1 67  GLN n 
1 68  ASN n 
1 69  ILE n 
1 70  ASP n 
1 71  GLN n 
1 72  SER n 
1 73  PHE n 
1 74  PRO n 
1 75  GLY n 
1 76  PHE n 
1 77  HIS n 
1 78  GLY n 
1 79  SER n 
1 80  GLU n 
1 81  MET n 
1 82  TRP n 
1 83  ASN n 
1 84  PRO n 
1 85  ASN n 
1 86  THR n 
1 87  ASP n 
1 88  LEU n 
1 89  SER n 
1 90  GLU n 
1 91  ASP n 
1 92  CYS n 
1 93  LEU n 
1 94  TYR n 
1 95  LEU n 
1 96  ASN n 
1 97  VAL n 
1 98  TRP n 
1 99  ILE n 
1 100 PRO n 
1 101 ALA n 
1 102 PRO n 
1 103 LYS n 
1 104 PRO n 
1 105 LYS n 
1 106 ASN n 
1 107 ALA n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 ILE n 
1 112 TRP n 
1 113 ILE n 
1 114 TYR n 
1 115 GLY n 
1 116 GLY n 
1 117 GLY n 
1 118 PHE n 
1 119 GLN n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 SER n 
1 124 SER n 
1 125 LEU n 
1 126 HIS n 
1 127 VAL n 
1 128 TYR n 
1 129 ASP n 
1 130 GLY n 
1 131 LYS n 
1 132 PHE n 
1 133 LEU n 
1 134 ALA n 
1 135 ARG n 
1 136 VAL n 
1 137 GLU n 
1 138 ARG n 
1 139 VAL n 
1 140 ILE n 
1 141 VAL n 
1 142 VAL n 
1 143 SER n 
1 144 MET n 
1 145 ASN n 
1 146 TYR n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ALA n 
1 151 LEU n 
1 152 GLY n 
1 153 PHE n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 PRO n 
1 158 GLY n 
1 159 ASN n 
1 160 PRO n 
1 161 GLU n 
1 162 ALA n 
1 163 PRO n 
1 164 GLY n 
1 165 ASN n 
1 166 MET n 
1 167 GLY n 
1 168 LEU n 
1 169 PHE n 
1 170 ASP n 
1 171 GLN n 
1 172 GLN n 
1 173 LEU n 
1 174 ALA n 
1 175 LEU n 
1 176 GLN n 
1 177 TRP n 
1 178 VAL n 
1 179 GLN n 
1 180 LYS n 
1 181 ASN n 
1 182 ILE n 
1 183 ALA n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 GLY n 
1 188 ASN n 
1 189 PRO n 
1 190 LYS n 
1 191 SER n 
1 192 VAL n 
1 193 THR n 
1 194 LEU n 
1 195 PHE n 
1 196 GLY n 
1 197 GLU n 
1 198 SER n 
1 199 ALA n 
1 200 GLY n 
1 201 ALA n 
1 202 ALA n 
1 203 SER n 
1 204 VAL n 
1 205 SER n 
1 206 LEU n 
1 207 HIS n 
1 208 LEU n 
1 209 LEU n 
1 210 SER n 
1 211 PRO n 
1 212 GLY n 
1 213 SER n 
1 214 HIS n 
1 215 SER n 
1 216 LEU n 
1 217 PHE n 
1 218 THR n 
1 219 ARG n 
1 220 ALA n 
1 221 ILE n 
1 222 LEU n 
1 223 GLN n 
1 224 SER n 
1 225 GLY n 
1 226 SER n 
1 227 PHE n 
1 228 ASN n 
1 229 ALA n 
1 230 PRO n 
1 231 TRP n 
1 232 ALA n 
1 233 VAL n 
1 234 THR n 
1 235 SER n 
1 236 LEU n 
1 237 TYR n 
1 238 GLU n 
1 239 ALA n 
1 240 ARG n 
1 241 ASN n 
1 242 ARG n 
1 243 THR n 
1 244 LEU n 
1 245 ASN n 
1 246 LEU n 
1 247 ALA n 
1 248 LYS n 
1 249 LEU n 
1 250 THR n 
1 251 GLY n 
1 252 CYS n 
1 253 SER n 
1 254 ARG n 
1 255 GLU n 
1 256 ASN n 
1 257 GLU n 
1 258 THR n 
1 259 GLU n 
1 260 ILE n 
1 261 ILE n 
1 262 LYS n 
1 263 CYS n 
1 264 LEU n 
1 265 ARG n 
1 266 ASN n 
1 267 LYS n 
1 268 ASP n 
1 269 PRO n 
1 270 GLN n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 LEU n 
1 275 ASN n 
1 276 GLU n 
1 277 ALA n 
1 278 PHE n 
1 279 VAL n 
1 280 VAL n 
1 281 PRO n 
1 282 TYR n 
1 283 GLY n 
1 284 THR n 
1 285 PRO n 
1 286 LEU n 
1 287 SER n 
1 288 VAL n 
1 289 ASN n 
1 290 PHE n 
1 291 GLY n 
1 292 PRO n 
1 293 THR n 
1 294 VAL n 
1 295 ASP n 
1 296 GLY n 
1 297 ASP n 
1 298 PHE n 
1 299 LEU n 
1 300 THR n 
1 301 ASP n 
1 302 MET n 
1 303 PRO n 
1 304 ASP n 
1 305 ILE n 
1 306 LEU n 
1 307 LEU n 
1 308 GLU n 
1 309 LEU n 
1 310 GLY n 
1 311 GLN n 
1 312 PHE n 
1 313 LYS n 
1 314 LYS n 
1 315 THR n 
1 316 GLN n 
1 317 ILE n 
1 318 LEU n 
1 319 VAL n 
1 320 GLY n 
1 321 VAL n 
1 322 ASN n 
1 323 LYS n 
1 324 ASP n 
1 325 GLU n 
1 326 GLY n 
1 327 THR n 
1 328 ALA n 
1 329 PHE n 
1 330 LEU n 
1 331 VAL n 
1 332 TYR n 
1 333 GLY n 
1 334 ALA n 
1 335 PRO n 
1 336 GLY n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 ASP n 
1 341 ASN n 
1 342 ASN n 
1 343 SER n 
1 344 ILE n 
1 345 ILE n 
1 346 THR n 
1 347 ARG n 
1 348 LYS n 
1 349 GLU n 
1 350 PHE n 
1 351 GLN n 
1 352 GLU n 
1 353 GLY n 
1 354 LEU n 
1 355 LYS n 
1 356 ILE n 
1 357 PHE n 
1 358 PHE n 
1 359 PRO n 
1 360 GLY n 
1 361 VAL n 
1 362 SER n 
1 363 GLU n 
1 364 PHE n 
1 365 GLY n 
1 366 LYS n 
1 367 GLU n 
1 368 SER n 
1 369 ILE n 
1 370 LEU n 
1 371 PHE n 
1 372 HIS n 
1 373 TYR n 
1 374 THR n 
1 375 ASP n 
1 376 TRP n 
1 377 VAL n 
1 378 ASP n 
1 379 ASP n 
1 380 GLN n 
1 381 ARG n 
1 382 PRO n 
1 383 GLU n 
1 384 ASN n 
1 385 TYR n 
1 386 ARG n 
1 387 GLU n 
1 388 ALA n 
1 389 LEU n 
1 390 GLY n 
1 391 ASP n 
1 392 VAL n 
1 393 VAL n 
1 394 GLY n 
1 395 ASP n 
1 396 TYR n 
1 397 ASN n 
1 398 PHE n 
1 399 ILE n 
1 400 CYS n 
1 401 PRO n 
1 402 ALA n 
1 403 LEU n 
1 404 GLU n 
1 405 PHE n 
1 406 THR n 
1 407 LYS n 
1 408 LYS n 
1 409 PHE n 
1 410 SER n 
1 411 GLU n 
1 412 TRP n 
1 413 GLY n 
1 414 ASN n 
1 415 ASN n 
1 416 ALA n 
1 417 PHE n 
1 418 PHE n 
1 419 TYR n 
1 420 TYR n 
1 421 PHE n 
1 422 GLU n 
1 423 HIS n 
1 424 ARG n 
1 425 SER n 
1 426 SER n 
1 427 LYS n 
1 428 LEU n 
1 429 PRO n 
1 430 TRP n 
1 431 PRO n 
1 432 GLU n 
1 433 TRP n 
1 434 MET n 
1 435 GLY n 
1 436 VAL n 
1 437 MET n 
1 438 HIS n 
1 439 GLY n 
1 440 TYR n 
1 441 GLU n 
1 442 ILE n 
1 443 GLU n 
1 444 PHE n 
1 445 VAL n 
1 446 PHE n 
1 447 GLY n 
1 448 LEU n 
1 449 PRO n 
1 450 LEU n 
1 451 GLU n 
1 452 ARG n 
1 453 ARG n 
1 454 ASP n 
1 455 GLN n 
1 456 TYR n 
1 457 THR n 
1 458 LYS n 
1 459 ALA n 
1 460 GLU n 
1 461 GLU n 
1 462 ILE n 
1 463 LEU n 
1 464 SER n 
1 465 ARG n 
1 466 SER n 
1 467 ILE n 
1 468 VAL n 
1 469 LYS n 
1 470 ARG n 
1 471 TRP n 
1 472 ALA n 
1 473 ASN n 
1 474 PHE n 
1 475 ALA n 
1 476 LYS n 
1 477 TYR n 
1 478 GLY n 
1 479 ASN n 
1 480 PRO n 
1 481 GLN n 
1 482 GLU n 
1 483 THR n 
1 484 GLN n 
1 485 ASN n 
1 486 GLN n 
1 487 SER n 
1 488 THR n 
1 489 SER n 
1 490 TRP n 
1 491 PRO n 
1 492 VAL n 
1 493 PHE n 
1 494 LYS n 
1 495 SER n 
1 496 THR n 
1 497 GLU n 
1 498 GLN n 
1 499 LYS n 
1 500 TYR n 
1 501 LEU n 
1 502 THR n 
1 503 LEU n 
1 504 ASN n 
1 505 THR n 
1 506 GLU n 
1 507 SER n 
1 508 THR n 
1 509 ARG n 
1 510 ILE n 
1 511 MET n 
1 512 THR n 
1 513 LYS n 
1 514 LEU n 
1 515 ARG n 
1 516 ALA n 
1 517 GLN n 
1 518 GLN n 
1 519 CYS n 
1 520 ARG n 
1 521 PHE n 
1 522 TRP n 
1 523 THR n 
1 524 SER n 
1 525 PHE n 
1 526 PHE n 
1 527 PRO n 
1 528 LYS n 
1 529 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BCHE OR CHE1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'ovary cells' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CHLE_HUMAN 
_struct_ref.pdbx_db_accession          P06276 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNP
NETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_struct_ref.pdbx_align_begin           29 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1P0P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 529 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06276 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  557 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       529 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P0P GLN A 17  ? UNP P06276 ASN 45  'engineered mutation' 17  1 
1 1P0P GLN A 455 ? UNP P06276 ASN 483 'engineered mutation' 455 2 
1 1P0P GLN A 481 ? UNP P06276 ASN 509 'engineered mutation' 481 3 
1 1P0P GLN A 486 ? UNP P06276 ASN 514 'engineered mutation' 486 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                   ? 'C4 H7 N O4'     133.103 
BCH non-polymer                   . '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' BUTYRYLTHIOCHOLINE 'C9 H20 N O S 1' 190.326 
CL  non-polymer                   . 'CHLORIDE ION'                                    ? 'Cl -1'          35.453  
CYS 'L-peptide linking'           y CYSTEINE                                          ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                              
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                           ? 'C2 H5 N O2'     75.067  
GOL non-polymer                   . GLYCEROL                                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 
92.094  
HIS 'L-peptide linking'           y HISTIDINE                                         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                             ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                        ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose          
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                            ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                                     ? 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                            ? 'C5 H11 N O2'    117.146 
VXA non-polymer                   . 'METHYLPHOSPHONIC ACID ESTER GROUP'               ? 'C H4 O2 P -1'   79.015  
# 
_exptl.entry_id          1P0P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.94 
_exptl_crystal.density_percent_sol   57.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;ammonium sulfate, butyrylthiocholine, 2-(N-Morpholino)-ethanesulfonic acid, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM30A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM30A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1P0P 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             55.05 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   28730 
_reflns.number_all                   29981 
_reflns.percent_possible_obs         86.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        8.1 
_reflns.B_iso_Wilson_estimate        12.0 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   86.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.264 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        5.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3318 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1P0P 
_refine.ls_number_reflns_obs                     28730 
_refine.ls_number_reflns_all                     28730 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.77 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    82.6 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1424 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               35.1 
_refine.aniso_B[1][1]                            -4.42 
_refine.aniso_B[2][2]                            -4.42 
_refine.aniso_B[3][3]                            8.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.350895 
_refine.solvent_model_param_bsol                 81.4425 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1P0I' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1P0P 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4157 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         147 
_refine_hist.number_atoms_solvent             337 
_refine_hist.number_atoms_total               4641 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        54.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        3.35  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       4.62  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        5.07  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       6.54  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             2543 
_refine_ls_shell.R_factor_R_work                  0.242 
_refine_ls_shell.percent_reflns_obs               47.4 
_refine_ls_shell.R_factor_R_free                  0.297 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_obs                2543 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 WATER.PARAM        ION.TOP          'X-RAY DIFFRACTION' 
4 ION.PARAM          WATER.TOP        'X-RAY DIFFRACTION' 
5 LIGAND.PARAM       LIGAND.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1P0P 
_struct.title                     
'Crystal structure of soman-aged human butyryl cholinesterase in complex with the substrate analog butyrylthiocholine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P0P 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Serine hydrolase, organophosphates, soman, butyrylthiocholine, cholinesterase, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 38  ? ARG A 42  ? LEU A 38  ARG A 42  5 ? 5  
HELX_P HELX_P2  2  PHE A 76  ? MET A 81  ? PHE A 76  MET A 81  1 ? 6  
HELX_P HELX_P3  3  LEU A 125 ? ASP A 129 ? LEU A 125 ASP A 129 5 ? 5  
HELX_P HELX_P4  4  GLY A 130 ? GLU A 137 ? GLY A 130 GLU A 137 1 ? 8  
HELX_P HELX_P5  5  GLY A 149 ? LEU A 154 ? GLY A 149 LEU A 154 1 ? 6  
HELX_P HELX_P6  6  ASN A 165 ? ILE A 182 ? ASN A 165 ILE A 182 1 ? 18 
HELX_P HELX_P7  7  ALA A 183 ? PHE A 185 ? ALA A 183 PHE A 185 5 ? 3  
HELX_P HELX_P8  8  SER A 198 ? SER A 210 ? SER A 198 SER A 210 1 ? 13 
HELX_P HELX_P9  9  PRO A 211 ? PHE A 217 ? PRO A 211 PHE A 217 5 ? 7  
HELX_P HELX_P10 10 SER A 235 ? THR A 250 ? SER A 235 THR A 250 1 ? 16 
HELX_P HELX_P11 11 ASN A 256 ? ARG A 265 ? ASN A 256 ARG A 265 1 ? 10 
HELX_P HELX_P12 12 ASP A 268 ? ALA A 277 ? ASP A 268 ALA A 277 1 ? 10 
HELX_P HELX_P13 13 MET A 302 ? LEU A 309 ? MET A 302 LEU A 309 1 ? 8  
HELX_P HELX_P14 14 GLY A 326 ? VAL A 331 ? GLY A 326 VAL A 331 1 ? 6  
HELX_P HELX_P15 15 THR A 346 ? PHE A 358 ? THR A 346 PHE A 358 1 ? 13 
HELX_P HELX_P16 16 SER A 362 ? THR A 374 ? SER A 362 THR A 374 1 ? 13 
HELX_P HELX_P17 17 GLU A 383 ? PHE A 398 ? GLU A 383 PHE A 398 1 ? 16 
HELX_P HELX_P18 18 PHE A 398 ? GLU A 411 ? PHE A 398 GLU A 411 1 ? 14 
HELX_P HELX_P19 19 PRO A 431 ? GLY A 435 ? PRO A 431 GLY A 435 5 ? 5  
HELX_P HELX_P20 20 GLU A 441 ? PHE A 446 ? GLU A 441 PHE A 446 1 ? 6  
HELX_P HELX_P21 21 GLY A 447 ? GLU A 451 ? GLY A 447 GLU A 451 5 ? 5  
HELX_P HELX_P22 22 THR A 457 ? GLY A 478 ? THR A 457 GLY A 478 1 ? 22 
HELX_P HELX_P23 23 ARG A 515 ? SER A 524 ? ARG A 515 SER A 524 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 65  SG  ? ? ? 1_555 A CYS 92  SG ? ? A CYS 65  A CYS 92  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2 disulf ?    ? A CYS 252 SG  ? ? ? 1_555 A CYS 263 SG ? ? A CYS 252 A CYS 263 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3 disulf ?    ? A CYS 400 SG  ? ? ? 1_555 A CYS 519 SG ? ? A CYS 400 A CYS 519 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one  ? A ASN 57  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 57  A NAG 537 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale2 covale one  ? A ASN 106 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 106 A NAG 536 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale3 covale one  ? A ASN 241 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 241 B NAG 1   1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale4 covale one  ? A ASN 341 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 341 C NAG 1   1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale5 covale one  ? A ASN 485 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 485 A NAG 538 1_555 ? ? ? ? ? ? ? 1.429 ? N-Glycosylation 
covale6 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.384 ? ?               
covale7 covale both ? B NAG .   O6  ? ? ? 1_555 B FUC .   C1 ? ? B NAG 1   B FUC 3   1_555 ? ? ? ? ? ? ? 1.400 ? ?               
covale8 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.381 ? ?               
covale9 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           101 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            101 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    102 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     102 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 5   ? THR A 8   ? ILE A 5   THR A 8   
A 2  GLY A 11  ? ARG A 14  ? GLY A 11  ARG A 14  
A 3  ILE A 55  ? ASN A 57  ? ILE A 55  ASN A 57  
B 1  MET A 16  ? VAL A 20  ? MET A 16  VAL A 20  
B 2  GLY A 23  ? PRO A 32  ? GLY A 23  PRO A 32  
B 3  TYR A 94  ? PRO A 100 ? TYR A 94  PRO A 100 
B 4  ILE A 140 ? MET A 144 ? ILE A 140 MET A 144 
B 5  ALA A 107 ? ILE A 113 ? ALA A 107 ILE A 113 
B 6  GLY A 187 ? GLU A 197 ? GLY A 187 GLU A 197 
B 7  ARG A 219 ? GLN A 223 ? ARG A 219 GLN A 223 
B 8  ILE A 317 ? ASN A 322 ? ILE A 317 ASN A 322 
B 9  ALA A 416 ? PHE A 421 ? ALA A 416 PHE A 421 
B 10 LYS A 499 ? LEU A 503 ? LYS A 499 LEU A 503 
B 11 ILE A 510 ? THR A 512 ? ILE A 510 THR A 512 
C 1  SER A 64  ? CYS A 65  ? SER A 64  CYS A 65  
C 2  LEU A 88  ? SER A 89  ? LEU A 88  SER A 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 8   ? N THR A 8   O GLY A 11  ? O GLY A 11  
A 2  3  N ARG A 14  ? N ARG A 14  O TRP A 56  ? O TRP A 56  
B 1  2  N LEU A 18  ? N LEU A 18  O VAL A 25  ? O VAL A 25  
B 2  3  N ILE A 31  ? N ILE A 31  O LEU A 95  ? O LEU A 95  
B 3  4  N ASN A 96  ? N ASN A 96  O SER A 143 ? O SER A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N LEU A 110 ? N LEU A 110 
B 5  6  N VAL A 109 ? N VAL A 109 O THR A 193 ? O THR A 193 
B 6  7  N LEU A 194 ? N LEU A 194 O ARG A 219 ? O ARG A 219 
B 7  8  N LEU A 222 ? N LEU A 222 O LEU A 318 ? O LEU A 318 
B 8  9  N VAL A 319 ? N VAL A 319 O PHE A 417 ? O PHE A 417 
B 9  10 N TYR A 420 ? N TYR A 420 O LEU A 501 ? O LEU A 501 
B 10 11 N TYR A 500 ? N TYR A 500 O MET A 511 ? O MET A 511 
C 1  2  N SER A 64  ? N SER A 64  O SER A 89  ? O SER A 89  
# 
_database_PDB_matrix.entry_id          1P0P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P0P 
_atom_sites.fract_transf_matrix[1][1]   0.006455 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006455 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007818 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 4   ? 120.517 135.768 15.620 1.00 59.35 ? 4    ILE A N   1 
ATOM   2    C  CA  . ILE A 1 4   ? 121.470 136.903 15.442 1.00 60.49 ? 4    ILE A CA  1 
ATOM   3    C  C   . ILE A 1 4   ? 122.804 136.406 14.876 1.00 56.24 ? 4    ILE A C   1 
ATOM   4    O  O   . ILE A 1 4   ? 123.280 135.328 15.233 1.00 54.95 ? 4    ILE A O   1 
ATOM   5    C  CB  . ILE A 1 4   ? 121.719 137.623 16.788 1.00 62.82 ? 4    ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 4   ? 122.383 138.977 16.540 0.00 62.29 ? 4    ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 4   ? 122.594 136.759 17.689 0.00 62.02 ? 4    ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 4   ? 122.396 139.878 17.754 1.00 62.75 ? 4    ILE A CD1 1 
ATOM   9    N  N   . ILE A 1 5   ? 123.402 137.199 13.992 1.00 50.10 ? 5    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 5   ? 124.665 136.828 13.371 1.00 46.31 ? 5    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 5   ? 125.787 137.780 13.764 1.00 47.69 ? 5    ILE A C   1 
ATOM   12   O  O   . ILE A 1 5   ? 125.668 138.996 13.610 1.00 45.43 ? 5    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 5   ? 124.537 136.821 11.837 1.00 46.02 ? 5    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 5   ? 123.440 135.840 11.414 1.00 48.36 ? 5    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 5   ? 125.861 136.437 11.203 1.00 41.45 ? 5    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 5   ? 123.076 135.934 9.952  0.00 48.24 ? 5    ILE A CD1 1 
ATOM   17   N  N   . ILE A 1 6   ? 126.874 137.213 14.280 1.00 43.54 ? 6    ILE A N   1 
ATOM   18   C  CA  . ILE A 1 6   ? 128.030 137.995 14.691 1.00 43.56 ? 6    ILE A CA  1 
ATOM   19   C  C   . ILE A 1 6   ? 129.192 137.625 13.783 1.00 47.37 ? 6    ILE A C   1 
ATOM   20   O  O   . ILE A 1 6   ? 129.340 136.465 13.397 1.00 48.24 ? 6    ILE A O   1 
ATOM   21   C  CB  . ILE A 1 6   ? 128.424 137.697 16.159 1.00 41.67 ? 6    ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 6   ? 127.297 138.121 17.100 1.00 41.18 ? 6    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 6   ? 129.723 138.415 16.514 1.00 39.16 ? 6    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 6   ? 126.994 139.607 17.070 1.00 39.81 ? 6    ILE A CD1 1 
ATOM   25   N  N   . ALA A 1 7   ? 130.008 138.614 13.436 1.00 48.58 ? 7    ALA A N   1 
ATOM   26   C  CA  . ALA A 1 7   ? 131.153 138.380 12.571 1.00 47.95 ? 7    ALA A CA  1 
ATOM   27   C  C   . ALA A 1 7   ? 132.420 138.272 13.405 1.00 47.03 ? 7    ALA A C   1 
ATOM   28   O  O   . ALA A 1 7   ? 132.782 139.206 14.115 1.00 47.49 ? 7    ALA A O   1 
ATOM   29   C  CB  . ALA A 1 7   ? 131.284 139.509 11.564 1.00 44.95 ? 7    ALA A CB  1 
ATOM   30   N  N   . THR A 1 8   ? 133.089 137.127 13.325 1.00 47.92 ? 8    THR A N   1 
ATOM   31   C  CA  . THR A 1 8   ? 134.319 136.923 14.075 1.00 47.53 ? 8    THR A CA  1 
ATOM   32   C  C   . THR A 1 8   ? 135.490 136.907 13.111 1.00 50.61 ? 8    THR A C   1 
ATOM   33   O  O   . THR A 1 8   ? 135.298 136.881 11.897 1.00 53.08 ? 8    THR A O   1 
ATOM   34   C  CB  . THR A 1 8   ? 134.302 135.595 14.844 1.00 49.63 ? 8    THR A CB  1 
ATOM   35   O  OG1 . THR A 1 8   ? 134.566 134.513 13.943 1.00 52.38 ? 8    THR A OG1 1 
ATOM   36   C  CG2 . THR A 1 8   ? 132.945 135.386 15.502 1.00 49.60 ? 8    THR A CG2 1 
ATOM   37   N  N   . LYS A 1 9   ? 136.702 136.913 13.655 1.00 52.80 ? 9    LYS A N   1 
ATOM   38   C  CA  . LYS A 1 9   ? 137.911 136.919 12.841 1.00 53.08 ? 9    LYS A CA  1 
ATOM   39   C  C   . LYS A 1 9   ? 138.037 135.725 11.909 1.00 52.14 ? 9    LYS A C   1 
ATOM   40   O  O   . LYS A 1 9   ? 138.743 135.796 10.909 1.00 53.36 ? 9    LYS A O   1 
ATOM   41   C  CB  . LYS A 1 9   ? 139.148 136.989 13.739 1.00 56.92 ? 9    LYS A CB  1 
ATOM   42   C  CG  . LYS A 1 9   ? 139.244 138.262 14.567 1.00 61.72 ? 9    LYS A CG  1 
ATOM   43   C  CD  . LYS A 1 9   ? 139.327 139.496 13.685 1.00 64.08 ? 9    LYS A CD  1 
ATOM   44   C  CE  . LYS A 1 9   ? 139.590 140.731 14.521 1.00 65.23 ? 9    LYS A CE  1 
ATOM   45   N  NZ  . LYS A 1 9   ? 140.814 140.539 15.348 0.00 65.62 ? 9    LYS A NZ  1 
ATOM   46   N  N   . ASN A 1 10  ? 137.356 134.630 12.227 1.00 55.26 ? 10   ASN A N   1 
ATOM   47   C  CA  . ASN A 1 10  ? 137.433 133.439 11.388 1.00 57.41 ? 10   ASN A CA  1 
ATOM   48   C  C   . ASN A 1 10  ? 136.175 133.179 10.572 1.00 54.08 ? 10   ASN A C   1 
ATOM   49   O  O   . ASN A 1 10  ? 136.129 132.242 9.778  1.00 56.98 ? 10   ASN A O   1 
ATOM   50   C  CB  . ASN A 1 10  ? 137.746 132.204 12.238 1.00 64.85 ? 10   ASN A CB  1 
ATOM   51   C  CG  . ASN A 1 10  ? 139.168 132.204 12.761 1.00 71.25 ? 10   ASN A CG  1 
ATOM   52   O  OD1 . ASN A 1 10  ? 139.402 132.355 13.962 1.00 74.50 ? 10   ASN A OD1 1 
ATOM   53   N  ND2 . ASN A 1 10  ? 140.131 132.040 11.858 1.00 69.45 ? 10   ASN A ND2 1 
ATOM   54   N  N   . GLY A 1 11  ? 135.155 134.003 10.764 1.00 49.70 ? 11   GLY A N   1 
ATOM   55   C  CA  . GLY A 1 11  ? 133.929 133.810 10.018 1.00 48.14 ? 11   GLY A CA  1 
ATOM   56   C  C   . GLY A 1 11  ? 132.695 134.242 10.780 1.00 51.21 ? 11   GLY A C   1 
ATOM   57   O  O   . GLY A 1 11  ? 132.788 134.721 11.909 1.00 50.17 ? 11   GLY A O   1 
ATOM   58   N  N   . LYS A 1 12  ? 131.533 134.073 10.160 1.00 49.77 ? 12   LYS A N   1 
ATOM   59   C  CA  . LYS A 1 12  ? 130.277 134.456 10.784 1.00 46.25 ? 12   LYS A CA  1 
ATOM   60   C  C   . LYS A 1 12  ? 129.713 133.304 11.597 1.00 43.39 ? 12   LYS A C   1 
ATOM   61   O  O   . LYS A 1 12  ? 129.961 132.138 11.292 1.00 42.60 ? 12   LYS A O   1 
ATOM   62   C  CB  . LYS A 1 12  ? 129.259 134.871 9.720  1.00 48.01 ? 12   LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 12  ? 129.727 135.992 8.816  1.00 53.29 ? 12   LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 12  ? 128.557 136.632 8.083  1.00 51.38 ? 12   LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 12  ? 128.997 137.891 7.355  0.00 52.72 ? 12   LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 12  ? 127.838 138.736 6.960  0.00 52.57 ? 12   LYS A NZ  1 
ATOM   67   N  N   . VAL A 1 13  ? 128.964 133.638 12.641 1.00 36.70 ? 13   VAL A N   1 
ATOM   68   C  CA  . VAL A 1 13  ? 128.344 132.625 13.481 1.00 41.96 ? 13   VAL A CA  1 
ATOM   69   C  C   . VAL A 1 13  ? 126.946 133.087 13.868 1.00 42.67 ? 13   VAL A C   1 
ATOM   70   O  O   . VAL A 1 13  ? 126.719 134.271 14.116 1.00 46.53 ? 13   VAL A O   1 
ATOM   71   C  CB  . VAL A 1 13  ? 129.162 132.347 14.783 1.00 39.90 ? 13   VAL A CB  1 
ATOM   72   C  CG1 . VAL A 1 13  ? 130.584 131.953 14.433 1.00 42.67 ? 13   VAL A CG1 1 
ATOM   73   C  CG2 . VAL A 1 13  ? 129.152 133.562 15.689 1.00 42.25 ? 13   VAL A CG2 1 
ATOM   74   N  N   . ARG A 1 14  ? 126.005 132.149 13.908 1.00 45.83 ? 14   ARG A N   1 
ATOM   75   C  CA  . ARG A 1 14  ? 124.635 132.475 14.277 1.00 46.42 ? 14   ARG A CA  1 
ATOM   76   C  C   . ARG A 1 14  ? 124.346 131.891 15.654 1.00 45.42 ? 14   ARG A C   1 
ATOM   77   O  O   . ARG A 1 14  ? 124.744 130.766 15.958 1.00 46.55 ? 14   ARG A O   1 
ATOM   78   C  CB  . ARG A 1 14  ? 123.639 131.906 13.251 1.00 49.88 ? 14   ARG A CB  1 
ATOM   79   C  CG  . ARG A 1 14  ? 122.218 132.458 13.409 1.00 58.83 ? 14   ARG A CG  1 
ATOM   80   C  CD  . ARG A 1 14  ? 121.245 131.876 12.415 1.00 68.76 ? 14   ARG A CD  1 
ATOM   81   N  NE  . ARG A 1 14  ? 121.699 131.930 11.027 1.00 70.83 ? 14   ARG A NE  1 
ATOM   82   C  CZ  . ARG A 1 14  ? 122.146 130.877 10.353 1.00 75.03 ? 14   ARG A CZ  1 
ATOM   83   N  NH1 . ARG A 1 14  ? 122.551 131.017 9.101  1.00 71.15 ? 14   ARG A NH1 1 
ATOM   84   N  NH2 . ARG A 1 14  ? 122.213 129.690 10.942 1.00 80.00 ? 14   ARG A NH2 1 
ATOM   85   N  N   . GLY A 1 15  ? 123.661 132.662 16.489 1.00 43.45 ? 15   GLY A N   1 
ATOM   86   C  CA  . GLY A 1 15  ? 123.326 132.190 17.818 1.00 42.72 ? 15   GLY A CA  1 
ATOM   87   C  C   . GLY A 1 15  ? 121.842 131.909 17.929 1.00 44.66 ? 15   GLY A C   1 
ATOM   88   O  O   . GLY A 1 15  ? 121.150 131.778 16.922 1.00 49.03 ? 15   GLY A O   1 
ATOM   89   N  N   . MET A 1 16  ? 121.350 131.813 19.156 1.00 43.38 ? 16   MET A N   1 
ATOM   90   C  CA  . MET A 1 16  ? 119.940 131.553 19.390 1.00 46.65 ? 16   MET A CA  1 
ATOM   91   C  C   . MET A 1 16  ? 119.469 132.423 20.545 1.00 46.09 ? 16   MET A C   1 
ATOM   92   O  O   . MET A 1 16  ? 120.248 132.768 21.429 1.00 47.14 ? 16   MET A O   1 
ATOM   93   C  CB  . MET A 1 16  ? 119.728 130.078 19.733 1.00 50.80 ? 16   MET A CB  1 
ATOM   94   C  CG  . MET A 1 16  ? 120.169 129.699 21.138 1.00 59.22 ? 16   MET A CG  1 
ATOM   95   S  SD  . MET A 1 16  ? 120.593 127.952 21.324 1.00 69.90 ? 16   MET A SD  1 
ATOM   96   C  CE  . MET A 1 16  ? 119.882 127.254 19.832 1.00 66.37 ? 16   MET A CE  1 
ATOM   97   N  N   . GLN A 1 17  ? 118.193 132.779 20.534 1.00 44.83 ? 17   GLN A N   1 
ATOM   98   C  CA  . GLN A 1 17  ? 117.634 133.604 21.588 1.00 42.83 ? 17   GLN A CA  1 
ATOM   99   C  C   . GLN A 1 17  ? 117.049 132.715 22.674 1.00 39.75 ? 17   GLN A C   1 
ATOM   100  O  O   . GLN A 1 17  ? 116.408 131.710 22.384 1.00 45.42 ? 17   GLN A O   1 
ATOM   101  C  CB  . GLN A 1 17  ? 116.551 134.519 21.013 1.00 49.09 ? 17   GLN A CB  1 
ATOM   102  C  CG  . GLN A 1 17  ? 116.808 136.011 21.212 1.00 59.90 ? 17   GLN A CG  1 
ATOM   103  C  CD  . GLN A 1 17  ? 118.106 136.493 20.581 1.00 60.53 ? 17   GLN A CD  1 
ATOM   104  O  OE1 . GLN A 1 17  ? 118.399 137.687 20.586 0.00 61.04 ? 17   GLN A OE1 1 
ATOM   105  N  NE2 . GLN A 1 17  ? 118.888 135.567 20.037 0.00 61.04 ? 17   GLN A NE2 1 
ATOM   106  N  N   . LEU A 1 18  ? 117.281 133.085 23.927 1.00 38.25 ? 18   LEU A N   1 
ATOM   107  C  CA  . LEU A 1 18  ? 116.774 132.314 25.052 1.00 40.78 ? 18   LEU A CA  1 
ATOM   108  C  C   . LEU A 1 18  ? 115.941 133.198 25.959 1.00 40.19 ? 18   LEU A C   1 
ATOM   109  O  O   . LEU A 1 18  ? 116.279 134.356 26.187 1.00 47.58 ? 18   LEU A O   1 
ATOM   110  C  CB  . LEU A 1 18  ? 117.935 131.727 25.866 1.00 41.61 ? 18   LEU A CB  1 
ATOM   111  C  CG  . LEU A 1 18  ? 118.918 130.785 25.167 1.00 46.31 ? 18   LEU A CG  1 
ATOM   112  C  CD1 . LEU A 1 18  ? 120.055 130.415 26.120 1.00 37.91 ? 18   LEU A CD1 1 
ATOM   113  C  CD2 . LEU A 1 18  ? 118.179 129.542 24.701 1.00 43.24 ? 18   LEU A CD2 1 
ATOM   114  N  N   . THR A 1 19  ? 114.849 132.654 26.474 1.00 38.32 ? 19   THR A N   1 
ATOM   115  C  CA  . THR A 1 19  ? 114.007 133.406 27.385 1.00 41.19 ? 19   THR A CA  1 
ATOM   116  C  C   . THR A 1 19  ? 114.423 133.079 28.814 1.00 43.01 ? 19   THR A C   1 
ATOM   117  O  O   . THR A 1 19  ? 114.375 131.923 29.236 1.00 45.98 ? 19   THR A O   1 
ATOM   118  C  CB  . THR A 1 19  ? 112.528 133.056 27.190 1.00 42.05 ? 19   THR A CB  1 
ATOM   119  O  OG1 . THR A 1 19  ? 112.072 133.636 25.964 1.00 49.97 ? 19   THR A OG1 1 
ATOM   120  C  CG2 . THR A 1 19  ? 111.689 133.587 28.349 1.00 45.87 ? 19   THR A CG2 1 
ATOM   121  N  N   . VAL A 1 20  ? 114.846 134.098 29.554 1.00 40.18 ? 20   VAL A N   1 
ATOM   122  C  CA  . VAL A 1 20  ? 115.264 133.883 30.927 1.00 37.39 ? 20   VAL A CA  1 
ATOM   123  C  C   . VAL A 1 20  ? 114.757 134.998 31.831 1.00 37.96 ? 20   VAL A C   1 
ATOM   124  O  O   . VAL A 1 20  ? 115.025 136.177 31.590 1.00 32.75 ? 20   VAL A O   1 
ATOM   125  C  CB  . VAL A 1 20  ? 116.812 133.822 31.047 1.00 35.12 ? 20   VAL A CB  1 
ATOM   126  C  CG1 . VAL A 1 20  ? 117.213 132.955 32.229 1.00 34.91 ? 20   VAL A CG1 1 
ATOM   127  C  CG2 . VAL A 1 20  ? 117.436 133.289 29.768 1.00 18.37 ? 20   VAL A CG2 1 
ATOM   128  N  N   . PHE A 1 21  ? 114.020 134.607 32.868 1.00 38.99 ? 21   PHE A N   1 
ATOM   129  C  CA  . PHE A 1 21  ? 113.464 135.541 33.842 1.00 39.22 ? 21   PHE A CA  1 
ATOM   130  C  C   . PHE A 1 21  ? 112.772 136.736 33.195 1.00 39.46 ? 21   PHE A C   1 
ATOM   131  O  O   . PHE A 1 21  ? 113.113 137.884 33.474 1.00 39.44 ? 21   PHE A O   1 
ATOM   132  C  CB  . PHE A 1 21  ? 114.561 136.047 34.777 1.00 42.35 ? 21   PHE A CB  1 
ATOM   133  C  CG  . PHE A 1 21  ? 115.274 134.955 35.526 1.00 46.00 ? 21   PHE A CG  1 
ATOM   134  C  CD1 . PHE A 1 21  ? 114.631 133.751 35.809 1.00 45.23 ? 21   PHE A CD1 1 
ATOM   135  C  CD2 . PHE A 1 21  ? 116.580 135.143 35.977 1.00 42.11 ? 21   PHE A CD2 1 
ATOM   136  C  CE1 . PHE A 1 21  ? 115.278 132.750 36.527 1.00 45.67 ? 21   PHE A CE1 1 
ATOM   137  C  CE2 . PHE A 1 21  ? 117.239 134.151 36.697 1.00 43.56 ? 21   PHE A CE2 1 
ATOM   138  C  CZ  . PHE A 1 21  ? 116.587 132.950 36.975 1.00 47.26 ? 21   PHE A CZ  1 
ATOM   139  N  N   . GLY A 1 22  ? 111.797 136.455 32.334 1.00 42.17 ? 22   GLY A N   1 
ATOM   140  C  CA  . GLY A 1 22  ? 111.056 137.509 31.661 1.00 40.49 ? 22   GLY A CA  1 
ATOM   141  C  C   . GLY A 1 22  ? 111.935 138.390 30.800 1.00 41.97 ? 22   GLY A C   1 
ATOM   142  O  O   . GLY A 1 22  ? 111.545 139.487 30.393 1.00 47.10 ? 22   GLY A O   1 
ATOM   143  N  N   . GLY A 1 23  ? 113.141 137.909 30.532 1.00 36.91 ? 23   GLY A N   1 
ATOM   144  C  CA  . GLY A 1 23  ? 114.068 138.659 29.710 1.00 31.19 ? 23   GLY A CA  1 
ATOM   145  C  C   . GLY A 1 23  ? 114.570 137.755 28.612 1.00 35.33 ? 23   GLY A C   1 
ATOM   146  O  O   . GLY A 1 23  ? 113.963 136.726 28.324 1.00 38.25 ? 23   GLY A O   1 
ATOM   147  N  N   . THR A 1 24  ? 115.692 138.120 28.008 1.00 32.53 ? 24   THR A N   1 
ATOM   148  C  CA  . THR A 1 24  ? 116.258 137.312 26.945 1.00 35.17 ? 24   THR A CA  1 
ATOM   149  C  C   . THR A 1 24  ? 117.784 137.327 26.915 1.00 32.51 ? 24   THR A C   1 
ATOM   150  O  O   . THR A 1 24  ? 118.413 138.353 27.152 1.00 35.38 ? 24   THR A O   1 
ATOM   151  C  CB  . THR A 1 24  ? 115.716 137.768 25.577 1.00 37.58 ? 24   THR A CB  1 
ATOM   152  O  OG1 . THR A 1 24  ? 116.742 137.650 24.585 1.00 48.87 ? 24   THR A OG1 1 
ATOM   153  C  CG2 . THR A 1 24  ? 115.245 139.200 25.647 1.00 52.05 ? 24   THR A CG2 1 
ATOM   154  N  N   . VAL A 1 25  ? 118.371 136.170 26.635 1.00 29.38 ? 25   VAL A N   1 
ATOM   155  C  CA  . VAL A 1 25  ? 119.818 136.035 26.543 1.00 29.82 ? 25   VAL A CA  1 
ATOM   156  C  C   . VAL A 1 25  ? 120.129 135.426 25.180 1.00 33.03 ? 25   VAL A C   1 
ATOM   157  O  O   . VAL A 1 25  ? 119.357 134.613 24.669 1.00 25.60 ? 25   VAL A O   1 
ATOM   158  C  CB  . VAL A 1 25  ? 120.378 135.100 27.659 1.00 31.35 ? 25   VAL A CB  1 
ATOM   159  C  CG1 . VAL A 1 25  ? 121.846 134.787 27.399 1.00 17.83 ? 25   VAL A CG1 1 
ATOM   160  C  CG2 . VAL A 1 25  ? 120.224 135.756 29.020 1.00 25.38 ? 25   VAL A CG2 1 
ATOM   161  N  N   . THR A 1 26  ? 121.248 135.833 24.592 1.00 30.73 ? 26   THR A N   1 
ATOM   162  C  CA  . THR A 1 26  ? 121.667 135.313 23.297 1.00 34.59 ? 26   THR A CA  1 
ATOM   163  C  C   . THR A 1 26  ? 122.817 134.333 23.510 1.00 38.18 ? 26   THR A C   1 
ATOM   164  O  O   . THR A 1 26  ? 123.867 134.697 24.041 1.00 34.65 ? 26   THR A O   1 
ATOM   165  C  CB  . THR A 1 26  ? 122.152 136.437 22.374 1.00 36.24 ? 26   THR A CB  1 
ATOM   166  O  OG1 . THR A 1 26  ? 121.142 137.450 22.289 1.00 42.04 ? 26   THR A OG1 1 
ATOM   167  C  CG2 . THR A 1 26  ? 122.451 135.885 20.989 1.00 34.64 ? 26   THR A CG2 1 
ATOM   168  N  N   . ALA A 1 27  ? 122.619 133.091 23.086 1.00 35.11 ? 27   ALA A N   1 
ATOM   169  C  CA  . ALA A 1 27  ? 123.636 132.072 23.264 1.00 32.43 ? 27   ALA A CA  1 
ATOM   170  C  C   . ALA A 1 27  ? 124.256 131.584 21.963 1.00 31.41 ? 27   ALA A C   1 
ATOM   171  O  O   . ALA A 1 27  ? 123.568 131.383 20.967 1.00 35.53 ? 27   ALA A O   1 
ATOM   172  C  CB  . ALA A 1 27  ? 123.044 130.890 24.031 1.00 29.21 ? 27   ALA A CB  1 
ATOM   173  N  N   . PHE A 1 28  ? 125.570 131.414 21.980 1.00 27.22 ? 28   PHE A N   1 
ATOM   174  C  CA  . PHE A 1 28  ? 126.301 130.902 20.833 1.00 29.15 ? 28   PHE A CA  1 
ATOM   175  C  C   . PHE A 1 28  ? 126.994 129.670 21.375 1.00 28.76 ? 28   PHE A C   1 
ATOM   176  O  O   . PHE A 1 28  ? 128.095 129.750 21.924 1.00 29.62 ? 28   PHE A O   1 
ATOM   177  C  CB  . PHE A 1 28  ? 127.344 131.900 20.331 1.00 28.40 ? 28   PHE A CB  1 
ATOM   178  C  CG  . PHE A 1 28  ? 126.759 133.180 19.819 1.00 34.56 ? 28   PHE A CG  1 
ATOM   179  C  CD1 . PHE A 1 28  ? 126.283 134.147 20.700 1.00 35.71 ? 28   PHE A CD1 1 
ATOM   180  C  CD2 . PHE A 1 28  ? 126.658 133.409 18.451 1.00 33.03 ? 28   PHE A CD2 1 
ATOM   181  C  CE1 . PHE A 1 28  ? 125.714 135.326 20.227 1.00 34.96 ? 28   PHE A CE1 1 
ATOM   182  C  CE2 . PHE A 1 28  ? 126.091 134.584 17.968 1.00 43.05 ? 28   PHE A CE2 1 
ATOM   183  C  CZ  . PHE A 1 28  ? 125.616 135.546 18.860 1.00 37.02 ? 28   PHE A CZ  1 
ATOM   184  N  N   . LEU A 1 29  ? 126.318 128.537 21.248 1.00 21.99 ? 29   LEU A N   1 
ATOM   185  C  CA  . LEU A 1 29  ? 126.839 127.277 21.728 1.00 23.53 ? 29   LEU A CA  1 
ATOM   186  C  C   . LEU A 1 29  ? 127.641 126.539 20.663 1.00 21.94 ? 29   LEU A C   1 
ATOM   187  O  O   . LEU A 1 29  ? 127.196 126.375 19.527 1.00 28.83 ? 29   LEU A O   1 
ATOM   188  C  CB  . LEU A 1 29  ? 125.684 126.398 22.202 1.00 22.11 ? 29   LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 29  ? 124.739 127.032 23.219 1.00 19.56 ? 29   LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 29  ? 123.821 125.954 23.747 1.00 23.69 ? 29   LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 29  ? 125.519 127.660 24.364 1.00 24.24 ? 29   LEU A CD2 1 
ATOM   192  N  N   . GLY A 1 30  ? 128.836 126.106 21.039 1.00 23.48 ? 30   GLY A N   1 
ATOM   193  C  CA  . GLY A 1 30  ? 129.676 125.366 20.120 1.00 16.28 ? 30   GLY A CA  1 
ATOM   194  C  C   . GLY A 1 30  ? 130.421 126.121 19.038 1.00 29.14 ? 30   GLY A C   1 
ATOM   195  O  O   . GLY A 1 30  ? 130.313 125.783 17.862 1.00 37.43 ? 30   GLY A O   1 
ATOM   196  N  N   . ILE A 1 31  ? 131.177 127.147 19.409 1.00 31.42 ? 31   ILE A N   1 
ATOM   197  C  CA  . ILE A 1 31  ? 131.958 127.866 18.414 1.00 28.85 ? 31   ILE A CA  1 
ATOM   198  C  C   . ILE A 1 31  ? 133.338 127.204 18.398 1.00 32.75 ? 31   ILE A C   1 
ATOM   199  O  O   . ILE A 1 31  ? 133.956 127.020 19.444 1.00 36.69 ? 31   ILE A O   1 
ATOM   200  C  CB  . ILE A 1 31  ? 132.144 129.356 18.778 1.00 31.28 ? 31   ILE A CB  1 
ATOM   201  C  CG1 . ILE A 1 31  ? 130.787 130.027 18.988 1.00 27.74 ? 31   ILE A CG1 1 
ATOM   202  C  CG2 . ILE A 1 31  ? 132.915 130.062 17.669 1.00 22.03 ? 31   ILE A CG2 1 
ATOM   203  C  CD1 . ILE A 1 31  ? 130.899 131.471 19.387 1.00 31.94 ? 31   ILE A CD1 1 
ATOM   204  N  N   . PRO A 1 32  ? 133.838 126.827 17.214 1.00 32.87 ? 32   PRO A N   1 
ATOM   205  C  CA  . PRO A 1 32  ? 135.160 126.193 17.170 1.00 31.35 ? 32   PRO A CA  1 
ATOM   206  C  C   . PRO A 1 32  ? 136.244 127.238 17.430 1.00 32.92 ? 32   PRO A C   1 
ATOM   207  O  O   . PRO A 1 32  ? 136.116 128.386 16.994 1.00 27.17 ? 32   PRO A O   1 
ATOM   208  C  CB  . PRO A 1 32  ? 135.221 125.643 15.748 1.00 31.09 ? 32   PRO A CB  1 
ATOM   209  C  CG  . PRO A 1 32  ? 134.476 126.695 14.971 1.00 27.89 ? 32   PRO A CG  1 
ATOM   210  C  CD  . PRO A 1 32  ? 133.273 126.968 15.859 1.00 29.79 ? 32   PRO A CD  1 
ATOM   211  N  N   . TYR A 1 33  ? 137.301 126.856 18.143 1.00 32.19 ? 33   TYR A N   1 
ATOM   212  C  CA  . TYR A 1 33  ? 138.372 127.807 18.413 1.00 35.00 ? 33   TYR A CA  1 
ATOM   213  C  C   . TYR A 1 33  ? 139.755 127.262 18.056 1.00 34.92 ? 33   TYR A C   1 
ATOM   214  O  O   . TYR A 1 33  ? 140.769 127.909 18.296 1.00 34.58 ? 33   TYR A O   1 
ATOM   215  C  CB  . TYR A 1 33  ? 138.336 128.279 19.880 1.00 29.24 ? 33   TYR A CB  1 
ATOM   216  C  CG  . TYR A 1 33  ? 138.728 127.247 20.921 1.00 23.25 ? 33   TYR A CG  1 
ATOM   217  C  CD1 . TYR A 1 33  ? 137.773 126.434 21.532 1.00 24.25 ? 33   TYR A CD1 1 
ATOM   218  C  CD2 . TYR A 1 33  ? 140.057 127.102 21.306 1.00 21.16 ? 33   TYR A CD2 1 
ATOM   219  C  CE1 . TYR A 1 33  ? 138.143 125.500 22.511 1.00 18.15 ? 33   TYR A CE1 1 
ATOM   220  C  CE2 . TYR A 1 33  ? 140.434 126.180 22.273 1.00 24.69 ? 33   TYR A CE2 1 
ATOM   221  C  CZ  . TYR A 1 33  ? 139.478 125.384 22.875 1.00 24.09 ? 33   TYR A CZ  1 
ATOM   222  O  OH  . TYR A 1 33  ? 139.867 124.490 23.853 1.00 21.77 ? 33   TYR A OH  1 
ATOM   223  N  N   . ALA A 1 34  ? 139.789 126.077 17.458 1.00 36.53 ? 34   ALA A N   1 
ATOM   224  C  CA  . ALA A 1 34  ? 141.050 125.466 17.060 1.00 34.72 ? 34   ALA A CA  1 
ATOM   225  C  C   . ALA A 1 34  ? 140.815 124.330 16.072 1.00 33.56 ? 34   ALA A C   1 
ATOM   226  O  O   . ALA A 1 34  ? 139.717 123.789 15.976 1.00 31.83 ? 34   ALA A O   1 
ATOM   227  C  CB  . ALA A 1 34  ? 141.787 124.945 18.286 1.00 29.50 ? 34   ALA A CB  1 
ATOM   228  N  N   . GLN A 1 35  ? 141.850 123.973 15.330 1.00 35.47 ? 35   GLN A N   1 
ATOM   229  C  CA  . GLN A 1 35  ? 141.727 122.889 14.377 1.00 39.46 ? 35   GLN A CA  1 
ATOM   230  C  C   . GLN A 1 35  ? 141.497 121.611 15.189 1.00 37.68 ? 35   GLN A C   1 
ATOM   231  O  O   . GLN A 1 35  ? 142.126 121.408 16.229 1.00 36.80 ? 35   GLN A O   1 
ATOM   232  C  CB  . GLN A 1 35  ? 143.010 122.770 13.545 1.00 44.64 ? 35   GLN A CB  1 
ATOM   233  C  CG  . GLN A 1 35  ? 142.738 122.441 12.091 1.00 53.93 ? 35   GLN A CG  1 
ATOM   234  C  CD  . GLN A 1 35  ? 143.808 121.576 11.460 0.00 51.62 ? 35   GLN A CD  1 
ATOM   235  O  OE1 . GLN A 1 35  ? 143.513 120.755 10.591 0.00 52.44 ? 35   GLN A OE1 1 
ATOM   236  N  NE2 . GLN A 1 35  ? 145.053 121.754 11.884 0.50 54.98 ? 35   GLN A NE2 1 
ATOM   237  N  N   . PRO A 1 36  ? 140.563 120.752 14.750 1.00 34.42 ? 36   PRO A N   1 
ATOM   238  C  CA  . PRO A 1 36  ? 140.321 119.517 15.501 1.00 32.76 ? 36   PRO A CA  1 
ATOM   239  C  C   . PRO A 1 36  ? 141.643 118.767 15.672 1.00 33.57 ? 36   PRO A C   1 
ATOM   240  O  O   . PRO A 1 36  ? 142.333 118.492 14.695 1.00 32.88 ? 36   PRO A O   1 
ATOM   241  C  CB  . PRO A 1 36  ? 139.323 118.776 14.617 1.00 30.19 ? 36   PRO A CB  1 
ATOM   242  C  CG  . PRO A 1 36  ? 138.516 119.889 14.047 1.00 25.48 ? 36   PRO A CG  1 
ATOM   243  C  CD  . PRO A 1 36  ? 139.580 120.904 13.663 1.00 30.62 ? 36   PRO A CD  1 
ATOM   244  N  N   . PRO A 1 37  ? 142.019 118.445 16.922 1.00 34.23 ? 37   PRO A N   1 
ATOM   245  C  CA  . PRO A 1 37  ? 143.269 117.732 17.213 1.00 32.30 ? 37   PRO A CA  1 
ATOM   246  C  C   . PRO A 1 37  ? 143.180 116.257 16.832 1.00 34.34 ? 37   PRO A C   1 
ATOM   247  O  O   . PRO A 1 37  ? 143.295 115.386 17.686 1.00 33.43 ? 37   PRO A O   1 
ATOM   248  C  CB  . PRO A 1 37  ? 143.417 117.928 18.715 1.00 28.76 ? 37   PRO A CB  1 
ATOM   249  C  CG  . PRO A 1 37  ? 141.982 117.806 19.177 1.00 29.20 ? 37   PRO A CG  1 
ATOM   250  C  CD  . PRO A 1 37  ? 141.236 118.656 18.157 1.00 28.32 ? 37   PRO A CD  1 
ATOM   251  N  N   . LEU A 1 38  ? 142.983 115.983 15.547 1.00 40.34 ? 38   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 38  ? 142.849 114.610 15.066 1.00 39.82 ? 38   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 38  ? 144.047 114.129 14.249 1.00 40.43 ? 38   LEU A C   1 
ATOM   254  O  O   . LEU A 1 38  ? 144.840 114.924 13.746 1.00 44.51 ? 38   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 38  ? 141.588 114.497 14.214 1.00 37.86 ? 38   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 38  ? 140.296 115.043 14.818 1.00 37.29 ? 38   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 38  ? 139.318 115.372 13.705 1.00 42.06 ? 38   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 38  ? 139.706 114.033 15.783 1.00 39.54 ? 38   LEU A CD2 1 
ATOM   259  N  N   . GLY A 1 39  ? 144.160 112.812 14.120 1.00 43.38 ? 39   GLY A N   1 
ATOM   260  C  CA  . GLY A 1 39  ? 145.239 112.218 13.352 1.00 38.40 ? 39   GLY A CA  1 
ATOM   261  C  C   . GLY A 1 39  ? 146.620 112.566 13.852 1.00 40.05 ? 39   GLY A C   1 
ATOM   262  O  O   . GLY A 1 39  ? 146.953 112.337 15.014 1.00 42.44 ? 39   GLY A O   1 
ATOM   263  N  N   . ARG A 1 40  ? 147.434 113.113 12.960 1.00 41.20 ? 40   ARG A N   1 
ATOM   264  C  CA  . ARG A 1 40  ? 148.792 113.505 13.299 1.00 42.52 ? 40   ARG A CA  1 
ATOM   265  C  C   . ARG A 1 40  ? 148.781 114.599 14.368 1.00 42.93 ? 40   ARG A C   1 
ATOM   266  O  O   . ARG A 1 40  ? 149.794 114.844 15.021 1.00 43.72 ? 40   ARG A O   1 
ATOM   267  C  CB  . ARG A 1 40  ? 149.500 114.010 12.044 1.00 51.02 ? 40   ARG A CB  1 
ATOM   268  C  CG  . ARG A 1 40  ? 148.662 115.032 11.305 1.00 61.88 ? 40   ARG A CG  1 
ATOM   269  C  CD  . ARG A 1 40  ? 149.419 115.788 10.233 1.00 66.32 ? 40   ARG A CD  1 
ATOM   270  N  NE  . ARG A 1 40  ? 148.917 117.158 10.167 1.00 69.17 ? 40   ARG A NE  1 
ATOM   271  C  CZ  . ARG A 1 40  ? 149.094 117.985 9.145  0.00 67.60 ? 40   ARG A CZ  1 
ATOM   272  N  NH1 . ARG A 1 40  ? 149.768 117.591 8.075  0.00 67.60 ? 40   ARG A NH1 1 
ATOM   273  N  NH2 . ARG A 1 40  ? 148.589 119.210 9.195  0.00 67.60 ? 40   ARG A NH2 1 
ATOM   274  N  N   . LEU A 1 41  ? 147.635 115.256 14.545 1.00 38.04 ? 41   LEU A N   1 
ATOM   275  C  CA  . LEU A 1 41  ? 147.514 116.317 15.539 1.00 34.00 ? 41   LEU A CA  1 
ATOM   276  C  C   . LEU A 1 41  ? 147.250 115.821 16.959 1.00 34.77 ? 41   LEU A C   1 
ATOM   277  O  O   . LEU A 1 41  ? 147.397 116.579 17.919 1.00 34.55 ? 41   LEU A O   1 
ATOM   278  C  CB  . LEU A 1 41  ? 146.421 117.308 15.133 1.00 30.45 ? 41   LEU A CB  1 
ATOM   279  C  CG  . LEU A 1 41  ? 146.751 118.126 13.884 1.00 33.46 ? 41   LEU A CG  1 
ATOM   280  C  CD1 . LEU A 1 41  ? 145.681 119.182 13.653 1.00 25.83 ? 41   LEU A CD1 1 
ATOM   281  C  CD2 . LEU A 1 41  ? 148.123 118.779 14.063 1.00 33.15 ? 41   LEU A CD2 1 
ATOM   282  N  N   . ARG A 1 42  ? 146.859 114.559 17.103 1.00 29.42 ? 42   ARG A N   1 
ATOM   283  C  CA  . ARG A 1 42  ? 146.615 114.019 18.435 1.00 31.70 ? 42   ARG A CA  1 
ATOM   284  C  C   . ARG A 1 42  ? 147.883 114.149 19.281 1.00 31.38 ? 42   ARG A C   1 
ATOM   285  O  O   . ARG A 1 42  ? 148.979 113.828 18.819 1.00 31.43 ? 42   ARG A O   1 
ATOM   286  C  CB  . ARG A 1 42  ? 146.203 112.545 18.363 1.00 28.41 ? 42   ARG A CB  1 
ATOM   287  C  CG  . ARG A 1 42  ? 146.101 111.883 19.725 1.00 32.11 ? 42   ARG A CG  1 
ATOM   288  C  CD  . ARG A 1 42  ? 145.901 110.382 19.619 1.00 30.34 ? 42   ARG A CD  1 
ATOM   289  N  NE  . ARG A 1 42  ? 144.585 110.032 19.097 1.00 32.74 ? 42   ARG A NE  1 
ATOM   290  C  CZ  . ARG A 1 42  ? 144.210 108.791 18.795 1.00 33.44 ? 42   ARG A CZ  1 
ATOM   291  N  NH1 . ARG A 1 42  ? 142.992 108.554 18.323 1.00 29.38 ? 42   ARG A NH1 1 
ATOM   292  N  NH2 . ARG A 1 42  ? 145.058 107.784 18.956 1.00 30.14 ? 42   ARG A NH2 1 
ATOM   293  N  N   . PHE A 1 43  ? 147.717 114.620 20.516 1.00 28.98 ? 43   PHE A N   1 
ATOM   294  C  CA  . PHE A 1 43  ? 148.811 114.815 21.471 1.00 27.78 ? 43   PHE A CA  1 
ATOM   295  C  C   . PHE A 1 43  ? 149.617 116.091 21.250 1.00 28.62 ? 43   PHE A C   1 
ATOM   296  O  O   . PHE A 1 43  ? 150.465 116.434 22.068 1.00 32.23 ? 43   PHE A O   1 
ATOM   297  C  CB  . PHE A 1 43  ? 149.770 113.619 21.475 1.00 30.26 ? 43   PHE A CB  1 
ATOM   298  C  CG  . PHE A 1 43  ? 149.134 112.333 21.901 1.00 35.38 ? 43   PHE A CG  1 
ATOM   299  C  CD1 . PHE A 1 43  ? 148.450 112.247 23.110 1.00 31.63 ? 43   PHE A CD1 1 
ATOM   300  C  CD2 . PHE A 1 43  ? 149.225 111.199 21.097 1.00 37.92 ? 43   PHE A CD2 1 
ATOM   301  C  CE1 . PHE A 1 43  ? 147.868 111.053 23.513 1.00 30.66 ? 43   PHE A CE1 1 
ATOM   302  C  CE2 . PHE A 1 43  ? 148.646 109.999 21.490 1.00 33.71 ? 43   PHE A CE2 1 
ATOM   303  C  CZ  . PHE A 1 43  ? 147.967 109.924 22.698 1.00 36.38 ? 43   PHE A CZ  1 
ATOM   304  N  N   . LYS A 1 44  ? 149.365 116.794 20.152 1.00 25.41 ? 44   LYS A N   1 
ATOM   305  C  CA  . LYS A 1 44  ? 150.092 118.029 19.890 1.00 27.98 ? 44   LYS A CA  1 
ATOM   306  C  C   . LYS A 1 44  ? 149.310 119.250 20.361 1.00 31.49 ? 44   LYS A C   1 
ATOM   307  O  O   . LYS A 1 44  ? 148.100 119.180 20.580 1.00 28.73 ? 44   LYS A O   1 
ATOM   308  C  CB  . LYS A 1 44  ? 150.407 118.170 18.397 1.00 27.31 ? 44   LYS A CB  1 
ATOM   309  C  CG  . LYS A 1 44  ? 151.467 117.188 17.886 1.00 42.22 ? 44   LYS A CG  1 
ATOM   310  C  CD  . LYS A 1 44  ? 151.913 117.513 16.458 1.00 34.24 ? 44   LYS A CD  1 
ATOM   311  C  CE  . LYS A 1 44  ? 152.559 118.886 16.372 0.00 38.85 ? 44   LYS A CE  1 
ATOM   312  N  NZ  . LYS A 1 44  ? 153.797 118.973 17.193 0.00 38.74 ? 44   LYS A NZ  1 
ATOM   313  N  N   . LYS A 1 45  ? 150.010 120.369 20.523 1.00 29.58 ? 45   LYS A N   1 
ATOM   314  C  CA  . LYS A 1 45  ? 149.375 121.603 20.957 1.00 28.79 ? 45   LYS A CA  1 
ATOM   315  C  C   . LYS A 1 45  ? 148.339 122.013 19.915 1.00 29.09 ? 45   LYS A C   1 
ATOM   316  O  O   . LYS A 1 45  ? 148.512 121.764 18.729 1.00 36.75 ? 45   LYS A O   1 
ATOM   317  C  CB  . LYS A 1 45  ? 150.424 122.712 21.135 1.00 26.51 ? 45   LYS A CB  1 
ATOM   318  C  CG  . LYS A 1 45  ? 151.525 122.363 22.131 1.00 30.98 ? 45   LYS A CG  1 
ATOM   319  C  CD  . LYS A 1 45  ? 152.077 123.584 22.847 1.00 37.21 ? 45   LYS A CD  1 
ATOM   320  C  CE  . LYS A 1 45  ? 152.661 124.606 21.885 1.00 47.87 ? 45   LYS A CE  1 
ATOM   321  N  NZ  . LYS A 1 45  ? 153.308 125.736 22.617 1.00 47.05 ? 45   LYS A NZ  1 
ATOM   322  N  N   . PRO A 1 46  ? 147.252 122.656 20.348 1.00 27.81 ? 46   PRO A N   1 
ATOM   323  C  CA  . PRO A 1 46  ? 146.195 123.090 19.432 1.00 32.58 ? 46   PRO A CA  1 
ATOM   324  C  C   . PRO A 1 46  ? 146.686 124.030 18.332 1.00 37.01 ? 46   PRO A C   1 
ATOM   325  O  O   . PRO A 1 46  ? 147.414 124.987 18.598 1.00 36.86 ? 46   PRO A O   1 
ATOM   326  C  CB  . PRO A 1 46  ? 145.186 123.754 20.369 1.00 33.11 ? 46   PRO A CB  1 
ATOM   327  C  CG  . PRO A 1 46  ? 146.059 124.308 21.454 1.00 24.74 ? 46   PRO A CG  1 
ATOM   328  C  CD  . PRO A 1 46  ? 147.020 123.178 21.706 1.00 27.52 ? 46   PRO A CD  1 
ATOM   329  N  N   . GLN A 1 47  ? 146.284 123.739 17.096 1.00 36.55 ? 47   GLN A N   1 
ATOM   330  C  CA  . GLN A 1 47  ? 146.661 124.546 15.941 1.00 37.41 ? 47   GLN A CA  1 
ATOM   331  C  C   . GLN A 1 47  ? 145.598 125.591 15.652 1.00 36.35 ? 47   GLN A C   1 
ATOM   332  O  O   . GLN A 1 47  ? 144.410 125.362 15.890 1.00 39.32 ? 47   GLN A O   1 
ATOM   333  C  CB  . GLN A 1 47  ? 146.849 123.664 14.706 1.00 31.64 ? 47   GLN A CB  1 
ATOM   334  C  CG  . GLN A 1 47  ? 147.982 122.645 14.821 1.00 43.81 ? 47   GLN A CG  1 
ATOM   335  C  CD  . GLN A 1 47  ? 149.344 123.296 15.037 1.00 49.17 ? 47   GLN A CD  1 
ATOM   336  O  OE1 . GLN A 1 47  ? 149.767 124.142 14.251 0.00 50.71 ? 47   GLN A OE1 1 
ATOM   337  N  NE2 . GLN A 1 47  ? 150.037 122.899 16.106 1.00 55.52 ? 47   GLN A NE2 1 
ATOM   338  N  N   . SER A 1 48  ? 146.021 126.737 15.134 1.00 44.18 ? 48   SER A N   1 
ATOM   339  C  CA  . SER A 1 48  ? 145.091 127.818 14.825 1.00 49.00 ? 48   SER A CA  1 
ATOM   340  C  C   . SER A 1 48  ? 144.014 127.366 13.852 1.00 50.39 ? 48   SER A C   1 
ATOM   341  O  O   . SER A 1 48  ? 144.280 126.608 12.902 1.00 51.55 ? 48   SER A O   1 
ATOM   342  C  CB  . SER A 1 48  ? 145.839 129.009 14.234 1.00 52.76 ? 48   SER A CB  1 
ATOM   343  O  OG  . SER A 1 48  ? 146.506 129.755 15.242 0.00 52.03 ? 48   SER A OG  1 
ATOM   344  N  N   . LEU A 1 49  ? 142.791 127.838 14.081 1.00 56.15 ? 49   LEU A N   1 
ATOM   345  C  CA  . LEU A 1 49  ? 141.682 127.463 13.211 1.00 60.43 ? 49   LEU A CA  1 
ATOM   346  C  C   . LEU A 1 49  ? 141.658 128.151 11.855 1.00 64.52 ? 49   LEU A C   1 
ATOM   347  O  O   . LEU A 1 49  ? 142.034 129.327 11.680 1.00 63.61 ? 49   LEU A O   1 
ATOM   348  C  CB  . LEU A 1 49  ? 140.331 127.655 13.904 1.00 58.16 ? 49   LEU A CB  1 
ATOM   349  C  CG  . LEU A 1 49  ? 139.137 127.147 13.120 1.00 59.51 ? 49   LEU A CG  1 
ATOM   350  C  CD1 . LEU A 1 49  ? 139.434 125.714 12.687 1.00 60.40 ? 49   LEU A CD1 1 
ATOM   351  C  CD2 . LEU A 1 49  ? 137.870 127.267 13.958 0.00 59.90 ? 49   LEU A CD2 1 
ATOM   352  N  N   . THR A 1 50  ? 141.195 127.358 10.899 1.00 67.77 ? 50   THR A N   1 
ATOM   353  C  CA  . THR A 1 50  ? 141.085 127.704 9.492  1.00 68.77 ? 50   THR A CA  1 
ATOM   354  C  C   . THR A 1 50  ? 139.813 128.537 9.281  1.00 65.29 ? 50   THR A C   1 
ATOM   355  O  O   . THR A 1 50  ? 138.709 128.108 9.612  1.00 63.47 ? 50   THR A O   1 
ATOM   356  C  CB  . THR A 1 50  ? 141.083 126.352 8.686  1.00 75.41 ? 50   THR A CB  1 
ATOM   357  O  OG1 . THR A 1 50  ? 141.221 126.560 7.277  1.00 83.29 ? 50   THR A OG1 1 
ATOM   358  C  CG2 . THR A 1 50  ? 139.826 125.602 8.929  1.00 74.35 ? 50   THR A CG2 1 
ATOM   359  N  N   . LYS A 1 51  ? 139.950 129.743 8.748  1.00 63.75 ? 51   LYS A N   1 
ATOM   360  C  CA  . LYS A 1 51  ? 138.762 130.577 8.554  1.00 64.84 ? 51   LYS A CA  1 
ATOM   361  C  C   . LYS A 1 51  ? 137.776 129.977 7.558  1.00 66.61 ? 51   LYS A C   1 
ATOM   362  O  O   . LYS A 1 51  ? 138.169 129.314 6.591  1.00 68.71 ? 51   LYS A O   1 
ATOM   363  C  CB  . LYS A 1 51  ? 139.152 131.992 8.122  0.00 62.57 ? 51   LYS A CB  1 
ATOM   364  C  CG  . LYS A 1 51  ? 139.824 132.127 6.772  0.00 59.81 ? 51   LYS A CG  1 
ATOM   365  C  CD  . LYS A 1 51  ? 140.138 133.585 6.476  0.00 57.10 ? 51   LYS A CD  1 
ATOM   366  C  CE  . LYS A 1 51  ? 140.868 133.731 5.151  0.00 55.26 ? 51   LYS A CE  1 
ATOM   367  N  NZ  . LYS A 1 51  ? 141.196 135.158 4.857  0.00 53.66 ? 51   LYS A NZ  1 
ATOM   368  N  N   . TRP A 1 52  ? 136.489 130.219 7.797  1.00 66.89 ? 52   TRP A N   1 
ATOM   369  C  CA  . TRP A 1 52  ? 135.423 129.679 6.955  1.00 65.03 ? 52   TRP A CA  1 
ATOM   370  C  C   . TRP A 1 52  ? 134.522 130.698 6.252  1.00 65.05 ? 52   TRP A C   1 
ATOM   371  O  O   . TRP A 1 52  ? 134.541 131.891 6.554  1.00 63.92 ? 52   TRP A O   1 
ATOM   372  C  CB  . TRP A 1 52  ? 134.541 128.761 7.791  1.00 60.82 ? 52   TRP A CB  1 
ATOM   373  C  CG  . TRP A 1 52  ? 133.713 129.476 8.813  1.00 60.29 ? 52   TRP A CG  1 
ATOM   374  C  CD1 . TRP A 1 52  ? 132.550 130.152 8.610  1.00 63.24 ? 52   TRP A CD1 1 
ATOM   375  C  CD2 . TRP A 1 52  ? 134.003 129.586 10.218 1.00 59.13 ? 52   TRP A CD2 1 
ATOM   376  N  NE1 . TRP A 1 52  ? 132.090 130.681 9.812  1.00 59.89 ? 52   TRP A NE1 1 
ATOM   377  C  CE2 . TRP A 1 52  ? 132.967 130.344 10.814 1.00 59.41 ? 52   TRP A CE2 1 
ATOM   378  C  CE3 . TRP A 1 52  ? 135.049 129.114 11.028 1.00 58.90 ? 52   TRP A CE3 1 
ATOM   379  C  CZ2 . TRP A 1 52  ? 132.935 130.637 12.172 1.00 57.26 ? 52   TRP A CZ2 1 
ATOM   380  C  CZ3 . TRP A 1 52  ? 135.023 129.407 12.397 1.00 54.20 ? 52   TRP A CZ3 1 
ATOM   381  C  CH2 . TRP A 1 52  ? 133.963 130.165 12.948 1.00 53.54 ? 52   TRP A CH2 1 
ATOM   382  N  N   . SER A 1 53  ? 133.709 130.195 5.325  1.00 68.63 ? 53   SER A N   1 
ATOM   383  C  CA  . SER A 1 53  ? 132.770 131.001 4.551  1.00 65.76 ? 53   SER A CA  1 
ATOM   384  C  C   . SER A 1 53  ? 131.392 130.434 4.879  0.50 64.60 ? 53   SER A C   1 
ATOM   385  O  O   . SER A 1 53  ? 131.275 129.248 5.196  0.50 61.25 ? 53   SER A O   1 
ATOM   386  C  CB  . SER A 1 53  ? 133.047 130.828 3.061  1.00 62.48 ? 53   SER A CB  1 
ATOM   387  O  OG  . SER A 1 53  ? 134.443 130.842 2.801  0.50 63.07 ? 53   SER A OG  1 
ATOM   388  N  N   . ASP A 1 54  ? 130.366 131.279 4.780  1.00 66.20 ? 54   ASP A N   1 
ATOM   389  C  CA  . ASP A 1 54  ? 128.988 130.913 5.091  1.00 65.61 ? 54   ASP A CA  1 
ATOM   390  C  C   . ASP A 1 54  ? 128.842 131.145 6.594  1.00 63.59 ? 54   ASP A C   1 
ATOM   391  O  O   . ASP A 1 54  ? 129.805 131.517 7.265  1.00 60.73 ? 54   ASP A O   1 
ATOM   392  C  CB  . ASP A 1 54  ? 128.704 129.445 4.755  0.00 63.94 ? 54   ASP A CB  1 
ATOM   393  C  CG  . ASP A 1 54  ? 128.882 129.137 3.275  0.00 62.97 ? 54   ASP A CG  1 
ATOM   394  O  OD1 . ASP A 1 54  ? 128.687 127.964 2.876  0.00 62.17 ? 54   ASP A OD1 1 
ATOM   395  O  OD2 . ASP A 1 54  ? 129.216 130.064 2.502  0.00 62.17 ? 54   ASP A OD2 1 
ATOM   396  N  N   . ILE A 1 55  ? 127.657 130.904 7.135  1.00 60.75 ? 55   ILE A N   1 
ATOM   397  C  CA  . ILE A 1 55  ? 127.440 131.114 8.559  1.00 58.35 ? 55   ILE A CA  1 
ATOM   398  C  C   . ILE A 1 55  ? 127.498 129.842 9.382  1.00 58.07 ? 55   ILE A C   1 
ATOM   399  O  O   . ILE A 1 55  ? 126.792 128.865 9.093  1.00 60.89 ? 55   ILE A O   1 
ATOM   400  C  CB  . ILE A 1 55  ? 126.076 131.770 8.799  1.00 57.20 ? 55   ILE A CB  1 
ATOM   401  C  CG1 . ILE A 1 55  ? 125.981 133.070 7.992  1.00 52.05 ? 55   ILE A CG1 1 
ATOM   402  C  CG2 . ILE A 1 55  ? 125.861 132.025 10.284 1.00 53.68 ? 55   ILE A CG2 1 
ATOM   403  C  CD1 . ILE A 1 55  ? 124.616 133.754 8.085  1.00 51.73 ? 55   ILE A CD1 1 
ATOM   404  N  N   . TRP A 1 56  ? 128.327 129.877 10.423 1.00 55.21 ? 56   TRP A N   1 
ATOM   405  C  CA  . TRP A 1 56  ? 128.453 128.732 11.306 1.00 48.87 ? 56   TRP A CA  1 
ATOM   406  C  C   . TRP A 1 56  ? 127.333 128.745 12.326 1.00 47.13 ? 56   TRP A C   1 
ATOM   407  O  O   . TRP A 1 56  ? 127.176 129.711 13.091 1.00 40.05 ? 56   TRP A O   1 
ATOM   408  C  CB  . TRP A 1 56  ? 129.790 128.725 12.044 1.00 45.95 ? 56   TRP A CB  1 
ATOM   409  C  CG  . TRP A 1 56  ? 129.922 127.548 12.982 1.00 45.55 ? 56   TRP A CG  1 
ATOM   410  C  CD1 . TRP A 1 56  ? 129.229 127.329 14.139 1.00 42.54 ? 56   TRP A CD1 1 
ATOM   411  C  CD2 . TRP A 1 56  ? 130.768 126.409 12.802 1.00 46.46 ? 56   TRP A CD2 1 
ATOM   412  N  NE1 . TRP A 1 56  ? 129.591 126.116 14.689 1.00 42.42 ? 56   TRP A NE1 1 
ATOM   413  C  CE2 . TRP A 1 56  ? 130.535 125.533 13.888 1.00 45.97 ? 56   TRP A CE2 1 
ATOM   414  C  CE3 . TRP A 1 56  ? 131.703 126.043 11.826 1.00 51.48 ? 56   TRP A CE3 1 
ATOM   415  C  CZ2 . TRP A 1 56  ? 131.202 124.319 14.023 1.00 47.05 ? 56   TRP A CZ2 1 
ATOM   416  C  CZ3 . TRP A 1 56  ? 132.368 124.834 11.961 1.00 54.27 ? 56   TRP A CZ3 1 
ATOM   417  C  CH2 . TRP A 1 56  ? 132.113 123.986 13.055 1.00 52.60 ? 56   TRP A CH2 1 
ATOM   418  N  N   . ASN A 1 57  ? 126.562 127.664 12.333 1.00 50.70 ? 57   ASN A N   1 
ATOM   419  C  CA  . ASN A 1 57  ? 125.453 127.547 13.253 1.00 55.40 ? 57   ASN A CA  1 
ATOM   420  C  C   . ASN A 1 57  ? 125.910 127.114 14.618 1.00 55.47 ? 57   ASN A C   1 
ATOM   421  O  O   . ASN A 1 57  ? 126.293 125.967 14.841 1.00 61.46 ? 57   ASN A O   1 
ATOM   422  C  CB  . ASN A 1 57  ? 124.424 126.573 12.720 1.00 60.32 ? 57   ASN A CB  1 
ATOM   423  C  CG  . ASN A 1 57  ? 123.721 127.111 11.529 1.00 66.59 ? 57   ASN A CG  1 
ATOM   424  O  OD1 . ASN A 1 57  ? 124.051 128.192 11.034 1.00 68.56 ? 57   ASN A OD1 1 
ATOM   425  N  ND2 . ASN A 1 57  ? 122.754 126.389 11.018 1.00 71.06 ? 57   ASN A ND2 1 
ATOM   426  N  N   . ALA A 1 58  ? 125.885 128.071 15.529 1.00 52.63 ? 58   ALA A N   1 
ATOM   427  C  CA  . ALA A 1 58  ? 126.296 127.839 16.899 1.00 42.91 ? 58   ALA A CA  1 
ATOM   428  C  C   . ALA A 1 58  ? 125.055 127.778 17.757 1.00 41.15 ? 58   ALA A C   1 
ATOM   429  O  O   . ALA A 1 58  ? 124.853 128.598 18.655 1.00 39.31 ? 58   ALA A O   1 
ATOM   430  C  CB  . ALA A 1 58  ? 127.203 128.962 17.356 1.00 40.68 ? 58   ALA A CB  1 
ATOM   431  N  N   . THR A 1 59  ? 124.231 126.776 17.484 1.00 41.63 ? 59   THR A N   1 
ATOM   432  C  CA  . THR A 1 59  ? 122.962 126.628 18.184 1.00 43.45 ? 59   THR A CA  1 
ATOM   433  C  C   . THR A 1 59  ? 122.802 125.385 19.056 1.00 42.38 ? 59   THR A C   1 
ATOM   434  O  O   . THR A 1 59  ? 121.695 125.066 19.494 1.00 41.48 ? 59   THR A O   1 
ATOM   435  C  CB  . THR A 1 59  ? 121.818 126.665 17.172 1.00 46.36 ? 59   THR A CB  1 
ATOM   436  O  OG1 . THR A 1 59  ? 122.065 125.688 16.154 1.00 57.56 ? 59   THR A OG1 1 
ATOM   437  C  CG2 . THR A 1 59  ? 121.729 128.048 16.526 1.00 41.30 ? 59   THR A CG2 1 
ATOM   438  N  N   . LYS A 1 60  ? 123.899 124.682 19.307 1.00 39.97 ? 60   LYS A N   1 
ATOM   439  C  CA  . LYS A 1 60  ? 123.852 123.494 20.155 1.00 35.99 ? 60   LYS A CA  1 
ATOM   440  C  C   . LYS A 1 60  ? 125.245 123.225 20.705 1.00 30.00 ? 60   LYS A C   1 
ATOM   441  O  O   . LYS A 1 60  ? 126.248 123.557 20.074 1.00 25.54 ? 60   LYS A O   1 
ATOM   442  C  CB  . LYS A 1 60  ? 123.369 122.272 19.357 1.00 39.58 ? 60   LYS A CB  1 
ATOM   443  C  CG  . LYS A 1 60  ? 124.427 121.686 18.425 1.00 45.27 ? 60   LYS A CG  1 
ATOM   444  C  CD  . LYS A 1 60  ? 123.873 120.617 17.501 0.00 51.16 ? 60   LYS A CD  1 
ATOM   445  C  CE  . LYS A 1 60  ? 124.873 120.274 16.402 0.00 55.34 ? 60   LYS A CE  1 
ATOM   446  N  NZ  . LYS A 1 60  ? 126.164 119.768 16.941 1.00 67.70 ? 60   LYS A NZ  1 
ATOM   447  N  N   . TYR A 1 61  ? 125.306 122.625 21.885 1.00 25.97 ? 61   TYR A N   1 
ATOM   448  C  CA  . TYR A 1 61  ? 126.595 122.301 22.480 1.00 27.73 ? 61   TYR A CA  1 
ATOM   449  C  C   . TYR A 1 61  ? 127.338 121.365 21.536 1.00 26.01 ? 61   TYR A C   1 
ATOM   450  O  O   . TYR A 1 61  ? 126.723 120.555 20.847 1.00 29.62 ? 61   TYR A O   1 
ATOM   451  C  CB  . TYR A 1 61  ? 126.403 121.615 23.829 1.00 24.94 ? 61   TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 61  ? 125.883 122.515 24.923 1.00 28.70 ? 61   TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 61  ? 126.669 123.545 25.440 1.00 25.19 ? 61   TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 61  ? 124.634 122.296 25.489 1.00 25.49 ? 61   TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 61  ? 126.225 124.325 26.503 1.00 27.30 ? 61   TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 61  ? 124.179 123.068 26.548 1.00 27.89 ? 61   TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 61  ? 124.980 124.077 27.055 1.00 32.93 ? 61   TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 61  ? 124.547 124.809 28.139 1.00 35.05 ? 61   TYR A OH  1 
ATOM   459  N  N   . ALA A 1 62  ? 128.656 121.486 21.496 1.00 22.89 ? 62   ALA A N   1 
ATOM   460  C  CA  . ALA A 1 62  ? 129.464 120.637 20.632 1.00 26.69 ? 62   ALA A CA  1 
ATOM   461  C  C   . ALA A 1 62  ? 129.839 119.348 21.355 1.00 27.16 ? 62   ALA A C   1 
ATOM   462  O  O   . ALA A 1 62  ? 129.375 119.089 22.458 1.00 25.79 ? 62   ALA A O   1 
ATOM   463  C  CB  . ALA A 1 62  ? 130.730 121.380 20.195 1.00 19.39 ? 62   ALA A CB  1 
ATOM   464  N  N   . ASN A 1 63  ? 130.675 118.539 20.717 1.00 28.42 ? 63   ASN A N   1 
ATOM   465  C  CA  . ASN A 1 63  ? 131.120 117.292 21.315 1.00 31.07 ? 63   ASN A CA  1 
ATOM   466  C  C   . ASN A 1 63  ? 131.964 117.550 22.552 1.00 28.84 ? 63   ASN A C   1 
ATOM   467  O  O   . ASN A 1 63  ? 132.641 118.569 22.655 1.00 30.58 ? 63   ASN A O   1 
ATOM   468  C  CB  . ASN A 1 63  ? 131.975 116.483 20.334 1.00 32.69 ? 63   ASN A CB  1 
ATOM   469  C  CG  . ASN A 1 63  ? 131.211 116.043 19.117 1.00 30.98 ? 63   ASN A CG  1 
ATOM   470  O  OD1 . ASN A 1 63  ? 130.053 115.643 19.211 1.00 33.25 ? 63   ASN A OD1 1 
ATOM   471  N  ND2 . ASN A 1 63  ? 131.861 116.098 17.961 1.00 35.28 ? 63   ASN A ND2 1 
ATOM   472  N  N   . SER A 1 64  ? 131.920 116.611 23.486 1.00 25.64 ? 64   SER A N   1 
ATOM   473  C  CA  . SER A 1 64  ? 132.716 116.697 24.694 1.00 25.98 ? 64   SER A CA  1 
ATOM   474  C  C   . SER A 1 64  ? 133.945 115.860 24.361 1.00 29.97 ? 64   SER A C   1 
ATOM   475  O  O   . SER A 1 64  ? 133.854 114.923 23.564 1.00 32.05 ? 64   SER A O   1 
ATOM   476  C  CB  . SER A 1 64  ? 131.971 116.075 25.872 1.00 25.70 ? 64   SER A CB  1 
ATOM   477  O  OG  . SER A 1 64  ? 130.745 116.737 26.112 1.00 27.54 ? 64   SER A OG  1 
ATOM   478  N  N   . CYS A 1 65  ? 135.084 116.195 24.955 1.00 18.75 ? 65   CYS A N   1 
ATOM   479  C  CA  . CYS A 1 65  ? 136.317 115.462 24.706 1.00 24.17 ? 65   CYS A CA  1 
ATOM   480  C  C   . CYS A 1 65  ? 136.263 114.043 25.267 1.00 25.95 ? 65   CYS A C   1 
ATOM   481  O  O   . CYS A 1 65  ? 135.588 113.785 26.267 1.00 25.99 ? 65   CYS A O   1 
ATOM   482  C  CB  . CYS A 1 65  ? 137.496 116.215 25.323 1.00 29.49 ? 65   CYS A CB  1 
ATOM   483  S  SG  . CYS A 1 65  ? 137.656 117.919 24.701 1.00 46.54 ? 65   CYS A SG  1 
ATOM   484  N  N   . CYS A 1 66  ? 136.981 113.126 24.620 1.00 24.05 ? 66   CYS A N   1 
ATOM   485  C  CA  . CYS A 1 66  ? 137.017 111.730 25.050 1.00 32.56 ? 66   CYS A CA  1 
ATOM   486  C  C   . CYS A 1 66  ? 137.417 111.630 26.512 1.00 31.59 ? 66   CYS A C   1 
ATOM   487  O  O   . CYS A 1 66  ? 138.366 112.277 26.951 1.00 35.52 ? 66   CYS A O   1 
ATOM   488  C  CB  . CYS A 1 66  ? 138.004 110.938 24.197 1.00 32.09 ? 66   CYS A CB  1 
ATOM   489  S  SG  . CYS A 1 66  ? 137.644 111.033 22.443 1.00 49.61 ? 66   CYS A SG  1 
ATOM   490  N  N   . GLN A 1 67  ? 136.701 110.804 27.261 1.00 27.37 ? 67   GLN A N   1 
ATOM   491  C  CA  . GLN A 1 67  ? 136.974 110.652 28.682 1.00 27.92 ? 67   GLN A CA  1 
ATOM   492  C  C   . GLN A 1 67  ? 136.233 109.443 29.245 1.00 26.92 ? 67   GLN A C   1 
ATOM   493  O  O   . GLN A 1 67  ? 135.174 109.076 28.748 1.00 25.19 ? 67   GLN A O   1 
ATOM   494  C  CB  . GLN A 1 67  ? 136.503 111.913 29.417 1.00 24.54 ? 67   GLN A CB  1 
ATOM   495  C  CG  . GLN A 1 67  ? 135.065 112.292 29.058 1.00 20.82 ? 67   GLN A CG  1 
ATOM   496  C  CD  . GLN A 1 67  ? 134.584 113.599 29.691 1.00 28.78 ? 67   GLN A CD  1 
ATOM   497  O  OE1 . GLN A 1 67  ? 134.319 113.673 30.890 1.00 23.25 ? 67   GLN A OE1 1 
ATOM   498  N  NE2 . GLN A 1 67  ? 134.463 114.631 28.873 1.00 26.74 ? 67   GLN A NE2 1 
ATOM   499  N  N   . ASN A 1 68  ? 136.796 108.820 30.274 1.00 21.86 ? 68   ASN A N   1 
ATOM   500  C  CA  . ASN A 1 68  ? 136.125 107.701 30.903 1.00 26.51 ? 68   ASN A CA  1 
ATOM   501  C  C   . ASN A 1 68  ? 134.988 108.330 31.694 1.00 28.16 ? 68   ASN A C   1 
ATOM   502  O  O   . ASN A 1 68  ? 135.095 109.475 32.134 1.00 29.62 ? 68   ASN A O   1 
ATOM   503  C  CB  . ASN A 1 68  ? 137.081 106.942 31.825 1.00 28.01 ? 68   ASN A CB  1 
ATOM   504  C  CG  . ASN A 1 68  ? 138.188 106.232 31.056 1.00 40.96 ? 68   ASN A CG  1 
ATOM   505  O  OD1 . ASN A 1 68  ? 137.923 105.478 30.117 1.00 45.57 ? 68   ASN A OD1 1 
ATOM   506  N  ND2 . ASN A 1 68  ? 139.433 106.467 31.453 1.00 43.39 ? 68   ASN A ND2 1 
ATOM   507  N  N   . ILE A 1 69  ? 133.894 107.597 31.856 1.00 25.32 ? 69   ILE A N   1 
ATOM   508  C  CA  . ILE A 1 69  ? 132.734 108.108 32.573 1.00 24.27 ? 69   ILE A CA  1 
ATOM   509  C  C   . ILE A 1 69  ? 132.565 107.437 33.925 1.00 26.73 ? 69   ILE A C   1 
ATOM   510  O  O   . ILE A 1 69  ? 132.946 106.285 34.111 1.00 28.18 ? 69   ILE A O   1 
ATOM   511  C  CB  . ILE A 1 69  ? 131.430 107.905 31.734 1.00 29.82 ? 69   ILE A CB  1 
ATOM   512  C  CG1 . ILE A 1 69  ? 131.293 109.025 30.699 1.00 26.59 ? 69   ILE A CG1 1 
ATOM   513  C  CG2 . ILE A 1 69  ? 130.206 107.864 32.632 1.00 31.06 ? 69   ILE A CG2 1 
ATOM   514  C  CD1 . ILE A 1 69  ? 132.301 108.956 29.592 1.00 31.04 ? 69   ILE A CD1 1 
ATOM   515  N  N   . ASP A 1 70  ? 131.995 108.170 34.871 1.00 26.15 ? 70   ASP A N   1 
ATOM   516  C  CA  . ASP A 1 70  ? 131.750 107.638 36.204 1.00 30.70 ? 70   ASP A CA  1 
ATOM   517  C  C   . ASP A 1 70  ? 130.575 106.658 36.117 1.00 30.47 ? 70   ASP A C   1 
ATOM   518  O  O   . ASP A 1 70  ? 129.477 107.036 35.704 1.00 25.41 ? 70   ASP A O   1 
ATOM   519  C  CB  . ASP A 1 70  ? 131.407 108.782 37.167 1.00 27.53 ? 70   ASP A CB  1 
ATOM   520  C  CG  . ASP A 1 70  ? 131.103 108.294 38.573 1.00 35.15 ? 70   ASP A CG  1 
ATOM   521  O  OD1 . ASP A 1 70  ? 130.685 109.118 39.412 1.00 33.20 ? 70   ASP A OD1 1 
ATOM   522  O  OD2 . ASP A 1 70  ? 131.286 107.088 38.846 1.00 38.56 ? 70   ASP A OD2 1 
ATOM   523  N  N   . GLN A 1 71  ? 130.814 105.406 36.505 1.00 35.90 ? 71   GLN A N   1 
ATOM   524  C  CA  . GLN A 1 71  ? 129.778 104.368 36.476 1.00 42.73 ? 71   GLN A CA  1 
ATOM   525  C  C   . GLN A 1 71  ? 129.594 103.700 37.818 1.00 41.85 ? 71   GLN A C   1 
ATOM   526  O  O   . GLN A 1 71  ? 129.117 102.567 37.884 1.00 44.97 ? 71   GLN A O   1 
ATOM   527  C  CB  . GLN A 1 71  ? 130.144 103.261 35.515 1.00 41.01 ? 71   GLN A CB  1 
ATOM   528  C  CG  . GLN A 1 71  ? 130.284 103.653 34.099 1.00 56.75 ? 71   GLN A CG  1 
ATOM   529  C  CD  . GLN A 1 71  ? 131.001 102.572 33.344 1.00 62.04 ? 71   GLN A CD  1 
ATOM   530  O  OE1 . GLN A 1 71  ? 132.211 102.649 33.118 1.00 69.65 ? 71   GLN A OE1 1 
ATOM   531  N  NE2 . GLN A 1 71  ? 130.268 101.533 32.972 0.00 63.62 ? 71   GLN A NE2 1 
ATOM   532  N  N   . SER A 1 72  ? 129.978 104.379 38.885 1.00 36.20 ? 72   SER A N   1 
ATOM   533  C  CA  . SER A 1 72  ? 129.855 103.787 40.201 1.00 37.21 ? 72   SER A CA  1 
ATOM   534  C  C   . SER A 1 72  ? 128.425 103.771 40.723 1.00 34.20 ? 72   SER A C   1 
ATOM   535  O  O   . SER A 1 72  ? 128.122 103.027 41.650 1.00 34.32 ? 72   SER A O   1 
ATOM   536  C  CB  . SER A 1 72  ? 130.770 104.524 41.177 1.00 41.12 ? 72   SER A CB  1 
ATOM   537  O  OG  . SER A 1 72  ? 132.110 104.480 40.714 1.00 44.66 ? 72   SER A OG  1 
ATOM   538  N  N   . PHE A 1 73  ? 127.549 104.576 40.127 1.00 26.62 ? 73   PHE A N   1 
ATOM   539  C  CA  . PHE A 1 73  ? 126.158 104.643 40.569 1.00 30.34 ? 73   PHE A CA  1 
ATOM   540  C  C   . PHE A 1 73  ? 125.176 104.853 39.414 1.00 32.89 ? 73   PHE A C   1 
ATOM   541  O  O   . PHE A 1 73  ? 124.531 105.901 39.310 1.00 32.02 ? 73   PHE A O   1 
ATOM   542  C  CB  . PHE A 1 73  ? 126.005 105.775 41.582 1.00 32.11 ? 73   PHE A CB  1 
ATOM   543  C  CG  . PHE A 1 73  ? 127.011 105.729 42.686 1.00 29.76 ? 73   PHE A CG  1 
ATOM   544  C  CD1 . PHE A 1 73  ? 126.956 104.729 43.647 1.00 29.27 ? 73   PHE A CD1 1 
ATOM   545  C  CD2 . PHE A 1 73  ? 128.029 106.670 42.755 1.00 26.57 ? 73   PHE A CD2 1 
ATOM   546  C  CE1 . PHE A 1 73  ? 127.903 104.663 44.659 1.00 33.79 ? 73   PHE A CE1 1 
ATOM   547  C  CE2 . PHE A 1 73  ? 128.980 106.612 43.764 1.00 33.44 ? 73   PHE A CE2 1 
ATOM   548  C  CZ  . PHE A 1 73  ? 128.917 105.607 44.720 1.00 30.83 ? 73   PHE A CZ  1 
ATOM   549  N  N   . PRO A 1 74  ? 125.041 103.853 38.530 1.00 34.97 ? 74   PRO A N   1 
ATOM   550  C  CA  . PRO A 1 74  ? 124.116 103.991 37.399 1.00 29.83 ? 74   PRO A CA  1 
ATOM   551  C  C   . PRO A 1 74  ? 122.735 104.452 37.862 1.00 29.38 ? 74   PRO A C   1 
ATOM   552  O  O   . PRO A 1 74  ? 122.228 103.998 38.890 1.00 29.28 ? 74   PRO A O   1 
ATOM   553  C  CB  . PRO A 1 74  ? 124.091 102.587 36.804 1.00 33.00 ? 74   PRO A CB  1 
ATOM   554  C  CG  . PRO A 1 74  ? 125.467 102.073 37.106 1.00 34.40 ? 74   PRO A CG  1 
ATOM   555  C  CD  . PRO A 1 74  ? 125.680 102.526 38.532 1.00 28.83 ? 74   PRO A CD  1 
ATOM   556  N  N   . GLY A 1 75  ? 122.145 105.375 37.110 1.00 27.96 ? 75   GLY A N   1 
ATOM   557  C  CA  . GLY A 1 75  ? 120.826 105.880 37.447 1.00 27.29 ? 75   GLY A CA  1 
ATOM   558  C  C   . GLY A 1 75  ? 120.763 106.849 38.611 1.00 29.54 ? 75   GLY A C   1 
ATOM   559  O  O   . GLY A 1 75  ? 119.682 107.327 38.951 1.00 28.67 ? 75   GLY A O   1 
ATOM   560  N  N   . PHE A 1 76  ? 121.903 107.145 39.226 1.00 29.13 ? 76   PHE A N   1 
ATOM   561  C  CA  . PHE A 1 76  ? 121.937 108.068 40.359 1.00 28.97 ? 76   PHE A CA  1 
ATOM   562  C  C   . PHE A 1 76  ? 122.292 109.477 39.887 1.00 31.92 ? 76   PHE A C   1 
ATOM   563  O  O   . PHE A 1 76  ? 123.353 109.701 39.302 1.00 26.81 ? 76   PHE A O   1 
ATOM   564  C  CB  . PHE A 1 76  ? 122.955 107.591 41.398 1.00 30.48 ? 76   PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 76  ? 122.996 108.435 42.636 1.00 28.80 ? 76   PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 76  ? 121.832 108.702 43.353 1.00 31.06 ? 76   PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 76  ? 124.197 108.956 43.094 1.00 26.52 ? 76   PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 76  ? 121.870 109.476 44.513 1.00 33.24 ? 76   PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 76  ? 124.247 109.730 44.252 1.00 28.84 ? 76   PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 76  ? 123.083 109.992 44.962 1.00 29.54 ? 76   PHE A CZ  1 
ATOM   571  N  N   . HIS A 1 77  ? 121.405 110.433 40.141 1.00 26.37 ? 77   HIS A N   1 
ATOM   572  C  CA  . HIS A 1 77  ? 121.668 111.794 39.704 1.00 32.28 ? 77   HIS A CA  1 
ATOM   573  C  C   . HIS A 1 77  ? 122.858 112.444 40.397 1.00 31.53 ? 77   HIS A C   1 
ATOM   574  O  O   . HIS A 1 77  ? 123.484 113.345 39.840 1.00 29.47 ? 77   HIS A O   1 
ATOM   575  C  CB  . HIS A 1 77  ? 120.438 112.677 39.894 1.00 25.41 ? 77   HIS A CB  1 
ATOM   576  C  CG  . HIS A 1 77  ? 120.480 113.918 39.064 1.00 35.57 ? 77   HIS A CG  1 
ATOM   577  N  ND1 . HIS A 1 77  ? 120.660 115.176 39.600 1.00 32.38 ? 77   HIS A ND1 1 
ATOM   578  C  CD2 . HIS A 1 77  ? 120.420 114.085 37.722 1.00 40.15 ? 77   HIS A CD2 1 
ATOM   579  C  CE1 . HIS A 1 77  ? 120.709 116.064 38.624 1.00 32.95 ? 77   HIS A CE1 1 
ATOM   580  N  NE2 . HIS A 1 77  ? 120.567 115.428 37.473 1.00 46.95 ? 77   HIS A NE2 1 
ATOM   581  N  N   . GLY A 1 78  ? 123.164 111.989 41.607 1.00 28.76 ? 78   GLY A N   1 
ATOM   582  C  CA  . GLY A 1 78  ? 124.277 112.550 42.344 1.00 28.37 ? 78   GLY A CA  1 
ATOM   583  C  C   . GLY A 1 78  ? 125.577 112.485 41.570 1.00 33.57 ? 78   GLY A C   1 
ATOM   584  O  O   . GLY A 1 78  ? 126.356 113.437 41.568 1.00 34.10 ? 78   GLY A O   1 
ATOM   585  N  N   . SER A 1 79  ? 125.812 111.362 40.900 1.00 29.33 ? 79   SER A N   1 
ATOM   586  C  CA  . SER A 1 79  ? 127.034 111.184 40.135 1.00 27.02 ? 79   SER A CA  1 
ATOM   587  C  C   . SER A 1 79  ? 126.853 111.421 38.643 1.00 31.40 ? 79   SER A C   1 
ATOM   588  O  O   . SER A 1 79  ? 127.748 111.957 37.984 1.00 29.92 ? 79   SER A O   1 
ATOM   589  C  CB  . SER A 1 79  ? 127.594 109.779 40.363 1.00 26.73 ? 79   SER A CB  1 
ATOM   590  O  OG  . SER A 1 79  ? 126.608 108.785 40.124 1.00 31.98 ? 79   SER A OG  1 
ATOM   591  N  N   . GLU A 1 80  ? 125.696 111.032 38.110 1.00 27.67 ? 80   GLU A N   1 
ATOM   592  C  CA  . GLU A 1 80  ? 125.440 111.187 36.682 1.00 28.88 ? 80   GLU A CA  1 
ATOM   593  C  C   . GLU A 1 80  ? 125.357 112.634 36.204 1.00 23.41 ? 80   GLU A C   1 
ATOM   594  O  O   . GLU A 1 80  ? 125.625 112.916 35.038 1.00 26.24 ? 80   GLU A O   1 
ATOM   595  C  CB  . GLU A 1 80  ? 124.183 110.402 36.276 1.00 35.46 ? 80   GLU A CB  1 
ATOM   596  C  CG  . GLU A 1 80  ? 124.401 108.878 36.269 1.00 49.34 ? 80   GLU A CG  1 
ATOM   597  C  CD  . GLU A 1 80  ? 123.290 108.096 35.565 1.00 54.77 ? 80   GLU A CD  1 
ATOM   598  O  OE1 . GLU A 1 80  ? 123.500 106.900 35.267 1.00 50.26 ? 80   GLU A OE1 1 
ATOM   599  O  OE2 . GLU A 1 80  ? 122.209 108.668 35.312 1.00 58.62 ? 80   GLU A OE2 1 
ATOM   600  N  N   . MET A 1 81  ? 125.000 113.551 37.098 1.00 20.82 ? 81   MET A N   1 
ATOM   601  C  CA  . MET A 1 81  ? 124.925 114.968 36.741 1.00 23.04 ? 81   MET A CA  1 
ATOM   602  C  C   . MET A 1 81  ? 126.294 115.514 36.293 1.00 27.87 ? 81   MET A C   1 
ATOM   603  O  O   . MET A 1 81  ? 126.374 116.554 35.630 1.00 27.88 ? 81   MET A O   1 
ATOM   604  C  CB  . MET A 1 81  ? 124.419 115.789 37.927 1.00 23.16 ? 81   MET A CB  1 
ATOM   605  C  CG  . MET A 1 81  ? 125.358 115.789 39.115 1.00 27.25 ? 81   MET A CG  1 
ATOM   606  S  SD  . MET A 1 81  ? 124.688 116.726 40.494 1.00 33.74 ? 81   MET A SD  1 
ATOM   607  C  CE  . MET A 1 81  ? 125.108 118.397 40.004 1.00 25.40 ? 81   MET A CE  1 
ATOM   608  N  N   . TRP A 1 82  ? 127.369 114.813 36.650 1.00 25.22 ? 82   TRP A N   1 
ATOM   609  C  CA  . TRP A 1 82  ? 128.713 115.245 36.270 1.00 23.01 ? 82   TRP A CA  1 
ATOM   610  C  C   . TRP A 1 82  ? 129.206 114.574 35.003 1.00 24.75 ? 82   TRP A C   1 
ATOM   611  O  O   . TRP A 1 82  ? 130.214 114.989 34.435 1.00 23.92 ? 82   TRP A O   1 
ATOM   612  C  CB  . TRP A 1 82  ? 129.708 114.969 37.398 1.00 17.93 ? 82   TRP A CB  1 
ATOM   613  C  CG  . TRP A 1 82  ? 129.300 115.611 38.675 1.00 25.05 ? 82   TRP A CG  1 
ATOM   614  C  CD1 . TRP A 1 82  ? 128.834 114.987 39.797 1.00 25.05 ? 82   TRP A CD1 1 
ATOM   615  C  CD2 . TRP A 1 82  ? 129.237 117.018 38.942 1.00 21.65 ? 82   TRP A CD2 1 
ATOM   616  N  NE1 . TRP A 1 82  ? 128.478 115.919 40.747 1.00 25.73 ? 82   TRP A NE1 1 
ATOM   617  C  CE2 . TRP A 1 82  ? 128.715 117.174 40.248 1.00 26.33 ? 82   TRP A CE2 1 
ATOM   618  C  CE3 . TRP A 1 82  ? 129.572 118.163 38.206 1.00 20.42 ? 82   TRP A CE3 1 
ATOM   619  C  CZ2 . TRP A 1 82  ? 128.518 118.430 40.833 1.00 21.40 ? 82   TRP A CZ2 1 
ATOM   620  C  CZ3 . TRP A 1 82  ? 129.376 119.416 38.790 1.00 19.50 ? 82   TRP A CZ3 1 
ATOM   621  C  CH2 . TRP A 1 82  ? 128.853 119.536 40.090 1.00 24.94 ? 82   TRP A CH2 1 
ATOM   622  N  N   . ASN A 1 83  ? 128.515 113.527 34.563 1.00 23.63 ? 83   ASN A N   1 
ATOM   623  C  CA  . ASN A 1 83  ? 128.925 112.836 33.347 1.00 21.51 ? 83   ASN A CA  1 
ATOM   624  C  C   . ASN A 1 83  ? 128.609 113.667 32.109 1.00 22.20 ? 83   ASN A C   1 
ATOM   625  O  O   . ASN A 1 83  ? 127.661 114.453 32.093 1.00 26.53 ? 83   ASN A O   1 
ATOM   626  C  CB  . ASN A 1 83  ? 128.242 111.467 33.242 1.00 27.60 ? 83   ASN A CB  1 
ATOM   627  C  CG  . ASN A 1 83  ? 128.749 110.478 34.280 1.00 34.96 ? 83   ASN A CG  1 
ATOM   628  O  OD1 . ASN A 1 83  ? 129.941 110.455 34.608 1.00 33.92 ? 83   ASN A OD1 1 
ATOM   629  N  ND2 . ASN A 1 83  ? 127.850 109.644 34.790 1.00 33.97 ? 83   ASN A ND2 1 
ATOM   630  N  N   . PRO A 1 84  ? 129.405 113.503 31.048 1.00 21.06 ? 84   PRO A N   1 
ATOM   631  C  CA  . PRO A 1 84  ? 129.178 114.259 29.809 1.00 23.22 ? 84   PRO A CA  1 
ATOM   632  C  C   . PRO A 1 84  ? 127.742 114.099 29.316 1.00 28.62 ? 84   PRO A C   1 
ATOM   633  O  O   . PRO A 1 84  ? 127.196 112.998 29.339 1.00 29.20 ? 84   PRO A O   1 
ATOM   634  C  CB  . PRO A 1 84  ? 130.187 113.650 28.840 1.00 21.86 ? 84   PRO A CB  1 
ATOM   635  C  CG  . PRO A 1 84  ? 131.293 113.192 29.745 1.00 27.52 ? 84   PRO A CG  1 
ATOM   636  C  CD  . PRO A 1 84  ? 130.556 112.594 30.917 1.00 18.96 ? 84   PRO A CD  1 
ATOM   637  N  N   . ASN A 1 85  ? 127.132 115.197 28.880 1.00 29.76 ? 85   ASN A N   1 
ATOM   638  C  CA  . ASN A 1 85  ? 125.759 115.167 28.383 1.00 26.60 ? 85   ASN A CA  1 
ATOM   639  C  C   . ASN A 1 85  ? 125.778 115.514 26.901 1.00 24.46 ? 85   ASN A C   1 
ATOM   640  O  O   . ASN A 1 85  ? 124.820 116.040 26.343 1.00 29.30 ? 85   ASN A O   1 
ATOM   641  C  CB  . ASN A 1 85  ? 124.887 116.162 29.169 1.00 27.95 ? 85   ASN A CB  1 
ATOM   642  C  CG  . ASN A 1 85  ? 125.331 117.615 28.994 1.00 26.30 ? 85   ASN A CG  1 
ATOM   643  O  OD1 . ASN A 1 85  ? 126.490 117.897 28.687 1.00 31.92 ? 85   ASN A OD1 1 
ATOM   644  N  ND2 . ASN A 1 85  ? 124.405 118.542 29.212 1.00 33.24 ? 85   ASN A ND2 1 
ATOM   645  N  N   . THR A 1 86  ? 126.899 115.206 26.271 1.00 26.84 ? 86   THR A N   1 
ATOM   646  C  CA  . THR A 1 86  ? 127.091 115.468 24.857 1.00 26.04 ? 86   THR A CA  1 
ATOM   647  C  C   . THR A 1 86  ? 127.997 114.372 24.311 1.00 30.70 ? 86   THR A C   1 
ATOM   648  O  O   . THR A 1 86  ? 128.826 113.833 25.044 1.00 30.87 ? 86   THR A O   1 
ATOM   649  C  CB  . THR A 1 86  ? 127.754 116.844 24.658 1.00 29.53 ? 86   THR A CB  1 
ATOM   650  O  OG1 . THR A 1 86  ? 126.798 117.752 24.103 1.00 35.86 ? 86   THR A OG1 1 
ATOM   651  C  CG2 . THR A 1 86  ? 128.969 116.743 23.755 1.00 24.54 ? 86   THR A CG2 1 
ATOM   652  N  N   . ASP A 1 87  ? 127.824 114.036 23.036 1.00 27.86 ? 87   ASP A N   1 
ATOM   653  C  CA  . ASP A 1 87  ? 128.639 113.017 22.382 1.00 26.82 ? 87   ASP A CA  1 
ATOM   654  C  C   . ASP A 1 87  ? 130.126 113.257 22.609 1.00 31.25 ? 87   ASP A C   1 
ATOM   655  O  O   . ASP A 1 87  ? 130.603 114.387 22.482 1.00 22.25 ? 87   ASP A O   1 
ATOM   656  C  CB  . ASP A 1 87  ? 128.364 113.023 20.876 1.00 39.01 ? 87   ASP A CB  1 
ATOM   657  C  CG  . ASP A 1 87  ? 127.378 111.956 20.456 1.00 42.62 ? 87   ASP A CG  1 
ATOM   658  O  OD1 . ASP A 1 87  ? 126.584 112.218 19.532 1.00 49.74 ? 87   ASP A OD1 1 
ATOM   659  O  OD2 . ASP A 1 87  ? 127.408 110.851 21.038 1.00 53.36 ? 87   ASP A OD2 1 
ATOM   660  N  N   . LEU A 1 88  ? 130.853 112.195 22.947 1.00 26.61 ? 88   LEU A N   1 
ATOM   661  C  CA  . LEU A 1 88  ? 132.291 112.301 23.159 1.00 32.78 ? 88   LEU A CA  1 
ATOM   662  C  C   . LEU A 1 88  ? 132.976 112.203 21.799 1.00 33.88 ? 88   LEU A C   1 
ATOM   663  O  O   . LEU A 1 88  ? 132.502 111.505 20.904 1.00 38.08 ? 88   LEU A O   1 
ATOM   664  C  CB  . LEU A 1 88  ? 132.795 111.178 24.072 1.00 27.33 ? 88   LEU A CB  1 
ATOM   665  C  CG  . LEU A 1 88  ? 132.166 111.035 25.461 1.00 26.06 ? 88   LEU A CG  1 
ATOM   666  C  CD1 . LEU A 1 88  ? 132.880 109.913 26.215 1.00 22.20 ? 88   LEU A CD1 1 
ATOM   667  C  CD2 . LEU A 1 88  ? 132.278 112.344 26.228 1.00 25.09 ? 88   LEU A CD2 1 
ATOM   668  N  N   . SER A 1 89  ? 134.092 112.902 21.644 1.00 33.11 ? 89   SER A N   1 
ATOM   669  C  CA  . SER A 1 89  ? 134.814 112.892 20.383 1.00 31.47 ? 89   SER A CA  1 
ATOM   670  C  C   . SER A 1 89  ? 136.147 113.599 20.554 1.00 35.16 ? 89   SER A C   1 
ATOM   671  O  O   . SER A 1 89  ? 136.305 114.418 21.454 1.00 39.97 ? 89   SER A O   1 
ATOM   672  C  CB  . SER A 1 89  ? 133.979 113.610 19.314 1.00 32.30 ? 89   SER A CB  1 
ATOM   673  O  OG  . SER A 1 89  ? 134.698 113.788 18.103 1.00 34.26 ? 89   SER A OG  1 
ATOM   674  N  N   . GLU A 1 90  ? 137.114 113.269 19.706 1.00 38.60 ? 90   GLU A N   1 
ATOM   675  C  CA  . GLU A 1 90  ? 138.406 113.934 19.767 1.00 38.17 ? 90   GLU A CA  1 
ATOM   676  C  C   . GLU A 1 90  ? 138.208 115.336 19.207 1.00 38.07 ? 90   GLU A C   1 
ATOM   677  O  O   . GLU A 1 90  ? 138.961 116.253 19.527 1.00 38.81 ? 90   GLU A O   1 
ATOM   678  C  CB  . GLU A 1 90  ? 139.448 113.188 18.943 1.00 34.93 ? 90   GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 90  ? 140.053 112.005 19.653 1.00 39.06 ? 90   GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 90  ? 141.233 111.443 18.899 1.00 43.52 ? 90   GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 90  ? 141.012 110.773 17.872 1.00 45.85 ? 90   GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 90  ? 142.382 111.682 19.323 1.00 45.59 ? 90   GLU A OE2 1 
ATOM   683  N  N   . ASP A 1 91  ? 137.193 115.488 18.360 1.00 33.14 ? 91   ASP A N   1 
ATOM   684  C  CA  . ASP A 1 91  ? 136.866 116.783 17.777 1.00 33.00 ? 91   ASP A CA  1 
ATOM   685  C  C   . ASP A 1 91  ? 136.000 117.439 18.847 1.00 31.84 ? 91   ASP A C   1 
ATOM   686  O  O   . ASP A 1 91  ? 134.774 117.327 18.820 1.00 31.96 ? 91   ASP A O   1 
ATOM   687  C  CB  . ASP A 1 91  ? 136.077 116.590 16.481 1.00 28.66 ? 91   ASP A CB  1 
ATOM   688  C  CG  . ASP A 1 91  ? 135.649 117.908 15.847 1.00 43.91 ? 91   ASP A CG  1 
ATOM   689  O  OD1 . ASP A 1 91  ? 134.968 117.869 14.800 1.00 50.40 ? 91   ASP A OD1 1 
ATOM   690  O  OD2 . ASP A 1 91  ? 135.989 118.981 16.387 1.00 37.78 ? 91   ASP A OD2 1 
ATOM   691  N  N   . CYS A 1 92  ? 136.645 118.118 19.792 1.00 29.19 ? 92   CYS A N   1 
ATOM   692  C  CA  . CYS A 1 92  ? 135.930 118.732 20.909 1.00 30.52 ? 92   CYS A CA  1 
ATOM   693  C  C   . CYS A 1 92  ? 136.388 120.130 21.319 1.00 26.83 ? 92   CYS A C   1 
ATOM   694  O  O   . CYS A 1 92  ? 135.955 120.634 22.352 1.00 26.83 ? 92   CYS A O   1 
ATOM   695  C  CB  . CYS A 1 92  ? 136.047 117.819 22.125 1.00 26.02 ? 92   CYS A CB  1 
ATOM   696  S  SG  . CYS A 1 92  ? 137.773 117.674 22.685 1.00 33.34 ? 92   CYS A SG  1 
ATOM   697  N  N   . LEU A 1 93  ? 137.260 120.756 20.538 1.00 25.57 ? 93   LEU A N   1 
ATOM   698  C  CA  . LEU A 1 93  ? 137.734 122.096 20.891 1.00 24.15 ? 93   LEU A CA  1 
ATOM   699  C  C   . LEU A 1 93  ? 136.759 123.197 20.470 1.00 22.80 ? 93   LEU A C   1 
ATOM   700  O  O   . LEU A 1 93  ? 136.944 123.866 19.453 1.00 25.63 ? 93   LEU A O   1 
ATOM   701  C  CB  . LEU A 1 93  ? 139.117 122.344 20.285 1.00 22.81 ? 93   LEU A CB  1 
ATOM   702  C  CG  . LEU A 1 93  ? 140.180 121.342 20.741 1.00 24.33 ? 93   LEU A CG  1 
ATOM   703  C  CD1 . LEU A 1 93  ? 141.548 121.740 20.203 1.00 27.18 ? 93   LEU A CD1 1 
ATOM   704  C  CD2 . LEU A 1 93  ? 140.206 121.291 22.258 1.00 30.08 ? 93   LEU A CD2 1 
ATOM   705  N  N   . TYR A 1 94  ? 135.713 123.367 21.271 1.00 17.36 ? 94   TYR A N   1 
ATOM   706  C  CA  . TYR A 1 94  ? 134.694 124.374 21.025 1.00 20.29 ? 94   TYR A CA  1 
ATOM   707  C  C   . TYR A 1 94  ? 134.443 125.161 22.307 1.00 23.14 ? 94   TYR A C   1 
ATOM   708  O  O   . TYR A 1 94  ? 134.839 124.734 23.390 1.00 24.82 ? 94   TYR A O   1 
ATOM   709  C  CB  . TYR A 1 94  ? 133.382 123.716 20.571 1.00 23.82 ? 94   TYR A CB  1 
ATOM   710  C  CG  . TYR A 1 94  ? 133.524 122.876 19.326 1.00 26.28 ? 94   TYR A CG  1 
ATOM   711  C  CD1 . TYR A 1 94  ? 134.021 121.573 19.391 1.00 28.45 ? 94   TYR A CD1 1 
ATOM   712  C  CD2 . TYR A 1 94  ? 133.228 123.408 18.071 1.00 28.84 ? 94   TYR A CD2 1 
ATOM   713  C  CE1 . TYR A 1 94  ? 134.226 120.821 18.235 1.00 29.77 ? 94   TYR A CE1 1 
ATOM   714  C  CE2 . TYR A 1 94  ? 133.431 122.669 16.908 1.00 28.42 ? 94   TYR A CE2 1 
ATOM   715  C  CZ  . TYR A 1 94  ? 133.931 121.379 16.996 1.00 31.95 ? 94   TYR A CZ  1 
ATOM   716  O  OH  . TYR A 1 94  ? 134.148 120.650 15.851 1.00 34.59 ? 94   TYR A OH  1 
ATOM   717  N  N   . LEU A 1 95  ? 133.789 126.310 22.182 1.00 18.01 ? 95   LEU A N   1 
ATOM   718  C  CA  . LEU A 1 95  ? 133.484 127.128 23.344 1.00 21.96 ? 95   LEU A CA  1 
ATOM   719  C  C   . LEU A 1 95  ? 132.078 127.703 23.222 1.00 22.01 ? 95   LEU A C   1 
ATOM   720  O  O   . LEU A 1 95  ? 131.478 127.687 22.148 1.00 24.47 ? 95   LEU A O   1 
ATOM   721  C  CB  . LEU A 1 95  ? 134.528 128.245 23.514 1.00 19.58 ? 95   LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 95  ? 134.830 129.187 22.339 1.00 22.98 ? 95   LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 95  ? 133.656 130.132 22.100 1.00 17.26 ? 95   LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 95  ? 136.111 129.983 22.646 1.00 19.85 ? 95   LEU A CD2 1 
ATOM   725  N  N   . ASN A 1 96  ? 131.557 128.204 24.335 1.00 19.12 ? 96   ASN A N   1 
ATOM   726  C  CA  . ASN A 1 96  ? 130.219 128.760 24.372 1.00 17.56 ? 96   ASN A CA  1 
ATOM   727  C  C   . ASN A 1 96  ? 130.239 130.213 24.832 1.00 26.70 ? 96   ASN A C   1 
ATOM   728  O  O   . ASN A 1 96  ? 131.119 130.632 25.591 1.00 21.45 ? 96   ASN A O   1 
ATOM   729  C  CB  . ASN A 1 96  ? 129.364 127.932 25.319 1.00 19.09 ? 96   ASN A CB  1 
ATOM   730  C  CG  . ASN A 1 96  ? 129.514 126.448 25.070 1.00 26.68 ? 96   ASN A CG  1 
ATOM   731  O  OD1 . ASN A 1 96  ? 129.193 125.958 23.991 1.00 26.60 ? 96   ASN A OD1 1 
ATOM   732  N  ND2 . ASN A 1 96  ? 130.024 125.727 26.062 1.00 21.90 ? 96   ASN A ND2 1 
ATOM   733  N  N   . VAL A 1 97  ? 129.260 130.978 24.366 1.00 29.36 ? 97   VAL A N   1 
ATOM   734  C  CA  . VAL A 1 97  ? 129.161 132.380 24.728 1.00 25.50 ? 97   VAL A CA  1 
ATOM   735  C  C   . VAL A 1 97  ? 127.726 132.764 25.038 1.00 26.22 ? 97   VAL A C   1 
ATOM   736  O  O   . VAL A 1 97  ? 126.817 132.478 24.266 1.00 28.35 ? 97   VAL A O   1 
ATOM   737  C  CB  . VAL A 1 97  ? 129.670 133.295 23.590 1.00 26.61 ? 97   VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 97  ? 129.691 134.741 24.061 1.00 20.47 ? 97   VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 97  ? 131.057 132.861 23.147 1.00 23.51 ? 97   VAL A CG2 1 
ATOM   740  N  N   . TRP A 1 98  ? 127.527 133.396 26.187 1.00 26.54 ? 98   TRP A N   1 
ATOM   741  C  CA  . TRP A 1 98  ? 126.207 133.866 26.581 1.00 27.31 ? 98   TRP A CA  1 
ATOM   742  C  C   . TRP A 1 98  ? 126.351 135.366 26.730 1.00 30.50 ? 98   TRP A C   1 
ATOM   743  O  O   . TRP A 1 98  ? 127.150 135.838 27.548 1.00 33.16 ? 98   TRP A O   1 
ATOM   744  C  CB  . TRP A 1 98  ? 125.779 133.271 27.918 1.00 24.59 ? 98   TRP A CB  1 
ATOM   745  C  CG  . TRP A 1 98  ? 125.340 131.851 27.851 1.00 30.89 ? 98   TRP A CG  1 
ATOM   746  C  CD1 . TRP A 1 98  ? 124.077 131.391 27.593 1.00 22.40 ? 98   TRP A CD1 1 
ATOM   747  C  CD2 . TRP A 1 98  ? 126.150 130.694 28.086 1.00 25.95 ? 98   TRP A CD2 1 
ATOM   748  N  NE1 . TRP A 1 98  ? 124.053 130.018 27.660 1.00 28.24 ? 98   TRP A NE1 1 
ATOM   749  C  CE2 . TRP A 1 98  ? 125.312 129.565 27.961 1.00 31.16 ? 98   TRP A CE2 1 
ATOM   750  C  CE3 . TRP A 1 98  ? 127.503 130.502 28.393 1.00 24.63 ? 98   TRP A CE3 1 
ATOM   751  C  CZ2 . TRP A 1 98  ? 125.785 128.259 28.134 1.00 29.41 ? 98   TRP A CZ2 1 
ATOM   752  C  CZ3 . TRP A 1 98  ? 127.974 129.200 28.565 1.00 25.53 ? 98   TRP A CZ3 1 
ATOM   753  C  CH2 . TRP A 1 98  ? 127.117 128.100 28.436 1.00 26.47 ? 98   TRP A CH2 1 
ATOM   754  N  N   . ILE A 1 99  ? 125.602 136.120 25.932 1.00 30.85 ? 99   ILE A N   1 
ATOM   755  C  CA  . ILE A 1 99  ? 125.673 137.568 26.016 1.00 35.53 ? 99   ILE A CA  1 
ATOM   756  C  C   . ILE A 1 99  ? 124.302 138.126 26.368 1.00 36.75 ? 99   ILE A C   1 
ATOM   757  O  O   . ILE A 1 99  ? 123.276 137.582 25.957 1.00 35.62 ? 99   ILE A O   1 
ATOM   758  C  CB  . ILE A 1 99  ? 126.166 138.198 24.692 1.00 38.88 ? 99   ILE A CB  1 
ATOM   759  C  CG1 . ILE A 1 99  ? 125.028 138.272 23.676 1.00 47.77 ? 99   ILE A CG1 1 
ATOM   760  C  CG2 . ILE A 1 99  ? 127.307 137.370 24.123 1.00 32.81 ? 99   ILE A CG2 1 
ATOM   761  C  CD1 . ILE A 1 99  ? 125.324 139.191 22.497 1.00 56.53 ? 99   ILE A CD1 1 
ATOM   762  N  N   . PRO A 1 100 ? 124.267 139.212 27.155 1.00 33.67 ? 100  PRO A N   1 
ATOM   763  C  CA  . PRO A 1 100 ? 122.982 139.802 27.532 1.00 31.88 ? 100  PRO A CA  1 
ATOM   764  C  C   . PRO A 1 100 ? 122.275 140.368 26.308 1.00 35.62 ? 100  PRO A C   1 
ATOM   765  O  O   . PRO A 1 100 ? 122.890 140.569 25.262 1.00 36.53 ? 100  PRO A O   1 
ATOM   766  C  CB  . PRO A 1 100 ? 123.377 140.901 28.521 1.00 33.34 ? 100  PRO A CB  1 
ATOM   767  C  CG  . PRO A 1 100 ? 124.693 140.428 29.071 1.00 33.22 ? 100  PRO A CG  1 
ATOM   768  C  CD  . PRO A 1 100 ? 125.377 139.883 27.852 1.00 29.69 ? 100  PRO A CD  1 
ATOM   769  N  N   . ALA A 1 101 ? 120.979 140.606 26.449 1.00 38.24 ? 101  ALA A N   1 
ATOM   770  C  CA  . ALA A 1 101 ? 120.165 141.173 25.388 1.00 38.57 ? 101  ALA A CA  1 
ATOM   771  C  C   . ALA A 1 101 ? 119.304 142.230 26.067 1.00 43.65 ? 101  ALA A C   1 
ATOM   772  O  O   . ALA A 1 101 ? 118.678 141.966 27.094 1.00 47.84 ? 101  ALA A O   1 
ATOM   773  C  CB  . ALA A 1 101 ? 119.294 140.105 24.752 1.00 38.48 ? 101  ALA A CB  1 
ATOM   774  N  N   . PRO A 1 102 ? 119.270 143.445 25.507 1.00 47.18 ? 102  PRO A N   1 
ATOM   775  C  CA  . PRO A 1 102 ? 119.999 143.820 24.291 1.00 44.99 ? 102  PRO A CA  1 
ATOM   776  C  C   . PRO A 1 102 ? 121.513 143.716 24.418 1.00 40.67 ? 102  PRO A C   1 
ATOM   777  O  O   . PRO A 1 102 ? 122.061 143.789 25.513 1.00 36.44 ? 102  PRO A O   1 
ATOM   778  C  CB  . PRO A 1 102 ? 119.535 145.252 24.040 1.00 48.74 ? 102  PRO A CB  1 
ATOM   779  C  CG  . PRO A 1 102 ? 119.260 145.760 25.430 1.00 51.84 ? 102  PRO A CG  1 
ATOM   780  C  CD  . PRO A 1 102 ? 118.539 144.598 26.062 1.00 44.07 ? 102  PRO A CD  1 
ATOM   781  N  N   . LYS A 1 103 ? 122.173 143.539 23.280 1.00 39.90 ? 103  LYS A N   1 
ATOM   782  C  CA  . LYS A 1 103 ? 123.620 143.428 23.212 1.00 38.57 ? 103  LYS A CA  1 
ATOM   783  C  C   . LYS A 1 103 ? 124.286 144.505 24.057 1.00 41.29 ? 103  LYS A C   1 
ATOM   784  O  O   . LYS A 1 103 ? 123.939 145.679 23.966 1.00 46.75 ? 103  LYS A O   1 
ATOM   785  C  CB  . LYS A 1 103 ? 124.071 143.570 21.763 1.00 38.33 ? 103  LYS A CB  1 
ATOM   786  C  CG  . LYS A 1 103 ? 125.558 143.442 21.555 1.00 44.18 ? 103  LYS A CG  1 
ATOM   787  C  CD  . LYS A 1 103 ? 125.908 143.653 20.093 1.00 54.46 ? 103  LYS A CD  1 
ATOM   788  C  CE  . LYS A 1 103 ? 127.349 143.273 19.799 1.00 56.00 ? 103  LYS A CE  1 
ATOM   789  N  NZ  . LYS A 1 103 ? 128.152 144.437 19.340 1.00 63.52 ? 103  LYS A NZ  1 
ATOM   790  N  N   . PRO A 1 104 ? 125.243 144.112 24.910 1.00 42.18 ? 104  PRO A N   1 
ATOM   791  C  CA  . PRO A 1 104 ? 125.952 145.063 25.767 1.00 39.69 ? 104  PRO A CA  1 
ATOM   792  C  C   . PRO A 1 104 ? 126.958 145.838 24.923 1.00 38.01 ? 104  PRO A C   1 
ATOM   793  O  O   . PRO A 1 104 ? 127.184 145.492 23.766 1.00 36.09 ? 104  PRO A O   1 
ATOM   794  C  CB  . PRO A 1 104 ? 126.614 144.154 26.794 1.00 39.27 ? 104  PRO A CB  1 
ATOM   795  C  CG  . PRO A 1 104 ? 126.953 142.955 25.971 1.00 42.33 ? 104  PRO A CG  1 
ATOM   796  C  CD  . PRO A 1 104 ? 125.680 142.733 25.192 1.00 42.42 ? 104  PRO A CD  1 
ATOM   797  N  N   . LYS A 1 105 ? 127.559 146.881 25.486 1.00 38.44 ? 105  LYS A N   1 
ATOM   798  C  CA  . LYS A 1 105 ? 128.524 147.666 24.728 1.00 42.61 ? 105  LYS A CA  1 
ATOM   799  C  C   . LYS A 1 105 ? 129.979 147.433 25.111 1.00 45.09 ? 105  LYS A C   1 
ATOM   800  O  O   . LYS A 1 105 ? 130.867 147.551 24.268 1.00 47.30 ? 105  LYS A O   1 
ATOM   801  C  CB  . LYS A 1 105 ? 128.177 149.153 24.826 1.00 47.62 ? 105  LYS A CB  1 
ATOM   802  C  CG  . LYS A 1 105 ? 127.032 149.530 23.899 1.00 54.52 ? 105  LYS A CG  1 
ATOM   803  C  CD  . LYS A 1 105 ? 126.444 150.890 24.204 1.00 56.33 ? 105  LYS A CD  1 
ATOM   804  C  CE  . LYS A 1 105 ? 125.068 151.022 23.560 1.00 58.21 ? 105  LYS A CE  1 
ATOM   805  N  NZ  . LYS A 1 105 ? 125.110 150.841 22.079 1.00 60.75 ? 105  LYS A NZ  1 
ATOM   806  N  N   . ASN A 1 106 ? 130.225 147.082 26.368 1.00 38.47 ? 106  ASN A N   1 
ATOM   807  C  CA  . ASN A 1 106 ? 131.583 146.846 26.830 1.00 36.81 ? 106  ASN A CA  1 
ATOM   808  C  C   . ASN A 1 106 ? 131.463 146.120 28.173 1.00 34.28 ? 106  ASN A C   1 
ATOM   809  O  O   . ASN A 1 106 ? 131.880 146.622 29.211 1.00 34.32 ? 106  ASN A O   1 
ATOM   810  C  CB  . ASN A 1 106 ? 132.297 148.191 26.980 1.00 37.26 ? 106  ASN A CB  1 
ATOM   811  C  CG  . ASN A 1 106 ? 133.796 148.112 26.693 1.00 48.65 ? 106  ASN A CG  1 
ATOM   812  O  OD1 . ASN A 1 106 ? 134.236 147.459 25.763 1.00 51.22 ? 106  ASN A OD1 1 
ATOM   813  N  ND2 . ASN A 1 106 ? 134.558 148.825 27.516 1.00 61.67 ? 106  ASN A ND2 1 
ATOM   814  N  N   . ALA A 1 107 ? 130.867 144.933 28.134 1.00 31.75 ? 107  ALA A N   1 
ATOM   815  C  CA  . ALA A 1 107 ? 130.636 144.127 29.329 1.00 28.83 ? 107  ALA A CA  1 
ATOM   816  C  C   . ALA A 1 107 ? 131.834 143.326 29.798 1.00 27.87 ? 107  ALA A C   1 
ATOM   817  O  O   . ALA A 1 107 ? 132.707 142.950 29.007 1.00 24.63 ? 107  ALA A O   1 
ATOM   818  C  CB  . ALA A 1 107 ? 129.470 143.182 29.088 1.00 23.74 ? 107  ALA A CB  1 
ATOM   819  N  N   . THR A 1 108 ? 131.859 143.060 31.099 1.00 24.89 ? 108  THR A N   1 
ATOM   820  C  CA  . THR A 1 108 ? 132.921 142.266 31.695 1.00 29.04 ? 108  THR A CA  1 
ATOM   821  C  C   . THR A 1 108 ? 132.687 140.805 31.291 1.00 27.78 ? 108  THR A C   1 
ATOM   822  O  O   . THR A 1 108 ? 131.542 140.360 31.161 1.00 24.46 ? 108  THR A O   1 
ATOM   823  C  CB  . THR A 1 108 ? 132.917 142.403 33.225 1.00 25.70 ? 108  THR A CB  1 
ATOM   824  O  OG1 . THR A 1 108 ? 133.384 143.709 33.581 1.00 30.28 ? 108  THR A OG1 1 
ATOM   825  C  CG2 . THR A 1 108 ? 133.803 141.344 33.862 1.00 32.96 ? 108  THR A CG2 1 
ATOM   826  N  N   . VAL A 1 109 ? 133.776 140.070 31.088 1.00 24.38 ? 109  VAL A N   1 
ATOM   827  C  CA  . VAL A 1 109 ? 133.690 138.683 30.657 1.00 24.06 ? 109  VAL A CA  1 
ATOM   828  C  C   . VAL A 1 109 ? 134.102 137.672 31.719 1.00 28.05 ? 109  VAL A C   1 
ATOM   829  O  O   . VAL A 1 109 ? 135.154 137.801 32.345 1.00 29.22 ? 109  VAL A O   1 
ATOM   830  C  CB  . VAL A 1 109 ? 134.567 138.453 29.402 1.00 26.66 ? 109  VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 109 ? 134.372 137.036 28.883 1.00 22.60 ? 109  VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 109 ? 134.224 139.482 28.326 1.00 17.64 ? 109  VAL A CG2 1 
ATOM   833  N  N   . LEU A 1 110 ? 133.260 136.663 31.911 1.00 29.23 ? 110  LEU A N   1 
ATOM   834  C  CA  . LEU A 1 110 ? 133.523 135.595 32.868 1.00 26.67 ? 110  LEU A CA  1 
ATOM   835  C  C   . LEU A 1 110 ? 133.818 134.316 32.093 1.00 26.74 ? 110  LEU A C   1 
ATOM   836  O  O   . LEU A 1 110 ? 132.965 133.805 31.366 1.00 22.50 ? 110  LEU A O   1 
ATOM   837  C  CB  . LEU A 1 110 ? 132.311 135.377 33.778 1.00 30.36 ? 110  LEU A CB  1 
ATOM   838  C  CG  . LEU A 1 110 ? 132.125 136.373 34.919 1.00 37.50 ? 110  LEU A CG  1 
ATOM   839  C  CD1 . LEU A 1 110 ? 130.860 136.050 35.689 1.00 34.79 ? 110  LEU A CD1 1 
ATOM   840  C  CD2 . LEU A 1 110 ? 133.326 136.301 35.842 1.00 45.71 ? 110  LEU A CD2 1 
ATOM   841  N  N   . ILE A 1 111 ? 135.031 133.803 32.244 1.00 24.72 ? 111  ILE A N   1 
ATOM   842  C  CA  . ILE A 1 111 ? 135.413 132.596 31.542 1.00 21.16 ? 111  ILE A CA  1 
ATOM   843  C  C   . ILE A 1 111 ? 135.510 131.413 32.494 1.00 20.74 ? 111  ILE A C   1 
ATOM   844  O  O   . ILE A 1 111 ? 136.365 131.381 33.380 1.00 20.62 ? 111  ILE A O   1 
ATOM   845  C  CB  . ILE A 1 111 ? 136.751 132.798 30.810 1.00 19.98 ? 111  ILE A CB  1 
ATOM   846  C  CG1 . ILE A 1 111 ? 136.620 133.974 29.841 1.00 19.67 ? 111  ILE A CG1 1 
ATOM   847  C  CG2 . ILE A 1 111 ? 137.141 131.536 30.063 1.00 20.38 ? 111  ILE A CG2 1 
ATOM   848  C  CD1 . ILE A 1 111 ? 137.861 134.262 29.030 1.00 16.76 ? 111  ILE A CD1 1 
ATOM   849  N  N   . TRP A 1 112 ? 134.604 130.453 32.316 1.00 13.08 ? 112  TRP A N   1 
ATOM   850  C  CA  . TRP A 1 112 ? 134.567 129.246 33.143 1.00 16.40 ? 112  TRP A CA  1 
ATOM   851  C  C   . TRP A 1 112 ? 135.468 128.101 32.655 1.00 17.06 ? 112  TRP A C   1 
ATOM   852  O  O   . TRP A 1 112 ? 135.570 127.818 31.460 1.00 22.37 ? 112  TRP A O   1 
ATOM   853  C  CB  . TRP A 1 112 ? 133.126 128.732 33.235 1.00 18.06 ? 112  TRP A CB  1 
ATOM   854  C  CG  . TRP A 1 112 ? 132.956 127.464 34.008 1.00 24.31 ? 112  TRP A CG  1 
ATOM   855  C  CD1 . TRP A 1 112 ? 132.673 126.240 33.507 1.00 25.57 ? 112  TRP A CD1 1 
ATOM   856  C  CD2 . TRP A 1 112 ? 133.028 127.308 35.440 1.00 22.53 ? 112  TRP A CD2 1 
ATOM   857  N  NE1 . TRP A 1 112 ? 132.557 125.317 34.535 1.00 21.62 ? 112  TRP A NE1 1 
ATOM   858  C  CE2 . TRP A 1 112 ? 132.769 125.950 35.732 1.00 19.51 ? 112  TRP A CE2 1 
ATOM   859  C  CE3 . TRP A 1 112 ? 133.286 128.191 36.500 1.00 20.80 ? 112  TRP A CE3 1 
ATOM   860  C  CZ2 . TRP A 1 112 ? 132.754 125.451 37.024 1.00 22.58 ? 112  TRP A CZ2 1 
ATOM   861  C  CZ3 . TRP A 1 112 ? 133.274 127.695 37.799 1.00 21.28 ? 112  TRP A CZ3 1 
ATOM   862  C  CH2 . TRP A 1 112 ? 133.007 126.330 38.044 1.00 19.97 ? 112  TRP A CH2 1 
ATOM   863  N  N   . ILE A 1 113 ? 136.136 127.457 33.605 1.00 15.85 ? 113  ILE A N   1 
ATOM   864  C  CA  . ILE A 1 113 ? 136.996 126.312 33.324 1.00 17.18 ? 113  ILE A CA  1 
ATOM   865  C  C   . ILE A 1 113 ? 136.558 125.204 34.259 1.00 21.09 ? 113  ILE A C   1 
ATOM   866  O  O   . ILE A 1 113 ? 136.821 125.262 35.448 1.00 24.03 ? 113  ILE A O   1 
ATOM   867  C  CB  . ILE A 1 113 ? 138.482 126.611 33.600 1.00 14.78 ? 113  ILE A CB  1 
ATOM   868  C  CG1 . ILE A 1 113 ? 138.963 127.816 32.769 1.00 15.10 ? 113  ILE A CG1 1 
ATOM   869  C  CG2 . ILE A 1 113 ? 139.328 125.351 33.285 1.00 11.20 ? 113  ILE A CG2 1 
ATOM   870  C  CD1 . ILE A 1 113 ? 140.416 128.151 32.934 1.00 17.21 ? 113  ILE A CD1 1 
ATOM   871  N  N   . TYR A 1 114 ? 135.865 124.206 33.723 1.00 19.67 ? 114  TYR A N   1 
ATOM   872  C  CA  . TYR A 1 114 ? 135.356 123.102 34.538 1.00 12.98 ? 114  TYR A CA  1 
ATOM   873  C  C   . TYR A 1 114 ? 136.434 122.216 35.162 1.00 16.59 ? 114  TYR A C   1 
ATOM   874  O  O   . TYR A 1 114 ? 137.573 122.129 34.683 1.00 14.45 ? 114  TYR A O   1 
ATOM   875  C  CB  . TYR A 1 114 ? 134.401 122.209 33.712 1.00 18.95 ? 114  TYR A CB  1 
ATOM   876  C  CG  . TYR A 1 114 ? 135.004 121.583 32.461 1.00 14.13 ? 114  TYR A CG  1 
ATOM   877  C  CD1 . TYR A 1 114 ? 135.895 120.513 32.540 1.00 16.44 ? 114  TYR A CD1 1 
ATOM   878  C  CD2 . TYR A 1 114 ? 134.722 122.103 31.195 1.00 19.01 ? 114  TYR A CD2 1 
ATOM   879  C  CE1 . TYR A 1 114 ? 136.498 119.979 31.387 1.00 17.58 ? 114  TYR A CE1 1 
ATOM   880  C  CE2 . TYR A 1 114 ? 135.315 121.583 30.045 1.00 11.58 ? 114  TYR A CE2 1 
ATOM   881  C  CZ  . TYR A 1 114 ? 136.200 120.527 30.142 1.00 19.81 ? 114  TYR A CZ  1 
ATOM   882  O  OH  . TYR A 1 114 ? 136.796 120.052 28.995 1.00 20.99 ? 114  TYR A OH  1 
ATOM   883  N  N   . GLY A 1 115 ? 136.058 121.553 36.247 1.00 16.39 ? 115  GLY A N   1 
ATOM   884  C  CA  . GLY A 1 115 ? 136.962 120.646 36.914 1.00 14.91 ? 115  GLY A CA  1 
ATOM   885  C  C   . GLY A 1 115 ? 136.690 119.218 36.455 1.00 22.42 ? 115  GLY A C   1 
ATOM   886  O  O   . GLY A 1 115 ? 135.914 118.980 35.531 1.00 16.04 ? 115  GLY A O   1 
ATOM   887  N  N   . GLY A 1 116 ? 137.300 118.257 37.138 1.00 16.69 ? 116  GLY A N   1 
ATOM   888  C  CA  . GLY A 1 116 ? 137.142 116.872 36.767 1.00 19.84 ? 116  GLY A CA  1 
ATOM   889  C  C   . GLY A 1 116 ? 138.493 116.187 36.848 1.00 24.16 ? 116  GLY A C   1 
ATOM   890  O  O   . GLY A 1 116 ? 138.750 115.230 36.135 1.00 23.28 ? 116  GLY A O   1 
ATOM   891  N  N   . GLY A 1 117 ? 139.371 116.688 37.712 1.00 20.91 ? 117  GLY A N   1 
ATOM   892  C  CA  . GLY A 1 117 ? 140.673 116.072 37.889 1.00 16.47 ? 117  GLY A CA  1 
ATOM   893  C  C   . GLY A 1 117 ? 141.522 115.998 36.638 1.00 14.22 ? 117  GLY A C   1 
ATOM   894  O  O   . GLY A 1 117 ? 142.424 115.176 36.566 1.00 20.34 ? 117  GLY A O   1 
ATOM   895  N  N   . PHE A 1 118 ? 141.275 116.883 35.677 1.00 9.72  ? 118  PHE A N   1 
ATOM   896  C  CA  . PHE A 1 118 ? 142.017 116.877 34.427 1.00 19.37 ? 118  PHE A CA  1 
ATOM   897  C  C   . PHE A 1 118 ? 141.793 115.579 33.648 1.00 22.02 ? 118  PHE A C   1 
ATOM   898  O  O   . PHE A 1 118 ? 142.486 115.329 32.675 1.00 23.01 ? 118  PHE A O   1 
ATOM   899  C  CB  . PHE A 1 118 ? 143.513 117.073 34.692 1.00 20.29 ? 118  PHE A CB  1 
ATOM   900  C  CG  . PHE A 1 118 ? 143.850 118.415 35.279 1.00 17.61 ? 118  PHE A CG  1 
ATOM   901  C  CD1 . PHE A 1 118 ? 144.366 118.520 36.565 1.00 12.51 ? 118  PHE A CD1 1 
ATOM   902  C  CD2 . PHE A 1 118 ? 143.688 119.580 34.531 1.00 14.73 ? 118  PHE A CD2 1 
ATOM   903  C  CE1 . PHE A 1 118 ? 144.719 119.765 37.097 1.00 18.36 ? 118  PHE A CE1 1 
ATOM   904  C  CE2 . PHE A 1 118 ? 144.038 120.833 35.059 1.00 16.16 ? 118  PHE A CE2 1 
ATOM   905  C  CZ  . PHE A 1 118 ? 144.556 120.921 36.340 1.00 14.57 ? 118  PHE A CZ  1 
ATOM   906  N  N   . GLN A 1 119 ? 140.809 114.773 34.045 1.00 19.57 ? 119  GLN A N   1 
ATOM   907  C  CA  . GLN A 1 119 ? 140.549 113.513 33.351 1.00 23.24 ? 119  GLN A CA  1 
ATOM   908  C  C   . GLN A 1 119 ? 139.137 113.524 32.762 1.00 23.25 ? 119  GLN A C   1 
ATOM   909  O  O   . GLN A 1 119 ? 138.865 112.839 31.783 1.00 34.97 ? 119  GLN A O   1 
ATOM   910  C  CB  . GLN A 1 119 ? 140.681 112.319 34.308 1.00 15.20 ? 119  GLN A CB  1 
ATOM   911  C  CG  . GLN A 1 119 ? 141.898 112.338 35.234 1.00 22.85 ? 119  GLN A CG  1 
ATOM   912  C  CD  . GLN A 1 119 ? 143.202 112.479 34.496 1.00 29.57 ? 119  GLN A CD  1 
ATOM   913  O  OE1 . GLN A 1 119 ? 143.543 111.676 33.620 1.00 28.88 ? 119  GLN A OE1 1 
ATOM   914  N  NE2 . GLN A 1 119 ? 143.950 113.510 34.853 1.00 30.82 ? 119  GLN A NE2 1 
ATOM   915  N  N   . THR A 1 120 ? 138.248 114.327 33.335 1.00 22.14 ? 120  THR A N   1 
ATOM   916  C  CA  . THR A 1 120 ? 136.874 114.382 32.870 1.00 23.71 ? 120  THR A CA  1 
ATOM   917  C  C   . THR A 1 120 ? 136.306 115.788 32.876 1.00 21.24 ? 120  THR A C   1 
ATOM   918  O  O   . THR A 1 120 ? 136.979 116.744 33.246 1.00 24.91 ? 120  THR A O   1 
ATOM   919  C  CB  . THR A 1 120 ? 135.971 113.519 33.762 1.00 27.87 ? 120  THR A CB  1 
ATOM   920  O  OG1 . THR A 1 120 ? 135.929 114.070 35.089 1.00 28.47 ? 120  THR A OG1 1 
ATOM   921  C  CG2 . THR A 1 120 ? 136.495 112.084 33.806 1.00 20.28 ? 120  THR A CG2 1 
ATOM   922  N  N   . GLY A 1 121 ? 135.048 115.906 32.476 1.00 18.59 ? 121  GLY A N   1 
ATOM   923  C  CA  . GLY A 1 121 ? 134.416 117.200 32.491 1.00 19.81 ? 121  GLY A CA  1 
ATOM   924  C  C   . GLY A 1 121 ? 134.047 117.720 31.123 1.00 20.12 ? 121  GLY A C   1 
ATOM   925  O  O   . GLY A 1 121 ? 134.551 117.250 30.110 1.00 22.69 ? 121  GLY A O   1 
ATOM   926  N  N   . THR A 1 122 ? 133.135 118.683 31.086 1.00 20.14 ? 122  THR A N   1 
ATOM   927  C  CA  . THR A 1 122 ? 132.711 119.302 29.829 1.00 22.09 ? 122  THR A CA  1 
ATOM   928  C  C   . THR A 1 122 ? 131.948 120.572 30.188 1.00 23.12 ? 122  THR A C   1 
ATOM   929  O  O   . THR A 1 122 ? 131.376 120.678 31.276 1.00 22.51 ? 122  THR A O   1 
ATOM   930  C  CB  . THR A 1 122 ? 131.806 118.350 29.003 1.00 23.18 ? 122  THR A CB  1 
ATOM   931  O  OG1 . THR A 1 122 ? 131.501 118.934 27.727 1.00 29.93 ? 122  THR A OG1 1 
ATOM   932  C  CG2 . THR A 1 122 ? 130.512 118.032 29.764 1.00 15.84 ? 122  THR A CG2 1 
ATOM   933  N  N   . SER A 1 123 ? 131.938 121.534 29.275 1.00 19.22 ? 123  SER A N   1 
ATOM   934  C  CA  . SER A 1 123 ? 131.275 122.808 29.520 1.00 22.00 ? 123  SER A CA  1 
ATOM   935  C  C   . SER A 1 123 ? 129.783 122.837 29.231 1.00 25.68 ? 123  SER A C   1 
ATOM   936  O  O   . SER A 1 123 ? 129.125 123.846 29.470 1.00 27.70 ? 123  SER A O   1 
ATOM   937  C  CB  . SER A 1 123 ? 131.953 123.907 28.710 1.00 23.58 ? 123  SER A CB  1 
ATOM   938  O  OG  . SER A 1 123 ? 131.894 123.602 27.335 1.00 21.89 ? 123  SER A OG  1 
ATOM   939  N  N   . SER A 1 124 ? 129.241 121.723 28.756 1.00 23.66 ? 124  SER A N   1 
ATOM   940  C  CA  . SER A 1 124 ? 127.830 121.654 28.432 1.00 20.88 ? 124  SER A CA  1 
ATOM   941  C  C   . SER A 1 124 ? 126.990 121.179 29.607 1.00 20.52 ? 124  SER A C   1 
ATOM   942  O  O   . SER A 1 124 ? 125.778 121.057 29.481 1.00 27.65 ? 124  SER A O   1 
ATOM   943  C  CB  . SER A 1 124 ? 127.617 120.728 27.233 1.00 21.13 ? 124  SER A CB  1 
ATOM   944  O  OG  . SER A 1 124 ? 128.217 119.458 27.430 1.00 26.07 ? 124  SER A OG  1 
ATOM   945  N  N   . LEU A 1 125 ? 127.605 120.953 30.765 1.00 22.21 ? 125  LEU A N   1 
ATOM   946  C  CA  . LEU A 1 125 ? 126.833 120.479 31.915 1.00 21.07 ? 125  LEU A CA  1 
ATOM   947  C  C   . LEU A 1 125 ? 125.765 121.504 32.287 1.00 22.90 ? 125  LEU A C   1 
ATOM   948  O  O   . LEU A 1 125 ? 125.913 122.697 32.051 1.00 26.07 ? 125  LEU A O   1 
ATOM   949  C  CB  . LEU A 1 125 ? 127.742 120.201 33.113 1.00 22.08 ? 125  LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 125 ? 128.722 119.044 33.003 1.00 27.49 ? 125  LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 125 ? 129.384 118.772 34.370 1.00 14.39 ? 125  LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 125 ? 127.956 117.833 32.483 1.00 25.65 ? 125  LEU A CD2 1 
ATOM   953  N  N   . HIS A 1 126 ? 124.666 121.011 32.833 1.00 27.75 ? 126  HIS A N   1 
ATOM   954  C  CA  . HIS A 1 126 ? 123.546 121.835 33.224 1.00 28.81 ? 126  HIS A CA  1 
ATOM   955  C  C   . HIS A 1 126 ? 123.948 122.874 34.278 1.00 29.91 ? 126  HIS A C   1 
ATOM   956  O  O   . HIS A 1 126 ? 123.507 124.021 34.213 1.00 29.19 ? 126  HIS A O   1 
ATOM   957  C  CB  . HIS A 1 126 ? 122.431 120.933 33.760 1.00 29.36 ? 126  HIS A CB  1 
ATOM   958  C  CG  . HIS A 1 126 ? 121.171 121.664 34.096 1.00 36.95 ? 126  HIS A CG  1 
ATOM   959  N  ND1 . HIS A 1 126 ? 120.707 121.790 35.390 1.00 39.85 ? 126  HIS A ND1 1 
ATOM   960  C  CD2 . HIS A 1 126 ? 120.272 122.306 33.313 1.00 45.66 ? 126  HIS A CD2 1 
ATOM   961  C  CE1 . HIS A 1 126 ? 119.575 122.479 35.386 1.00 45.99 ? 126  HIS A CE1 1 
ATOM   962  N  NE2 . HIS A 1 126 ? 119.292 122.802 34.141 1.00 52.99 ? 126  HIS A NE2 1 
ATOM   963  N  N   . VAL A 1 127 ? 124.794 122.484 35.231 1.00 25.60 ? 127  VAL A N   1 
ATOM   964  C  CA  . VAL A 1 127 ? 125.237 123.385 36.278 1.00 27.84 ? 127  VAL A CA  1 
ATOM   965  C  C   . VAL A 1 127 ? 126.236 124.452 35.826 1.00 28.50 ? 127  VAL A C   1 
ATOM   966  O  O   . VAL A 1 127 ? 126.609 125.313 36.613 1.00 28.22 ? 127  VAL A O   1 
ATOM   967  C  CB  . VAL A 1 127 ? 125.831 122.609 37.453 1.00 29.21 ? 127  VAL A CB  1 
ATOM   968  C  CG1 . VAL A 1 127 ? 124.710 121.846 38.166 1.00 33.70 ? 127  VAL A CG1 1 
ATOM   969  C  CG2 . VAL A 1 127 ? 126.932 121.653 36.999 1.00 21.48 ? 127  VAL A CG2 1 
ATOM   970  N  N   . TYR A 1 128 ? 126.635 124.430 34.554 1.00 25.05 ? 128  TYR A N   1 
ATOM   971  C  CA  . TYR A 1 128 ? 127.574 125.434 34.033 1.00 20.41 ? 128  TYR A CA  1 
ATOM   972  C  C   . TYR A 1 128 ? 126.876 126.325 33.007 1.00 18.76 ? 128  TYR A C   1 
ATOM   973  O  O   . TYR A 1 128 ? 127.534 127.030 32.252 1.00 23.86 ? 128  TYR A O   1 
ATOM   974  C  CB  . TYR A 1 128 ? 128.786 124.785 33.349 1.00 12.58 ? 128  TYR A CB  1 
ATOM   975  C  CG  . TYR A 1 128 ? 129.553 123.769 34.178 1.00 18.63 ? 128  TYR A CG  1 
ATOM   976  C  CD1 . TYR A 1 128 ? 129.657 123.892 35.562 1.00 19.88 ? 128  TYR A CD1 1 
ATOM   977  C  CD2 . TYR A 1 128 ? 130.221 122.707 33.568 1.00 15.09 ? 128  TYR A CD2 1 
ATOM   978  C  CE1 . TYR A 1 128 ? 130.402 122.991 36.310 1.00 14.92 ? 128  TYR A CE1 1 
ATOM   979  C  CE2 . TYR A 1 128 ? 130.969 121.803 34.307 1.00 15.75 ? 128  TYR A CE2 1 
ATOM   980  C  CZ  . TYR A 1 128 ? 131.053 121.946 35.674 1.00 17.94 ? 128  TYR A CZ  1 
ATOM   981  O  OH  . TYR A 1 128 ? 131.750 121.017 36.403 1.00 16.17 ? 128  TYR A OH  1 
ATOM   982  N  N   . ASP A 1 129 ? 125.549 126.292 32.965 1.00 19.77 ? 129  ASP A N   1 
ATOM   983  C  CA  . ASP A 1 129 ? 124.803 127.107 32.004 1.00 22.05 ? 129  ASP A CA  1 
ATOM   984  C  C   . ASP A 1 129 ? 125.005 128.571 32.377 1.00 22.25 ? 129  ASP A C   1 
ATOM   985  O  O   . ASP A 1 129 ? 124.596 129.000 33.446 1.00 22.79 ? 129  ASP A O   1 
ATOM   986  C  CB  . ASP A 1 129 ? 123.323 126.766 32.084 1.00 30.41 ? 129  ASP A CB  1 
ATOM   987  C  CG  . ASP A 1 129 ? 122.557 127.225 30.878 1.00 33.78 ? 129  ASP A CG  1 
ATOM   988  O  OD1 . ASP A 1 129 ? 122.885 128.298 30.317 1.00 38.49 ? 129  ASP A OD1 1 
ATOM   989  O  OD2 . ASP A 1 129 ? 121.599 126.524 30.472 1.00 39.00 ? 129  ASP A OD2 1 
ATOM   990  N  N   . GLY A 1 130 ? 125.636 129.332 31.493 1.00 18.06 ? 130  GLY A N   1 
ATOM   991  C  CA  . GLY A 1 130 ? 125.892 130.730 31.773 1.00 20.38 ? 130  GLY A CA  1 
ATOM   992  C  C   . GLY A 1 130 ? 124.779 131.740 31.521 1.00 27.01 ? 130  GLY A C   1 
ATOM   993  O  O   . GLY A 1 130 ? 124.979 132.922 31.783 1.00 25.33 ? 130  GLY A O   1 
ATOM   994  N  N   . LYS A 1 131 ? 123.621 131.297 31.042 1.00 20.08 ? 131  LYS A N   1 
ATOM   995  C  CA  . LYS A 1 131 ? 122.535 132.207 30.718 1.00 26.91 ? 131  LYS A CA  1 
ATOM   996  C  C   . LYS A 1 131 ? 121.965 132.982 31.902 1.00 28.51 ? 131  LYS A C   1 
ATOM   997  O  O   . LYS A 1 131 ? 121.457 134.095 31.735 1.00 28.01 ? 131  LYS A O   1 
ATOM   998  C  CB  . LYS A 1 131 ? 121.422 131.440 30.031 1.00 25.54 ? 131  LYS A CB  1 
ATOM   999  C  CG  . LYS A 1 131 ? 120.393 130.777 30.934 1.00 28.32 ? 131  LYS A CG  1 
ATOM   1000 C  CD  . LYS A 1 131 ? 119.790 129.552 30.274 1.00 31.14 ? 131  LYS A CD  1 
ATOM   1001 C  CE  . LYS A 1 131 ? 118.483 129.155 30.935 1.00 34.49 ? 131  LYS A CE  1 
ATOM   1002 N  NZ  . LYS A 1 131 ? 117.938 127.910 30.312 1.00 37.66 ? 131  LYS A NZ  1 
ATOM   1003 N  N   . PHE A 1 132 ? 122.044 132.409 33.099 1.00 23.26 ? 132  PHE A N   1 
ATOM   1004 C  CA  . PHE A 1 132 ? 121.518 133.112 34.266 1.00 26.02 ? 132  PHE A CA  1 
ATOM   1005 C  C   . PHE A 1 132 ? 122.387 134.301 34.621 1.00 27.29 ? 132  PHE A C   1 
ATOM   1006 O  O   . PHE A 1 132 ? 121.860 135.364 34.937 1.00 30.80 ? 132  PHE A O   1 
ATOM   1007 C  CB  . PHE A 1 132 ? 121.395 132.167 35.466 1.00 31.43 ? 132  PHE A CB  1 
ATOM   1008 C  CG  . PHE A 1 132 ? 120.457 131.033 35.236 1.00 36.82 ? 132  PHE A CG  1 
ATOM   1009 C  CD1 . PHE A 1 132 ? 120.899 129.725 35.357 1.00 43.32 ? 132  PHE A CD1 1 
ATOM   1010 C  CD2 . PHE A 1 132 ? 119.137 131.270 34.864 1.00 37.65 ? 132  PHE A CD2 1 
ATOM   1011 C  CE1 . PHE A 1 132 ? 120.039 128.661 35.106 1.00 47.93 ? 132  PHE A CE1 1 
ATOM   1012 C  CE2 . PHE A 1 132 ? 118.268 130.216 34.611 1.00 41.08 ? 132  PHE A CE2 1 
ATOM   1013 C  CZ  . PHE A 1 132 ? 118.717 128.909 34.729 1.00 44.55 ? 132  PHE A CZ  1 
ATOM   1014 N  N   . LEU A 1 133 ? 123.707 134.125 34.560 1.00 24.25 ? 133  LEU A N   1 
ATOM   1015 C  CA  . LEU A 1 133 ? 124.632 135.209 34.869 1.00 26.85 ? 133  LEU A CA  1 
ATOM   1016 C  C   . LEU A 1 133 ? 124.536 136.305 33.819 1.00 27.66 ? 133  LEU A C   1 
ATOM   1017 O  O   . LEU A 1 133 ? 124.602 137.488 34.141 1.00 24.39 ? 133  LEU A O   1 
ATOM   1018 C  CB  . LEU A 1 133 ? 126.068 134.683 34.926 1.00 23.90 ? 133  LEU A CB  1 
ATOM   1019 C  CG  . LEU A 1 133 ? 126.399 133.805 36.133 1.00 30.31 ? 133  LEU A CG  1 
ATOM   1020 C  CD1 . LEU A 1 133 ? 127.633 132.992 35.847 1.00 27.81 ? 133  LEU A CD1 1 
ATOM   1021 C  CD2 . LEU A 1 133 ? 126.588 134.676 37.361 1.00 26.08 ? 133  LEU A CD2 1 
ATOM   1022 N  N   . ALA A 1 134 ? 124.389 135.906 32.560 1.00 26.17 ? 134  ALA A N   1 
ATOM   1023 C  CA  . ALA A 1 134 ? 124.292 136.864 31.468 1.00 32.60 ? 134  ALA A CA  1 
ATOM   1024 C  C   . ALA A 1 134 ? 123.036 137.708 31.657 1.00 31.45 ? 134  ALA A C   1 
ATOM   1025 O  O   . ALA A 1 134 ? 123.018 138.901 31.368 1.00 36.80 ? 134  ALA A O   1 
ATOM   1026 C  CB  . ALA A 1 134 ? 124.240 136.127 30.134 1.00 28.38 ? 134  ALA A CB  1 
ATOM   1027 N  N   . ARG A 1 135 ? 121.992 137.072 32.165 1.00 30.32 ? 135  ARG A N   1 
ATOM   1028 C  CA  . ARG A 1 135 ? 120.721 137.730 32.402 1.00 33.62 ? 135  ARG A CA  1 
ATOM   1029 C  C   . ARG A 1 135 ? 120.729 138.640 33.639 1.00 38.01 ? 135  ARG A C   1 
ATOM   1030 O  O   . ARG A 1 135 ? 120.480 139.842 33.543 1.00 41.40 ? 135  ARG A O   1 
ATOM   1031 C  CB  . ARG A 1 135 ? 119.633 136.661 32.552 1.00 33.78 ? 135  ARG A CB  1 
ATOM   1032 C  CG  . ARG A 1 135 ? 118.288 137.169 33.049 1.00 45.52 ? 135  ARG A CG  1 
ATOM   1033 C  CD  . ARG A 1 135 ? 117.598 138.018 32.010 1.00 54.09 ? 135  ARG A CD  1 
ATOM   1034 N  NE  . ARG A 1 135 ? 116.661 138.958 32.616 1.00 66.51 ? 135  ARG A NE  1 
ATOM   1035 C  CZ  . ARG A 1 135 ? 116.185 140.036 32.004 1.00 69.90 ? 135  ARG A CZ  1 
ATOM   1036 N  NH1 . ARG A 1 135 ? 115.360 140.849 32.649 1.00 76.32 ? 135  ARG A NH1 1 
ATOM   1037 N  NH2 . ARG A 1 135 ? 116.580 140.332 30.773 1.00 75.60 ? 135  ARG A NH2 1 
ATOM   1038 N  N   . VAL A 1 136 ? 121.032 138.058 34.795 1.00 34.58 ? 136  VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 136 ? 121.020 138.774 36.062 1.00 31.51 ? 136  VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 136 ? 122.087 139.835 36.312 1.00 35.74 ? 136  VAL A C   1 
ATOM   1041 O  O   . VAL A 1 136 ? 121.804 140.846 36.957 1.00 36.45 ? 136  VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 136 ? 121.056 137.772 37.231 1.00 32.80 ? 136  VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 136 ? 120.995 138.505 38.565 1.00 32.41 ? 136  VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 136 ? 119.897 136.804 37.102 1.00 31.85 ? 136  VAL A CG2 1 
ATOM   1045 N  N   . GLU A 1 137 ? 123.301 139.615 35.818 1.00 34.97 ? 137  GLU A N   1 
ATOM   1046 C  CA  . GLU A 1 137 ? 124.392 140.561 36.038 1.00 29.53 ? 137  GLU A CA  1 
ATOM   1047 C  C   . GLU A 1 137 ? 124.888 141.289 34.795 1.00 28.96 ? 137  GLU A C   1 
ATOM   1048 O  O   . GLU A 1 137 ? 125.788 142.124 34.877 1.00 30.16 ? 137  GLU A O   1 
ATOM   1049 C  CB  . GLU A 1 137 ? 125.556 139.837 36.718 1.00 22.68 ? 137  GLU A CB  1 
ATOM   1050 C  CG  . GLU A 1 137 ? 125.206 139.408 38.108 1.00 30.60 ? 137  GLU A CG  1 
ATOM   1051 C  CD  . GLU A 1 137 ? 124.921 140.592 39.037 1.00 42.44 ? 137  GLU A CD  1 
ATOM   1052 O  OE1 . GLU A 1 137 ? 124.192 140.384 40.017 1.00 34.66 ? 137  GLU A OE1 1 
ATOM   1053 O  OE2 . GLU A 1 137 ? 125.413 141.724 38.801 1.00 42.30 ? 137  GLU A OE2 1 
ATOM   1054 N  N   . ARG A 1 138 ? 124.291 140.981 33.651 1.00 25.84 ? 138  ARG A N   1 
ATOM   1055 C  CA  . ARG A 1 138 ? 124.679 141.598 32.385 1.00 28.27 ? 138  ARG A CA  1 
ATOM   1056 C  C   . ARG A 1 138 ? 126.154 141.412 32.053 1.00 28.93 ? 138  ARG A C   1 
ATOM   1057 O  O   . ARG A 1 138 ? 126.795 142.297 31.481 1.00 35.02 ? 138  ARG A O   1 
ATOM   1058 C  CB  . ARG A 1 138 ? 124.338 143.095 32.352 0.50 25.72 ? 138  ARG A CB  1 
ATOM   1059 C  CG  . ARG A 1 138 ? 122.876 143.396 32.051 0.50 39.91 ? 138  ARG A CG  1 
ATOM   1060 C  CD  . ARG A 1 138 ? 122.736 144.691 31.300 1.00 56.96 ? 138  ARG A CD  1 
ATOM   1061 N  NE  . ARG A 1 138 ? 122.179 144.499 29.964 1.00 68.78 ? 138  ARG A NE  1 
ATOM   1062 C  CZ  . ARG A 1 138 ? 122.704 144.984 28.843 1.00 71.30 ? 138  ARG A CZ  1 
ATOM   1063 N  NH1 . ARG A 1 138 ? 122.103 144.725 27.689 1.00 69.43 ? 138  ARG A NH1 1 
ATOM   1064 N  NH2 . ARG A 1 138 ? 123.846 145.672 28.860 1.00 67.23 ? 138  ARG A NH2 1 
ATOM   1065 N  N   . VAL A 1 139 ? 126.702 140.267 32.433 1.00 26.87 ? 139  VAL A N   1 
ATOM   1066 C  CA  . VAL A 1 139 ? 128.085 139.966 32.105 1.00 21.79 ? 139  VAL A CA  1 
ATOM   1067 C  C   . VAL A 1 139 ? 128.034 138.942 30.980 1.00 21.96 ? 139  VAL A C   1 
ATOM   1068 O  O   . VAL A 1 139 ? 127.022 138.268 30.781 1.00 25.81 ? 139  VAL A O   1 
ATOM   1069 C  CB  . VAL A 1 139 ? 128.869 139.351 33.304 1.00 22.05 ? 139  VAL A CB  1 
ATOM   1070 C  CG1 . VAL A 1 139 ? 129.132 140.411 34.365 1.00 19.64 ? 139  VAL A CG1 1 
ATOM   1071 C  CG2 . VAL A 1 139 ? 128.095 138.178 33.893 1.00 16.56 ? 139  VAL A CG2 1 
ATOM   1072 N  N   . ILE A 1 140 ? 129.121 138.843 30.231 1.00 26.50 ? 140  ILE A N   1 
ATOM   1073 C  CA  . ILE A 1 140 ? 129.205 137.875 29.155 1.00 19.51 ? 140  ILE A CA  1 
ATOM   1074 C  C   . ILE A 1 140 ? 129.867 136.639 29.752 1.00 27.15 ? 140  ILE A C   1 
ATOM   1075 O  O   . ILE A 1 140 ? 130.889 136.743 30.440 1.00 26.42 ? 140  ILE A O   1 
ATOM   1076 C  CB  . ILE A 1 140 ? 130.051 138.417 28.002 1.00 19.02 ? 140  ILE A CB  1 
ATOM   1077 C  CG1 . ILE A 1 140 ? 129.240 139.472 27.245 1.00 24.13 ? 140  ILE A CG1 1 
ATOM   1078 C  CG2 . ILE A 1 140 ? 130.483 137.284 27.082 1.00 22.06 ? 140  ILE A CG2 1 
ATOM   1079 C  CD1 . ILE A 1 140 ? 130.008 140.162 26.144 1.00 27.35 ? 140  ILE A CD1 1 
ATOM   1080 N  N   . VAL A 1 141 ? 129.279 135.473 29.511 1.00 20.86 ? 141  VAL A N   1 
ATOM   1081 C  CA  . VAL A 1 141 ? 129.834 134.246 30.050 1.00 21.27 ? 141  VAL A CA  1 
ATOM   1082 C  C   . VAL A 1 141 ? 130.392 133.363 28.941 1.00 23.54 ? 141  VAL A C   1 
ATOM   1083 O  O   . VAL A 1 141 ? 129.707 133.070 27.959 1.00 29.72 ? 141  VAL A O   1 
ATOM   1084 C  CB  . VAL A 1 141 ? 128.764 133.455 30.839 1.00 20.72 ? 141  VAL A CB  1 
ATOM   1085 C  CG1 . VAL A 1 141 ? 129.361 132.159 31.379 1.00 17.93 ? 141  VAL A CG1 1 
ATOM   1086 C  CG2 . VAL A 1 141 ? 128.217 134.313 31.975 1.00 18.77 ? 141  VAL A CG2 1 
ATOM   1087 N  N   . VAL A 1 142 ? 131.643 132.954 29.103 1.00 18.24 ? 142  VAL A N   1 
ATOM   1088 C  CA  . VAL A 1 142 ? 132.298 132.084 28.137 1.00 19.22 ? 142  VAL A CA  1 
ATOM   1089 C  C   . VAL A 1 142 ? 132.790 130.840 28.863 1.00 21.95 ? 142  VAL A C   1 
ATOM   1090 O  O   . VAL A 1 142 ? 133.198 130.911 30.023 1.00 20.63 ? 142  VAL A O   1 
ATOM   1091 C  CB  . VAL A 1 142 ? 133.508 132.777 27.471 1.00 19.87 ? 142  VAL A CB  1 
ATOM   1092 C  CG1 . VAL A 1 142 ? 134.248 131.793 26.556 1.00 15.17 ? 142  VAL A CG1 1 
ATOM   1093 C  CG2 . VAL A 1 142 ? 133.034 133.979 26.677 1.00 21.74 ? 142  VAL A CG2 1 
ATOM   1094 N  N   . SER A 1 143 ? 132.725 129.700 28.181 1.00 18.67 ? 143  SER A N   1 
ATOM   1095 C  CA  . SER A 1 143 ? 133.199 128.437 28.736 1.00 17.16 ? 143  SER A CA  1 
ATOM   1096 C  C   . SER A 1 143 ? 133.714 127.629 27.559 1.00 23.04 ? 143  SER A C   1 
ATOM   1097 O  O   . SER A 1 143 ? 133.230 127.791 26.439 1.00 22.76 ? 143  SER A O   1 
ATOM   1098 C  CB  . SER A 1 143 ? 132.072 127.685 29.439 1.00 17.10 ? 143  SER A CB  1 
ATOM   1099 O  OG  . SER A 1 143 ? 131.119 127.200 28.508 1.00 21.23 ? 143  SER A OG  1 
ATOM   1100 N  N   . MET A 1 144 ? 134.695 126.766 27.799 1.00 23.09 ? 144  MET A N   1 
ATOM   1101 C  CA  . MET A 1 144 ? 135.259 125.978 26.714 1.00 23.81 ? 144  MET A CA  1 
ATOM   1102 C  C   . MET A 1 144 ? 135.549 124.539 27.107 1.00 25.47 ? 144  MET A C   1 
ATOM   1103 O  O   . MET A 1 144 ? 135.622 124.203 28.290 1.00 23.69 ? 144  MET A O   1 
ATOM   1104 C  CB  . MET A 1 144 ? 136.560 126.626 26.213 1.00 23.83 ? 144  MET A CB  1 
ATOM   1105 C  CG  . MET A 1 144 ? 137.839 126.207 26.962 1.00 22.25 ? 144  MET A CG  1 
ATOM   1106 S  SD  . MET A 1 144 ? 137.912 126.626 28.725 1.00 27.61 ? 144  MET A SD  1 
ATOM   1107 C  CE  . MET A 1 144 ? 138.561 128.326 28.638 1.00 22.40 ? 144  MET A CE  1 
ATOM   1108 N  N   . ASN A 1 145 ? 135.701 123.689 26.098 1.00 21.49 ? 145  ASN A N   1 
ATOM   1109 C  CA  . ASN A 1 145 ? 136.045 122.294 26.325 1.00 22.95 ? 145  ASN A CA  1 
ATOM   1110 C  C   . ASN A 1 145 ? 137.541 122.212 26.064 1.00 21.26 ? 145  ASN A C   1 
ATOM   1111 O  O   . ASN A 1 145 ? 138.045 122.843 25.138 1.00 21.62 ? 145  ASN A O   1 
ATOM   1112 C  CB  . ASN A 1 145 ? 135.325 121.369 25.336 1.00 24.55 ? 145  ASN A CB  1 
ATOM   1113 C  CG  . ASN A 1 145 ? 133.845 121.239 25.612 1.00 23.46 ? 145  ASN A CG  1 
ATOM   1114 O  OD1 . ASN A 1 145 ? 133.099 120.734 24.777 1.00 29.26 ? 145  ASN A OD1 1 
ATOM   1115 N  ND2 . ASN A 1 145 ? 133.413 121.676 26.787 1.00 20.29 ? 145  ASN A ND2 1 
ATOM   1116 N  N   . TYR A 1 146 ? 138.256 121.459 26.889 1.00 18.16 ? 146  TYR A N   1 
ATOM   1117 C  CA  . TYR A 1 146 ? 139.681 121.293 26.677 1.00 14.48 ? 146  TYR A CA  1 
ATOM   1118 C  C   . TYR A 1 146 ? 139.977 119.812 26.845 1.00 15.76 ? 146  TYR A C   1 
ATOM   1119 O  O   . TYR A 1 146 ? 139.319 119.133 27.625 1.00 14.34 ? 146  TYR A O   1 
ATOM   1120 C  CB  . TYR A 1 146 ? 140.479 122.152 27.670 1.00 15.37 ? 146  TYR A CB  1 
ATOM   1121 C  CG  . TYR A 1 146 ? 140.217 121.840 29.124 1.00 13.94 ? 146  TYR A CG  1 
ATOM   1122 C  CD1 . TYR A 1 146 ? 141.001 120.915 29.815 1.00 6.73  ? 146  TYR A CD1 1 
ATOM   1123 C  CD2 . TYR A 1 146 ? 139.181 122.471 29.815 1.00 16.30 ? 146  TYR A CD2 1 
ATOM   1124 C  CE1 . TYR A 1 146 ? 140.759 120.631 31.164 1.00 13.33 ? 146  TYR A CE1 1 
ATOM   1125 C  CE2 . TYR A 1 146 ? 138.930 122.192 31.163 1.00 9.63  ? 146  TYR A CE2 1 
ATOM   1126 C  CZ  . TYR A 1 146 ? 139.723 121.274 31.828 1.00 10.48 ? 146  TYR A CZ  1 
ATOM   1127 O  OH  . TYR A 1 146 ? 139.485 121.004 33.156 1.00 16.80 ? 146  TYR A OH  1 
ATOM   1128 N  N   . ARG A 1 147 ? 140.950 119.307 26.097 1.00 19.08 ? 147  ARG A N   1 
ATOM   1129 C  CA  . ARG A 1 147 ? 141.306 117.896 26.175 1.00 23.76 ? 147  ARG A CA  1 
ATOM   1130 C  C   . ARG A 1 147 ? 141.680 117.473 27.587 1.00 25.73 ? 147  ARG A C   1 
ATOM   1131 O  O   . ARG A 1 147 ? 142.375 118.195 28.299 1.00 29.89 ? 147  ARG A O   1 
ATOM   1132 C  CB  . ARG A 1 147 ? 142.461 117.591 25.223 1.00 24.18 ? 147  ARG A CB  1 
ATOM   1133 C  CG  . ARG A 1 147 ? 142.045 117.523 23.774 1.00 24.53 ? 147  ARG A CG  1 
ATOM   1134 C  CD  . ARG A 1 147 ? 143.250 117.409 22.871 1.00 26.28 ? 147  ARG A CD  1 
ATOM   1135 N  NE  . ARG A 1 147 ? 143.958 118.679 22.763 1.00 27.53 ? 147  ARG A NE  1 
ATOM   1136 C  CZ  . ARG A 1 147 ? 145.105 118.841 22.110 1.00 37.53 ? 147  ARG A CZ  1 
ATOM   1137 N  NH1 . ARG A 1 147 ? 145.676 117.806 21.504 1.00 33.64 ? 147  ARG A NH1 1 
ATOM   1138 N  NH2 . ARG A 1 147 ? 145.685 120.035 22.065 1.00 31.74 ? 147  ARG A NH2 1 
ATOM   1139 N  N   . VAL A 1 148 ? 141.207 116.296 27.982 1.00 19.97 ? 148  VAL A N   1 
ATOM   1140 C  CA  . VAL A 1 148 ? 141.481 115.756 29.303 1.00 20.33 ? 148  VAL A CA  1 
ATOM   1141 C  C   . VAL A 1 148 ? 142.095 114.350 29.216 1.00 22.91 ? 148  VAL A C   1 
ATOM   1142 O  O   . VAL A 1 148 ? 142.123 113.737 28.153 1.00 25.44 ? 148  VAL A O   1 
ATOM   1143 C  CB  . VAL A 1 148 ? 140.194 115.724 30.140 1.00 21.07 ? 148  VAL A CB  1 
ATOM   1144 C  CG1 . VAL A 1 148 ? 139.701 117.153 30.372 1.00 13.45 ? 148  VAL A CG1 1 
ATOM   1145 C  CG2 . VAL A 1 148 ? 139.120 114.902 29.424 1.00 11.93 ? 148  VAL A CG2 1 
ATOM   1146 N  N   . GLY A 1 149 ? 142.596 113.847 30.336 1.00 21.98 ? 149  GLY A N   1 
ATOM   1147 C  CA  . GLY A 1 149 ? 143.207 112.534 30.333 1.00 19.66 ? 149  GLY A CA  1 
ATOM   1148 C  C   . GLY A 1 149 ? 144.481 112.517 29.512 1.00 24.81 ? 149  GLY A C   1 
ATOM   1149 O  O   . GLY A 1 149 ? 145.098 113.556 29.289 1.00 27.55 ? 149  GLY A O   1 
ATOM   1150 N  N   . ALA A 1 150 ? 144.876 111.333 29.055 1.00 26.77 ? 150  ALA A N   1 
ATOM   1151 C  CA  . ALA A 1 150 ? 146.091 111.179 28.269 1.00 22.17 ? 150  ALA A CA  1 
ATOM   1152 C  C   . ALA A 1 150 ? 146.050 112.010 27.002 1.00 23.19 ? 150  ALA A C   1 
ATOM   1153 O  O   . ALA A 1 150 ? 147.072 112.551 26.578 1.00 27.41 ? 150  ALA A O   1 
ATOM   1154 C  CB  . ALA A 1 150 ? 146.308 109.719 27.925 1.00 27.81 ? 150  ALA A CB  1 
ATOM   1155 N  N   . LEU A 1 151 ? 144.875 112.121 26.396 1.00 16.91 ? 151  LEU A N   1 
ATOM   1156 C  CA  . LEU A 1 151 ? 144.751 112.906 25.177 1.00 23.64 ? 151  LEU A CA  1 
ATOM   1157 C  C   . LEU A 1 151 ? 145.104 114.373 25.384 1.00 25.60 ? 151  LEU A C   1 
ATOM   1158 O  O   . LEU A 1 151 ? 145.457 115.064 24.434 1.00 29.90 ? 151  LEU A O   1 
ATOM   1159 C  CB  . LEU A 1 151 ? 143.332 112.794 24.605 1.00 25.84 ? 151  LEU A CB  1 
ATOM   1160 C  CG  . LEU A 1 151 ? 143.001 111.479 23.884 1.00 29.09 ? 151  LEU A CG  1 
ATOM   1161 C  CD1 . LEU A 1 151 ? 141.531 111.464 23.509 1.00 26.29 ? 151  LEU A CD1 1 
ATOM   1162 C  CD2 . LEU A 1 151 ? 143.875 111.325 22.636 1.00 24.09 ? 151  LEU A CD2 1 
ATOM   1163 N  N   . GLY A 1 152 ? 145.021 114.846 26.622 1.00 25.79 ? 152  GLY A N   1 
ATOM   1164 C  CA  . GLY A 1 152 ? 145.321 116.241 26.883 1.00 24.91 ? 152  GLY A CA  1 
ATOM   1165 C  C   . GLY A 1 152 ? 146.545 116.513 27.738 1.00 25.15 ? 152  GLY A C   1 
ATOM   1166 O  O   . GLY A 1 152 ? 147.035 117.642 27.772 1.00 24.10 ? 152  GLY A O   1 
ATOM   1167 N  N   . PHE A 1 153 ? 147.057 115.493 28.418 1.00 22.33 ? 153  PHE A N   1 
ATOM   1168 C  CA  . PHE A 1 153 ? 148.206 115.699 29.282 1.00 21.04 ? 153  PHE A CA  1 
ATOM   1169 C  C   . PHE A 1 153 ? 149.334 114.682 29.179 1.00 29.83 ? 153  PHE A C   1 
ATOM   1170 O  O   . PHE A 1 153 ? 150.269 114.715 29.987 1.00 26.57 ? 153  PHE A O   1 
ATOM   1171 C  CB  . PHE A 1 153 ? 147.715 115.823 30.723 1.00 17.71 ? 153  PHE A CB  1 
ATOM   1172 C  CG  . PHE A 1 153 ? 146.808 117.000 30.933 1.00 19.56 ? 153  PHE A CG  1 
ATOM   1173 C  CD1 . PHE A 1 153 ? 147.333 118.260 31.218 1.00 18.64 ? 153  PHE A CD1 1 
ATOM   1174 C  CD2 . PHE A 1 153 ? 145.428 116.868 30.768 1.00 18.98 ? 153  PHE A CD2 1 
ATOM   1175 C  CE1 . PHE A 1 153 ? 146.500 119.375 31.330 1.00 24.96 ? 153  PHE A CE1 1 
ATOM   1176 C  CE2 . PHE A 1 153 ? 144.587 117.971 30.874 1.00 13.93 ? 153  PHE A CE2 1 
ATOM   1177 C  CZ  . PHE A 1 153 ? 145.119 119.227 31.156 1.00 16.19 ? 153  PHE A CZ  1 
ATOM   1178 N  N   . LEU A 1 154 ? 149.258 113.785 28.193 1.00 31.00 ? 154  LEU A N   1 
ATOM   1179 C  CA  . LEU A 1 154 ? 150.321 112.797 27.993 1.00 31.68 ? 154  LEU A CA  1 
ATOM   1180 C  C   . LEU A 1 154 ? 151.617 113.608 27.941 1.00 32.73 ? 154  LEU A C   1 
ATOM   1181 O  O   . LEU A 1 154 ? 151.736 114.539 27.147 1.00 27.68 ? 154  LEU A O   1 
ATOM   1182 C  CB  . LEU A 1 154 ? 150.126 112.055 26.668 1.00 35.50 ? 154  LEU A CB  1 
ATOM   1183 C  CG  . LEU A 1 154 ? 151.155 110.976 26.307 1.00 36.17 ? 154  LEU A CG  1 
ATOM   1184 C  CD1 . LEU A 1 154 ? 150.968 109.776 27.209 1.00 33.62 ? 154  LEU A CD1 1 
ATOM   1185 C  CD2 . LEU A 1 154 ? 150.983 110.561 24.857 1.00 38.77 ? 154  LEU A CD2 1 
ATOM   1186 N  N   . ALA A 1 155 ? 152.586 113.264 28.781 1.00 32.31 ? 155  ALA A N   1 
ATOM   1187 C  CA  . ALA A 1 155 ? 153.826 114.025 28.811 1.00 37.88 ? 155  ALA A CA  1 
ATOM   1188 C  C   . ALA A 1 155 ? 155.083 113.286 28.386 1.00 41.56 ? 155  ALA A C   1 
ATOM   1189 O  O   . ALA A 1 155 ? 155.357 112.168 28.827 1.00 37.98 ? 155  ALA A O   1 
ATOM   1190 C  CB  . ALA A 1 155 ? 154.034 114.629 30.210 1.00 33.93 ? 155  ALA A CB  1 
ATOM   1191 N  N   . LEU A 1 156 ? 155.839 113.956 27.525 1.00 41.64 ? 156  LEU A N   1 
ATOM   1192 C  CA  . LEU A 1 156 ? 157.110 113.483 26.999 1.00 48.47 ? 156  LEU A CA  1 
ATOM   1193 C  C   . LEU A 1 156 ? 157.836 114.821 26.837 1.00 52.39 ? 156  LEU A C   1 
ATOM   1194 O  O   . LEU A 1 156 ? 158.014 115.319 25.724 1.00 54.20 ? 156  LEU A O   1 
ATOM   1195 C  CB  . LEU A 1 156 ? 156.904 112.802 25.644 1.00 49.59 ? 156  LEU A CB  1 
ATOM   1196 C  CG  . LEU A 1 156 ? 157.792 111.596 25.318 1.00 53.29 ? 156  LEU A CG  1 
ATOM   1197 C  CD1 . LEU A 1 156 ? 157.570 110.493 26.341 1.00 46.97 ? 156  LEU A CD1 1 
ATOM   1198 C  CD2 . LEU A 1 156 ? 157.466 111.087 23.926 1.00 51.74 ? 156  LEU A CD2 1 
ATOM   1199 N  N   . PRO A 1 157 ? 158.248 115.427 27.966 1.00 53.62 ? 157  PRO A N   1 
ATOM   1200 C  CA  . PRO A 1 157 ? 158.947 116.715 28.039 1.00 54.32 ? 157  PRO A CA  1 
ATOM   1201 C  C   . PRO A 1 157 ? 159.993 116.987 26.967 1.00 54.88 ? 157  PRO A C   1 
ATOM   1202 O  O   . PRO A 1 157 ? 160.921 116.202 26.768 1.00 56.18 ? 157  PRO A O   1 
ATOM   1203 C  CB  . PRO A 1 157 ? 159.533 116.712 29.452 1.00 54.40 ? 157  PRO A CB  1 
ATOM   1204 C  CG  . PRO A 1 157 ? 159.663 115.254 29.775 1.00 51.06 ? 157  PRO A CG  1 
ATOM   1205 C  CD  . PRO A 1 157 ? 158.372 114.711 29.247 1.00 54.89 ? 157  PRO A CD  1 
ATOM   1206 N  N   . GLY A 1 158 ? 159.824 118.115 26.282 1.00 51.98 ? 158  GLY A N   1 
ATOM   1207 C  CA  . GLY A 1 158 ? 160.744 118.506 25.232 1.00 53.93 ? 158  GLY A CA  1 
ATOM   1208 C  C   . GLY A 1 158 ? 160.364 117.981 23.862 1.00 56.23 ? 158  GLY A C   1 
ATOM   1209 O  O   . GLY A 1 158 ? 160.895 118.438 22.849 1.00 58.75 ? 158  GLY A O   1 
ATOM   1210 N  N   . ASN A 1 159 ? 159.436 117.029 23.827 1.00 54.99 ? 159  ASN A N   1 
ATOM   1211 C  CA  . ASN A 1 159 ? 158.998 116.423 22.573 1.00 49.19 ? 159  ASN A CA  1 
ATOM   1212 C  C   . ASN A 1 159 ? 157.687 117.024 22.066 1.00 50.39 ? 159  ASN A C   1 
ATOM   1213 O  O   . ASN A 1 159 ? 156.626 116.783 22.640 1.00 51.97 ? 159  ASN A O   1 
ATOM   1214 C  CB  . ASN A 1 159 ? 158.818 114.921 22.768 1.00 49.90 ? 159  ASN A CB  1 
ATOM   1215 C  CG  . ASN A 1 159 ? 158.871 114.160 21.466 1.00 53.95 ? 159  ASN A CG  1 
ATOM   1216 O  OD1 . ASN A 1 159 ? 158.398 114.638 20.436 1.00 49.23 ? 159  ASN A OD1 1 
ATOM   1217 N  ND2 . ASN A 1 159 ? 159.441 112.960 21.505 1.00 61.04 ? 159  ASN A ND2 1 
ATOM   1218 N  N   . PRO A 1 160 ? 157.743 117.802 20.970 1.00 47.62 ? 160  PRO A N   1 
ATOM   1219 C  CA  . PRO A 1 160 ? 156.569 118.449 20.372 1.00 45.22 ? 160  PRO A CA  1 
ATOM   1220 C  C   . PRO A 1 160 ? 155.445 117.497 19.972 1.00 46.80 ? 160  PRO A C   1 
ATOM   1221 O  O   . PRO A 1 160 ? 154.341 117.933 19.653 1.00 49.49 ? 160  PRO A O   1 
ATOM   1222 C  CB  . PRO A 1 160 ? 157.153 119.175 19.164 1.00 41.77 ? 160  PRO A CB  1 
ATOM   1223 C  CG  . PRO A 1 160 ? 158.542 119.487 19.603 1.00 46.34 ? 160  PRO A CG  1 
ATOM   1224 C  CD  . PRO A 1 160 ? 158.967 118.198 20.254 1.00 42.48 ? 160  PRO A CD  1 
ATOM   1225 N  N   . GLU A 1 161 ? 155.729 116.199 19.985 1.00 50.35 ? 161  GLU A N   1 
ATOM   1226 C  CA  . GLU A 1 161 ? 154.730 115.200 19.619 1.00 50.84 ? 161  GLU A CA  1 
ATOM   1227 C  C   . GLU A 1 161 ? 153.786 114.910 20.784 1.00 47.99 ? 161  GLU A C   1 
ATOM   1228 O  O   . GLU A 1 161 ? 152.629 114.537 20.584 1.00 41.40 ? 161  GLU A O   1 
ATOM   1229 C  CB  . GLU A 1 161 ? 155.424 113.911 19.164 1.00 51.44 ? 161  GLU A CB  1 
ATOM   1230 C  CG  . GLU A 1 161 ? 156.393 114.124 18.013 1.00 58.37 ? 161  GLU A CG  1 
ATOM   1231 C  CD  . GLU A 1 161 ? 155.748 114.827 16.827 1.00 68.17 ? 161  GLU A CD  1 
ATOM   1232 O  OE1 . GLU A 1 161 ? 156.480 115.211 15.889 1.00 75.27 ? 161  GLU A OE1 1 
ATOM   1233 O  OE2 . GLU A 1 161 ? 154.509 114.996 16.826 1.00 70.89 ? 161  GLU A OE2 1 
ATOM   1234 N  N   . ALA A 1 162 ? 154.295 115.090 21.998 1.00 43.76 ? 162  ALA A N   1 
ATOM   1235 C  CA  . ALA A 1 162 ? 153.532 114.874 23.227 1.00 42.67 ? 162  ALA A CA  1 
ATOM   1236 C  C   . ALA A 1 162 ? 154.296 115.616 24.321 1.00 36.87 ? 162  ALA A C   1 
ATOM   1237 O  O   . ALA A 1 162 ? 154.903 115.003 25.199 1.00 39.28 ? 162  ALA A O   1 
ATOM   1238 C  CB  . ALA A 1 162 ? 153.457 113.381 23.545 1.00 39.72 ? 162  ALA A CB  1 
ATOM   1239 N  N   . PRO A 1 163 ? 154.264 116.956 24.278 1.00 30.86 ? 163  PRO A N   1 
ATOM   1240 C  CA  . PRO A 1 163 ? 154.948 117.835 25.228 1.00 30.19 ? 163  PRO A CA  1 
ATOM   1241 C  C   . PRO A 1 163 ? 154.340 117.947 26.618 1.00 31.39 ? 163  PRO A C   1 
ATOM   1242 O  O   . PRO A 1 163 ? 155.037 118.281 27.577 1.00 35.89 ? 163  PRO A O   1 
ATOM   1243 C  CB  . PRO A 1 163 ? 154.951 119.169 24.496 1.00 23.99 ? 163  PRO A CB  1 
ATOM   1244 C  CG  . PRO A 1 163 ? 153.610 119.169 23.860 1.00 29.84 ? 163  PRO A CG  1 
ATOM   1245 C  CD  . PRO A 1 163 ? 153.500 117.752 23.299 1.00 31.45 ? 163  PRO A CD  1 
ATOM   1246 N  N   . GLY A 1 164 ? 153.048 117.665 26.725 1.00 28.44 ? 164  GLY A N   1 
ATOM   1247 C  CA  . GLY A 1 164 ? 152.376 117.766 28.005 1.00 20.56 ? 164  GLY A CA  1 
ATOM   1248 C  C   . GLY A 1 164 ? 151.597 119.070 28.075 1.00 21.02 ? 164  GLY A C   1 
ATOM   1249 O  O   . GLY A 1 164 ? 151.859 119.992 27.307 1.00 20.23 ? 164  GLY A O   1 
ATOM   1250 N  N   . ASN A 1 165 ? 150.625 119.140 28.978 1.00 17.02 ? 165  ASN A N   1 
ATOM   1251 C  CA  . ASN A 1 165 ? 149.818 120.344 29.159 1.00 15.29 ? 165  ASN A CA  1 
ATOM   1252 C  C   . ASN A 1 165 ? 149.020 120.776 27.928 1.00 18.40 ? 165  ASN A C   1 
ATOM   1253 O  O   . ASN A 1 165 ? 148.635 121.938 27.817 1.00 21.34 ? 165  ASN A O   1 
ATOM   1254 C  CB  . ASN A 1 165 ? 150.709 121.511 29.598 1.00 10.79 ? 165  ASN A CB  1 
ATOM   1255 C  CG  . ASN A 1 165 ? 151.483 121.216 30.862 1.00 20.08 ? 165  ASN A CG  1 
ATOM   1256 O  OD1 . ASN A 1 165 ? 151.068 120.406 31.696 1.00 19.26 ? 165  ASN A OD1 1 
ATOM   1257 N  ND2 . ASN A 1 165 ? 152.611 121.894 31.024 1.00 22.94 ? 165  ASN A ND2 1 
ATOM   1258 N  N   . MET A 1 166 ? 148.773 119.861 26.999 1.00 20.39 ? 166  MET A N   1 
ATOM   1259 C  CA  . MET A 1 166 ? 148.018 120.220 25.804 1.00 21.05 ? 166  MET A CA  1 
ATOM   1260 C  C   . MET A 1 166 ? 146.659 120.822 26.191 1.00 19.94 ? 166  MET A C   1 
ATOM   1261 O  O   . MET A 1 166 ? 146.204 121.799 25.592 1.00 21.05 ? 166  MET A O   1 
ATOM   1262 C  CB  . MET A 1 166 ? 147.814 118.989 24.910 1.00 24.09 ? 166  MET A CB  1 
ATOM   1263 C  CG  . MET A 1 166 ? 149.109 118.370 24.349 1.00 24.41 ? 166  MET A CG  1 
ATOM   1264 S  SD  . MET A 1 166 ? 150.102 117.368 25.515 1.00 29.25 ? 166  MET A SD  1 
ATOM   1265 C  CE  . MET A 1 166 ? 149.332 115.747 25.341 1.00 20.10 ? 166  MET A CE  1 
ATOM   1266 N  N   . GLY A 1 167 ? 146.015 120.238 27.197 1.00 19.95 ? 167  GLY A N   1 
ATOM   1267 C  CA  . GLY A 1 167 ? 144.725 120.743 27.646 1.00 19.99 ? 167  GLY A CA  1 
ATOM   1268 C  C   . GLY A 1 167 ? 144.823 122.181 28.136 1.00 22.37 ? 167  GLY A C   1 
ATOM   1269 O  O   . GLY A 1 167 ? 143.932 122.993 27.893 1.00 24.63 ? 167  GLY A O   1 
ATOM   1270 N  N   . LEU A 1 168 ? 145.906 122.495 28.842 1.00 17.61 ? 168  LEU A N   1 
ATOM   1271 C  CA  . LEU A 1 168 ? 146.113 123.848 29.327 1.00 20.09 ? 168  LEU A CA  1 
ATOM   1272 C  C   . LEU A 1 168 ? 146.286 124.777 28.129 1.00 23.24 ? 168  LEU A C   1 
ATOM   1273 O  O   . LEU A 1 168 ? 145.798 125.906 28.141 1.00 22.25 ? 168  LEU A O   1 
ATOM   1274 C  CB  . LEU A 1 168 ? 147.333 123.904 30.245 1.00 19.53 ? 168  LEU A CB  1 
ATOM   1275 C  CG  . LEU A 1 168 ? 147.094 123.201 31.581 1.00 13.27 ? 168  LEU A CG  1 
ATOM   1276 C  CD1 . LEU A 1 168 ? 148.368 123.172 32.391 1.00 10.84 ? 168  LEU A CD1 1 
ATOM   1277 C  CD2 . LEU A 1 168 ? 145.992 123.922 32.335 1.00 18.10 ? 168  LEU A CD2 1 
ATOM   1278 N  N   . PHE A 1 169 ? 146.970 124.304 27.087 1.00 18.32 ? 169  PHE A N   1 
ATOM   1279 C  CA  . PHE A 1 169 ? 147.135 125.126 25.900 1.00 21.16 ? 169  PHE A CA  1 
ATOM   1280 C  C   . PHE A 1 169 ? 145.796 125.302 25.180 1.00 25.12 ? 169  PHE A C   1 
ATOM   1281 O  O   . PHE A 1 169 ? 145.572 126.321 24.523 1.00 25.45 ? 169  PHE A O   1 
ATOM   1282 C  CB  . PHE A 1 169 ? 148.179 124.531 24.958 1.00 18.49 ? 169  PHE A CB  1 
ATOM   1283 C  CG  . PHE A 1 169 ? 149.585 124.906 25.313 1.00 21.61 ? 169  PHE A CG  1 
ATOM   1284 C  CD1 . PHE A 1 169 ? 150.473 123.960 25.807 1.00 18.37 ? 169  PHE A CD1 1 
ATOM   1285 C  CD2 . PHE A 1 169 ? 150.017 126.225 25.174 1.00 26.25 ? 169  PHE A CD2 1 
ATOM   1286 C  CE1 . PHE A 1 169 ? 151.777 124.321 26.163 1.00 29.34 ? 169  PHE A CE1 1 
ATOM   1287 C  CE2 . PHE A 1 169 ? 151.318 126.598 25.525 1.00 28.20 ? 169  PHE A CE2 1 
ATOM   1288 C  CZ  . PHE A 1 169 ? 152.199 125.641 26.021 1.00 28.26 ? 169  PHE A CZ  1 
ATOM   1289 N  N   . ASP A 1 170 ? 144.898 124.325 25.301 1.00 21.70 ? 170  ASP A N   1 
ATOM   1290 C  CA  . ASP A 1 170 ? 143.597 124.481 24.653 1.00 24.32 ? 170  ASP A CA  1 
ATOM   1291 C  C   . ASP A 1 170 ? 142.895 125.641 25.361 1.00 20.77 ? 170  ASP A C   1 
ATOM   1292 O  O   . ASP A 1 170 ? 142.342 126.529 24.714 1.00 20.50 ? 170  ASP A O   1 
ATOM   1293 C  CB  . ASP A 1 170 ? 142.722 123.220 24.766 1.00 16.75 ? 170  ASP A CB  1 
ATOM   1294 C  CG  . ASP A 1 170 ? 143.328 122.003 24.071 1.00 27.59 ? 170  ASP A CG  1 
ATOM   1295 O  OD1 . ASP A 1 170 ? 144.128 122.173 23.128 1.00 25.54 ? 170  ASP A OD1 1 
ATOM   1296 O  OD2 . ASP A 1 170 ? 142.982 120.870 24.463 1.00 20.53 ? 170  ASP A OD2 1 
ATOM   1297 N  N   . GLN A 1 171 ? 142.925 125.628 26.692 1.00 18.50 ? 171  GLN A N   1 
ATOM   1298 C  CA  . GLN A 1 171 ? 142.297 126.691 27.475 1.00 20.12 ? 171  GLN A CA  1 
ATOM   1299 C  C   . GLN A 1 171 ? 142.901 128.039 27.085 1.00 19.72 ? 171  GLN A C   1 
ATOM   1300 O  O   . GLN A 1 171 ? 142.188 129.025 26.881 1.00 18.72 ? 171  GLN A O   1 
ATOM   1301 C  CB  . GLN A 1 171 ? 142.515 126.463 28.973 1.00 15.20 ? 171  GLN A CB  1 
ATOM   1302 C  CG  . GLN A 1 171 ? 141.914 125.177 29.515 1.00 23.26 ? 171  GLN A CG  1 
ATOM   1303 C  CD  . GLN A 1 171 ? 142.311 124.904 30.957 1.00 23.06 ? 171  GLN A CD  1 
ATOM   1304 O  OE1 . GLN A 1 171 ? 142.026 123.832 31.504 1.00 25.59 ? 171  GLN A OE1 1 
ATOM   1305 N  NE2 . GLN A 1 171 ? 142.968 125.875 31.582 1.00 11.27 ? 171  GLN A NE2 1 
ATOM   1306 N  N   . GLN A 1 172 ? 144.223 128.076 26.975 1.00 15.54 ? 172  GLN A N   1 
ATOM   1307 C  CA  . GLN A 1 172 ? 144.901 129.314 26.621 1.00 24.93 ? 172  GLN A CA  1 
ATOM   1308 C  C   . GLN A 1 172 ? 144.511 129.817 25.242 1.00 23.78 ? 172  GLN A C   1 
ATOM   1309 O  O   . GLN A 1 172 ? 144.346 131.016 25.039 1.00 27.68 ? 172  GLN A O   1 
ATOM   1310 C  CB  . GLN A 1 172 ? 146.410 129.130 26.683 1.00 22.57 ? 172  GLN A CB  1 
ATOM   1311 C  CG  . GLN A 1 172 ? 147.188 130.376 26.335 1.00 22.46 ? 172  GLN A CG  1 
ATOM   1312 C  CD  . GLN A 1 172 ? 148.659 130.172 26.565 1.00 29.22 ? 172  GLN A CD  1 
ATOM   1313 O  OE1 . GLN A 1 172 ? 149.131 130.205 27.703 1.00 31.45 ? 172  GLN A OE1 1 
ATOM   1314 N  NE2 . GLN A 1 172 ? 149.396 129.924 25.489 1.00 34.90 ? 172  GLN A NE2 1 
ATOM   1315 N  N   . LEU A 1 173 ? 144.372 128.897 24.294 1.00 24.82 ? 173  LEU A N   1 
ATOM   1316 C  CA  . LEU A 1 173 ? 143.989 129.273 22.945 1.00 20.46 ? 173  LEU A CA  1 
ATOM   1317 C  C   . LEU A 1 173 ? 142.563 129.815 22.989 1.00 19.56 ? 173  LEU A C   1 
ATOM   1318 O  O   . LEU A 1 173 ? 142.212 130.734 22.241 1.00 25.45 ? 173  LEU A O   1 
ATOM   1319 C  CB  . LEU A 1 173 ? 144.079 128.067 22.005 1.00 28.74 ? 173  LEU A CB  1 
ATOM   1320 C  CG  . LEU A 1 173 ? 143.947 128.396 20.513 1.00 31.30 ? 173  LEU A CG  1 
ATOM   1321 C  CD1 . LEU A 1 173 ? 145.019 129.411 20.113 1.00 37.32 ? 173  LEU A CD1 1 
ATOM   1322 C  CD2 . LEU A 1 173 ? 144.092 127.131 19.692 1.00 36.46 ? 173  LEU A CD2 1 
ATOM   1323 N  N   . ALA A 1 174 ? 141.745 129.254 23.874 1.00 12.01 ? 174  ALA A N   1 
ATOM   1324 C  CA  . ALA A 1 174 ? 140.372 129.727 24.015 1.00 17.45 ? 174  ALA A CA  1 
ATOM   1325 C  C   . ALA A 1 174 ? 140.372 131.138 24.601 1.00 20.63 ? 174  ALA A C   1 
ATOM   1326 O  O   . ALA A 1 174 ? 139.567 131.981 24.201 1.00 27.78 ? 174  ALA A O   1 
ATOM   1327 C  CB  . ALA A 1 174 ? 139.568 128.788 24.903 1.00 22.20 ? 174  ALA A CB  1 
ATOM   1328 N  N   . LEU A 1 175 ? 141.271 131.401 25.545 1.00 22.89 ? 175  LEU A N   1 
ATOM   1329 C  CA  . LEU A 1 175 ? 141.352 132.734 26.141 1.00 27.19 ? 175  LEU A CA  1 
ATOM   1330 C  C   . LEU A 1 175 ? 141.799 133.739 25.072 1.00 23.86 ? 175  LEU A C   1 
ATOM   1331 O  O   . LEU A 1 175 ? 141.376 134.892 25.075 1.00 24.50 ? 175  LEU A O   1 
ATOM   1332 C  CB  . LEU A 1 175 ? 142.344 132.747 27.309 1.00 27.30 ? 175  LEU A CB  1 
ATOM   1333 C  CG  . LEU A 1 175 ? 142.157 131.708 28.418 1.00 32.45 ? 175  LEU A CG  1 
ATOM   1334 C  CD1 . LEU A 1 175 ? 143.189 131.945 29.509 1.00 32.61 ? 175  LEU A CD1 1 
ATOM   1335 C  CD2 . LEU A 1 175 ? 140.757 131.794 28.988 1.00 30.48 ? 175  LEU A CD2 1 
ATOM   1336 N  N   . GLN A 1 176 ? 142.651 133.293 24.157 1.00 21.17 ? 176  GLN A N   1 
ATOM   1337 C  CA  . GLN A 1 176 ? 143.140 134.159 23.098 1.00 24.82 ? 176  GLN A CA  1 
ATOM   1338 C  C   . GLN A 1 176 ? 141.987 134.491 22.166 1.00 28.73 ? 176  GLN A C   1 
ATOM   1339 O  O   . GLN A 1 176 ? 141.879 135.611 21.658 1.00 27.90 ? 176  GLN A O   1 
ATOM   1340 C  CB  . GLN A 1 176 ? 144.263 133.461 22.335 1.00 27.40 ? 176  GLN A CB  1 
ATOM   1341 C  CG  . GLN A 1 176 ? 145.593 134.199 22.401 1.00 44.81 ? 176  GLN A CG  1 
ATOM   1342 C  CD  . GLN A 1 176 ? 146.757 133.277 22.198 0.00 48.12 ? 176  GLN A CD  1 
ATOM   1343 O  OE1 . GLN A 1 176 ? 146.818 132.248 22.833 1.00 60.86 ? 176  GLN A OE1 1 
ATOM   1344 N  NE2 . GLN A 1 176 ? 147.684 133.634 21.311 0.00 51.10 ? 176  GLN A NE2 1 
ATOM   1345 N  N   . TRP A 1 177 ? 141.117 133.508 21.958 1.00 29.12 ? 177  TRP A N   1 
ATOM   1346 C  CA  . TRP A 1 177 ? 139.964 133.685 21.093 1.00 27.67 ? 177  TRP A CA  1 
ATOM   1347 C  C   . TRP A 1 177 ? 139.117 134.834 21.628 1.00 27.11 ? 177  TRP A C   1 
ATOM   1348 O  O   . TRP A 1 177 ? 138.636 135.675 20.870 1.00 27.26 ? 177  TRP A O   1 
ATOM   1349 C  CB  . TRP A 1 177 ? 139.123 132.405 21.057 1.00 26.43 ? 177  TRP A CB  1 
ATOM   1350 C  CG  . TRP A 1 177 ? 137.987 132.487 20.093 1.00 30.08 ? 177  TRP A CG  1 
ATOM   1351 C  CD1 . TRP A 1 177 ? 138.002 132.133 18.774 1.00 28.64 ? 177  TRP A CD1 1 
ATOM   1352 C  CD2 . TRP A 1 177 ? 136.681 133.009 20.353 1.00 23.60 ? 177  TRP A CD2 1 
ATOM   1353 N  NE1 . TRP A 1 177 ? 136.785 132.401 18.198 1.00 26.10 ? 177  TRP A NE1 1 
ATOM   1354 C  CE2 . TRP A 1 177 ? 135.955 132.940 19.143 1.00 25.96 ? 177  TRP A CE2 1 
ATOM   1355 C  CE3 . TRP A 1 177 ? 136.052 133.529 21.490 1.00 21.55 ? 177  TRP A CE3 1 
ATOM   1356 C  CZ2 . TRP A 1 177 ? 134.631 133.373 19.037 1.00 29.63 ? 177  TRP A CZ2 1 
ATOM   1357 C  CZ3 . TRP A 1 177 ? 134.736 133.960 21.386 1.00 20.86 ? 177  TRP A CZ3 1 
ATOM   1358 C  CH2 . TRP A 1 177 ? 134.040 133.879 20.167 1.00 24.63 ? 177  TRP A CH2 1 
ATOM   1359 N  N   . VAL A 1 178 ? 138.929 134.861 22.941 1.00 26.32 ? 178  VAL A N   1 
ATOM   1360 C  CA  . VAL A 1 178 ? 138.140 135.915 23.565 1.00 30.40 ? 178  VAL A CA  1 
ATOM   1361 C  C   . VAL A 1 178 ? 138.815 137.275 23.369 1.00 29.08 ? 178  VAL A C   1 
ATOM   1362 O  O   . VAL A 1 178 ? 138.152 138.274 23.088 1.00 24.74 ? 178  VAL A O   1 
ATOM   1363 C  CB  . VAL A 1 178 ? 137.944 135.637 25.067 1.00 24.49 ? 178  VAL A CB  1 
ATOM   1364 C  CG1 . VAL A 1 178 ? 137.310 136.838 25.744 1.00 22.82 ? 178  VAL A CG1 1 
ATOM   1365 C  CG2 . VAL A 1 178 ? 137.076 134.399 25.244 1.00 16.31 ? 178  VAL A CG2 1 
ATOM   1366 N  N   . GLN A 1 179 ? 140.134 137.307 23.506 1.00 27.34 ? 179  GLN A N   1 
ATOM   1367 C  CA  . GLN A 1 179 ? 140.870 138.549 23.322 1.00 31.98 ? 179  GLN A CA  1 
ATOM   1368 C  C   . GLN A 1 179 ? 140.630 139.134 21.933 1.00 31.71 ? 179  GLN A C   1 
ATOM   1369 O  O   . GLN A 1 179 ? 140.381 140.327 21.785 1.00 32.82 ? 179  GLN A O   1 
ATOM   1370 C  CB  . GLN A 1 179 ? 142.372 138.315 23.530 1.00 28.14 ? 179  GLN A CB  1 
ATOM   1371 C  CG  . GLN A 1 179 ? 142.776 138.193 24.988 1.00 31.56 ? 179  GLN A CG  1 
ATOM   1372 C  CD  . GLN A 1 179 ? 142.305 139.377 25.813 1.00 33.92 ? 179  GLN A CD  1 
ATOM   1373 O  OE1 . GLN A 1 179 ? 142.749 140.501 25.609 1.00 31.18 ? 179  GLN A OE1 1 
ATOM   1374 N  NE2 . GLN A 1 179 ? 141.391 139.129 26.743 1.00 32.48 ? 179  GLN A NE2 1 
ATOM   1375 N  N   . LYS A 1 180 ? 140.679 138.276 20.921 1.00 35.22 ? 180  LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 180 ? 140.507 138.701 19.538 1.00 34.36 ? 180  LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 180 ? 139.077 138.803 19.032 1.00 35.96 ? 180  LYS A C   1 
ATOM   1378 O  O   . LYS A 1 180 ? 138.841 139.437 18.006 1.00 45.24 ? 180  LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 180 ? 141.255 137.745 18.610 1.00 32.11 ? 180  LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 180 ? 142.750 137.677 18.808 1.00 41.73 ? 180  LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 180 ? 143.302 136.493 18.029 1.00 47.10 ? 180  LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 180 ? 144.782 136.644 17.723 1.00 48.45 ? 180  LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 180 ? 145.235 135.572 16.790 0.50 47.67 ? 180  LYS A NZ  1 
ATOM   1384 N  N   . ASN A 1 181 ? 138.122 138.201 19.732 1.00 31.40 ? 181  ASN A N   1 
ATOM   1385 C  CA  . ASN A 1 181 ? 136.750 138.205 19.236 1.00 29.94 ? 181  ASN A CA  1 
ATOM   1386 C  C   . ASN A 1 181 ? 135.634 138.742 20.110 1.00 27.14 ? 181  ASN A C   1 
ATOM   1387 O  O   . ASN A 1 181 ? 134.584 139.116 19.593 1.00 29.53 ? 181  ASN A O   1 
ATOM   1388 C  CB  . ASN A 1 181 ? 136.353 136.780 18.824 1.00 28.79 ? 181  ASN A CB  1 
ATOM   1389 C  CG  . ASN A 1 181 ? 137.162 136.257 17.657 1.00 29.27 ? 181  ASN A CG  1 
ATOM   1390 O  OD1 . ASN A 1 181 ? 137.053 136.757 16.541 1.00 38.22 ? 181  ASN A OD1 1 
ATOM   1391 N  ND2 . ASN A 1 181 ? 137.978 135.240 17.910 1.00 27.42 ? 181  ASN A ND2 1 
ATOM   1392 N  N   . ILE A 1 182 ? 135.842 138.776 21.421 1.00 28.55 ? 182  ILE A N   1 
ATOM   1393 C  CA  . ILE A 1 182 ? 134.786 139.195 22.334 1.00 26.71 ? 182  ILE A CA  1 
ATOM   1394 C  C   . ILE A 1 182 ? 134.234 140.603 22.146 1.00 29.75 ? 182  ILE A C   1 
ATOM   1395 O  O   . ILE A 1 182 ? 133.088 140.869 22.498 1.00 33.90 ? 182  ILE A O   1 
ATOM   1396 C  CB  . ILE A 1 182 ? 135.225 138.994 23.800 1.00 30.07 ? 182  ILE A CB  1 
ATOM   1397 C  CG1 . ILE A 1 182 ? 133.994 138.718 24.663 1.00 33.24 ? 182  ILE A CG1 1 
ATOM   1398 C  CG2 . ILE A 1 182 ? 135.980 140.211 24.307 1.00 30.44 ? 182  ILE A CG2 1 
ATOM   1399 C  CD1 . ILE A 1 182 ? 133.277 137.431 24.303 1.00 27.30 ? 182  ILE A CD1 1 
ATOM   1400 N  N   . ALA A 1 183 ? 135.034 141.503 21.587 1.00 30.65 ? 183  ALA A N   1 
ATOM   1401 C  CA  . ALA A 1 183 ? 134.574 142.864 21.367 1.00 33.38 ? 183  ALA A CA  1 
ATOM   1402 C  C   . ALA A 1 183 ? 133.401 142.838 20.392 1.00 34.39 ? 183  ALA A C   1 
ATOM   1403 O  O   . ALA A 1 183 ? 132.470 143.631 20.504 1.00 39.12 ? 183  ALA A O   1 
ATOM   1404 C  CB  . ALA A 1 183 ? 135.710 143.719 20.816 1.00 33.67 ? 183  ALA A CB  1 
ATOM   1405 N  N   . ALA A 1 184 ? 133.448 141.910 19.442 1.00 36.17 ? 184  ALA A N   1 
ATOM   1406 C  CA  . ALA A 1 184 ? 132.389 141.770 18.452 1.00 31.13 ? 184  ALA A CA  1 
ATOM   1407 C  C   . ALA A 1 184 ? 131.057 141.387 19.105 1.00 36.50 ? 184  ALA A C   1 
ATOM   1408 O  O   . ALA A 1 184 ? 129.985 141.727 18.594 1.00 39.76 ? 184  ALA A O   1 
ATOM   1409 C  CB  . ALA A 1 184 ? 132.783 140.730 17.414 1.00 26.89 ? 184  ALA A CB  1 
ATOM   1410 N  N   . PHE A 1 185 ? 131.124 140.681 20.233 1.00 33.99 ? 185  PHE A N   1 
ATOM   1411 C  CA  . PHE A 1 185 ? 129.915 140.267 20.946 1.00 29.48 ? 185  PHE A CA  1 
ATOM   1412 C  C   . PHE A 1 185 ? 129.536 141.295 22.006 1.00 28.79 ? 185  PHE A C   1 
ATOM   1413 O  O   . PHE A 1 185 ? 128.661 141.050 22.832 1.00 29.27 ? 185  PHE A O   1 
ATOM   1414 C  CB  . PHE A 1 185 ? 130.111 138.905 21.625 1.00 28.31 ? 185  PHE A CB  1 
ATOM   1415 C  CG  . PHE A 1 185 ? 130.376 137.774 20.669 1.00 24.80 ? 185  PHE A CG  1 
ATOM   1416 C  CD1 . PHE A 1 185 ? 131.620 137.640 20.057 1.00 19.89 ? 185  PHE A CD1 1 
ATOM   1417 C  CD2 . PHE A 1 185 ? 129.375 136.841 20.380 1.00 19.36 ? 185  PHE A CD2 1 
ATOM   1418 C  CE1 . PHE A 1 185 ? 131.873 136.591 19.166 1.00 29.34 ? 185  PHE A CE1 1 
ATOM   1419 C  CE2 . PHE A 1 185 ? 129.609 135.790 19.491 1.00 20.13 ? 185  PHE A CE2 1 
ATOM   1420 C  CZ  . PHE A 1 185 ? 130.863 135.662 18.882 1.00 24.23 ? 185  PHE A CZ  1 
ATOM   1421 N  N   . GLY A 1 186 ? 130.207 142.441 21.982 1.00 29.43 ? 186  GLY A N   1 
ATOM   1422 C  CA  . GLY A 1 186 ? 129.921 143.485 22.949 1.00 31.20 ? 186  GLY A CA  1 
ATOM   1423 C  C   . GLY A 1 186 ? 130.638 143.292 24.270 1.00 30.27 ? 186  GLY A C   1 
ATOM   1424 O  O   . GLY A 1 186 ? 130.234 143.844 25.294 1.00 28.00 ? 186  GLY A O   1 
ATOM   1425 N  N   . GLY A 1 187 ? 131.709 142.505 24.248 1.00 29.77 ? 187  GLY A N   1 
ATOM   1426 C  CA  . GLY A 1 187 ? 132.461 142.249 25.462 1.00 29.33 ? 187  GLY A CA  1 
ATOM   1427 C  C   . GLY A 1 187 ? 133.699 143.117 25.571 1.00 31.91 ? 187  GLY A C   1 
ATOM   1428 O  O   . GLY A 1 187 ? 134.125 143.727 24.596 1.00 34.99 ? 187  GLY A O   1 
ATOM   1429 N  N   . ASN A 1 188 ? 134.280 143.174 26.761 1.00 32.07 ? 188  ASN A N   1 
ATOM   1430 C  CA  . ASN A 1 188 ? 135.476 143.976 26.990 1.00 28.00 ? 188  ASN A CA  1 
ATOM   1431 C  C   . ASN A 1 188 ? 136.689 143.081 27.259 1.00 28.42 ? 188  ASN A C   1 
ATOM   1432 O  O   . ASN A 1 188 ? 136.850 142.563 28.362 1.00 26.93 ? 188  ASN A O   1 
ATOM   1433 C  CB  . ASN A 1 188 ? 135.243 144.901 28.184 1.00 27.88 ? 188  ASN A CB  1 
ATOM   1434 C  CG  . ASN A 1 188 ? 136.439 145.776 28.494 1.00 24.60 ? 188  ASN A CG  1 
ATOM   1435 O  OD1 . ASN A 1 188 ? 136.498 146.389 29.548 1.00 26.39 ? 188  ASN A OD1 1 
ATOM   1436 N  ND2 . ASN A 1 188 ? 137.390 145.843 27.574 1.00 27.15 ? 188  ASN A ND2 1 
ATOM   1437 N  N   . PRO A 1 189 ? 137.560 142.896 26.254 1.00 23.59 ? 189  PRO A N   1 
ATOM   1438 C  CA  . PRO A 1 189 ? 138.750 142.057 26.420 1.00 26.84 ? 189  PRO A CA  1 
ATOM   1439 C  C   . PRO A 1 189 ? 139.686 142.536 27.538 1.00 32.48 ? 189  PRO A C   1 
ATOM   1440 O  O   . PRO A 1 189 ? 140.548 141.787 27.988 1.00 29.64 ? 189  PRO A O   1 
ATOM   1441 C  CB  . PRO A 1 189 ? 139.404 142.113 25.039 1.00 25.11 ? 189  PRO A CB  1 
ATOM   1442 C  CG  . PRO A 1 189 ? 139.028 143.458 24.548 1.00 24.12 ? 189  PRO A CG  1 
ATOM   1443 C  CD  . PRO A 1 189 ? 137.571 143.555 24.938 1.00 26.05 ? 189  PRO A CD  1 
ATOM   1444 N  N   . LYS A 1 190 ? 139.512 143.779 27.981 1.00 28.29 ? 190  LYS A N   1 
ATOM   1445 C  CA  . LYS A 1 190 ? 140.332 144.330 29.057 1.00 25.14 ? 190  LYS A CA  1 
ATOM   1446 C  C   . LYS A 1 190 ? 139.758 144.004 30.430 1.00 25.89 ? 190  LYS A C   1 
ATOM   1447 O  O   . LYS A 1 190 ? 140.377 144.299 31.450 1.00 25.70 ? 190  LYS A O   1 
ATOM   1448 C  CB  . LYS A 1 190 ? 140.447 145.844 28.911 1.00 27.80 ? 190  LYS A CB  1 
ATOM   1449 C  CG  . LYS A 1 190 ? 141.564 146.282 28.008 1.00 32.01 ? 190  LYS A CG  1 
ATOM   1450 C  CD  . LYS A 1 190 ? 141.198 147.551 27.279 0.00 36.25 ? 190  LYS A CD  1 
ATOM   1451 C  CE  . LYS A 1 190 ? 142.419 148.145 26.620 1.00 41.88 ? 190  LYS A CE  1 
ATOM   1452 N  NZ  . LYS A 1 190 ? 143.518 147.148 26.526 0.00 40.53 ? 190  LYS A NZ  1 
ATOM   1453 N  N   . SER A 1 191 ? 138.565 143.415 30.458 1.00 19.96 ? 191  SER A N   1 
ATOM   1454 C  CA  . SER A 1 191 ? 137.944 143.045 31.720 1.00 14.60 ? 191  SER A CA  1 
ATOM   1455 C  C   . SER A 1 191 ? 137.463 141.593 31.673 1.00 20.88 ? 191  SER A C   1 
ATOM   1456 O  O   . SER A 1 191 ? 136.262 141.313 31.596 1.00 19.84 ? 191  SER A O   1 
ATOM   1457 C  CB  . SER A 1 191 ? 136.777 143.981 32.028 1.00 15.74 ? 191  SER A CB  1 
ATOM   1458 O  OG  . SER A 1 191 ? 136.170 143.638 33.263 1.00 20.12 ? 191  SER A OG  1 
ATOM   1459 N  N   . VAL A 1 192 ? 138.420 140.673 31.723 1.00 20.84 ? 192  VAL A N   1 
ATOM   1460 C  CA  . VAL A 1 192 ? 138.132 139.243 31.683 1.00 19.10 ? 192  VAL A CA  1 
ATOM   1461 C  C   . VAL A 1 192 ? 138.515 138.556 32.998 1.00 20.51 ? 192  VAL A C   1 
ATOM   1462 O  O   . VAL A 1 192 ? 139.664 138.615 33.441 1.00 22.68 ? 192  VAL A O   1 
ATOM   1463 C  CB  . VAL A 1 192 ? 138.905 138.561 30.525 1.00 25.16 ? 192  VAL A CB  1 
ATOM   1464 C  CG1 . VAL A 1 192 ? 138.636 137.067 30.521 1.00 24.25 ? 192  VAL A CG1 1 
ATOM   1465 C  CG2 . VAL A 1 192 ? 138.497 139.173 29.201 1.00 22.52 ? 192  VAL A CG2 1 
ATOM   1466 N  N   . THR A 1 193 ? 137.545 137.905 33.621 1.00 24.46 ? 193  THR A N   1 
ATOM   1467 C  CA  . THR A 1 193 ? 137.786 137.199 34.870 1.00 22.36 ? 193  THR A CA  1 
ATOM   1468 C  C   . THR A 1 193 ? 137.661 135.704 34.641 1.00 24.29 ? 193  THR A C   1 
ATOM   1469 O  O   . THR A 1 193 ? 136.657 135.234 34.107 1.00 19.33 ? 193  THR A O   1 
ATOM   1470 C  CB  . THR A 1 193 ? 136.778 137.610 35.954 1.00 21.01 ? 193  THR A CB  1 
ATOM   1471 O  OG1 . THR A 1 193 ? 137.040 138.956 36.354 1.00 29.57 ? 193  THR A OG1 1 
ATOM   1472 C  CG2 . THR A 1 193 ? 136.892 136.698 37.173 1.00 16.06 ? 193  THR A CG2 1 
ATOM   1473 N  N   . LEU A 1 194 ? 138.686 134.959 35.044 1.00 22.07 ? 194  LEU A N   1 
ATOM   1474 C  CA  . LEU A 1 194 ? 138.662 133.512 34.884 1.00 20.91 ? 194  LEU A CA  1 
ATOM   1475 C  C   . LEU A 1 194 ? 138.168 132.913 36.178 1.00 22.49 ? 194  LEU A C   1 
ATOM   1476 O  O   . LEU A 1 194 ? 138.525 133.395 37.251 1.00 20.20 ? 194  LEU A O   1 
ATOM   1477 C  CB  . LEU A 1 194 ? 140.068 132.949 34.620 1.00 19.63 ? 194  LEU A CB  1 
ATOM   1478 C  CG  . LEU A 1 194 ? 140.922 133.456 33.460 1.00 23.97 ? 194  LEU A CG  1 
ATOM   1479 C  CD1 . LEU A 1 194 ? 142.287 132.781 33.518 1.00 18.55 ? 194  LEU A CD1 1 
ATOM   1480 C  CD2 . LEU A 1 194 ? 140.234 133.179 32.131 1.00 25.05 ? 194  LEU A CD2 1 
ATOM   1481 N  N   . PHE A 1 195 ? 137.334 131.881 36.080 1.00 21.11 ? 195  PHE A N   1 
ATOM   1482 C  CA  . PHE A 1 195 ? 136.877 131.184 37.269 1.00 18.00 ? 195  PHE A CA  1 
ATOM   1483 C  C   . PHE A 1 195 ? 136.642 129.722 36.935 1.00 19.72 ? 195  PHE A C   1 
ATOM   1484 O  O   . PHE A 1 195 ? 136.282 129.377 35.811 1.00 19.26 ? 195  PHE A O   1 
ATOM   1485 C  CB  . PHE A 1 195 ? 135.646 131.869 37.908 1.00 17.30 ? 195  PHE A CB  1 
ATOM   1486 C  CG  . PHE A 1 195 ? 134.350 131.697 37.163 1.00 18.21 ? 195  PHE A CG  1 
ATOM   1487 C  CD1 . PHE A 1 195 ? 134.261 131.928 35.796 1.00 23.79 ? 195  PHE A CD1 1 
ATOM   1488 C  CD2 . PHE A 1 195 ? 133.186 131.385 37.866 1.00 18.48 ? 195  PHE A CD2 1 
ATOM   1489 C  CE1 . PHE A 1 195 ? 133.034 131.858 35.138 1.00 26.41 ? 195  PHE A CE1 1 
ATOM   1490 C  CE2 . PHE A 1 195 ? 131.963 131.311 37.226 1.00 18.01 ? 195  PHE A CE2 1 
ATOM   1491 C  CZ  . PHE A 1 195 ? 131.883 131.549 35.855 1.00 25.97 ? 195  PHE A CZ  1 
ATOM   1492 N  N   . GLY A 1 196 ? 136.912 128.862 37.909 1.00 20.71 ? 196  GLY A N   1 
ATOM   1493 C  CA  . GLY A 1 196 ? 136.758 127.436 37.718 1.00 12.51 ? 196  GLY A CA  1 
ATOM   1494 C  C   . GLY A 1 196 ? 136.746 126.725 39.051 1.00 19.12 ? 196  GLY A C   1 
ATOM   1495 O  O   . GLY A 1 196 ? 137.075 127.321 40.072 1.00 22.46 ? 196  GLY A O   1 
ATOM   1496 N  N   . GLU A 1 197 ? 136.371 125.451 39.046 1.00 19.42 ? 197  GLU A N   1 
ATOM   1497 C  CA  . GLU A 1 197 ? 136.300 124.675 40.274 1.00 14.83 ? 197  GLU A CA  1 
ATOM   1498 C  C   . GLU A 1 197 ? 137.181 123.427 40.198 1.00 17.34 ? 197  GLU A C   1 
ATOM   1499 O  O   . GLU A 1 197 ? 137.310 122.808 39.142 1.00 17.15 ? 197  GLU A O   1 
ATOM   1500 C  CB  . GLU A 1 197 ? 134.835 124.301 40.543 1.00 14.12 ? 197  GLU A CB  1 
ATOM   1501 C  CG  . GLU A 1 197 ? 134.567 123.592 41.863 1.00 17.35 ? 197  GLU A CG  1 
ATOM   1502 C  CD  . GLU A 1 197 ? 134.590 122.077 41.737 1.00 32.42 ? 197  GLU A CD  1 
ATOM   1503 O  OE1 . GLU A 1 197 ? 134.651 121.580 40.588 1.00 25.41 ? 197  GLU A OE1 1 
ATOM   1504 O  OE2 . GLU A 1 197 ? 134.533 121.387 42.782 1.00 25.59 ? 197  GLU A OE2 1 
ATOM   1505 N  N   . SER A 1 198 ? 137.799 123.079 41.323 1.00 20.11 ? 198  SER A N   1 
ATOM   1506 C  CA  . SER A 1 198 ? 138.673 121.910 41.416 1.00 14.24 ? 198  SER A CA  1 
ATOM   1507 C  C   . SER A 1 198 ? 139.810 121.965 40.390 1.00 19.32 ? 198  SER A C   1 
ATOM   1508 O  O   . SER A 1 198 ? 140.632 122.881 40.434 1.00 19.08 ? 198  SER A O   1 
ATOM   1509 C  CB  . SER A 1 198 ? 137.851 120.634 41.234 1.00 16.30 ? 198  SER A CB  1 
ATOM   1510 O  OG  . SER A 1 198 ? 138.497 119.550 41.873 1.00 27.08 ? 198  SER A OG  1 
ATOM   1511 N  N   . ALA A 1 199 ? 139.879 120.996 39.477 1.00 14.49 ? 199  ALA A N   1 
ATOM   1512 C  CA  . ALA A 1 199 ? 140.939 121.027 38.474 1.00 18.27 ? 199  ALA A CA  1 
ATOM   1513 C  C   . ALA A 1 199 ? 140.821 122.319 37.657 1.00 19.56 ? 199  ALA A C   1 
ATOM   1514 O  O   . ALA A 1 199 ? 141.821 122.847 37.153 1.00 18.89 ? 199  ALA A O   1 
ATOM   1515 C  CB  . ALA A 1 199 ? 140.864 119.801 37.557 1.00 15.90 ? 199  ALA A CB  1 
ATOM   1516 N  N   . GLY A 1 200 ? 139.595 122.819 37.528 1.00 12.22 ? 200  GLY A N   1 
ATOM   1517 C  CA  . GLY A 1 200 ? 139.383 124.060 36.808 1.00 14.76 ? 200  GLY A CA  1 
ATOM   1518 C  C   . GLY A 1 200 ? 140.071 125.184 37.571 1.00 15.03 ? 200  GLY A C   1 
ATOM   1519 O  O   . GLY A 1 200 ? 140.737 126.033 36.983 1.00 17.58 ? 200  GLY A O   1 
ATOM   1520 N  N   . ALA A 1 201 ? 139.918 125.187 38.890 1.00 15.89 ? 201  ALA A N   1 
ATOM   1521 C  CA  . ALA A 1 201 ? 140.547 126.211 39.726 1.00 22.64 ? 201  ALA A CA  1 
ATOM   1522 C  C   . ALA A 1 201 ? 142.069 126.061 39.641 1.00 21.15 ? 201  ALA A C   1 
ATOM   1523 O  O   . ALA A 1 201 ? 142.790 127.047 39.495 1.00 16.67 ? 201  ALA A O   1 
ATOM   1524 C  CB  . ALA A 1 201 ? 140.070 126.082 41.192 1.00 17.26 ? 201  ALA A CB  1 
ATOM   1525 N  N   . ALA A 1 202 ? 142.554 124.826 39.737 1.00 12.36 ? 202  ALA A N   1 
ATOM   1526 C  CA  . ALA A 1 202 ? 143.984 124.598 39.642 1.00 17.15 ? 202  ALA A CA  1 
ATOM   1527 C  C   . ALA A 1 202 ? 144.442 125.137 38.290 1.00 18.86 ? 202  ALA A C   1 
ATOM   1528 O  O   . ALA A 1 202 ? 145.520 125.716 38.177 1.00 20.53 ? 202  ALA A O   1 
ATOM   1529 C  CB  . ALA A 1 202 ? 144.295 123.126 39.757 1.00 4.51  ? 202  ALA A CB  1 
ATOM   1530 N  N   . SER A 1 203 ? 143.612 124.966 37.266 1.00 14.15 ? 203  SER A N   1 
ATOM   1531 C  CA  . SER A 1 203 ? 143.971 125.466 35.948 1.00 16.87 ? 203  SER A CA  1 
ATOM   1532 C  C   . SER A 1 203 ? 144.107 126.983 36.006 1.00 17.03 ? 203  SER A C   1 
ATOM   1533 O  O   . SER A 1 203 ? 145.094 127.541 35.539 1.00 15.84 ? 203  SER A O   1 
ATOM   1534 C  CB  . SER A 1 203 ? 142.919 125.064 34.913 1.00 14.80 ? 203  SER A CB  1 
ATOM   1535 O  OG  . SER A 1 203 ? 142.975 123.673 34.646 1.00 26.27 ? 203  SER A OG  1 
ATOM   1536 N  N   . VAL A 1 204 ? 143.116 127.644 36.596 1.00 15.99 ? 204  VAL A N   1 
ATOM   1537 C  CA  . VAL A 1 204 ? 143.143 129.094 36.722 1.00 17.69 ? 204  VAL A CA  1 
ATOM   1538 C  C   . VAL A 1 204 ? 144.430 129.543 37.405 1.00 19.95 ? 204  VAL A C   1 
ATOM   1539 O  O   . VAL A 1 204 ? 145.126 130.438 36.927 1.00 18.33 ? 204  VAL A O   1 
ATOM   1540 C  CB  . VAL A 1 204 ? 141.923 129.607 37.532 1.00 24.18 ? 204  VAL A CB  1 
ATOM   1541 C  CG1 . VAL A 1 204 ? 142.172 131.023 38.039 1.00 16.43 ? 204  VAL A CG1 1 
ATOM   1542 C  CG2 . VAL A 1 204 ? 140.685 129.589 36.653 1.00 20.34 ? 204  VAL A CG2 1 
ATOM   1543 N  N   . SER A 1 205 ? 144.756 128.907 38.520 1.00 19.82 ? 205  SER A N   1 
ATOM   1544 C  CA  . SER A 1 205 ? 145.964 129.268 39.241 1.00 21.43 ? 205  SER A CA  1 
ATOM   1545 C  C   . SER A 1 205 ? 147.222 129.107 38.374 1.00 16.77 ? 205  SER A C   1 
ATOM   1546 O  O   . SER A 1 205 ? 148.175 129.869 38.523 1.00 21.41 ? 205  SER A O   1 
ATOM   1547 C  CB  . SER A 1 205 ? 146.085 128.434 40.527 1.00 16.49 ? 205  SER A CB  1 
ATOM   1548 O  OG  . SER A 1 205 ? 146.299 127.062 40.247 1.00 22.80 ? 205  SER A OG  1 
ATOM   1549 N  N   . LEU A 1 206 ? 147.221 128.128 37.471 1.00 14.04 ? 206  LEU A N   1 
ATOM   1550 C  CA  . LEU A 1 206 ? 148.375 127.890 36.605 1.00 16.27 ? 206  LEU A CA  1 
ATOM   1551 C  C   . LEU A 1 206 ? 148.476 128.971 35.539 1.00 20.47 ? 206  LEU A C   1 
ATOM   1552 O  O   . LEU A 1 206 ? 149.566 129.275 35.056 1.00 16.64 ? 206  LEU A O   1 
ATOM   1553 C  CB  . LEU A 1 206 ? 148.291 126.502 35.950 1.00 16.14 ? 206  LEU A CB  1 
ATOM   1554 C  CG  . LEU A 1 206 ? 148.603 125.304 36.864 1.00 26.58 ? 206  LEU A CG  1 
ATOM   1555 C  CD1 . LEU A 1 206 ? 148.393 123.993 36.117 1.00 21.74 ? 206  LEU A CD1 1 
ATOM   1556 C  CD2 . LEU A 1 206 ? 150.041 125.392 37.362 1.00 17.40 ? 206  LEU A CD2 1 
ATOM   1557 N  N   . HIS A 1 207 ? 147.333 129.541 35.161 1.00 18.53 ? 207  HIS A N   1 
ATOM   1558 C  CA  . HIS A 1 207 ? 147.324 130.622 34.184 1.00 19.58 ? 207  HIS A CA  1 
ATOM   1559 C  C   . HIS A 1 207 ? 147.894 131.876 34.855 1.00 22.78 ? 207  HIS A C   1 
ATOM   1560 O  O   . HIS A 1 207 ? 148.437 132.751 34.184 1.00 23.36 ? 207  HIS A O   1 
ATOM   1561 C  CB  . HIS A 1 207 ? 145.906 130.885 33.678 1.00 15.69 ? 207  HIS A CB  1 
ATOM   1562 C  CG  . HIS A 1 207 ? 145.435 129.882 32.673 1.00 23.12 ? 207  HIS A CG  1 
ATOM   1563 N  ND1 . HIS A 1 207 ? 145.944 129.818 31.394 1.00 23.67 ? 207  HIS A ND1 1 
ATOM   1564 C  CD2 . HIS A 1 207 ? 144.540 128.871 32.773 1.00 21.34 ? 207  HIS A CD2 1 
ATOM   1565 C  CE1 . HIS A 1 207 ? 145.384 128.809 30.750 1.00 26.02 ? 207  HIS A CE1 1 
ATOM   1566 N  NE2 . HIS A 1 207 ? 144.530 128.217 31.564 1.00 18.72 ? 207  HIS A NE2 1 
ATOM   1567 N  N   . LEU A 1 208 ? 147.763 131.959 36.179 1.00 18.24 ? 208  LEU A N   1 
ATOM   1568 C  CA  . LEU A 1 208 ? 148.314 133.086 36.925 1.00 23.68 ? 208  LEU A CA  1 
ATOM   1569 C  C   . LEU A 1 208 ? 149.840 132.949 36.909 1.00 22.95 ? 208  LEU A C   1 
ATOM   1570 O  O   . LEU A 1 208 ? 150.559 133.924 37.082 1.00 27.74 ? 208  LEU A O   1 
ATOM   1571 C  CB  . LEU A 1 208 ? 147.823 133.088 38.384 1.00 14.50 ? 208  LEU A CB  1 
ATOM   1572 C  CG  . LEU A 1 208 ? 146.415 133.613 38.688 1.00 17.52 ? 208  LEU A CG  1 
ATOM   1573 C  CD1 . LEU A 1 208 ? 146.016 133.209 40.096 1.00 13.28 ? 208  LEU A CD1 1 
ATOM   1574 C  CD2 . LEU A 1 208 ? 146.374 135.128 38.535 1.00 9.84  ? 208  LEU A CD2 1 
ATOM   1575 N  N   . LEU A 1 209 ? 150.326 131.733 36.687 1.00 19.74 ? 209  LEU A N   1 
ATOM   1576 C  CA  . LEU A 1 209 ? 151.759 131.480 36.661 1.00 22.89 ? 209  LEU A CA  1 
ATOM   1577 C  C   . LEU A 1 209 ? 152.358 131.438 35.266 1.00 26.11 ? 209  LEU A C   1 
ATOM   1578 O  O   . LEU A 1 209 ? 153.563 131.610 35.105 1.00 31.87 ? 209  LEU A O   1 
ATOM   1579 C  CB  . LEU A 1 209 ? 152.080 130.156 37.364 1.00 22.92 ? 209  LEU A CB  1 
ATOM   1580 C  CG  . LEU A 1 209 ? 152.390 130.165 38.862 1.00 23.51 ? 209  LEU A CG  1 
ATOM   1581 C  CD1 . LEU A 1 209 ? 151.336 130.941 39.633 1.00 31.58 ? 209  LEU A CD1 1 
ATOM   1582 C  CD2 . LEU A 1 209 ? 152.460 128.734 39.345 1.00 24.33 ? 209  LEU A CD2 1 
ATOM   1583 N  N   . SER A 1 210 ? 151.532 131.202 34.255 1.00 27.80 ? 210  SER A N   1 
ATOM   1584 C  CA  . SER A 1 210 ? 152.054 131.116 32.902 1.00 28.29 ? 210  SER A CA  1 
ATOM   1585 C  C   . SER A 1 210 ? 152.177 132.459 32.196 1.00 32.05 ? 210  SER A C   1 
ATOM   1586 O  O   . SER A 1 210 ? 151.187 133.143 31.945 1.00 28.91 ? 210  SER A O   1 
ATOM   1587 C  CB  . SER A 1 210 ? 151.199 130.173 32.061 1.00 28.51 ? 210  SER A CB  1 
ATOM   1588 O  OG  . SER A 1 210 ? 151.851 129.883 30.836 1.00 35.68 ? 210  SER A OG  1 
ATOM   1589 N  N   . PRO A 1 211 ? 153.411 132.849 31.855 1.00 36.69 ? 211  PRO A N   1 
ATOM   1590 C  CA  . PRO A 1 211 ? 153.667 134.118 31.171 1.00 36.85 ? 211  PRO A CA  1 
ATOM   1591 C  C   . PRO A 1 211 ? 152.793 134.270 29.929 1.00 34.57 ? 211  PRO A C   1 
ATOM   1592 O  O   . PRO A 1 211 ? 152.268 135.349 29.659 1.00 35.36 ? 211  PRO A O   1 
ATOM   1593 C  CB  . PRO A 1 211 ? 155.151 134.025 30.826 1.00 37.73 ? 211  PRO A CB  1 
ATOM   1594 C  CG  . PRO A 1 211 ? 155.700 133.212 31.962 1.00 38.28 ? 211  PRO A CG  1 
ATOM   1595 C  CD  . PRO A 1 211 ? 154.669 132.115 32.089 1.00 38.41 ? 211  PRO A CD  1 
ATOM   1596 N  N   . GLY A 1 212 ? 152.640 133.178 29.184 1.00 28.93 ? 212  GLY A N   1 
ATOM   1597 C  CA  . GLY A 1 212 ? 151.838 133.210 27.977 1.00 20.72 ? 212  GLY A CA  1 
ATOM   1598 C  C   . GLY A 1 212 ? 150.370 133.530 28.202 1.00 28.74 ? 212  GLY A C   1 
ATOM   1599 O  O   . GLY A 1 212 ? 149.647 133.811 27.254 1.00 31.78 ? 212  GLY A O   1 
ATOM   1600 N  N   . SER A 1 213 ? 149.922 133.496 29.452 1.00 26.34 ? 213  SER A N   1 
ATOM   1601 C  CA  . SER A 1 213 ? 148.523 133.785 29.759 1.00 27.66 ? 213  SER A CA  1 
ATOM   1602 C  C   . SER A 1 213 ? 148.336 135.120 30.473 1.00 25.90 ? 213  SER A C   1 
ATOM   1603 O  O   . SER A 1 213 ? 147.218 135.610 30.590 1.00 24.13 ? 213  SER A O   1 
ATOM   1604 C  CB  . SER A 1 213 ? 147.929 132.673 30.637 1.00 21.99 ? 213  SER A CB  1 
ATOM   1605 O  OG  . SER A 1 213 ? 147.929 131.430 29.962 1.00 29.26 ? 213  SER A OG  1 
ATOM   1606 N  N   A HIS A 1 214 ? 149.436 135.704 30.940 0.50 24.78 ? 214  HIS A N   1 
ATOM   1607 N  N   B HIS A 1 214 ? 149.433 135.699 30.946 0.50 24.16 ? 214  HIS A N   1 
ATOM   1608 C  CA  A HIS A 1 214 ? 149.396 136.972 31.667 0.50 26.42 ? 214  HIS A CA  1 
ATOM   1609 C  CA  B HIS A 1 214 ? 149.390 136.967 31.665 0.50 25.19 ? 214  HIS A CA  1 
ATOM   1610 C  C   A HIS A 1 214 ? 148.500 138.037 31.044 0.50 24.44 ? 214  HIS A C   1 
ATOM   1611 C  C   B HIS A 1 214 ? 148.502 138.040 31.044 0.50 23.77 ? 214  HIS A C   1 
ATOM   1612 O  O   A HIS A 1 214 ? 147.685 138.650 31.734 0.50 27.22 ? 214  HIS A O   1 
ATOM   1613 O  O   B HIS A 1 214 ? 147.692 138.658 31.734 0.50 26.78 ? 214  HIS A O   1 
ATOM   1614 C  CB  A HIS A 1 214 ? 150.814 137.534 31.832 0.50 27.93 ? 214  HIS A CB  1 
ATOM   1615 C  CB  B HIS A 1 214 ? 150.810 137.506 31.843 0.50 25.29 ? 214  HIS A CB  1 
ATOM   1616 C  CG  A HIS A 1 214 ? 150.879 138.782 32.662 0.50 33.21 ? 214  HIS A CG  1 
ATOM   1617 C  CG  B HIS A 1 214 ? 151.532 136.919 33.016 0.50 26.73 ? 214  HIS A CG  1 
ATOM   1618 N  ND1 A HIS A 1 214 ? 150.230 139.946 32.310 0.50 34.79 ? 214  HIS A ND1 1 
ATOM   1619 N  ND1 B HIS A 1 214 ? 151.153 135.732 33.607 0.50 26.52 ? 214  HIS A ND1 1 
ATOM   1620 C  CD2 A HIS A 1 214 ? 151.511 139.043 33.831 0.50 30.49 ? 214  HIS A CD2 1 
ATOM   1621 C  CD2 B HIS A 1 214 ? 152.620 137.348 33.699 0.50 30.82 ? 214  HIS A CD2 1 
ATOM   1622 C  CE1 A HIS A 1 214 ? 150.457 140.869 33.228 0.50 31.88 ? 214  HIS A CE1 1 
ATOM   1623 C  CE1 B HIS A 1 214 ? 151.977 135.456 34.602 0.50 25.07 ? 214  HIS A CE1 1 
ATOM   1624 N  NE2 A HIS A 1 214 ? 151.232 140.347 34.161 0.50 27.13 ? 214  HIS A NE2 1 
ATOM   1625 N  NE2 B HIS A 1 214 ? 152.876 136.420 34.679 0.50 23.90 ? 214  HIS A NE2 1 
ATOM   1626 N  N   . SER A 1 215 ? 148.648 138.258 29.744 1.00 23.63 ? 215  SER A N   1 
ATOM   1627 C  CA  . SER A 1 215 ? 147.858 139.274 29.054 1.00 24.59 ? 215  SER A CA  1 
ATOM   1628 C  C   . SER A 1 215 ? 146.515 138.811 28.516 1.00 28.47 ? 215  SER A C   1 
ATOM   1629 O  O   . SER A 1 215 ? 145.874 139.544 27.769 1.00 31.28 ? 215  SER A O   1 
ATOM   1630 C  CB  . SER A 1 215 ? 148.667 139.855 27.898 1.00 33.99 ? 215  SER A CB  1 
ATOM   1631 O  OG  . SER A 1 215 ? 148.953 138.849 26.939 1.00 42.50 ? 215  SER A OG  1 
ATOM   1632 N  N   . LEU A 1 216 ? 146.083 137.610 28.894 1.00 27.59 ? 216  LEU A N   1 
ATOM   1633 C  CA  . LEU A 1 216 ? 144.817 137.086 28.406 1.00 22.99 ? 216  LEU A CA  1 
ATOM   1634 C  C   . LEU A 1 216 ? 143.655 137.211 29.385 1.00 25.26 ? 216  LEU A C   1 
ATOM   1635 O  O   . LEU A 1 216 ? 142.540 136.803 29.065 1.00 23.25 ? 216  LEU A O   1 
ATOM   1636 C  CB  . LEU A 1 216 ? 144.978 135.623 27.995 1.00 20.85 ? 216  LEU A CB  1 
ATOM   1637 C  CG  . LEU A 1 216 ? 146.055 135.333 26.949 1.00 23.69 ? 216  LEU A CG  1 
ATOM   1638 C  CD1 . LEU A 1 216 ? 145.996 133.867 26.543 1.00 17.67 ? 216  LEU A CD1 1 
ATOM   1639 C  CD2 . LEU A 1 216 ? 145.854 136.222 25.747 1.00 19.55 ? 216  LEU A CD2 1 
ATOM   1640 N  N   . PHE A 1 217 ? 143.911 137.747 30.576 1.00 19.31 ? 217  PHE A N   1 
ATOM   1641 C  CA  . PHE A 1 217 ? 142.848 137.930 31.566 1.00 15.66 ? 217  PHE A CA  1 
ATOM   1642 C  C   . PHE A 1 217 ? 143.199 138.961 32.626 1.00 14.91 ? 217  PHE A C   1 
ATOM   1643 O  O   . PHE A 1 217 ? 144.349 139.357 32.767 1.00 20.48 ? 217  PHE A O   1 
ATOM   1644 C  CB  . PHE A 1 217 ? 142.464 136.604 32.237 1.00 15.01 ? 217  PHE A CB  1 
ATOM   1645 C  CG  . PHE A 1 217 ? 143.513 136.042 33.151 1.00 16.31 ? 217  PHE A CG  1 
ATOM   1646 C  CD1 . PHE A 1 217 ? 144.667 135.466 32.639 1.00 17.62 ? 217  PHE A CD1 1 
ATOM   1647 C  CD2 . PHE A 1 217 ? 143.333 136.071 34.528 1.00 19.90 ? 217  PHE A CD2 1 
ATOM   1648 C  CE1 . PHE A 1 217 ? 145.619 134.915 33.483 1.00 16.42 ? 217  PHE A CE1 1 
ATOM   1649 C  CE2 . PHE A 1 217 ? 144.279 135.524 35.379 1.00 18.06 ? 217  PHE A CE2 1 
ATOM   1650 C  CZ  . PHE A 1 217 ? 145.427 134.948 34.854 1.00 25.75 ? 217  PHE A CZ  1 
ATOM   1651 N  N   . THR A 1 218 ? 142.188 139.389 33.370 1.00 21.02 ? 218  THR A N   1 
ATOM   1652 C  CA  . THR A 1 218 ? 142.349 140.407 34.396 1.00 20.65 ? 218  THR A CA  1 
ATOM   1653 C  C   . THR A 1 218 ? 142.415 139.869 35.826 1.00 26.82 ? 218  THR A C   1 
ATOM   1654 O  O   . THR A 1 218 ? 143.362 140.148 36.562 1.00 23.70 ? 218  THR A O   1 
ATOM   1655 C  CB  . THR A 1 218 ? 141.175 141.410 34.325 1.00 25.80 ? 218  THR A CB  1 
ATOM   1656 O  OG1 . THR A 1 218 ? 141.014 141.854 32.974 1.00 31.52 ? 218  THR A OG1 1 
ATOM   1657 C  CG2 . THR A 1 218 ? 141.430 142.605 35.232 1.00 21.14 ? 218  THR A CG2 1 
ATOM   1658 N  N   . ARG A 1 219 ? 141.392 139.113 36.213 1.00 20.51 ? 219  ARG A N   1 
ATOM   1659 C  CA  . ARG A 1 219 ? 141.302 138.569 37.559 1.00 20.84 ? 219  ARG A CA  1 
ATOM   1660 C  C   . ARG A 1 219 ? 141.053 137.070 37.563 1.00 21.56 ? 219  ARG A C   1 
ATOM   1661 O  O   . ARG A 1 219 ? 140.824 136.470 36.512 1.00 20.75 ? 219  ARG A O   1 
ATOM   1662 C  CB  . ARG A 1 219 ? 140.179 139.271 38.326 1.00 25.64 ? 219  ARG A CB  1 
ATOM   1663 C  CG  . ARG A 1 219 ? 140.591 140.571 38.988 1.00 30.92 ? 219  ARG A CG  1 
ATOM   1664 C  CD  . ARG A 1 219 ? 139.407 141.246 39.649 1.00 25.67 ? 219  ARG A CD  1 
ATOM   1665 N  NE  . ARG A 1 219 ? 138.721 142.123 38.714 1.00 32.59 ? 219  ARG A NE  1 
ATOM   1666 C  CZ  . ARG A 1 219 ? 139.209 143.280 38.293 1.00 23.65 ? 219  ARG A CZ  1 
ATOM   1667 N  NH1 . ARG A 1 219 ? 140.384 143.693 38.735 1.00 31.72 ? 219  ARG A NH1 1 
ATOM   1668 N  NH2 . ARG A 1 219 ? 138.533 144.014 37.426 0.50 22.70 ? 219  ARG A NH2 1 
ATOM   1669 N  N   . ALA A 1 220 ? 141.071 136.480 38.757 1.00 16.20 ? 220  ALA A N   1 
ATOM   1670 C  CA  . ALA A 1 220 ? 140.885 135.038 38.902 1.00 15.97 ? 220  ALA A CA  1 
ATOM   1671 C  C   . ALA A 1 220 ? 140.083 134.638 40.137 1.00 12.18 ? 220  ALA A C   1 
ATOM   1672 O  O   . ALA A 1 220 ? 140.237 135.215 41.214 1.00 17.12 ? 220  ALA A O   1 
ATOM   1673 C  CB  . ALA A 1 220 ? 142.260 134.347 38.927 1.00 7.54  ? 220  ALA A CB  1 
ATOM   1674 N  N   . ILE A 1 221 ? 139.220 133.647 39.958 1.00 15.03 ? 221  ILE A N   1 
ATOM   1675 C  CA  . ILE A 1 221 ? 138.394 133.104 41.030 1.00 14.57 ? 221  ILE A CA  1 
ATOM   1676 C  C   . ILE A 1 221 ? 138.717 131.604 41.086 1.00 18.77 ? 221  ILE A C   1 
ATOM   1677 O  O   . ILE A 1 221 ? 138.616 130.899 40.078 1.00 19.80 ? 221  ILE A O   1 
ATOM   1678 C  CB  . ILE A 1 221 ? 136.895 133.293 40.725 1.00 17.71 ? 221  ILE A CB  1 
ATOM   1679 C  CG1 . ILE A 1 221 ? 136.562 134.792 40.645 1.00 7.94  ? 221  ILE A CG1 1 
ATOM   1680 C  CG2 . ILE A 1 221 ? 136.052 132.561 41.778 1.00 14.36 ? 221  ILE A CG2 1 
ATOM   1681 C  CD1 . ILE A 1 221 ? 135.100 135.093 40.313 1.00 11.63 ? 221  ILE A CD1 1 
ATOM   1682 N  N   . LEU A 1 222 ? 139.123 131.125 42.256 1.00 19.49 ? 222  LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 222 ? 139.472 129.716 42.429 1.00 19.72 ? 222  LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 222 ? 138.603 129.026 43.485 1.00 20.67 ? 222  LEU A C   1 
ATOM   1685 O  O   . LEU A 1 222 ? 138.778 129.245 44.685 1.00 15.23 ? 222  LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 222 ? 140.949 129.579 42.822 1.00 23.12 ? 222  LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 222 ? 142.001 130.116 41.844 1.00 26.93 ? 222  LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 222 ? 141.852 131.626 41.700 1.00 29.04 ? 222  LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 222 ? 143.387 129.773 42.350 1.00 18.66 ? 222  LEU A CD2 1 
ATOM   1690 N  N   . GLN A 1 223 ? 137.677 128.185 43.029 1.00 14.34 ? 223  GLN A N   1 
ATOM   1691 C  CA  . GLN A 1 223 ? 136.775 127.464 43.931 1.00 18.51 ? 223  GLN A CA  1 
ATOM   1692 C  C   . GLN A 1 223 ? 137.243 126.029 44.165 1.00 18.53 ? 223  GLN A C   1 
ATOM   1693 O  O   . GLN A 1 223 ? 137.296 125.223 43.234 1.00 19.47 ? 223  GLN A O   1 
ATOM   1694 C  CB  . GLN A 1 223 ? 135.355 127.453 43.351 1.00 20.78 ? 223  GLN A CB  1 
ATOM   1695 C  CG  . GLN A 1 223 ? 134.852 128.842 42.955 1.00 29.13 ? 223  GLN A CG  1 
ATOM   1696 C  CD  . GLN A 1 223 ? 133.561 128.813 42.161 1.00 36.38 ? 223  GLN A CD  1 
ATOM   1697 O  OE1 . GLN A 1 223 ? 133.188 129.804 41.533 1.00 37.84 ? 223  GLN A OE1 1 
ATOM   1698 N  NE2 . GLN A 1 223 ? 132.868 127.678 42.188 1.00 41.14 ? 223  GLN A NE2 1 
ATOM   1699 N  N   . SER A 1 224 ? 137.595 125.723 45.410 1.00 15.11 ? 224  SER A N   1 
ATOM   1700 C  CA  . SER A 1 224 ? 138.048 124.383 45.788 1.00 21.68 ? 224  SER A CA  1 
ATOM   1701 C  C   . SER A 1 224 ? 139.177 123.823 44.921 1.00 25.29 ? 224  SER A C   1 
ATOM   1702 O  O   . SER A 1 224 ? 139.073 122.702 44.418 1.00 25.45 ? 224  SER A O   1 
ATOM   1703 C  CB  . SER A 1 224 ? 136.872 123.406 45.744 1.00 18.29 ? 224  SER A CB  1 
ATOM   1704 O  OG  . SER A 1 224 ? 135.829 123.840 46.600 1.00 27.66 ? 224  SER A OG  1 
ATOM   1705 N  N   . GLY A 1 225 ? 140.252 124.584 44.753 1.00 15.94 ? 225  GLY A N   1 
ATOM   1706 C  CA  . GLY A 1 225 ? 141.352 124.107 43.937 1.00 15.58 ? 225  GLY A CA  1 
ATOM   1707 C  C   . GLY A 1 225 ? 142.459 125.120 43.708 1.00 21.19 ? 225  GLY A C   1 
ATOM   1708 O  O   . GLY A 1 225 ? 142.215 126.325 43.690 1.00 20.29 ? 225  GLY A O   1 
ATOM   1709 N  N   . SER A 1 226 ? 143.682 124.618 43.551 1.00 16.61 ? 226  SER A N   1 
ATOM   1710 C  CA  . SER A 1 226 ? 144.865 125.440 43.285 1.00 20.78 ? 226  SER A CA  1 
ATOM   1711 C  C   . SER A 1 226 ? 145.971 124.476 42.856 1.00 20.74 ? 226  SER A C   1 
ATOM   1712 O  O   . SER A 1 226 ? 145.930 123.299 43.215 1.00 20.33 ? 226  SER A O   1 
ATOM   1713 C  CB  . SER A 1 226 ? 145.274 126.245 44.529 1.00 13.25 ? 226  SER A CB  1 
ATOM   1714 O  OG  . SER A 1 226 ? 145.379 125.423 45.677 1.00 17.35 ? 226  SER A OG  1 
ATOM   1715 N  N   . PHE A 1 227 ? 146.950 124.956 42.092 1.00 19.74 ? 227  PHE A N   1 
ATOM   1716 C  CA  . PHE A 1 227 ? 148.009 124.069 41.602 1.00 23.25 ? 227  PHE A CA  1 
ATOM   1717 C  C   . PHE A 1 227 ? 148.852 123.393 42.674 1.00 23.84 ? 227  PHE A C   1 
ATOM   1718 O  O   . PHE A 1 227 ? 149.470 122.369 42.414 1.00 33.10 ? 227  PHE A O   1 
ATOM   1719 C  CB  . PHE A 1 227 ? 148.951 124.806 40.636 1.00 26.45 ? 227  PHE A CB  1 
ATOM   1720 C  CG  . PHE A 1 227 ? 149.770 125.887 41.287 1.00 35.13 ? 227  PHE A CG  1 
ATOM   1721 C  CD1 . PHE A 1 227 ? 149.431 127.228 41.127 1.00 39.58 ? 227  PHE A CD1 1 
ATOM   1722 C  CD2 . PHE A 1 227 ? 150.870 125.563 42.076 1.00 41.08 ? 227  PHE A CD2 1 
ATOM   1723 C  CE1 . PHE A 1 227 ? 150.173 128.231 41.742 1.00 41.41 ? 227  PHE A CE1 1 
ATOM   1724 C  CE2 . PHE A 1 227 ? 151.616 126.555 42.694 1.00 38.37 ? 227  PHE A CE2 1 
ATOM   1725 C  CZ  . PHE A 1 227 ? 151.267 127.893 42.527 1.00 45.64 ? 227  PHE A CZ  1 
ATOM   1726 N  N   . ASN A 1 228 ? 148.891 123.959 43.872 1.00 21.01 ? 228  ASN A N   1 
ATOM   1727 C  CA  . ASN A 1 228 ? 149.700 123.374 44.930 1.00 17.93 ? 228  ASN A CA  1 
ATOM   1728 C  C   . ASN A 1 228 ? 148.977 122.245 45.634 1.00 18.74 ? 228  ASN A C   1 
ATOM   1729 O  O   . ASN A 1 228 ? 149.472 121.715 46.626 1.00 26.93 ? 228  ASN A O   1 
ATOM   1730 C  CB  . ASN A 1 228 ? 150.133 124.448 45.938 1.00 12.45 ? 228  ASN A CB  1 
ATOM   1731 C  CG  . ASN A 1 228 ? 148.953 125.155 46.573 1.00 26.08 ? 228  ASN A CG  1 
ATOM   1732 O  OD1 . ASN A 1 228 ? 147.984 125.498 45.890 1.00 19.69 ? 228  ASN A OD1 1 
ATOM   1733 N  ND2 . ASN A 1 228 ? 149.028 125.388 47.880 1.00 12.28 ? 228  ASN A ND2 1 
ATOM   1734 N  N   . ALA A 1 229 ? 147.801 121.878 45.137 1.00 17.99 ? 229  ALA A N   1 
ATOM   1735 C  CA  . ALA A 1 229 ? 147.073 120.759 45.732 1.00 22.34 ? 229  ALA A CA  1 
ATOM   1736 C  C   . ALA A 1 229 ? 147.914 119.519 45.408 1.00 17.13 ? 229  ALA A C   1 
ATOM   1737 O  O   . ALA A 1 229 ? 148.511 119.434 44.335 1.00 14.87 ? 229  ALA A O   1 
ATOM   1738 C  CB  . ALA A 1 229 ? 145.688 120.639 45.120 1.00 20.85 ? 229  ALA A CB  1 
ATOM   1739 N  N   . PRO A 1 230 ? 147.974 118.542 46.325 1.00 19.04 ? 230  PRO A N   1 
ATOM   1740 C  CA  . PRO A 1 230 ? 148.785 117.348 46.042 1.00 18.48 ? 230  PRO A CA  1 
ATOM   1741 C  C   . PRO A 1 230 ? 148.431 116.562 44.774 1.00 21.72 ? 230  PRO A C   1 
ATOM   1742 O  O   . PRO A 1 230 ? 149.259 115.819 44.258 1.00 24.49 ? 230  PRO A O   1 
ATOM   1743 C  CB  . PRO A 1 230 ? 148.649 116.519 47.323 1.00 15.71 ? 230  PRO A CB  1 
ATOM   1744 C  CG  . PRO A 1 230 ? 147.307 116.914 47.856 1.00 21.21 ? 230  PRO A CG  1 
ATOM   1745 C  CD  . PRO A 1 230 ? 147.252 118.410 47.603 1.00 14.72 ? 230  PRO A CD  1 
ATOM   1746 N  N   . TRP A 1 231 ? 147.217 116.742 44.262 1.00 22.28 ? 231  TRP A N   1 
ATOM   1747 C  CA  . TRP A 1 231 ? 146.777 116.046 43.052 1.00 19.09 ? 231  TRP A CA  1 
ATOM   1748 C  C   . TRP A 1 231 ? 146.862 116.904 41.784 1.00 19.17 ? 231  TRP A C   1 
ATOM   1749 O  O   . TRP A 1 231 ? 146.614 116.415 40.686 1.00 21.49 ? 231  TRP A O   1 
ATOM   1750 C  CB  . TRP A 1 231 ? 145.323 115.595 43.217 1.00 18.27 ? 231  TRP A CB  1 
ATOM   1751 C  CG  . TRP A 1 231 ? 144.412 116.719 43.651 1.00 16.14 ? 231  TRP A CG  1 
ATOM   1752 C  CD1 . TRP A 1 231 ? 143.965 116.966 44.919 1.00 20.84 ? 231  TRP A CD1 1 
ATOM   1753 C  CD2 . TRP A 1 231 ? 143.905 117.783 42.836 1.00 10.15 ? 231  TRP A CD2 1 
ATOM   1754 N  NE1 . TRP A 1 231 ? 143.214 118.119 44.946 1.00 16.74 ? 231  TRP A NE1 1 
ATOM   1755 C  CE2 . TRP A 1 231 ? 143.162 118.642 43.682 1.00 15.04 ? 231  TRP A CE2 1 
ATOM   1756 C  CE3 . TRP A 1 231 ? 144.009 118.099 41.477 1.00 14.50 ? 231  TRP A CE3 1 
ATOM   1757 C  CZ2 . TRP A 1 231 ? 142.527 119.799 43.212 1.00 13.21 ? 231  TRP A CZ2 1 
ATOM   1758 C  CZ3 . TRP A 1 231 ? 143.376 119.256 41.008 1.00 10.71 ? 231  TRP A CZ3 1 
ATOM   1759 C  CH2 . TRP A 1 231 ? 142.648 120.088 41.877 1.00 9.23  ? 231  TRP A CH2 1 
ATOM   1760 N  N   . ALA A 1 232 ? 147.211 118.177 41.931 1.00 22.36 ? 232  ALA A N   1 
ATOM   1761 C  CA  . ALA A 1 232 ? 147.243 119.102 40.796 1.00 20.68 ? 232  ALA A CA  1 
ATOM   1762 C  C   . ALA A 1 232 ? 148.397 119.054 39.798 1.00 22.69 ? 232  ALA A C   1 
ATOM   1763 O  O   . ALA A 1 232 ? 148.202 119.368 38.624 1.00 30.01 ? 232  ALA A O   1 
ATOM   1764 C  CB  . ALA A 1 232 ? 147.077 120.529 41.311 1.00 18.92 ? 232  ALA A CB  1 
ATOM   1765 N  N   . VAL A 1 233 ? 149.597 118.694 40.236 1.00 22.32 ? 233  VAL A N   1 
ATOM   1766 C  CA  . VAL A 1 233 ? 150.719 118.645 39.300 1.00 25.17 ? 233  VAL A CA  1 
ATOM   1767 C  C   . VAL A 1 233 ? 151.415 117.290 39.290 1.00 28.25 ? 233  VAL A C   1 
ATOM   1768 O  O   . VAL A 1 233 ? 151.858 116.805 40.327 1.00 30.78 ? 233  VAL A O   1 
ATOM   1769 C  CB  . VAL A 1 233 ? 151.775 119.736 39.614 1.00 25.09 ? 233  VAL A CB  1 
ATOM   1770 C  CG1 . VAL A 1 233 ? 152.959 119.612 38.642 1.00 16.60 ? 233  VAL A CG1 1 
ATOM   1771 C  CG2 . VAL A 1 233 ? 151.142 121.125 39.501 1.00 18.89 ? 233  VAL A CG2 1 
ATOM   1772 N  N   . THR A 1 234 ? 151.499 116.682 38.112 1.00 28.51 ? 234  THR A N   1 
ATOM   1773 C  CA  . THR A 1 234 ? 152.155 115.389 37.958 1.00 30.14 ? 234  THR A CA  1 
ATOM   1774 C  C   . THR A 1 234 ? 153.666 115.598 37.882 1.00 32.41 ? 234  THR A C   1 
ATOM   1775 O  O   . THR A 1 234 ? 154.144 116.410 37.087 1.00 36.31 ? 234  THR A O   1 
ATOM   1776 C  CB  . THR A 1 234 ? 151.713 114.696 36.666 1.00 32.25 ? 234  THR A CB  1 
ATOM   1777 O  OG1 . THR A 1 234 ? 150.282 114.627 36.631 1.00 35.11 ? 234  THR A OG1 1 
ATOM   1778 C  CG2 . THR A 1 234 ? 152.302 113.287 36.588 1.00 35.29 ? 234  THR A CG2 1 
ATOM   1779 N  N   . SER A 1 235 ? 154.414 114.871 38.708 1.00 33.65 ? 235  SER A N   1 
ATOM   1780 C  CA  . SER A 1 235 ? 155.870 114.990 38.711 1.00 37.31 ? 235  SER A CA  1 
ATOM   1781 C  C   . SER A 1 235 ? 156.443 114.453 37.403 1.00 38.83 ? 235  SER A C   1 
ATOM   1782 O  O   . SER A 1 235 ? 155.825 113.614 36.739 1.00 32.41 ? 235  SER A O   1 
ATOM   1783 C  CB  . SER A 1 235 ? 156.471 114.204 39.874 1.00 36.78 ? 235  SER A CB  1 
ATOM   1784 O  OG  . SER A 1 235 ? 156.417 112.812 39.624 1.00 37.66 ? 235  SER A OG  1 
ATOM   1785 N  N   . LEU A 1 236 ? 157.622 114.942 37.035 1.00 38.56 ? 236  LEU A N   1 
ATOM   1786 C  CA  . LEU A 1 236 ? 158.286 114.508 35.810 1.00 42.09 ? 236  LEU A CA  1 
ATOM   1787 C  C   . LEU A 1 236 ? 158.540 113.000 35.840 1.00 42.20 ? 236  LEU A C   1 
ATOM   1788 O  O   . LEU A 1 236 ? 158.490 112.330 34.811 1.00 36.44 ? 236  LEU A O   1 
ATOM   1789 C  CB  . LEU A 1 236 ? 159.604 115.274 35.637 1.00 51.43 ? 236  LEU A CB  1 
ATOM   1790 C  CG  . LEU A 1 236 ? 160.847 114.556 35.097 1.00 54.84 ? 236  LEU A CG  1 
ATOM   1791 C  CD1 . LEU A 1 236 ? 161.328 115.222 33.821 0.00 54.28 ? 236  LEU A CD1 1 
ATOM   1792 C  CD2 . LEU A 1 236 ? 161.937 114.587 36.161 0.00 54.28 ? 236  LEU A CD2 1 
ATOM   1793 N  N   . TYR A 1 237 ? 158.791 112.470 37.030 1.00 41.23 ? 237  TYR A N   1 
ATOM   1794 C  CA  . TYR A 1 237 ? 159.047 111.048 37.179 1.00 43.80 ? 237  TYR A CA  1 
ATOM   1795 C  C   . TYR A 1 237 ? 157.757 110.272 36.943 1.00 46.28 ? 237  TYR A C   1 
ATOM   1796 O  O   . TYR A 1 237 ? 157.732 109.290 36.201 1.00 47.46 ? 237  TYR A O   1 
ATOM   1797 C  CB  . TYR A 1 237 ? 159.585 110.745 38.581 1.00 46.00 ? 237  TYR A CB  1 
ATOM   1798 C  CG  . TYR A 1 237 ? 160.338 109.438 38.669 0.00 52.96 ? 237  TYR A CG  1 
ATOM   1799 C  CD1 . TYR A 1 237 ? 161.596 109.297 38.082 0.00 54.34 ? 237  TYR A CD1 1 
ATOM   1800 C  CD2 . TYR A 1 237 ? 159.793 108.338 39.327 1.00 59.01 ? 237  TYR A CD2 1 
ATOM   1801 C  CE1 . TYR A 1 237 ? 162.292 108.092 38.149 0.00 56.19 ? 237  TYR A CE1 1 
ATOM   1802 C  CE2 . TYR A 1 237 ? 160.482 107.126 39.399 1.00 60.00 ? 237  TYR A CE2 1 
ATOM   1803 C  CZ  . TYR A 1 237 ? 161.729 107.012 38.809 0.00 57.37 ? 237  TYR A CZ  1 
ATOM   1804 O  OH  . TYR A 1 237 ? 162.413 105.820 38.881 0.00 57.42 ? 237  TYR A OH  1 
ATOM   1805 N  N   . GLU A 1 238 ? 156.685 110.716 37.585 1.00 44.53 ? 238  GLU A N   1 
ATOM   1806 C  CA  . GLU A 1 238 ? 155.393 110.068 37.431 1.00 41.43 ? 238  GLU A CA  1 
ATOM   1807 C  C   . GLU A 1 238 ? 154.959 110.079 35.968 1.00 37.29 ? 238  GLU A C   1 
ATOM   1808 O  O   . GLU A 1 238 ? 154.554 109.053 35.428 1.00 36.60 ? 238  GLU A O   1 
ATOM   1809 C  CB  . GLU A 1 238 ? 154.340 110.777 38.292 1.00 44.87 ? 238  GLU A CB  1 
ATOM   1810 C  CG  . GLU A 1 238 ? 154.321 110.343 39.752 1.00 46.19 ? 238  GLU A CG  1 
ATOM   1811 C  CD  . GLU A 1 238 ? 153.619 111.348 40.655 1.00 52.92 ? 238  GLU A CD  1 
ATOM   1812 O  OE1 . GLU A 1 238 ? 153.289 110.993 41.810 1.00 53.78 ? 238  GLU A OE1 1 
ATOM   1813 O  OE2 . GLU A 1 238 ? 153.410 112.500 40.216 1.00 48.86 ? 238  GLU A OE2 1 
ATOM   1814 N  N   . ALA A 1 239 ? 155.047 111.241 35.331 1.00 34.61 ? 239  ALA A N   1 
ATOM   1815 C  CA  . ALA A 1 239 ? 154.651 111.376 33.935 1.00 35.07 ? 239  ALA A CA  1 
ATOM   1816 C  C   . ALA A 1 239 ? 155.365 110.345 33.073 1.00 38.74 ? 239  ALA A C   1 
ATOM   1817 O  O   . ALA A 1 239 ? 154.745 109.654 32.264 1.00 38.26 ? 239  ALA A O   1 
ATOM   1818 C  CB  . ALA A 1 239 ? 154.966 112.776 33.437 1.00 32.53 ? 239  ALA A CB  1 
ATOM   1819 N  N   . ARG A 1 240 ? 156.677 110.255 33.256 1.00 39.94 ? 240  ARG A N   1 
ATOM   1820 C  CA  . ARG A 1 240 ? 157.511 109.327 32.511 1.00 41.98 ? 240  ARG A CA  1 
ATOM   1821 C  C   . ARG A 1 240 ? 157.056 107.880 32.728 1.00 37.91 ? 240  ARG A C   1 
ATOM   1822 O  O   . ARG A 1 240 ? 156.808 107.148 31.773 1.00 41.52 ? 240  ARG A O   1 
ATOM   1823 C  CB  . ARG A 1 240 ? 158.976 109.521 32.937 1.00 43.29 ? 240  ARG A CB  1 
ATOM   1824 C  CG  . ARG A 1 240 ? 159.922 108.500 32.366 1.00 53.55 ? 240  ARG A CG  1 
ATOM   1825 C  CD  . ARG A 1 240 ? 161.037 109.028 31.524 0.00 60.68 ? 240  ARG A CD  1 
ATOM   1826 N  NE  . ARG A 1 240 ? 161.515 107.876 30.754 1.00 68.04 ? 240  ARG A NE  1 
ATOM   1827 C  CZ  . ARG A 1 240 ? 161.938 107.897 29.495 1.00 73.42 ? 240  ARG A CZ  1 
ATOM   1828 N  NH1 . ARG A 1 240 ? 161.920 109.027 28.810 1.00 73.33 ? 240  ARG A NH1 1 
ATOM   1829 N  NH2 . ARG A 1 240 ? 162.479 106.798 28.963 1.00 81.87 ? 240  ARG A NH2 1 
ATOM   1830 N  N   . ASN A 1 241 ? 156.924 107.481 33.986 1.00 32.19 ? 241  ASN A N   1 
ATOM   1831 C  CA  . ASN A 1 241 ? 156.502 106.127 34.307 1.00 36.84 ? 241  ASN A CA  1 
ATOM   1832 C  C   . ASN A 1 241 ? 155.102 105.829 33.794 1.00 38.77 ? 241  ASN A C   1 
ATOM   1833 O  O   . ASN A 1 241 ? 154.760 104.671 33.556 1.00 43.11 ? 241  ASN A O   1 
ATOM   1834 C  CB  . ASN A 1 241 ? 156.535 105.900 35.818 1.00 40.49 ? 241  ASN A CB  1 
ATOM   1835 C  CG  . ASN A 1 241 ? 156.773 104.450 36.180 1.00 46.59 ? 241  ASN A CG  1 
ATOM   1836 O  OD1 . ASN A 1 241 ? 157.776 103.865 35.764 1.00 49.37 ? 241  ASN A OD1 1 
ATOM   1837 N  ND2 . ASN A 1 241 ? 155.868 103.864 36.957 1.00 54.34 ? 241  ASN A ND2 1 
ATOM   1838 N  N   . ARG A 1 242 ? 154.292 106.870 33.624 1.00 37.30 ? 242  ARG A N   1 
ATOM   1839 C  CA  . ARG A 1 242 ? 152.925 106.687 33.149 1.00 35.41 ? 242  ARG A CA  1 
ATOM   1840 C  C   . ARG A 1 242 ? 152.837 106.639 31.637 1.00 33.90 ? 242  ARG A C   1 
ATOM   1841 O  O   . ARG A 1 242 ? 152.085 105.834 31.083 1.00 31.13 ? 242  ARG A O   1 
ATOM   1842 C  CB  . ARG A 1 242 ? 152.021 107.781 33.717 1.00 35.09 ? 242  ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1 242 ? 151.891 107.663 35.220 1.00 42.68 ? 242  ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1 242 ? 151.188 108.831 35.869 1.00 38.98 ? 242  ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1 242 ? 151.270 108.696 37.319 1.00 44.19 ? 242  ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1 242 ? 150.654 109.483 38.192 1.00 38.34 ? 242  ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1 242 ? 149.894 110.485 37.773 1.00 44.26 ? 242  ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1 242 ? 150.794 109.258 39.489 1.00 30.85 ? 242  ARG A NH2 1 
ATOM   1849 N  N   . THR A 1 243 ? 153.606 107.492 30.971 1.00 31.67 ? 243  THR A N   1 
ATOM   1850 C  CA  . THR A 1 243 ? 153.625 107.506 29.515 1.00 38.54 ? 243  THR A CA  1 
ATOM   1851 C  C   . THR A 1 243 ? 154.119 106.140 29.034 1.00 39.07 ? 243  THR A C   1 
ATOM   1852 O  O   . THR A 1 243 ? 153.584 105.577 28.085 1.00 40.27 ? 243  THR A O   1 
ATOM   1853 C  CB  . THR A 1 243 ? 154.571 108.597 28.977 1.00 41.45 ? 243  THR A CB  1 
ATOM   1854 O  OG1 . THR A 1 243 ? 154.020 109.888 29.255 1.00 40.39 ? 243  THR A OG1 1 
ATOM   1855 C  CG2 . THR A 1 243 ? 154.773 108.446 27.473 1.00 39.44 ? 243  THR A CG2 1 
ATOM   1856 N  N   . LEU A 1 244 ? 155.136 105.609 29.704 1.00 35.56 ? 244  LEU A N   1 
ATOM   1857 C  CA  . LEU A 1 244 ? 155.692 104.311 29.338 1.00 40.66 ? 244  LEU A CA  1 
ATOM   1858 C  C   . LEU A 1 244 ? 154.745 103.162 29.674 1.00 40.81 ? 244  LEU A C   1 
ATOM   1859 O  O   . LEU A 1 244 ? 154.569 102.239 28.875 1.00 39.65 ? 244  LEU A O   1 
ATOM   1860 C  CB  . LEU A 1 244 ? 157.043 104.102 30.029 1.00 43.30 ? 244  LEU A CB  1 
ATOM   1861 C  CG  . LEU A 1 244 ? 158.150 105.030 29.521 1.00 45.39 ? 244  LEU A CG  1 
ATOM   1862 C  CD1 . LEU A 1 244 ? 159.426 104.789 30.305 1.00 45.88 ? 244  LEU A CD1 1 
ATOM   1863 C  CD2 . LEU A 1 244 ? 158.371 104.796 28.031 1.00 47.79 ? 244  LEU A CD2 1 
ATOM   1864 N  N   . ASN A 1 245 ? 154.138 103.213 30.855 1.00 39.14 ? 245  ASN A N   1 
ATOM   1865 C  CA  . ASN A 1 245 ? 153.196 102.178 31.260 1.00 37.14 ? 245  ASN A CA  1 
ATOM   1866 C  C   . ASN A 1 245 ? 152.022 102.125 30.281 1.00 38.02 ? 245  ASN A C   1 
ATOM   1867 O  O   . ASN A 1 245 ? 151.473 101.056 30.014 1.00 37.35 ? 245  ASN A O   1 
ATOM   1868 C  CB  . ASN A 1 245 ? 152.687 102.453 32.675 1.00 43.35 ? 245  ASN A CB  1 
ATOM   1869 C  CG  . ASN A 1 245 ? 153.666 102.008 33.745 1.00 45.48 ? 245  ASN A CG  1 
ATOM   1870 O  OD1 . ASN A 1 245 ? 154.846 101.794 33.469 1.00 47.98 ? 245  ASN A OD1 1 
ATOM   1871 N  ND2 . ASN A 1 245 ? 153.182 101.877 34.975 1.00 39.65 ? 245  ASN A ND2 1 
ATOM   1872 N  N   . LEU A 1 246 ? 151.630 103.281 29.754 1.00 39.55 ? 246  LEU A N   1 
ATOM   1873 C  CA  . LEU A 1 246 ? 150.530 103.333 28.795 1.00 39.62 ? 246  LEU A CA  1 
ATOM   1874 C  C   . LEU A 1 246 ? 151.027 102.716 27.487 1.00 40.93 ? 246  LEU A C   1 
ATOM   1875 O  O   . LEU A 1 246 ? 150.281 102.041 26.780 1.00 38.47 ? 246  LEU A O   1 
ATOM   1876 C  CB  . LEU A 1 246 ? 150.079 104.780 28.553 1.00 31.32 ? 246  LEU A CB  1 
ATOM   1877 C  CG  . LEU A 1 246 ? 148.916 104.958 27.570 1.00 24.26 ? 246  LEU A CG  1 
ATOM   1878 C  CD1 . LEU A 1 246 ? 147.698 104.264 28.125 1.00 20.90 ? 246  LEU A CD1 1 
ATOM   1879 C  CD2 . LEU A 1 246 ? 148.627 106.430 27.335 1.00 16.31 ? 246  LEU A CD2 1 
ATOM   1880 N  N   . ALA A 1 247 ? 152.297 102.952 27.174 1.00 41.40 ? 247  ALA A N   1 
ATOM   1881 C  CA  . ALA A 1 247 ? 152.898 102.404 25.967 1.00 41.53 ? 247  ALA A CA  1 
ATOM   1882 C  C   . ALA A 1 247 ? 152.838 100.880 26.027 1.00 41.98 ? 247  ALA A C   1 
ATOM   1883 O  O   . ALA A 1 247 ? 152.303 100.231 25.129 1.00 41.65 ? 247  ALA A O   1 
ATOM   1884 C  CB  . ALA A 1 247 ? 154.343 102.864 25.849 1.00 37.11 ? 247  ALA A CB  1 
ATOM   1885 N  N   . LYS A 1 248 ? 153.374 100.309 27.100 1.00 38.95 ? 248  LYS A N   1 
ATOM   1886 C  CA  . LYS A 1 248 ? 153.377 98.865  27.245 1.00 46.36 ? 248  LYS A CA  1 
ATOM   1887 C  C   . LYS A 1 248 ? 151.968 98.279  27.201 1.00 47.54 ? 248  LYS A C   1 
ATOM   1888 O  O   . LYS A 1 248 ? 151.744 97.237  26.588 1.00 57.42 ? 248  LYS A O   1 
ATOM   1889 C  CB  . LYS A 1 248 ? 154.072 98.457  28.547 1.00 45.07 ? 248  LYS A CB  1 
ATOM   1890 C  CG  . LYS A 1 248 ? 154.315 96.957  28.665 0.00 49.96 ? 248  LYS A CG  1 
ATOM   1891 C  CD  . LYS A 1 248 ? 155.144 96.604  29.893 1.00 54.22 ? 248  LYS A CD  1 
ATOM   1892 C  CE  . LYS A 1 248 ? 154.414 96.941  31.181 0.00 53.50 ? 248  LYS A CE  1 
ATOM   1893 N  NZ  . LYS A 1 248 ? 155.228 96.591  32.377 0.00 54.08 ? 248  LYS A NZ  1 
ATOM   1894 N  N   . LEU A 1 249 ? 151.017 98.952  27.839 1.00 46.46 ? 249  LEU A N   1 
ATOM   1895 C  CA  . LEU A 1 249 ? 149.640 98.472  27.872 1.00 41.42 ? 249  LEU A CA  1 
ATOM   1896 C  C   . LEU A 1 249 ? 148.940 98.474  26.518 1.00 43.25 ? 249  LEU A C   1 
ATOM   1897 O  O   . LEU A 1 249 ? 147.951 97.770  26.331 1.00 50.43 ? 249  LEU A O   1 
ATOM   1898 C  CB  . LEU A 1 249 ? 148.830 99.292  28.871 1.00 41.78 ? 249  LEU A CB  1 
ATOM   1899 C  CG  . LEU A 1 249 ? 149.138 98.968  30.331 1.00 44.27 ? 249  LEU A CG  1 
ATOM   1900 C  CD1 . LEU A 1 249 ? 148.698 100.109 31.230 1.00 51.37 ? 249  LEU A CD1 1 
ATOM   1901 C  CD2 . LEU A 1 249 ? 148.440 97.677  30.706 1.00 42.28 ? 249  LEU A CD2 1 
ATOM   1902 N  N   . THR A 1 250 ? 149.442 99.260  25.574 1.00 39.84 ? 250  THR A N   1 
ATOM   1903 C  CA  . THR A 1 250 ? 148.834 99.318  24.250 1.00 44.75 ? 250  THR A CA  1 
ATOM   1904 C  C   . THR A 1 250 ? 149.783 98.726  23.217 1.00 49.89 ? 250  THR A C   1 
ATOM   1905 O  O   . THR A 1 250 ? 149.623 98.939  22.013 1.00 52.32 ? 250  THR A O   1 
ATOM   1906 C  CB  . THR A 1 250 ? 148.507 100.773 23.828 1.00 45.48 ? 250  THR A CB  1 
ATOM   1907 O  OG1 . THR A 1 250 ? 149.724 101.521 23.691 1.00 45.04 ? 250  THR A OG1 1 
ATOM   1908 C  CG2 . THR A 1 250 ? 147.606 101.438 24.858 1.00 40.26 ? 250  THR A CG2 1 
ATOM   1909 N  N   . GLY A 1 251 ? 150.777 97.985  23.693 1.00 51.07 ? 251  GLY A N   1 
ATOM   1910 C  CA  . GLY A 1 251 ? 151.740 97.387  22.788 1.00 54.54 ? 251  GLY A CA  1 
ATOM   1911 C  C   . GLY A 1 251 ? 152.399 98.420  21.895 1.00 54.12 ? 251  GLY A C   1 
ATOM   1912 O  O   . GLY A 1 251 ? 152.536 98.214  20.689 1.00 53.70 ? 251  GLY A O   1 
ATOM   1913 N  N   . CYS A 1 252 ? 152.807 99.535  22.492 1.00 53.23 ? 252  CYS A N   1 
ATOM   1914 C  CA  . CYS A 1 252 ? 153.449 100.613 21.756 1.00 52.65 ? 252  CYS A CA  1 
ATOM   1915 C  C   . CYS A 1 252 ? 154.862 100.897 22.234 1.00 54.45 ? 252  CYS A C   1 
ATOM   1916 O  O   . CYS A 1 252 ? 155.481 101.860 21.787 1.00 55.48 ? 252  CYS A O   1 
ATOM   1917 C  CB  . CYS A 1 252 ? 152.623 101.893 21.865 1.00 55.21 ? 252  CYS A CB  1 
ATOM   1918 S  SG  . CYS A 1 252 ? 151.274 102.049 20.650 1.00 62.30 ? 252  CYS A SG  1 
ATOM   1919 N  N   . SER A 1 253 ? 155.372 100.067 23.141 1.00 55.26 ? 253  SER A N   1 
ATOM   1920 C  CA  . SER A 1 253 ? 156.724 100.260 23.657 1.00 56.02 ? 253  SER A CA  1 
ATOM   1921 C  C   . SER A 1 253 ? 157.728 100.216 22.512 1.00 60.21 ? 253  SER A C   1 
ATOM   1922 O  O   . SER A 1 253 ? 157.704 99.300  21.691 1.00 63.45 ? 253  SER A O   1 
ATOM   1923 C  CB  . SER A 1 253 ? 157.075 99.183  24.689 1.00 51.05 ? 253  SER A CB  1 
ATOM   1924 O  OG  . SER A 1 253 ? 156.286 99.301  25.863 1.00 46.63 ? 253  SER A OG  1 
ATOM   1925 N  N   . ARG A 1 254 ? 158.604 101.215 22.461 1.00 64.39 ? 254  ARG A N   1 
ATOM   1926 C  CA  . ARG A 1 254 ? 159.623 101.303 21.419 1.00 66.05 ? 254  ARG A CA  1 
ATOM   1927 C  C   . ARG A 1 254 ? 160.984 101.668 22.013 1.00 67.18 ? 254  ARG A C   1 
ATOM   1928 O  O   . ARG A 1 254 ? 161.868 102.168 21.314 1.00 68.75 ? 254  ARG A O   1 
ATOM   1929 C  CB  . ARG A 1 254 ? 159.216 102.347 20.372 1.00 65.22 ? 254  ARG A CB  1 
ATOM   1930 C  CG  . ARG A 1 254 ? 158.570 101.782 19.107 1.00 60.67 ? 254  ARG A CG  1 
ATOM   1931 C  CD  . ARG A 1 254 ? 157.379 100.892 19.406 1.00 57.82 ? 254  ARG A CD  1 
ATOM   1932 N  NE  . ARG A 1 254 ? 156.661 100.522 18.191 1.00 55.27 ? 254  ARG A NE  1 
ATOM   1933 C  CZ  . ARG A 1 254 ? 155.648 99.665  18.154 1.00 57.53 ? 254  ARG A CZ  1 
ATOM   1934 N  NH1 . ARG A 1 254 ? 155.051 99.394  17.001 1.00 60.23 ? 254  ARG A NH1 1 
ATOM   1935 N  NH2 . ARG A 1 254 ? 155.237 99.070  19.266 1.00 54.65 ? 254  ARG A NH2 1 
ATOM   1936 N  N   . ASN A 1 256 ? 162.886 104.791 20.333 1.00 54.96 ? 256  ASN A N   1 
ATOM   1937 C  CA  . ASN A 1 256 ? 162.566 106.128 19.844 1.00 64.20 ? 256  ASN A CA  1 
ATOM   1938 C  C   . ASN A 1 256 ? 161.219 106.583 20.399 1.00 67.18 ? 256  ASN A C   1 
ATOM   1939 O  O   . ASN A 1 256 ? 160.161 106.156 19.928 1.00 68.90 ? 256  ASN A O   1 
ATOM   1940 C  CB  . ASN A 1 256 ? 162.522 106.143 18.312 1.00 64.54 ? 256  ASN A CB  1 
ATOM   1941 C  CG  . ASN A 1 256 ? 163.389 107.240 17.711 1.00 65.22 ? 256  ASN A CG  1 
ATOM   1942 O  OD1 . ASN A 1 256 ? 164.602 107.269 17.920 0.00 64.00 ? 256  ASN A OD1 1 
ATOM   1943 N  ND2 . ASN A 1 256 ? 162.770 108.143 16.961 1.00 61.58 ? 256  ASN A ND2 1 
ATOM   1944 N  N   . GLU A 1 257 ? 161.268 107.458 21.398 1.00 67.00 ? 257  GLU A N   1 
ATOM   1945 C  CA  . GLU A 1 257 ? 160.061 107.970 22.031 1.00 64.50 ? 257  GLU A CA  1 
ATOM   1946 C  C   . GLU A 1 257 ? 159.088 108.553 21.023 1.00 60.46 ? 257  GLU A C   1 
ATOM   1947 O  O   . GLU A 1 257 ? 157.878 108.535 21.239 1.00 59.52 ? 257  GLU A O   1 
ATOM   1948 C  CB  . GLU A 1 257 ? 160.423 109.032 23.064 1.00 65.67 ? 257  GLU A CB  1 
ATOM   1949 C  CG  . GLU A 1 257 ? 161.455 108.564 24.062 1.00 69.37 ? 257  GLU A CG  1 
ATOM   1950 C  CD  . GLU A 1 257 ? 161.552 109.480 25.253 1.00 69.40 ? 257  GLU A CD  1 
ATOM   1951 O  OE1 . GLU A 1 257 ? 161.716 110.702 25.051 1.00 66.76 ? 257  GLU A OE1 1 
ATOM   1952 O  OE2 . GLU A 1 257 ? 161.463 108.971 26.390 1.00 70.48 ? 257  GLU A OE2 1 
ATOM   1953 N  N   . THR A 1 258 ? 159.616 109.074 19.921 1.00 57.26 ? 258  THR A N   1 
ATOM   1954 C  CA  . THR A 1 258 ? 158.762 109.648 18.894 1.00 54.91 ? 258  THR A CA  1 
ATOM   1955 C  C   . THR A 1 258 ? 157.945 108.554 18.212 1.00 54.41 ? 258  THR A C   1 
ATOM   1956 O  O   . THR A 1 258 ? 156.796 108.778 17.833 1.00 58.87 ? 258  THR A O   1 
ATOM   1957 C  CB  . THR A 1 258 ? 159.585 110.403 17.840 1.00 53.01 ? 258  THR A CB  1 
ATOM   1958 O  OG1 . THR A 1 258 ? 160.363 111.417 18.484 1.00 57.37 ? 258  THR A OG1 1 
ATOM   1959 C  CG2 . THR A 1 258 ? 158.662 111.058 16.817 1.00 54.53 ? 258  THR A CG2 1 
ATOM   1960 N  N   . GLU A 1 259 ? 158.532 107.370 18.058 1.00 50.72 ? 259  GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 259 ? 157.812 106.270 17.433 1.00 51.87 ? 259  GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 259 ? 156.705 105.793 18.361 1.00 48.15 ? 259  GLU A C   1 
ATOM   1963 O  O   . GLU A 1 259 ? 155.691 105.264 17.910 1.00 53.22 ? 259  GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 259 ? 158.752 105.106 17.105 0.50 49.77 ? 259  GLU A CB  1 
ATOM   1965 C  CG  . GLU A 1 259 ? 159.678 105.363 15.925 0.00 49.58 ? 259  GLU A CG  1 
ATOM   1966 C  CD  . GLU A 1 259 ? 160.400 104.110 15.464 0.00 48.95 ? 259  GLU A CD  1 
ATOM   1967 O  OE1 . GLU A 1 259 ? 161.329 104.227 14.636 0.00 48.66 ? 259  GLU A OE1 1 
ATOM   1968 O  OE2 . GLU A 1 259 ? 160.035 103.007 15.923 0.00 48.66 ? 259  GLU A OE2 1 
ATOM   1969 N  N   . ILE A 1 260 ? 156.899 105.981 19.660 1.00 46.61 ? 260  ILE A N   1 
ATOM   1970 C  CA  . ILE A 1 260 ? 155.890 105.574 20.627 1.00 48.85 ? 260  ILE A CA  1 
ATOM   1971 C  C   . ILE A 1 260 ? 154.622 106.375 20.385 1.00 46.30 ? 260  ILE A C   1 
ATOM   1972 O  O   . ILE A 1 260 ? 153.515 105.836 20.432 1.00 49.63 ? 260  ILE A O   1 
ATOM   1973 C  CB  . ILE A 1 260 ? 156.348 105.828 22.077 1.00 47.82 ? 260  ILE A CB  1 
ATOM   1974 C  CG1 . ILE A 1 260 ? 157.583 104.985 22.391 1.00 49.60 ? 260  ILE A CG1 1 
ATOM   1975 C  CG2 . ILE A 1 260 ? 155.222 105.492 23.040 1.00 43.32 ? 260  ILE A CG2 1 
ATOM   1976 C  CD1 . ILE A 1 260 ? 158.038 105.097 23.827 1.00 55.38 ? 260  ILE A CD1 1 
ATOM   1977 N  N   . ILE A 1 261 ? 154.794 107.666 20.124 1.00 42.85 ? 261  ILE A N   1 
ATOM   1978 C  CA  . ILE A 1 261 ? 153.667 108.550 19.883 1.00 43.18 ? 261  ILE A CA  1 
ATOM   1979 C  C   . ILE A 1 261 ? 152.996 108.214 18.563 1.00 43.34 ? 261  ILE A C   1 
ATOM   1980 O  O   . ILE A 1 261 ? 151.769 108.249 18.456 1.00 41.16 ? 261  ILE A O   1 
ATOM   1981 C  CB  . ILE A 1 261 ? 154.108 110.030 19.857 1.00 42.98 ? 261  ILE A CB  1 
ATOM   1982 C  CG1 . ILE A 1 261 ? 154.935 110.351 21.104 1.00 43.25 ? 261  ILE A CG1 1 
ATOM   1983 C  CG2 . ILE A 1 261 ? 152.885 110.934 19.802 1.00 37.49 ? 261  ILE A CG2 1 
ATOM   1984 C  CD1 . ILE A 1 261 ? 154.240 110.026 22.412 1.00 44.98 ? 261  ILE A CD1 1 
ATOM   1985 N  N   . LYS A 1 262 ? 153.804 107.888 17.559 1.00 46.46 ? 262  LYS A N   1 
ATOM   1986 C  CA  . LYS A 1 262 ? 153.277 107.541 16.243 1.00 49.95 ? 262  LYS A CA  1 
ATOM   1987 C  C   . LYS A 1 262 ? 152.380 106.313 16.388 1.00 45.74 ? 262  LYS A C   1 
ATOM   1988 O  O   . LYS A 1 262 ? 151.317 106.219 15.766 1.00 42.63 ? 262  LYS A O   1 
ATOM   1989 C  CB  . LYS A 1 262 ? 154.426 107.253 15.270 1.00 51.56 ? 262  LYS A CB  1 
ATOM   1990 C  CG  . LYS A 1 262 ? 153.969 106.969 13.843 1.00 64.97 ? 262  LYS A CG  1 
ATOM   1991 C  CD  . LYS A 1 262 ? 155.146 106.682 12.914 1.00 71.46 ? 262  LYS A CD  1 
ATOM   1992 C  CE  . LYS A 1 262 ? 154.678 106.324 11.508 1.00 69.01 ? 262  LYS A CE  1 
ATOM   1993 N  NZ  . LYS A 1 262 ? 153.813 105.110 11.504 0.00 70.12 ? 262  LYS A NZ  1 
ATOM   1994 N  N   . CYS A 1 263 ? 152.819 105.384 17.230 1.00 42.65 ? 263  CYS A N   1 
ATOM   1995 C  CA  . CYS A 1 263 ? 152.078 104.156 17.495 1.00 50.67 ? 263  CYS A CA  1 
ATOM   1996 C  C   . CYS A 1 263 ? 150.769 104.487 18.208 1.00 49.67 ? 263  CYS A C   1 
ATOM   1997 O  O   . CYS A 1 263 ? 149.703 104.001 17.824 1.00 48.32 ? 263  CYS A O   1 
ATOM   1998 C  CB  . CYS A 1 263 ? 152.928 103.223 18.363 1.00 56.13 ? 263  CYS A CB  1 
ATOM   1999 S  SG  . CYS A 1 263 ? 152.183 101.637 18.877 1.00 69.00 ? 263  CYS A SG  1 
ATOM   2000 N  N   . LEU A 1 264 ? 150.859 105.319 19.246 1.00 48.34 ? 264  LEU A N   1 
ATOM   2001 C  CA  . LEU A 1 264 ? 149.687 105.722 20.017 1.00 45.79 ? 264  LEU A CA  1 
ATOM   2002 C  C   . LEU A 1 264 ? 148.697 106.523 19.183 1.00 42.00 ? 264  LEU A C   1 
ATOM   2003 O  O   . LEU A 1 264 ? 147.508 106.560 19.490 1.00 41.71 ? 264  LEU A O   1 
ATOM   2004 C  CB  . LEU A 1 264 ? 150.106 106.542 21.238 1.00 40.30 ? 264  LEU A CB  1 
ATOM   2005 C  CG  . LEU A 1 264 ? 150.638 105.752 22.434 1.00 45.21 ? 264  LEU A CG  1 
ATOM   2006 C  CD1 . LEU A 1 264 ? 151.276 106.704 23.432 1.00 43.13 ? 264  LEU A CD1 1 
ATOM   2007 C  CD2 . LEU A 1 264 ? 149.501 104.966 23.081 1.00 45.43 ? 264  LEU A CD2 1 
ATOM   2008 N  N   . ARG A 1 265 ? 149.187 107.165 18.128 1.00 39.22 ? 265  ARG A N   1 
ATOM   2009 C  CA  . ARG A 1 265 ? 148.315 107.952 17.273 1.00 41.11 ? 265  ARG A CA  1 
ATOM   2010 C  C   . ARG A 1 265 ? 147.504 107.077 16.316 1.00 45.13 ? 265  ARG A C   1 
ATOM   2011 O  O   . ARG A 1 265 ? 146.629 107.568 15.604 1.00 45.10 ? 265  ARG A O   1 
ATOM   2012 C  CB  . ARG A 1 265 ? 149.125 108.988 16.484 1.00 43.60 ? 265  ARG A CB  1 
ATOM   2013 C  CG  . ARG A 1 265 ? 149.787 110.050 17.349 1.00 49.32 ? 265  ARG A CG  1 
ATOM   2014 C  CD  . ARG A 1 265 ? 149.742 111.415 16.687 1.00 54.14 ? 265  ARG A CD  1 
ATOM   2015 N  NE  . ARG A 1 265 ? 151.073 111.961 16.476 1.00 67.30 ? 265  ARG A NE  1 
ATOM   2016 C  CZ  . ARG A 1 265 ? 151.900 111.558 15.519 1.00 73.59 ? 265  ARG A CZ  1 
ATOM   2017 N  NH1 . ARG A 1 265 ? 151.532 110.598 14.680 1.00 77.51 ? 265  ARG A NH1 1 
ATOM   2018 N  NH2 . ARG A 1 265 ? 153.088 112.129 15.393 1.00 77.17 ? 265  ARG A NH2 1 
ATOM   2019 N  N   . ASN A 1 266 ? 147.796 105.780 16.293 1.00 49.71 ? 266  ASN A N   1 
ATOM   2020 C  CA  . ASN A 1 266 ? 147.055 104.866 15.432 1.00 53.22 ? 266  ASN A CA  1 
ATOM   2021 C  C   . ASN A 1 266 ? 146.015 104.139 16.264 1.00 51.27 ? 266  ASN A C   1 
ATOM   2022 O  O   . ASN A 1 266 ? 145.047 103.602 15.733 1.00 56.72 ? 266  ASN A O   1 
ATOM   2023 C  CB  . ASN A 1 266 ? 147.990 103.855 14.765 1.00 54.97 ? 266  ASN A CB  1 
ATOM   2024 C  CG  . ASN A 1 266 ? 148.881 104.491 13.723 1.00 59.13 ? 266  ASN A CG  1 
ATOM   2025 O  OD1 . ASN A 1 266 ? 148.417 105.272 12.891 1.00 61.56 ? 266  ASN A OD1 1 
ATOM   2026 N  ND2 . ASN A 1 266 ? 150.166 104.157 13.756 1.00 66.59 ? 266  ASN A ND2 1 
ATOM   2027 N  N   . LYS A 1 267 ? 146.224 104.131 17.575 1.00 49.49 ? 267  LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 267 ? 145.302 103.485 18.496 1.00 49.57 ? 267  LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 267 ? 143.959 104.207 18.525 1.00 47.86 ? 267  LYS A C   1 
ATOM   2030 O  O   . LYS A 1 267 ? 143.882 105.408 18.278 1.00 49.39 ? 267  LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 267 ? 145.905 103.462 19.901 1.00 53.36 ? 267  LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 267 ? 147.135 102.579 20.024 1.00 57.25 ? 267  LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 267 ? 146.758 101.116 19.876 1.00 60.22 ? 267  LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 267 ? 147.983 100.228 19.764 1.00 69.01 ? 267  LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 267 ? 148.766 100.513 18.526 1.00 74.29 ? 267  LYS A NZ  1 
ATOM   2036 N  N   . ASP A 1 268 ? 142.898 103.464 18.809 1.00 51.08 ? 268  ASP A N   1 
ATOM   2037 C  CA  . ASP A 1 268 ? 141.566 104.046 18.883 1.00 48.71 ? 268  ASP A CA  1 
ATOM   2038 C  C   . ASP A 1 268 ? 141.389 104.697 20.249 1.00 46.24 ? 268  ASP A C   1 
ATOM   2039 O  O   . ASP A 1 268 ? 141.805 104.142 21.270 1.00 43.05 ? 268  ASP A O   1 
ATOM   2040 C  CB  . ASP A 1 268 ? 140.499 102.967 18.675 1.00 52.93 ? 268  ASP A CB  1 
ATOM   2041 C  CG  . ASP A 1 268 ? 140.399 102.517 17.231 0.50 51.66 ? 268  ASP A CG  1 
ATOM   2042 O  OD1 . ASP A 1 268 ? 139.655 101.551 16.961 0.00 52.51 ? 268  ASP A OD1 1 
ATOM   2043 O  OD2 . ASP A 1 268 ? 141.058 103.131 16.365 0.00 52.51 ? 268  ASP A OD2 1 
ATOM   2044 N  N   . PRO A 1 269 ? 140.758 105.884 20.285 1.00 43.57 ? 269  PRO A N   1 
ATOM   2045 C  CA  . PRO A 1 269 ? 140.520 106.627 21.523 1.00 38.87 ? 269  PRO A CA  1 
ATOM   2046 C  C   . PRO A 1 269 ? 140.126 105.725 22.681 1.00 36.29 ? 269  PRO A C   1 
ATOM   2047 O  O   . PRO A 1 269 ? 140.583 105.913 23.808 1.00 31.88 ? 269  PRO A O   1 
ATOM   2048 C  CB  . PRO A 1 269 ? 139.410 107.590 21.131 1.00 41.49 ? 269  PRO A CB  1 
ATOM   2049 C  CG  . PRO A 1 269 ? 139.743 107.895 19.712 1.00 43.65 ? 269  PRO A CG  1 
ATOM   2050 C  CD  . PRO A 1 269 ? 140.078 106.535 19.151 1.00 42.51 ? 269  PRO A CD  1 
ATOM   2051 N  N   . GLN A 1 270 ? 139.287 104.735 22.403 1.00 35.40 ? 270  GLN A N   1 
ATOM   2052 C  CA  . GLN A 1 270 ? 138.852 103.825 23.451 1.00 40.03 ? 270  GLN A CA  1 
ATOM   2053 C  C   . GLN A 1 270 ? 140.006 102.977 23.981 1.00 35.78 ? 270  GLN A C   1 
ATOM   2054 O  O   . GLN A 1 270 ? 140.146 102.783 25.186 1.00 36.48 ? 270  GLN A O   1 
ATOM   2055 C  CB  . GLN A 1 270 ? 137.737 102.906 22.949 1.00 39.62 ? 270  GLN A CB  1 
ATOM   2056 C  CG  . GLN A 1 270 ? 136.518 102.853 23.876 1.00 56.14 ? 270  GLN A CG  1 
ATOM   2057 C  CD  . GLN A 1 270 ? 136.864 102.631 25.352 1.00 64.92 ? 270  GLN A CD  1 
ATOM   2058 O  OE1 . GLN A 1 270 ? 136.024 102.828 26.230 1.00 66.71 ? 270  GLN A OE1 1 
ATOM   2059 N  NE2 . GLN A 1 270 ? 138.089 102.213 25.625 1.00 71.09 ? 270  GLN A NE2 1 
ATOM   2060 N  N   . GLU A 1 271 ? 140.842 102.465 23.094 1.00 39.27 ? 271  GLU A N   1 
ATOM   2061 C  CA  . GLU A 1 271 ? 141.946 101.653 23.574 1.00 47.09 ? 271  GLU A CA  1 
ATOM   2062 C  C   . GLU A 1 271 ? 142.785 102.472 24.558 1.00 50.33 ? 271  GLU A C   1 
ATOM   2063 O  O   . GLU A 1 271 ? 143.268 101.954 25.567 1.00 51.62 ? 271  GLU A O   1 
ATOM   2064 C  CB  . GLU A 1 271 ? 142.799 101.176 22.402 1.00 52.70 ? 271  GLU A CB  1 
ATOM   2065 C  CG  . GLU A 1 271 ? 143.920 100.239 22.804 1.00 59.06 ? 271  GLU A CG  1 
ATOM   2066 C  CD  . GLU A 1 271 ? 144.501 99.473  21.628 0.50 57.36 ? 271  GLU A CD  1 
ATOM   2067 O  OE1 . GLU A 1 271 ? 145.456 98.695  21.843 0.50 55.95 ? 271  GLU A OE1 1 
ATOM   2068 O  OE2 . GLU A 1 271 ? 144.004 99.644  20.493 0.50 54.14 ? 271  GLU A OE2 1 
ATOM   2069 N  N   . ILE A 1 272 ? 142.939 103.760 24.265 1.00 46.86 ? 272  ILE A N   1 
ATOM   2070 C  CA  . ILE A 1 272 ? 143.703 104.644 25.127 1.00 41.18 ? 272  ILE A CA  1 
ATOM   2071 C  C   . ILE A 1 272 ? 142.962 104.903 26.438 1.00 41.33 ? 272  ILE A C   1 
ATOM   2072 O  O   . ILE A 1 272 ? 143.552 104.813 27.514 1.00 43.46 ? 272  ILE A O   1 
ATOM   2073 C  CB  . ILE A 1 272 ? 144.010 105.977 24.402 1.00 44.25 ? 272  ILE A CB  1 
ATOM   2074 C  CG1 . ILE A 1 272 ? 145.202 105.776 23.462 1.00 46.52 ? 272  ILE A CG1 1 
ATOM   2075 C  CG2 . ILE A 1 272 ? 144.308 107.083 25.409 1.00 44.04 ? 272  ILE A CG2 1 
ATOM   2076 C  CD1 . ILE A 1 272 ? 145.278 106.769 22.328 1.00 43.38 ? 272  ILE A CD1 1 
ATOM   2077 N  N   . LEU A 1 273 ? 141.673 105.213 26.358 1.00 32.69 ? 273  LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 273 ? 140.899 105.474 27.567 1.00 36.42 ? 273  LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 273 ? 140.865 104.256 28.483 1.00 40.97 ? 273  LEU A C   1 
ATOM   2080 O  O   . LEU A 1 273 ? 140.993 104.372 29.704 1.00 41.66 ? 273  LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 273 ? 139.466 105.872 27.215 1.00 31.82 ? 273  LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 273 ? 139.229 107.279 26.664 1.00 42.72 ? 273  LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 273 ? 137.741 107.456 26.396 1.00 46.95 ? 273  LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 273 ? 139.711 108.325 27.664 1.00 37.84 ? 273  LEU A CD2 1 
ATOM   2085 N  N   . LEU A 1 274 ? 140.687 103.086 27.884 1.00 40.06 ? 274  LEU A N   1 
ATOM   2086 C  CA  . LEU A 1 274 ? 140.621 101.845 28.633 1.00 38.52 ? 274  LEU A CA  1 
ATOM   2087 C  C   . LEU A 1 274 ? 141.886 101.571 29.436 1.00 34.04 ? 274  LEU A C   1 
ATOM   2088 O  O   . LEU A 1 274 ? 141.826 101.040 30.542 1.00 37.47 ? 274  LEU A O   1 
ATOM   2089 C  CB  . LEU A 1 274 ? 140.367 100.678 27.678 1.00 41.34 ? 274  LEU A CB  1 
ATOM   2090 C  CG  . LEU A 1 274 ? 140.527 99.272  28.263 1.00 41.67 ? 274  LEU A CG  1 
ATOM   2091 C  CD1 . LEU A 1 274 ? 139.397 98.984  29.237 0.00 43.66 ? 274  LEU A CD1 1 
ATOM   2092 C  CD2 . LEU A 1 274 ? 140.531 98.255  27.135 0.00 43.66 ? 274  LEU A CD2 1 
ATOM   2093 N  N   . ASN A 1 275 ? 143.034 101.940 28.888 1.00 32.24 ? 275  ASN A N   1 
ATOM   2094 C  CA  . ASN A 1 275 ? 144.293 101.678 29.572 1.00 40.96 ? 275  ASN A CA  1 
ATOM   2095 C  C   . ASN A 1 275 ? 144.812 102.763 30.517 1.00 42.55 ? 275  ASN A C   1 
ATOM   2096 O  O   . ASN A 1 275 ? 145.708 102.508 31.323 1.00 42.64 ? 275  ASN A O   1 
ATOM   2097 C  CB  . ASN A 1 275 ? 145.347 101.312 28.529 1.00 43.20 ? 275  ASN A CB  1 
ATOM   2098 C  CG  . ASN A 1 275 ? 145.016 100.013 27.819 1.00 43.87 ? 275  ASN A CG  1 
ATOM   2099 O  OD1 . ASN A 1 275 ? 144.948 98.960  28.445 1.00 43.17 ? 275  ASN A OD1 1 
ATOM   2100 N  ND2 . ASN A 1 275 ? 144.792 100.085 26.514 1.00 41.39 ? 275  ASN A ND2 1 
ATOM   2101 N  N   . GLU A 1 276 ? 144.243 103.961 30.427 1.00 42.40 ? 276  GLU A N   1 
ATOM   2102 C  CA  . GLU A 1 276 ? 144.648 105.068 31.287 1.00 44.88 ? 276  GLU A CA  1 
ATOM   2103 C  C   . GLU A 1 276 ? 144.499 104.713 32.763 1.00 43.18 ? 276  GLU A C   1 
ATOM   2104 O  O   . GLU A 1 276 ? 145.317 105.106 33.597 1.00 41.22 ? 276  GLU A O   1 
ATOM   2105 C  CB  . GLU A 1 276 ? 143.796 106.305 30.997 1.00 42.51 ? 276  GLU A CB  1 
ATOM   2106 C  CG  . GLU A 1 276 ? 144.149 107.035 29.721 1.00 53.95 ? 276  GLU A CG  1 
ATOM   2107 C  CD  . GLU A 1 276 ? 143.339 108.314 29.543 1.00 61.58 ? 276  GLU A CD  1 
ATOM   2108 O  OE1 . GLU A 1 276 ? 142.873 108.878 30.559 1.00 56.34 ? 276  GLU A OE1 1 
ATOM   2109 O  OE2 . GLU A 1 276 ? 143.181 108.765 28.389 1.00 62.10 ? 276  GLU A OE2 1 
ATOM   2110 N  N   . ALA A 1 277 ? 143.449 103.962 33.072 1.00 40.07 ? 277  ALA A N   1 
ATOM   2111 C  CA  . ALA A 1 277 ? 143.149 103.571 34.440 1.00 43.38 ? 277  ALA A CA  1 
ATOM   2112 C  C   . ALA A 1 277 ? 144.150 102.649 35.135 1.00 47.82 ? 277  ALA A C   1 
ATOM   2113 O  O   . ALA A 1 277 ? 144.125 102.532 36.358 1.00 53.62 ? 277  ALA A O   1 
ATOM   2114 C  CB  . ALA A 1 277 ? 141.764 102.949 34.488 1.00 45.80 ? 277  ALA A CB  1 
ATOM   2115 N  N   . PHE A 1 278 ? 145.032 101.996 34.385 1.00 49.24 ? 278  PHE A N   1 
ATOM   2116 C  CA  . PHE A 1 278 ? 145.988 101.090 35.015 1.00 47.01 ? 278  PHE A CA  1 
ATOM   2117 C  C   . PHE A 1 278 ? 147.434 101.572 34.968 1.00 50.79 ? 278  PHE A C   1 
ATOM   2118 O  O   . PHE A 1 278 ? 148.350 100.840 35.358 1.00 44.98 ? 278  PHE A O   1 
ATOM   2119 C  CB  . PHE A 1 278 ? 145.902 99.705  34.370 1.00 45.75 ? 278  PHE A CB  1 
ATOM   2120 C  CG  . PHE A 1 278 ? 144.502 99.193  34.217 1.00 49.04 ? 278  PHE A CG  1 
ATOM   2121 C  CD1 . PHE A 1 278 ? 143.804 99.395  33.032 1.00 55.20 ? 278  PHE A CD1 1 
ATOM   2122 C  CD2 . PHE A 1 278 ? 143.871 98.522  35.260 1.00 51.38 ? 278  PHE A CD2 1 
ATOM   2123 C  CE1 . PHE A 1 278 ? 142.500 98.934  32.884 1.00 57.75 ? 278  PHE A CE1 1 
ATOM   2124 C  CE2 . PHE A 1 278 ? 142.561 98.057  35.123 1.00 52.81 ? 278  PHE A CE2 1 
ATOM   2125 C  CZ  . PHE A 1 278 ? 141.876 98.265  33.932 0.00 55.16 ? 278  PHE A CZ  1 
ATOM   2126 N  N   . VAL A 1 279 ? 147.648 102.797 34.495 1.00 49.11 ? 279  VAL A N   1 
ATOM   2127 C  CA  . VAL A 1 279 ? 149.004 103.329 34.408 1.00 50.97 ? 279  VAL A CA  1 
ATOM   2128 C  C   . VAL A 1 279 ? 149.626 103.494 35.792 1.00 47.52 ? 279  VAL A C   1 
ATOM   2129 O  O   . VAL A 1 279 ? 150.840 103.424 35.943 1.00 48.33 ? 279  VAL A O   1 
ATOM   2130 C  CB  . VAL A 1 279 ? 149.035 104.686 33.670 1.00 53.16 ? 279  VAL A CB  1 
ATOM   2131 C  CG1 . VAL A 1 279 ? 148.421 104.534 32.290 1.00 54.73 ? 279  VAL A CG1 1 
ATOM   2132 C  CG2 . VAL A 1 279 ? 148.294 105.737 34.470 1.00 54.30 ? 279  VAL A CG2 1 
ATOM   2133 N  N   . VAL A 1 280 ? 148.787 103.706 36.798 1.00 49.74 ? 280  VAL A N   1 
ATOM   2134 C  CA  . VAL A 1 280 ? 149.257 103.871 38.168 1.00 53.22 ? 280  VAL A CA  1 
ATOM   2135 C  C   . VAL A 1 280 ? 149.028 102.587 38.964 1.00 58.76 ? 280  VAL A C   1 
ATOM   2136 O  O   . VAL A 1 280 ? 147.901 102.096 39.051 1.00 60.85 ? 280  VAL A O   1 
ATOM   2137 C  CB  . VAL A 1 280 ? 148.522 105.038 38.866 1.00 53.37 ? 280  VAL A CB  1 
ATOM   2138 C  CG1 . VAL A 1 280 ? 148.994 105.171 40.306 1.00 50.12 ? 280  VAL A CG1 1 
ATOM   2139 C  CG2 . VAL A 1 280 ? 148.768 106.330 38.105 1.00 49.74 ? 280  VAL A CG2 1 
ATOM   2140 N  N   . PRO A 1 281 ? 150.095 102.028 39.562 1.00 59.62 ? 281  PRO A N   1 
ATOM   2141 C  CA  . PRO A 1 281 ? 149.948 100.793 40.340 1.00 62.12 ? 281  PRO A CA  1 
ATOM   2142 C  C   . PRO A 1 281 ? 148.867 100.866 41.423 1.00 62.38 ? 281  PRO A C   1 
ATOM   2143 O  O   . PRO A 1 281 ? 147.974 100.020 41.469 1.00 59.89 ? 281  PRO A O   1 
ATOM   2144 C  CB  . PRO A 1 281 ? 151.353 100.568 40.905 1.00 63.59 ? 281  PRO A CB  1 
ATOM   2145 C  CG  . PRO A 1 281 ? 151.931 101.947 40.971 0.00 62.50 ? 281  PRO A CG  1 
ATOM   2146 C  CD  . PRO A 1 281 ? 151.456 102.576 39.689 0.00 61.60 ? 281  PRO A CD  1 
ATOM   2147 N  N   . TYR A 1 282 ? 148.947 101.880 42.281 1.00 63.75 ? 282  TYR A N   1 
ATOM   2148 C  CA  . TYR A 1 282 ? 147.972 102.073 43.356 1.00 61.04 ? 282  TYR A CA  1 
ATOM   2149 C  C   . TYR A 1 282 ? 147.549 103.540 43.410 1.00 57.17 ? 282  TYR A C   1 
ATOM   2150 O  O   . TYR A 1 282 ? 148.119 104.332 44.158 1.00 59.97 ? 282  TYR A O   1 
ATOM   2151 C  CB  . TYR A 1 282 ? 148.576 101.668 44.706 1.00 61.63 ? 282  TYR A CB  1 
ATOM   2152 C  CG  . TYR A 1 282 ? 149.018 100.223 44.787 1.00 65.00 ? 282  TYR A CG  1 
ATOM   2153 C  CD1 . TYR A 1 282 ? 148.098 99.183  44.663 1.00 66.72 ? 282  TYR A CD1 1 
ATOM   2154 C  CD2 . TYR A 1 282 ? 150.356 99.895  44.996 0.00 65.51 ? 282  TYR A CD2 1 
ATOM   2155 C  CE1 . TYR A 1 282 ? 148.500 97.850  44.746 1.00 69.84 ? 282  TYR A CE1 1 
ATOM   2156 C  CE2 . TYR A 1 282 ? 150.768 98.567  45.081 1.00 67.47 ? 282  TYR A CE2 1 
ATOM   2157 C  CZ  . TYR A 1 282 ? 149.836 97.551  44.956 0.00 67.26 ? 282  TYR A CZ  1 
ATOM   2158 O  OH  . TYR A 1 282 ? 150.238 96.238  45.045 0.00 67.31 ? 282  TYR A OH  1 
ATOM   2159 N  N   . GLY A 1 283 ? 146.552 103.901 42.612 1.00 53.31 ? 283  GLY A N   1 
ATOM   2160 C  CA  . GLY A 1 283 ? 146.090 105.276 42.595 1.00 48.72 ? 283  GLY A CA  1 
ATOM   2161 C  C   . GLY A 1 283 ? 145.005 105.561 43.615 1.00 45.55 ? 283  GLY A C   1 
ATOM   2162 O  O   . GLY A 1 283 ? 144.358 104.645 44.118 1.00 48.83 ? 283  GLY A O   1 
ATOM   2163 N  N   . THR A 1 284 ? 144.796 106.836 43.921 1.00 41.79 ? 284  THR A N   1 
ATOM   2164 C  CA  . THR A 1 284 ? 143.779 107.217 44.889 1.00 36.00 ? 284  THR A CA  1 
ATOM   2165 C  C   . THR A 1 284 ? 142.475 107.566 44.173 1.00 36.35 ? 284  THR A C   1 
ATOM   2166 O  O   . THR A 1 284 ? 142.430 107.650 42.944 1.00 34.21 ? 284  THR A O   1 
ATOM   2167 C  CB  . THR A 1 284 ? 144.233 108.432 45.719 1.00 37.66 ? 284  THR A CB  1 
ATOM   2168 O  OG1 . THR A 1 284 ? 144.202 109.608 44.904 1.00 41.58 ? 284  THR A OG1 1 
ATOM   2169 C  CG2 . THR A 1 284 ? 145.646 108.227 46.225 1.00 37.10 ? 284  THR A CG2 1 
ATOM   2170 N  N   . PRO A 1 285 ? 141.388 107.754 44.936 1.00 34.19 ? 285  PRO A N   1 
ATOM   2171 C  CA  . PRO A 1 285 ? 140.096 108.096 44.335 1.00 31.02 ? 285  PRO A CA  1 
ATOM   2172 C  C   . PRO A 1 285 ? 140.110 109.407 43.556 1.00 30.74 ? 285  PRO A C   1 
ATOM   2173 O  O   . PRO A 1 285 ? 139.169 109.697 42.823 1.00 32.96 ? 285  PRO A O   1 
ATOM   2174 C  CB  . PRO A 1 285 ? 139.164 108.143 45.537 1.00 28.33 ? 285  PRO A CB  1 
ATOM   2175 C  CG  . PRO A 1 285 ? 139.739 107.080 46.420 1.00 28.81 ? 285  PRO A CG  1 
ATOM   2176 C  CD  . PRO A 1 285 ? 141.216 107.373 46.350 1.00 29.17 ? 285  PRO A CD  1 
ATOM   2177 N  N   . LEU A 1 286 ? 141.164 110.204 43.721 1.00 32.47 ? 286  LEU A N   1 
ATOM   2178 C  CA  . LEU A 1 286 ? 141.263 111.466 42.988 1.00 38.65 ? 286  LEU A CA  1 
ATOM   2179 C  C   . LEU A 1 286 ? 141.670 111.169 41.542 1.00 42.25 ? 286  LEU A C   1 
ATOM   2180 O  O   . LEU A 1 286 ? 141.344 111.918 40.619 1.00 40.58 ? 286  LEU A O   1 
ATOM   2181 C  CB  . LEU A 1 286 ? 142.249 112.417 43.677 1.00 35.73 ? 286  LEU A CB  1 
ATOM   2182 C  CG  . LEU A 1 286 ? 141.522 113.242 44.755 1.00 43.14 ? 286  LEU A CG  1 
ATOM   2183 C  CD1 . LEU A 1 286 ? 142.158 113.032 46.109 1.00 39.21 ? 286  LEU A CD1 1 
ATOM   2184 C  CD2 . LEU A 1 286 ? 141.529 114.717 44.375 1.00 31.69 ? 286  LEU A CD2 1 
ATOM   2185 N  N   . SER A 1 287 ? 142.366 110.049 41.373 1.00 39.49 ? 287  SER A N   1 
ATOM   2186 C  CA  . SER A 1 287 ? 142.804 109.538 40.076 1.00 37.61 ? 287  SER A CA  1 
ATOM   2187 C  C   . SER A 1 287 ? 143.217 110.514 38.988 1.00 33.16 ? 287  SER A C   1 
ATOM   2188 O  O   . SER A 1 287 ? 142.664 110.488 37.886 1.00 36.72 ? 287  SER A O   1 
ATOM   2189 C  CB  . SER A 1 287 ? 141.723 108.616 39.502 1.00 39.44 ? 287  SER A CB  1 
ATOM   2190 O  OG  . SER A 1 287 ? 140.662 108.445 40.425 1.00 57.12 ? 287  SER A OG  1 
ATOM   2191 N  N   . VAL A 1 288 ? 144.186 111.369 39.280 1.00 29.36 ? 288  VAL A N   1 
ATOM   2192 C  CA  . VAL A 1 288 ? 144.676 112.296 38.271 1.00 23.13 ? 288  VAL A CA  1 
ATOM   2193 C  C   . VAL A 1 288 ? 145.855 111.594 37.586 1.00 24.53 ? 288  VAL A C   1 
ATOM   2194 O  O   . VAL A 1 288 ? 147.008 111.963 37.778 1.00 32.89 ? 288  VAL A O   1 
ATOM   2195 C  CB  . VAL A 1 288 ? 145.162 113.617 38.897 1.00 23.13 ? 288  VAL A CB  1 
ATOM   2196 C  CG1 . VAL A 1 288 ? 145.666 114.562 37.808 1.00 13.54 ? 288  VAL A CG1 1 
ATOM   2197 C  CG2 . VAL A 1 288 ? 144.042 114.253 39.675 1.00 13.10 ? 288  VAL A CG2 1 
ATOM   2198 N  N   . ASN A 1 289 ? 145.549 110.578 36.786 1.00 26.97 ? 289  ASN A N   1 
ATOM   2199 C  CA  . ASN A 1 289 ? 146.571 109.810 36.086 1.00 29.32 ? 289  ASN A CA  1 
ATOM   2200 C  C   . ASN A 1 289 ? 147.441 110.652 35.167 1.00 27.17 ? 289  ASN A C   1 
ATOM   2201 O  O   . ASN A 1 289 ? 148.655 110.475 35.129 1.00 23.33 ? 289  ASN A O   1 
ATOM   2202 C  CB  . ASN A 1 289 ? 145.925 108.682 35.277 1.00 28.80 ? 289  ASN A CB  1 
ATOM   2203 C  CG  . ASN A 1 289 ? 145.184 107.685 36.153 1.00 33.31 ? 289  ASN A CG  1 
ATOM   2204 O  OD1 . ASN A 1 289 ? 145.756 107.113 37.080 1.00 32.56 ? 289  ASN A OD1 1 
ATOM   2205 N  ND2 . ASN A 1 289 ? 143.907 107.476 35.863 1.00 25.40 ? 289  ASN A ND2 1 
ATOM   2206 N  N   . PHE A 1 290 ? 146.812 111.556 34.422 1.00 23.86 ? 290  PHE A N   1 
ATOM   2207 C  CA  . PHE A 1 290 ? 147.522 112.425 33.488 1.00 21.19 ? 290  PHE A CA  1 
ATOM   2208 C  C   . PHE A 1 290 ? 147.132 113.876 33.704 1.00 26.42 ? 290  PHE A C   1 
ATOM   2209 O  O   . PHE A 1 290 ? 146.044 114.294 33.302 1.00 24.15 ? 290  PHE A O   1 
ATOM   2210 C  CB  . PHE A 1 290 ? 147.201 112.026 32.047 1.00 23.11 ? 290  PHE A CB  1 
ATOM   2211 C  CG  . PHE A 1 290 ? 147.751 110.685 31.655 1.00 31.25 ? 290  PHE A CG  1 
ATOM   2212 C  CD1 . PHE A 1 290 ? 149.092 110.543 31.314 1.00 29.29 ? 290  PHE A CD1 1 
ATOM   2213 C  CD2 . PHE A 1 290 ? 146.939 109.554 31.671 1.00 35.10 ? 290  PHE A CD2 1 
ATOM   2214 C  CE1 . PHE A 1 290 ? 149.621 109.289 30.995 1.00 35.87 ? 290  PHE A CE1 1 
ATOM   2215 C  CE2 . PHE A 1 290 ? 147.459 108.296 31.356 1.00 36.05 ? 290  PHE A CE2 1 
ATOM   2216 C  CZ  . PHE A 1 290 ? 148.802 108.163 31.017 1.00 33.91 ? 290  PHE A CZ  1 
ATOM   2217 N  N   . GLY A 1 291 ? 148.026 114.646 34.325 1.00 23.73 ? 291  GLY A N   1 
ATOM   2218 C  CA  . GLY A 1 291 ? 147.738 116.046 34.579 1.00 20.21 ? 291  GLY A CA  1 
ATOM   2219 C  C   . GLY A 1 291 ? 148.830 117.012 34.166 1.00 23.58 ? 291  GLY A C   1 
ATOM   2220 O  O   . GLY A 1 291 ? 149.751 116.651 33.437 1.00 20.85 ? 291  GLY A O   1 
ATOM   2221 N  N   . PRO A 1 292 ? 148.745 118.272 34.617 1.00 26.81 ? 292  PRO A N   1 
ATOM   2222 C  CA  . PRO A 1 292 ? 149.761 119.266 34.267 1.00 21.46 ? 292  PRO A CA  1 
ATOM   2223 C  C   . PRO A 1 292 ? 151.159 118.804 34.688 1.00 24.88 ? 292  PRO A C   1 
ATOM   2224 O  O   . PRO A 1 292 ? 151.322 118.102 35.687 1.00 27.10 ? 292  PRO A O   1 
ATOM   2225 C  CB  . PRO A 1 292 ? 149.312 120.504 35.049 1.00 23.80 ? 292  PRO A CB  1 
ATOM   2226 C  CG  . PRO A 1 292 ? 147.829 120.339 35.137 1.00 25.00 ? 292  PRO A CG  1 
ATOM   2227 C  CD  . PRO A 1 292 ? 147.682 118.872 35.442 1.00 21.97 ? 292  PRO A CD  1 
ATOM   2228 N  N   . THR A 1 293 ? 152.168 119.181 33.917 1.00 22.71 ? 293  THR A N   1 
ATOM   2229 C  CA  . THR A 1 293 ? 153.537 118.834 34.266 1.00 25.76 ? 293  THR A CA  1 
ATOM   2230 C  C   . THR A 1 293 ? 154.428 120.021 33.946 1.00 24.54 ? 293  THR A C   1 
ATOM   2231 O  O   . THR A 1 293 ? 154.059 120.877 33.140 1.00 20.71 ? 293  THR A O   1 
ATOM   2232 C  CB  . THR A 1 293 ? 154.052 117.603 33.481 1.00 27.28 ? 293  THR A CB  1 
ATOM   2233 O  OG1 . THR A 1 293 ? 153.929 117.841 32.074 1.00 21.93 ? 293  THR A OG1 1 
ATOM   2234 C  CG2 . THR A 1 293 ? 153.265 116.364 33.861 1.00 35.12 ? 293  THR A CG2 1 
ATOM   2235 N  N   . VAL A 1 294 ? 155.583 120.093 34.600 1.00 21.44 ? 294  VAL A N   1 
ATOM   2236 C  CA  . VAL A 1 294 ? 156.521 121.173 34.317 1.00 27.82 ? 294  VAL A CA  1 
ATOM   2237 C  C   . VAL A 1 294 ? 157.068 120.796 32.942 1.00 25.80 ? 294  VAL A C   1 
ATOM   2238 O  O   . VAL A 1 294 ? 157.925 119.923 32.816 1.00 30.53 ? 294  VAL A O   1 
ATOM   2239 C  CB  . VAL A 1 294 ? 157.670 121.224 35.353 1.00 26.27 ? 294  VAL A CB  1 
ATOM   2240 C  CG1 . VAL A 1 294 ? 158.510 122.471 35.134 1.00 28.28 ? 294  VAL A CG1 1 
ATOM   2241 C  CG2 . VAL A 1 294 ? 157.099 121.219 36.759 1.00 24.31 ? 294  VAL A CG2 1 
ATOM   2242 N  N   . ASP A 1 295 ? 156.544 121.452 31.915 1.00 26.97 ? 295  ASP A N   1 
ATOM   2243 C  CA  . ASP A 1 295 ? 156.914 121.170 30.534 1.00 30.49 ? 295  ASP A CA  1 
ATOM   2244 C  C   . ASP A 1 295 ? 158.009 122.071 29.972 1.00 33.50 ? 295  ASP A C   1 
ATOM   2245 O  O   . ASP A 1 295 ? 158.644 121.736 28.976 1.00 36.32 ? 295  ASP A O   1 
ATOM   2246 C  CB  . ASP A 1 295 ? 155.667 121.286 29.657 1.00 27.19 ? 295  ASP A CB  1 
ATOM   2247 C  CG  . ASP A 1 295 ? 155.124 122.703 29.613 1.00 32.32 ? 295  ASP A CG  1 
ATOM   2248 O  OD1 . ASP A 1 295 ? 155.328 123.445 30.596 1.00 28.73 ? 295  ASP A OD1 1 
ATOM   2249 O  OD2 . ASP A 1 295 ? 154.491 123.074 28.605 1.00 34.80 ? 295  ASP A OD2 1 
ATOM   2250 N  N   . GLY A 1 296 ? 158.227 123.217 30.600 1.00 35.15 ? 296  GLY A N   1 
ATOM   2251 C  CA  . GLY A 1 296 ? 159.243 124.115 30.101 1.00 33.71 ? 296  GLY A CA  1 
ATOM   2252 C  C   . GLY A 1 296 ? 158.665 125.041 29.053 1.00 37.20 ? 296  GLY A C   1 
ATOM   2253 O  O   . GLY A 1 296 ? 159.376 125.863 28.484 1.00 44.19 ? 296  GLY A O   1 
ATOM   2254 N  N   . ASP A 1 297 ? 157.372 124.901 28.782 1.00 37.09 ? 297  ASP A N   1 
ATOM   2255 C  CA  . ASP A 1 297 ? 156.715 125.761 27.807 1.00 34.21 ? 297  ASP A CA  1 
ATOM   2256 C  C   . ASP A 1 297 ? 155.640 126.557 28.534 1.00 29.87 ? 297  ASP A C   1 
ATOM   2257 O  O   . ASP A 1 297 ? 155.772 127.764 28.711 1.00 31.72 ? 297  ASP A O   1 
ATOM   2258 C  CB  . ASP A 1 297 ? 156.081 124.939 26.684 1.00 31.78 ? 297  ASP A CB  1 
ATOM   2259 C  CG  . ASP A 1 297 ? 155.620 125.805 25.517 1.00 41.84 ? 297  ASP A CG  1 
ATOM   2260 O  OD1 . ASP A 1 297 ? 155.565 127.045 25.674 1.00 44.59 ? 297  ASP A OD1 1 
ATOM   2261 O  OD2 . ASP A 1 297 ? 155.305 125.252 24.441 1.00 43.98 ? 297  ASP A OD2 1 
ATOM   2262 N  N   . PHE A 1 298 ? 154.581 125.872 28.960 1.00 28.58 ? 298  PHE A N   1 
ATOM   2263 C  CA  . PHE A 1 298 ? 153.492 126.513 29.686 1.00 26.53 ? 298  PHE A CA  1 
ATOM   2264 C  C   . PHE A 1 298 ? 153.965 126.827 31.105 1.00 29.01 ? 298  PHE A C   1 
ATOM   2265 O  O   . PHE A 1 298 ? 153.681 127.894 31.644 1.00 31.25 ? 298  PHE A O   1 
ATOM   2266 C  CB  . PHE A 1 298 ? 152.269 125.593 29.726 1.00 25.45 ? 298  PHE A CB  1 
ATOM   2267 C  CG  . PHE A 1 298 ? 151.056 126.225 30.349 1.00 21.59 ? 298  PHE A CG  1 
ATOM   2268 C  CD1 . PHE A 1 298 ? 150.815 126.109 31.712 1.00 20.58 ? 298  PHE A CD1 1 
ATOM   2269 C  CD2 . PHE A 1 298 ? 150.161 126.949 29.571 1.00 18.43 ? 298  PHE A CD2 1 
ATOM   2270 C  CE1 . PHE A 1 298 ? 149.701 126.712 32.297 1.00 17.48 ? 298  PHE A CE1 1 
ATOM   2271 C  CE2 . PHE A 1 298 ? 149.044 127.557 30.145 1.00 25.07 ? 298  PHE A CE2 1 
ATOM   2272 C  CZ  . PHE A 1 298 ? 148.815 127.434 31.512 1.00 23.80 ? 298  PHE A CZ  1 
ATOM   2273 N  N   . LEU A 1 299 ? 154.680 125.880 31.700 1.00 26.99 ? 299  LEU A N   1 
ATOM   2274 C  CA  . LEU A 1 299 ? 155.237 126.023 33.039 1.00 33.53 ? 299  LEU A CA  1 
ATOM   2275 C  C   . LEU A 1 299 ? 156.754 125.915 32.904 1.00 36.53 ? 299  LEU A C   1 
ATOM   2276 O  O   . LEU A 1 299 ? 157.267 124.891 32.450 1.00 33.88 ? 299  LEU A O   1 
ATOM   2277 C  CB  . LEU A 1 299 ? 154.738 124.907 33.953 1.00 36.52 ? 299  LEU A CB  1 
ATOM   2278 C  CG  . LEU A 1 299 ? 153.616 125.196 34.943 1.00 45.62 ? 299  LEU A CG  1 
ATOM   2279 C  CD1 . LEU A 1 299 ? 153.385 123.950 35.792 1.00 39.96 ? 299  LEU A CD1 1 
ATOM   2280 C  CD2 . LEU A 1 299 ? 153.995 126.375 35.825 1.00 51.58 ? 299  LEU A CD2 1 
ATOM   2281 N  N   . THR A 1 300 ? 157.466 126.961 33.313 1.00 39.19 ? 300  THR A N   1 
ATOM   2282 C  CA  . THR A 1 300 ? 158.921 126.993 33.197 1.00 39.54 ? 300  THR A CA  1 
ATOM   2283 C  C   . THR A 1 300 ? 159.714 126.489 34.397 1.00 36.57 ? 300  THR A C   1 
ATOM   2284 O  O   . THR A 1 300 ? 160.937 126.415 34.334 1.00 42.27 ? 300  THR A O   1 
ATOM   2285 C  CB  . THR A 1 300 ? 159.407 128.412 32.897 1.00 42.68 ? 300  THR A CB  1 
ATOM   2286 O  OG1 . THR A 1 300 ? 159.031 129.280 33.974 1.00 48.42 ? 300  THR A OG1 1 
ATOM   2287 C  CG2 . THR A 1 300 ? 158.793 128.917 31.604 1.00 48.98 ? 300  THR A CG2 1 
ATOM   2288 N  N   . ASP A 1 301 ? 159.034 126.143 35.482 1.00 32.75 ? 301  ASP A N   1 
ATOM   2289 C  CA  . ASP A 1 301 ? 159.725 125.661 36.670 1.00 29.15 ? 301  ASP A CA  1 
ATOM   2290 C  C   . ASP A 1 301 ? 158.689 125.094 37.631 1.00 25.98 ? 301  ASP A C   1 
ATOM   2291 O  O   . ASP A 1 301 ? 157.499 125.308 37.455 1.00 27.16 ? 301  ASP A O   1 
ATOM   2292 C  CB  . ASP A 1 301 ? 160.471 126.829 37.324 1.00 34.45 ? 301  ASP A CB  1 
ATOM   2293 C  CG  . ASP A 1 301 ? 161.519 126.379 38.331 1.00 39.07 ? 301  ASP A CG  1 
ATOM   2294 O  OD1 . ASP A 1 301 ? 161.621 125.167 38.619 1.00 35.25 ? 301  ASP A OD1 1 
ATOM   2295 O  OD2 . ASP A 1 301 ? 162.244 127.263 38.840 1.00 44.19 ? 301  ASP A OD2 1 
ATOM   2296 N  N   . MET A 1 302 ? 159.130 124.354 38.638 1.00 27.75 ? 302  MET A N   1 
ATOM   2297 C  CA  . MET A 1 302 ? 158.187 123.806 39.596 1.00 32.50 ? 302  MET A CA  1 
ATOM   2298 C  C   . MET A 1 302 ? 157.346 124.958 40.151 1.00 31.53 ? 302  MET A C   1 
ATOM   2299 O  O   . MET A 1 302 ? 157.880 125.935 40.673 1.00 35.80 ? 302  MET A O   1 
ATOM   2300 C  CB  . MET A 1 302 ? 158.935 123.086 40.714 1.00 35.09 ? 302  MET A CB  1 
ATOM   2301 C  CG  . MET A 1 302 ? 159.683 121.850 40.239 1.00 44.20 ? 302  MET A CG  1 
ATOM   2302 S  SD  . MET A 1 302 ? 160.542 120.995 41.581 1.00 63.29 ? 302  MET A SD  1 
ATOM   2303 C  CE  . MET A 1 302 ? 159.271 119.809 42.117 1.00 53.71 ? 302  MET A CE  1 
ATOM   2304 N  N   . PRO A 1 303 ? 156.014 124.858 40.028 1.00 28.85 ? 303  PRO A N   1 
ATOM   2305 C  CA  . PRO A 1 303 ? 155.061 125.868 40.497 1.00 24.84 ? 303  PRO A CA  1 
ATOM   2306 C  C   . PRO A 1 303 ? 155.294 126.349 41.927 1.00 20.74 ? 303  PRO A C   1 
ATOM   2307 O  O   . PRO A 1 303 ? 155.153 127.532 42.219 1.00 23.55 ? 303  PRO A O   1 
ATOM   2308 C  CB  . PRO A 1 303 ? 153.713 125.167 40.336 1.00 30.09 ? 303  PRO A CB  1 
ATOM   2309 C  CG  . PRO A 1 303 ? 153.944 124.282 39.153 1.00 36.86 ? 303  PRO A CG  1 
ATOM   2310 C  CD  . PRO A 1 303 ? 155.307 123.706 39.442 1.00 26.00 ? 303  PRO A CD  1 
ATOM   2311 N  N   . ASP A 1 304 ? 155.628 125.430 42.823 1.00 24.82 ? 304  ASP A N   1 
ATOM   2312 C  CA  . ASP A 1 304 ? 155.881 125.794 44.212 1.00 25.96 ? 304  ASP A CA  1 
ATOM   2313 C  C   . ASP A 1 304 ? 156.982 126.846 44.305 1.00 27.35 ? 304  ASP A C   1 
ATOM   2314 O  O   . ASP A 1 304 ? 156.934 127.739 45.154 1.00 28.52 ? 304  ASP A O   1 
ATOM   2315 C  CB  . ASP A 1 304 ? 156.277 124.558 45.041 1.00 29.01 ? 304  ASP A CB  1 
ATOM   2316 C  CG  . ASP A 1 304 ? 157.258 123.646 44.316 1.00 29.04 ? 304  ASP A CG  1 
ATOM   2317 O  OD1 . ASP A 1 304 ? 157.966 122.873 44.995 0.00 29.94 ? 304  ASP A OD1 1 
ATOM   2318 O  OD2 . ASP A 1 304 ? 157.310 123.688 43.069 0.00 29.94 ? 304  ASP A OD2 1 
ATOM   2319 N  N   . ILE A 1 305 ? 157.970 126.740 43.425 1.00 27.89 ? 305  ILE A N   1 
ATOM   2320 C  CA  . ILE A 1 305 ? 159.077 127.688 43.423 1.00 28.98 ? 305  ILE A CA  1 
ATOM   2321 C  C   . ILE A 1 305 ? 158.609 129.055 42.936 1.00 28.99 ? 305  ILE A C   1 
ATOM   2322 O  O   . ILE A 1 305 ? 158.921 130.080 43.554 1.00 26.42 ? 305  ILE A O   1 
ATOM   2323 C  CB  . ILE A 1 305 ? 160.239 127.188 42.530 1.00 25.86 ? 305  ILE A CB  1 
ATOM   2324 C  CG1 . ILE A 1 305 ? 160.758 125.851 43.072 1.00 29.15 ? 305  ILE A CG1 1 
ATOM   2325 C  CG2 . ILE A 1 305 ? 161.350 128.227 42.488 1.00 26.68 ? 305  ILE A CG2 1 
ATOM   2326 C  CD1 . ILE A 1 305 ? 161.894 125.247 42.272 0.50 31.70 ? 305  ILE A CD1 1 
ATOM   2327 N  N   . LEU A 1 306 ? 157.847 129.065 41.843 1.00 20.11 ? 306  LEU A N   1 
ATOM   2328 C  CA  . LEU A 1 306 ? 157.339 130.310 41.269 1.00 26.89 ? 306  LEU A CA  1 
ATOM   2329 C  C   . LEU A 1 306 ? 156.424 131.056 42.234 1.00 29.13 ? 306  LEU A C   1 
ATOM   2330 O  O   . LEU A 1 306 ? 156.494 132.282 42.344 1.00 30.07 ? 306  LEU A O   1 
ATOM   2331 C  CB  . LEU A 1 306 ? 156.577 130.021 39.975 1.00 20.70 ? 306  LEU A CB  1 
ATOM   2332 C  CG  . LEU A 1 306 ? 157.398 129.356 38.872 1.00 23.18 ? 306  LEU A CG  1 
ATOM   2333 C  CD1 . LEU A 1 306 ? 156.501 129.005 37.701 1.00 23.21 ? 306  LEU A CD1 1 
ATOM   2334 C  CD2 . LEU A 1 306 ? 158.516 130.295 38.440 1.00 18.73 ? 306  LEU A CD2 1 
ATOM   2335 N  N   . LEU A 1 307 ? 155.561 130.308 42.921 1.00 30.09 ? 307  LEU A N   1 
ATOM   2336 C  CA  . LEU A 1 307 ? 154.631 130.897 43.876 1.00 27.28 ? 307  LEU A CA  1 
ATOM   2337 C  C   . LEU A 1 307 ? 155.408 131.514 45.027 1.00 27.27 ? 307  LEU A C   1 
ATOM   2338 O  O   . LEU A 1 307 ? 155.202 132.677 45.377 1.00 22.36 ? 307  LEU A O   1 
ATOM   2339 C  CB  . LEU A 1 307 ? 153.672 129.837 44.427 1.00 25.15 ? 307  LEU A CB  1 
ATOM   2340 C  CG  . LEU A 1 307 ? 152.737 130.325 45.546 1.00 29.32 ? 307  LEU A CG  1 
ATOM   2341 C  CD1 . LEU A 1 307 ? 151.868 131.466 45.034 1.00 26.92 ? 307  LEU A CD1 1 
ATOM   2342 C  CD2 . LEU A 1 307 ? 151.873 129.174 46.050 1.00 27.86 ? 307  LEU A CD2 1 
ATOM   2343 N  N   . GLU A 1 308 ? 156.317 130.727 45.592 1.00 26.23 ? 308  GLU A N   1 
ATOM   2344 C  CA  . GLU A 1 308 ? 157.125 131.167 46.718 1.00 28.72 ? 308  GLU A CA  1 
ATOM   2345 C  C   . GLU A 1 308 ? 157.961 132.408 46.429 1.00 26.51 ? 308  GLU A C   1 
ATOM   2346 O  O   . GLU A 1 308 ? 158.156 133.241 47.312 1.00 28.02 ? 308  GLU A O   1 
ATOM   2347 C  CB  . GLU A 1 308 ? 158.051 130.035 47.172 1.00 24.31 ? 308  GLU A CB  1 
ATOM   2348 C  CG  . GLU A 1 308 ? 158.850 130.380 48.409 1.00 25.16 ? 308  GLU A CG  1 
ATOM   2349 C  CD  . GLU A 1 308 ? 158.014 130.345 49.671 0.50 32.09 ? 308  GLU A CD  1 
ATOM   2350 O  OE1 . GLU A 1 308 ? 158.414 130.980 50.669 0.50 31.40 ? 308  GLU A OE1 1 
ATOM   2351 O  OE2 . GLU A 1 308 ? 156.963 129.670 49.671 0.50 34.92 ? 308  GLU A OE2 1 
ATOM   2352 N  N   . LEU A 1 309 ? 158.445 132.537 45.197 1.00 24.34 ? 309  LEU A N   1 
ATOM   2353 C  CA  . LEU A 1 309 ? 159.287 133.673 44.843 1.00 24.68 ? 309  LEU A CA  1 
ATOM   2354 C  C   . LEU A 1 309 ? 158.576 134.806 44.129 1.00 27.63 ? 309  LEU A C   1 
ATOM   2355 O  O   . LEU A 1 309 ? 159.213 135.607 43.448 1.00 26.57 ? 309  LEU A O   1 
ATOM   2356 C  CB  . LEU A 1 309 ? 160.483 133.201 44.008 1.00 11.92 ? 309  LEU A CB  1 
ATOM   2357 C  CG  . LEU A 1 309 ? 161.317 132.133 44.725 1.00 21.47 ? 309  LEU A CG  1 
ATOM   2358 C  CD1 . LEU A 1 309 ? 162.450 131.669 43.836 1.00 20.00 ? 309  LEU A CD1 1 
ATOM   2359 C  CD2 . LEU A 1 309 ? 161.853 132.685 46.029 1.00 16.54 ? 309  LEU A CD2 1 
ATOM   2360 N  N   . GLY A 1 310 ? 157.258 134.870 44.289 1.00 31.67 ? 310  GLY A N   1 
ATOM   2361 C  CA  . GLY A 1 310 ? 156.478 135.935 43.680 1.00 29.16 ? 310  GLY A CA  1 
ATOM   2362 C  C   . GLY A 1 310 ? 156.459 136.021 42.168 1.00 31.50 ? 310  GLY A C   1 
ATOM   2363 O  O   . GLY A 1 310 ? 156.223 137.094 41.626 1.00 31.57 ? 310  GLY A O   1 
ATOM   2364 N  N   . GLN A 1 311 ? 156.688 134.910 41.477 1.00 28.13 ? 311  GLN A N   1 
ATOM   2365 C  CA  . GLN A 1 311 ? 156.680 134.933 40.019 1.00 27.92 ? 311  GLN A CA  1 
ATOM   2366 C  C   . GLN A 1 311 ? 155.308 134.561 39.470 1.00 30.12 ? 311  GLN A C   1 
ATOM   2367 O  O   . GLN A 1 311 ? 155.064 133.402 39.122 1.00 34.63 ? 311  GLN A O   1 
ATOM   2368 C  CB  . GLN A 1 311 ? 157.728 133.965 39.467 1.00 32.06 ? 311  GLN A CB  1 
ATOM   2369 C  CG  . GLN A 1 311 ? 159.142 134.267 39.914 1.00 39.03 ? 311  GLN A CG  1 
ATOM   2370 C  CD  . GLN A 1 311 ? 159.552 135.691 39.601 1.00 45.32 ? 311  GLN A CD  1 
ATOM   2371 O  OE1 . GLN A 1 311 ? 159.476 136.130 38.453 1.00 43.40 ? 311  GLN A OE1 1 
ATOM   2372 N  NE2 . GLN A 1 311 ? 159.990 136.421 40.623 1.00 39.83 ? 311  GLN A NE2 1 
ATOM   2373 N  N   . PHE A 1 312 ? 154.415 135.543 39.395 1.00 24.67 ? 312  PHE A N   1 
ATOM   2374 C  CA  . PHE A 1 312 ? 153.072 135.310 38.885 1.00 24.26 ? 312  PHE A CA  1 
ATOM   2375 C  C   . PHE A 1 312 ? 152.347 136.621 38.619 1.00 23.75 ? 312  PHE A C   1 
ATOM   2376 O  O   . PHE A 1 312 ? 152.752 137.674 39.113 1.00 22.95 ? 312  PHE A O   1 
ATOM   2377 C  CB  . PHE A 1 312 ? 152.281 134.456 39.882 1.00 22.53 ? 312  PHE A CB  1 
ATOM   2378 C  CG  . PHE A 1 312 ? 152.379 134.938 41.299 1.00 24.31 ? 312  PHE A CG  1 
ATOM   2379 C  CD1 . PHE A 1 312 ? 151.533 135.931 41.772 1.00 24.37 ? 312  PHE A CD1 1 
ATOM   2380 C  CD2 . PHE A 1 312 ? 153.330 134.405 42.160 1.00 21.85 ? 312  PHE A CD2 1 
ATOM   2381 C  CE1 . PHE A 1 312 ? 151.629 136.387 43.090 1.00 21.11 ? 312  PHE A CE1 1 
ATOM   2382 C  CE2 . PHE A 1 312 ? 153.437 134.852 43.477 1.00 25.09 ? 312  PHE A CE2 1 
ATOM   2383 C  CZ  . PHE A 1 312 ? 152.581 135.847 43.943 1.00 23.86 ? 312  PHE A CZ  1 
ATOM   2384 N  N   . LYS A 1 313 ? 151.283 136.547 37.823 1.00 16.08 ? 313  LYS A N   1 
ATOM   2385 C  CA  . LYS A 1 313 ? 150.490 137.718 37.477 1.00 17.08 ? 313  LYS A CA  1 
ATOM   2386 C  C   . LYS A 1 313 ? 149.990 138.395 38.748 1.00 21.14 ? 313  LYS A C   1 
ATOM   2387 O  O   . LYS A 1 313 ? 149.344 137.762 39.585 1.00 23.86 ? 313  LYS A O   1 
ATOM   2388 C  CB  . LYS A 1 313 ? 149.301 137.301 36.609 1.00 19.94 ? 313  LYS A CB  1 
ATOM   2389 C  CG  . LYS A 1 313 ? 148.423 138.453 36.145 1.00 13.53 ? 313  LYS A CG  1 
ATOM   2390 C  CD  . LYS A 1 313 ? 147.205 137.934 35.396 1.00 23.35 ? 313  LYS A CD  1 
ATOM   2391 C  CE  . LYS A 1 313 ? 146.296 139.065 34.959 1.00 23.67 ? 313  LYS A CE  1 
ATOM   2392 N  NZ  . LYS A 1 313 ? 146.983 140.009 34.030 1.00 19.98 ? 313  LYS A NZ  1 
ATOM   2393 N  N   . LYS A 1 314 ? 150.297 139.679 38.896 1.00 19.04 ? 314  LYS A N   1 
ATOM   2394 C  CA  . LYS A 1 314 ? 149.875 140.429 40.075 1.00 21.40 ? 314  LYS A CA  1 
ATOM   2395 C  C   . LYS A 1 314 ? 148.477 140.989 39.861 1.00 23.45 ? 314  LYS A C   1 
ATOM   2396 O  O   . LYS A 1 314 ? 148.273 141.876 39.030 1.00 21.98 ? 314  LYS A O   1 
ATOM   2397 C  CB  . LYS A 1 314 ? 150.859 141.572 40.367 1.00 22.11 ? 314  LYS A CB  1 
ATOM   2398 C  CG  . LYS A 1 314 ? 152.277 141.109 40.684 1.00 17.68 ? 314  LYS A CG  1 
ATOM   2399 C  CD  . LYS A 1 314 ? 152.287 140.105 41.833 1.00 26.23 ? 314  LYS A CD  1 
ATOM   2400 C  CE  . LYS A 1 314 ? 153.696 139.641 42.177 1.00 26.63 ? 314  LYS A CE  1 
ATOM   2401 N  NZ  . LYS A 1 314 ? 154.368 139.007 41.017 1.00 23.93 ? 314  LYS A NZ  1 
ATOM   2402 N  N   . THR A 1 315 ? 147.512 140.461 40.603 1.00 18.64 ? 315  THR A N   1 
ATOM   2403 C  CA  . THR A 1 315 ? 146.138 140.918 40.476 1.00 16.16 ? 315  THR A CA  1 
ATOM   2404 C  C   . THR A 1 315 ? 145.347 140.460 41.693 1.00 19.37 ? 315  THR A C   1 
ATOM   2405 O  O   . THR A 1 315 ? 145.915 139.886 42.618 1.00 20.34 ? 315  THR A O   1 
ATOM   2406 C  CB  . THR A 1 315 ? 145.493 140.340 39.197 1.00 21.12 ? 315  THR A CB  1 
ATOM   2407 O  OG1 . THR A 1 315 ? 144.189 140.899 39.021 1.00 21.76 ? 315  THR A OG1 1 
ATOM   2408 C  CG2 . THR A 1 315 ? 145.382 138.815 39.295 1.00 13.30 ? 315  THR A CG2 1 
ATOM   2409 N  N   . GLN A 1 316 ? 144.043 140.722 41.701 1.00 19.78 ? 316  GLN A N   1 
ATOM   2410 C  CA  . GLN A 1 316 ? 143.200 140.300 42.815 1.00 21.18 ? 316  GLN A CA  1 
ATOM   2411 C  C   . GLN A 1 316 ? 142.713 138.882 42.546 1.00 21.21 ? 316  GLN A C   1 
ATOM   2412 O  O   . GLN A 1 316 ? 142.522 138.486 41.401 1.00 22.78 ? 316  GLN A O   1 
ATOM   2413 C  CB  . GLN A 1 316 ? 141.971 141.201 42.967 1.00 14.52 ? 316  GLN A CB  1 
ATOM   2414 C  CG  . GLN A 1 316 ? 142.248 142.684 43.105 1.00 20.44 ? 316  GLN A CG  1 
ATOM   2415 C  CD  . GLN A 1 316 ? 142.744 143.293 41.818 1.00 28.87 ? 316  GLN A CD  1 
ATOM   2416 O  OE1 . GLN A 1 316 ? 142.147 143.106 40.756 1.00 25.69 ? 316  GLN A OE1 1 
ATOM   2417 N  NE2 . GLN A 1 316 ? 143.841 144.030 41.902 1.00 25.31 ? 316  GLN A NE2 1 
ATOM   2418 N  N   . ILE A 1 317 ? 142.523 138.114 43.607 1.00 19.62 ? 317  ILE A N   1 
ATOM   2419 C  CA  . ILE A 1 317 ? 142.010 136.764 43.460 1.00 20.89 ? 317  ILE A CA  1 
ATOM   2420 C  C   . ILE A 1 317 ? 140.921 136.549 44.495 1.00 19.92 ? 317  ILE A C   1 
ATOM   2421 O  O   . ILE A 1 317 ? 140.890 137.211 45.524 1.00 21.79 ? 317  ILE A O   1 
ATOM   2422 C  CB  . ILE A 1 317 ? 143.092 135.678 43.676 1.00 21.03 ? 317  ILE A CB  1 
ATOM   2423 C  CG1 . ILE A 1 317 ? 143.664 135.783 45.086 1.00 19.68 ? 317  ILE A CG1 1 
ATOM   2424 C  CG2 . ILE A 1 317 ? 144.163 135.780 42.606 1.00 14.12 ? 317  ILE A CG2 1 
ATOM   2425 C  CD1 . ILE A 1 317 ? 144.658 134.688 45.412 1.00 23.88 ? 317  ILE A CD1 1 
ATOM   2426 N  N   . LEU A 1 318 ? 140.015 135.632 44.198 1.00 19.27 ? 318  LEU A N   1 
ATOM   2427 C  CA  . LEU A 1 318 ? 138.938 135.289 45.105 1.00 14.97 ? 318  LEU A CA  1 
ATOM   2428 C  C   . LEU A 1 318 ? 139.106 133.777 45.207 1.00 20.02 ? 318  LEU A C   1 
ATOM   2429 O  O   . LEU A 1 318 ? 139.057 133.064 44.203 1.00 19.07 ? 318  LEU A O   1 
ATOM   2430 C  CB  . LEU A 1 318 ? 137.593 135.675 44.488 1.00 23.77 ? 318  LEU A CB  1 
ATOM   2431 C  CG  . LEU A 1 318 ? 136.342 135.627 45.367 1.00 25.12 ? 318  LEU A CG  1 
ATOM   2432 C  CD1 . LEU A 1 318 ? 135.210 136.369 44.678 1.00 26.71 ? 318  LEU A CD1 1 
ATOM   2433 C  CD2 . LEU A 1 318 ? 135.959 134.190 45.644 1.00 25.41 ? 318  LEU A CD2 1 
ATOM   2434 N  N   . VAL A 1 319 ? 139.332 133.297 46.419 1.00 16.49 ? 319  VAL A N   1 
ATOM   2435 C  CA  . VAL A 1 319 ? 139.566 131.881 46.656 1.00 15.21 ? 319  VAL A CA  1 
ATOM   2436 C  C   . VAL A 1 319 ? 138.658 131.364 47.768 1.00 19.48 ? 319  VAL A C   1 
ATOM   2437 O  O   . VAL A 1 319 ? 138.326 132.100 48.700 1.00 23.00 ? 319  VAL A O   1 
ATOM   2438 C  CB  . VAL A 1 319 ? 141.043 131.662 47.071 1.00 17.21 ? 319  VAL A CB  1 
ATOM   2439 C  CG1 . VAL A 1 319 ? 141.322 130.187 47.294 1.00 18.51 ? 319  VAL A CG1 1 
ATOM   2440 C  CG2 . VAL A 1 319 ? 141.977 132.254 46.015 1.00 13.95 ? 319  VAL A CG2 1 
ATOM   2441 N  N   . GLY A 1 320 ? 138.266 130.096 47.679 1.00 16.06 ? 320  GLY A N   1 
ATOM   2442 C  CA  . GLY A 1 320 ? 137.405 129.533 48.699 1.00 13.62 ? 320  GLY A CA  1 
ATOM   2443 C  C   . GLY A 1 320 ? 137.258 128.030 48.606 1.00 17.96 ? 320  GLY A C   1 
ATOM   2444 O  O   . GLY A 1 320 ? 137.689 127.413 47.635 1.00 22.63 ? 320  GLY A O   1 
ATOM   2445 N  N   . VAL A 1 321 ? 136.635 127.445 49.623 1.00 19.82 ? 321  VAL A N   1 
ATOM   2446 C  CA  . VAL A 1 321 ? 136.423 126.004 49.693 1.00 16.02 ? 321  VAL A CA  1 
ATOM   2447 C  C   . VAL A 1 321 ? 135.090 125.711 50.368 1.00 19.71 ? 321  VAL A C   1 
ATOM   2448 O  O   . VAL A 1 321 ? 134.476 126.594 50.965 1.00 21.63 ? 321  VAL A O   1 
ATOM   2449 C  CB  . VAL A 1 321 ? 137.535 125.314 50.523 1.00 19.92 ? 321  VAL A CB  1 
ATOM   2450 C  CG1 . VAL A 1 321 ? 138.877 125.426 49.812 1.00 18.55 ? 321  VAL A CG1 1 
ATOM   2451 C  CG2 . VAL A 1 321 ? 137.619 125.962 51.895 1.00 11.68 ? 321  VAL A CG2 1 
ATOM   2452 N  N   . ASN A 1 322 ? 134.657 124.462 50.277 1.00 18.66 ? 322  ASN A N   1 
ATOM   2453 C  CA  . ASN A 1 322 ? 133.410 124.036 50.878 1.00 17.21 ? 322  ASN A CA  1 
ATOM   2454 C  C   . ASN A 1 322 ? 133.726 123.320 52.189 1.00 20.43 ? 322  ASN A C   1 
ATOM   2455 O  O   . ASN A 1 322 ? 134.818 122.775 52.358 1.00 16.86 ? 322  ASN A O   1 
ATOM   2456 C  CB  . ASN A 1 322 ? 132.655 123.112 49.916 1.00 23.05 ? 322  ASN A CB  1 
ATOM   2457 C  CG  . ASN A 1 322 ? 132.314 123.795 48.596 1.00 28.09 ? 322  ASN A CG  1 
ATOM   2458 O  OD1 . ASN A 1 322 ? 132.355 125.021 48.484 1.00 32.10 ? 322  ASN A OD1 1 
ATOM   2459 N  ND2 . ASN A 1 322 ? 131.966 123.002 47.595 1.00 20.77 ? 322  ASN A ND2 1 
ATOM   2460 N  N   . LYS A 1 323 ? 132.762 123.329 53.108 1.00 19.48 ? 323  LYS A N   1 
ATOM   2461 C  CA  . LYS A 1 323 ? 132.912 122.721 54.429 1.00 24.01 ? 323  LYS A CA  1 
ATOM   2462 C  C   . LYS A 1 323 ? 133.281 121.241 54.457 1.00 22.88 ? 323  LYS A C   1 
ATOM   2463 O  O   . LYS A 1 323 ? 134.056 120.820 55.313 1.00 23.34 ? 323  LYS A O   1 
ATOM   2464 C  CB  . LYS A 1 323 ? 131.626 122.930 55.236 1.00 31.47 ? 323  LYS A CB  1 
ATOM   2465 C  CG  . LYS A 1 323 ? 131.680 122.480 56.691 1.00 28.86 ? 323  LYS A CG  1 
ATOM   2466 C  CD  . LYS A 1 323 ? 130.318 122.680 57.347 1.00 36.38 ? 323  LYS A CD  1 
ATOM   2467 C  CE  . LYS A 1 323 ? 130.341 122.307 58.816 1.00 39.01 ? 323  LYS A CE  1 
ATOM   2468 N  NZ  . LYS A 1 323 ? 128.970 122.095 59.359 0.00 40.15 ? 323  LYS A NZ  1 
ATOM   2469 N  N   . ASP A 1 324 ? 132.732 120.451 53.538 1.00 16.68 ? 324  ASP A N   1 
ATOM   2470 C  CA  . ASP A 1 324 ? 133.015 119.019 53.521 1.00 18.21 ? 324  ASP A CA  1 
ATOM   2471 C  C   . ASP A 1 324 ? 133.590 118.545 52.194 1.00 18.55 ? 324  ASP A C   1 
ATOM   2472 O  O   . ASP A 1 324 ? 133.082 117.604 51.587 1.00 26.40 ? 324  ASP A O   1 
ATOM   2473 C  CB  . ASP A 1 324 ? 131.733 118.233 53.842 1.00 26.79 ? 324  ASP A CB  1 
ATOM   2474 C  CG  . ASP A 1 324 ? 131.128 118.613 55.197 1.00 35.26 ? 324  ASP A CG  1 
ATOM   2475 O  OD1 . ASP A 1 324 ? 131.725 118.264 56.238 1.00 37.07 ? 324  ASP A OD1 1 
ATOM   2476 O  OD2 . ASP A 1 324 ? 130.058 119.265 55.224 1.00 37.63 ? 324  ASP A OD2 1 
ATOM   2477 N  N   . GLU A 1 325 ? 134.659 119.197 51.756 1.00 23.65 ? 325  GLU A N   1 
ATOM   2478 C  CA  . GLU A 1 325 ? 135.326 118.867 50.495 1.00 23.85 ? 325  GLU A CA  1 
ATOM   2479 C  C   . GLU A 1 325 ? 135.638 117.381 50.290 1.00 23.49 ? 325  GLU A C   1 
ATOM   2480 O  O   . GLU A 1 325 ? 135.461 116.850 49.196 1.00 24.54 ? 325  GLU A O   1 
ATOM   2481 C  CB  . GLU A 1 325 ? 136.643 119.643 50.387 1.00 19.14 ? 325  GLU A CB  1 
ATOM   2482 C  CG  . GLU A 1 325 ? 136.490 121.152 50.256 1.00 25.55 ? 325  GLU A CG  1 
ATOM   2483 C  CD  . GLU A 1 325 ? 136.019 121.571 48.878 1.00 25.77 ? 325  GLU A CD  1 
ATOM   2484 O  OE1 . GLU A 1 325 ? 135.850 120.690 48.009 1.00 26.00 ? 325  GLU A OE1 1 
ATOM   2485 O  OE2 . GLU A 1 325 ? 135.821 122.783 48.660 1.00 25.03 ? 325  GLU A OE2 1 
ATOM   2486 N  N   . GLY A 1 326 ? 136.104 116.721 51.345 1.00 19.62 ? 326  GLY A N   1 
ATOM   2487 C  CA  . GLY A 1 326 ? 136.497 115.328 51.236 1.00 22.69 ? 326  GLY A CA  1 
ATOM   2488 C  C   . GLY A 1 326 ? 135.487 114.194 51.190 1.00 21.18 ? 326  GLY A C   1 
ATOM   2489 O  O   . GLY A 1 326 ? 135.754 113.184 50.549 1.00 27.96 ? 326  GLY A O   1 
ATOM   2490 N  N   . THR A 1 327 ? 134.346 114.344 51.855 1.00 16.88 ? 327  THR A N   1 
ATOM   2491 C  CA  . THR A 1 327 ? 133.333 113.288 51.898 1.00 20.90 ? 327  THR A CA  1 
ATOM   2492 C  C   . THR A 1 327 ? 133.032 112.573 50.574 1.00 22.78 ? 327  THR A C   1 
ATOM   2493 O  O   . THR A 1 327 ? 132.980 111.346 50.520 1.00 28.45 ? 327  THR A O   1 
ATOM   2494 C  CB  . THR A 1 327 ? 132.012 113.825 52.466 1.00 21.32 ? 327  THR A CB  1 
ATOM   2495 O  OG1 . THR A 1 327 ? 131.540 114.907 51.649 1.00 23.29 ? 327  THR A OG1 1 
ATOM   2496 C  CG2 . THR A 1 327 ? 132.212 114.318 53.892 1.00 23.78 ? 327  THR A CG2 1 
ATOM   2497 N  N   . ALA A 1 328 ? 132.848 113.339 49.509 1.00 27.95 ? 328  ALA A N   1 
ATOM   2498 C  CA  . ALA A 1 328 ? 132.528 112.780 48.202 1.00 24.36 ? 328  ALA A CA  1 
ATOM   2499 C  C   . ALA A 1 328 ? 133.464 111.681 47.702 1.00 28.24 ? 328  ALA A C   1 
ATOM   2500 O  O   . ALA A 1 328 ? 133.032 110.772 46.997 1.00 25.51 ? 328  ALA A O   1 
ATOM   2501 C  CB  . ALA A 1 328 ? 132.468 113.894 47.171 1.00 28.94 ? 328  ALA A CB  1 
ATOM   2502 N  N   . PHE A 1 329 ? 134.743 111.757 48.047 1.00 21.34 ? 329  PHE A N   1 
ATOM   2503 C  CA  . PHE A 1 329 ? 135.680 110.750 47.566 1.00 24.10 ? 329  PHE A CA  1 
ATOM   2504 C  C   . PHE A 1 329 ? 135.674 109.485 48.408 1.00 19.12 ? 329  PHE A C   1 
ATOM   2505 O  O   . PHE A 1 329 ? 136.230 108.473 48.005 1.00 21.44 ? 329  PHE A O   1 
ATOM   2506 C  CB  . PHE A 1 329 ? 137.106 111.319 47.508 1.00 17.20 ? 329  PHE A CB  1 
ATOM   2507 C  CG  . PHE A 1 329 ? 137.231 112.545 46.657 1.00 25.27 ? 329  PHE A CG  1 
ATOM   2508 C  CD1 . PHE A 1 329 ? 136.866 113.794 47.157 1.00 20.15 ? 329  PHE A CD1 1 
ATOM   2509 C  CD2 . PHE A 1 329 ? 137.679 112.450 45.338 1.00 23.92 ? 329  PHE A CD2 1 
ATOM   2510 C  CE1 . PHE A 1 329 ? 136.945 114.934 46.360 1.00 22.12 ? 329  PHE A CE1 1 
ATOM   2511 C  CE2 . PHE A 1 329 ? 137.762 113.581 44.531 1.00 22.13 ? 329  PHE A CE2 1 
ATOM   2512 C  CZ  . PHE A 1 329 ? 137.391 114.830 45.044 1.00 21.30 ? 329  PHE A CZ  1 
ATOM   2513 N  N   . LEU A 1 330 ? 135.045 109.536 49.575 1.00 20.31 ? 330  LEU A N   1 
ATOM   2514 C  CA  . LEU A 1 330 ? 135.023 108.367 50.441 1.00 25.16 ? 330  LEU A CA  1 
ATOM   2515 C  C   . LEU A 1 330 ? 134.268 107.173 49.847 1.00 31.17 ? 330  LEU A C   1 
ATOM   2516 O  O   . LEU A 1 330 ? 134.667 106.025 50.048 1.00 26.89 ? 330  LEU A O   1 
ATOM   2517 C  CB  . LEU A 1 330 ? 134.456 108.740 51.814 1.00 21.26 ? 330  LEU A CB  1 
ATOM   2518 C  CG  . LEU A 1 330 ? 135.217 109.871 52.529 1.00 22.67 ? 330  LEU A CG  1 
ATOM   2519 C  CD1 . LEU A 1 330 ? 134.598 110.119 53.896 1.00 24.48 ? 330  LEU A CD1 1 
ATOM   2520 C  CD2 . LEU A 1 330 ? 136.694 109.513 52.666 1.00 16.36 ? 330  LEU A CD2 1 
ATOM   2521 N  N   . VAL A 1 331 ? 133.195 107.426 49.104 1.00 28.44 ? 331  VAL A N   1 
ATOM   2522 C  CA  . VAL A 1 331 ? 132.447 106.322 48.518 1.00 28.64 ? 331  VAL A CA  1 
ATOM   2523 C  C   . VAL A 1 331 ? 133.055 105.786 47.222 1.00 33.00 ? 331  VAL A C   1 
ATOM   2524 O  O   . VAL A 1 331 ? 132.458 104.941 46.555 1.00 35.51 ? 331  VAL A O   1 
ATOM   2525 C  CB  . VAL A 1 331 ? 130.985 106.706 48.262 1.00 26.82 ? 331  VAL A CB  1 
ATOM   2526 C  CG1 . VAL A 1 331 ? 130.288 106.953 49.592 1.00 27.10 ? 331  VAL A CG1 1 
ATOM   2527 C  CG2 . VAL A 1 331 ? 130.910 107.939 47.365 1.00 27.36 ? 331  VAL A CG2 1 
ATOM   2528 N  N   . TYR A 1 332 ? 134.242 106.266 46.866 1.00 25.56 ? 332  TYR A N   1 
ATOM   2529 C  CA  . TYR A 1 332 ? 134.895 105.793 45.656 1.00 23.55 ? 332  TYR A CA  1 
ATOM   2530 C  C   . TYR A 1 332 ? 136.163 105.014 45.981 1.00 31.81 ? 332  TYR A C   1 
ATOM   2531 O  O   . TYR A 1 332 ? 137.153 105.101 45.256 1.00 35.46 ? 332  TYR A O   1 
ATOM   2532 C  CB  . TYR A 1 332 ? 135.237 106.958 44.717 1.00 24.81 ? 332  TYR A CB  1 
ATOM   2533 C  CG  . TYR A 1 332 ? 134.044 107.586 44.017 1.00 25.19 ? 332  TYR A CG  1 
ATOM   2534 C  CD1 . TYR A 1 332 ? 133.261 108.553 44.651 1.00 19.59 ? 332  TYR A CD1 1 
ATOM   2535 C  CD2 . TYR A 1 332 ? 133.698 107.208 42.717 1.00 22.77 ? 332  TYR A CD2 1 
ATOM   2536 C  CE1 . TYR A 1 332 ? 132.163 109.130 44.006 1.00 21.72 ? 332  TYR A CE1 1 
ATOM   2537 C  CE2 . TYR A 1 332 ? 132.608 107.775 42.065 1.00 18.98 ? 332  TYR A CE2 1 
ATOM   2538 C  CZ  . TYR A 1 332 ? 131.847 108.735 42.712 1.00 25.71 ? 332  TYR A CZ  1 
ATOM   2539 O  OH  . TYR A 1 332 ? 130.779 109.301 42.059 1.00 23.17 ? 332  TYR A OH  1 
ATOM   2540 N  N   . GLY A 1 333 ? 136.140 104.252 47.069 1.00 35.34 ? 333  GLY A N   1 
ATOM   2541 C  CA  . GLY A 1 333 ? 137.315 103.478 47.418 1.00 38.84 ? 333  GLY A CA  1 
ATOM   2542 C  C   . GLY A 1 333 ? 137.481 103.174 48.893 1.00 44.52 ? 333  GLY A C   1 
ATOM   2543 O  O   . GLY A 1 333 ? 138.032 102.133 49.252 1.00 47.30 ? 333  GLY A O   1 
ATOM   2544 N  N   . ALA A 1 334 ? 137.010 104.071 49.751 1.00 37.23 ? 334  ALA A N   1 
ATOM   2545 C  CA  . ALA A 1 334 ? 137.129 103.874 51.193 1.00 38.04 ? 334  ALA A CA  1 
ATOM   2546 C  C   . ALA A 1 334 ? 136.242 102.739 51.712 1.00 38.72 ? 334  ALA A C   1 
ATOM   2547 O  O   . ALA A 1 334 ? 135.014 102.789 51.607 1.00 40.47 ? 334  ALA A O   1 
ATOM   2548 C  CB  . ALA A 1 334 ? 136.801 105.173 51.923 1.00 31.60 ? 334  ALA A CB  1 
ATOM   2549 N  N   . PRO A 1 335 ? 136.858 101.705 52.300 1.00 36.95 ? 335  PRO A N   1 
ATOM   2550 C  CA  . PRO A 1 335 ? 136.108 100.565 52.832 1.00 39.00 ? 335  PRO A CA  1 
ATOM   2551 C  C   . PRO A 1 335 ? 135.170 100.967 53.961 1.00 38.43 ? 335  PRO A C   1 
ATOM   2552 O  O   . PRO A 1 335 ? 135.517 101.794 54.803 1.00 39.90 ? 335  PRO A O   1 
ATOM   2553 C  CB  . PRO A 1 335 ? 137.208 99.624  53.303 1.00 36.74 ? 335  PRO A CB  1 
ATOM   2554 C  CG  . PRO A 1 335 ? 138.261 100.570 53.760 1.00 44.82 ? 335  PRO A CG  1 
ATOM   2555 C  CD  . PRO A 1 335 ? 138.282 101.598 52.652 1.00 39.78 ? 335  PRO A CD  1 
ATOM   2556 N  N   . GLY A 1 336 ? 133.979 100.383 53.972 1.00 39.98 ? 336  GLY A N   1 
ATOM   2557 C  CA  . GLY A 1 336 ? 133.020 100.699 55.012 1.00 34.85 ? 336  GLY A CA  1 
ATOM   2558 C  C   . GLY A 1 336 ? 132.112 101.865 54.680 1.00 33.24 ? 336  GLY A C   1 
ATOM   2559 O  O   . GLY A 1 336 ? 131.154 102.107 55.400 1.00 37.12 ? 336  GLY A O   1 
ATOM   2560 N  N   . PHE A 1 337 ? 132.404 102.594 53.606 1.00 34.64 ? 337  PHE A N   1 
ATOM   2561 C  CA  . PHE A 1 337 ? 131.566 103.731 53.226 1.00 35.57 ? 337  PHE A CA  1 
ATOM   2562 C  C   . PHE A 1 337 ? 130.536 103.372 52.168 1.00 36.17 ? 337  PHE A C   1 
ATOM   2563 O  O   . PHE A 1 337 ? 130.718 102.436 51.390 1.00 40.86 ? 337  PHE A O   1 
ATOM   2564 C  CB  . PHE A 1 337 ? 132.415 104.903 52.724 1.00 32.80 ? 337  PHE A CB  1 
ATOM   2565 C  CG  . PHE A 1 337 ? 133.202 105.586 53.801 1.00 29.20 ? 337  PHE A CG  1 
ATOM   2566 C  CD1 . PHE A 1 337 ? 134.433 105.090 54.202 1.00 25.17 ? 337  PHE A CD1 1 
ATOM   2567 C  CD2 . PHE A 1 337 ? 132.685 106.696 54.453 1.00 26.42 ? 337  PHE A CD2 1 
ATOM   2568 C  CE1 . PHE A 1 337 ? 135.141 105.698 55.224 1.00 25.40 ? 337  PHE A CE1 1 
ATOM   2569 C  CE2 . PHE A 1 337 ? 133.388 107.307 55.477 1.00 29.57 ? 337  PHE A CE2 1 
ATOM   2570 C  CZ  . PHE A 1 337 ? 134.614 106.803 55.867 1.00 26.38 ? 337  PHE A CZ  1 
ATOM   2571 N  N   . SER A 1 338 ? 129.450 104.131 52.147 1.00 32.53 ? 338  SER A N   1 
ATOM   2572 C  CA  . SER A 1 338 ? 128.376 103.904 51.193 1.00 34.91 ? 338  SER A CA  1 
ATOM   2573 C  C   . SER A 1 338 ? 127.409 105.073 51.237 1.00 28.37 ? 338  SER A C   1 
ATOM   2574 O  O   . SER A 1 338 ? 127.137 105.623 52.302 1.00 33.68 ? 338  SER A O   1 
ATOM   2575 C  CB  . SER A 1 338 ? 127.635 102.601 51.532 1.00 34.28 ? 338  SER A CB  1 
ATOM   2576 O  OG  . SER A 1 338 ? 126.408 102.495 50.827 1.00 34.45 ? 338  SER A OG  1 
ATOM   2577 N  N   . LYS A 1 339 ? 126.893 105.460 50.079 1.00 27.69 ? 339  LYS A N   1 
ATOM   2578 C  CA  . LYS A 1 339 ? 125.947 106.562 50.035 1.00 34.39 ? 339  LYS A CA  1 
ATOM   2579 C  C   . LYS A 1 339 ? 124.576 106.081 50.512 1.00 34.82 ? 339  LYS A C   1 
ATOM   2580 O  O   . LYS A 1 339 ? 123.649 106.875 50.625 1.00 35.48 ? 339  LYS A O   1 
ATOM   2581 C  CB  . LYS A 1 339 ? 125.826 107.117 48.613 1.00 32.86 ? 339  LYS A CB  1 
ATOM   2582 C  CG  . LYS A 1 339 ? 125.012 106.244 47.669 1.00 32.98 ? 339  LYS A CG  1 
ATOM   2583 C  CD  . LYS A 1 339 ? 124.809 106.916 46.320 1.00 38.82 ? 339  LYS A CD  1 
ATOM   2584 C  CE  . LYS A 1 339 ? 123.762 106.187 45.489 1.00 43.63 ? 339  LYS A CE  1 
ATOM   2585 N  NZ  . LYS A 1 339 ? 122.404 106.233 46.119 1.00 40.70 ? 339  LYS A NZ  1 
ATOM   2586 N  N   . ASP A 1 340 ? 124.451 104.788 50.806 1.00 34.00 ? 340  ASP A N   1 
ATOM   2587 C  CA  . ASP A 1 340 ? 123.165 104.252 51.242 1.00 40.44 ? 340  ASP A CA  1 
ATOM   2588 C  C   . ASP A 1 340 ? 123.006 103.928 52.733 1.00 44.61 ? 340  ASP A C   1 
ATOM   2589 O  O   . ASP A 1 340 ? 122.002 103.337 53.138 1.00 46.22 ? 340  ASP A O   1 
ATOM   2590 C  CB  . ASP A 1 340 ? 122.803 103.032 50.391 1.00 38.26 ? 340  ASP A CB  1 
ATOM   2591 C  CG  . ASP A 1 340 ? 122.772 103.354 48.900 1.00 45.75 ? 340  ASP A CG  1 
ATOM   2592 O  OD1 . ASP A 1 340 ? 122.257 104.433 48.538 1.00 36.69 ? 340  ASP A OD1 1 
ATOM   2593 O  OD2 . ASP A 1 340 ? 123.253 102.532 48.089 1.00 50.68 ? 340  ASP A OD2 1 
ATOM   2594 N  N   . ASN A 1 341 ? 123.994 104.302 53.544 1.00 43.22 ? 341  ASN A N   1 
ATOM   2595 C  CA  . ASN A 1 341 ? 123.927 104.110 54.994 1.00 42.28 ? 341  ASN A CA  1 
ATOM   2596 C  C   . ASN A 1 341 ? 124.795 105.165 55.666 1.00 43.36 ? 341  ASN A C   1 
ATOM   2597 O  O   . ASN A 1 341 ? 125.589 105.822 54.998 1.00 48.34 ? 341  ASN A O   1 
ATOM   2598 C  CB  . ASN A 1 341 ? 124.356 102.694 55.422 1.00 34.07 ? 341  ASN A CB  1 
ATOM   2599 C  CG  . ASN A 1 341 ? 125.763 102.340 55.002 1.00 38.52 ? 341  ASN A CG  1 
ATOM   2600 O  OD1 . ASN A 1 341 ? 126.679 103.164 55.073 1.00 38.46 ? 341  ASN A OD1 1 
ATOM   2601 N  ND2 . ASN A 1 341 ? 125.933 101.088 54.584 1.00 32.68 ? 341  ASN A ND2 1 
ATOM   2602 N  N   . ASN A 1 342 ? 124.636 105.334 56.977 1.00 45.09 ? 342  ASN A N   1 
ATOM   2603 C  CA  . ASN A 1 342 ? 125.384 106.341 57.731 1.00 43.15 ? 342  ASN A CA  1 
ATOM   2604 C  C   . ASN A 1 342 ? 126.898 106.145 57.752 1.00 39.19 ? 342  ASN A C   1 
ATOM   2605 O  O   . ASN A 1 342 ? 127.622 106.942 58.339 1.00 42.03 ? 342  ASN A O   1 
ATOM   2606 C  CB  . ASN A 1 342 ? 124.851 106.430 59.166 1.00 45.74 ? 342  ASN A CB  1 
ATOM   2607 C  CG  . ASN A 1 342 ? 124.783 105.083 59.844 1.00 46.40 ? 342  ASN A CG  1 
ATOM   2608 O  OD1 . ASN A 1 342 ? 125.763 104.339 59.862 1.00 50.29 ? 342  ASN A OD1 1 
ATOM   2609 N  ND2 . ASN A 1 342 ? 123.624 104.757 60.406 0.00 48.76 ? 342  ASN A ND2 1 
ATOM   2610 N  N   . SER A 1 343 ? 127.373 105.082 57.114 1.00 39.72 ? 343  SER A N   1 
ATOM   2611 C  CA  . SER A 1 343 ? 128.803 104.800 57.034 1.00 41.71 ? 343  SER A CA  1 
ATOM   2612 C  C   . SER A 1 343 ? 129.597 104.899 58.337 1.00 43.03 ? 343  SER A C   1 
ATOM   2613 O  O   . SER A 1 343 ? 130.697 105.452 58.349 1.00 37.05 ? 343  SER A O   1 
ATOM   2614 C  CB  . SER A 1 343 ? 129.448 105.717 55.993 1.00 39.63 ? 343  SER A CB  1 
ATOM   2615 O  OG  . SER A 1 343 ? 129.003 105.398 54.690 1.00 39.32 ? 343  SER A OG  1 
ATOM   2616 N  N   . ILE A 1 344 ? 129.053 104.369 59.428 1.00 43.86 ? 344  ILE A N   1 
ATOM   2617 C  CA  . ILE A 1 344 ? 129.761 104.398 60.705 1.00 45.47 ? 344  ILE A CA  1 
ATOM   2618 C  C   . ILE A 1 344 ? 130.918 103.403 60.613 1.00 46.58 ? 344  ILE A C   1 
ATOM   2619 O  O   . ILE A 1 344 ? 130.709 102.196 60.684 1.00 55.21 ? 344  ILE A O   1 
ATOM   2620 C  CB  . ILE A 1 344 ? 128.839 103.985 61.875 1.00 43.75 ? 344  ILE A CB  1 
ATOM   2621 C  CG1 . ILE A 1 344 ? 127.710 105.002 62.038 1.00 40.97 ? 344  ILE A CG1 1 
ATOM   2622 C  CG2 . ILE A 1 344 ? 129.643 103.873 63.161 1.00 42.48 ? 344  ILE A CG2 1 
ATOM   2623 C  CD1 . ILE A 1 344 ? 128.175 106.396 62.386 1.00 39.16 ? 344  ILE A CD1 1 
ATOM   2624 N  N   . ILE A 1 345 ? 132.137 103.906 60.449 1.00 43.76 ? 345  ILE A N   1 
ATOM   2625 C  CA  . ILE A 1 345 ? 133.292 103.023 60.329 1.00 39.79 ? 345  ILE A CA  1 
ATOM   2626 C  C   . ILE A 1 345 ? 134.100 102.873 61.618 1.00 40.08 ? 345  ILE A C   1 
ATOM   2627 O  O   . ILE A 1 345 ? 133.931 103.636 62.568 1.00 41.43 ? 345  ILE A O   1 
ATOM   2628 C  CB  . ILE A 1 345 ? 134.245 103.504 59.213 1.00 40.36 ? 345  ILE A CB  1 
ATOM   2629 C  CG1 . ILE A 1 345 ? 134.747 104.918 59.522 1.00 35.03 ? 345  ILE A CG1 1 
ATOM   2630 C  CG2 . ILE A 1 345 ? 133.534 103.457 57.871 1.00 28.35 ? 345  ILE A CG2 1 
ATOM   2631 C  CD1 . ILE A 1 345 ? 135.974 105.305 58.731 1.00 32.97 ? 345  ILE A CD1 1 
ATOM   2632 N  N   . THR A 1 346 ? 134.988 101.884 61.633 1.00 43.25 ? 346  THR A N   1 
ATOM   2633 C  CA  . THR A 1 346 ? 135.835 101.618 62.794 1.00 43.73 ? 346  THR A CA  1 
ATOM   2634 C  C   . THR A 1 346 ? 137.238 102.188 62.602 1.00 43.44 ? 346  THR A C   1 
ATOM   2635 O  O   . THR A 1 346 ? 137.591 102.645 61.517 1.00 45.23 ? 346  THR A O   1 
ATOM   2636 C  CB  . THR A 1 346 ? 135.982 100.098 63.047 1.00 45.40 ? 346  THR A CB  1 
ATOM   2637 O  OG1 . THR A 1 346 ? 136.567 99.472  61.896 1.00 39.32 ? 346  THR A OG1 1 
ATOM   2638 C  CG2 . THR A 1 346 ? 134.634 99.471  63.328 1.00 41.62 ? 346  THR A CG2 1 
ATOM   2639 N  N   . ARG A 1 347 ? 138.036 102.144 63.664 1.00 42.26 ? 347  ARG A N   1 
ATOM   2640 C  CA  . ARG A 1 347 ? 139.410 102.633 63.626 1.00 36.63 ? 347  ARG A CA  1 
ATOM   2641 C  C   . ARG A 1 347 ? 140.176 101.865 62.557 1.00 33.90 ? 347  ARG A C   1 
ATOM   2642 O  O   . ARG A 1 347 ? 140.983 102.434 61.813 1.00 35.39 ? 347  ARG A O   1 
ATOM   2643 C  CB  . ARG A 1 347 ? 140.076 102.412 64.986 1.00 39.34 ? 347  ARG A CB  1 
ATOM   2644 C  CG  . ARG A 1 347 ? 141.497 102.941 65.109 1.00 41.77 ? 347  ARG A CG  1 
ATOM   2645 C  CD  . ARG A 1 347 ? 142.109 102.468 66.417 1.00 45.43 ? 347  ARG A CD  1 
ATOM   2646 N  NE  . ARG A 1 347 ? 143.426 103.041 66.675 1.00 51.83 ? 347  ARG A NE  1 
ATOM   2647 C  CZ  . ARG A 1 347 ? 143.643 104.312 67.003 1.00 56.77 ? 347  ARG A CZ  1 
ATOM   2648 N  NH1 . ARG A 1 347 ? 142.629 105.162 67.114 1.00 52.98 ? 347  ARG A NH1 1 
ATOM   2649 N  NH2 . ARG A 1 347 ? 144.879 104.731 67.233 1.00 63.62 ? 347  ARG A NH2 1 
ATOM   2650 N  N   . LYS A 1 348 ? 139.907 100.566 62.484 1.00 31.57 ? 348  LYS A N   1 
ATOM   2651 C  CA  . LYS A 1 348 ? 140.564 99.694  61.525 1.00 33.75 ? 348  LYS A CA  1 
ATOM   2652 C  C   . LYS A 1 348 ? 140.201 100.073 60.093 1.00 32.41 ? 348  LYS A C   1 
ATOM   2653 O  O   . LYS A 1 348 ? 141.044 100.011 59.194 1.00 33.15 ? 348  LYS A O   1 
ATOM   2654 C  CB  . LYS A 1 348 ? 140.180 98.233  61.795 1.00 42.47 ? 348  LYS A CB  1 
ATOM   2655 C  CG  . LYS A 1 348 ? 141.062 97.204  61.087 1.00 47.99 ? 348  LYS A CG  1 
ATOM   2656 C  CD  . LYS A 1 348 ? 142.480 97.213  61.639 0.00 46.83 ? 348  LYS A CD  1 
ATOM   2657 C  CE  . LYS A 1 348 ? 143.346 96.157  60.968 0.00 47.33 ? 348  LYS A CE  1 
ATOM   2658 N  NZ  . LYS A 1 348 ? 142.815 94.781  61.178 0.00 47.02 ? 348  LYS A NZ  1 
ATOM   2659 N  N   . GLU A 1 349 ? 138.948 100.459 59.870 1.00 32.46 ? 349  GLU A N   1 
ATOM   2660 C  CA  . GLU A 1 349 ? 138.530 100.850 58.529 1.00 38.09 ? 349  GLU A CA  1 
ATOM   2661 C  C   . GLU A 1 349 ? 139.158 102.200 58.193 1.00 36.22 ? 349  GLU A C   1 
ATOM   2662 O  O   . GLU A 1 349 ? 139.640 102.420 57.075 1.00 34.02 ? 349  GLU A O   1 
ATOM   2663 C  CB  . GLU A 1 349 ? 137.001 100.896 58.438 1.00 41.30 ? 349  GLU A CB  1 
ATOM   2664 C  CG  . GLU A 1 349 ? 136.393 99.508  58.213 1.00 49.51 ? 349  GLU A CG  1 
ATOM   2665 C  CD  . GLU A 1 349 ? 134.887 99.462  58.411 1.00 52.98 ? 349  GLU A CD  1 
ATOM   2666 O  OE1 . GLU A 1 349 ? 134.403 100.006 59.428 1.00 45.17 ? 349  GLU A OE1 1 
ATOM   2667 O  OE2 . GLU A 1 349 ? 134.193 98.869  57.555 1.00 56.31 ? 349  GLU A OE2 1 
ATOM   2668 N  N   . PHE A 1 350 ? 139.179 103.090 59.179 1.00 30.85 ? 350  PHE A N   1 
ATOM   2669 C  CA  . PHE A 1 350 ? 139.788 104.402 59.009 1.00 29.91 ? 350  PHE A CA  1 
ATOM   2670 C  C   . PHE A 1 350 ? 141.232 104.209 58.563 1.00 31.36 ? 350  PHE A C   1 
ATOM   2671 O  O   . PHE A 1 350 ? 141.699 104.857 57.622 1.00 31.60 ? 350  PHE A O   1 
ATOM   2672 C  CB  . PHE A 1 350 ? 139.743 105.172 60.330 1.00 28.77 ? 350  PHE A CB  1 
ATOM   2673 C  CG  . PHE A 1 350 ? 140.489 106.479 60.306 1.00 34.16 ? 350  PHE A CG  1 
ATOM   2674 C  CD1 . PHE A 1 350 ? 141.869 106.515 60.495 1.00 32.88 ? 350  PHE A CD1 1 
ATOM   2675 C  CD2 . PHE A 1 350 ? 139.808 107.680 60.116 1.00 35.37 ? 350  PHE A CD2 1 
ATOM   2676 C  CE1 . PHE A 1 350 ? 142.559 107.724 60.497 1.00 31.14 ? 350  PHE A CE1 1 
ATOM   2677 C  CE2 . PHE A 1 350 ? 140.488 108.894 60.118 1.00 31.66 ? 350  PHE A CE2 1 
ATOM   2678 C  CZ  . PHE A 1 350 ? 141.870 108.914 60.309 1.00 27.05 ? 350  PHE A CZ  1 
ATOM   2679 N  N   . GLN A 1 351 ? 141.937 103.303 59.235 1.00 32.90 ? 351  GLN A N   1 
ATOM   2680 C  CA  . GLN A 1 351 ? 143.327 103.036 58.892 1.00 33.01 ? 351  GLN A CA  1 
ATOM   2681 C  C   . GLN A 1 351 ? 143.462 102.507 57.470 1.00 31.64 ? 351  GLN A C   1 
ATOM   2682 O  O   . GLN A 1 351 ? 144.394 102.871 56.757 1.00 29.33 ? 351  GLN A O   1 
ATOM   2683 C  CB  . GLN A 1 351 ? 143.938 102.062 59.897 1.00 38.61 ? 351  GLN A CB  1 
ATOM   2684 C  CG  . GLN A 1 351 ? 144.007 102.648 61.302 1.00 50.83 ? 351  GLN A CG  1 
ATOM   2685 C  CD  . GLN A 1 351 ? 144.606 101.696 62.314 1.00 54.89 ? 351  GLN A CD  1 
ATOM   2686 O  OE1 . GLN A 1 351 ? 144.062 100.623 62.575 1.00 56.21 ? 351  GLN A OE1 1 
ATOM   2687 N  NE2 . GLN A 1 351 ? 145.734 102.087 62.894 1.00 55.78 ? 351  GLN A NE2 1 
ATOM   2688 N  N   . GLU A 1 352 ? 142.533 101.653 57.048 1.00 35.42 ? 352  GLU A N   1 
ATOM   2689 C  CA  . GLU A 1 352 ? 142.586 101.134 55.684 1.00 36.62 ? 352  GLU A CA  1 
ATOM   2690 C  C   . GLU A 1 352 ? 142.275 102.266 54.722 1.00 34.61 ? 352  GLU A C   1 
ATOM   2691 O  O   . GLU A 1 352 ? 142.786 102.301 53.604 1.00 29.10 ? 352  GLU A O   1 
ATOM   2692 C  CB  . GLU A 1 352 ? 141.589 99.985  55.478 1.00 44.44 ? 352  GLU A CB  1 
ATOM   2693 C  CG  . GLU A 1 352 ? 142.122 98.643  55.952 1.00 52.01 ? 352  GLU A CG  1 
ATOM   2694 C  CD  . GLU A 1 352 ? 143.498 98.336  55.377 1.00 52.85 ? 352  GLU A CD  1 
ATOM   2695 O  OE1 . GLU A 1 352 ? 144.402 97.971  56.155 0.00 52.61 ? 352  GLU A OE1 1 
ATOM   2696 O  OE2 . GLU A 1 352 ? 143.677 98.463  54.149 0.00 52.61 ? 352  GLU A OE2 1 
ATOM   2697 N  N   . GLY A 1 353 ? 141.433 103.194 55.167 1.00 34.14 ? 353  GLY A N   1 
ATOM   2698 C  CA  . GLY A 1 353 ? 141.087 104.332 54.333 1.00 32.15 ? 353  GLY A CA  1 
ATOM   2699 C  C   . GLY A 1 353 ? 142.326 105.141 54.003 1.00 33.60 ? 353  GLY A C   1 
ATOM   2700 O  O   . GLY A 1 353 ? 142.507 105.565 52.859 1.00 31.79 ? 353  GLY A O   1 
ATOM   2701 N  N   . LEU A 1 354 ? 143.185 105.350 55.002 1.00 29.86 ? 354  LEU A N   1 
ATOM   2702 C  CA  . LEU A 1 354 ? 144.413 106.113 54.801 1.00 28.27 ? 354  LEU A CA  1 
ATOM   2703 C  C   . LEU A 1 354 ? 145.281 105.414 53.767 1.00 29.82 ? 354  LEU A C   1 
ATOM   2704 O  O   . LEU A 1 354 ? 145.958 106.062 52.972 1.00 32.29 ? 354  LEU A O   1 
ATOM   2705 C  CB  . LEU A 1 354 ? 145.187 106.263 56.116 1.00 26.27 ? 354  LEU A CB  1 
ATOM   2706 C  CG  . LEU A 1 354 ? 144.548 107.108 57.225 1.00 30.09 ? 354  LEU A CG  1 
ATOM   2707 C  CD1 . LEU A 1 354 ? 145.473 107.152 58.428 1.00 29.32 ? 354  LEU A CD1 1 
ATOM   2708 C  CD2 . LEU A 1 354 ? 144.283 108.517 56.719 1.00 28.35 ? 354  LEU A CD2 1 
ATOM   2709 N  N   . LYS A 1 355 ? 145.259 104.087 53.786 1.00 32.43 ? 355  LYS A N   1 
ATOM   2710 C  CA  . LYS A 1 355 ? 146.030 103.298 52.830 1.00 38.80 ? 355  LYS A CA  1 
ATOM   2711 C  C   . LYS A 1 355 ? 145.603 103.690 51.423 1.00 36.84 ? 355  LYS A C   1 
ATOM   2712 O  O   . LYS A 1 355 ? 146.428 103.846 50.522 1.00 35.39 ? 355  LYS A O   1 
ATOM   2713 C  CB  . LYS A 1 355 ? 145.764 101.806 53.041 1.00 41.98 ? 355  LYS A CB  1 
ATOM   2714 C  CG  . LYS A 1 355 ? 146.786 101.096 53.889 1.00 49.37 ? 355  LYS A CG  1 
ATOM   2715 C  CD  . LYS A 1 355 ? 147.760 100.302 53.029 1.00 61.79 ? 355  LYS A CD  1 
ATOM   2716 C  CE  . LYS A 1 355 ? 147.576 98.808  53.258 1.00 68.61 ? 355  LYS A CE  1 
ATOM   2717 N  NZ  . LYS A 1 355 ? 147.466 98.502  54.720 1.00 74.81 ? 355  LYS A NZ  1 
ATOM   2718 N  N   . ILE A 1 356 ? 144.296 103.851 51.255 1.00 36.64 ? 356  ILE A N   1 
ATOM   2719 C  CA  . ILE A 1 356 ? 143.713 104.218 49.974 1.00 36.72 ? 356  ILE A CA  1 
ATOM   2720 C  C   . ILE A 1 356 ? 144.063 105.632 49.537 1.00 37.23 ? 356  ILE A C   1 
ATOM   2721 O  O   . ILE A 1 356 ? 144.406 105.860 48.379 1.00 40.81 ? 356  ILE A O   1 
ATOM   2722 C  CB  . ILE A 1 356 ? 142.184 104.061 50.027 1.00 36.83 ? 356  ILE A CB  1 
ATOM   2723 C  CG1 . ILE A 1 356 ? 141.835 102.578 49.929 1.00 36.07 ? 356  ILE A CG1 1 
ATOM   2724 C  CG2 . ILE A 1 356 ? 141.522 104.855 48.914 1.00 34.74 ? 356  ILE A CG2 1 
ATOM   2725 C  CD1 . ILE A 1 356 ? 140.517 102.243 50.547 1.00 44.48 ? 356  ILE A CD1 1 
ATOM   2726 N  N   . PHE A 1 357 ? 143.991 106.581 50.461 1.00 34.76 ? 357  PHE A N   1 
ATOM   2727 C  CA  . PHE A 1 357 ? 144.293 107.961 50.120 1.00 33.28 ? 357  PHE A CA  1 
ATOM   2728 C  C   . PHE A 1 357 ? 145.763 108.360 50.177 1.00 29.90 ? 357  PHE A C   1 
ATOM   2729 O  O   . PHE A 1 357 ? 146.155 109.366 49.591 1.00 24.03 ? 357  PHE A O   1 
ATOM   2730 C  CB  . PHE A 1 357 ? 143.440 108.887 50.982 1.00 29.34 ? 357  PHE A CB  1 
ATOM   2731 C  CG  . PHE A 1 357 ? 141.999 108.899 50.576 1.00 30.57 ? 357  PHE A CG  1 
ATOM   2732 C  CD1 . PHE A 1 357 ? 141.594 109.597 49.444 1.00 27.74 ? 357  PHE A CD1 1 
ATOM   2733 C  CD2 . PHE A 1 357 ? 141.053 108.172 51.293 1.00 28.77 ? 357  PHE A CD2 1 
ATOM   2734 C  CE1 . PHE A 1 357 ? 140.266 109.570 49.027 1.00 29.56 ? 357  PHE A CE1 1 
ATOM   2735 C  CE2 . PHE A 1 357 ? 139.719 108.138 50.885 1.00 32.61 ? 357  PHE A CE2 1 
ATOM   2736 C  CZ  . PHE A 1 357 ? 139.325 108.838 49.751 1.00 24.51 ? 357  PHE A CZ  1 
ATOM   2737 N  N   . PHE A 1 358 ? 146.580 107.568 50.861 1.00 28.68 ? 358  PHE A N   1 
ATOM   2738 C  CA  . PHE A 1 358 ? 148.004 107.867 50.955 1.00 33.86 ? 358  PHE A CA  1 
ATOM   2739 C  C   . PHE A 1 358 ? 148.832 106.621 50.663 1.00 37.92 ? 358  PHE A C   1 
ATOM   2740 O  O   . PHE A 1 358 ? 149.602 106.164 51.506 1.00 40.26 ? 358  PHE A O   1 
ATOM   2741 C  CB  . PHE A 1 358 ? 148.335 108.408 52.344 1.00 24.28 ? 358  PHE A CB  1 
ATOM   2742 C  CG  . PHE A 1 358 ? 147.540 109.625 52.719 1.00 30.97 ? 358  PHE A CG  1 
ATOM   2743 C  CD1 . PHE A 1 358 ? 146.263 109.498 53.255 1.00 23.65 ? 358  PHE A CD1 1 
ATOM   2744 C  CD2 . PHE A 1 358 ? 148.058 110.904 52.515 1.00 32.14 ? 358  PHE A CD2 1 
ATOM   2745 C  CE1 . PHE A 1 358 ? 145.512 110.622 53.584 1.00 25.83 ? 358  PHE A CE1 1 
ATOM   2746 C  CE2 . PHE A 1 358 ? 147.309 112.038 52.843 1.00 23.93 ? 358  PHE A CE2 1 
ATOM   2747 C  CZ  . PHE A 1 358 ? 146.038 111.894 53.377 1.00 20.46 ? 358  PHE A CZ  1 
ATOM   2748 N  N   . PRO A 1 359 ? 148.690 106.066 49.446 1.00 44.82 ? 359  PRO A N   1 
ATOM   2749 C  CA  . PRO A 1 359 ? 149.387 104.866 48.972 1.00 47.05 ? 359  PRO A CA  1 
ATOM   2750 C  C   . PRO A 1 359 ? 150.891 104.741 49.228 1.00 50.65 ? 359  PRO A C   1 
ATOM   2751 O  O   . PRO A 1 359 ? 151.321 103.834 49.939 1.00 55.76 ? 359  PRO A O   1 
ATOM   2752 C  CB  . PRO A 1 359 ? 149.044 104.830 47.479 1.00 45.69 ? 359  PRO A CB  1 
ATOM   2753 C  CG  . PRO A 1 359 ? 148.738 106.255 47.148 1.00 46.70 ? 359  PRO A CG  1 
ATOM   2754 C  CD  . PRO A 1 359 ? 147.935 106.680 48.341 1.00 44.40 ? 359  PRO A CD  1 
ATOM   2755 N  N   . GLY A 1 360 ? 151.691 105.636 48.660 1.00 49.51 ? 360  GLY A N   1 
ATOM   2756 C  CA  . GLY A 1 360 ? 153.131 105.533 48.849 1.00 52.04 ? 360  GLY A CA  1 
ATOM   2757 C  C   . GLY A 1 360 ? 153.709 106.098 50.138 1.00 52.69 ? 360  GLY A C   1 
ATOM   2758 O  O   . GLY A 1 360 ? 154.926 106.213 50.278 1.00 56.48 ? 360  GLY A O   1 
ATOM   2759 N  N   . VAL A 1 361 ? 152.846 106.439 51.086 1.00 50.51 ? 361  VAL A N   1 
ATOM   2760 C  CA  . VAL A 1 361 ? 153.288 107.012 52.350 1.00 41.86 ? 361  VAL A CA  1 
ATOM   2761 C  C   . VAL A 1 361 ? 153.754 105.967 53.356 1.00 40.41 ? 361  VAL A C   1 
ATOM   2762 O  O   . VAL A 1 361 ? 153.161 104.894 53.473 1.00 34.59 ? 361  VAL A O   1 
ATOM   2763 C  CB  . VAL A 1 361 ? 152.162 107.844 52.991 1.00 33.55 ? 361  VAL A CB  1 
ATOM   2764 C  CG1 . VAL A 1 361 ? 152.609 108.390 54.340 1.00 33.53 ? 361  VAL A CG1 1 
ATOM   2765 C  CG2 . VAL A 1 361 ? 151.781 108.971 52.063 1.00 34.43 ? 361  VAL A CG2 1 
ATOM   2766 N  N   . SER A 1 362 ? 154.812 106.300 54.090 1.00 33.22 ? 362  SER A N   1 
ATOM   2767 C  CA  . SER A 1 362 ? 155.368 105.407 55.098 1.00 32.67 ? 362  SER A CA  1 
ATOM   2768 C  C   . SER A 1 362 ? 154.355 105.100 56.193 1.00 31.26 ? 362  SER A C   1 
ATOM   2769 O  O   . SER A 1 362 ? 153.344 105.787 56.333 1.00 32.59 ? 362  SER A O   1 
ATOM   2770 C  CB  . SER A 1 362 ? 156.596 106.045 55.735 1.00 34.70 ? 362  SER A CB  1 
ATOM   2771 O  OG  . SER A 1 362 ? 156.229 107.183 56.494 1.00 42.59 ? 362  SER A OG  1 
ATOM   2772 N  N   . GLU A 1 363 ? 154.638 104.072 56.980 1.00 30.72 ? 363  GLU A N   1 
ATOM   2773 C  CA  . GLU A 1 363 ? 153.748 103.693 58.067 1.00 34.74 ? 363  GLU A CA  1 
ATOM   2774 C  C   . GLU A 1 363 ? 153.697 104.820 59.101 1.00 34.60 ? 363  GLU A C   1 
ATOM   2775 O  O   . GLU A 1 363 ? 152.638 105.116 59.661 1.00 41.48 ? 363  GLU A O   1 
ATOM   2776 C  CB  . GLU A 1 363 ? 154.236 102.396 58.724 1.00 37.36 ? 363  GLU A CB  1 
ATOM   2777 C  CG  . GLU A 1 363 ? 153.103 101.482 59.158 1.00 60.06 ? 363  GLU A CG  1 
ATOM   2778 C  CD  . GLU A 1 363 ? 152.275 100.968 57.979 1.00 71.94 ? 363  GLU A CD  1 
ATOM   2779 O  OE1 . GLU A 1 363 ? 151.135 100.504 58.202 1.00 72.71 ? 363  GLU A OE1 1 
ATOM   2780 O  OE2 . GLU A 1 363 ? 152.767 101.017 56.829 1.00 78.81 ? 363  GLU A OE2 1 
ATOM   2781 N  N   . PHE A 1 364 ? 154.846 105.446 59.352 1.00 28.29 ? 364  PHE A N   1 
ATOM   2782 C  CA  . PHE A 1 364 ? 154.919 106.544 60.308 1.00 27.47 ? 364  PHE A CA  1 
ATOM   2783 C  C   . PHE A 1 364 ? 154.106 107.732 59.785 1.00 29.92 ? 364  PHE A C   1 
ATOM   2784 O  O   . PHE A 1 364 ? 153.417 108.420 60.545 1.00 27.67 ? 364  PHE A O   1 
ATOM   2785 C  CB  . PHE A 1 364 ? 156.378 106.951 60.533 1.00 28.16 ? 364  PHE A CB  1 
ATOM   2786 C  CG  . PHE A 1 364 ? 156.539 108.271 61.237 1.00 28.08 ? 364  PHE A CG  1 
ATOM   2787 C  CD1 . PHE A 1 364 ? 156.879 109.416 60.518 1.00 21.63 ? 364  PHE A CD1 1 
ATOM   2788 C  CD2 . PHE A 1 364 ? 156.327 108.376 62.611 1.00 23.15 ? 364  PHE A CD2 1 
ATOM   2789 C  CE1 . PHE A 1 364 ? 157.007 110.648 61.160 1.00 29.93 ? 364  PHE A CE1 1 
ATOM   2790 C  CE2 . PHE A 1 364 ? 156.451 109.603 63.264 1.00 27.02 ? 364  PHE A CE2 1 
ATOM   2791 C  CZ  . PHE A 1 364 ? 156.791 110.743 62.538 1.00 25.70 ? 364  PHE A CZ  1 
ATOM   2792 N  N   . GLY A 1 365 ? 154.195 107.964 58.480 1.00 24.65 ? 365  GLY A N   1 
ATOM   2793 C  CA  . GLY A 1 365 ? 153.440 109.042 57.874 1.00 26.37 ? 365  GLY A CA  1 
ATOM   2794 C  C   . GLY A 1 365 ? 151.947 108.896 58.127 1.00 24.18 ? 365  GLY A C   1 
ATOM   2795 O  O   . GLY A 1 365 ? 151.264 109.872 58.436 1.00 30.87 ? 365  GLY A O   1 
ATOM   2796 N  N   . LYS A 1 366 ? 151.429 107.677 58.015 1.00 21.66 ? 366  LYS A N   1 
ATOM   2797 C  CA  . LYS A 1 366 ? 150.002 107.465 58.237 1.00 23.65 ? 366  LYS A CA  1 
ATOM   2798 C  C   . LYS A 1 366 ? 149.629 107.532 59.712 1.00 25.90 ? 366  LYS A C   1 
ATOM   2799 O  O   . LYS A 1 366 ? 148.535 107.975 60.064 1.00 29.59 ? 366  LYS A O   1 
ATOM   2800 C  CB  . LYS A 1 366 ? 149.563 106.127 57.654 1.00 23.46 ? 366  LYS A CB  1 
ATOM   2801 C  CG  . LYS A 1 366 ? 149.925 105.967 56.194 1.00 30.02 ? 366  LYS A CG  1 
ATOM   2802 C  CD  . LYS A 1 366 ? 149.661 104.558 55.716 0.50 33.47 ? 366  LYS A CD  1 
ATOM   2803 C  CE  . LYS A 1 366 ? 150.832 104.057 54.894 1.00 35.18 ? 366  LYS A CE  1 
ATOM   2804 N  NZ  . LYS A 1 366 ? 150.551 102.722 54.305 0.50 37.28 ? 366  LYS A NZ  1 
ATOM   2805 N  N   . GLU A 1 367 ? 150.537 107.099 60.577 1.00 26.03 ? 367  GLU A N   1 
ATOM   2806 C  CA  . GLU A 1 367 ? 150.277 107.133 62.009 1.00 28.56 ? 367  GLU A CA  1 
ATOM   2807 C  C   . GLU A 1 367 ? 150.153 108.586 62.481 1.00 28.18 ? 367  GLU A C   1 
ATOM   2808 O  O   . GLU A 1 367 ? 149.315 108.907 63.333 1.00 21.23 ? 367  GLU A O   1 
ATOM   2809 C  CB  . GLU A 1 367 ? 151.402 106.436 62.773 1.00 34.73 ? 367  GLU A CB  1 
ATOM   2810 C  CG  . GLU A 1 367 ? 151.041 106.128 64.215 1.00 43.78 ? 367  GLU A CG  1 
ATOM   2811 C  CD  . GLU A 1 367 ? 150.051 104.984 64.338 0.50 45.20 ? 367  GLU A CD  1 
ATOM   2812 O  OE1 . GLU A 1 367 ? 149.413 104.862 65.405 0.50 45.91 ? 367  GLU A OE1 1 
ATOM   2813 O  OE2 . GLU A 1 367 ? 149.921 104.198 63.375 0.00 46.07 ? 367  GLU A OE2 1 
ATOM   2814 N  N   . SER A 1 368 ? 150.987 109.462 61.923 1.00 25.02 ? 368  SER A N   1 
ATOM   2815 C  CA  . SER A 1 368 ? 150.949 110.877 62.287 1.00 27.91 ? 368  SER A CA  1 
ATOM   2816 C  C   . SER A 1 368 ? 149.591 111.470 61.910 1.00 22.44 ? 368  SER A C   1 
ATOM   2817 O  O   . SER A 1 368 ? 149.064 112.334 62.607 1.00 27.84 ? 368  SER A O   1 
ATOM   2818 C  CB  . SER A 1 368 ? 152.067 111.642 61.584 1.00 19.63 ? 368  SER A CB  1 
ATOM   2819 O  OG  . SER A 1 368 ? 151.858 111.677 60.188 1.00 36.50 ? 368  SER A OG  1 
ATOM   2820 N  N   . ILE A 1 369 ? 149.022 111.003 60.804 1.00 21.91 ? 369  ILE A N   1 
ATOM   2821 C  CA  . ILE A 1 369 ? 147.706 111.482 60.388 1.00 24.02 ? 369  ILE A CA  1 
ATOM   2822 C  C   . ILE A 1 369 ? 146.701 111.027 61.449 1.00 21.46 ? 369  ILE A C   1 
ATOM   2823 O  O   . ILE A 1 369 ? 145.918 111.823 61.969 1.00 25.13 ? 369  ILE A O   1 
ATOM   2824 C  CB  . ILE A 1 369 ? 147.296 110.896 59.013 1.00 20.54 ? 369  ILE A CB  1 
ATOM   2825 C  CG1 . ILE A 1 369 ? 148.213 111.437 57.918 1.00 19.96 ? 369  ILE A CG1 1 
ATOM   2826 C  CG2 . ILE A 1 369 ? 145.849 111.246 58.700 1.00 18.52 ? 369  ILE A CG2 1 
ATOM   2827 C  CD1 . ILE A 1 369 ? 147.931 110.838 56.549 1.00 19.43 ? 369  ILE A CD1 1 
ATOM   2828 N  N   . LEU A 1 370 ? 146.743 109.742 61.778 1.00 24.44 ? 370  LEU A N   1 
ATOM   2829 C  CA  . LEU A 1 370 ? 145.845 109.183 62.777 1.00 26.71 ? 370  LEU A CA  1 
ATOM   2830 C  C   . LEU A 1 370 ? 145.967 109.941 64.093 1.00 27.61 ? 370  LEU A C   1 
ATOM   2831 O  O   . LEU A 1 370 ? 144.963 110.324 64.691 1.00 24.75 ? 370  LEU A O   1 
ATOM   2832 C  CB  . LEU A 1 370 ? 146.175 107.713 63.020 1.00 33.21 ? 370  LEU A CB  1 
ATOM   2833 C  CG  . LEU A 1 370 ? 145.266 106.998 64.020 1.00 37.57 ? 370  LEU A CG  1 
ATOM   2834 C  CD1 . LEU A 1 370 ? 143.995 106.545 63.323 1.00 41.83 ? 370  LEU A CD1 1 
ATOM   2835 C  CD2 . LEU A 1 370 ? 145.987 105.801 64.593 1.00 41.40 ? 370  LEU A CD2 1 
ATOM   2836 N  N   . PHE A 1 371 ? 147.205 110.146 64.541 1.00 27.38 ? 371  PHE A N   1 
ATOM   2837 C  CA  . PHE A 1 371 ? 147.467 110.852 65.791 1.00 24.23 ? 371  PHE A CA  1 
ATOM   2838 C  C   . PHE A 1 371 ? 146.866 112.250 65.803 1.00 25.02 ? 371  PHE A C   1 
ATOM   2839 O  O   . PHE A 1 371 ? 146.223 112.649 66.771 1.00 26.67 ? 371  PHE A O   1 
ATOM   2840 C  CB  . PHE A 1 371 ? 148.979 110.950 66.046 1.00 26.15 ? 371  PHE A CB  1 
ATOM   2841 C  CG  . PHE A 1 371 ? 149.338 111.770 67.261 1.00 38.92 ? 371  PHE A CG  1 
ATOM   2842 C  CD1 . PHE A 1 371 ? 149.628 113.128 67.144 1.00 34.28 ? 371  PHE A CD1 1 
ATOM   2843 C  CD2 . PHE A 1 371 ? 149.346 111.192 68.532 1.00 43.13 ? 371  PHE A CD2 1 
ATOM   2844 C  CE1 . PHE A 1 371 ? 149.917 113.900 68.274 1.00 42.42 ? 371  PHE A CE1 1 
ATOM   2845 C  CE2 . PHE A 1 371 ? 149.635 111.958 69.671 1.00 44.04 ? 371  PHE A CE2 1 
ATOM   2846 C  CZ  . PHE A 1 371 ? 149.920 113.311 69.542 1.00 40.75 ? 371  PHE A CZ  1 
ATOM   2847 N  N   . HIS A 1 372 ? 147.089 112.991 64.724 1.00 26.03 ? 372  HIS A N   1 
ATOM   2848 C  CA  . HIS A 1 372 ? 146.590 114.354 64.608 1.00 30.01 ? 372  HIS A CA  1 
ATOM   2849 C  C   . HIS A 1 372 ? 145.068 114.435 64.522 1.00 29.20 ? 372  HIS A C   1 
ATOM   2850 O  O   . HIS A 1 372 ? 144.455 115.322 65.111 1.00 29.06 ? 372  HIS A O   1 
ATOM   2851 C  CB  . HIS A 1 372 ? 147.199 115.034 63.378 1.00 31.75 ? 372  HIS A CB  1 
ATOM   2852 C  CG  . HIS A 1 372 ? 146.886 116.493 63.283 1.00 50.70 ? 372  HIS A CG  1 
ATOM   2853 N  ND1 . HIS A 1 372 ? 147.639 117.460 63.916 1.00 52.39 ? 372  HIS A ND1 1 
ATOM   2854 C  CD2 . HIS A 1 372 ? 145.869 117.148 62.672 1.00 53.84 ? 372  HIS A CD2 1 
ATOM   2855 C  CE1 . HIS A 1 372 ? 147.098 118.646 63.700 1.00 53.30 ? 372  HIS A CE1 1 
ATOM   2856 N  NE2 . HIS A 1 372 ? 146.022 118.485 62.949 1.00 54.59 ? 372  HIS A NE2 1 
ATOM   2857 N  N   . TYR A 1 373 ? 144.452 113.501 63.806 1.00 32.67 ? 373  TYR A N   1 
ATOM   2858 C  CA  . TYR A 1 373 ? 142.999 113.528 63.636 1.00 33.31 ? 373  TYR A CA  1 
ATOM   2859 C  C   . TYR A 1 373 ? 142.143 112.668 64.558 1.00 37.74 ? 373  TYR A C   1 
ATOM   2860 O  O   . TYR A 1 373 ? 140.924 112.630 64.393 1.00 40.94 ? 373  TYR A O   1 
ATOM   2861 C  CB  . TYR A 1 373 ? 142.656 113.182 62.189 1.00 27.83 ? 373  TYR A CB  1 
ATOM   2862 C  CG  . TYR A 1 373 ? 142.821 114.335 61.229 1.00 22.91 ? 373  TYR A CG  1 
ATOM   2863 C  CD1 . TYR A 1 373 ? 141.758 115.201 60.958 1.00 18.30 ? 373  TYR A CD1 1 
ATOM   2864 C  CD2 . TYR A 1 373 ? 144.044 114.577 60.609 1.00 16.63 ? 373  TYR A CD2 1 
ATOM   2865 C  CE1 . TYR A 1 373 ? 141.915 116.284 60.090 1.00 13.22 ? 373  TYR A CE1 1 
ATOM   2866 C  CE2 . TYR A 1 373 ? 144.211 115.653 59.746 1.00 17.15 ? 373  TYR A CE2 1 
ATOM   2867 C  CZ  . TYR A 1 373 ? 143.143 116.504 59.493 1.00 14.26 ? 373  TYR A CZ  1 
ATOM   2868 O  OH  . TYR A 1 373 ? 143.321 117.585 58.667 1.00 17.34 ? 373  TYR A OH  1 
ATOM   2869 N  N   . THR A 1 374 ? 142.744 111.983 65.526 1.00 43.34 ? 374  THR A N   1 
ATOM   2870 C  CA  . THR A 1 374 ? 141.939 111.136 66.401 1.00 53.12 ? 374  THR A CA  1 
ATOM   2871 C  C   . THR A 1 374 ? 141.914 111.508 67.879 1.00 54.13 ? 374  THR A C   1 
ATOM   2872 O  O   . THR A 1 374 ? 141.516 110.697 68.713 1.00 54.66 ? 374  THR A O   1 
ATOM   2873 C  CB  . THR A 1 374 ? 142.341 109.644 66.273 1.00 53.67 ? 374  THR A CB  1 
ATOM   2874 O  OG1 . THR A 1 374 ? 143.715 109.478 66.643 1.00 60.12 ? 374  THR A OG1 1 
ATOM   2875 C  CG2 . THR A 1 374 ? 142.131 109.160 64.843 1.00 51.43 ? 374  THR A CG2 1 
ATOM   2876 N  N   . ASP A 1 375 ? 142.328 112.725 68.212 1.00 58.83 ? 375  ASP A N   1 
ATOM   2877 C  CA  . ASP A 1 375 ? 142.288 113.149 69.608 1.00 63.66 ? 375  ASP A CA  1 
ATOM   2878 C  C   . ASP A 1 375 ? 140.844 113.578 69.877 1.00 64.71 ? 375  ASP A C   1 
ATOM   2879 O  O   . ASP A 1 375 ? 140.522 114.769 69.910 1.00 64.41 ? 375  ASP A O   1 
ATOM   2880 C  CB  . ASP A 1 375 ? 143.245 114.316 69.856 1.00 64.71 ? 375  ASP A CB  1 
ATOM   2881 C  CG  . ASP A 1 375 ? 143.649 114.434 71.314 0.50 61.69 ? 375  ASP A CG  1 
ATOM   2882 O  OD1 . ASP A 1 375 ? 144.279 113.488 71.831 0.00 62.49 ? 375  ASP A OD1 1 
ATOM   2883 O  OD2 . ASP A 1 375 ? 143.338 115.468 71.942 0.00 62.49 ? 375  ASP A OD2 1 
ATOM   2884 N  N   . TRP A 1 376 ? 139.986 112.577 70.054 1.00 63.31 ? 376  TRP A N   1 
ATOM   2885 C  CA  . TRP A 1 376 ? 138.557 112.752 70.296 1.00 63.79 ? 376  TRP A CA  1 
ATOM   2886 C  C   . TRP A 1 376 ? 138.183 113.755 71.379 1.00 67.07 ? 376  TRP A C   1 
ATOM   2887 O  O   . TRP A 1 376 ? 138.740 113.741 72.479 1.00 68.58 ? 376  TRP A O   1 
ATOM   2888 C  CB  . TRP A 1 376 ? 137.946 111.396 70.631 1.00 61.24 ? 376  TRP A CB  1 
ATOM   2889 C  CG  . TRP A 1 376 ? 138.212 110.355 69.590 1.00 52.76 ? 376  TRP A CG  1 
ATOM   2890 C  CD1 . TRP A 1 376 ? 138.500 109.043 69.807 1.00 50.96 ? 376  TRP A CD1 1 
ATOM   2891 C  CD2 . TRP A 1 376 ? 138.190 110.533 68.169 1.00 50.25 ? 376  TRP A CD2 1 
ATOM   2892 N  NE1 . TRP A 1 376 ? 138.659 108.387 68.611 1.00 51.44 ? 376  TRP A NE1 1 
ATOM   2893 C  CE2 . TRP A 1 376 ? 138.473 109.278 67.588 1.00 48.04 ? 376  TRP A CE2 1 
ATOM   2894 C  CE3 . TRP A 1 376 ? 137.957 111.629 67.329 1.00 47.08 ? 376  TRP A CE3 1 
ATOM   2895 C  CZ2 . TRP A 1 376 ? 138.530 109.086 66.205 1.00 42.79 ? 376  TRP A CZ2 1 
ATOM   2896 C  CZ3 . TRP A 1 376 ? 138.014 111.439 65.954 1.00 44.05 ? 376  TRP A CZ3 1 
ATOM   2897 C  CH2 . TRP A 1 376 ? 138.298 110.174 65.407 1.00 44.20 ? 376  TRP A CH2 1 
ATOM   2898 N  N   . VAL A 1 377 ? 137.214 114.609 71.056 1.00 69.69 ? 377  VAL A N   1 
ATOM   2899 C  CA  . VAL A 1 377 ? 136.731 115.639 71.970 1.00 72.08 ? 377  VAL A CA  1 
ATOM   2900 C  C   . VAL A 1 377 ? 135.570 115.114 72.807 1.00 74.19 ? 377  VAL A C   1 
ATOM   2901 O  O   . VAL A 1 377 ? 135.535 113.936 73.173 1.00 75.40 ? 377  VAL A O   1 
ATOM   2902 C  CB  . VAL A 1 377 ? 136.256 116.890 71.193 1.00 72.05 ? 377  VAL A CB  1 
ATOM   2903 C  CG1 . VAL A 1 377 ? 135.855 117.988 72.164 0.00 72.55 ? 377  VAL A CG1 1 
ATOM   2904 C  CG2 . VAL A 1 377 ? 137.360 117.374 70.266 0.00 72.55 ? 377  VAL A CG2 1 
ATOM   2905 N  N   . GLN A 1 380 ? 133.814 107.065 72.039 1.00 70.47 ? 380  GLN A N   1 
ATOM   2906 C  CA  . GLN A 1 380 ? 132.626 107.759 72.524 1.00 73.31 ? 380  GLN A CA  1 
ATOM   2907 C  C   . GLN A 1 380 ? 131.586 107.847 71.398 1.00 72.48 ? 380  GLN A C   1 
ATOM   2908 O  O   . GLN A 1 380 ? 130.717 106.979 71.271 1.00 71.60 ? 380  GLN A O   1 
ATOM   2909 C  CB  . GLN A 1 380 ? 133.000 109.165 73.015 1.00 75.99 ? 380  GLN A CB  1 
ATOM   2910 C  CG  . GLN A 1 380 ? 131.894 109.864 73.805 1.00 80.06 ? 380  GLN A CG  1 
ATOM   2911 C  CD  . GLN A 1 380 ? 131.903 111.371 73.628 1.00 84.05 ? 380  GLN A CD  1 
ATOM   2912 O  OE1 . GLN A 1 380 ? 132.748 111.917 72.927 1.00 85.38 ? 380  GLN A OE1 1 
ATOM   2913 N  NE2 . GLN A 1 380 ? 130.952 112.049 74.259 1.00 87.81 ? 380  GLN A NE2 1 
ATOM   2914 N  N   . ARG A 1 381 ? 131.687 108.894 70.580 1.00 70.51 ? 381  ARG A N   1 
ATOM   2915 C  CA  . ARG A 1 381 ? 130.770 109.099 69.458 1.00 63.96 ? 381  ARG A CA  1 
ATOM   2916 C  C   . ARG A 1 381 ? 131.030 108.078 68.352 1.00 57.75 ? 381  ARG A C   1 
ATOM   2917 O  O   . ARG A 1 381 ? 132.167 107.881 67.924 1.00 57.81 ? 381  ARG A O   1 
ATOM   2918 C  CB  . ARG A 1 381 ? 130.927 110.509 68.888 1.00 68.68 ? 381  ARG A CB  1 
ATOM   2919 C  CG  . ARG A 1 381 ? 130.689 111.625 69.894 1.00 76.43 ? 381  ARG A CG  1 
ATOM   2920 C  CD  . ARG A 1 381 ? 130.819 112.990 69.228 1.00 80.61 ? 381  ARG A CD  1 
ATOM   2921 N  NE  . ARG A 1 381 ? 129.776 113.225 68.229 1.00 86.89 ? 381  ARG A NE  1 
ATOM   2922 C  CZ  . ARG A 1 381 ? 130.000 113.570 66.962 1.00 87.44 ? 381  ARG A CZ  1 
ATOM   2923 N  NH1 . ARG A 1 381 ? 128.976 113.762 66.141 1.00 86.59 ? 381  ARG A NH1 1 
ATOM   2924 N  NH2 . ARG A 1 381 ? 131.238 113.716 66.511 1.00 83.99 ? 381  ARG A NH2 1 
ATOM   2925 N  N   . PRO A 1 382 ? 129.968 107.427 67.863 1.00 51.76 ? 382  PRO A N   1 
ATOM   2926 C  CA  . PRO A 1 382 ? 130.086 106.419 66.804 1.00 48.26 ? 382  PRO A CA  1 
ATOM   2927 C  C   . PRO A 1 382 ? 130.565 106.902 65.435 1.00 45.36 ? 382  PRO A C   1 
ATOM   2928 O  O   . PRO A 1 382 ? 131.073 106.106 64.648 1.00 44.22 ? 382  PRO A O   1 
ATOM   2929 C  CB  . PRO A 1 382 ? 128.685 105.818 66.749 1.00 47.27 ? 382  PRO A CB  1 
ATOM   2930 C  CG  . PRO A 1 382 ? 127.811 106.974 67.121 1.00 50.40 ? 382  PRO A CG  1 
ATOM   2931 C  CD  . PRO A 1 382 ? 128.564 107.603 68.272 1.00 50.69 ? 382  PRO A CD  1 
ATOM   2932 N  N   . GLU A 1 383 ? 130.413 108.191 65.146 1.00 43.20 ? 383  GLU A N   1 
ATOM   2933 C  CA  . GLU A 1 383 ? 130.834 108.719 63.850 1.00 47.53 ? 383  GLU A CA  1 
ATOM   2934 C  C   . GLU A 1 383 ? 132.174 109.453 63.859 1.00 47.10 ? 383  GLU A C   1 
ATOM   2935 O  O   . GLU A 1 383 ? 132.513 110.137 62.891 1.00 46.28 ? 383  GLU A O   1 
ATOM   2936 C  CB  . GLU A 1 383 ? 129.751 109.642 63.267 1.00 48.56 ? 383  GLU A CB  1 
ATOM   2937 C  CG  . GLU A 1 383 ? 129.288 110.748 64.200 1.00 54.08 ? 383  GLU A CG  1 
ATOM   2938 C  CD  . GLU A 1 383 ? 128.403 110.232 65.318 0.00 55.87 ? 383  GLU A CD  1 
ATOM   2939 O  OE1 . GLU A 1 383 ? 128.663 110.568 66.491 1.00 61.08 ? 383  GLU A OE1 1 
ATOM   2940 O  OE2 . GLU A 1 383 ? 127.442 109.492 65.022 0.00 56.99 ? 383  GLU A OE2 1 
ATOM   2941 N  N   . ASN A 1 384 ? 132.942 109.305 64.936 1.00 45.45 ? 384  ASN A N   1 
ATOM   2942 C  CA  . ASN A 1 384 ? 134.238 109.972 65.029 1.00 40.29 ? 384  ASN A CA  1 
ATOM   2943 C  C   . ASN A 1 384 ? 135.148 109.679 63.841 1.00 36.03 ? 384  ASN A C   1 
ATOM   2944 O  O   . ASN A 1 384 ? 135.636 110.599 63.195 1.00 34.25 ? 384  ASN A O   1 
ATOM   2945 C  CB  . ASN A 1 384 ? 134.963 109.585 66.322 1.00 39.47 ? 384  ASN A CB  1 
ATOM   2946 C  CG  . ASN A 1 384 ? 134.446 110.338 67.531 1.00 43.83 ? 384  ASN A CG  1 
ATOM   2947 O  OD1 . ASN A 1 384 ? 133.996 111.480 67.423 1.00 45.51 ? 384  ASN A OD1 1 
ATOM   2948 N  ND2 . ASN A 1 384 ? 134.529 109.708 68.696 1.00 48.11 ? 384  ASN A ND2 1 
ATOM   2949 N  N   . TYR A 1 385 ? 135.365 108.400 63.552 1.00 37.44 ? 385  TYR A N   1 
ATOM   2950 C  CA  . TYR A 1 385 ? 136.236 107.997 62.448 1.00 41.26 ? 385  TYR A CA  1 
ATOM   2951 C  C   . TYR A 1 385 ? 135.707 108.365 61.067 1.00 37.54 ? 385  TYR A C   1 
ATOM   2952 O  O   . TYR A 1 385 ? 136.487 108.659 60.160 1.00 30.04 ? 385  TYR A O   1 
ATOM   2953 C  CB  . TYR A 1 385 ? 136.509 106.487 62.508 1.00 46.15 ? 385  TYR A CB  1 
ATOM   2954 C  CG  . TYR A 1 385 ? 137.400 106.081 63.662 1.00 50.98 ? 385  TYR A CG  1 
ATOM   2955 C  CD1 . TYR A 1 385 ? 138.757 106.406 63.669 1.00 50.96 ? 385  TYR A CD1 1 
ATOM   2956 C  CD2 . TYR A 1 385 ? 136.878 105.417 64.769 1.00 50.50 ? 385  TYR A CD2 1 
ATOM   2957 C  CE1 . TYR A 1 385 ? 139.567 106.083 64.751 1.00 52.05 ? 385  TYR A CE1 1 
ATOM   2958 C  CE2 . TYR A 1 385 ? 137.679 105.091 65.854 1.00 49.98 ? 385  TYR A CE2 1 
ATOM   2959 C  CZ  . TYR A 1 385 ? 139.020 105.427 65.840 1.00 50.77 ? 385  TYR A CZ  1 
ATOM   2960 O  OH  . TYR A 1 385 ? 139.809 105.112 66.918 1.00 49.39 ? 385  TYR A OH  1 
ATOM   2961 N  N   . ARG A 1 386 ? 134.387 108.342 60.906 1.00 32.99 ? 386  ARG A N   1 
ATOM   2962 C  CA  . ARG A 1 386 ? 133.781 108.685 59.625 1.00 30.40 ? 386  ARG A CA  1 
ATOM   2963 C  C   . ARG A 1 386 ? 134.072 110.148 59.304 1.00 29.27 ? 386  ARG A C   1 
ATOM   2964 O  O   . ARG A 1 386 ? 134.492 110.486 58.195 1.00 27.25 ? 386  ARG A O   1 
ATOM   2965 C  CB  . ARG A 1 386 ? 132.268 108.469 59.679 1.00 31.64 ? 386  ARG A CB  1 
ATOM   2966 C  CG  . ARG A 1 386 ? 131.551 108.674 58.351 1.00 29.83 ? 386  ARG A CG  1 
ATOM   2967 C  CD  . ARG A 1 386 ? 130.039 108.720 58.551 1.00 30.24 ? 386  ARG A CD  1 
ATOM   2968 N  NE  . ARG A 1 386 ? 129.619 109.957 59.207 1.00 25.84 ? 386  ARG A NE  1 
ATOM   2969 C  CZ  . ARG A 1 386 ? 128.436 110.129 59.785 1.00 24.95 ? 386  ARG A CZ  1 
ATOM   2970 N  NH1 . ARG A 1 386 ? 128.128 111.286 60.357 1.00 26.10 ? 386  ARG A NH1 1 
ATOM   2971 N  NH2 . ARG A 1 386 ? 127.564 109.133 59.806 1.00 25.33 ? 386  ARG A NH2 1 
ATOM   2972 N  N   . GLU A 1 387 ? 133.850 111.014 60.287 1.00 24.11 ? 387  GLU A N   1 
ATOM   2973 C  CA  . GLU A 1 387 ? 134.081 112.436 60.106 1.00 30.55 ? 387  GLU A CA  1 
ATOM   2974 C  C   . GLU A 1 387 ? 135.563 112.783 60.017 1.00 28.09 ? 387  GLU A C   1 
ATOM   2975 O  O   . GLU A 1 387 ? 135.944 113.695 59.285 1.00 26.20 ? 387  GLU A O   1 
ATOM   2976 C  CB  . GLU A 1 387 ? 133.432 113.227 61.241 1.00 34.38 ? 387  GLU A CB  1 
ATOM   2977 C  CG  . GLU A 1 387 ? 131.977 112.856 61.483 1.00 51.45 ? 387  GLU A CG  1 
ATOM   2978 C  CD  . GLU A 1 387 ? 131.176 113.981 62.111 1.00 61.41 ? 387  GLU A CD  1 
ATOM   2979 O  OE1 . GLU A 1 387 ? 131.734 114.713 62.957 1.00 66.59 ? 387  GLU A OE1 1 
ATOM   2980 O  OE2 . GLU A 1 387 ? 129.982 114.123 61.766 1.00 68.75 ? 387  GLU A OE2 1 
ATOM   2981 N  N   . ALA A 1 388 ? 136.401 112.057 60.749 1.00 22.65 ? 388  ALA A N   1 
ATOM   2982 C  CA  . ALA A 1 388 ? 137.832 112.333 60.729 1.00 20.20 ? 388  ALA A CA  1 
ATOM   2983 C  C   . ALA A 1 388 ? 138.430 112.029 59.365 1.00 24.45 ? 388  ALA A C   1 
ATOM   2984 O  O   . ALA A 1 388 ? 139.262 112.792 58.870 1.00 20.21 ? 388  ALA A O   1 
ATOM   2985 C  CB  . ALA A 1 388 ? 138.557 111.519 61.811 1.00 21.48 ? 388  ALA A CB  1 
ATOM   2986 N  N   . LEU A 1 389 ? 138.008 110.922 58.754 1.00 17.09 ? 389  LEU A N   1 
ATOM   2987 C  CA  . LEU A 1 389 ? 138.544 110.556 57.450 1.00 21.48 ? 389  LEU A CA  1 
ATOM   2988 C  C   . LEU A 1 389 ? 138.125 111.572 56.400 1.00 23.58 ? 389  LEU A C   1 
ATOM   2989 O  O   . LEU A 1 389 ? 138.917 111.927 55.527 1.00 24.36 ? 389  LEU A O   1 
ATOM   2990 C  CB  . LEU A 1 389 ? 138.080 109.160 57.032 1.00 17.02 ? 389  LEU A CB  1 
ATOM   2991 C  CG  . LEU A 1 389 ? 138.792 108.640 55.779 1.00 18.03 ? 389  LEU A CG  1 
ATOM   2992 C  CD1 . LEU A 1 389 ? 140.287 108.548 56.035 1.00 20.71 ? 389  LEU A CD1 1 
ATOM   2993 C  CD2 . LEU A 1 389 ? 138.227 107.284 55.397 1.00 28.22 ? 389  LEU A CD2 1 
ATOM   2994 N  N   . GLY A 1 390 ? 136.880 112.037 56.491 1.00 24.57 ? 390  GLY A N   1 
ATOM   2995 C  CA  . GLY A 1 390 ? 136.391 113.031 55.551 1.00 26.46 ? 390  GLY A CA  1 
ATOM   2996 C  C   . GLY A 1 390 ? 137.217 114.301 55.639 1.00 25.41 ? 390  GLY A C   1 
ATOM   2997 O  O   . GLY A 1 390 ? 137.621 114.857 54.614 1.00 25.85 ? 390  GLY A O   1 
ATOM   2998 N  N   . ASP A 1 391 ? 137.473 114.757 56.865 1.00 24.48 ? 391  ASP A N   1 
ATOM   2999 C  CA  . ASP A 1 391 ? 138.275 115.960 57.084 1.00 24.86 ? 391  ASP A CA  1 
ATOM   3000 C  C   . ASP A 1 391 ? 139.713 115.761 56.632 1.00 23.09 ? 391  ASP A C   1 
ATOM   3001 O  O   . ASP A 1 391 ? 140.346 116.690 56.122 1.00 24.00 ? 391  ASP A O   1 
ATOM   3002 C  CB  . ASP A 1 391 ? 138.262 116.369 58.557 1.00 32.20 ? 391  ASP A CB  1 
ATOM   3003 C  CG  . ASP A 1 391 ? 136.903 116.867 59.007 1.00 44.06 ? 391  ASP A CG  1 
ATOM   3004 O  OD1 . ASP A 1 391 ? 136.236 117.577 58.218 1.00 49.84 ? 391  ASP A OD1 1 
ATOM   3005 O  OD2 . ASP A 1 391 ? 136.508 116.559 60.153 1.00 46.97 ? 391  ASP A OD2 1 
ATOM   3006 N  N   . VAL A 1 392 ? 140.227 114.550 56.820 1.00 16.09 ? 392  VAL A N   1 
ATOM   3007 C  CA  . VAL A 1 392 ? 141.586 114.244 56.408 1.00 21.59 ? 392  VAL A CA  1 
ATOM   3008 C  C   . VAL A 1 392 ? 141.689 114.492 54.913 1.00 22.84 ? 392  VAL A C   1 
ATOM   3009 O  O   . VAL A 1 392 ? 142.553 115.238 54.462 1.00 23.88 ? 392  VAL A O   1 
ATOM   3010 C  CB  . VAL A 1 392 ? 141.958 112.763 56.692 1.00 19.97 ? 392  VAL A CB  1 
ATOM   3011 C  CG1 . VAL A 1 392 ? 143.217 112.388 55.944 1.00 20.93 ? 392  VAL A CG1 1 
ATOM   3012 C  CG2 . VAL A 1 392 ? 142.172 112.555 58.162 1.00 17.36 ? 392  VAL A CG2 1 
ATOM   3013 N  N   . VAL A 1 393 ? 140.791 113.871 54.152 1.00 23.85 ? 393  VAL A N   1 
ATOM   3014 C  CA  . VAL A 1 393 ? 140.799 114.003 52.700 1.00 23.60 ? 393  VAL A CA  1 
ATOM   3015 C  C   . VAL A 1 393 ? 140.570 115.437 52.235 1.00 18.26 ? 393  VAL A C   1 
ATOM   3016 O  O   . VAL A 1 393 ? 141.255 115.929 51.325 1.00 16.78 ? 393  VAL A O   1 
ATOM   3017 C  CB  . VAL A 1 393 ? 139.744 113.077 52.049 1.00 18.97 ? 393  VAL A CB  1 
ATOM   3018 C  CG1 . VAL A 1 393 ? 139.675 113.340 50.553 1.00 15.51 ? 393  VAL A CG1 1 
ATOM   3019 C  CG2 . VAL A 1 393 ? 140.112 111.621 52.304 1.00 16.75 ? 393  VAL A CG2 1 
ATOM   3020 N  N   . GLY A 1 394 ? 139.614 116.106 52.869 1.00 14.67 ? 394  GLY A N   1 
ATOM   3021 C  CA  . GLY A 1 394 ? 139.320 117.479 52.507 1.00 13.12 ? 394  GLY A CA  1 
ATOM   3022 C  C   . GLY A 1 394 ? 140.447 118.448 52.841 1.00 21.60 ? 394  GLY A C   1 
ATOM   3023 O  O   . GLY A 1 394 ? 140.819 119.284 52.012 1.00 19.23 ? 394  GLY A O   1 
ATOM   3024 N  N   . ASP A 1 395 ? 140.995 118.342 54.049 1.00 18.05 ? 395  ASP A N   1 
ATOM   3025 C  CA  . ASP A 1 395 ? 142.070 119.237 54.483 1.00 18.51 ? 395  ASP A CA  1 
ATOM   3026 C  C   . ASP A 1 395 ? 143.334 119.071 53.653 1.00 18.15 ? 395  ASP A C   1 
ATOM   3027 O  O   . ASP A 1 395 ? 143.915 120.044 53.182 1.00 20.85 ? 395  ASP A O   1 
ATOM   3028 C  CB  . ASP A 1 395 ? 142.382 118.998 55.962 1.00 10.65 ? 395  ASP A CB  1 
ATOM   3029 C  CG  . ASP A 1 395 ? 141.259 119.467 56.877 1.00 28.26 ? 395  ASP A CG  1 
ATOM   3030 O  OD1 . ASP A 1 395 ? 141.269 119.101 58.076 1.00 25.69 ? 395  ASP A OD1 1 
ATOM   3031 O  OD2 . ASP A 1 395 ? 140.370 120.205 56.395 1.00 24.69 ? 395  ASP A OD2 1 
ATOM   3032 N  N   . TYR A 1 396 ? 143.743 117.826 53.459 1.00 21.04 ? 396  TYR A N   1 
ATOM   3033 C  CA  . TYR A 1 396 ? 144.943 117.513 52.697 1.00 17.23 ? 396  TYR A CA  1 
ATOM   3034 C  C   . TYR A 1 396 ? 144.853 117.869 51.213 1.00 16.06 ? 396  TYR A C   1 
ATOM   3035 O  O   . TYR A 1 396 ? 145.758 118.476 50.651 1.00 13.92 ? 396  TYR A O   1 
ATOM   3036 C  CB  . TYR A 1 396 ? 145.246 116.023 52.839 1.00 16.10 ? 396  TYR A CB  1 
ATOM   3037 C  CG  . TYR A 1 396 ? 146.350 115.529 51.947 1.00 17.02 ? 396  TYR A CG  1 
ATOM   3038 C  CD1 . TYR A 1 396 ? 147.652 116.020 52.081 1.00 18.85 ? 396  TYR A CD1 1 
ATOM   3039 C  CD2 . TYR A 1 396 ? 146.106 114.543 50.986 1.00 18.02 ? 396  TYR A CD2 1 
ATOM   3040 C  CE1 . TYR A 1 396 ? 148.689 115.538 51.285 1.00 20.86 ? 396  TYR A CE1 1 
ATOM   3041 C  CE2 . TYR A 1 396 ? 147.137 114.051 50.179 1.00 18.78 ? 396  TYR A CE2 1 
ATOM   3042 C  CZ  . TYR A 1 396 ? 148.427 114.555 50.337 1.00 24.86 ? 396  TYR A CZ  1 
ATOM   3043 O  OH  . TYR A 1 396 ? 149.455 114.088 49.555 1.00 24.11 ? 396  TYR A OH  1 
ATOM   3044 N  N   . ASN A 1 397 ? 143.752 117.492 50.581 1.00 18.79 ? 397  ASN A N   1 
ATOM   3045 C  CA  . ASN A 1 397 ? 143.585 117.733 49.158 1.00 18.16 ? 397  ASN A CA  1 
ATOM   3046 C  C   . ASN A 1 397 ? 143.053 119.086 48.711 1.00 17.26 ? 397  ASN A C   1 
ATOM   3047 O  O   . ASN A 1 397 ? 143.357 119.515 47.601 1.00 13.93 ? 397  ASN A O   1 
ATOM   3048 C  CB  . ASN A 1 397 ? 142.706 116.631 48.553 1.00 13.31 ? 397  ASN A CB  1 
ATOM   3049 C  CG  . ASN A 1 397 ? 143.450 115.323 48.387 1.00 21.63 ? 397  ASN A CG  1 
ATOM   3050 O  OD1 . ASN A 1 397 ? 144.318 115.189 47.515 1.00 16.07 ? 397  ASN A OD1 1 
ATOM   3051 N  ND2 . ASN A 1 397 ? 143.125 114.350 49.230 1.00 14.90 ? 397  ASN A ND2 1 
ATOM   3052 N  N   . PHE A 1 398 ? 142.283 119.772 49.552 1.00 16.20 ? 398  PHE A N   1 
ATOM   3053 C  CA  . PHE A 1 398 ? 141.718 121.043 49.111 1.00 17.03 ? 398  PHE A CA  1 
ATOM   3054 C  C   . PHE A 1 398 ? 141.867 122.271 49.999 1.00 18.91 ? 398  PHE A C   1 
ATOM   3055 O  O   . PHE A 1 398 ? 142.465 123.272 49.599 1.00 21.16 ? 398  PHE A O   1 
ATOM   3056 C  CB  . PHE A 1 398 ? 140.231 120.850 48.793 1.00 12.85 ? 398  PHE A CB  1 
ATOM   3057 C  CG  . PHE A 1 398 ? 139.963 119.765 47.790 1.00 18.12 ? 398  PHE A CG  1 
ATOM   3058 C  CD1 . PHE A 1 398 ? 139.651 118.475 48.203 1.00 21.57 ? 398  PHE A CD1 1 
ATOM   3059 C  CD2 . PHE A 1 398 ? 140.038 120.028 46.430 1.00 20.36 ? 398  PHE A CD2 1 
ATOM   3060 C  CE1 . PHE A 1 398 ? 139.415 117.460 47.275 1.00 20.30 ? 398  PHE A CE1 1 
ATOM   3061 C  CE2 . PHE A 1 398 ? 139.804 119.022 45.497 1.00 24.36 ? 398  PHE A CE2 1 
ATOM   3062 C  CZ  . PHE A 1 398 ? 139.491 117.733 45.923 1.00 18.15 ? 398  PHE A CZ  1 
ATOM   3063 N  N   . ILE A 1 399 ? 141.316 122.196 51.200 1.00 20.81 ? 399  ILE A N   1 
ATOM   3064 C  CA  . ILE A 1 399 ? 141.331 123.329 52.106 1.00 21.91 ? 399  ILE A CA  1 
ATOM   3065 C  C   . ILE A 1 399 ? 142.707 123.900 52.431 1.00 21.79 ? 399  ILE A C   1 
ATOM   3066 O  O   . ILE A 1 399 ? 142.956 125.081 52.194 1.00 16.96 ? 399  ILE A O   1 
ATOM   3067 C  CB  . ILE A 1 399 ? 140.581 122.984 53.399 1.00 17.72 ? 399  ILE A CB  1 
ATOM   3068 C  CG1 . ILE A 1 399 ? 139.141 122.602 53.057 1.00 18.29 ? 399  ILE A CG1 1 
ATOM   3069 C  CG2 . ILE A 1 399 ? 140.607 124.171 54.352 1.00 18.81 ? 399  ILE A CG2 1 
ATOM   3070 C  CD1 . ILE A 1 399 ? 138.312 122.168 54.259 1.00 30.85 ? 399  ILE A CD1 1 
ATOM   3071 N  N   . CYS A 1 400 ? 143.603 123.077 52.961 1.00 16.67 ? 400  CYS A N   1 
ATOM   3072 C  CA  . CYS A 1 400 ? 144.920 123.581 53.296 1.00 20.04 ? 400  CYS A CA  1 
ATOM   3073 C  C   . CYS A 1 400 ? 145.699 124.092 52.085 1.00 21.59 ? 400  CYS A C   1 
ATOM   3074 O  O   . CYS A 1 400 ? 146.360 125.124 52.170 1.00 21.09 ? 400  CYS A O   1 
ATOM   3075 C  CB  . CYS A 1 400 ? 145.697 122.529 54.083 1.00 24.68 ? 400  CYS A CB  1 
ATOM   3076 S  SG  . CYS A 1 400 ? 144.920 122.259 55.715 1.00 37.81 ? 400  CYS A SG  1 
ATOM   3077 N  N   . PRO A 1 401 ? 145.633 123.391 50.941 1.00 21.88 ? 401  PRO A N   1 
ATOM   3078 C  CA  . PRO A 1 401 ? 146.381 123.908 49.785 1.00 20.10 ? 401  PRO A CA  1 
ATOM   3079 C  C   . PRO A 1 401 ? 145.813 125.262 49.324 1.00 19.86 ? 401  PRO A C   1 
ATOM   3080 O  O   . PRO A 1 401 ? 146.562 126.148 48.894 1.00 16.88 ? 401  PRO A O   1 
ATOM   3081 C  CB  . PRO A 1 401 ? 146.194 122.817 48.732 1.00 16.72 ? 401  PRO A CB  1 
ATOM   3082 C  CG  . PRO A 1 401 ? 146.068 121.562 49.562 1.00 19.18 ? 401  PRO A CG  1 
ATOM   3083 C  CD  . PRO A 1 401 ? 145.160 122.015 50.693 1.00 18.11 ? 401  PRO A CD  1 
ATOM   3084 N  N   . ALA A 1 402 ? 144.491 125.416 49.415 1.00 15.00 ? 402  ALA A N   1 
ATOM   3085 C  CA  . ALA A 1 402 ? 143.843 126.674 49.022 1.00 17.12 ? 402  ALA A CA  1 
ATOM   3086 C  C   . ALA A 1 402 ? 144.257 127.819 49.953 1.00 20.03 ? 402  ALA A C   1 
ATOM   3087 O  O   . ALA A 1 402 ? 144.537 128.936 49.503 1.00 15.59 ? 402  ALA A O   1 
ATOM   3088 C  CB  . ALA A 1 402 ? 142.316 126.526 49.040 1.00 6.28  ? 402  ALA A CB  1 
ATOM   3089 N  N   . LEU A 1 403 ? 144.286 127.543 51.253 1.00 17.53 ? 403  LEU A N   1 
ATOM   3090 C  CA  . LEU A 1 403 ? 144.660 128.562 52.223 1.00 20.04 ? 403  LEU A CA  1 
ATOM   3091 C  C   . LEU A 1 403 ? 146.118 128.947 52.051 1.00 19.80 ? 403  LEU A C   1 
ATOM   3092 O  O   . LEU A 1 403 ? 146.458 130.122 52.105 1.00 18.96 ? 403  LEU A O   1 
ATOM   3093 C  CB  . LEU A 1 403 ? 144.413 128.066 53.647 1.00 18.15 ? 403  LEU A CB  1 
ATOM   3094 C  CG  . LEU A 1 403 ? 142.961 128.096 54.124 1.00 20.03 ? 403  LEU A CG  1 
ATOM   3095 C  CD1 . LEU A 1 403 ? 142.818 127.280 55.388 1.00 14.23 ? 403  LEU A CD1 1 
ATOM   3096 C  CD2 . LEU A 1 403 ? 142.534 129.531 54.362 1.00 13.57 ? 403  LEU A CD2 1 
ATOM   3097 N  N   . GLU A 1 404 ? 146.974 127.952 51.832 1.00 23.62 ? 404  GLU A N   1 
ATOM   3098 C  CA  . GLU A 1 404 ? 148.400 128.202 51.649 1.00 27.05 ? 404  GLU A CA  1 
ATOM   3099 C  C   . GLU A 1 404 ? 148.652 129.035 50.386 1.00 27.44 ? 404  GLU A C   1 
ATOM   3100 O  O   . GLU A 1 404 ? 149.471 129.955 50.381 1.00 26.74 ? 404  GLU A O   1 
ATOM   3101 C  CB  . GLU A 1 404 ? 149.165 126.879 51.576 1.00 26.03 ? 404  GLU A CB  1 
ATOM   3102 C  CG  . GLU A 1 404 ? 150.655 127.046 51.861 1.00 47.14 ? 404  GLU A CG  1 
ATOM   3103 C  CD  . GLU A 1 404 ? 150.916 127.785 53.180 1.00 54.13 ? 404  GLU A CD  1 
ATOM   3104 O  OE1 . GLU A 1 404 ? 151.624 128.817 53.173 1.00 57.26 ? 404  GLU A OE1 1 
ATOM   3105 O  OE2 . GLU A 1 404 ? 150.410 127.334 54.230 1.00 58.33 ? 404  GLU A OE2 1 
ATOM   3106 N  N   . PHE A 1 405 ? 147.935 128.714 49.318 1.00 24.81 ? 405  PHE A N   1 
ATOM   3107 C  CA  . PHE A 1 405 ? 148.072 129.454 48.075 1.00 18.96 ? 405  PHE A CA  1 
ATOM   3108 C  C   . PHE A 1 405 ? 147.677 130.920 48.307 1.00 16.39 ? 405  PHE A C   1 
ATOM   3109 O  O   . PHE A 1 405 ? 148.350 131.840 47.845 1.00 18.19 ? 405  PHE A O   1 
ATOM   3110 C  CB  . PHE A 1 405 ? 147.162 128.855 46.998 1.00 11.86 ? 405  PHE A CB  1 
ATOM   3111 C  CG  . PHE A 1 405 ? 147.100 129.675 45.746 1.00 14.41 ? 405  PHE A CG  1 
ATOM   3112 C  CD1 . PHE A 1 405 ? 148.030 129.489 44.723 1.00 23.11 ? 405  PHE A CD1 1 
ATOM   3113 C  CD2 . PHE A 1 405 ? 146.148 130.680 45.609 1.00 13.73 ? 405  PHE A CD2 1 
ATOM   3114 C  CE1 . PHE A 1 405 ? 148.011 130.298 43.578 1.00 17.26 ? 405  PHE A CE1 1 
ATOM   3115 C  CE2 . PHE A 1 405 ? 146.121 131.496 44.469 1.00 19.99 ? 405  PHE A CE2 1 
ATOM   3116 C  CZ  . PHE A 1 405 ? 147.057 131.302 43.455 1.00 16.61 ? 405  PHE A CZ  1 
ATOM   3117 N  N   . THR A 1 406 ? 146.575 131.121 49.025 1.00 15.06 ? 406  THR A N   1 
ATOM   3118 C  CA  . THR A 1 406 ? 146.065 132.456 49.307 1.00 17.64 ? 406  THR A CA  1 
ATOM   3119 C  C   . THR A 1 406 ? 147.053 133.258 50.136 1.00 17.32 ? 406  THR A C   1 
ATOM   3120 O  O   . THR A 1 406 ? 147.311 134.423 49.858 1.00 22.16 ? 406  THR A O   1 
ATOM   3121 C  CB  . THR A 1 406 ? 144.718 132.373 50.053 1.00 21.96 ? 406  THR A CB  1 
ATOM   3122 O  OG1 . THR A 1 406 ? 143.807 131.579 49.285 1.00 27.49 ? 406  THR A OG1 1 
ATOM   3123 C  CG2 . THR A 1 406 ? 144.117 133.764 50.257 1.00 19.83 ? 406  THR A CG2 1 
ATOM   3124 N  N   . LYS A 1 407 ? 147.607 132.619 51.153 1.00 18.82 ? 407  LYS A N   1 
ATOM   3125 C  CA  . LYS A 1 407 ? 148.567 133.258 52.027 1.00 19.87 ? 407  LYS A CA  1 
ATOM   3126 C  C   . LYS A 1 407 ? 149.784 133.702 51.223 1.00 20.81 ? 407  LYS A C   1 
ATOM   3127 O  O   . LYS A 1 407 ? 150.163 134.871 51.240 1.00 23.57 ? 407  LYS A O   1 
ATOM   3128 C  CB  . LYS A 1 407 ? 148.983 132.275 53.125 1.00 18.90 ? 407  LYS A CB  1 
ATOM   3129 C  CG  . LYS A 1 407 ? 149.219 132.919 54.478 1.00 36.38 ? 407  LYS A CG  1 
ATOM   3130 C  CD  . LYS A 1 407 ? 150.609 132.613 55.012 0.00 31.84 ? 407  LYS A CD  1 
ATOM   3131 C  CE  . LYS A 1 407 ? 150.584 132.356 56.510 0.00 33.87 ? 407  LYS A CE  1 
ATOM   3132 N  NZ  . LYS A 1 407 ? 149.879 131.082 56.824 0.00 33.44 ? 407  LYS A NZ  1 
ATOM   3133 N  N   . LYS A 1 408 ? 150.386 132.768 50.498 1.00 22.74 ? 408  LYS A N   1 
ATOM   3134 C  CA  . LYS A 1 408 ? 151.564 133.085 49.712 1.00 21.86 ? 408  LYS A CA  1 
ATOM   3135 C  C   . LYS A 1 408 ? 151.311 134.111 48.622 1.00 21.12 ? 408  LYS A C   1 
ATOM   3136 O  O   . LYS A 1 408 ? 152.146 134.973 48.375 1.00 20.51 ? 408  LYS A O   1 
ATOM   3137 C  CB  . LYS A 1 408 ? 152.158 131.814 49.096 1.00 23.19 ? 408  LYS A CB  1 
ATOM   3138 C  CG  . LYS A 1 408 ? 152.671 130.836 50.131 1.00 25.24 ? 408  LYS A CG  1 
ATOM   3139 C  CD  . LYS A 1 408 ? 153.714 129.894 49.561 0.00 37.19 ? 408  LYS A CD  1 
ATOM   3140 C  CE  . LYS A 1 408 ? 154.261 128.984 50.648 1.00 43.54 ? 408  LYS A CE  1 
ATOM   3141 N  NZ  . LYS A 1 408 ? 154.786 129.775 51.808 1.00 60.96 ? 408  LYS A NZ  1 
ATOM   3142 N  N   . PHE A 1 409 ? 150.159 134.024 47.970 1.00 22.02 ? 409  PHE A N   1 
ATOM   3143 C  CA  . PHE A 1 409 ? 149.840 134.956 46.903 1.00 17.35 ? 409  PHE A CA  1 
ATOM   3144 C  C   . PHE A 1 409 ? 149.683 136.380 47.438 1.00 20.17 ? 409  PHE A C   1 
ATOM   3145 O  O   . PHE A 1 409 ? 150.236 137.321 46.878 1.00 21.41 ? 409  PHE A O   1 
ATOM   3146 C  CB  . PHE A 1 409 ? 148.549 134.531 46.198 1.00 18.72 ? 409  PHE A CB  1 
ATOM   3147 C  CG  . PHE A 1 409 ? 148.260 135.315 44.950 1.00 18.12 ? 409  PHE A CG  1 
ATOM   3148 C  CD1 . PHE A 1 409 ? 148.704 134.863 43.711 1.00 22.20 ? 409  PHE A CD1 1 
ATOM   3149 C  CD2 . PHE A 1 409 ? 147.558 136.512 45.010 1.00 15.42 ? 409  PHE A CD2 1 
ATOM   3150 C  CE1 . PHE A 1 409 ? 148.453 135.596 42.552 1.00 16.84 ? 409  PHE A CE1 1 
ATOM   3151 C  CE2 . PHE A 1 409 ? 147.306 137.251 43.857 1.00 18.49 ? 409  PHE A CE2 1 
ATOM   3152 C  CZ  . PHE A 1 409 ? 147.754 136.788 42.626 1.00 18.54 ? 409  PHE A CZ  1 
ATOM   3153 N  N   . SER A 1 410 ? 148.932 136.534 48.523 1.00 23.96 ? 410  SER A N   1 
ATOM   3154 C  CA  . SER A 1 410 ? 148.700 137.854 49.098 1.00 28.34 ? 410  SER A CA  1 
ATOM   3155 C  C   . SER A 1 410 ? 149.970 138.486 49.666 1.00 31.21 ? 410  SER A C   1 
ATOM   3156 O  O   . SER A 1 410 ? 150.065 139.708 49.768 1.00 30.23 ? 410  SER A O   1 
ATOM   3157 C  CB  . SER A 1 410 ? 147.631 137.779 50.194 1.00 22.56 ? 410  SER A CB  1 
ATOM   3158 O  OG  . SER A 1 410 ? 148.110 137.051 51.310 1.00 31.42 ? 410  SER A OG  1 
ATOM   3159 N  N   . GLU A 1 411 ? 150.949 137.664 50.032 1.00 32.30 ? 411  GLU A N   1 
ATOM   3160 C  CA  . GLU A 1 411 ? 152.187 138.201 50.589 1.00 31.42 ? 411  GLU A CA  1 
ATOM   3161 C  C   . GLU A 1 411 ? 152.908 139.141 49.633 1.00 30.59 ? 411  GLU A C   1 
ATOM   3162 O  O   . GLU A 1 411 ? 153.778 139.902 50.049 1.00 34.50 ? 411  GLU A O   1 
ATOM   3163 C  CB  . GLU A 1 411 ? 153.127 137.072 51.010 1.00 30.03 ? 411  GLU A CB  1 
ATOM   3164 C  CG  . GLU A 1 411 ? 152.712 136.429 52.317 1.00 43.21 ? 411  GLU A CG  1 
ATOM   3165 C  CD  . GLU A 1 411 ? 153.512 135.196 52.655 0.50 45.55 ? 411  GLU A CD  1 
ATOM   3166 O  OE1 . GLU A 1 411 ? 153.216 134.575 53.699 1.00 54.56 ? 411  GLU A OE1 1 
ATOM   3167 O  OE2 . GLU A 1 411 ? 154.429 134.846 51.883 0.50 42.57 ? 411  GLU A OE2 1 
ATOM   3168 N  N   . TRP A 1 412 ? 152.549 139.105 48.355 1.00 23.78 ? 412  TRP A N   1 
ATOM   3169 C  CA  . TRP A 1 412 ? 153.202 139.982 47.404 1.00 23.44 ? 412  TRP A CA  1 
ATOM   3170 C  C   . TRP A 1 412 ? 152.424 141.248 47.089 1.00 20.62 ? 412  TRP A C   1 
ATOM   3171 O  O   . TRP A 1 412 ? 152.628 141.863 46.050 1.00 25.59 ? 412  TRP A O   1 
ATOM   3172 C  CB  . TRP A 1 412 ? 153.557 139.221 46.126 1.00 24.20 ? 412  TRP A CB  1 
ATOM   3173 C  CG  . TRP A 1 412 ? 154.644 138.221 46.370 1.00 26.26 ? 412  TRP A CG  1 
ATOM   3174 C  CD1 . TRP A 1 412 ? 154.503 136.965 46.894 1.00 26.68 ? 412  TRP A CD1 1 
ATOM   3175 C  CD2 . TRP A 1 412 ? 156.052 138.424 46.190 1.00 29.72 ? 412  TRP A CD2 1 
ATOM   3176 N  NE1 . TRP A 1 412 ? 155.737 136.374 47.054 1.00 27.69 ? 412  TRP A NE1 1 
ATOM   3177 C  CE2 . TRP A 1 412 ? 156.705 137.247 46.632 1.00 28.73 ? 412  TRP A CE2 1 
ATOM   3178 C  CE3 . TRP A 1 412 ? 156.826 139.486 45.702 1.00 31.87 ? 412  TRP A CE3 1 
ATOM   3179 C  CZ2 . TRP A 1 412 ? 158.100 137.105 46.601 1.00 29.61 ? 412  TRP A CZ2 1 
ATOM   3180 C  CZ3 . TRP A 1 412 ? 158.219 139.344 45.670 1.00 31.27 ? 412  TRP A CZ3 1 
ATOM   3181 C  CH2 . TRP A 1 412 ? 158.838 138.160 46.118 1.00 31.16 ? 412  TRP A CH2 1 
ATOM   3182 N  N   . GLY A 1 413 ? 151.520 141.623 47.990 1.00 23.58 ? 413  GLY A N   1 
ATOM   3183 C  CA  . GLY A 1 413 ? 150.787 142.867 47.823 1.00 22.83 ? 413  GLY A CA  1 
ATOM   3184 C  C   . GLY A 1 413 ? 149.405 142.914 47.210 1.00 28.35 ? 413  GLY A C   1 
ATOM   3185 O  O   . GLY A 1 413 ? 148.729 143.930 47.307 1.00 31.30 ? 413  GLY A O   1 
ATOM   3186 N  N   . ASN A 1 414 ? 148.965 141.835 46.584 1.00 31.36 ? 414  ASN A N   1 
ATOM   3187 C  CA  . ASN A 1 414 ? 147.655 141.852 45.960 1.00 26.08 ? 414  ASN A CA  1 
ATOM   3188 C  C   . ASN A 1 414 ? 146.505 141.551 46.910 1.00 24.56 ? 414  ASN A C   1 
ATOM   3189 O  O   . ASN A 1 414 ? 146.634 140.744 47.831 1.00 22.56 ? 414  ASN A O   1 
ATOM   3190 C  CB  . ASN A 1 414 ? 147.632 140.865 44.796 1.00 32.12 ? 414  ASN A CB  1 
ATOM   3191 C  CG  . ASN A 1 414 ? 148.488 141.324 43.630 1.00 38.89 ? 414  ASN A CG  1 
ATOM   3192 O  OD1 . ASN A 1 414 ? 149.453 140.660 43.252 1.00 39.12 ? 414  ASN A OD1 1 
ATOM   3193 N  ND2 . ASN A 1 414 ? 148.134 142.471 43.052 1.00 35.45 ? 414  ASN A ND2 1 
ATOM   3194 N  N   . ASN A 1 415 ? 145.381 142.221 46.690 1.00 20.91 ? 415  ASN A N   1 
ATOM   3195 C  CA  . ASN A 1 415 ? 144.195 141.982 47.503 1.00 20.40 ? 415  ASN A CA  1 
ATOM   3196 C  C   . ASN A 1 415 ? 143.673 140.574 47.189 1.00 24.35 ? 415  ASN A C   1 
ATOM   3197 O  O   . ASN A 1 415 ? 143.615 140.163 46.026 1.00 23.18 ? 415  ASN A O   1 
ATOM   3198 C  CB  . ASN A 1 415 ? 143.091 142.992 47.170 1.00 22.46 ? 415  ASN A CB  1 
ATOM   3199 C  CG  . ASN A 1 415 ? 143.180 144.263 47.990 1.00 28.93 ? 415  ASN A CG  1 
ATOM   3200 O  OD1 . ASN A 1 415 ? 142.286 145.108 47.930 1.00 31.04 ? 415  ASN A OD1 1 
ATOM   3201 N  ND2 . ASN A 1 415 ? 144.250 144.407 48.759 1.00 31.96 ? 415  ASN A ND2 1 
ATOM   3202 N  N   . ALA A 1 416 ? 143.289 139.843 48.227 1.00 18.48 ? 416  ALA A N   1 
ATOM   3203 C  CA  . ALA A 1 416 ? 142.758 138.499 48.058 1.00 20.04 ? 416  ALA A CA  1 
ATOM   3204 C  C   . ALA A 1 416 ? 141.576 138.359 48.997 1.00 22.10 ? 416  ALA A C   1 
ATOM   3205 O  O   . ALA A 1 416 ? 141.567 138.952 50.079 1.00 20.43 ? 416  ALA A O   1 
ATOM   3206 C  CB  . ALA A 1 416 ? 143.817 137.457 48.390 1.00 21.59 ? 416  ALA A CB  1 
ATOM   3207 N  N   . PHE A 1 417 ? 140.577 137.591 48.572 1.00 16.11 ? 417  PHE A N   1 
ATOM   3208 C  CA  . PHE A 1 417 ? 139.385 137.364 49.373 1.00 15.41 ? 417  PHE A CA  1 
ATOM   3209 C  C   . PHE A 1 417 ? 139.161 135.862 49.472 1.00 15.26 ? 417  PHE A C   1 
ATOM   3210 O  O   . PHE A 1 417 ? 139.294 135.142 48.489 1.00 19.19 ? 417  PHE A O   1 
ATOM   3211 C  CB  . PHE A 1 417 ? 138.184 138.061 48.731 1.00 11.42 ? 417  PHE A CB  1 
ATOM   3212 C  CG  . PHE A 1 417 ? 138.396 139.537 48.504 1.00 21.20 ? 417  PHE A CG  1 
ATOM   3213 C  CD1 . PHE A 1 417 ? 139.037 139.997 47.357 1.00 11.36 ? 417  PHE A CD1 1 
ATOM   3214 C  CD2 . PHE A 1 417 ? 137.994 140.465 49.460 1.00 11.30 ? 417  PHE A CD2 1 
ATOM   3215 C  CE1 . PHE A 1 417 ? 139.284 141.359 47.172 1.00 18.90 ? 417  PHE A CE1 1 
ATOM   3216 C  CE2 . PHE A 1 417 ? 138.237 141.819 49.284 1.00 21.80 ? 417  PHE A CE2 1 
ATOM   3217 C  CZ  . PHE A 1 417 ? 138.881 142.270 48.136 1.00 14.95 ? 417  PHE A CZ  1 
ATOM   3218 N  N   . PHE A 1 418 ? 138.823 135.392 50.666 1.00 17.25 ? 418  PHE A N   1 
ATOM   3219 C  CA  . PHE A 1 418 ? 138.627 133.969 50.892 1.00 7.92  ? 418  PHE A CA  1 
ATOM   3220 C  C   . PHE A 1 418 ? 137.252 133.665 51.480 1.00 18.78 ? 418  PHE A C   1 
ATOM   3221 O  O   . PHE A 1 418 ? 136.788 134.346 52.403 1.00 16.73 ? 418  PHE A O   1 
ATOM   3222 C  CB  . PHE A 1 418 ? 139.723 133.456 51.835 1.00 6.21  ? 418  PHE A CB  1 
ATOM   3223 C  CG  . PHE A 1 418 ? 139.877 131.965 51.831 1.00 13.52 ? 418  PHE A CG  1 
ATOM   3224 C  CD1 . PHE A 1 418 ? 138.951 131.149 52.479 1.00 11.83 ? 418  PHE A CD1 1 
ATOM   3225 C  CD2 . PHE A 1 418 ? 140.926 131.365 51.126 1.00 10.42 ? 418  PHE A CD2 1 
ATOM   3226 C  CE1 . PHE A 1 418 ? 139.069 129.752 52.420 1.00 10.96 ? 418  PHE A CE1 1 
ATOM   3227 C  CE2 . PHE A 1 418 ? 141.050 129.979 51.062 1.00 13.12 ? 418  PHE A CE2 1 
ATOM   3228 C  CZ  . PHE A 1 418 ? 140.122 129.171 51.707 1.00 12.50 ? 418  PHE A CZ  1 
ATOM   3229 N  N   . TYR A 1 419 ? 136.597 132.640 50.946 1.00 11.79 ? 419  TYR A N   1 
ATOM   3230 C  CA  . TYR A 1 419 ? 135.289 132.264 51.456 1.00 15.83 ? 419  TYR A CA  1 
ATOM   3231 C  C   . TYR A 1 419 ? 135.277 130.810 51.902 1.00 16.43 ? 419  TYR A C   1 
ATOM   3232 O  O   . TYR A 1 419 ? 136.084 129.994 51.454 1.00 14.63 ? 419  TYR A O   1 
ATOM   3233 C  CB  . TYR A 1 419 ? 134.195 132.469 50.403 1.00 13.78 ? 419  TYR A CB  1 
ATOM   3234 C  CG  . TYR A 1 419 ? 134.276 131.504 49.247 1.00 10.59 ? 419  TYR A CG  1 
ATOM   3235 C  CD1 . TYR A 1 419 ? 134.946 131.846 48.078 1.00 13.88 ? 419  TYR A CD1 1 
ATOM   3236 C  CD2 . TYR A 1 419 ? 133.696 130.236 49.330 1.00 11.72 ? 419  TYR A CD2 1 
ATOM   3237 C  CE1 . TYR A 1 419 ? 135.037 130.957 47.016 1.00 17.51 ? 419  TYR A CE1 1 
ATOM   3238 C  CE2 . TYR A 1 419 ? 133.783 129.336 48.275 1.00 18.46 ? 419  TYR A CE2 1 
ATOM   3239 C  CZ  . TYR A 1 419 ? 134.456 129.703 47.119 1.00 22.45 ? 419  TYR A CZ  1 
ATOM   3240 O  OH  . TYR A 1 419 ? 134.566 128.815 46.072 1.00 27.52 ? 419  TYR A OH  1 
ATOM   3241 N  N   . TYR A 1 420 ? 134.340 130.507 52.789 1.00 19.56 ? 420  TYR A N   1 
ATOM   3242 C  CA  . TYR A 1 420 ? 134.153 129.173 53.334 1.00 20.89 ? 420  TYR A CA  1 
ATOM   3243 C  C   . TYR A 1 420 ? 132.666 128.889 53.117 1.00 23.39 ? 420  TYR A C   1 
ATOM   3244 O  O   . TYR A 1 420 ? 131.808 129.414 53.834 1.00 23.17 ? 420  TYR A O   1 
ATOM   3245 C  CB  . TYR A 1 420 ? 134.501 129.172 54.824 1.00 14.67 ? 420  TYR A CB  1 
ATOM   3246 C  CG  . TYR A 1 420 ? 134.478 127.810 55.469 1.00 16.81 ? 420  TYR A CG  1 
ATOM   3247 C  CD1 . TYR A 1 420 ? 135.290 126.785 54.995 1.00 17.93 ? 420  TYR A CD1 1 
ATOM   3248 C  CD2 . TYR A 1 420 ? 133.680 127.557 56.585 1.00 16.27 ? 420  TYR A CD2 1 
ATOM   3249 C  CE1 . TYR A 1 420 ? 135.316 125.545 55.613 1.00 18.60 ? 420  TYR A CE1 1 
ATOM   3250 C  CE2 . TYR A 1 420 ? 133.698 126.320 57.210 1.00 15.28 ? 420  TYR A CE2 1 
ATOM   3251 C  CZ  . TYR A 1 420 ? 134.519 125.321 56.719 1.00 19.90 ? 420  TYR A CZ  1 
ATOM   3252 O  OH  . TYR A 1 420 ? 134.547 124.097 57.335 1.00 21.51 ? 420  TYR A OH  1 
ATOM   3253 N  N   . PHE A 1 421 ? 132.374 128.082 52.100 1.00 20.72 ? 421  PHE A N   1 
ATOM   3254 C  CA  . PHE A 1 421 ? 131.001 127.742 51.741 1.00 18.06 ? 421  PHE A CA  1 
ATOM   3255 C  C   . PHE A 1 421 ? 130.459 126.637 52.651 1.00 22.09 ? 421  PHE A C   1 
ATOM   3256 O  O   . PHE A 1 421 ? 130.942 125.499 52.622 1.00 17.20 ? 421  PHE A O   1 
ATOM   3257 C  CB  . PHE A 1 421 ? 130.955 127.294 50.277 1.00 11.86 ? 421  PHE A CB  1 
ATOM   3258 C  CG  . PHE A 1 421 ? 129.567 127.169 49.723 1.00 19.14 ? 421  PHE A CG  1 
ATOM   3259 C  CD1 . PHE A 1 421 ? 128.869 128.295 49.302 1.00 20.64 ? 421  PHE A CD1 1 
ATOM   3260 C  CD2 . PHE A 1 421 ? 128.949 125.927 49.639 1.00 18.06 ? 421  PHE A CD2 1 
ATOM   3261 C  CE1 . PHE A 1 421 ? 127.574 128.182 48.803 1.00 27.34 ? 421  PHE A CE1 1 
ATOM   3262 C  CE2 . PHE A 1 421 ? 127.659 125.806 49.143 1.00 21.30 ? 421  PHE A CE2 1 
ATOM   3263 C  CZ  . PHE A 1 421 ? 126.969 126.932 48.726 1.00 22.54 ? 421  PHE A CZ  1 
ATOM   3264 N  N   . GLU A 1 422 ? 129.449 126.966 53.453 1.00 22.57 ? 422  GLU A N   1 
ATOM   3265 C  CA  . GLU A 1 422 ? 128.889 125.983 54.372 1.00 26.78 ? 422  GLU A CA  1 
ATOM   3266 C  C   . GLU A 1 422 ? 127.396 125.712 54.291 1.00 28.29 ? 422  GLU A C   1 
ATOM   3267 O  O   . GLU A 1 422 ? 126.773 125.380 55.294 1.00 36.74 ? 422  GLU A O   1 
ATOM   3268 C  CB  . GLU A 1 422 ? 129.255 126.347 55.811 1.00 27.64 ? 422  GLU A CB  1 
ATOM   3269 C  CG  . GLU A 1 422 ? 129.158 127.819 56.138 1.00 37.72 ? 422  GLU A CG  1 
ATOM   3270 C  CD  . GLU A 1 422 ? 129.601 128.111 57.555 1.00 41.33 ? 422  GLU A CD  1 
ATOM   3271 O  OE1 . GLU A 1 422 ? 130.623 127.535 57.982 1.00 38.67 ? 422  GLU A OE1 1 
ATOM   3272 O  OE2 . GLU A 1 422 ? 128.937 128.915 58.242 1.00 45.73 ? 422  GLU A OE2 1 
ATOM   3273 N  N   . HIS A 1 423 ? 126.813 125.840 53.110 1.00 26.18 ? 423  HIS A N   1 
ATOM   3274 C  CA  . HIS A 1 423 ? 125.391 125.556 52.969 1.00 22.36 ? 423  HIS A CA  1 
ATOM   3275 C  C   . HIS A 1 423 ? 125.191 124.278 52.167 1.00 21.16 ? 423  HIS A C   1 
ATOM   3276 O  O   . HIS A 1 423 ? 125.768 124.117 51.093 1.00 21.62 ? 423  HIS A O   1 
ATOM   3277 C  CB  . HIS A 1 423 ? 124.665 126.689 52.248 1.00 23.78 ? 423  HIS A CB  1 
ATOM   3278 C  CG  . HIS A 1 423 ? 123.252 126.348 51.893 1.00 32.42 ? 423  HIS A CG  1 
ATOM   3279 N  ND1 . HIS A 1 423 ? 122.241 126.306 52.830 1.00 31.07 ? 423  HIS A ND1 1 
ATOM   3280 C  CD2 . HIS A 1 423 ? 122.698 125.943 50.726 1.00 30.19 ? 423  HIS A CD2 1 
ATOM   3281 C  CE1 . HIS A 1 423 ? 121.129 125.884 52.257 1.00 29.13 ? 423  HIS A CE1 1 
ATOM   3282 N  NE2 . HIS A 1 423 ? 121.380 125.656 50.980 1.00 30.66 ? 423  HIS A NE2 1 
ATOM   3283 N  N   . ARG A 1 424 ? 124.387 123.361 52.692 1.00 22.04 ? 424  ARG A N   1 
ATOM   3284 C  CA  . ARG A 1 424 ? 124.101 122.125 51.974 1.00 25.82 ? 424  ARG A CA  1 
ATOM   3285 C  C   . ARG A 1 424 ? 122.808 122.292 51.185 1.00 27.89 ? 424  ARG A C   1 
ATOM   3286 O  O   . ARG A 1 424 ? 121.754 122.545 51.765 1.00 27.34 ? 424  ARG A O   1 
ATOM   3287 C  CB  . ARG A 1 424 ? 123.934 120.955 52.933 1.00 20.42 ? 424  ARG A CB  1 
ATOM   3288 C  CG  . ARG A 1 424 ? 123.554 119.677 52.214 1.00 23.14 ? 424  ARG A CG  1 
ATOM   3289 C  CD  . ARG A 1 424 ? 123.341 118.539 53.182 1.00 24.36 ? 424  ARG A CD  1 
ATOM   3290 N  NE  . ARG A 1 424 ? 122.647 117.420 52.555 1.00 32.86 ? 424  ARG A NE  1 
ATOM   3291 C  CZ  . ARG A 1 424 ? 123.237 116.326 52.086 1.00 37.80 ? 424  ARG A CZ  1 
ATOM   3292 N  NH1 . ARG A 1 424 ? 124.554 116.182 52.163 1.00 34.26 ? 424  ARG A NH1 1 
ATOM   3293 N  NH2 . ARG A 1 424 ? 122.503 115.366 51.550 1.00 35.21 ? 424  ARG A NH2 1 
ATOM   3294 N  N   . SER A 1 425 ? 122.897 122.143 49.866 1.00 28.48 ? 425  SER A N   1 
ATOM   3295 C  CA  . SER A 1 425 ? 121.736 122.278 48.993 1.00 32.33 ? 425  SER A CA  1 
ATOM   3296 C  C   . SER A 1 425 ? 120.551 121.442 49.475 1.00 31.18 ? 425  SER A C   1 
ATOM   3297 O  O   . SER A 1 425 ? 120.696 120.264 49.793 1.00 29.31 ? 425  SER A O   1 
ATOM   3298 C  CB  . SER A 1 425 ? 122.102 121.863 47.572 1.00 35.68 ? 425  SER A CB  1 
ATOM   3299 O  OG  . SER A 1 425 ? 120.998 122.054 46.709 1.00 48.57 ? 425  SER A OG  1 
ATOM   3300 N  N   . SER A 1 426 ? 119.377 122.059 49.532 1.00 31.10 ? 426  SER A N   1 
ATOM   3301 C  CA  . SER A 1 426 ? 118.181 121.358 49.983 1.00 32.15 ? 426  SER A CA  1 
ATOM   3302 C  C   . SER A 1 426 ? 117.826 120.208 49.052 1.00 30.62 ? 426  SER A C   1 
ATOM   3303 O  O   . SER A 1 426 ? 117.100 119.309 49.444 1.00 32.21 ? 426  SER A O   1 
ATOM   3304 C  CB  . SER A 1 426 ? 116.996 122.322 50.062 1.00 30.29 ? 426  SER A CB  1 
ATOM   3305 O  OG  . SER A 1 426 ? 116.676 122.836 48.782 1.00 32.08 ? 426  SER A OG  1 
ATOM   3306 N  N   . LYS A 1 427 ? 118.349 120.240 47.829 1.00 34.36 ? 427  LYS A N   1 
ATOM   3307 C  CA  . LYS A 1 427 ? 118.068 119.207 46.832 1.00 37.39 ? 427  LYS A CA  1 
ATOM   3308 C  C   . LYS A 1 427 ? 119.217 118.217 46.620 1.00 39.20 ? 427  LYS A C   1 
ATOM   3309 O  O   . LYS A 1 427 ? 119.214 117.473 45.639 1.00 38.24 ? 427  LYS A O   1 
ATOM   3310 C  CB  . LYS A 1 427 ? 117.753 119.857 45.484 1.00 39.10 ? 427  LYS A CB  1 
ATOM   3311 C  CG  . LYS A 1 427 ? 116.817 121.050 45.542 1.00 49.54 ? 427  LYS A CG  1 
ATOM   3312 C  CD  . LYS A 1 427 ? 116.713 121.709 44.169 1.00 52.94 ? 427  LYS A CD  1 
ATOM   3313 C  CE  . LYS A 1 427 ? 116.220 120.722 43.114 1.00 61.85 ? 427  LYS A CE  1 
ATOM   3314 N  NZ  . LYS A 1 427 ? 116.296 121.271 41.731 1.00 58.58 ? 427  LYS A NZ  1 
ATOM   3315 N  N   . LEU A 1 428 ? 120.194 118.207 47.522 1.00 35.58 ? 428  LEU A N   1 
ATOM   3316 C  CA  . LEU A 1 428 ? 121.345 117.314 47.400 1.00 34.91 ? 428  LEU A CA  1 
ATOM   3317 C  C   . LEU A 1 428 ? 120.903 115.840 47.432 1.00 35.98 ? 428  LEU A C   1 
ATOM   3318 O  O   . LEU A 1 428 ? 120.232 115.413 48.369 1.00 40.23 ? 428  LEU A O   1 
ATOM   3319 C  CB  . LEU A 1 428 ? 122.331 117.620 48.537 1.00 39.06 ? 428  LEU A CB  1 
ATOM   3320 C  CG  . LEU A 1 428 ? 123.851 117.516 48.344 1.00 39.74 ? 428  LEU A CG  1 
ATOM   3321 C  CD1 . LEU A 1 428 ? 124.334 116.117 48.639 1.00 47.27 ? 428  LEU A CD1 1 
ATOM   3322 C  CD2 . LEU A 1 428 ? 124.217 117.939 46.936 1.00 38.72 ? 428  LEU A CD2 1 
ATOM   3323 N  N   . PRO A 1 429 ? 121.265 115.053 46.396 1.00 33.15 ? 429  PRO A N   1 
ATOM   3324 C  CA  . PRO A 1 429 ? 120.933 113.626 46.255 1.00 27.35 ? 429  PRO A CA  1 
ATOM   3325 C  C   . PRO A 1 429 ? 121.741 112.735 47.191 1.00 28.42 ? 429  PRO A C   1 
ATOM   3326 O  O   . PRO A 1 429 ? 121.301 111.652 47.566 1.00 26.60 ? 429  PRO A O   1 
ATOM   3327 C  CB  . PRO A 1 429 ? 121.280 113.319 44.798 1.00 28.55 ? 429  PRO A CB  1 
ATOM   3328 C  CG  . PRO A 1 429 ? 121.335 114.642 44.139 1.00 33.61 ? 429  PRO A CG  1 
ATOM   3329 C  CD  . PRO A 1 429 ? 121.935 115.533 45.180 1.00 33.63 ? 429  PRO A CD  1 
ATOM   3330 N  N   . TRP A 1 430 ? 122.938 113.182 47.550 1.00 26.10 ? 430  TRP A N   1 
ATOM   3331 C  CA  . TRP A 1 430 ? 123.777 112.397 48.439 1.00 27.00 ? 430  TRP A CA  1 
ATOM   3332 C  C   . TRP A 1 430 ? 123.240 112.462 49.868 1.00 24.73 ? 430  TRP A C   1 
ATOM   3333 O  O   . TRP A 1 430 ? 122.523 113.396 50.230 1.00 18.12 ? 430  TRP A O   1 
ATOM   3334 C  CB  . TRP A 1 430 ? 125.217 112.903 48.386 1.00 22.87 ? 430  TRP A CB  1 
ATOM   3335 C  CG  . TRP A 1 430 ? 125.796 112.911 47.007 1.00 16.10 ? 430  TRP A CG  1 
ATOM   3336 C  CD1 . TRP A 1 430 ? 125.763 113.942 46.102 1.00 18.72 ? 430  TRP A CD1 1 
ATOM   3337 C  CD2 . TRP A 1 430 ? 126.509 111.846 46.370 1.00 17.72 ? 430  TRP A CD2 1 
ATOM   3338 N  NE1 . TRP A 1 430 ? 126.420 113.585 44.945 1.00 17.99 ? 430  TRP A NE1 1 
ATOM   3339 C  CE2 . TRP A 1 430 ? 126.889 112.303 45.083 1.00 17.44 ? 430  TRP A CE2 1 
ATOM   3340 C  CE3 . TRP A 1 430 ? 126.871 110.547 46.765 1.00 12.17 ? 430  TRP A CE3 1 
ATOM   3341 C  CZ2 . TRP A 1 430 ? 127.607 111.508 44.185 1.00 14.76 ? 430  TRP A CZ2 1 
ATOM   3342 C  CZ3 . TRP A 1 430 ? 127.592 109.753 45.869 1.00 15.73 ? 430  TRP A CZ3 1 
ATOM   3343 C  CH2 . TRP A 1 430 ? 127.952 110.239 44.596 1.00 20.27 ? 430  TRP A CH2 1 
ATOM   3344 N  N   . PRO A 1 431 ? 123.586 111.467 50.697 1.00 20.94 ? 431  PRO A N   1 
ATOM   3345 C  CA  . PRO A 1 431 ? 123.150 111.382 52.095 1.00 21.92 ? 431  PRO A CA  1 
ATOM   3346 C  C   . PRO A 1 431 ? 123.650 112.523 52.980 1.00 26.08 ? 431  PRO A C   1 
ATOM   3347 O  O   . PRO A 1 431 ? 124.648 113.174 52.677 1.00 28.71 ? 431  PRO A O   1 
ATOM   3348 C  CB  . PRO A 1 431 ? 123.693 110.031 52.537 1.00 20.86 ? 431  PRO A CB  1 
ATOM   3349 C  CG  . PRO A 1 431 ? 124.980 109.932 51.762 1.00 24.90 ? 431  PRO A CG  1 
ATOM   3350 C  CD  . PRO A 1 431 ? 124.560 110.406 50.385 1.00 23.30 ? 431  PRO A CD  1 
ATOM   3351 N  N   . GLU A 1 432 ? 122.957 112.738 54.090 1.00 29.05 ? 432  GLU A N   1 
ATOM   3352 C  CA  . GLU A 1 432 ? 123.300 113.798 55.023 1.00 30.88 ? 432  GLU A CA  1 
ATOM   3353 C  C   . GLU A 1 432 ? 124.698 113.758 55.624 1.00 32.31 ? 432  GLU A C   1 
ATOM   3354 O  O   . GLU A 1 432 ? 125.283 114.808 55.887 1.00 34.10 ? 432  GLU A O   1 
ATOM   3355 C  CB  . GLU A 1 432 ? 122.272 113.851 56.156 1.00 30.86 ? 432  GLU A CB  1 
ATOM   3356 C  CG  . GLU A 1 432 ? 121.007 114.594 55.775 1.00 47.67 ? 432  GLU A CG  1 
ATOM   3357 C  CD  . GLU A 1 432 ? 121.273 116.047 55.425 0.50 44.36 ? 432  GLU A CD  1 
ATOM   3358 O  OE1 . GLU A 1 432 ? 121.419 116.872 56.352 0.00 45.57 ? 432  GLU A OE1 1 
ATOM   3359 O  OE2 . GLU A 1 432 ? 121.346 116.356 54.221 0.00 45.57 ? 432  GLU A OE2 1 
ATOM   3360 N  N   . TRP A 1 433 ? 125.247 112.569 55.839 1.00 30.93 ? 433  TRP A N   1 
ATOM   3361 C  CA  . TRP A 1 433 ? 126.568 112.498 56.441 1.00 32.52 ? 433  TRP A CA  1 
ATOM   3362 C  C   . TRP A 1 433 ? 127.673 113.070 55.556 1.00 33.84 ? 433  TRP A C   1 
ATOM   3363 O  O   . TRP A 1 433 ? 128.789 113.291 56.026 1.00 30.72 ? 433  TRP A O   1 
ATOM   3364 C  CB  . TRP A 1 433 ? 126.915 111.059 56.862 1.00 26.96 ? 433  TRP A CB  1 
ATOM   3365 C  CG  . TRP A 1 433 ? 127.189 110.092 55.747 1.00 25.82 ? 433  TRP A CG  1 
ATOM   3366 C  CD1 . TRP A 1 433 ? 126.335 109.148 55.251 1.00 29.73 ? 433  TRP A CD1 1 
ATOM   3367 C  CD2 . TRP A 1 433 ? 128.409 109.957 55.009 1.00 23.24 ? 433  TRP A CD2 1 
ATOM   3368 N  NE1 . TRP A 1 433 ? 126.951 108.429 54.249 1.00 34.31 ? 433  TRP A NE1 1 
ATOM   3369 C  CE2 . TRP A 1 433 ? 128.223 108.908 54.079 1.00 26.79 ? 433  TRP A CE2 1 
ATOM   3370 C  CE3 . TRP A 1 433 ? 129.643 110.621 55.042 1.00 26.86 ? 433  TRP A CE3 1 
ATOM   3371 C  CZ2 . TRP A 1 433 ? 129.228 108.506 53.187 1.00 35.55 ? 433  TRP A CZ2 1 
ATOM   3372 C  CZ3 . TRP A 1 433 ? 130.644 110.221 54.154 1.00 30.41 ? 433  TRP A CZ3 1 
ATOM   3373 C  CH2 . TRP A 1 433 ? 130.428 109.175 53.239 1.00 28.45 ? 433  TRP A CH2 1 
ATOM   3374 N  N   . MET A 1 434 ? 127.378 113.314 54.283 1.00 31.52 ? 434  MET A N   1 
ATOM   3375 C  CA  . MET A 1 434 ? 128.394 113.875 53.396 1.00 30.78 ? 434  MET A CA  1 
ATOM   3376 C  C   . MET A 1 434 ? 128.430 115.394 53.503 1.00 22.02 ? 434  MET A C   1 
ATOM   3377 O  O   . MET A 1 434 ? 129.345 116.029 52.995 1.00 28.55 ? 434  MET A O   1 
ATOM   3378 C  CB  . MET A 1 434 ? 128.154 113.446 51.947 1.00 29.38 ? 434  MET A CB  1 
ATOM   3379 C  CG  . MET A 1 434 ? 128.188 111.943 51.750 1.00 34.17 ? 434  MET A CG  1 
ATOM   3380 S  SD  . MET A 1 434 ? 128.190 111.472 50.029 1.00 34.08 ? 434  MET A SD  1 
ATOM   3381 C  CE  . MET A 1 434 ? 129.266 110.073 50.064 1.00 40.32 ? 434  MET A CE  1 
ATOM   3382 N  N   . GLY A 1 435 ? 127.431 115.966 54.170 1.00 18.30 ? 435  GLY A N   1 
ATOM   3383 C  CA  . GLY A 1 435 ? 127.373 117.409 54.371 1.00 18.63 ? 435  GLY A CA  1 
ATOM   3384 C  C   . GLY A 1 435 ? 127.451 118.315 53.152 1.00 21.99 ? 435  GLY A C   1 
ATOM   3385 O  O   . GLY A 1 435 ? 126.830 118.030 52.128 1.00 25.63 ? 435  GLY A O   1 
ATOM   3386 N  N   . VAL A 1 436 ? 128.204 119.413 53.284 1.00 21.99 ? 436  VAL A N   1 
ATOM   3387 C  CA  . VAL A 1 436 ? 128.403 120.417 52.225 1.00 19.01 ? 436  VAL A CA  1 
ATOM   3388 C  C   . VAL A 1 436 ? 129.492 119.929 51.273 1.00 22.55 ? 436  VAL A C   1 
ATOM   3389 O  O   . VAL A 1 436 ? 130.652 120.341 51.359 1.00 26.45 ? 436  VAL A O   1 
ATOM   3390 C  CB  . VAL A 1 436 ? 128.850 121.770 52.829 1.00 24.19 ? 436  VAL A CB  1 
ATOM   3391 C  CG1 . VAL A 1 436 ? 128.802 122.857 51.770 1.00 20.57 ? 436  VAL A CG1 1 
ATOM   3392 C  CG2 . VAL A 1 436 ? 127.963 122.130 54.009 1.00 21.69 ? 436  VAL A CG2 1 
ATOM   3393 N  N   . MET A 1 437 ? 129.091 119.068 50.351 1.00 22.86 ? 437  MET A N   1 
ATOM   3394 C  CA  . MET A 1 437 ? 129.990 118.436 49.401 1.00 23.89 ? 437  MET A CA  1 
ATOM   3395 C  C   . MET A 1 437 ? 130.765 119.251 48.388 1.00 27.59 ? 437  MET A C   1 
ATOM   3396 O  O   . MET A 1 437 ? 130.383 120.356 48.002 1.00 23.62 ? 437  MET A O   1 
ATOM   3397 C  CB  . MET A 1 437 ? 129.233 117.365 48.637 1.00 28.81 ? 437  MET A CB  1 
ATOM   3398 C  CG  . MET A 1 437 ? 128.753 116.216 49.489 1.00 25.60 ? 437  MET A CG  1 
ATOM   3399 S  SD  . MET A 1 437 ? 127.754 115.133 48.484 1.00 30.02 ? 437  MET A SD  1 
ATOM   3400 C  CE  . MET A 1 437 ? 128.939 114.551 47.275 1.00 17.48 ? 437  MET A CE  1 
ATOM   3401 N  N   . HIS A 1 438 ? 131.858 118.638 47.951 1.00 28.57 ? 438  HIS A N   1 
ATOM   3402 C  CA  . HIS A 1 438 ? 132.757 119.176 46.945 1.00 28.82 ? 438  HIS A CA  1 
ATOM   3403 C  C   . HIS A 1 438 ? 131.964 119.362 45.651 1.00 28.55 ? 438  HIS A C   1 
ATOM   3404 O  O   . HIS A 1 438 ? 131.259 118.455 45.217 1.00 24.48 ? 438  HIS A O   1 
ATOM   3405 C  CB  . HIS A 1 438 ? 133.897 118.172 46.736 1.00 25.93 ? 438  HIS A CB  1 
ATOM   3406 C  CG  . HIS A 1 438 ? 134.806 118.494 45.591 1.00 25.57 ? 438  HIS A CG  1 
ATOM   3407 N  ND1 . HIS A 1 438 ? 135.564 119.644 45.537 1.00 27.82 ? 438  HIS A ND1 1 
ATOM   3408 C  CD2 . HIS A 1 438 ? 135.129 117.781 44.485 1.00 23.44 ? 438  HIS A CD2 1 
ATOM   3409 C  CE1 . HIS A 1 438 ? 136.317 119.622 44.451 1.00 27.31 ? 438  HIS A CE1 1 
ATOM   3410 N  NE2 . HIS A 1 438 ? 136.073 118.501 43.796 1.00 24.88 ? 438  HIS A NE2 1 
ATOM   3411 N  N   . GLY A 1 439 ? 132.066 120.548 45.059 1.00 31.36 ? 439  GLY A N   1 
ATOM   3412 C  CA  . GLY A 1 439 ? 131.374 120.831 43.812 1.00 24.55 ? 439  GLY A CA  1 
ATOM   3413 C  C   . GLY A 1 439 ? 129.931 121.306 43.896 1.00 25.34 ? 439  GLY A C   1 
ATOM   3414 O  O   . GLY A 1 439 ? 129.332 121.648 42.879 1.00 21.68 ? 439  GLY A O   1 
ATOM   3415 N  N   . TYR A 1 440 ? 129.353 121.361 45.086 1.00 21.84 ? 440  TYR A N   1 
ATOM   3416 C  CA  . TYR A 1 440 ? 127.966 121.777 45.150 1.00 21.46 ? 440  TYR A CA  1 
ATOM   3417 C  C   . TYR A 1 440 ? 127.688 123.227 45.504 1.00 29.08 ? 440  TYR A C   1 
ATOM   3418 O  O   . TYR A 1 440 ? 126.608 123.564 45.994 1.00 28.51 ? 440  TYR A O   1 
ATOM   3419 C  CB  . TYR A 1 440 ? 127.173 120.817 46.041 1.00 13.22 ? 440  TYR A CB  1 
ATOM   3420 C  CG  . TYR A 1 440 ? 126.964 119.492 45.339 1.00 26.41 ? 440  TYR A CG  1 
ATOM   3421 C  CD1 . TYR A 1 440 ? 127.908 118.464 45.434 1.00 24.56 ? 440  TYR A CD1 1 
ATOM   3422 C  CD2 . TYR A 1 440 ? 125.873 119.307 44.482 1.00 20.20 ? 440  TYR A CD2 1 
ATOM   3423 C  CE1 . TYR A 1 440 ? 127.769 117.294 44.688 1.00 28.88 ? 440  TYR A CE1 1 
ATOM   3424 C  CE2 . TYR A 1 440 ? 125.726 118.150 43.737 1.00 19.29 ? 440  TYR A CE2 1 
ATOM   3425 C  CZ  . TYR A 1 440 ? 126.673 117.149 43.837 1.00 30.05 ? 440  TYR A CZ  1 
ATOM   3426 O  OH  . TYR A 1 440 ? 126.530 116.018 43.071 1.00 30.80 ? 440  TYR A OH  1 
ATOM   3427 N  N   . GLU A 1 441 ? 128.664 124.090 45.236 1.00 23.14 ? 441  GLU A N   1 
ATOM   3428 C  CA  . GLU A 1 441 ? 128.482 125.517 45.467 1.00 25.59 ? 441  GLU A CA  1 
ATOM   3429 C  C   . GLU A 1 441 ? 128.350 126.084 44.058 1.00 20.93 ? 441  GLU A C   1 
ATOM   3430 O  O   . GLU A 1 441 ? 127.860 127.193 43.847 1.00 24.07 ? 441  GLU A O   1 
ATOM   3431 C  CB  . GLU A 1 441 ? 129.700 126.139 46.176 1.00 24.14 ? 441  GLU A CB  1 
ATOM   3432 C  CG  . GLU A 1 441 ? 130.883 126.446 45.272 1.00 29.57 ? 441  GLU A CG  1 
ATOM   3433 C  CD  . GLU A 1 441 ? 131.537 125.195 44.695 1.00 43.03 ? 441  GLU A CD  1 
ATOM   3434 O  OE1 . GLU A 1 441 ? 132.344 125.336 43.747 1.00 44.41 ? 441  GLU A OE1 1 
ATOM   3435 O  OE2 . GLU A 1 441 ? 131.251 124.082 45.191 1.00 34.50 ? 441  GLU A OE2 1 
ATOM   3436 N  N   . ILE A 1 442 ? 128.794 125.287 43.094 1.00 19.46 ? 442  ILE A N   1 
ATOM   3437 C  CA  . ILE A 1 442 ? 128.762 125.668 41.692 1.00 22.49 ? 442  ILE A CA  1 
ATOM   3438 C  C   . ILE A 1 442 ? 127.385 126.135 41.240 1.00 21.16 ? 442  ILE A C   1 
ATOM   3439 O  O   . ILE A 1 442 ? 127.265 127.165 40.581 1.00 24.99 ? 442  ILE A O   1 
ATOM   3440 C  CB  . ILE A 1 442 ? 129.223 124.496 40.805 1.00 26.39 ? 442  ILE A CB  1 
ATOM   3441 C  CG1 . ILE A 1 442 ? 130.684 124.157 41.126 1.00 23.18 ? 442  ILE A CG1 1 
ATOM   3442 C  CG2 . ILE A 1 442 ? 129.042 124.845 39.337 1.00 26.14 ? 442  ILE A CG2 1 
ATOM   3443 C  CD1 . ILE A 1 442 ? 131.224 122.947 40.384 1.00 20.88 ? 442  ILE A CD1 1 
ATOM   3444 N  N   . GLU A 1 443 ? 126.346 125.385 41.595 1.00 22.77 ? 443  GLU A N   1 
ATOM   3445 C  CA  . GLU A 1 443 ? 124.997 125.759 41.203 1.00 25.46 ? 443  GLU A CA  1 
ATOM   3446 C  C   . GLU A 1 443 ? 124.608 127.133 41.760 1.00 26.28 ? 443  GLU A C   1 
ATOM   3447 O  O   . GLU A 1 443 ? 123.831 127.859 41.142 1.00 26.24 ? 443  GLU A O   1 
ATOM   3448 C  CB  . GLU A 1 443 ? 123.992 124.682 41.641 1.00 28.84 ? 443  GLU A CB  1 
ATOM   3449 C  CG  . GLU A 1 443 ? 124.079 124.267 43.100 1.00 37.08 ? 443  GLU A CG  1 
ATOM   3450 C  CD  . GLU A 1 443 ? 123.385 122.936 43.368 1.00 46.62 ? 443  GLU A CD  1 
ATOM   3451 O  OE1 . GLU A 1 443 ? 122.136 122.892 43.383 1.00 48.07 ? 443  GLU A OE1 1 
ATOM   3452 O  OE2 . GLU A 1 443 ? 124.095 121.925 43.552 1.00 46.94 ? 443  GLU A OE2 1 
ATOM   3453 N  N   . PHE A 1 444 ? 125.160 127.500 42.913 1.00 22.32 ? 444  PHE A N   1 
ATOM   3454 C  CA  . PHE A 1 444 ? 124.852 128.796 43.507 1.00 25.34 ? 444  PHE A CA  1 
ATOM   3455 C  C   . PHE A 1 444 ? 125.558 129.911 42.758 1.00 22.99 ? 444  PHE A C   1 
ATOM   3456 O  O   . PHE A 1 444 ? 124.997 130.991 42.551 1.00 23.17 ? 444  PHE A O   1 
ATOM   3457 C  CB  . PHE A 1 444 ? 125.234 128.812 44.988 1.00 19.68 ? 444  PHE A CB  1 
ATOM   3458 C  CG  . PHE A 1 444 ? 124.289 128.028 45.846 1.00 24.52 ? 444  PHE A CG  1 
ATOM   3459 C  CD1 . PHE A 1 444 ? 124.370 126.641 45.907 1.00 21.03 ? 444  PHE A CD1 1 
ATOM   3460 C  CD2 . PHE A 1 444 ? 123.252 128.670 46.518 1.00 22.38 ? 444  PHE A CD2 1 
ATOM   3461 C  CE1 . PHE A 1 444 ? 123.426 125.905 46.620 1.00 23.42 ? 444  PHE A CE1 1 
ATOM   3462 C  CE2 . PHE A 1 444 ? 122.307 127.948 47.231 1.00 22.03 ? 444  PHE A CE2 1 
ATOM   3463 C  CZ  . PHE A 1 444 ? 122.391 126.563 47.283 1.00 20.13 ? 444  PHE A CZ  1 
ATOM   3464 N  N   . VAL A 1 445 ? 126.784 129.636 42.335 1.00 20.48 ? 445  VAL A N   1 
ATOM   3465 C  CA  . VAL A 1 445 ? 127.569 130.614 41.589 1.00 15.39 ? 445  VAL A CA  1 
ATOM   3466 C  C   . VAL A 1 445 ? 126.912 130.884 40.235 1.00 22.01 ? 445  VAL A C   1 
ATOM   3467 O  O   . VAL A 1 445 ? 126.849 132.035 39.790 1.00 22.27 ? 445  VAL A O   1 
ATOM   3468 C  CB  . VAL A 1 445 ? 129.016 130.112 41.365 1.00 17.22 ? 445  VAL A CB  1 
ATOM   3469 C  CG1 . VAL A 1 445 ? 129.777 131.080 40.494 1.00 13.79 ? 445  VAL A CG1 1 
ATOM   3470 C  CG2 . VAL A 1 445 ? 129.719 129.947 42.700 1.00 20.53 ? 445  VAL A CG2 1 
ATOM   3471 N  N   . PHE A 1 446 ? 126.423 129.829 39.579 1.00 21.90 ? 446  PHE A N   1 
ATOM   3472 C  CA  . PHE A 1 446 ? 125.764 129.997 38.287 1.00 23.02 ? 446  PHE A CA  1 
ATOM   3473 C  C   . PHE A 1 446 ? 124.309 130.455 38.405 1.00 26.17 ? 446  PHE A C   1 
ATOM   3474 O  O   . PHE A 1 446 ? 123.630 130.668 37.402 1.00 25.55 ? 446  PHE A O   1 
ATOM   3475 C  CB  . PHE A 1 446 ? 125.857 128.719 37.457 1.00 16.61 ? 446  PHE A CB  1 
ATOM   3476 C  CG  . PHE A 1 446 ? 127.163 128.572 36.735 1.00 19.67 ? 446  PHE A CG  1 
ATOM   3477 C  CD1 . PHE A 1 446 ? 128.274 128.023 37.374 1.00 15.07 ? 446  PHE A CD1 1 
ATOM   3478 C  CD2 . PHE A 1 446 ? 127.301 129.043 35.434 1.00 11.71 ? 446  PHE A CD2 1 
ATOM   3479 C  CE1 . PHE A 1 446 ? 129.517 127.948 36.722 1.00 22.00 ? 446  PHE A CE1 1 
ATOM   3480 C  CE2 . PHE A 1 446 ? 128.526 128.976 34.773 1.00 17.14 ? 446  PHE A CE2 1 
ATOM   3481 C  CZ  . PHE A 1 446 ? 129.645 128.425 35.422 1.00 20.19 ? 446  PHE A CZ  1 
ATOM   3482 N  N   . GLY A 1 447 ? 123.833 130.594 39.637 1.00 25.80 ? 447  GLY A N   1 
ATOM   3483 C  CA  . GLY A 1 447 ? 122.486 131.089 39.854 1.00 22.97 ? 447  GLY A CA  1 
ATOM   3484 C  C   . GLY A 1 447 ? 121.305 130.206 39.527 1.00 29.44 ? 447  GLY A C   1 
ATOM   3485 O  O   . GLY A 1 447 ? 120.251 130.723 39.164 1.00 28.31 ? 447  GLY A O   1 
ATOM   3486 N  N   . LEU A 1 448 ? 121.459 128.892 39.647 1.00 25.31 ? 448  LEU A N   1 
ATOM   3487 C  CA  . LEU A 1 448 ? 120.346 127.993 39.377 1.00 30.40 ? 448  LEU A CA  1 
ATOM   3488 C  C   . LEU A 1 448 ? 119.197 128.240 40.362 1.00 32.46 ? 448  LEU A C   1 
ATOM   3489 O  O   . LEU A 1 448 ? 118.023 128.170 39.993 1.00 30.88 ? 448  LEU A O   1 
ATOM   3490 C  CB  . LEU A 1 448 ? 120.806 126.534 39.450 1.00 23.30 ? 448  LEU A CB  1 
ATOM   3491 C  CG  . LEU A 1 448 ? 121.257 125.933 38.113 1.00 31.82 ? 448  LEU A CG  1 
ATOM   3492 C  CD1 . LEU A 1 448 ? 122.409 126.748 37.526 1.00 22.99 ? 448  LEU A CD1 1 
ATOM   3493 C  CD2 . LEU A 1 448 ? 121.663 124.480 38.316 1.00 29.79 ? 448  LEU A CD2 1 
ATOM   3494 N  N   . PRO A 1 449 ? 119.522 128.531 41.632 1.00 33.29 ? 449  PRO A N   1 
ATOM   3495 C  CA  . PRO A 1 449 ? 118.462 128.781 42.612 1.00 30.95 ? 449  PRO A CA  1 
ATOM   3496 C  C   . PRO A 1 449 ? 117.608 130.001 42.293 1.00 23.61 ? 449  PRO A C   1 
ATOM   3497 O  O   . PRO A 1 449 ? 116.524 130.153 42.843 1.00 26.80 ? 449  PRO A O   1 
ATOM   3498 C  CB  . PRO A 1 449 ? 119.233 128.939 43.914 1.00 27.85 ? 449  PRO A CB  1 
ATOM   3499 C  CG  . PRO A 1 449 ? 120.367 127.989 43.720 1.00 33.80 ? 449  PRO A CG  1 
ATOM   3500 C  CD  . PRO A 1 449 ? 120.809 128.324 42.316 1.00 27.72 ? 449  PRO A CD  1 
ATOM   3501 N  N   . LEU A 1 450 ? 118.090 130.871 41.415 1.00 24.00 ? 450  LEU A N   1 
ATOM   3502 C  CA  . LEU A 1 450 ? 117.322 132.058 41.054 1.00 27.30 ? 450  LEU A CA  1 
ATOM   3503 C  C   . LEU A 1 450 ? 116.040 131.639 40.324 1.00 35.33 ? 450  LEU A C   1 
ATOM   3504 O  O   . LEU A 1 450 ? 115.051 132.371 40.301 1.00 35.83 ? 450  LEU A O   1 
ATOM   3505 C  CB  . LEU A 1 450 ? 118.160 132.993 40.175 1.00 21.38 ? 450  LEU A CB  1 
ATOM   3506 C  CG  . LEU A 1 450 ? 119.450 133.524 40.822 1.00 30.88 ? 450  LEU A CG  1 
ATOM   3507 C  CD1 . LEU A 1 450 ? 120.132 134.516 39.888 1.00 28.59 ? 450  LEU A CD1 1 
ATOM   3508 C  CD2 . LEU A 1 450 ? 119.124 134.195 42.154 1.00 25.78 ? 450  LEU A CD2 1 
ATOM   3509 N  N   . GLU A 1 451 ? 116.065 130.443 39.744 1.00 39.92 ? 451  GLU A N   1 
ATOM   3510 C  CA  . GLU A 1 451 ? 114.922 129.892 39.022 1.00 42.27 ? 451  GLU A CA  1 
ATOM   3511 C  C   . GLU A 1 451 ? 113.953 129.270 40.023 1.00 45.79 ? 451  GLU A C   1 
ATOM   3512 O  O   . GLU A 1 451 ? 114.221 128.198 40.568 1.00 48.51 ? 451  GLU A O   1 
ATOM   3513 C  CB  . GLU A 1 451 ? 115.410 128.821 38.048 1.00 39.75 ? 451  GLU A CB  1 
ATOM   3514 C  CG  . GLU A 1 451 ? 114.320 127.988 37.365 1.00 44.63 ? 451  GLU A CG  1 
ATOM   3515 C  CD  . GLU A 1 451 ? 113.737 128.660 36.116 0.00 44.23 ? 451  GLU A CD  1 
ATOM   3516 O  OE1 . GLU A 1 451 ? 112.833 129.511 36.202 0.00 45.00 ? 451  GLU A OE1 1 
ATOM   3517 O  OE2 . GLU A 1 451 ? 114.194 128.342 35.009 0.50 45.70 ? 451  GLU A OE2 1 
ATOM   3518 N  N   . ARG A 1 452 ? 112.831 129.939 40.264 1.00 46.80 ? 452  ARG A N   1 
ATOM   3519 C  CA  . ARG A 1 452 ? 111.835 129.429 41.203 1.00 51.74 ? 452  ARG A CA  1 
ATOM   3520 C  C   . ARG A 1 452 ? 111.137 128.138 40.751 1.00 51.02 ? 452  ARG A C   1 
ATOM   3521 O  O   . ARG A 1 452 ? 110.588 127.421 41.576 1.00 47.46 ? 452  ARG A O   1 
ATOM   3522 C  CB  . ARG A 1 452 ? 110.780 130.503 41.506 1.00 53.91 ? 452  ARG A CB  1 
ATOM   3523 C  CG  . ARG A 1 452 ? 111.289 131.636 42.396 1.00 61.99 ? 452  ARG A CG  1 
ATOM   3524 C  CD  . ARG A 1 452 ? 110.167 132.569 42.786 1.00 63.32 ? 452  ARG A CD  1 
ATOM   3525 N  NE  . ARG A 1 452 ? 110.225 133.842 42.085 0.00 59.68 ? 452  ARG A NE  1 
ATOM   3526 C  CZ  . ARG A 1 452 ? 110.755 134.951 42.585 0.50 59.82 ? 452  ARG A CZ  1 
ATOM   3527 N  NH1 . ARG A 1 452 ? 110.734 136.061 41.864 0.50 59.08 ? 452  ARG A NH1 1 
ATOM   3528 N  NH2 . ARG A 1 452 ? 111.298 134.956 43.795 0.50 57.31 ? 452  ARG A NH2 1 
ATOM   3529 N  N   . ARG A 1 453 ? 111.153 127.842 39.453 1.00 54.83 ? 453  ARG A N   1 
ATOM   3530 C  CA  . ARG A 1 453 ? 110.520 126.634 38.926 1.00 61.41 ? 453  ARG A CA  1 
ATOM   3531 C  C   . ARG A 1 453 ? 111.086 125.400 39.612 1.00 66.76 ? 453  ARG A C   1 
ATOM   3532 O  O   . ARG A 1 453 ? 110.519 124.312 39.508 1.00 70.96 ? 453  ARG A O   1 
ATOM   3533 C  CB  . ARG A 1 453 ? 110.729 126.502 37.408 1.00 60.19 ? 453  ARG A CB  1 
ATOM   3534 C  CG  . ARG A 1 453 ? 109.531 126.915 36.559 0.00 56.12 ? 453  ARG A CG  1 
ATOM   3535 C  CD  . ARG A 1 453 ? 109.566 128.389 36.197 0.50 51.67 ? 453  ARG A CD  1 
ATOM   3536 N  NE  . ARG A 1 453 ? 108.231 128.914 35.920 0.50 53.47 ? 453  ARG A NE  1 
ATOM   3537 C  CZ  . ARG A 1 453 ? 107.853 129.457 34.766 0.50 55.89 ? 453  ARG A CZ  1 
ATOM   3538 N  NH1 . ARG A 1 453 ? 106.613 129.907 34.623 0.50 57.31 ? 453  ARG A NH1 1 
ATOM   3539 N  NH2 . ARG A 1 453 ? 108.707 129.545 33.753 0.50 57.78 ? 453  ARG A NH2 1 
ATOM   3540 N  N   . ASP A 1 454 ? 112.207 125.571 40.307 1.00 67.31 ? 454  ASP A N   1 
ATOM   3541 C  CA  . ASP A 1 454 ? 112.841 124.464 41.013 1.00 70.26 ? 454  ASP A CA  1 
ATOM   3542 C  C   . ASP A 1 454 ? 112.457 124.441 42.490 1.00 69.80 ? 454  ASP A C   1 
ATOM   3543 O  O   . ASP A 1 454 ? 112.742 123.476 43.202 1.00 70.88 ? 454  ASP A O   1 
ATOM   3544 C  CB  . ASP A 1 454 ? 114.360 124.555 40.877 1.00 77.15 ? 454  ASP A CB  1 
ATOM   3545 C  CG  . ASP A 1 454 ? 114.827 124.379 39.446 1.00 84.18 ? 454  ASP A CG  1 
ATOM   3546 O  OD1 . ASP A 1 454 ? 114.354 125.135 38.570 1.00 83.66 ? 454  ASP A OD1 1 
ATOM   3547 O  OD2 . ASP A 1 454 ? 115.667 123.484 39.200 1.00 88.71 ? 454  ASP A OD2 1 
ATOM   3548 N  N   . TYR A 1 456 ? 114.335 124.829 45.038 1.00 32.37 ? 456  TYR A N   1 
ATOM   3549 C  CA  . TYR A 1 456 ? 115.146 125.417 46.095 1.00 34.34 ? 456  TYR A CA  1 
ATOM   3550 C  C   . TYR A 1 456 ? 114.304 126.279 47.023 1.00 32.19 ? 456  TYR A C   1 
ATOM   3551 O  O   . TYR A 1 456 ? 113.298 126.852 46.610 1.00 36.19 ? 456  TYR A O   1 
ATOM   3552 C  CB  . TYR A 1 456 ? 116.261 126.288 45.507 1.00 31.68 ? 456  TYR A CB  1 
ATOM   3553 C  CG  . TYR A 1 456 ? 117.237 125.568 44.603 1.00 31.90 ? 456  TYR A CG  1 
ATOM   3554 C  CD1 . TYR A 1 456 ? 117.034 125.515 43.225 1.00 29.02 ? 456  TYR A CD1 1 
ATOM   3555 C  CD2 . TYR A 1 456 ? 118.392 124.981 45.122 1.00 28.72 ? 456  TYR A CD2 1 
ATOM   3556 C  CE1 . TYR A 1 456 ? 117.966 124.903 42.380 1.00 28.92 ? 456  TYR A CE1 1 
ATOM   3557 C  CE2 . TYR A 1 456 ? 119.328 124.364 44.289 1.00 30.76 ? 456  TYR A CE2 1 
ATOM   3558 C  CZ  . TYR A 1 456 ? 119.111 124.333 42.919 1.00 32.31 ? 456  TYR A CZ  1 
ATOM   3559 O  OH  . TYR A 1 456 ? 120.046 123.758 42.089 1.00 28.09 ? 456  TYR A OH  1 
ATOM   3560 N  N   . THR A 1 457 ? 114.727 126.380 48.276 1.00 30.95 ? 457  THR A N   1 
ATOM   3561 C  CA  . THR A 1 457 ? 114.016 127.188 49.256 1.00 30.50 ? 457  THR A CA  1 
ATOM   3562 C  C   . THR A 1 457 ? 114.202 128.663 48.917 1.00 31.32 ? 457  THR A C   1 
ATOM   3563 O  O   . THR A 1 457 ? 114.947 129.009 48.001 1.00 33.57 ? 457  THR A O   1 
ATOM   3564 C  CB  . THR A 1 457 ? 114.563 126.958 50.671 1.00 33.20 ? 457  THR A CB  1 
ATOM   3565 O  OG1 . THR A 1 457 ? 115.921 127.413 50.734 1.00 37.61 ? 457  THR A OG1 1 
ATOM   3566 C  CG2 . THR A 1 457 ? 114.506 125.479 51.032 1.00 28.28 ? 457  THR A CG2 1 
ATOM   3567 N  N   . LYS A 1 458 ? 113.526 129.530 49.660 1.00 32.94 ? 458  LYS A N   1 
ATOM   3568 C  CA  . LYS A 1 458 ? 113.634 130.964 49.430 1.00 35.67 ? 458  LYS A CA  1 
ATOM   3569 C  C   . LYS A 1 458 ? 115.009 131.435 49.897 1.00 32.63 ? 458  LYS A C   1 
ATOM   3570 O  O   . LYS A 1 458 ? 115.641 132.295 49.279 1.00 34.92 ? 458  LYS A O   1 
ATOM   3571 C  CB  . LYS A 1 458 ? 112.548 131.710 50.209 1.00 36.89 ? 458  LYS A CB  1 
ATOM   3572 C  CG  . LYS A 1 458 ? 112.455 133.191 49.868 1.00 42.03 ? 458  LYS A CG  1 
ATOM   3573 C  CD  . LYS A 1 458 ? 111.736 133.410 48.546 1.00 45.83 ? 458  LYS A CD  1 
ATOM   3574 C  CE  . LYS A 1 458 ? 112.523 134.346 47.651 0.00 50.08 ? 458  LYS A CE  1 
ATOM   3575 N  NZ  . LYS A 1 458 ? 111.666 135.005 46.626 1.00 57.88 ? 458  LYS A NZ  1 
ATOM   3576 N  N   . ALA A 1 459 ? 115.466 130.855 50.998 1.00 32.24 ? 459  ALA A N   1 
ATOM   3577 C  CA  . ALA A 1 459 ? 116.752 131.209 51.567 1.00 27.83 ? 459  ALA A CA  1 
ATOM   3578 C  C   . ALA A 1 459 ? 117.874 130.946 50.582 1.00 29.39 ? 459  ALA A C   1 
ATOM   3579 O  O   . ALA A 1 459 ? 118.812 131.734 50.483 1.00 34.52 ? 459  ALA A O   1 
ATOM   3580 C  CB  . ALA A 1 459 ? 116.982 130.428 52.841 1.00 30.75 ? 459  ALA A CB  1 
ATOM   3581 N  N   . GLU A 1 460 ? 117.774 129.842 49.845 1.00 30.74 ? 460  GLU A N   1 
ATOM   3582 C  CA  . GLU A 1 460 ? 118.804 129.493 48.874 1.00 25.22 ? 460  GLU A CA  1 
ATOM   3583 C  C   . GLU A 1 460 ? 118.800 130.447 47.688 1.00 28.62 ? 460  GLU A C   1 
ATOM   3584 O  O   . GLU A 1 460 ? 119.851 130.751 47.123 1.00 28.72 ? 460  GLU A O   1 
ATOM   3585 C  CB  . GLU A 1 460 ? 118.620 128.048 48.415 1.00 29.10 ? 460  GLU A CB  1 
ATOM   3586 C  CG  . GLU A 1 460 ? 118.832 127.037 49.539 1.00 30.43 ? 460  GLU A CG  1 
ATOM   3587 C  CD  . GLU A 1 460 ? 118.706 125.593 49.083 1.00 37.40 ? 460  GLU A CD  1 
ATOM   3588 O  OE1 . GLU A 1 460 ? 117.685 125.261 48.452 1.00 39.80 ? 460  GLU A OE1 1 
ATOM   3589 O  OE2 . GLU A 1 460 ? 119.621 124.786 49.361 1.00 40.82 ? 460  GLU A OE2 1 
ATOM   3590 N  N   . GLU A 1 461 ? 117.618 130.933 47.322 1.00 29.93 ? 461  GLU A N   1 
ATOM   3591 C  CA  . GLU A 1 461 ? 117.493 131.880 46.217 1.00 28.76 ? 461  GLU A CA  1 
ATOM   3592 C  C   . GLU A 1 461 ? 118.236 133.155 46.597 1.00 30.34 ? 461  GLU A C   1 
ATOM   3593 O  O   . GLU A 1 461 ? 118.996 133.715 45.803 1.00 31.26 ? 461  GLU A O   1 
ATOM   3594 C  CB  . GLU A 1 461 ? 116.025 132.210 45.957 1.00 29.78 ? 461  GLU A CB  1 
ATOM   3595 C  CG  . GLU A 1 461 ? 115.821 133.331 44.952 1.00 39.79 ? 461  GLU A CG  1 
ATOM   3596 C  CD  . GLU A 1 461 ? 114.364 133.737 44.814 0.00 39.86 ? 461  GLU A CD  1 
ATOM   3597 O  OE1 . GLU A 1 461 ? 114.082 134.716 44.095 1.00 40.07 ? 461  GLU A OE1 1 
ATOM   3598 O  OE2 . GLU A 1 461 ? 113.497 133.078 45.422 0.50 43.12 ? 461  GLU A OE2 1 
ATOM   3599 N  N   . ILE A 1 462 ? 118.013 133.604 47.824 1.00 29.08 ? 462  ILE A N   1 
ATOM   3600 C  CA  . ILE A 1 462 ? 118.660 134.807 48.320 1.00 30.97 ? 462  ILE A CA  1 
ATOM   3601 C  C   . ILE A 1 462 ? 120.173 134.607 48.399 1.00 31.48 ? 462  ILE A C   1 
ATOM   3602 O  O   . ILE A 1 462 ? 120.938 135.480 47.990 1.00 27.49 ? 462  ILE A O   1 
ATOM   3603 C  CB  . ILE A 1 462 ? 118.092 135.197 49.706 1.00 37.67 ? 462  ILE A CB  1 
ATOM   3604 C  CG1 . ILE A 1 462 ? 116.640 135.657 49.549 1.00 36.48 ? 462  ILE A CG1 1 
ATOM   3605 C  CG2 . ILE A 1 462 ? 118.932 136.296 50.335 1.00 29.86 ? 462  ILE A CG2 1 
ATOM   3606 C  CD1 . ILE A 1 462 ? 115.947 135.955 50.856 1.00 50.38 ? 462  ILE A CD1 1 
ATOM   3607 N  N   . LEU A 1 463 ? 120.601 133.454 48.909 1.00 28.74 ? 463  LEU A N   1 
ATOM   3608 C  CA  . LEU A 1 463 ? 122.027 133.158 49.012 1.00 25.32 ? 463  LEU A CA  1 
ATOM   3609 C  C   . LEU A 1 463 ? 122.691 133.195 47.636 1.00 22.34 ? 463  LEU A C   1 
ATOM   3610 O  O   . LEU A 1 463 ? 123.753 133.794 47.466 1.00 20.77 ? 463  LEU A O   1 
ATOM   3611 C  CB  . LEU A 1 463 ? 122.255 131.780 49.658 1.00 18.63 ? 463  LEU A CB  1 
ATOM   3612 C  CG  . LEU A 1 463 ? 123.703 131.259 49.646 1.00 16.89 ? 463  LEU A CG  1 
ATOM   3613 C  CD1 . LEU A 1 463 ? 124.628 132.247 50.347 1.00 10.92 ? 463  LEU A CD1 1 
ATOM   3614 C  CD2 . LEU A 1 463 ? 123.766 129.895 50.317 1.00 16.97 ? 463  LEU A CD2 1 
ATOM   3615 N  N   . SER A 1 464 ? 122.057 132.564 46.655 1.00 20.86 ? 464  SER A N   1 
ATOM   3616 C  CA  . SER A 1 464 ? 122.599 132.524 45.305 1.00 24.98 ? 464  SER A CA  1 
ATOM   3617 C  C   . SER A 1 464 ? 122.677 133.930 44.716 1.00 23.89 ? 464  SER A C   1 
ATOM   3618 O  O   . SER A 1 464 ? 123.648 134.277 44.043 1.00 23.51 ? 464  SER A O   1 
ATOM   3619 C  CB  . SER A 1 464 ? 121.727 131.631 44.419 1.00 24.06 ? 464  SER A CB  1 
ATOM   3620 O  OG  . SER A 1 464 ? 122.250 131.526 43.108 1.00 20.00 ? 464  SER A OG  1 
ATOM   3621 N  N   . ARG A 1 465 ? 121.653 134.734 44.977 1.00 22.30 ? 465  ARG A N   1 
ATOM   3622 C  CA  . ARG A 1 465 ? 121.614 136.105 44.473 1.00 26.85 ? 465  ARG A CA  1 
ATOM   3623 C  C   . ARG A 1 465 ? 122.792 136.877 45.055 1.00 26.13 ? 465  ARG A C   1 
ATOM   3624 O  O   . ARG A 1 465 ? 123.486 137.598 44.348 1.00 31.93 ? 465  ARG A O   1 
ATOM   3625 C  CB  . ARG A 1 465 ? 120.299 136.791 44.870 1.00 27.49 ? 465  ARG A CB  1 
ATOM   3626 C  CG  . ARG A 1 465 ? 120.173 138.236 44.378 1.00 30.47 ? 465  ARG A CG  1 
ATOM   3627 C  CD  . ARG A 1 465 ? 119.781 138.231 42.866 1.00 34.20 ? 465  ARG A CD  1 
ATOM   3628 N  NE  . ARG A 1 465 ? 120.511 139.260 42.120 1.00 46.68 ? 465  ARG A NE  1 
ATOM   3629 C  CZ  . ARG A 1 465 ? 121.839 139.315 41.997 1.00 46.02 ? 465  ARG A CZ  1 
ATOM   3630 N  NH1 . ARG A 1 465 ? 122.382 140.281 41.271 1.00 49.29 ? 465  ARG A NH1 1 
ATOM   3631 N  NH2 . ARG A 1 465 ? 122.622 138.382 42.522 1.00 45.75 ? 465  ARG A NH2 1 
ATOM   3632 N  N   . SER A 1 466 ? 123.034 136.721 46.348 1.00 26.14 ? 466  SER A N   1 
ATOM   3633 C  CA  . SER A 1 466 ? 124.150 137.421 46.969 1.00 24.71 ? 466  SER A CA  1 
ATOM   3634 C  C   . SER A 1 466 ? 125.501 136.999 46.377 1.00 22.49 ? 466  SER A C   1 
ATOM   3635 O  O   . SER A 1 466 ? 126.358 137.844 46.086 1.00 20.81 ? 466  SER A O   1 
ATOM   3636 C  CB  . SER A 1 466 ? 124.149 137.164 48.468 1.00 25.29 ? 466  SER A CB  1 
ATOM   3637 O  OG  . SER A 1 466 ? 125.135 137.952 49.105 1.00 40.79 ? 466  SER A OG  1 
ATOM   3638 N  N   . ILE A 1 467 ? 125.684 135.692 46.199 1.00 17.73 ? 467  ILE A N   1 
ATOM   3639 C  CA  . ILE A 1 467 ? 126.928 135.149 45.651 1.00 20.85 ? 467  ILE A CA  1 
ATOM   3640 C  C   . ILE A 1 467 ? 127.162 135.630 44.215 1.00 17.50 ? 467  ILE A C   1 
ATOM   3641 O  O   . ILE A 1 467 ? 128.268 136.038 43.855 1.00 18.94 ? 467  ILE A O   1 
ATOM   3642 C  CB  . ILE A 1 467 ? 126.917 133.595 45.711 1.00 22.41 ? 467  ILE A CB  1 
ATOM   3643 C  CG1 . ILE A 1 467 ? 126.888 133.149 47.180 1.00 25.50 ? 467  ILE A CG1 1 
ATOM   3644 C  CG2 . ILE A 1 467 ? 128.130 133.020 44.996 1.00 19.97 ? 467  ILE A CG2 1 
ATOM   3645 C  CD1 . ILE A 1 467 ? 126.857 131.639 47.394 1.00 17.11 ? 467  ILE A CD1 1 
ATOM   3646 N  N   . VAL A 1 468 ? 126.109 135.591 43.406 1.00 22.30 ? 468  VAL A N   1 
ATOM   3647 C  CA  . VAL A 1 468 ? 126.172 136.034 42.018 1.00 21.26 ? 468  VAL A CA  1 
ATOM   3648 C  C   . VAL A 1 468 ? 126.598 137.496 41.965 1.00 22.84 ? 468  VAL A C   1 
ATOM   3649 O  O   . VAL A 1 468 ? 127.437 137.882 41.141 1.00 21.58 ? 468  VAL A O   1 
ATOM   3650 C  CB  . VAL A 1 468 ? 124.788 135.866 41.323 1.00 22.57 ? 468  VAL A CB  1 
ATOM   3651 C  CG1 . VAL A 1 468 ? 124.743 136.658 40.030 1.00 16.82 ? 468  VAL A CG1 1 
ATOM   3652 C  CG2 . VAL A 1 468 ? 124.534 134.392 41.035 1.00 12.96 ? 468  VAL A CG2 1 
ATOM   3653 N  N   . LYS A 1 469 ? 126.021 138.307 42.847 1.00 18.70 ? 469  LYS A N   1 
ATOM   3654 C  CA  . LYS A 1 469 ? 126.360 139.727 42.900 1.00 18.33 ? 469  LYS A CA  1 
ATOM   3655 C  C   . LYS A 1 469 ? 127.821 139.912 43.334 1.00 18.64 ? 469  LYS A C   1 
ATOM   3656 O  O   . LYS A 1 469 ? 128.569 140.679 42.719 1.00 19.75 ? 469  LYS A O   1 
ATOM   3657 C  CB  . LYS A 1 469 ? 125.406 140.461 43.858 1.00 14.05 ? 469  LYS A CB  1 
ATOM   3658 C  CG  . LYS A 1 469 ? 125.766 141.913 44.129 1.00 20.08 ? 469  LYS A CG  1 
ATOM   3659 C  CD  . LYS A 1 469 ? 125.838 142.732 42.854 1.00 24.05 ? 469  LYS A CD  1 
ATOM   3660 C  CE  . LYS A 1 469 ? 124.462 142.921 42.245 1.00 27.88 ? 469  LYS A CE  1 
ATOM   3661 N  NZ  . LYS A 1 469 ? 124.549 143.723 40.998 1.00 26.75 ? 469  LYS A NZ  1 
ATOM   3662 N  N   . ARG A 1 470 ? 128.234 139.200 44.380 1.00 21.05 ? 470  ARG A N   1 
ATOM   3663 C  CA  . ARG A 1 470 ? 129.612 139.307 44.860 1.00 21.41 ? 470  ARG A CA  1 
ATOM   3664 C  C   . ARG A 1 470 ? 130.605 138.860 43.781 1.00 24.07 ? 470  ARG A C   1 
ATOM   3665 O  O   . ARG A 1 470 ? 131.608 139.534 43.549 1.00 20.00 ? 470  ARG A O   1 
ATOM   3666 C  CB  . ARG A 1 470 ? 129.817 138.471 46.130 1.00 21.95 ? 470  ARG A CB  1 
ATOM   3667 C  CG  . ARG A 1 470 ? 129.174 139.037 47.392 1.00 19.43 ? 470  ARG A CG  1 
ATOM   3668 C  CD  . ARG A 1 470 ? 129.456 138.131 48.577 1.00 22.82 ? 470  ARG A CD  1 
ATOM   3669 N  NE  . ARG A 1 470 ? 128.803 138.559 49.811 1.00 21.61 ? 470  ARG A NE  1 
ATOM   3670 C  CZ  . ARG A 1 470 ? 129.155 139.617 50.535 1.00 23.39 ? 470  ARG A CZ  1 
ATOM   3671 N  NH1 . ARG A 1 470 ? 128.485 139.906 51.643 1.00 20.38 ? 470  ARG A NH1 1 
ATOM   3672 N  NH2 . ARG A 1 470 ? 130.170 140.385 50.160 1.00 21.19 ? 470  ARG A NH2 1 
ATOM   3673 N  N   . TRP A 1 471 ? 130.325 137.730 43.127 1.00 21.34 ? 471  TRP A N   1 
ATOM   3674 C  CA  . TRP A 1 471 ? 131.205 137.228 42.069 1.00 20.51 ? 471  TRP A CA  1 
ATOM   3675 C  C   . TRP A 1 471 ? 131.274 138.228 40.917 1.00 19.01 ? 471  TRP A C   1 
ATOM   3676 O  O   . TRP A 1 471 ? 132.338 138.461 40.341 1.00 21.55 ? 471  TRP A O   1 
ATOM   3677 C  CB  . TRP A 1 471 ? 130.702 135.885 41.525 1.00 9.87  ? 471  TRP A CB  1 
ATOM   3678 C  CG  . TRP A 1 471 ? 131.380 134.641 42.094 1.00 23.02 ? 471  TRP A CG  1 
ATOM   3679 C  CD1 . TRP A 1 471 ? 131.890 133.592 41.378 1.00 14.20 ? 471  TRP A CD1 1 
ATOM   3680 C  CD2 . TRP A 1 471 ? 131.549 134.295 43.480 1.00 16.30 ? 471  TRP A CD2 1 
ATOM   3681 N  NE1 . TRP A 1 471 ? 132.356 132.618 42.226 1.00 23.85 ? 471  TRP A NE1 1 
ATOM   3682 C  CE2 . TRP A 1 471 ? 132.162 133.021 43.520 1.00 20.48 ? 471  TRP A CE2 1 
ATOM   3683 C  CE3 . TRP A 1 471 ? 131.242 134.937 44.688 1.00 18.11 ? 471  TRP A CE3 1 
ATOM   3684 C  CZ2 . TRP A 1 471 ? 132.474 132.374 44.722 1.00 19.63 ? 471  TRP A CZ2 1 
ATOM   3685 C  CZ3 . TRP A 1 471 ? 131.552 134.291 45.888 1.00 25.07 ? 471  TRP A CZ3 1 
ATOM   3686 C  CH2 . TRP A 1 471 ? 132.162 133.021 45.892 1.00 22.62 ? 471  TRP A CH2 1 
ATOM   3687 N  N   . ALA A 1 472 ? 130.128 138.815 40.584 1.00 19.28 ? 472  ALA A N   1 
ATOM   3688 C  CA  . ALA A 1 472 ? 130.059 139.785 39.500 1.00 19.28 ? 472  ALA A CA  1 
ATOM   3689 C  C   . ALA A 1 472 ? 130.826 141.046 39.859 1.00 20.38 ? 472  ALA A C   1 
ATOM   3690 O  O   . ALA A 1 472 ? 131.618 141.539 39.056 1.00 18.53 ? 472  ALA A O   1 
ATOM   3691 C  CB  . ALA A 1 472 ? 128.611 140.122 39.186 1.00 19.46 ? 472  ALA A CB  1 
ATOM   3692 N  N   . ASN A 1 473 ? 130.599 141.569 41.061 1.00 17.75 ? 473  ASN A N   1 
ATOM   3693 C  CA  . ASN A 1 473 ? 131.310 142.773 41.474 1.00 18.78 ? 473  ASN A CA  1 
ATOM   3694 C  C   . ASN A 1 473 ? 132.809 142.545 41.507 1.00 20.24 ? 473  ASN A C   1 
ATOM   3695 O  O   . ASN A 1 473 ? 133.584 143.450 41.191 1.00 24.86 ? 473  ASN A O   1 
ATOM   3696 C  CB  . ASN A 1 473 ? 130.822 143.265 42.834 1.00 18.89 ? 473  ASN A CB  1 
ATOM   3697 C  CG  . ASN A 1 473 ? 129.562 144.097 42.722 1.00 18.99 ? 473  ASN A CG  1 
ATOM   3698 O  OD1 . ASN A 1 473 ? 129.190 144.532 41.633 1.00 22.20 ? 473  ASN A OD1 1 
ATOM   3699 N  ND2 . ASN A 1 473 ? 128.906 144.333 43.848 1.00 18.32 ? 473  ASN A ND2 1 
ATOM   3700 N  N   . PHE A 1 474 ? 133.230 141.342 41.882 1.00 18.84 ? 474  PHE A N   1 
ATOM   3701 C  CA  . PHE A 1 474 ? 134.658 141.059 41.892 1.00 21.92 ? 474  PHE A CA  1 
ATOM   3702 C  C   . PHE A 1 474 ? 135.184 141.081 40.456 1.00 19.84 ? 474  PHE A C   1 
ATOM   3703 O  O   . PHE A 1 474 ? 136.250 141.622 40.186 1.00 15.37 ? 474  PHE A O   1 
ATOM   3704 C  CB  . PHE A 1 474 ? 134.955 139.691 42.491 1.00 19.14 ? 474  PHE A CB  1 
ATOM   3705 C  CG  . PHE A 1 474 ? 136.395 139.299 42.378 1.00 15.68 ? 474  PHE A CG  1 
ATOM   3706 C  CD1 . PHE A 1 474 ? 137.347 139.850 43.234 1.00 15.02 ? 474  PHE A CD1 1 
ATOM   3707 C  CD2 . PHE A 1 474 ? 136.808 138.397 41.404 1.00 9.06  ? 474  PHE A CD2 1 
ATOM   3708 C  CE1 . PHE A 1 474 ? 138.697 139.506 43.120 1.00 20.15 ? 474  PHE A CE1 1 
ATOM   3709 C  CE2 . PHE A 1 474 ? 138.157 138.044 41.279 1.00 12.11 ? 474  PHE A CE2 1 
ATOM   3710 C  CZ  . PHE A 1 474 ? 139.104 138.599 42.139 1.00 16.82 ? 474  PHE A CZ  1 
ATOM   3711 N  N   . ALA A 1 475 ? 134.431 140.482 39.540 1.00 17.77 ? 475  ALA A N   1 
ATOM   3712 C  CA  . ALA A 1 475 ? 134.841 140.444 38.141 1.00 24.14 ? 475  ALA A CA  1 
ATOM   3713 C  C   . ALA A 1 475 ? 134.913 141.855 37.551 1.00 22.65 ? 475  ALA A C   1 
ATOM   3714 O  O   . ALA A 1 475 ? 135.886 142.220 36.894 1.00 18.37 ? 475  ALA A O   1 
ATOM   3715 C  CB  . ALA A 1 475 ? 133.871 139.580 37.331 1.00 22.91 ? 475  ALA A CB  1 
ATOM   3716 N  N   . LYS A 1 476 ? 133.878 142.648 37.791 1.00 21.47 ? 476  LYS A N   1 
ATOM   3717 C  CA  . LYS A 1 476 ? 133.841 144.006 37.269 1.00 24.20 ? 476  LYS A CA  1 
ATOM   3718 C  C   . LYS A 1 476 ? 134.757 144.986 37.997 1.00 23.50 ? 476  LYS A C   1 
ATOM   3719 O  O   . LYS A 1 476 ? 135.428 145.793 37.358 1.00 22.85 ? 476  LYS A O   1 
ATOM   3720 C  CB  . LYS A 1 476 ? 132.412 144.558 37.321 1.00 20.19 ? 476  LYS A CB  1 
ATOM   3721 C  CG  . LYS A 1 476 ? 131.411 143.789 36.481 1.00 31.40 ? 476  LYS A CG  1 
ATOM   3722 C  CD  . LYS A 1 476 ? 129.991 144.242 36.773 1.00 27.96 ? 476  LYS A CD  1 
ATOM   3723 C  CE  . LYS A 1 476 ? 128.980 143.398 36.011 1.00 40.87 ? 476  LYS A CE  1 
ATOM   3724 N  NZ  . LYS A 1 476 ? 127.581 143.630 36.485 1.00 43.05 ? 476  LYS A NZ  1 
ATOM   3725 N  N   . TYR A 1 477 ? 134.801 144.909 39.325 1.00 20.28 ? 477  TYR A N   1 
ATOM   3726 C  CA  . TYR A 1 477 ? 135.591 145.871 40.086 1.00 23.59 ? 477  TYR A CA  1 
ATOM   3727 C  C   . TYR A 1 477 ? 136.684 145.342 41.012 1.00 22.96 ? 477  TYR A C   1 
ATOM   3728 O  O   . TYR A 1 477 ? 137.318 146.122 41.717 1.00 28.16 ? 477  TYR A O   1 
ATOM   3729 C  CB  . TYR A 1 477 ? 134.633 146.752 40.888 1.00 12.72 ? 477  TYR A CB  1 
ATOM   3730 C  CG  . TYR A 1 477 ? 133.340 147.028 40.160 1.00 15.46 ? 477  TYR A CG  1 
ATOM   3731 C  CD1 . TYR A 1 477 ? 132.115 146.590 40.672 1.00 17.69 ? 477  TYR A CD1 1 
ATOM   3732 C  CD2 . TYR A 1 477 ? 133.335 147.721 38.952 1.00 19.13 ? 477  TYR A CD2 1 
ATOM   3733 C  CE1 . TYR A 1 477 ? 130.920 146.840 39.993 1.00 19.77 ? 477  TYR A CE1 1 
ATOM   3734 C  CE2 . TYR A 1 477 ? 132.149 147.976 38.268 1.00 13.69 ? 477  TYR A CE2 1 
ATOM   3735 C  CZ  . TYR A 1 477 ? 130.948 147.535 38.790 1.00 18.52 ? 477  TYR A CZ  1 
ATOM   3736 O  OH  . TYR A 1 477 ? 129.778 147.783 38.106 1.00 19.67 ? 477  TYR A OH  1 
ATOM   3737 N  N   . GLY A 1 478 ? 136.905 144.035 41.022 1.00 21.82 ? 478  GLY A N   1 
ATOM   3738 C  CA  . GLY A 1 478 ? 137.936 143.481 41.883 1.00 22.21 ? 478  GLY A CA  1 
ATOM   3739 C  C   . GLY A 1 478 ? 137.621 143.565 43.369 1.00 26.93 ? 478  GLY A C   1 
ATOM   3740 O  O   . GLY A 1 478 ? 138.523 143.475 44.200 1.00 27.91 ? 478  GLY A O   1 
ATOM   3741 N  N   . ASN A 1 479 ? 136.344 143.726 43.710 1.00 22.64 ? 479  ASN A N   1 
ATOM   3742 C  CA  . ASN A 1 479 ? 135.921 143.820 45.110 1.00 25.31 ? 479  ASN A CA  1 
ATOM   3743 C  C   . ASN A 1 479 ? 134.606 143.036 45.279 1.00 19.63 ? 479  ASN A C   1 
ATOM   3744 O  O   . ASN A 1 479 ? 133.548 143.500 44.866 1.00 24.00 ? 479  ASN A O   1 
ATOM   3745 C  CB  . ASN A 1 479 ? 135.705 145.288 45.479 1.00 27.36 ? 479  ASN A CB  1 
ATOM   3746 C  CG  . ASN A 1 479 ? 135.969 145.570 46.946 1.00 35.44 ? 479  ASN A CG  1 
ATOM   3747 O  OD1 . ASN A 1 479 ? 135.843 144.689 47.797 1.00 37.07 ? 479  ASN A OD1 1 
ATOM   3748 N  ND2 . ASN A 1 479 ? 136.321 146.813 47.250 1.00 40.90 ? 479  ASN A ND2 1 
ATOM   3749 N  N   . PRO A 1 480 ? 134.657 141.855 45.921 1.00 21.51 ? 480  PRO A N   1 
ATOM   3750 C  CA  . PRO A 1 480 ? 133.490 140.986 46.140 1.00 16.96 ? 480  PRO A CA  1 
ATOM   3751 C  C   . PRO A 1 480 ? 132.429 141.434 47.142 1.00 21.05 ? 480  PRO A C   1 
ATOM   3752 O  O   . PRO A 1 480 ? 131.933 140.628 47.939 1.00 18.33 ? 480  PRO A O   1 
ATOM   3753 C  CB  . PRO A 1 480 ? 134.132 139.662 46.537 1.00 14.79 ? 480  PRO A CB  1 
ATOM   3754 C  CG  . PRO A 1 480 ? 135.284 140.121 47.370 1.00 22.37 ? 480  PRO A CG  1 
ATOM   3755 C  CD  . PRO A 1 480 ? 135.859 141.284 46.558 1.00 19.06 ? 480  PRO A CD  1 
ATOM   3756 N  N   . GLN A 1 481 ? 132.052 142.704 47.080 1.00 22.51 ? 481  GLN A N   1 
ATOM   3757 C  CA  . GLN A 1 481 ? 131.054 143.235 48.001 1.00 22.49 ? 481  GLN A CA  1 
ATOM   3758 C  C   . GLN A 1 481 ? 129.641 143.196 47.433 1.00 22.36 ? 481  GLN A C   1 
ATOM   3759 O  O   . GLN A 1 481 ? 129.444 143.111 46.221 1.00 26.81 ? 481  GLN A O   1 
ATOM   3760 C  CB  . GLN A 1 481 ? 131.382 144.694 48.362 1.00 15.64 ? 481  GLN A CB  1 
ATOM   3761 C  CG  . GLN A 1 481 ? 132.821 144.963 48.783 1.00 15.16 ? 481  GLN A CG  1 
ATOM   3762 C  CD  . GLN A 1 481 ? 133.282 144.062 49.912 1.00 18.95 ? 481  GLN A CD  1 
ATOM   3763 O  OE1 . GLN A 1 481 ? 132.498 143.692 50.787 1.00 18.30 ? 481  GLN A OE1 1 
ATOM   3764 N  NE2 . GLN A 1 481 ? 134.564 143.714 49.905 1.00 18.41 ? 481  GLN A NE2 1 
ATOM   3765 N  N   . GLU A 1 482 ? 128.667 143.237 48.336 1.00 25.48 ? 482  GLU A N   1 
ATOM   3766 C  CA  . GLU A 1 482 ? 127.246 143.307 47.995 1.00 24.30 ? 482  GLU A CA  1 
ATOM   3767 C  C   . GLU A 1 482 ? 126.938 144.594 48.750 1.00 26.40 ? 482  GLU A C   1 
ATOM   3768 O  O   . GLU A 1 482 ? 126.710 144.585 49.960 1.00 33.58 ? 482  GLU A O   1 
ATOM   3769 C  CB  . GLU A 1 482 ? 126.465 142.142 48.594 1.00 27.51 ? 482  GLU A CB  1 
ATOM   3770 C  CG  . GLU A 1 482 ? 125.001 142.065 48.140 1.00 39.53 ? 482  GLU A CG  1 
ATOM   3771 C  CD  . GLU A 1 482 ? 124.212 143.340 48.415 1.00 43.30 ? 482  GLU A CD  1 
ATOM   3772 O  OE1 . GLU A 1 482 ? 123.818 144.015 47.440 1.00 36.58 ? 482  GLU A OE1 1 
ATOM   3773 O  OE2 . GLU A 1 482 ? 123.986 143.671 49.601 1.00 42.95 ? 482  GLU A OE2 1 
ATOM   3774 N  N   . THR A 1 483 ? 126.947 145.703 48.033 1.00 23.68 ? 483  THR A N   1 
ATOM   3775 C  CA  . THR A 1 483 ? 126.767 147.011 48.647 1.00 32.04 ? 483  THR A CA  1 
ATOM   3776 C  C   . THR A 1 483 ? 125.383 147.593 48.895 1.00 31.11 ? 483  THR A C   1 
ATOM   3777 O  O   . THR A 1 483 ? 125.280 148.652 49.503 1.00 35.55 ? 483  THR A O   1 
ATOM   3778 C  CB  . THR A 1 483 ? 127.529 148.054 47.840 1.00 31.09 ? 483  THR A CB  1 
ATOM   3779 O  OG1 . THR A 1 483 ? 126.877 148.235 46.579 1.00 31.39 ? 483  THR A OG1 1 
ATOM   3780 C  CG2 . THR A 1 483 ? 128.945 147.584 47.581 1.00 30.39 ? 483  THR A CG2 1 
ATOM   3781 N  N   . GLN A 1 484 ? 124.323 146.932 48.453 1.00 35.88 ? 484  GLN A N   1 
ATOM   3782 C  CA  . GLN A 1 484 ? 122.999 147.509 48.631 1.00 35.94 ? 484  GLN A CA  1 
ATOM   3783 C  C   . GLN A 1 484 ? 122.114 146.971 49.750 1.00 38.65 ? 484  GLN A C   1 
ATOM   3784 O  O   . GLN A 1 484 ? 121.380 147.739 50.375 1.00 37.20 ? 484  GLN A O   1 
ATOM   3785 C  CB  . GLN A 1 484 ? 122.243 147.433 47.308 1.00 36.67 ? 484  GLN A CB  1 
ATOM   3786 C  CG  . GLN A 1 484 ? 123.036 147.992 46.140 1.00 46.12 ? 484  GLN A CG  1 
ATOM   3787 C  CD  . GLN A 1 484 ? 122.290 147.917 44.821 1.00 52.16 ? 484  GLN A CD  1 
ATOM   3788 O  OE1 . GLN A 1 484 ? 121.618 146.924 44.525 1.00 54.21 ? 484  GLN A OE1 1 
ATOM   3789 N  NE2 . GLN A 1 484 ? 122.421 148.962 44.011 1.00 53.35 ? 484  GLN A NE2 1 
ATOM   3790 N  N   . ASN A 1 485 ? 122.177 145.672 50.020 1.00 42.20 ? 485  ASN A N   1 
ATOM   3791 C  CA  . ASN A 1 485 ? 121.320 145.098 51.050 1.00 43.38 ? 485  ASN A CA  1 
ATOM   3792 C  C   . ASN A 1 485 ? 121.920 144.901 52.419 1.00 45.78 ? 485  ASN A C   1 
ATOM   3793 O  O   . ASN A 1 485 ? 121.778 143.836 53.016 1.00 51.35 ? 485  ASN A O   1 
ATOM   3794 C  CB  . ASN A 1 485 ? 120.745 143.780 50.562 1.00 46.54 ? 485  ASN A CB  1 
ATOM   3795 C  CG  . ASN A 1 485 ? 119.924 143.950 49.326 1.00 53.20 ? 485  ASN A CG  1 
ATOM   3796 O  OD1 . ASN A 1 485 ? 119.675 145.070 48.887 1.00 49.20 ? 485  ASN A OD1 1 
ATOM   3797 N  ND2 . ASN A 1 485 ? 119.501 142.834 48.767 1.00 62.34 ? 485  ASN A ND2 1 
ATOM   3798 N  N   . GLN A 1 486 ? 122.575 145.938 52.925 1.00 47.18 ? 486  GLN A N   1 
ATOM   3799 C  CA  . GLN A 1 486 ? 123.178 145.875 54.248 1.00 49.45 ? 486  GLN A CA  1 
ATOM   3800 C  C   . GLN A 1 486 ? 123.824 144.515 54.477 1.00 49.68 ? 486  GLN A C   1 
ATOM   3801 O  O   . GLN A 1 486 ? 123.492 143.809 55.433 1.00 54.58 ? 486  GLN A O   1 
ATOM   3802 C  CB  . GLN A 1 486 ? 122.114 146.130 55.311 1.00 50.47 ? 486  GLN A CB  1 
ATOM   3803 N  N   . SER A 1 487 ? 124.736 144.143 53.586 1.00 43.74 ? 487  SER A N   1 
ATOM   3804 C  CA  . SER A 1 487 ? 125.419 142.861 53.691 1.00 42.92 ? 487  SER A CA  1 
ATOM   3805 C  C   . SER A 1 487 ? 126.727 143.002 54.455 1.00 39.60 ? 487  SER A C   1 
ATOM   3806 O  O   . SER A 1 487 ? 127.266 144.102 54.590 1.00 39.11 ? 487  SER A O   1 
ATOM   3807 C  CB  . SER A 1 487 ? 125.714 142.302 52.296 1.00 43.76 ? 487  SER A CB  1 
ATOM   3808 O  OG  . SER A 1 487 ? 124.526 142.165 51.540 1.00 48.72 ? 487  SER A OG  1 
ATOM   3809 N  N   . THR A 1 488 ? 127.226 141.880 54.965 1.00 35.77 ? 488  THR A N   1 
ATOM   3810 C  CA  . THR A 1 488 ? 128.489 141.871 55.686 1.00 26.29 ? 488  THR A CA  1 
ATOM   3811 C  C   . THR A 1 488 ? 129.548 142.259 54.665 1.00 27.83 ? 488  THR A C   1 
ATOM   3812 O  O   . THR A 1 488 ? 129.489 141.828 53.515 1.00 30.18 ? 488  THR A O   1 
ATOM   3813 C  CB  . THR A 1 488 ? 128.835 140.464 56.211 1.00 29.46 ? 488  THR A CB  1 
ATOM   3814 O  OG1 . THR A 1 488 ? 127.835 140.031 57.143 1.00 35.76 ? 488  THR A OG1 1 
ATOM   3815 C  CG2 . THR A 1 488 ? 130.206 140.469 56.878 1.00 29.22 ? 488  THR A CG2 1 
ATOM   3816 N  N   . SER A 1 489 ? 130.500 143.087 55.071 1.00 28.03 ? 489  SER A N   1 
ATOM   3817 C  CA  . SER A 1 489 ? 131.566 143.492 54.168 1.00 28.47 ? 489  SER A CA  1 
ATOM   3818 C  C   . SER A 1 489 ? 132.595 142.364 54.136 1.00 29.02 ? 489  SER A C   1 
ATOM   3819 O  O   . SER A 1 489 ? 132.916 141.776 55.166 1.00 33.27 ? 489  SER A O   1 
ATOM   3820 C  CB  . SER A 1 489 ? 132.211 144.786 54.662 1.00 28.21 ? 489  SER A CB  1 
ATOM   3821 O  OG  . SER A 1 489 ? 133.260 145.188 53.803 1.00 46.76 ? 489  SER A OG  1 
ATOM   3822 N  N   . TRP A 1 490 ? 133.093 142.047 52.950 1.00 22.58 ? 490  TRP A N   1 
ATOM   3823 C  CA  . TRP A 1 490 ? 134.069 140.982 52.808 1.00 18.82 ? 490  TRP A CA  1 
ATOM   3824 C  C   . TRP A 1 490 ? 135.462 141.587 52.956 1.00 15.31 ? 490  TRP A C   1 
ATOM   3825 O  O   . TRP A 1 490 ? 135.921 142.333 52.098 1.00 20.42 ? 490  TRP A O   1 
ATOM   3826 C  CB  . TRP A 1 490 ? 133.919 140.324 51.435 1.00 17.97 ? 490  TRP A CB  1 
ATOM   3827 C  CG  . TRP A 1 490 ? 134.610 139.002 51.282 1.00 21.17 ? 490  TRP A CG  1 
ATOM   3828 C  CD1 . TRP A 1 490 ? 135.723 138.566 51.953 1.00 21.27 ? 490  TRP A CD1 1 
ATOM   3829 C  CD2 . TRP A 1 490 ? 134.277 137.970 50.348 1.00 17.26 ? 490  TRP A CD2 1 
ATOM   3830 N  NE1 . TRP A 1 490 ? 136.100 137.330 51.490 1.00 14.41 ? 490  TRP A NE1 1 
ATOM   3831 C  CE2 . TRP A 1 490 ? 135.234 136.939 50.504 1.00 15.84 ? 490  TRP A CE2 1 
ATOM   3832 C  CE3 . TRP A 1 490 ? 133.264 137.816 49.390 1.00 17.87 ? 490  TRP A CE3 1 
ATOM   3833 C  CZ2 . TRP A 1 490 ? 135.210 135.766 49.731 1.00 19.53 ? 490  TRP A CZ2 1 
ATOM   3834 C  CZ3 . TRP A 1 490 ? 133.238 136.650 48.620 1.00 21.50 ? 490  TRP A CZ3 1 
ATOM   3835 C  CH2 . TRP A 1 490 ? 134.208 135.641 48.797 1.00 24.04 ? 490  TRP A CH2 1 
ATOM   3836 N  N   . PRO A 1 491 ? 136.157 141.265 54.054 1.00 20.32 ? 491  PRO A N   1 
ATOM   3837 C  CA  . PRO A 1 491 ? 137.497 141.799 54.284 1.00 19.30 ? 491  PRO A CA  1 
ATOM   3838 C  C   . PRO A 1 491 ? 138.550 141.119 53.434 1.00 20.91 ? 491  PRO A C   1 
ATOM   3839 O  O   . PRO A 1 491 ? 138.392 139.967 53.031 1.00 24.59 ? 491  PRO A O   1 
ATOM   3840 C  CB  . PRO A 1 491 ? 137.715 141.523 55.756 1.00 25.29 ? 491  PRO A CB  1 
ATOM   3841 C  CG  . PRO A 1 491 ? 137.063 140.190 55.910 1.00 20.10 ? 491  PRO A CG  1 
ATOM   3842 C  CD  . PRO A 1 491 ? 135.765 140.360 55.150 1.00 22.02 ? 491  PRO A CD  1 
ATOM   3843 N  N   . VAL A 1 492 ? 139.625 141.848 53.167 1.00 18.50 ? 492  VAL A N   1 
ATOM   3844 C  CA  . VAL A 1 492 ? 140.733 141.325 52.393 1.00 18.70 ? 492  VAL A CA  1 
ATOM   3845 C  C   . VAL A 1 492 ? 141.439 140.289 53.261 1.00 23.25 ? 492  VAL A C   1 
ATOM   3846 O  O   . VAL A 1 492 ? 141.478 140.426 54.481 1.00 24.60 ? 492  VAL A O   1 
ATOM   3847 C  CB  . VAL A 1 492 ? 141.716 142.455 52.029 1.00 21.46 ? 492  VAL A CB  1 
ATOM   3848 C  CG1 . VAL A 1 492 ? 143.049 141.883 51.622 1.00 30.22 ? 492  VAL A CG1 1 
ATOM   3849 C  CG2 . VAL A 1 492 ? 141.141 143.287 50.895 1.00 24.77 ? 492  VAL A CG2 1 
ATOM   3850 N  N   . PHE A 1 493 ? 141.978 139.247 52.635 1.00 22.88 ? 493  PHE A N   1 
ATOM   3851 C  CA  . PHE A 1 493 ? 142.697 138.199 53.358 1.00 22.55 ? 493  PHE A CA  1 
ATOM   3852 C  C   . PHE A 1 493 ? 144.170 138.571 53.379 1.00 24.93 ? 493  PHE A C   1 
ATOM   3853 O  O   . PHE A 1 493 ? 144.771 138.787 52.328 1.00 32.42 ? 493  PHE A O   1 
ATOM   3854 C  CB  . PHE A 1 493 ? 142.501 136.848 52.653 1.00 19.37 ? 493  PHE A CB  1 
ATOM   3855 C  CG  . PHE A 1 493 ? 143.262 135.697 53.277 1.00 22.30 ? 493  PHE A CG  1 
ATOM   3856 C  CD1 . PHE A 1 493 ? 144.645 135.597 53.151 1.00 19.89 ? 493  PHE A CD1 1 
ATOM   3857 C  CD2 . PHE A 1 493 ? 142.582 134.691 53.959 1.00 24.86 ? 493  PHE A CD2 1 
ATOM   3858 C  CE1 . PHE A 1 493 ? 145.340 134.516 53.689 1.00 22.70 ? 493  PHE A CE1 1 
ATOM   3859 C  CE2 . PHE A 1 493 ? 143.267 133.601 54.502 1.00 26.00 ? 493  PHE A CE2 1 
ATOM   3860 C  CZ  . PHE A 1 493 ? 144.650 133.515 54.365 1.00 23.36 ? 493  PHE A CZ  1 
ATOM   3861 N  N   . LYS A 1 494 ? 144.744 138.652 54.575 1.00 27.40 ? 494  LYS A N   1 
ATOM   3862 C  CA  . LYS A 1 494 ? 146.158 138.988 54.746 1.00 31.11 ? 494  LYS A CA  1 
ATOM   3863 C  C   . LYS A 1 494 ? 146.829 137.890 55.573 1.00 30.13 ? 494  LYS A C   1 
ATOM   3864 O  O   . LYS A 1 494 ? 146.185 137.280 56.427 1.00 31.08 ? 494  LYS A O   1 
ATOM   3865 C  CB  . LYS A 1 494 ? 146.294 140.349 55.437 1.00 32.85 ? 494  LYS A CB  1 
ATOM   3866 C  CG  . LYS A 1 494 ? 145.779 141.500 54.591 1.00 39.10 ? 494  LYS A CG  1 
ATOM   3867 C  CD  . LYS A 1 494 ? 145.582 142.777 55.394 1.00 46.94 ? 494  LYS A CD  1 
ATOM   3868 C  CE  . LYS A 1 494 ? 144.962 143.862 54.517 0.50 50.09 ? 494  LYS A CE  1 
ATOM   3869 N  NZ  . LYS A 1 494 ? 144.545 145.074 55.277 1.00 56.80 ? 494  LYS A NZ  1 
ATOM   3870 N  N   . SER A 1 495 ? 148.112 137.644 55.308 1.00 27.77 ? 495  SER A N   1 
ATOM   3871 C  CA  . SER A 1 495 ? 148.885 136.606 55.997 1.00 35.52 ? 495  SER A CA  1 
ATOM   3872 C  C   . SER A 1 495 ? 148.831 136.616 57.519 1.00 37.23 ? 495  SER A C   1 
ATOM   3873 O  O   . SER A 1 495 ? 148.888 135.561 58.151 1.00 42.50 ? 495  SER A O   1 
ATOM   3874 C  CB  . SER A 1 495 ? 150.353 136.663 55.571 1.00 43.26 ? 495  SER A CB  1 
ATOM   3875 O  OG  . SER A 1 495 ? 150.515 136.205 54.243 1.00 53.53 ? 495  SER A OG  1 
ATOM   3876 N  N   . THR A 1 496 ? 148.727 137.800 58.107 1.00 31.81 ? 496  THR A N   1 
ATOM   3877 C  CA  . THR A 1 496 ? 148.677 137.918 59.557 1.00 37.94 ? 496  THR A CA  1 
ATOM   3878 C  C   . THR A 1 496 ? 147.313 137.549 60.130 1.00 32.06 ? 496  THR A C   1 
ATOM   3879 O  O   . THR A 1 496 ? 147.159 136.529 60.801 1.00 33.56 ? 496  THR A O   1 
ATOM   3880 C  CB  . THR A 1 496 ? 148.990 139.350 59.997 1.00 46.52 ? 496  THR A CB  1 
ATOM   3881 O  OG1 . THR A 1 496 ? 150.055 139.870 59.191 1.00 57.89 ? 496  THR A OG1 1 
ATOM   3882 C  CG2 . THR A 1 496 ? 149.395 139.372 61.468 1.00 43.54 ? 496  THR A CG2 1 
ATOM   3883 N  N   . GLU A 1 497 ? 146.325 138.389 59.852 1.00 29.97 ? 497  GLU A N   1 
ATOM   3884 C  CA  . GLU A 1 497 ? 144.981 138.179 60.355 1.00 29.48 ? 497  GLU A CA  1 
ATOM   3885 C  C   . GLU A 1 497 ? 144.228 137.012 59.712 1.00 28.71 ? 497  GLU A C   1 
ATOM   3886 O  O   . GLU A 1 497 ? 143.500 136.298 60.398 1.00 27.78 ? 497  GLU A O   1 
ATOM   3887 C  CB  . GLU A 1 497 ? 144.214 139.497 60.252 1.00 34.19 ? 497  GLU A CB  1 
ATOM   3888 C  CG  . GLU A 1 497 ? 144.605 140.461 61.384 1.00 42.82 ? 497  GLU A CG  1 
ATOM   3889 C  CD  . GLU A 1 497 ? 144.474 141.937 61.037 1.00 41.18 ? 497  GLU A CD  1 
ATOM   3890 O  OE1 . GLU A 1 497 ? 144.103 142.724 61.933 0.00 42.74 ? 497  GLU A OE1 1 
ATOM   3891 O  OE2 . GLU A 1 497 ? 144.765 142.318 59.887 0.00 42.74 ? 497  GLU A OE2 1 
ATOM   3892 N  N   . GLN A 1 498 ? 144.413 136.807 58.412 1.00 24.14 ? 498  GLN A N   1 
ATOM   3893 C  CA  . GLN A 1 498 ? 143.771 135.699 57.705 1.00 20.64 ? 498  GLN A CA  1 
ATOM   3894 C  C   . GLN A 1 498 ? 142.250 135.642 57.839 1.00 20.42 ? 498  GLN A C   1 
ATOM   3895 O  O   . GLN A 1 498 ? 141.675 134.590 58.126 1.00 17.01 ? 498  GLN A O   1 
ATOM   3896 C  CB  . GLN A 1 498 ? 144.373 134.381 58.185 1.00 19.53 ? 498  GLN A CB  1 
ATOM   3897 C  CG  . GLN A 1 498 ? 145.862 134.263 57.924 1.00 30.35 ? 498  GLN A CG  1 
ATOM   3898 C  CD  . GLN A 1 498 ? 146.501 133.161 58.741 1.00 28.74 ? 498  GLN A CD  1 
ATOM   3899 O  OE1 . GLN A 1 498 ? 146.077 132.013 58.679 1.00 34.30 ? 498  GLN A OE1 1 
ATOM   3900 N  NE2 . GLN A 1 498 ? 147.523 133.508 59.514 0.00 31.47 ? 498  GLN A NE2 1 
ATOM   3901 N  N   . LYS A 1 499 ? 141.592 136.771 57.622 1.00 17.82 ? 499  LYS A N   1 
ATOM   3902 C  CA  . LYS A 1 499 ? 140.142 136.804 57.723 1.00 20.30 ? 499  LYS A CA  1 
ATOM   3903 C  C   . LYS A 1 499 ? 139.512 136.206 56.478 1.00 19.38 ? 499  LYS A C   1 
ATOM   3904 O  O   . LYS A 1 499 ? 140.049 136.341 55.382 1.00 22.27 ? 499  LYS A O   1 
ATOM   3905 C  CB  . LYS A 1 499 ? 139.653 138.244 57.898 1.00 17.85 ? 499  LYS A CB  1 
ATOM   3906 C  CG  . LYS A 1 499 ? 140.278 138.951 59.084 1.00 19.26 ? 499  LYS A CG  1 
ATOM   3907 C  CD  . LYS A 1 499 ? 139.745 140.362 59.257 1.00 22.80 ? 499  LYS A CD  1 
ATOM   3908 C  CE  . LYS A 1 499 ? 140.540 141.084 60.328 1.00 23.51 ? 499  LYS A CE  1 
ATOM   3909 N  NZ  . LYS A 1 499 ? 139.991 142.424 60.622 1.00 31.86 ? 499  LYS A NZ  1 
ATOM   3910 N  N   . TYR A 1 500 ? 138.382 135.529 56.663 1.00 21.75 ? 500  TYR A N   1 
ATOM   3911 C  CA  . TYR A 1 500 ? 137.641 134.936 55.559 1.00 20.60 ? 500  TYR A CA  1 
ATOM   3912 C  C   . TYR A 1 500 ? 136.151 135.094 55.823 1.00 21.28 ? 500  TYR A C   1 
ATOM   3913 O  O   . TYR A 1 500 ? 135.734 135.323 56.954 1.00 18.52 ? 500  TYR A O   1 
ATOM   3914 C  CB  . TYR A 1 500 ? 137.977 133.455 55.385 1.00 17.61 ? 500  TYR A CB  1 
ATOM   3915 C  CG  . TYR A 1 500 ? 137.607 132.572 56.555 1.00 19.25 ? 500  TYR A CG  1 
ATOM   3916 C  CD1 . TYR A 1 500 ? 138.457 132.446 57.656 1.00 18.92 ? 500  TYR A CD1 1 
ATOM   3917 C  CD2 . TYR A 1 500 ? 136.420 131.839 56.552 1.00 11.26 ? 500  TYR A CD2 1 
ATOM   3918 C  CE1 . TYR A 1 500 ? 138.140 131.610 58.721 1.00 12.73 ? 500  TYR A CE1 1 
ATOM   3919 C  CE2 . TYR A 1 500 ? 136.087 130.999 57.616 1.00 16.85 ? 500  TYR A CE2 1 
ATOM   3920 C  CZ  . TYR A 1 500 ? 136.952 130.892 58.696 1.00 20.23 ? 500  TYR A CZ  1 
ATOM   3921 O  OH  . TYR A 1 500 ? 136.622 130.092 59.763 1.00 18.98 ? 500  TYR A OH  1 
ATOM   3922 N  N   . LEU A 1 501 ? 135.351 134.953 54.776 1.00 21.96 ? 501  LEU A N   1 
ATOM   3923 C  CA  . LEU A 1 501 ? 133.909 135.110 54.894 1.00 22.74 ? 501  LEU A CA  1 
ATOM   3924 C  C   . LEU A 1 501 ? 133.178 133.782 54.769 1.00 22.55 ? 501  LEU A C   1 
ATOM   3925 O  O   . LEU A 1 501 ? 133.481 132.990 53.885 1.00 25.72 ? 501  LEU A O   1 
ATOM   3926 C  CB  . LEU A 1 501 ? 133.414 136.069 53.807 1.00 14.41 ? 501  LEU A CB  1 
ATOM   3927 C  CG  . LEU A 1 501 ? 131.910 136.328 53.703 1.00 25.81 ? 501  LEU A CG  1 
ATOM   3928 C  CD1 . LEU A 1 501 ? 131.440 137.048 54.952 1.00 25.58 ? 501  LEU A CD1 1 
ATOM   3929 C  CD2 . LEU A 1 501 ? 131.613 137.173 52.468 1.00 28.77 ? 501  LEU A CD2 1 
ATOM   3930 N  N   . THR A 1 502 ? 132.223 133.529 55.655 1.00 22.67 ? 502  THR A N   1 
ATOM   3931 C  CA  . THR A 1 502 ? 131.457 132.293 55.565 1.00 28.90 ? 502  THR A CA  1 
ATOM   3932 C  C   . THR A 1 502 ? 130.189 132.588 54.776 1.00 30.66 ? 502  THR A C   1 
ATOM   3933 O  O   . THR A 1 502 ? 129.557 133.637 54.962 1.00 26.21 ? 502  THR A O   1 
ATOM   3934 C  CB  . THR A 1 502 ? 131.054 131.733 56.945 1.00 27.56 ? 502  THR A CB  1 
ATOM   3935 O  OG1 . THR A 1 502 ? 130.155 132.641 57.592 1.00 31.40 ? 502  THR A OG1 1 
ATOM   3936 C  CG2 . THR A 1 502 ? 132.280 131.521 57.808 1.00 22.79 ? 502  THR A CG2 1 
ATOM   3937 N  N   . LEU A 1 503 ? 129.834 131.666 53.886 1.00 24.63 ? 503  LEU A N   1 
ATOM   3938 C  CA  . LEU A 1 503 ? 128.646 131.817 53.060 1.00 25.14 ? 503  LEU A CA  1 
ATOM   3939 C  C   . LEU A 1 503 ? 127.621 130.763 53.444 1.00 24.11 ? 503  LEU A C   1 
ATOM   3940 O  O   . LEU A 1 503 ? 127.889 129.568 53.369 1.00 27.44 ? 503  LEU A O   1 
ATOM   3941 C  CB  . LEU A 1 503 ? 129.009 131.678 51.583 1.00 24.94 ? 503  LEU A CB  1 
ATOM   3942 C  CG  . LEU A 1 503 ? 129.991 132.709 51.029 1.00 21.23 ? 503  LEU A CG  1 
ATOM   3943 C  CD1 . LEU A 1 503 ? 130.443 132.300 49.626 1.00 19.94 ? 503  LEU A CD1 1 
ATOM   3944 C  CD2 . LEU A 1 503 ? 129.323 134.072 51.013 1.00 21.53 ? 503  LEU A CD2 1 
ATOM   3945 N  N   . ASN A 1 504 ? 126.448 131.216 53.863 1.00 27.20 ? 504  ASN A N   1 
ATOM   3946 C  CA  . ASN A 1 504 ? 125.377 130.316 54.264 1.00 32.29 ? 504  ASN A CA  1 
ATOM   3947 C  C   . ASN A 1 504 ? 124.055 131.079 54.266 1.00 34.15 ? 504  ASN A C   1 
ATOM   3948 O  O   . ASN A 1 504 ? 124.034 132.278 53.989 1.00 31.45 ? 504  ASN A O   1 
ATOM   3949 C  CB  . ASN A 1 504 ? 125.680 129.749 55.650 1.00 30.11 ? 504  ASN A CB  1 
ATOM   3950 C  CG  . ASN A 1 504 ? 125.869 130.832 56.689 1.00 41.97 ? 504  ASN A CG  1 
ATOM   3951 O  OD1 . ASN A 1 504 ? 124.913 131.493 57.090 1.00 51.37 ? 504  ASN A OD1 1 
ATOM   3952 N  ND2 . ASN A 1 504 ? 127.111 131.031 57.123 1.00 43.76 ? 504  ASN A ND2 1 
ATOM   3953 N  N   . THR A 1 505 ? 122.955 130.389 54.570 1.00 38.04 ? 505  THR A N   1 
ATOM   3954 C  CA  . THR A 1 505 ? 121.642 131.033 54.588 1.00 40.16 ? 505  THR A CA  1 
ATOM   3955 C  C   . THR A 1 505 ? 121.362 131.731 55.908 1.00 42.11 ? 505  THR A C   1 
ATOM   3956 O  O   . THR A 1 505 ? 120.766 132.801 55.930 1.00 52.20 ? 505  THR A O   1 
ATOM   3957 C  CB  . THR A 1 505 ? 120.496 130.025 54.318 1.00 38.74 ? 505  THR A CB  1 
ATOM   3958 O  OG1 . THR A 1 505 ? 120.580 128.941 55.249 1.00 40.62 ? 505  THR A OG1 1 
ATOM   3959 C  CG2 . THR A 1 505 ? 120.577 129.486 52.898 1.00 32.50 ? 505  THR A CG2 1 
ATOM   3960 N  N   . GLU A 1 506 ? 121.793 131.119 57.004 1.00 46.92 ? 506  GLU A N   1 
ATOM   3961 C  CA  . GLU A 1 506 ? 121.590 131.678 58.335 1.00 47.69 ? 506  GLU A CA  1 
ATOM   3962 C  C   . GLU A 1 506 ? 122.119 133.104 58.419 1.00 49.41 ? 506  GLU A C   1 
ATOM   3963 O  O   . GLU A 1 506 ? 121.368 134.072 58.279 0.00 49.43 ? 506  GLU A O   1 
ATOM   3964 C  CB  . GLU A 1 506 ? 122.307 130.812 59.370 1.00 54.01 ? 506  GLU A CB  1 
ATOM   3965 C  CG  . GLU A 1 506 ? 121.855 129.358 59.384 1.00 56.41 ? 506  GLU A CG  1 
ATOM   3966 C  CD  . GLU A 1 506 ? 122.763 128.472 60.213 0.00 55.35 ? 506  GLU A CD  1 
ATOM   3967 O  OE1 . GLU A 1 506 ? 122.951 128.764 61.413 0.00 55.38 ? 506  GLU A OE1 1 
ATOM   3968 O  OE2 . GLU A 1 506 ? 123.287 127.481 59.663 0.00 55.38 ? 506  GLU A OE2 1 
ATOM   3969 N  N   . SER A 1 507 ? 123.422 133.219 58.649 1.00 49.83 ? 507  SER A N   1 
ATOM   3970 C  CA  . SER A 1 507 ? 124.068 134.517 58.764 1.00 50.67 ? 507  SER A CA  1 
ATOM   3971 C  C   . SER A 1 507 ? 125.535 134.452 58.321 1.00 49.01 ? 507  SER A C   1 
ATOM   3972 O  O   . SER A 1 507 ? 126.278 133.568 58.744 1.00 45.11 ? 507  SER A O   1 
ATOM   3973 C  CB  . SER A 1 507 ? 123.971 135.007 60.214 0.00 50.71 ? 507  SER A CB  1 
ATOM   3974 O  OG  . SER A 1 507 ? 124.695 134.169 61.101 0.00 51.48 ? 507  SER A OG  1 
ATOM   3975 N  N   . THR A 1 508 ? 125.940 135.386 57.462 1.00 43.26 ? 508  THR A N   1 
ATOM   3976 C  CA  . THR A 1 508 ? 127.312 135.433 56.961 1.00 42.12 ? 508  THR A CA  1 
ATOM   3977 C  C   . THR A 1 508 ? 128.217 136.033 58.028 1.00 38.47 ? 508  THR A C   1 
ATOM   3978 O  O   . THR A 1 508 ? 127.877 137.036 58.651 1.00 39.99 ? 508  THR A O   1 
ATOM   3979 C  CB  . THR A 1 508 ? 127.424 136.296 55.697 1.00 37.32 ? 508  THR A CB  1 
ATOM   3980 O  OG1 . THR A 1 508 ? 127.935 137.586 56.042 1.00 43.90 ? 508  THR A OG1 1 
ATOM   3981 C  CG2 . THR A 1 508 ? 126.063 136.471 55.063 1.00 46.46 ? 508  THR A CG2 1 
ATOM   3982 N  N   . ARG A 1 509 ? 129.381 135.433 58.226 1.00 34.69 ? 509  ARG A N   1 
ATOM   3983 C  CA  . ARG A 1 509 ? 130.277 135.927 59.246 1.00 32.71 ? 509  ARG A CA  1 
ATOM   3984 C  C   . ARG A 1 509 ? 131.704 136.123 58.787 1.00 33.22 ? 509  ARG A C   1 
ATOM   3985 O  O   . ARG A 1 509 ? 132.128 135.588 57.759 1.00 28.86 ? 509  ARG A O   1 
ATOM   3986 C  CB  . ARG A 1 509 ? 130.270 134.967 60.429 1.00 33.79 ? 509  ARG A CB  1 
ATOM   3987 C  CG  . ARG A 1 509 ? 128.936 134.836 61.116 1.00 45.29 ? 509  ARG A CG  1 
ATOM   3988 C  CD  . ARG A 1 509 ? 128.947 133.589 61.980 1.00 60.19 ? 509  ARG A CD  1 
ATOM   3989 N  NE  . ARG A 1 509 ? 127.764 133.453 62.830 1.00 75.97 ? 509  ARG A NE  1 
ATOM   3990 C  CZ  . ARG A 1 509 ? 127.339 134.367 63.699 1.00 77.37 ? 509  ARG A CZ  1 
ATOM   3991 N  NH1 . ARG A 1 509 ? 128.003 135.506 63.852 1.00 75.05 ? 509  ARG A NH1 1 
ATOM   3992 N  NH2 . ARG A 1 509 ? 126.237 134.143 64.406 1.00 81.75 ? 509  ARG A NH2 1 
ATOM   3993 N  N   . ILE A 1 510 ? 132.429 136.916 59.568 1.00 27.97 ? 510  ILE A N   1 
ATOM   3994 C  CA  . ILE A 1 510 ? 133.833 137.175 59.324 1.00 26.37 ? 510  ILE A CA  1 
ATOM   3995 C  C   . ILE A 1 510 ? 134.559 136.349 60.382 1.00 27.11 ? 510  ILE A C   1 
ATOM   3996 O  O   . ILE A 1 510 ? 134.416 136.595 61.580 1.00 25.83 ? 510  ILE A O   1 
ATOM   3997 C  CB  . ILE A 1 510 ? 134.196 138.666 59.513 1.00 25.57 ? 510  ILE A CB  1 
ATOM   3998 C  CG1 . ILE A 1 510 ? 133.403 139.531 58.535 1.00 30.47 ? 510  ILE A CG1 1 
ATOM   3999 C  CG2 . ILE A 1 510 ? 135.688 138.865 59.294 1.00 23.75 ? 510  ILE A CG2 1 
ATOM   4000 C  CD1 . ILE A 1 510 ? 133.512 139.080 57.102 1.00 33.72 ? 510  ILE A CD1 1 
ATOM   4001 N  N   A MET A 1 511 ? 135.322 135.361 59.930 0.50 23.97 ? 511  MET A N   1 
ATOM   4002 N  N   B MET A 1 511 ? 135.322 135.360 59.931 0.50 23.80 ? 511  MET A N   1 
ATOM   4003 C  CA  A MET A 1 511 ? 136.073 134.497 60.827 0.50 21.67 ? 511  MET A CA  1 
ATOM   4004 C  CA  B MET A 1 511 ? 136.074 134.497 60.827 0.50 21.19 ? 511  MET A CA  1 
ATOM   4005 C  C   A MET A 1 511 ? 137.555 134.609 60.496 0.50 19.05 ? 511  MET A C   1 
ATOM   4006 C  C   B MET A 1 511 ? 137.555 134.610 60.496 0.50 18.88 ? 511  MET A C   1 
ATOM   4007 O  O   A MET A 1 511 ? 137.928 135.234 59.502 0.50 18.50 ? 511  MET A O   1 
ATOM   4008 O  O   B MET A 1 511 ? 137.929 135.234 59.501 0.50 18.45 ? 511  MET A O   1 
ATOM   4009 C  CB  A MET A 1 511 ? 135.614 133.047 60.660 0.50 28.33 ? 511  MET A CB  1 
ATOM   4010 C  CB  B MET A 1 511 ? 135.616 133.049 60.659 0.50 26.70 ? 511  MET A CB  1 
ATOM   4011 C  CG  A MET A 1 511 ? 134.111 132.848 60.773 0.50 33.81 ? 511  MET A CG  1 
ATOM   4012 C  CG  B MET A 1 511 ? 134.162 132.823 61.013 0.50 29.83 ? 511  MET A CG  1 
ATOM   4013 S  SD  A MET A 1 511 ? 133.664 131.601 62.003 0.50 46.94 ? 511  MET A SD  1 
ATOM   4014 S  SD  B MET A 1 511 ? 133.880 133.104 62.764 0.50 37.15 ? 511  MET A SD  1 
ATOM   4015 C  CE  A MET A 1 511 ? 133.649 132.668 63.499 0.50 47.86 ? 511  MET A CE  1 
ATOM   4016 C  CE  B MET A 1 511 ? 134.361 131.403 63.445 0.50 32.83 ? 511  MET A CE  1 
ATOM   4017 N  N   . THR A 1 512 ? 138.398 134.006 61.325 1.00 14.42 ? 512  THR A N   1 
ATOM   4018 C  CA  . THR A 1 512 ? 139.839 134.054 61.093 1.00 18.58 ? 512  THR A CA  1 
ATOM   4019 C  C   . THR A 1 512 ? 140.548 132.719 61.279 1.00 18.73 ? 512  THR A C   1 
ATOM   4020 O  O   . THR A 1 512 ? 140.116 131.870 62.055 1.00 17.05 ? 512  THR A O   1 
ATOM   4021 C  CB  . THR A 1 512 ? 140.539 135.079 62.022 1.00 25.58 ? 512  THR A CB  1 
ATOM   4022 O  OG1 . THR A 1 512 ? 140.242 134.765 63.389 1.00 26.10 ? 512  THR A OG1 1 
ATOM   4023 C  CG2 . THR A 1 512 ? 140.075 136.503 61.711 1.00 22.63 ? 512  THR A CG2 1 
ATOM   4024 N  N   . LYS A 1 513 ? 141.637 132.553 60.537 1.00 17.24 ? 513  LYS A N   1 
ATOM   4025 C  CA  . LYS A 1 513 ? 142.483 131.374 60.605 1.00 20.06 ? 513  LYS A CA  1 
ATOM   4026 C  C   . LYS A 1 513 ? 141.789 130.025 60.463 1.00 23.08 ? 513  LYS A C   1 
ATOM   4027 O  O   . LYS A 1 513 ? 141.865 129.173 61.345 1.00 22.35 ? 513  LYS A O   1 
ATOM   4028 C  CB  . LYS A 1 513 ? 143.298 131.441 61.900 1.00 24.53 ? 513  LYS A CB  1 
ATOM   4029 C  CG  . LYS A 1 513 ? 144.138 132.715 61.969 1.00 27.25 ? 513  LYS A CG  1 
ATOM   4030 C  CD  . LYS A 1 513 ? 144.921 132.836 63.250 1.00 37.44 ? 513  LYS A CD  1 
ATOM   4031 C  CE  . LYS A 1 513 ? 145.780 134.097 63.238 1.00 39.16 ? 513  LYS A CE  1 
ATOM   4032 N  NZ  . LYS A 1 513 ? 146.574 134.250 64.494 1.00 47.23 ? 513  LYS A NZ  1 
ATOM   4033 N  N   . LEU A 1 514 ? 141.126 129.838 59.327 1.00 22.39 ? 514  LEU A N   1 
ATOM   4034 C  CA  . LEU A 1 514 ? 140.421 128.599 59.022 1.00 20.68 ? 514  LEU A CA  1 
ATOM   4035 C  C   . LEU A 1 514 ? 141.337 127.369 59.113 1.00 21.36 ? 514  LEU A C   1 
ATOM   4036 O  O   . LEU A 1 514 ? 142.400 127.342 58.501 1.00 18.72 ? 514  LEU A O   1 
ATOM   4037 C  CB  . LEU A 1 514 ? 139.843 128.691 57.613 1.00 16.69 ? 514  LEU A CB  1 
ATOM   4038 C  CG  . LEU A 1 514 ? 139.121 127.459 57.067 1.00 22.05 ? 514  LEU A CG  1 
ATOM   4039 C  CD1 . LEU A 1 514 ? 137.830 127.263 57.832 1.00 19.85 ? 514  LEU A CD1 1 
ATOM   4040 C  CD2 . LEU A 1 514 ? 138.839 127.638 55.572 1.00 15.54 ? 514  LEU A CD2 1 
ATOM   4041 N  N   . ARG A 1 515 ? 140.917 126.360 59.876 1.00 20.40 ? 515  ARG A N   1 
ATOM   4042 C  CA  . ARG A 1 515 ? 141.679 125.115 60.027 1.00 24.07 ? 515  ARG A CA  1 
ATOM   4043 C  C   . ARG A 1 515 ? 143.132 125.336 60.428 1.00 22.60 ? 515  ARG A C   1 
ATOM   4044 O  O   . ARG A 1 515 ? 144.017 124.624 59.960 1.00 23.32 ? 515  ARG A O   1 
ATOM   4045 C  CB  . ARG A 1 515 ? 141.652 124.315 58.720 1.00 24.64 ? 515  ARG A CB  1 
ATOM   4046 C  CG  . ARG A 1 515 ? 140.270 123.918 58.226 1.00 24.97 ? 515  ARG A CG  1 
ATOM   4047 C  CD  . ARG A 1 515 ? 139.787 122.601 58.821 1.00 31.13 ? 515  ARG A CD  1 
ATOM   4048 N  NE  . ARG A 1 515 ? 138.675 122.048 58.049 1.00 30.95 ? 515  ARG A NE  1 
ATOM   4049 C  CZ  . ARG A 1 515 ? 137.476 122.619 57.944 1.00 41.15 ? 515  ARG A CZ  1 
ATOM   4050 N  NH1 . ARG A 1 515 ? 136.520 122.049 57.214 1.00 31.34 ? 515  ARG A NH1 1 
ATOM   4051 N  NH2 . ARG A 1 515 ? 137.226 123.756 58.582 1.00 37.63 ? 515  ARG A NH2 1 
ATOM   4052 N  N   . ALA A 1 516 ? 143.369 126.313 61.301 1.00 26.47 ? 516  ALA A N   1 
ATOM   4053 C  CA  . ALA A 1 516 ? 144.715 126.647 61.763 1.00 25.63 ? 516  ALA A CA  1 
ATOM   4054 C  C   . ALA A 1 516 ? 145.563 125.445 62.192 1.00 27.16 ? 516  ALA A C   1 
ATOM   4055 O  O   . ALA A 1 516 ? 146.685 125.275 61.719 1.00 23.57 ? 516  ALA A O   1 
ATOM   4056 C  CB  . ALA A 1 516 ? 144.630 127.640 62.898 1.00 20.23 ? 516  ALA A CB  1 
ATOM   4057 N  N   . GLN A 1 517 ? 145.038 124.614 63.087 1.00 29.69 ? 517  GLN A N   1 
ATOM   4058 C  CA  . GLN A 1 517 ? 145.793 123.451 63.548 1.00 33.22 ? 517  GLN A CA  1 
ATOM   4059 C  C   . GLN A 1 517 ? 145.996 122.394 62.467 1.00 29.45 ? 517  GLN A C   1 
ATOM   4060 O  O   . GLN A 1 517 ? 147.089 121.845 62.333 1.00 32.55 ? 517  GLN A O   1 
ATOM   4061 C  CB  . GLN A 1 517 ? 145.111 122.796 64.757 1.00 40.92 ? 517  GLN A CB  1 
ATOM   4062 C  CG  . GLN A 1 517 ? 145.067 123.655 66.017 1.00 54.39 ? 517  GLN A CG  1 
ATOM   4063 C  CD  . GLN A 1 517 ? 144.802 122.837 67.273 1.00 63.35 ? 517  GLN A CD  1 
ATOM   4064 O  OE1 . GLN A 1 517 ? 145.720 122.250 67.852 1.00 68.92 ? 517  GLN A OE1 1 
ATOM   4065 N  NE2 . GLN A 1 517 ? 143.540 122.780 67.690 1.00 64.69 ? 517  GLN A NE2 1 
ATOM   4066 N  N   . GLN A 1 518 ? 144.951 122.114 61.694 1.00 24.94 ? 518  GLN A N   1 
ATOM   4067 C  CA  . GLN A 1 518 ? 145.036 121.095 60.655 1.00 26.19 ? 518  GLN A CA  1 
ATOM   4068 C  C   . GLN A 1 518 ? 145.968 121.456 59.519 1.00 26.51 ? 518  GLN A C   1 
ATOM   4069 O  O   . GLN A 1 518 ? 146.667 120.593 58.988 1.00 24.15 ? 518  GLN A O   1 
ATOM   4070 C  CB  . GLN A 1 518 ? 143.653 120.775 60.077 1.00 24.40 ? 518  GLN A CB  1 
ATOM   4071 C  CG  . GLN A 1 518 ? 142.663 120.288 61.107 1.00 31.60 ? 518  GLN A CG  1 
ATOM   4072 C  CD  . GLN A 1 518 ? 141.918 121.423 61.773 1.00 32.27 ? 518  GLN A CD  1 
ATOM   4073 O  OE1 . GLN A 1 518 ? 142.492 122.472 62.072 1.00 37.08 ? 518  GLN A OE1 1 
ATOM   4074 N  NE2 . GLN A 1 518 ? 140.633 121.215 62.021 1.00 37.52 ? 518  GLN A NE2 1 
ATOM   4075 N  N   . CYS A 1 519 ? 145.987 122.723 59.131 1.00 25.40 ? 519  CYS A N   1 
ATOM   4076 C  CA  . CYS A 1 519 ? 146.856 123.099 58.035 1.00 30.77 ? 519  CYS A CA  1 
ATOM   4077 C  C   . CYS A 1 519 ? 148.311 123.178 58.459 1.00 29.70 ? 519  CYS A C   1 
ATOM   4078 O  O   . CYS A 1 519 ? 149.211 122.940 57.654 1.00 35.75 ? 519  CYS A O   1 
ATOM   4079 C  CB  . CYS A 1 519 ? 146.374 124.399 57.402 1.00 35.92 ? 519  CYS A CB  1 
ATOM   4080 S  SG  . CYS A 1 519 ? 144.812 124.151 56.488 1.00 57.42 ? 519  CYS A SG  1 
ATOM   4081 N  N   . ARG A 1 520 ? 148.540 123.494 59.728 1.00 30.25 ? 520  ARG A N   1 
ATOM   4082 C  CA  . ARG A 1 520 ? 149.896 123.553 60.260 1.00 29.98 ? 520  ARG A CA  1 
ATOM   4083 C  C   . ARG A 1 520 ? 150.478 122.151 60.106 1.00 26.86 ? 520  ARG A C   1 
ATOM   4084 O  O   . ARG A 1 520 ? 151.663 121.983 59.848 1.00 25.76 ? 520  ARG A O   1 
ATOM   4085 C  CB  . ARG A 1 520 ? 149.864 123.941 61.740 1.00 35.59 ? 520  ARG A CB  1 
ATOM   4086 C  CG  . ARG A 1 520 ? 150.519 125.282 62.064 1.00 48.81 ? 520  ARG A CG  1 
ATOM   4087 C  CD  . ARG A 1 520 ? 150.114 125.793 63.430 1.00 53.32 ? 520  ARG A CD  1 
ATOM   4088 N  NE  . ARG A 1 520 ? 149.160 126.890 63.325 1.00 58.85 ? 520  ARG A NE  1 
ATOM   4089 C  CZ  . ARG A 1 520 ? 148.176 127.127 64.181 1.00 62.69 ? 520  ARG A CZ  1 
ATOM   4090 N  NH1 . ARG A 1 520 ? 147.971 126.324 65.216 1.00 52.41 ? 520  ARG A NH1 1 
ATOM   4091 N  NH2 . ARG A 1 520 ? 147.474 128.247 64.055 1.00 70.36 ? 520  ARG A NH2 1 
ATOM   4092 N  N   . PHE A 1 521 ? 149.620 121.146 60.267 1.00 28.97 ? 521  PHE A N   1 
ATOM   4093 C  CA  . PHE A 1 521 ? 150.030 119.750 60.138 1.00 25.44 ? 521  PHE A CA  1 
ATOM   4094 C  C   . PHE A 1 521 ? 150.343 119.392 58.689 1.00 23.90 ? 521  PHE A C   1 
ATOM   4095 O  O   . PHE A 1 521 ? 151.396 118.843 58.399 1.00 25.07 ? 521  PHE A O   1 
ATOM   4096 C  CB  . PHE A 1 521 ? 148.930 118.813 60.651 1.00 20.68 ? 521  PHE A CB  1 
ATOM   4097 C  CG  . PHE A 1 521 ? 149.171 117.365 60.321 1.00 21.58 ? 521  PHE A CG  1 
ATOM   4098 C  CD1 . PHE A 1 521 ? 150.120 116.627 61.018 1.00 24.35 ? 521  PHE A CD1 1 
ATOM   4099 C  CD2 . PHE A 1 521 ? 148.467 116.748 59.296 1.00 19.16 ? 521  PHE A CD2 1 
ATOM   4100 C  CE1 . PHE A 1 521 ? 150.367 115.289 60.696 1.00 29.86 ? 521  PHE A CE1 1 
ATOM   4101 C  CE2 . PHE A 1 521 ? 148.707 115.410 58.964 1.00 28.14 ? 521  PHE A CE2 1 
ATOM   4102 C  CZ  . PHE A 1 521 ? 149.658 114.678 59.666 1.00 26.50 ? 521  PHE A CZ  1 
ATOM   4103 N  N   . TRP A 1 522 ? 149.425 119.713 57.783 1.00 25.87 ? 522  TRP A N   1 
ATOM   4104 C  CA  . TRP A 1 522 ? 149.595 119.401 56.367 1.00 27.71 ? 522  TRP A CA  1 
ATOM   4105 C  C   . TRP A 1 522 ? 150.631 120.253 55.652 1.00 32.13 ? 522  TRP A C   1 
ATOM   4106 O  O   . TRP A 1 522 ? 151.329 119.777 54.760 1.00 33.82 ? 522  TRP A O   1 
ATOM   4107 C  CB  . TRP A 1 522 ? 148.255 119.532 55.633 1.00 20.64 ? 522  TRP A CB  1 
ATOM   4108 C  CG  . TRP A 1 522 ? 147.260 118.517 56.055 1.00 17.01 ? 522  TRP A CG  1 
ATOM   4109 C  CD1 . TRP A 1 522 ? 146.105 118.734 56.745 1.00 18.62 ? 522  TRP A CD1 1 
ATOM   4110 C  CD2 . TRP A 1 522 ? 147.355 117.103 55.859 1.00 16.34 ? 522  TRP A CD2 1 
ATOM   4111 N  NE1 . TRP A 1 522 ? 145.472 117.538 56.995 1.00 22.45 ? 522  TRP A NE1 1 
ATOM   4112 C  CE2 . TRP A 1 522 ? 146.221 116.520 56.463 1.00 16.00 ? 522  TRP A CE2 1 
ATOM   4113 C  CE3 . TRP A 1 522 ? 148.296 116.270 55.235 1.00 19.17 ? 522  TRP A CE3 1 
ATOM   4114 C  CZ2 . TRP A 1 522 ? 145.996 115.138 56.462 1.00 23.55 ? 522  TRP A CZ2 1 
ATOM   4115 C  CZ3 . TRP A 1 522 ? 148.076 114.894 55.234 1.00 18.02 ? 522  TRP A CZ3 1 
ATOM   4116 C  CH2 . TRP A 1 522 ? 146.933 114.343 55.846 1.00 20.97 ? 522  TRP A CH2 1 
ATOM   4117 N  N   . THR A 1 523 ? 150.737 121.513 56.047 1.00 36.81 ? 523  THR A N   1 
ATOM   4118 C  CA  . THR A 1 523 ? 151.668 122.419 55.400 1.00 35.67 ? 523  THR A CA  1 
ATOM   4119 C  C   . THR A 1 523 ? 153.093 122.403 55.949 1.00 35.71 ? 523  THR A C   1 
ATOM   4120 O  O   . THR A 1 523 ? 154.048 122.597 55.202 1.00 38.84 ? 523  THR A O   1 
ATOM   4121 C  CB  . THR A 1 523 ? 151.106 123.854 55.440 1.00 40.37 ? 523  THR A CB  1 
ATOM   4122 O  OG1 . THR A 1 523 ? 149.781 123.850 54.889 1.00 40.01 ? 523  THR A OG1 1 
ATOM   4123 C  CG2 . THR A 1 523 ? 151.981 124.805 54.629 1.00 37.31 ? 523  THR A CG2 1 
ATOM   4124 N  N   . SER A 1 524 ? 153.247 122.150 57.241 1.00 39.39 ? 524  SER A N   1 
ATOM   4125 C  CA  . SER A 1 524 ? 154.578 122.150 57.833 1.00 43.25 ? 524  SER A CA  1 
ATOM   4126 C  C   . SER A 1 524 ? 155.186 120.777 58.070 1.00 44.29 ? 524  SER A C   1 
ATOM   4127 O  O   . SER A 1 524 ? 156.284 120.494 57.598 1.00 53.24 ? 524  SER A O   1 
ATOM   4128 C  CB  . SER A 1 524 ? 154.557 122.918 59.155 1.00 49.48 ? 524  SER A CB  1 
ATOM   4129 O  OG  . SER A 1 524 ? 154.043 124.225 58.970 1.00 55.50 ? 524  SER A OG  1 
ATOM   4130 N  N   . PHE A 1 525 ? 154.476 119.927 58.802 1.00 38.35 ? 525  PHE A N   1 
ATOM   4131 C  CA  . PHE A 1 525 ? 154.977 118.597 59.121 1.00 38.95 ? 525  PHE A CA  1 
ATOM   4132 C  C   . PHE A 1 525 ? 154.943 117.560 57.996 1.00 44.50 ? 525  PHE A C   1 
ATOM   4133 O  O   . PHE A 1 525 ? 155.984 117.167 57.470 1.00 44.64 ? 525  PHE A O   1 
ATOM   4134 C  CB  . PHE A 1 525 ? 154.224 118.036 60.328 1.00 38.02 ? 525  PHE A CB  1 
ATOM   4135 C  CG  . PHE A 1 525 ? 154.504 116.585 60.589 1.00 45.90 ? 525  PHE A CG  1 
ATOM   4136 C  CD1 . PHE A 1 525 ? 153.476 115.659 60.607 0.00 49.45 ? 525  PHE A CD1 1 
ATOM   4137 C  CD2 . PHE A 1 525 ? 155.807 116.140 60.793 1.00 56.93 ? 525  PHE A CD2 1 
ATOM   4138 C  CE1 . PHE A 1 525 ? 153.736 114.312 60.821 1.00 51.03 ? 525  PHE A CE1 1 
ATOM   4139 C  CE2 . PHE A 1 525 ? 156.076 114.789 61.007 1.00 52.98 ? 525  PHE A CE2 1 
ATOM   4140 C  CZ  . PHE A 1 525 ? 155.036 113.875 61.021 0.00 53.04 ? 525  PHE A CZ  1 
ATOM   4141 N  N   . PHE A 1 526 ? 153.739 117.122 57.637 1.00 44.29 ? 526  PHE A N   1 
ATOM   4142 C  CA  . PHE A 1 526 ? 153.547 116.096 56.617 1.00 40.79 ? 526  PHE A CA  1 
ATOM   4143 C  C   . PHE A 1 526 ? 154.419 116.124 55.356 1.00 38.40 ? 526  PHE A C   1 
ATOM   4144 O  O   . PHE A 1 526 ? 154.846 115.075 54.883 1.00 39.49 ? 526  PHE A O   1 
ATOM   4145 C  CB  . PHE A 1 526 ? 152.078 116.044 56.190 1.00 36.26 ? 526  PHE A CB  1 
ATOM   4146 C  CG  . PHE A 1 526 ? 151.705 114.761 55.500 1.00 36.28 ? 526  PHE A CG  1 
ATOM   4147 C  CD1 . PHE A 1 526 ? 151.642 113.571 56.215 1.00 29.77 ? 526  PHE A CD1 1 
ATOM   4148 C  CD2 . PHE A 1 526 ? 151.441 114.733 54.134 1.00 30.19 ? 526  PHE A CD2 1 
ATOM   4149 C  CE1 . PHE A 1 526 ? 151.332 112.377 55.584 1.00 27.45 ? 526  PHE A CE1 1 
ATOM   4150 C  CE2 . PHE A 1 526 ? 151.130 113.536 53.497 1.00 26.90 ? 526  PHE A CE2 1 
ATOM   4151 C  CZ  . PHE A 1 526 ? 151.072 112.361 54.224 1.00 26.34 ? 526  PHE A CZ  1 
ATOM   4152 N  N   . PRO A 1 527 ? 154.674 117.310 54.782 1.00 37.86 ? 527  PRO A N   1 
ATOM   4153 C  CA  . PRO A 1 527 ? 155.501 117.373 53.571 1.00 39.52 ? 527  PRO A CA  1 
ATOM   4154 C  C   . PRO A 1 527 ? 156.901 116.791 53.744 1.00 44.43 ? 527  PRO A C   1 
ATOM   4155 O  O   . PRO A 1 527 ? 157.632 116.612 52.769 1.00 48.49 ? 527  PRO A O   1 
ATOM   4156 C  CB  . PRO A 1 527 ? 155.536 118.865 53.254 1.00 34.76 ? 527  PRO A CB  1 
ATOM   4157 C  CG  . PRO A 1 527 ? 154.210 119.332 53.743 1.00 41.93 ? 527  PRO A CG  1 
ATOM   4158 C  CD  . PRO A 1 527 ? 154.085 118.627 55.076 1.00 34.00 ? 527  PRO A CD  1 
ATOM   4159 N  N   . LYS A 1 528 ? 157.269 116.495 54.984 1.00 45.31 ? 528  LYS A N   1 
ATOM   4160 C  CA  . LYS A 1 528 ? 158.584 115.946 55.278 1.00 49.89 ? 528  LYS A CA  1 
ATOM   4161 C  C   . LYS A 1 528 ? 158.617 114.423 55.211 1.00 54.07 ? 528  LYS A C   1 
ATOM   4162 O  O   . LYS A 1 528 ? 159.543 113.842 54.642 1.00 56.12 ? 528  LYS A O   1 
ATOM   4163 C  CB  . LYS A 1 528 ? 159.031 116.411 56.660 1.00 45.22 ? 528  LYS A CB  1 
ATOM   4164 C  CG  . LYS A 1 528 ? 159.109 117.921 56.783 1.00 48.07 ? 528  LYS A CG  1 
ATOM   4165 C  CD  . LYS A 1 528 ? 159.297 118.354 58.228 1.00 44.54 ? 528  LYS A CD  1 
ATOM   4166 C  CE  . LYS A 1 528 ? 159.362 119.863 58.341 1.00 44.01 ? 528  LYS A CE  1 
ATOM   4167 N  NZ  . LYS A 1 528 ? 159.425 120.300 59.757 1.00 51.90 ? 528  LYS A NZ  1 
ATOM   4168 N  N   . VAL A 1 529 ? 157.605 113.777 55.784 1.00 58.48 ? 529  VAL A N   1 
ATOM   4169 C  CA  . VAL A 1 529 ? 157.538 112.317 55.796 1.00 62.29 ? 529  VAL A CA  1 
ATOM   4170 C  C   . VAL A 1 529 ? 157.637 111.710 54.391 1.00 65.56 ? 529  VAL A C   1 
ATOM   4171 O  O   . VAL A 1 529 ? 157.600 112.473 53.404 1.00 66.91 ? 529  VAL A O   1 
ATOM   4172 C  CB  . VAL A 1 529 ? 156.227 111.822 56.462 1.00 61.00 ? 529  VAL A CB  1 
ATOM   4173 C  CG1 . VAL A 1 529 ? 156.085 112.432 57.847 1.00 54.41 ? 529  VAL A CG1 1 
ATOM   4174 C  CG2 . VAL A 1 529 ? 155.028 112.174 55.595 1.00 61.22 ? 529  VAL A CG2 1 
ATOM   4175 O  OXT . VAL A 1 529 ? 157.748 110.470 54.290 1.00 70.64 ? 529  VAL A OXT 1 
HETATM 4176 C  C1  . NAG B 2 .   ? 156.153 102.556 37.519 1.00 60.31 ? 1    NAG B C1  1 
HETATM 4177 C  C2  . NAG B 2 .   ? 155.757 102.487 39.000 1.00 62.78 ? 1    NAG B C2  1 
HETATM 4178 C  C3  . NAG B 2 .   ? 156.052 101.082 39.556 1.00 66.18 ? 1    NAG B C3  1 
HETATM 4179 C  C4  . NAG B 2 .   ? 155.496 99.975  38.653 1.00 66.08 ? 1    NAG B C4  1 
HETATM 4180 C  C5  . NAG B 2 .   ? 155.909 100.214 37.197 1.00 64.07 ? 1    NAG B C5  1 
HETATM 4181 C  C6  . NAG B 2 .   ? 155.314 99.216  36.217 1.00 62.28 ? 1    NAG B C6  1 
HETATM 4182 C  C7  . NAG B 2 .   ? 155.963 104.122 40.771 0.00 62.96 ? 1    NAG B C7  1 
HETATM 4183 C  C8  . NAG B 2 .   ? 156.807 105.195 41.440 0.00 62.99 ? 1    NAG B C8  1 
HETATM 4184 N  N2  . NAG B 2 .   ? 156.516 103.473 39.750 1.00 63.47 ? 1    NAG B N2  1 
HETATM 4185 O  O3  . NAG B 2 .   ? 155.484 100.949 40.850 1.00 71.42 ? 1    NAG B O3  1 
HETATM 4186 O  O4  . NAG B 2 .   ? 156.001 98.700  39.095 1.00 66.93 ? 1    NAG B O4  1 
HETATM 4187 O  O5  . NAG B 2 .   ? 155.491 101.527 36.780 1.00 64.06 ? 1    NAG B O5  1 
HETATM 4188 O  O6  . NAG B 2 .   ? 153.883 99.175  36.366 1.00 62.96 ? 1    NAG B O6  1 
HETATM 4189 O  O7  . NAG B 2 .   ? 154.823 103.891 41.181 1.00 61.82 ? 1    NAG B O7  1 
HETATM 4190 C  C1  . NAG B 2 .   ? 155.052 97.732  39.373 1.00 70.53 ? 2    NAG B C1  1 
HETATM 4191 C  C2  . NAG B 2 .   ? 155.667 96.338  39.235 1.00 73.32 ? 2    NAG B C2  1 
HETATM 4192 C  C3  . NAG B 2 .   ? 154.621 95.278  39.596 1.00 75.36 ? 2    NAG B C3  1 
HETATM 4193 C  C4  . NAG B 2 .   ? 154.003 95.567  40.970 1.00 77.88 ? 2    NAG B C4  1 
HETATM 4194 C  C5  . NAG B 2 .   ? 153.513 97.022  41.050 1.00 78.53 ? 2    NAG B C5  1 
HETATM 4195 C  C6  . NAG B 2 .   ? 153.024 97.399  42.434 1.00 78.06 ? 2    NAG B C6  1 
HETATM 4196 C  C7  . NAG B 2 .   ? 157.412 96.313  37.571 1.00 74.59 ? 2    NAG B C7  1 
HETATM 4197 C  C8  . NAG B 2 .   ? 157.849 95.942  36.163 1.00 72.91 ? 2    NAG B C8  1 
HETATM 4198 N  N2  . NAG B 2 .   ? 156.129 96.135  37.875 1.00 75.07 ? 2    NAG B N2  1 
HETATM 4199 O  O3  . NAG B 2 .   ? 155.229 93.995  39.610 0.00 74.86 ? 2    NAG B O3  1 
HETATM 4200 O  O4  . NAG B 2 .   ? 152.911 94.687  41.194 0.00 76.73 ? 2    NAG B O4  1 
HETATM 4201 O  O5  . NAG B 2 .   ? 154.586 97.929  40.713 1.00 73.84 ? 2    NAG B O5  1 
HETATM 4202 O  O6  . NAG B 2 .   ? 151.860 96.663  42.783 0.00 77.44 ? 2    NAG B O6  1 
HETATM 4203 O  O7  . NAG B 2 .   ? 158.236 96.757  38.371 1.00 73.53 ? 2    NAG B O7  1 
HETATM 4204 C  C1  . FUC B 2 .   ? 153.337 97.981  35.880 1.00 57.53 ? 3    FUC B C1  1 
HETATM 4205 C  C2  . FUC B 2 .   ? 152.052 97.654  36.642 1.00 59.02 ? 3    FUC B C2  1 
HETATM 4206 C  C3  . FUC B 2 .   ? 150.946 98.657  36.292 1.00 59.96 ? 3    FUC B C3  1 
HETATM 4207 C  C4  . FUC B 2 .   ? 150.760 98.775  34.775 1.00 56.15 ? 3    FUC B C4  1 
HETATM 4208 C  C5  . FUC B 2 .   ? 152.106 99.020  34.074 1.00 54.58 ? 3    FUC B C5  1 
HETATM 4209 C  C6  . FUC B 2 .   ? 152.002 98.953  32.562 1.00 48.26 ? 3    FUC B C6  1 
HETATM 4210 O  O2  . FUC B 2 .   ? 152.307 97.696  38.039 0.00 59.48 ? 3    FUC B O2  1 
HETATM 4211 O  O3  . FUC B 2 .   ? 149.725 98.241  36.888 1.00 68.41 ? 3    FUC B O3  1 
HETATM 4212 O  O4  . FUC B 2 .   ? 150.152 97.597  34.268 1.00 58.21 ? 3    FUC B O4  1 
HETATM 4213 O  O5  . FUC B 2 .   ? 153.077 98.027  34.478 1.00 56.65 ? 3    FUC B O5  1 
HETATM 4214 C  C1  . NAG C 2 .   ? 127.255 100.495 54.533 1.00 37.49 ? 1    NAG C C1  1 
HETATM 4215 C  C2  . NAG C 2 .   ? 127.473 99.604  55.760 1.00 44.01 ? 1    NAG C C2  1 
HETATM 4216 C  C3  . NAG C 2 .   ? 128.819 98.871  55.675 1.00 42.78 ? 1    NAG C C3  1 
HETATM 4217 C  C4  . NAG C 2 .   ? 128.998 98.185  54.318 1.00 43.54 ? 1    NAG C C4  1 
HETATM 4218 C  C5  . NAG C 2 .   ? 128.730 99.182  53.190 1.00 41.72 ? 1    NAG C C5  1 
HETATM 4219 C  C6  . NAG C 2 .   ? 128.836 98.588  51.789 1.00 49.62 ? 1    NAG C C6  1 
HETATM 4220 C  C7  . NAG C 2 .   ? 126.685 100.069 57.991 1.00 57.11 ? 1    NAG C C7  1 
HETATM 4221 C  C8  . NAG C 2 .   ? 125.266 100.610 58.032 1.00 58.21 ? 1    NAG C C8  1 
HETATM 4222 N  N2  . NAG C 2 .   ? 127.443 100.420 56.958 1.00 53.55 ? 1    NAG C N2  1 
HETATM 4223 O  O3  . NAG C 2 .   ? 128.892 97.897  56.704 1.00 44.25 ? 1    NAG C O3  1 
HETATM 4224 O  O4  . NAG C 2 .   ? 130.345 97.697  54.207 1.00 48.52 ? 1    NAG C O4  1 
HETATM 4225 O  O5  . NAG C 2 .   ? 127.408 99.732  53.331 1.00 37.37 ? 1    NAG C O5  1 
HETATM 4226 O  O6  . NAG C 2 .   ? 128.043 97.386  51.680 1.00 52.47 ? 1    NAG C O6  1 
HETATM 4227 O  O7  . NAG C 2 .   ? 127.089 99.338  58.894 1.00 68.23 ? 1    NAG C O7  1 
HETATM 4228 C  C1  . NAG C 2 .   ? 130.502 96.337  54.023 1.00 57.91 ? 2    NAG C C1  1 
HETATM 4229 C  C2  . NAG C 2 .   ? 131.821 96.083  53.294 1.00 61.56 ? 2    NAG C C2  1 
HETATM 4230 C  C3  . NAG C 2 .   ? 132.078 94.580  53.182 1.00 65.46 ? 2    NAG C C3  1 
HETATM 4231 C  C4  . NAG C 2 .   ? 132.009 93.927  54.567 1.00 66.11 ? 2    NAG C C4  1 
HETATM 4232 C  C5  . NAG C 2 .   ? 130.681 94.282  55.247 0.00 65.24 ? 2    NAG C C5  1 
HETATM 4233 C  C6  . NAG C 2 .   ? 130.598 93.752  56.665 1.00 66.62 ? 2    NAG C C6  1 
HETATM 4234 C  C7  . NAG C 2 .   ? 132.449 97.797  51.725 1.00 65.33 ? 2    NAG C C7  1 
HETATM 4235 C  C8  . NAG C 2 .   ? 133.783 97.656  51.009 1.00 67.21 ? 2    NAG C C8  1 
HETATM 4236 N  N2  . NAG C 2 .   ? 131.772 96.680  51.973 1.00 65.89 ? 2    NAG C N2  1 
HETATM 4237 O  O3  . NAG C 2 .   ? 133.359 94.358  52.611 1.00 65.07 ? 2    NAG C O3  1 
HETATM 4238 O  O4  . NAG C 2 .   ? 132.119 92.517  54.436 0.00 65.57 ? 2    NAG C O4  1 
HETATM 4239 O  O5  . NAG C 2 .   ? 130.521 95.717  55.317 1.00 67.28 ? 2    NAG C O5  1 
HETATM 4240 O  O6  . NAG C 2 .   ? 131.021 94.727  57.608 0.00 65.62 ? 2    NAG C O6  1 
HETATM 4241 O  O7  . NAG C 2 .   ? 132.043 98.912  52.053 0.00 66.30 ? 2    NAG C O7  1 
HETATM 4242 C  C1  . FUC C 2 .   ? 127.319 97.340  50.478 1.00 53.40 ? 3    FUC C C1  1 
HETATM 4243 C  C2  . FUC C 2 .   ? 126.749 95.935  50.257 0.00 56.17 ? 3    FUC C C2  1 
HETATM 4244 C  C3  . FUC C 2 .   ? 125.612 95.639  51.245 1.00 56.33 ? 3    FUC C C3  1 
HETATM 4245 C  C4  . FUC C 2 .   ? 124.557 96.752  51.207 1.00 56.88 ? 3    FUC C C4  1 
HETATM 4246 C  C5  . FUC C 2 .   ? 125.235 98.111  51.421 1.00 55.23 ? 3    FUC C C5  1 
HETATM 4247 C  C6  . FUC C 2 .   ? 124.287 99.292  51.318 1.00 48.80 ? 3    FUC C C6  1 
HETATM 4248 O  O2  . FUC C 2 .   ? 127.782 94.978  50.417 1.00 56.18 ? 3    FUC C O2  1 
HETATM 4249 O  O3  . FUC C 2 .   ? 125.006 94.400  50.908 1.00 65.72 ? 3    FUC C O3  1 
HETATM 4250 O  O4  . FUC C 2 .   ? 123.890 96.734  49.950 1.00 52.55 ? 3    FUC C O4  1 
HETATM 4251 O  O5  . FUC C 2 .   ? 126.270 98.305  50.432 1.00 54.57 ? 3    FUC C O5  1 
HETATM 4252 C  C1  . NAG D 3 .   ? 135.969 149.035 27.271 1.00 64.73 ? 536  NAG A C1  1 
HETATM 4253 C  C2  . NAG D 3 .   ? 136.131 150.056 26.139 1.00 67.59 ? 536  NAG A C2  1 
HETATM 4254 C  C3  . NAG D 3 .   ? 137.607 150.440 25.945 1.00 68.26 ? 536  NAG A C3  1 
HETATM 4255 C  C4  . NAG D 3 .   ? 138.276 150.827 27.272 1.00 70.85 ? 536  NAG A C4  1 
HETATM 4256 C  C5  . NAG D 3 .   ? 138.020 149.726 28.304 1.00 69.39 ? 536  NAG A C5  1 
HETATM 4257 C  C6  . NAG D 3 .   ? 138.568 150.090 29.679 1.00 71.35 ? 536  NAG A C6  1 
HETATM 4258 C  C7  . NAG D 3 .   ? 134.709 150.222 24.180 1.00 61.32 ? 536  NAG A C7  1 
HETATM 4259 C  C8  . NAG D 3 .   ? 133.384 150.519 24.867 1.00 57.55 ? 536  NAG A C8  1 
HETATM 4260 N  N2  . NAG D 3 .   ? 135.611 149.536 24.881 1.00 65.05 ? 536  NAG A N2  1 
HETATM 4261 O  O3  . NAG D 3 .   ? 137.683 151.534 25.045 1.00 67.89 ? 536  NAG A O3  1 
HETATM 4262 O  O4  . NAG D 3 .   ? 139.680 150.986 27.093 1.00 66.61 ? 536  NAG A O4  1 
HETATM 4263 O  O5  . NAG D 3 .   ? 136.599 149.519 28.469 1.00 68.29 ? 536  NAG A O5  1 
HETATM 4264 O  O6  . NAG D 3 .   ? 138.229 149.101 30.649 1.00 60.42 ? 536  NAG A O6  1 
HETATM 4265 O  O7  . NAG D 3 .   ? 134.893 150.580 23.016 1.00 66.91 ? 536  NAG A O7  1 
HETATM 4266 C  C1  . NAG E 3 .   ? 122.012 126.999 9.954  1.00 74.21 ? 537  NAG A C1  1 
HETATM 4267 C  C2  . NAG E 3 .   ? 122.076 126.041 8.781  1.00 74.18 ? 537  NAG A C2  1 
HETATM 4268 C  C3  . NAG E 3 .   ? 121.223 126.588 7.627  1.00 73.89 ? 537  NAG A C3  1 
HETATM 4269 C  C4  . NAG E 3 .   ? 119.788 126.908 8.079  0.00 75.50 ? 537  NAG A C4  1 
HETATM 4270 C  C5  . NAG E 3 .   ? 119.797 127.766 9.370  1.00 76.74 ? 537  NAG A C5  1 
HETATM 4271 C  C6  . NAG E 3 .   ? 118.403 127.829 9.989  1.00 76.09 ? 537  NAG A C6  1 
HETATM 4272 C  C7  . NAG E 3 .   ? 123.865 124.644 8.018  1.00 70.45 ? 537  NAG A C7  1 
HETATM 4273 C  C8  . NAG E 3 .   ? 125.249 124.584 7.413  0.00 70.10 ? 537  NAG A C8  1 
HETATM 4274 N  N2  . NAG E 3 .   ? 123.447 125.855 8.353  1.00 72.59 ? 537  NAG A N2  1 
HETATM 4275 O  O3  . NAG E 3 .   ? 121.191 125.664 6.547  0.00 73.32 ? 537  NAG A O3  1 
HETATM 4276 O  O4  . NAG E 3 .   ? 119.113 127.596 7.033  1.00 77.30 ? 537  NAG A O4  1 
HETATM 4277 O  O5  . NAG E 3 .   ? 120.653 127.151 10.370 1.00 79.54 ? 537  NAG A O5  1 
HETATM 4278 O  O6  . NAG E 3 .   ? 117.421 128.247 9.054  1.00 83.58 ? 537  NAG A O6  1 
HETATM 4279 O  O7  . NAG E 3 .   ? 123.184 123.617 8.168  1.00 76.18 ? 537  NAG A O7  1 
HETATM 4280 C  C1  . NAG F 3 .   ? 118.470 142.887 47.779 1.00 61.99 ? 538  NAG A C1  1 
HETATM 4281 C  C2  . NAG F 3 .   ? 118.660 141.683 46.849 1.00 65.38 ? 538  NAG A C2  1 
HETATM 4282 C  C3  . NAG F 3 .   ? 117.401 141.350 46.022 1.00 64.79 ? 538  NAG A C3  1 
HETATM 4283 C  C4  . NAG F 3 .   ? 116.142 141.415 46.875 0.00 63.94 ? 538  NAG A C4  1 
HETATM 4284 C  C5  . NAG F 3 .   ? 116.117 142.756 47.581 1.00 65.17 ? 538  NAG A C5  1 
HETATM 4285 C  C6  . NAG F 3 .   ? 114.844 142.977 48.396 0.00 64.16 ? 538  NAG A C6  1 
HETATM 4286 C  C7  . NAG F 3 .   ? 120.900 141.324 46.012 1.00 61.64 ? 538  NAG A C7  1 
HETATM 4287 C  C8  . NAG F 3 .   ? 121.980 141.745 45.030 1.00 53.24 ? 538  NAG A C8  1 
HETATM 4288 N  N2  . NAG F 3 .   ? 119.745 141.977 45.932 1.00 59.66 ? 538  NAG A N2  1 
HETATM 4289 O  O3  . NAG F 3 .   ? 117.521 140.044 45.480 0.00 62.09 ? 538  NAG A O3  1 
HETATM 4290 O  O4  . NAG F 3 .   ? 114.983 141.270 46.065 1.00 69.89 ? 538  NAG A O4  1 
HETATM 4291 O  O5  . NAG F 3 .   ? 117.232 142.831 48.470 0.00 62.68 ? 538  NAG A O5  1 
HETATM 4292 O  O6  . NAG F 3 .   ? 115.064 142.931 49.806 1.00 72.21 ? 538  NAG A O6  1 
HETATM 4293 O  O7  . NAG F 3 .   ? 121.116 140.418 46.825 1.00 58.23 ? 538  NAG A O7  1 
HETATM 4294 S  S   . SO4 G 4 .   ? 145.425 145.276 44.671 1.00 63.91 ? 603  SO4 A S   1 
HETATM 4295 O  O1  . SO4 G 4 .   ? 145.526 143.831 44.408 1.00 55.19 ? 603  SO4 A O1  1 
HETATM 4296 O  O2  . SO4 G 4 .   ? 146.651 145.508 45.458 1.00 57.58 ? 603  SO4 A O2  1 
HETATM 4297 O  O3  . SO4 G 4 .   ? 144.380 145.676 45.620 1.00 61.00 ? 603  SO4 A O3  1 
HETATM 4298 O  O4  . SO4 G 4 .   ? 145.415 146.204 43.519 1.00 56.94 ? 603  SO4 A O4  1 
HETATM 4299 CL CL  . CL  H 5 .   ? 124.607 139.166 55.574 1.00 51.78 ? 701  CL  A CL  1 
HETATM 4300 CL CL  . CL  I 5 .   ? 154.925 104.630 63.959 0.50 27.95 ? 702  CL  A CL  1 
HETATM 4301 P  P1  . VXA J 6 .   ? 138.550 118.135 41.062 1.00 22.96 ? 601  VXA A P1  1 
HETATM 4302 O  O1  . VXA J 6 .   ? 138.681 118.365 39.479 1.00 16.19 ? 601  VXA A O1  1 
HETATM 4303 O  O2  . VXA J 6 .   ? 137.311 117.394 41.425 1.00 16.96 ? 601  VXA A O2  1 
HETATM 4304 C  C1  . VXA J 6 .   ? 139.996 117.302 41.569 1.00 14.38 ? 601  VXA A C1  1 
HETATM 4305 C  C21 . BCH K 7 .   ? 134.929 111.359 42.219 1.00 57.32 ? 604  BCH A C21 1 
HETATM 4306 C  C20 . BCH K 7 .   ? 134.535 112.001 43.558 1.00 59.07 ? 604  BCH A C20 1 
HETATM 4307 C  C19 . BCH K 7 .   ? 133.239 112.824 43.442 1.00 60.13 ? 604  BCH A C19 1 
HETATM 4308 C  C18 . BCH K 7 .   ? 133.359 114.016 42.469 1.00 64.78 ? 604  BCH A C18 1 
HETATM 4309 O  O12 . BCH K 7 .   ? 133.948 115.058 42.799 1.00 66.36 ? 604  BCH A O12 1 
HETATM 4310 S  S17 . BCH K 7 .   ? 132.553 113.849 40.818 1.00 63.44 ? 604  BCH A S17 1 
HETATM 4311 C  C16 . BCH K 7 .   ? 132.960 115.407 39.867 1.00 59.91 ? 604  BCH A C16 1 
HETATM 4312 C  C15 . BCH K 7 .   ? 132.918 116.834 40.568 1.00 53.96 ? 604  BCH A C15 1 
HETATM 4313 N  N14 . BCH K 7 .   ? 133.348 118.020 39.729 1.00 53.43 ? 604  BCH A N14 1 
HETATM 4314 C  C13 . BCH K 7 .   ? 133.300 117.766 38.236 1.00 49.69 ? 604  BCH A C13 1 
HETATM 4315 C  C22 . BCH K 7 .   ? 134.727 118.411 40.086 1.00 51.00 ? 604  BCH A C22 1 
HETATM 4316 C  C11 . BCH K 7 .   ? 132.438 119.105 40.039 1.00 47.67 ? 604  BCH A C11 1 
HETATM 4317 C  C1  . GOL L 8 .   ? 121.877 126.774 27.177 1.00 42.37 ? 602  GOL A C1  1 
HETATM 4318 O  O1  . GOL L 8 .   ? 122.054 128.052 27.760 1.00 38.87 ? 602  GOL A O1  1 
HETATM 4319 C  C2  . GOL L 8 .   ? 120.396 126.572 26.855 1.00 43.71 ? 602  GOL A C2  1 
HETATM 4320 O  O2  . GOL L 8 .   ? 119.664 126.265 28.049 1.00 49.51 ? 602  GOL A O2  1 
HETATM 4321 C  C3  . GOL L 8 .   ? 120.224 125.461 25.817 1.00 46.41 ? 602  GOL A C3  1 
HETATM 4322 O  O3  . GOL L 8 .   ? 120.682 124.222 26.334 1.00 51.86 ? 602  GOL A O3  1 
HETATM 4323 O  O   . HOH M 9 .   ? 119.063 135.219 11.366 1.00 54.61 ? 703  HOH A O   1 
HETATM 4324 O  O   . HOH M 9 .   ? 140.635 134.032 16.268 1.00 34.18 ? 704  HOH A O   1 
HETATM 4325 O  O   . HOH M 9 .   ? 142.418 132.755 18.481 1.00 37.72 ? 705  HOH A O   1 
HETATM 4326 O  O   . HOH M 9 .   ? 114.213 129.171 25.384 1.00 55.66 ? 706  HOH A O   1 
HETATM 4327 O  O   . HOH M 9 .   ? 122.306 122.042 23.266 1.00 44.52 ? 707  HOH A O   1 
HETATM 4328 O  O   . HOH M 9 .   ? 127.795 123.639 17.351 1.00 55.71 ? 708  HOH A O   1 
HETATM 4329 O  O   . HOH M 9 .   ? 129.678 123.601 22.991 1.00 28.51 ? 709  HOH A O   1 
HETATM 4330 O  O   . HOH M 9 .   ? 144.679 121.635 16.635 1.00 31.33 ? 710  HOH A O   1 
HETATM 4331 O  O   . HOH M 9 .   ? 146.646 119.589 18.018 1.00 36.50 ? 711  HOH A O   1 
HETATM 4332 O  O   . HOH M 9 .   ? 141.683 118.577 12.117 1.00 45.16 ? 712  HOH A O   1 
HETATM 4333 O  O   . HOH M 9 .   ? 140.840 115.457 21.430 1.00 29.28 ? 713  HOH A O   1 
HETATM 4334 O  O   . HOH M 9 .   ? 142.974 114.209 20.027 1.00 23.79 ? 714  HOH A O   1 
HETATM 4335 O  O   . HOH M 9 .   ? 145.235 115.027 21.715 1.00 23.67 ? 715  HOH A O   1 
HETATM 4336 O  O   . HOH M 9 .   ? 142.737 110.938 15.916 1.00 40.04 ? 716  HOH A O   1 
HETATM 4337 O  O   . HOH M 9 .   ? 150.257 109.721 12.173 1.00 53.52 ? 717  HOH A O   1 
HETATM 4338 O  O   . HOH M 9 .   ? 155.289 122.651 24.185 1.00 32.80 ? 718  HOH A O   1 
HETATM 4339 O  O   . HOH M 9 .   ? 130.719 119.069 17.370 1.00 50.37 ? 719  HOH A O   1 
HETATM 4340 O  O   . HOH M 9 .   ? 134.805 118.212 27.068 1.00 31.34 ? 720  HOH A O   1 
HETATM 4341 O  O   . HOH M 9 .   ? 130.224 120.104 24.975 1.00 32.95 ? 721  HOH A O   1 
HETATM 4342 O  O   . HOH M 9 .   ? 133.366 111.662 32.629 1.00 29.75 ? 722  HOH A O   1 
HETATM 4343 O  O   . HOH M 9 .   ? 127.693 106.892 38.431 1.00 40.77 ? 723  HOH A O   1 
HETATM 4344 O  O   . HOH M 9 .   ? 126.188 106.084 35.728 1.00 45.70 ? 724  HOH A O   1 
HETATM 4345 O  O   . HOH M 9 .   ? 125.294 107.086 31.978 0.50 54.86 ? 725  HOH A O   1 
HETATM 4346 O  O   . HOH M 9 .   ? 123.070 102.586 41.421 1.00 36.05 ? 726  HOH A O   1 
HETATM 4347 O  O   . HOH M 9 .   ? 120.627 110.238 36.758 1.00 40.35 ? 727  HOH A O   1 
HETATM 4348 O  O   . HOH M 9 .   ? 120.509 117.478 34.641 1.00 48.95 ? 728  HOH A O   1 
HETATM 4349 O  O   . HOH M 9 .   ? 121.517 119.506 39.332 1.00 34.71 ? 729  HOH A O   1 
HETATM 4350 O  O   . HOH M 9 .   ? 122.290 119.188 42.495 1.00 38.34 ? 730  HOH A O   1 
HETATM 4351 O  O   . HOH M 9 .   ? 132.139 116.606 35.287 1.00 16.98 ? 731  HOH A O   1 
HETATM 4352 O  O   . HOH M 9 .   ? 133.122 119.333 34.838 1.00 16.26 ? 732  HOH A O   1 
HETATM 4353 O  O   . HOH M 9 .   ? 124.644 113.455 18.289 1.00 48.23 ? 733  HOH A O   1 
HETATM 4354 O  O   . HOH M 9 .   ? 132.120 111.157 17.810 1.00 50.57 ? 734  HOH A O   1 
HETATM 4355 O  O   . HOH M 9 .   ? 136.648 111.347 17.618 1.00 52.09 ? 735  HOH A O   1 
HETATM 4356 O  O   . HOH M 9 .   ? 139.096 109.645 16.504 1.00 45.48 ? 736  HOH A O   1 
HETATM 4357 O  O   . HOH M 9 .   ? 137.782 120.165 17.897 1.00 30.73 ? 737  HOH A O   1 
HETATM 4358 O  O   . HOH M 9 .   ? 125.618 147.563 27.617 1.00 50.62 ? 738  HOH A O   1 
HETATM 4359 O  O   . HOH M 9 .   ? 128.017 146.899 29.737 1.00 52.33 ? 739  HOH A O   1 
HETATM 4360 O  O   . HOH M 9 .   ? 132.899 146.068 22.236 1.00 43.06 ? 740  HOH A O   1 
HETATM 4361 O  O   . HOH M 9 .   ? 141.613 151.713 29.873 1.00 62.72 ? 741  HOH A O   1 
HETATM 4362 O  O   . HOH M 9 .   ? 139.443 147.906 33.164 1.00 59.09 ? 742  HOH A O   1 
HETATM 4363 O  O   . HOH M 9 .   ? 134.664 147.377 34.975 1.00 35.21 ? 743  HOH A O   1 
HETATM 4364 O  O   . HOH M 9 .   ? 137.155 141.093 34.778 1.00 22.26 ? 744  HOH A O   1 
HETATM 4365 O  O   . HOH M 9 .   ? 140.706 136.505 27.094 1.00 15.87 ? 745  HOH A O   1 
HETATM 4366 O  O   . HOH M 9 .   ? 129.458 126.357 30.438 1.00 19.69 ? 746  HOH A O   1 
HETATM 4367 O  O   . HOH M 9 .   ? 135.060 125.331 30.767 1.00 16.09 ? 747  HOH A O   1 
HETATM 4368 O  O   . HOH M 9 .   ? 133.969 121.830 38.007 1.00 28.43 ? 748  HOH A O   1 
HETATM 4369 O  O   . HOH M 9 .   ? 139.139 118.338 34.577 1.00 17.69 ? 749  HOH A O   1 
HETATM 4370 O  O   . HOH M 9 .   ? 126.560 124.301 30.183 1.00 29.29 ? 750  HOH A O   1 
HETATM 4371 O  O   . HOH M 9 .   ? 124.457 131.308 34.698 1.00 29.55 ? 751  HOH A O   1 
HETATM 4372 O  O   . HOH M 9 .   ? 124.204 145.096 36.491 1.00 49.29 ? 752  HOH A O   1 
HETATM 4373 O  O   . HOH M 9 .   ? 140.087 114.427 25.778 1.00 32.37 ? 753  HOH A O   1 
HETATM 4374 O  O   . HOH M 9 .   ? 151.088 117.165 31.171 1.00 18.60 ? 754  HOH A O   1 
HETATM 4375 O  O   . HOH M 9 .   ? 150.691 114.066 32.575 1.00 32.02 ? 755  HOH A O   1 
HETATM 4376 O  O   . HOH M 9 .   ? 134.492 144.853 17.661 1.00 46.75 ? 756  HOH A O   1 
HETATM 4377 O  O   . HOH M 9 .   ? 133.777 122.663 45.180 1.00 21.39 ? 757  HOH A O   1 
HETATM 4378 O  O   . HOH M 9 .   ? 155.515 132.629 36.470 1.00 30.95 ? 758  HOH A O   1 
HETATM 4379 O  O   . HOH M 9 .   ? 155.578 129.459 34.072 1.00 31.54 ? 759  HOH A O   1 
HETATM 4380 O  O   . HOH M 9 .   ? 140.287 127.004 46.074 1.00 30.22 ? 760  HOH A O   1 
HETATM 4381 O  O   . HOH M 9 .   ? 134.120 126.034 46.604 1.00 27.53 ? 761  HOH A O   1 
HETATM 4382 O  O   . HOH M 9 .   ? 143.065 123.872 46.424 1.00 31.32 ? 762  HOH A O   1 
HETATM 4383 O  O   . HOH M 9 .   ? 145.864 113.089 46.547 1.00 28.47 ? 763  HOH A O   1 
HETATM 4384 O  O   . HOH M 9 .   ? 156.174 117.916 36.289 1.00 30.83 ? 764  HOH A O   1 
HETATM 4385 O  O   . HOH M 9 .   ? 158.687 117.844 38.691 1.00 34.66 ? 765  HOH A O   1 
HETATM 4386 O  O   . HOH M 9 .   ? 156.018 118.623 40.760 1.00 56.42 ? 766  HOH A O   1 
HETATM 4387 O  O   . HOH M 9 .   ? 153.569 107.153 38.800 1.00 59.75 ? 767  HOH A O   1 
HETATM 4388 O  O   . HOH M 9 .   ? 157.533 101.717 26.923 1.00 53.65 ? 768  HOH A O   1 
HETATM 4389 O  O   . HOH M 9 .   ? 165.029 109.438 15.971 1.00 50.20 ? 769  HOH A O   1 
HETATM 4390 O  O   . HOH M 9 .   ? 145.820 104.377 37.123 1.00 38.94 ? 770  HOH A O   1 
HETATM 4391 O  O   . HOH M 9 .   ? 153.980 121.493 26.602 1.00 36.78 ? 771  HOH A O   1 
HETATM 4392 O  O   . HOH M 9 .   ? 161.227 119.292 37.146 1.00 40.10 ? 772  HOH A O   1 
HETATM 4393 O  O   . HOH M 9 .   ? 161.169 139.206 40.339 1.00 55.41 ? 773  HOH A O   1 
HETATM 4394 O  O   . HOH M 9 .   ? 152.233 141.129 36.913 1.00 34.42 ? 774  HOH A O   1 
HETATM 4395 O  O   . HOH M 9 .   ? 137.892 119.419 56.129 1.00 33.21 ? 775  HOH A O   1 
HETATM 4396 O  O   . HOH M 9 .   ? 136.279 117.526 53.929 1.00 34.25 ? 776  HOH A O   1 
HETATM 4397 O  O   . HOH M 9 .   ? 134.187 117.099 55.944 1.00 33.48 ? 777  HOH A O   1 
HETATM 4398 O  O   . HOH M 9 .   ? 133.627 123.176 60.306 1.00 33.75 ? 778  HOH A O   1 
HETATM 4399 O  O   . HOH M 9 .   ? 132.697 116.240 49.264 1.00 16.62 ? 779  HOH A O   1 
HETATM 4400 O  O   . HOH M 9 .   ? 137.641 103.544 55.256 1.00 38.68 ? 780  HOH A O   1 
HETATM 4401 O  O   . HOH M 9 .   ? 129.973 101.712 57.708 1.00 28.42 ? 781  HOH A O   1 
HETATM 4402 O  O   . HOH M 9 .   ? 123.781 98.780  55.311 1.00 52.09 ? 782  HOH A O   1 
HETATM 4403 O  O   . HOH M 9 .   ? 123.331 110.247 57.039 1.00 29.46 ? 783  HOH A O   1 
HETATM 4404 O  O   . HOH M 9 .   ? 146.249 100.425 66.617 1.00 44.51 ? 784  HOH A O   1 
HETATM 4405 O  O   . HOH M 9 .   ? 141.270 98.600  65.846 1.00 54.23 ? 785  HOH A O   1 
HETATM 4406 O  O   . HOH M 9 .   ? 147.594 104.129 60.711 1.00 30.12 ? 786  HOH A O   1 
HETATM 4407 O  O   . HOH M 9 .   ? 143.496 99.802  52.058 1.00 44.46 ? 787  HOH A O   1 
HETATM 4408 O  O   . HOH M 9 .   ? 155.948 108.637 53.159 1.00 34.89 ? 788  HOH A O   1 
HETATM 4409 O  O   . HOH M 9 .   ? 157.199 102.113 56.082 1.00 42.69 ? 789  HOH A O   1 
HETATM 4410 O  O   . HOH M 9 .   ? 150.179 116.207 64.844 1.00 40.92 ? 790  HOH A O   1 
HETATM 4411 O  O   . HOH M 9 .   ? 133.181 111.929 56.439 1.00 38.06 ? 791  HOH A O   1 
HETATM 4412 O  O   . HOH M 9 .   ? 130.573 112.451 58.087 1.00 31.37 ? 792  HOH A O   1 
HETATM 4413 O  O   . HOH M 9 .   ? 125.634 112.035 61.840 1.00 59.68 ? 793  HOH A O   1 
HETATM 4414 O  O   . HOH M 9 .   ? 125.131 108.970 61.665 1.00 48.54 ? 794  HOH A O   1 
HETATM 4415 O  O   . HOH M 9 .   ? 139.172 119.298 59.892 1.00 28.39 ? 795  HOH A O   1 
HETATM 4416 O  O   . HOH M 9 .   ? 133.128 117.040 60.184 1.00 50.00 ? 796  HOH A O   1 
HETATM 4417 O  O   . HOH M 9 .   ? 149.015 122.308 52.190 1.00 17.20 ? 797  HOH A O   1 
HETATM 4418 O  O   . HOH M 9 .   ? 147.954 119.594 51.505 1.00 24.50 ? 798  HOH A O   1 
HETATM 4419 O  O   . HOH M 9 .   ? 150.515 118.212 52.688 1.00 23.80 ? 799  HOH A O   1 
HETATM 4420 O  O   . HOH M 9 .   ? 144.462 111.700 48.835 1.00 29.68 ? 800  HOH A O   1 
HETATM 4421 O  O   . HOH M 9 .   ? 144.399 131.027 57.028 1.00 33.89 ? 801  HOH A O   1 
HETATM 4422 O  O   . HOH M 9 .   ? 141.512 131.978 57.258 1.00 28.17 ? 802  HOH A O   1 
HETATM 4423 O  O   . HOH M 9 .   ? 153.822 126.604 52.642 1.00 71.56 ? 803  HOH A O   1 
HETATM 4424 O  O   . HOH M 9 .   ? 150.261 139.500 45.357 1.00 31.08 ? 804  HOH A O   1 
HETATM 4425 O  O   . HOH M 9 .   ? 145.327 140.596 50.391 1.00 29.35 ? 805  HOH A O   1 
HETATM 4426 O  O   . HOH M 9 .   ? 157.439 140.675 49.620 1.00 44.76 ? 806  HOH A O   1 
HETATM 4427 O  O   . HOH M 9 .   ? 143.673 146.095 51.230 1.00 32.69 ? 807  HOH A O   1 
HETATM 4428 O  O   . HOH M 9 .   ? 138.819 137.055 52.950 1.00 19.37 ? 808  HOH A O   1 
HETATM 4429 O  O   . HOH M 9 .   ? 123.251 127.406 55.515 1.00 41.44 ? 809  HOH A O   1 
HETATM 4430 O  O   . HOH M 9 .   ? 120.086 118.641 51.700 1.00 40.35 ? 810  HOH A O   1 
HETATM 4431 O  O   . HOH M 9 .   ? 125.429 122.518 48.551 1.00 42.49 ? 811  HOH A O   1 
HETATM 4432 O  O   . HOH M 9 .   ? 126.604 122.388 42.177 1.00 37.14 ? 812  HOH A O   1 
HETATM 4433 O  O   . HOH M 9 .   ? 117.558 126.124 37.904 1.00 42.64 ? 813  HOH A O   1 
HETATM 4434 O  O   . HOH M 9 .   ? 111.286 131.379 35.937 1.00 55.56 ? 814  HOH A O   1 
HETATM 4435 O  O   . HOH M 9 .   ? 115.627 127.208 33.046 1.00 48.42 ? 815  HOH A O   1 
HETATM 4436 O  O   . HOH M 9 .   ? 117.419 126.184 52.892 1.00 46.81 ? 816  HOH A O   1 
HETATM 4437 O  O   . HOH M 9 .   ? 113.747 129.267 52.671 1.00 32.98 ? 817  HOH A O   1 
HETATM 4438 O  O   . HOH M 9 .   ? 114.414 127.018 54.855 1.00 50.10 ? 818  HOH A O   1 
HETATM 4439 O  O   . HOH M 9 .   ? 110.912 127.955 50.763 1.00 36.71 ? 819  HOH A O   1 
HETATM 4440 O  O   . HOH M 9 .   ? 122.545 135.795 51.891 1.00 54.38 ? 820  HOH A O   1 
HETATM 4441 O  O   . HOH M 9 .   ? 129.530 143.447 51.103 1.00 41.90 ? 821  HOH A O   1 
HETATM 4442 O  O   . HOH M 9 .   ? 127.039 136.656 50.060 1.00 31.04 ? 822  HOH A O   1 
HETATM 4443 O  O   . HOH M 9 .   ? 123.907 148.323 52.281 1.00 40.77 ? 823  HOH A O   1 
HETATM 4444 O  O   . HOH M 9 .   ? 139.796 145.209 54.063 1.00 44.74 ? 824  HOH A O   1 
HETATM 4445 O  O   . HOH M 9 .   ? 142.745 139.145 56.586 1.00 23.60 ? 825  HOH A O   1 
HETATM 4446 O  O   . HOH M 9 .   ? 143.395 141.590 58.120 1.00 29.57 ? 826  HOH A O   1 
HETATM 4447 O  O   . HOH M 9 .   ? 137.827 139.616 61.834 1.00 32.17 ? 827  HOH A O   1 
HETATM 4448 O  O   . HOH M 9 .   ? 138.692 145.747 56.816 1.00 58.10 ? 828  HOH A O   1 
HETATM 4449 O  O   . HOH M 9 .   ? 137.858 136.019 64.538 1.00 30.00 ? 829  HOH A O   1 
HETATM 4450 O  O   . HOH M 9 .   ? 138.207 129.834 62.307 1.00 26.33 ? 830  HOH A O   1 
HETATM 4451 O  O   . HOH M 9 .   ? 138.588 131.087 66.411 1.00 26.02 ? 831  HOH A O   1 
HETATM 4452 O  O   . HOH M 9 .   ? 141.434 129.427 64.076 1.00 35.54 ? 832  HOH A O   1 
HETATM 4453 O  O   . HOH M 9 .   ? 137.144 132.978 63.969 1.00 37.09 ? 833  HOH A O   1 
HETATM 4454 O  O   . HOH M 9 .   ? 143.609 136.820 63.451 1.00 45.99 ? 834  HOH A O   1 
HETATM 4455 O  O   . HOH M 9 .   ? 142.247 135.511 66.028 1.00 41.84 ? 835  HOH A O   1 
HETATM 4456 O  O   . HOH M 9 .   ? 138.350 125.407 61.747 1.00 43.02 ? 836  HOH A O   1 
HETATM 4457 O  O   . HOH M 9 .   ? 148.328 127.232 60.534 1.00 33.83 ? 837  HOH A O   1 
HETATM 4458 O  O   . HOH M 9 .   ? 151.831 119.359 64.468 1.00 31.83 ? 838  HOH A O   1 
HETATM 4459 O  O   . HOH M 9 .   ? 154.951 115.392 63.913 0.50 44.80 ? 839  HOH A O   1 
HETATM 4460 O  O   . HOH M 9 .   ? 119.721 139.514 19.066 1.00 49.87 ? 840  HOH A O   1 
HETATM 4461 O  O   . HOH M 9 .   ? 129.643 142.286 15.380 1.00 38.91 ? 841  HOH A O   1 
HETATM 4462 O  O   . HOH M 9 .   ? 116.406 131.841 18.112 1.00 43.31 ? 842  HOH A O   1 
HETATM 4463 O  O   . HOH M 9 .   ? 113.308 131.883 33.525 1.00 43.32 ? 843  HOH A O   1 
HETATM 4464 O  O   . HOH M 9 .   ? 116.556 137.399 39.692 1.00 50.97 ? 844  HOH A O   1 
HETATM 4465 O  O   . HOH M 9 .   ? 119.696 140.740 30.818 1.00 44.56 ? 845  HOH A O   1 
HETATM 4466 O  O   . HOH M 9 .   ? 137.531 122.866 16.704 1.00 29.69 ? 846  HOH A O   1 
HETATM 4467 O  O   . HOH M 9 .   ? 144.079 116.495 11.717 1.00 53.27 ? 847  HOH A O   1 
HETATM 4468 O  O   . HOH M 9 .   ? 144.985 109.018 12.249 1.00 84.22 ? 848  HOH A O   1 
HETATM 4469 O  O   . HOH M 9 .   ? 146.488 112.761 9.369  1.00 49.62 ? 849  HOH A O   1 
HETATM 4470 O  O   . HOH M 9 .   ? 152.917 120.644 19.719 1.00 38.04 ? 850  HOH A O   1 
HETATM 4471 O  O   . HOH M 9 .   ? 154.411 125.624 18.708 1.00 68.52 ? 851  HOH A O   1 
HETATM 4472 O  O   . HOH M 9 .   ? 130.159 122.852 25.804 1.00 59.20 ? 852  HOH A O   1 
HETATM 4473 O  O   . HOH M 9 .   ? 127.658 116.230 20.187 1.00 44.83 ? 853  HOH A O   1 
HETATM 4474 O  O   . HOH M 9 .   ? 128.931 113.613 16.599 1.00 45.01 ? 854  HOH A O   1 
HETATM 4475 O  O   . HOH M 9 .   ? 140.521 111.110 29.109 1.00 27.52 ? 855  HOH A O   1 
HETATM 4476 O  O   . HOH M 9 .   ? 134.191 106.674 27.219 1.00 47.46 ? 856  HOH A O   1 
HETATM 4477 O  O   . HOH M 9 .   ? 130.115 111.919 41.677 1.00 22.13 ? 857  HOH A O   1 
HETATM 4478 O  O   . HOH M 9 .   ? 130.370 111.747 38.622 1.00 29.73 ? 858  HOH A O   1 
HETATM 4479 O  O   . HOH M 9 .   ? 130.418 101.791 43.936 1.00 65.48 ? 859  HOH A O   1 
HETATM 4480 O  O   . HOH M 9 .   ? 125.374 109.886 33.079 1.00 51.40 ? 860  HOH A O   1 
HETATM 4481 O  O   . HOH M 9 .   ? 122.337 119.048 36.601 1.00 33.69 ? 861  HOH A O   1 
HETATM 4482 O  O   . HOH M 9 .   ? 124.994 119.055 35.351 1.00 39.43 ? 862  HOH A O   1 
HETATM 4483 O  O   . HOH M 9 .   ? 121.486 117.012 31.271 1.00 75.20 ? 863  HOH A O   1 
HETATM 4484 O  O   . HOH M 9 .   ? 119.744 141.612 21.550 1.00 46.46 ? 864  HOH A O   1 
HETATM 4485 O  O   . HOH M 9 .   ? 128.523 146.292 21.652 1.00 43.51 ? 865  HOH A O   1 
HETATM 4486 O  O   . HOH M 9 .   ? 132.874 151.399 29.085 1.00 43.06 ? 866  HOH A O   1 
HETATM 4487 O  O   . HOH M 9 .   ? 117.319 124.984 31.784 1.00 55.07 ? 867  HOH A O   1 
HETATM 4488 O  O   . HOH M 9 .   ? 122.057 145.517 41.408 1.00 65.50 ? 868  HOH A O   1 
HETATM 4489 O  O   . HOH M 9 .   ? 152.246 111.476 30.871 1.00 45.31 ? 869  HOH A O   1 
HETATM 4490 O  O   . HOH M 9 .   ? 142.829 143.402 26.499 1.00 37.68 ? 870  HOH A O   1 
HETATM 4491 O  O   . HOH M 9 .   ? 133.814 146.184 30.953 1.00 43.26 ? 871  HOH A O   1 
HETATM 4492 O  O   . HOH M 9 .   ? 138.409 147.307 37.321 1.00 45.29 ? 872  HOH A O   1 
HETATM 4493 O  O   . HOH M 9 .   ? 132.082 146.728 33.682 1.00 55.82 ? 873  HOH A O   1 
HETATM 4494 O  O   . HOH M 9 .   ? 150.921 137.105 27.918 1.00 55.34 ? 874  HOH A O   1 
HETATM 4495 O  O   . HOH M 9 .   ? 148.449 143.092 29.926 1.00 64.96 ? 875  HOH A O   1 
HETATM 4496 O  O   . HOH M 9 .   ? 151.167 120.284 43.343 1.00 42.15 ? 876  HOH A O   1 
HETATM 4497 O  O   . HOH M 9 .   ? 153.516 123.124 45.036 1.00 54.49 ? 877  HOH A O   1 
HETATM 4498 O  O   . HOH M 9 .   ? 164.829 110.481 30.422 1.00 45.78 ? 878  HOH A O   1 
HETATM 4499 O  O   . HOH M 9 .   ? 157.415 101.386 34.471 1.00 55.71 ? 879  HOH A O   1 
HETATM 4500 O  O   . HOH M 9 .   ? 161.496 97.887  19.973 1.00 64.70 ? 880  HOH A O   1 
HETATM 4501 O  O   . HOH M 9 .   ? 162.593 110.393 14.326 1.00 58.98 ? 881  HOH A O   1 
HETATM 4502 O  O   . HOH M 9 .   ? 135.450 108.554 20.034 1.00 50.56 ? 882  HOH A O   1 
HETATM 4503 O  O   . HOH M 9 .   ? 145.865 108.104 41.099 1.00 55.68 ? 883  HOH A O   1 
HETATM 4504 O  O   . HOH M 9 .   ? 155.377 127.662 47.790 1.00 41.56 ? 884  HOH A O   1 
HETATM 4505 O  O   . HOH M 9 .   ? 140.329 144.953 45.480 1.00 37.55 ? 885  HOH A O   1 
HETATM 4506 O  O   . HOH M 9 .   ? 133.886 114.643 57.424 1.00 47.59 ? 886  HOH A O   1 
HETATM 4507 O  O   . HOH M 9 .   ? 129.908 114.166 43.766 1.00 32.47 ? 887  HOH A O   1 
HETATM 4508 O  O   . HOH M 9 .   ? 130.499 103.001 47.571 1.00 43.13 ? 888  HOH A O   1 
HETATM 4509 O  O   . HOH M 9 .   ? 133.757 102.948 48.661 1.00 46.29 ? 889  HOH A O   1 
HETATM 4510 O  O   . HOH M 9 .   ? 136.153 108.909 40.652 1.00 61.39 ? 890  HOH A O   1 
HETATM 4511 O  O   . HOH M 9 .   ? 138.250 105.825 41.735 1.00 56.54 ? 891  HOH A O   1 
HETATM 4512 O  O   . HOH M 9 .   ? 121.748 108.701 48.440 1.00 53.53 ? 892  HOH A O   1 
HETATM 4513 O  O   . HOH M 9 .   ? 132.945 106.167 62.471 1.00 38.48 ? 893  HOH A O   1 
HETATM 4514 O  O   . HOH M 9 .   ? 138.418 98.723  64.649 1.00 51.52 ? 894  HOH A O   1 
HETATM 4515 O  O   . HOH M 9 .   ? 138.623 105.403 70.173 1.00 48.42 ? 895  HOH A O   1 
HETATM 4516 O  O   . HOH M 9 .   ? 148.069 110.351 47.956 1.00 36.86 ? 896  HOH A O   1 
HETATM 4517 O  O   . HOH M 9 .   ? 157.690 104.335 58.715 1.00 45.68 ? 897  HOH A O   1 
HETATM 4518 O  O   . HOH M 9 .   ? 139.272 117.668 62.551 1.00 43.16 ? 898  HOH A O   1 
HETATM 4519 O  O   . HOH M 9 .   ? 147.263 130.534 55.592 1.00 56.24 ? 899  HOH A O   1 
HETATM 4520 O  O   . HOH M 9 .   ? 148.417 141.777 50.674 1.00 46.06 ? 900  HOH A O   1 
HETATM 4521 O  O   . HOH M 9 .   ? 129.048 131.035 60.100 1.00 40.05 ? 901  HOH A O   1 
HETATM 4522 O  O   . HOH M 9 .   ? 123.074 123.958 55.150 1.00 32.73 ? 902  HOH A O   1 
HETATM 4523 O  O   . HOH M 9 .   ? 114.947 135.179 41.577 1.00 37.25 ? 903  HOH A O   1 
HETATM 4524 O  O   . HOH M 9 .   ? 113.436 138.622 48.308 1.00 62.46 ? 904  HOH A O   1 
HETATM 4525 O  O   . HOH M 9 .   ? 126.226 138.491 52.660 1.00 44.57 ? 905  HOH A O   1 
HETATM 4526 O  O   . HOH M 9 .   ? 126.708 145.552 45.309 1.00 36.23 ? 906  HOH A O   1 
HETATM 4527 O  O   . HOH M 9 .   ? 123.839 144.912 45.034 1.00 29.72 ? 907  HOH A O   1 
HETATM 4528 O  O   . HOH M 9 .   ? 130.282 148.599 35.683 1.00 38.15 ? 908  HOH A O   1 
HETATM 4529 O  O   . HOH M 9 .   ? 136.817 148.249 44.413 1.00 35.44 ? 909  HOH A O   1 
HETATM 4530 O  O   . HOH M 9 .   ? 132.339 147.749 56.982 1.00 58.52 ? 910  HOH A O   1 
HETATM 4531 O  O   . HOH M 9 .   ? 141.477 142.663 56.065 1.00 24.33 ? 911  HOH A O   1 
HETATM 4532 O  O   . HOH M 9 .   ? 139.870 143.677 58.525 1.00 38.10 ? 912  HOH A O   1 
HETATM 4533 O  O   . HOH M 9 .   ? 141.303 144.079 62.693 1.00 57.08 ? 913  HOH A O   1 
HETATM 4534 O  O   . HOH M 9 .   ? 139.859 139.823 63.952 0.50 51.44 ? 914  HOH A O   1 
HETATM 4535 O  O   . HOH M 9 .   ? 148.948 131.712 62.313 1.00 55.42 ? 915  HOH A O   1 
HETATM 4536 O  O   . HOH M 9 .   ? 144.534 128.684 58.739 1.00 46.01 ? 916  HOH A O   1 
HETATM 4537 O  O   . HOH M 9 .   ? 140.986 132.344 65.231 1.00 57.68 ? 917  HOH A O   1 
HETATM 4538 O  O   . HOH M 9 .   ? 135.539 125.532 60.721 1.00 42.49 ? 918  HOH A O   1 
HETATM 4539 O  O   . HOH M 9 .   ? 137.115 121.491 60.841 1.00 54.03 ? 919  HOH A O   1 
HETATM 4540 O  O   . HOH M 9 .   ? 145.407 129.506 65.973 1.00 47.48 ? 920  HOH A O   1 
HETATM 4541 O  O   . HOH M 9 .   ? 152.593 116.820 51.058 1.00 38.45 ? 921  HOH A O   1 
HETATM 4542 O  O   . HOH M 9 .   ? 134.778 135.839 7.341  1.00 58.01 ? 922  HOH A O   1 
HETATM 4543 O  O   . HOH M 9 .   ? 116.633 139.621 37.172 1.00 53.82 ? 923  HOH A O   1 
HETATM 4544 O  O   . HOH M 9 .   ? 120.436 138.881 28.624 1.00 64.45 ? 924  HOH A O   1 
HETATM 4545 O  O   . HOH M 9 .   ? 136.720 123.607 12.308 1.00 55.58 ? 925  HOH A O   1 
HETATM 4546 O  O   . HOH M 9 .   ? 147.734 113.765 6.920  1.00 62.06 ? 926  HOH A O   1 
HETATM 4547 O  O   . HOH M 9 .   ? 137.288 125.907 9.752  1.00 61.07 ? 927  HOH A O   1 
HETATM 4548 O  O   . HOH M 9 .   ? 116.515 128.968 11.633 1.00 61.10 ? 928  HOH A O   1 
HETATM 4549 O  O   . HOH M 9 .   ? 118.310 126.064 4.823  1.00 68.79 ? 929  HOH A O   1 
HETATM 4550 O  O   . HOH M 9 .   ? 139.361 109.801 31.751 1.00 45.41 ? 930  HOH A O   1 
HETATM 4551 O  O   . HOH M 9 .   ? 133.395 104.348 37.156 1.00 48.03 ? 931  HOH A O   1 
HETATM 4552 O  O   . HOH M 9 .   ? 128.656 99.731  36.304 1.00 53.79 ? 932  HOH A O   1 
HETATM 4553 O  O   . HOH M 9 .   ? 124.027 117.877 32.757 1.00 48.25 ? 933  HOH A O   1 
HETATM 4554 O  O   . HOH M 9 .   ? 131.681 116.574 43.501 1.00 35.85 ? 934  HOH A O   1 
HETATM 4555 O  O   . HOH M 9 .   ? 122.613 118.502 24.768 1.00 55.25 ? 935  HOH A O   1 
HETATM 4556 O  O   . HOH M 9 .   ? 120.862 119.989 30.672 1.00 46.47 ? 936  HOH A O   1 
HETATM 4557 O  O   . HOH M 9 .   ? 136.808 146.864 22.981 1.00 50.14 ? 937  HOH A O   1 
HETATM 4558 O  O   . HOH M 9 .   ? 138.624 147.349 25.657 1.00 58.76 ? 938  HOH A O   1 
HETATM 4559 O  O   . HOH M 9 .   ? 136.234 153.444 21.523 1.00 67.22 ? 939  HOH A O   1 
HETATM 4560 O  O   . HOH M 9 .   ? 157.565 119.741 26.918 1.00 44.26 ? 940  HOH A O   1 
HETATM 4561 O  O   . HOH M 9 .   ? 155.995 118.059 30.446 1.00 57.38 ? 941  HOH A O   1 
HETATM 4562 O  O   . HOH M 9 .   ? 137.883 141.620 21.375 1.00 47.34 ? 942  HOH A O   1 
HETATM 4563 O  O   . HOH M 9 .   ? 155.189 141.206 34.478 1.00 58.65 ? 943  HOH A O   1 
HETATM 4564 O  O   . HOH M 9 .   ? 145.406 142.837 34.284 1.00 47.58 ? 944  HOH A O   1 
HETATM 4565 O  O   . HOH M 9 .   ? 153.138 125.393 47.560 1.00 71.59 ? 945  HOH A O   1 
HETATM 4566 O  O   . HOH M 9 .   ? 148.842 113.177 47.177 1.00 48.63 ? 946  HOH A O   1 
HETATM 4567 O  O   . HOH M 9 .   ? 146.123 111.815 43.762 1.00 23.02 ? 947  HOH A O   1 
HETATM 4568 O  O   . HOH M 9 .   ? 155.100 121.665 41.953 1.00 54.16 ? 948  HOH A O   1 
HETATM 4569 O  O   . HOH M 9 .   ? 148.816 113.755 39.251 1.00 21.59 ? 949  HOH A O   1 
HETATM 4570 O  O   . HOH M 9 .   ? 146.080 111.274 40.972 1.00 38.84 ? 950  HOH A O   1 
HETATM 4571 O  O   . HOH M 9 .   ? 138.882 96.992  56.238 1.00 51.84 ? 951  HOH A O   1 
HETATM 4572 O  O   . HOH M 9 .   ? 121.058 120.371 44.820 1.00 49.34 ? 952  HOH A O   1 
HETATM 4573 O  O   . HOH M 9 .   ? 119.877 133.285 52.907 1.00 51.05 ? 953  HOH A O   1 
HETATM 4574 O  O   . HOH M 9 .   ? 115.817 144.091 43.998 1.00 53.60 ? 954  HOH A O   1 
HETATM 4575 O  O   . HOH M 9 .   ? 134.700 128.398 59.997 1.00 49.43 ? 955  HOH A O   1 
HETATM 4576 O  O   . HOH M 9 .   ? 146.704 130.085 60.615 1.00 50.38 ? 956  HOH A O   1 
HETATM 4577 O  O   . HOH M 9 .   ? 154.035 122.286 51.336 1.00 60.51 ? 957  HOH A O   1 
HETATM 4578 O  O   . HOH M 9 .   ? 145.569 110.189 16.018 1.00 38.76 ? 958  HOH A O   1 
HETATM 4579 O  O   . HOH M 9 .   ? 135.710 107.543 22.967 1.00 61.13 ? 959  HOH A O   1 
HETATM 4580 O  O   . HOH M 9 .   ? 128.049 105.411 33.285 1.00 62.79 ? 960  HOH A O   1 
HETATM 4581 O  O   . HOH M 9 .   ? 133.457 101.529 40.273 1.00 46.90 ? 961  HOH A O   1 
HETATM 4582 O  O   . HOH M 9 .   ? 129.918 144.408 32.758 1.00 50.30 ? 962  HOH A O   1 
HETATM 4583 O  O   . HOH M 9 .   ? 136.688 115.349 39.964 1.00 40.89 ? 963  HOH A O   1 
HETATM 4584 O  O   . HOH M 9 .   ? 142.203 108.938 33.084 1.00 41.44 ? 964  HOH A O   1 
HETATM 4585 O  O   . HOH M 9 .   ? 131.667 115.324 32.000 1.00 43.25 ? 965  HOH A O   1 
HETATM 4586 O  O   . HOH M 9 .   ? 122.144 123.536 29.944 1.00 56.48 ? 966  HOH A O   1 
HETATM 4587 O  O   . HOH M 9 .   ? 161.337 120.856 29.436 1.00 52.20 ? 967  HOH A O   1 
HETATM 4588 O  O   . HOH M 9 .   ? 147.971 130.451 22.938 1.00 49.51 ? 968  HOH A O   1 
HETATM 4589 O  O   . HOH M 9 .   ? 155.366 136.400 26.836 1.00 58.48 ? 969  HOH A O   1 
HETATM 4590 O  O   . HOH M 9 .   ? 144.055 143.798 37.919 1.00 44.21 ? 970  HOH A O   1 
HETATM 4591 O  O   . HOH M 9 .   ? 152.819 104.078 45.418 1.00 65.29 ? 971  HOH A O   1 
HETATM 4592 O  O   . HOH M 9 .   ? 133.524 100.902 46.015 1.00 59.09 ? 972  HOH A O   1 
HETATM 4593 O  O   . HOH M 9 .   ? 122.149 106.798 53.299 1.00 44.02 ? 973  HOH A O   1 
HETATM 4594 O  O   . HOH M 9 .   ? 138.243 102.653 68.922 1.00 50.62 ? 974  HOH A O   1 
HETATM 4595 O  O   . HOH M 9 .   ? 147.052 103.115 57.509 1.00 53.04 ? 975  HOH A O   1 
HETATM 4596 O  O   . HOH M 9 .   ? 135.994 108.738 72.754 1.00 46.57 ? 976  HOH A O   1 
HETATM 4597 O  O   . HOH M 9 .   ? 147.525 126.016 55.031 1.00 45.04 ? 977  HOH A O   1 
HETATM 4598 O  O   . HOH M 9 .   ? 149.244 139.271 53.191 1.00 43.99 ? 978  HOH A O   1 
HETATM 4599 O  O   . HOH M 9 .   ? 154.449 143.020 49.001 1.00 52.22 ? 979  HOH A O   1 
HETATM 4600 O  O   . HOH M 9 .   ? 125.543 119.543 55.822 1.00 57.03 ? 980  HOH A O   1 
HETATM 4601 O  O   . HOH M 9 .   ? 118.957 115.715 51.469 1.00 55.96 ? 981  HOH A O   1 
HETATM 4602 O  O   . HOH M 9 .   ? 118.280 142.150 41.475 1.00 56.16 ? 982  HOH A O   1 
HETATM 4603 O  O   . HOH M 9 .   ? 126.664 133.953 53.802 1.00 45.33 ? 983  HOH A O   1 
HETATM 4604 O  O   . HOH M 9 .   ? 149.502 112.153 41.425 1.00 34.94 ? 984  HOH A O   1 
HETATM 4605 O  O   . HOH M 9 .   ? 131.998 133.276 7.481  1.00 63.28 ? 985  HOH A O   1 
HETATM 4606 O  O   . HOH M 9 .   ? 135.681 122.086 14.514 1.00 49.36 ? 986  HOH A O   1 
HETATM 4607 O  O   . HOH M 9 .   ? 151.900 120.774 13.243 1.00 66.05 ? 987  HOH A O   1 
HETATM 4608 O  O   . HOH M 9 .   ? 139.282 113.813 23.097 1.00 55.69 ? 988  HOH A O   1 
HETATM 4609 O  O   . HOH M 9 .   ? 118.601 109.463 41.491 1.00 51.77 ? 989  HOH A O   1 
HETATM 4610 O  O   . HOH M 9 .   ? 121.932 114.917 35.162 1.00 56.27 ? 990  HOH A O   1 
HETATM 4611 O  O   . HOH M 9 .   ? 124.661 112.155 31.168 1.00 48.37 ? 991  HOH A O   1 
HETATM 4612 O  O   . HOH M 9 .   ? 133.965 114.778 36.708 1.00 43.02 ? 992  HOH A O   1 
HETATM 4613 O  O   . HOH M 9 .   ? 137.070 112.919 38.388 1.00 64.34 ? 993  HOH A O   1 
HETATM 4614 O  O   . HOH M 9 .   ? 142.519 110.791 26.927 1.00 50.49 ? 994  HOH A O   1 
HETATM 4615 O  O   . HOH M 9 .   ? 157.943 122.077 25.258 1.00 48.74 ? 995  HOH A O   1 
HETATM 4616 O  O   . HOH M 9 .   ? 158.328 121.058 22.509 1.00 57.82 ? 996  HOH A O   1 
HETATM 4617 O  O   . HOH M 9 .   ? 139.101 144.360 20.463 1.00 53.68 ? 997  HOH A O   1 
HETATM 4618 O  O   . HOH M 9 .   ? 149.747 119.760 49.159 1.00 52.59 ? 998  HOH A O   1 
HETATM 4619 O  O   . HOH M 9 .   ? 162.589 105.298 32.900 1.00 69.26 ? 999  HOH A O   1 
HETATM 4620 O  O   . HOH M 9 .   ? 150.669 94.022  23.595 1.00 60.82 ? 1000 HOH A O   1 
HETATM 4621 O  O   . HOH M 9 .   ? 151.656 113.968 18.028 1.00 44.47 ? 1001 HOH A O   1 
HETATM 4622 O  O   . HOH M 9 .   ? 144.998 97.983  24.209 1.00 51.66 ? 1002 HOH A O   1 
HETATM 4623 O  O   . HOH M 9 .   ? 151.123 103.817 42.851 1.00 70.26 ? 1003 HOH A O   1 
HETATM 4624 O  O   . HOH M 9 .   ? 159.060 126.077 46.251 1.00 42.37 ? 1004 HOH A O   1 
HETATM 4625 O  O   . HOH M 9 .   ? 154.805 133.866 48.027 1.00 39.19 ? 1005 HOH A O   1 
HETATM 4626 O  O   . HOH M 9 .   ? 156.486 134.091 50.544 1.00 47.72 ? 1006 HOH A O   1 
HETATM 4627 O  O   . HOH M 9 .   ? 131.483 99.651  58.943 1.00 72.12 ? 1007 HOH A O   1 
HETATM 4628 O  O   . HOH M 9 .   ? 122.133 108.025 55.842 1.00 64.68 ? 1008 HOH A O   1 
HETATM 4629 O  O   . HOH M 9 .   ? 134.555 111.031 71.734 1.00 56.72 ? 1009 HOH A O   1 
HETATM 4630 O  O   . HOH M 9 .   ? 155.194 132.053 57.855 1.00 57.01 ? 1010 HOH A O   1 
HETATM 4631 O  O   . HOH M 9 .   ? 152.284 129.421 55.367 1.00 59.66 ? 1011 HOH A O   1 
HETATM 4632 O  O   . HOH M 9 .   ? 146.668 144.957 48.139 1.00 56.39 ? 1012 HOH A O   1 
HETATM 4633 O  O   . HOH M 9 .   ? 137.390 145.205 51.173 1.00 54.48 ? 1013 HOH A O   1 
HETATM 4634 O  O   . HOH M 9 .   ? 131.695 128.493 60.112 1.00 58.00 ? 1014 HOH A O   1 
HETATM 4635 O  O   . HOH M 9 .   ? 116.754 114.422 46.133 1.00 56.79 ? 1015 HOH A O   1 
HETATM 4636 O  O   . HOH M 9 .   ? 120.265 110.953 54.399 1.00 64.55 ? 1016 HOH A O   1 
HETATM 4637 O  O   . HOH M 9 .   ? 111.740 129.421 38.135 1.00 62.96 ? 1017 HOH A O   1 
HETATM 4638 O  O   . HOH M 9 .   ? 108.440 137.133 40.749 0.50 64.23 ? 1018 HOH A O   1 
HETATM 4639 O  O   . HOH M 9 .   ? 108.627 139.531 39.212 1.00 62.87 ? 1019 HOH A O   1 
HETATM 4640 O  O   . HOH M 9 .   ? 124.119 137.414 58.839 0.50 52.21 ? 1020 HOH A O   1 
HETATM 4641 O  O   . HOH M 9 .   ? 118.357 148.250 48.232 1.00 53.42 ? 1021 HOH A O   1 
HETATM 4642 O  O   . HOH M 9 .   ? 154.890 113.834 52.575 1.00 54.91 ? 1022 HOH A O   1 
HETATM 4643 O  O   . HOH M 9 .   ? 122.368 140.892 10.122 1.00 60.04 ? 1023 HOH A O   1 
HETATM 4644 O  O   . HOH M 9 .   ? 120.872 133.860 9.195  1.00 58.45 ? 1024 HOH A O   1 
HETATM 4645 O  O   . HOH M 9 .   ? 142.261 107.158 15.156 1.00 66.36 ? 1025 HOH A O   1 
HETATM 4646 O  O   . HOH M 9 .   ? 147.727 127.768 22.844 1.00 54.30 ? 1026 HOH A O   1 
HETATM 4647 O  O   . HOH M 9 .   ? 134.022 104.810 30.486 1.00 53.47 ? 1027 HOH A O   1 
HETATM 4648 O  O   . HOH M 9 .   ? 139.879 151.018 24.287 1.00 68.06 ? 1028 HOH A O   1 
HETATM 4649 O  O   . HOH M 9 .   ? 137.778 150.630 22.160 1.00 60.51 ? 1029 HOH A O   1 
HETATM 4650 O  O   . HOH M 9 .   ? 139.036 113.633 40.414 1.00 52.45 ? 1030 HOH A O   1 
HETATM 4651 O  O   . HOH M 9 .   ? 127.163 145.221 39.873 1.00 48.75 ? 1031 HOH A O   1 
HETATM 4652 O  O   . HOH M 9 .   ? 119.954 143.429 29.908 1.00 54.67 ? 1032 HOH A O   1 
HETATM 4653 O  O   . HOH M 9 .   ? 145.786 137.049 21.836 1.00 59.40 ? 1033 HOH A O   1 
HETATM 4654 O  O   . HOH M 9 .   ? 152.208 119.189 46.565 1.00 46.92 ? 1034 HOH A O   1 
HETATM 4655 O  O   . HOH M 9 .   ? 125.164 96.240  55.336 1.00 54.09 ? 1035 HOH A O   1 
HETATM 4656 O  O   . HOH M 9 .   ? 153.057 110.457 47.929 1.00 56.20 ? 1036 HOH A O   1 
HETATM 4657 O  O   . HOH M 9 .   ? 157.220 137.284 51.907 1.00 54.32 ? 1037 HOH A O   1 
HETATM 4658 O  O   . HOH M 9 .   ? 127.444 146.531 35.135 1.00 54.59 ? 1038 HOH A O   1 
HETATM 4659 O  O   . HOH M 9 .   ? 139.773 147.872 45.150 1.00 56.12 ? 1039 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  MET 81  81  81  MET MET A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TRP 177 177 177 TRP TRP A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 CYS 252 252 252 CYS CYS A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLU 255 255 ?   ?   ?   A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 CYS 263 263 263 CYS CYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ASN 266 266 266 ASN ASN A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 VAL 279 279 279 VAL VAL A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 THR 284 284 284 THR THR A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 PRO 292 292 292 PRO PRO A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 ILE 317 317 317 ILE ILE A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 TYR 332 332 332 TYR TYR A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 PRO 335 335 335 PRO PRO A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ASN 341 341 341 ASN ASN A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 THR 346 346 346 THR THR A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
A 1 351 GLN 351 351 351 GLN GLN A . n 
A 1 352 GLU 352 352 352 GLU GLU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 PHE 357 357 357 PHE PHE A . n 
A 1 358 PHE 358 358 358 PHE PHE A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 TYR 373 373 373 TYR TYR A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 TRP 376 376 376 TRP TRP A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 ASP 378 378 ?   ?   ?   A . n 
A 1 379 ASP 379 379 ?   ?   ?   A . n 
A 1 380 GLN 380 380 380 GLN GLN A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 TYR 385 385 385 TYR TYR A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 VAL 392 392 392 VAL VAL A . n 
A 1 393 VAL 393 393 393 VAL VAL A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 ASP 395 395 395 ASP ASP A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 PHE 398 398 398 PHE PHE A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 CYS 400 400 400 CYS CYS A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 ALA 402 402 402 ALA ALA A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 LYS 407 407 407 LYS LYS A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 PHE 409 409 409 PHE PHE A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 TRP 412 412 412 TRP TRP A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 ASN 414 414 414 ASN ASN A . n 
A 1 415 ASN 415 415 415 ASN ASN A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 PHE 417 417 417 PHE PHE A . n 
A 1 418 PHE 418 418 418 PHE PHE A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 TYR 420 420 420 TYR TYR A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 GLU 422 422 422 GLU GLU A . n 
A 1 423 HIS 423 423 423 HIS HIS A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LYS 427 427 427 LYS LYS A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 PRO 429 429 429 PRO PRO A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 TRP 433 433 433 TRP TRP A . n 
A 1 434 MET 434 434 434 MET MET A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 MET 437 437 437 MET MET A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 TYR 440 440 440 TYR TYR A . n 
A 1 441 GLU 441 441 441 GLU GLU A . n 
A 1 442 ILE 442 442 442 ILE ILE A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 PHE 444 444 444 PHE PHE A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 PRO 449 449 449 PRO PRO A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 GLU 451 451 451 GLU GLU A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 ARG 453 453 453 ARG ARG A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 GLN 455 455 ?   ?   ?   A . n 
A 1 456 TYR 456 456 456 TYR TYR A . n 
A 1 457 THR 457 457 457 THR THR A . n 
A 1 458 LYS 458 458 458 LYS LYS A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 GLU 460 460 460 GLU GLU A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ILE 462 462 462 ILE ILE A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 SER 464 464 464 SER SER A . n 
A 1 465 ARG 465 465 465 ARG ARG A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ILE 467 467 467 ILE ILE A . n 
A 1 468 VAL 468 468 468 VAL VAL A . n 
A 1 469 LYS 469 469 469 LYS LYS A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 TRP 471 471 471 TRP TRP A . n 
A 1 472 ALA 472 472 472 ALA ALA A . n 
A 1 473 ASN 473 473 473 ASN ASN A . n 
A 1 474 PHE 474 474 474 PHE PHE A . n 
A 1 475 ALA 475 475 475 ALA ALA A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 TYR 477 477 477 TYR TYR A . n 
A 1 478 GLY 478 478 478 GLY GLY A . n 
A 1 479 ASN 479 479 479 ASN ASN A . n 
A 1 480 PRO 480 480 480 PRO PRO A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 GLN 484 484 484 GLN GLN A . n 
A 1 485 ASN 485 485 485 ASN ASN A . n 
A 1 486 GLN 486 486 486 GLN ALA A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 TRP 490 490 490 TRP TRP A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 PHE 493 493 493 PHE PHE A . n 
A 1 494 LYS 494 494 494 LYS LYS A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 GLN 498 498 498 GLN GLN A . n 
A 1 499 LYS 499 499 499 LYS LYS A . n 
A 1 500 TYR 500 500 500 TYR TYR A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 ASN 504 504 504 ASN ASN A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 ARG 509 509 509 ARG ARG A . n 
A 1 510 ILE 510 510 510 ILE ILE A . n 
A 1 511 MET 511 511 511 MET MET A . n 
A 1 512 THR 512 512 512 THR THR A . n 
A 1 513 LYS 513 513 513 LYS LYS A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 ALA 516 516 516 ALA ALA A . n 
A 1 517 GLN 517 517 517 GLN GLN A . n 
A 1 518 GLN 518 518 518 GLN GLN A . n 
A 1 519 CYS 519 519 519 CYS CYS A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 PHE 521 521 521 PHE PHE A . n 
A 1 522 TRP 522 522 522 TRP TRP A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 PHE 526 526 526 PHE PHE A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   536  21  NAG NAG A . 
E 3 NAG 1   537  31  NAG NAG A . 
F 3 NAG 1   538  41  NAG NAG A . 
G 4 SO4 1   603  3   SO4 SUL A . 
H 5 CL  1   701  1   CL  CL1 A . 
I 5 CL  1   702  2   CL  CL1 A . 
J 6 VXA 1   601  1   VXA SOM A . 
K 7 BCH 1   604  4   BCH BTC A . 
L 8 GOL 1   602  2   GOL GOL A . 
M 9 HOH 1   703  1   HOH WAT A . 
M 9 HOH 2   704  2   HOH WAT A . 
M 9 HOH 3   705  3   HOH WAT A . 
M 9 HOH 4   706  4   HOH WAT A . 
M 9 HOH 5   707  5   HOH WAT A . 
M 9 HOH 6   708  6   HOH WAT A . 
M 9 HOH 7   709  7   HOH WAT A . 
M 9 HOH 8   710  8   HOH WAT A . 
M 9 HOH 9   711  9   HOH WAT A . 
M 9 HOH 10  712  10  HOH WAT A . 
M 9 HOH 11  713  11  HOH WAT A . 
M 9 HOH 12  714  12  HOH WAT A . 
M 9 HOH 13  715  13  HOH WAT A . 
M 9 HOH 14  716  14  HOH WAT A . 
M 9 HOH 15  717  15  HOH WAT A . 
M 9 HOH 16  718  16  HOH WAT A . 
M 9 HOH 17  719  17  HOH WAT A . 
M 9 HOH 18  720  18  HOH WAT A . 
M 9 HOH 19  721  19  HOH WAT A . 
M 9 HOH 20  722  20  HOH WAT A . 
M 9 HOH 21  723  21  HOH WAT A . 
M 9 HOH 22  724  22  HOH WAT A . 
M 9 HOH 23  725  23  HOH WAT A . 
M 9 HOH 24  726  24  HOH WAT A . 
M 9 HOH 25  727  25  HOH WAT A . 
M 9 HOH 26  728  26  HOH WAT A . 
M 9 HOH 27  729  27  HOH WAT A . 
M 9 HOH 28  730  28  HOH WAT A . 
M 9 HOH 29  731  29  HOH WAT A . 
M 9 HOH 30  732  30  HOH WAT A . 
M 9 HOH 31  733  31  HOH WAT A . 
M 9 HOH 32  734  32  HOH WAT A . 
M 9 HOH 33  735  33  HOH WAT A . 
M 9 HOH 34  736  34  HOH WAT A . 
M 9 HOH 35  737  35  HOH WAT A . 
M 9 HOH 36  738  36  HOH WAT A . 
M 9 HOH 37  739  37  HOH WAT A . 
M 9 HOH 38  740  38  HOH WAT A . 
M 9 HOH 39  741  39  HOH WAT A . 
M 9 HOH 40  742  40  HOH WAT A . 
M 9 HOH 41  743  41  HOH WAT A . 
M 9 HOH 42  744  42  HOH WAT A . 
M 9 HOH 43  745  43  HOH WAT A . 
M 9 HOH 44  746  44  HOH WAT A . 
M 9 HOH 45  747  45  HOH WAT A . 
M 9 HOH 46  748  46  HOH WAT A . 
M 9 HOH 47  749  47  HOH WAT A . 
M 9 HOH 48  750  48  HOH WAT A . 
M 9 HOH 49  751  49  HOH WAT A . 
M 9 HOH 50  752  50  HOH WAT A . 
M 9 HOH 51  753  51  HOH WAT A . 
M 9 HOH 52  754  52  HOH WAT A . 
M 9 HOH 53  755  53  HOH WAT A . 
M 9 HOH 54  756  54  HOH WAT A . 
M 9 HOH 55  757  55  HOH WAT A . 
M 9 HOH 56  758  56  HOH WAT A . 
M 9 HOH 57  759  57  HOH WAT A . 
M 9 HOH 58  760  58  HOH WAT A . 
M 9 HOH 59  761  59  HOH WAT A . 
M 9 HOH 60  762  60  HOH WAT A . 
M 9 HOH 61  763  61  HOH WAT A . 
M 9 HOH 62  764  62  HOH WAT A . 
M 9 HOH 63  765  63  HOH WAT A . 
M 9 HOH 64  766  64  HOH WAT A . 
M 9 HOH 65  767  65  HOH WAT A . 
M 9 HOH 66  768  66  HOH WAT A . 
M 9 HOH 67  769  67  HOH WAT A . 
M 9 HOH 68  770  68  HOH WAT A . 
M 9 HOH 69  771  69  HOH WAT A . 
M 9 HOH 70  772  70  HOH WAT A . 
M 9 HOH 71  773  71  HOH WAT A . 
M 9 HOH 72  774  72  HOH WAT A . 
M 9 HOH 73  775  73  HOH WAT A . 
M 9 HOH 74  776  74  HOH WAT A . 
M 9 HOH 75  777  75  HOH WAT A . 
M 9 HOH 76  778  76  HOH WAT A . 
M 9 HOH 77  779  77  HOH WAT A . 
M 9 HOH 78  780  78  HOH WAT A . 
M 9 HOH 79  781  79  HOH WAT A . 
M 9 HOH 80  782  80  HOH WAT A . 
M 9 HOH 81  783  81  HOH WAT A . 
M 9 HOH 82  784  82  HOH WAT A . 
M 9 HOH 83  785  83  HOH WAT A . 
M 9 HOH 84  786  84  HOH WAT A . 
M 9 HOH 85  787  85  HOH WAT A . 
M 9 HOH 86  788  86  HOH WAT A . 
M 9 HOH 87  789  87  HOH WAT A . 
M 9 HOH 88  790  88  HOH WAT A . 
M 9 HOH 89  791  89  HOH WAT A . 
M 9 HOH 90  792  90  HOH WAT A . 
M 9 HOH 91  793  91  HOH WAT A . 
M 9 HOH 92  794  92  HOH WAT A . 
M 9 HOH 93  795  93  HOH WAT A . 
M 9 HOH 94  796  94  HOH WAT A . 
M 9 HOH 95  797  95  HOH WAT A . 
M 9 HOH 96  798  96  HOH WAT A . 
M 9 HOH 97  799  97  HOH WAT A . 
M 9 HOH 98  800  98  HOH WAT A . 
M 9 HOH 99  801  99  HOH WAT A . 
M 9 HOH 100 802  100 HOH WAT A . 
M 9 HOH 101 803  101 HOH WAT A . 
M 9 HOH 102 804  102 HOH WAT A . 
M 9 HOH 103 805  103 HOH WAT A . 
M 9 HOH 104 806  104 HOH WAT A . 
M 9 HOH 105 807  105 HOH WAT A . 
M 9 HOH 106 808  106 HOH WAT A . 
M 9 HOH 107 809  107 HOH WAT A . 
M 9 HOH 108 810  108 HOH WAT A . 
M 9 HOH 109 811  109 HOH WAT A . 
M 9 HOH 110 812  110 HOH WAT A . 
M 9 HOH 111 813  111 HOH WAT A . 
M 9 HOH 112 814  112 HOH WAT A . 
M 9 HOH 113 815  113 HOH WAT A . 
M 9 HOH 114 816  114 HOH WAT A . 
M 9 HOH 115 817  115 HOH WAT A . 
M 9 HOH 116 818  116 HOH WAT A . 
M 9 HOH 117 819  117 HOH WAT A . 
M 9 HOH 118 820  118 HOH WAT A . 
M 9 HOH 119 821  119 HOH WAT A . 
M 9 HOH 120 822  120 HOH WAT A . 
M 9 HOH 121 823  121 HOH WAT A . 
M 9 HOH 122 824  122 HOH WAT A . 
M 9 HOH 123 825  123 HOH WAT A . 
M 9 HOH 124 826  124 HOH WAT A . 
M 9 HOH 125 827  125 HOH WAT A . 
M 9 HOH 126 828  126 HOH WAT A . 
M 9 HOH 127 829  127 HOH WAT A . 
M 9 HOH 128 830  128 HOH WAT A . 
M 9 HOH 129 831  129 HOH WAT A . 
M 9 HOH 130 832  130 HOH WAT A . 
M 9 HOH 131 833  131 HOH WAT A . 
M 9 HOH 132 834  132 HOH WAT A . 
M 9 HOH 133 835  133 HOH WAT A . 
M 9 HOH 134 836  134 HOH WAT A . 
M 9 HOH 135 837  135 HOH WAT A . 
M 9 HOH 136 838  136 HOH WAT A . 
M 9 HOH 137 839  137 HOH WAT A . 
M 9 HOH 138 840  138 HOH WAT A . 
M 9 HOH 139 841  139 HOH WAT A . 
M 9 HOH 140 842  140 HOH WAT A . 
M 9 HOH 141 843  141 HOH WAT A . 
M 9 HOH 142 844  142 HOH WAT A . 
M 9 HOH 143 845  143 HOH WAT A . 
M 9 HOH 144 846  144 HOH WAT A . 
M 9 HOH 145 847  145 HOH WAT A . 
M 9 HOH 146 848  146 HOH WAT A . 
M 9 HOH 147 849  147 HOH WAT A . 
M 9 HOH 148 850  148 HOH WAT A . 
M 9 HOH 149 851  149 HOH WAT A . 
M 9 HOH 150 852  150 HOH WAT A . 
M 9 HOH 151 853  151 HOH WAT A . 
M 9 HOH 152 854  152 HOH WAT A . 
M 9 HOH 153 855  153 HOH WAT A . 
M 9 HOH 154 856  154 HOH WAT A . 
M 9 HOH 155 857  155 HOH WAT A . 
M 9 HOH 156 858  156 HOH WAT A . 
M 9 HOH 157 859  157 HOH WAT A . 
M 9 HOH 158 860  158 HOH WAT A . 
M 9 HOH 159 861  159 HOH WAT A . 
M 9 HOH 160 862  160 HOH WAT A . 
M 9 HOH 161 863  161 HOH WAT A . 
M 9 HOH 162 864  162 HOH WAT A . 
M 9 HOH 163 865  163 HOH WAT A . 
M 9 HOH 164 866  164 HOH WAT A . 
M 9 HOH 165 867  165 HOH WAT A . 
M 9 HOH 166 868  166 HOH WAT A . 
M 9 HOH 167 869  167 HOH WAT A . 
M 9 HOH 168 870  168 HOH WAT A . 
M 9 HOH 169 871  169 HOH WAT A . 
M 9 HOH 170 872  170 HOH WAT A . 
M 9 HOH 171 873  171 HOH WAT A . 
M 9 HOH 172 874  172 HOH WAT A . 
M 9 HOH 173 875  173 HOH WAT A . 
M 9 HOH 174 876  174 HOH WAT A . 
M 9 HOH 175 877  175 HOH WAT A . 
M 9 HOH 176 878  176 HOH WAT A . 
M 9 HOH 177 879  177 HOH WAT A . 
M 9 HOH 178 880  178 HOH WAT A . 
M 9 HOH 179 881  179 HOH WAT A . 
M 9 HOH 180 882  180 HOH WAT A . 
M 9 HOH 181 883  181 HOH WAT A . 
M 9 HOH 182 884  182 HOH WAT A . 
M 9 HOH 183 885  183 HOH WAT A . 
M 9 HOH 184 886  184 HOH WAT A . 
M 9 HOH 185 887  185 HOH WAT A . 
M 9 HOH 186 888  186 HOH WAT A . 
M 9 HOH 187 889  187 HOH WAT A . 
M 9 HOH 188 890  188 HOH WAT A . 
M 9 HOH 189 891  189 HOH WAT A . 
M 9 HOH 190 892  190 HOH WAT A . 
M 9 HOH 191 893  191 HOH WAT A . 
M 9 HOH 192 894  192 HOH WAT A . 
M 9 HOH 193 895  193 HOH WAT A . 
M 9 HOH 194 896  194 HOH WAT A . 
M 9 HOH 195 897  195 HOH WAT A . 
M 9 HOH 196 898  196 HOH WAT A . 
M 9 HOH 197 899  197 HOH WAT A . 
M 9 HOH 198 900  198 HOH WAT A . 
M 9 HOH 199 901  199 HOH WAT A . 
M 9 HOH 200 902  200 HOH WAT A . 
M 9 HOH 201 903  201 HOH WAT A . 
M 9 HOH 202 904  202 HOH WAT A . 
M 9 HOH 203 905  203 HOH WAT A . 
M 9 HOH 204 906  204 HOH WAT A . 
M 9 HOH 205 907  205 HOH WAT A . 
M 9 HOH 206 908  206 HOH WAT A . 
M 9 HOH 207 909  207 HOH WAT A . 
M 9 HOH 208 910  208 HOH WAT A . 
M 9 HOH 209 911  209 HOH WAT A . 
M 9 HOH 210 912  210 HOH WAT A . 
M 9 HOH 211 913  211 HOH WAT A . 
M 9 HOH 212 914  212 HOH WAT A . 
M 9 HOH 213 915  213 HOH WAT A . 
M 9 HOH 214 916  214 HOH WAT A . 
M 9 HOH 215 917  215 HOH WAT A . 
M 9 HOH 216 918  216 HOH WAT A . 
M 9 HOH 217 919  217 HOH WAT A . 
M 9 HOH 218 920  218 HOH WAT A . 
M 9 HOH 219 921  219 HOH WAT A . 
M 9 HOH 220 922  220 HOH WAT A . 
M 9 HOH 221 923  221 HOH WAT A . 
M 9 HOH 222 924  222 HOH WAT A . 
M 9 HOH 223 925  223 HOH WAT A . 
M 9 HOH 224 926  224 HOH WAT A . 
M 9 HOH 225 927  225 HOH WAT A . 
M 9 HOH 226 928  226 HOH WAT A . 
M 9 HOH 227 929  227 HOH WAT A . 
M 9 HOH 228 930  228 HOH WAT A . 
M 9 HOH 229 931  229 HOH WAT A . 
M 9 HOH 230 932  230 HOH WAT A . 
M 9 HOH 231 933  231 HOH WAT A . 
M 9 HOH 232 934  232 HOH WAT A . 
M 9 HOH 233 935  233 HOH WAT A . 
M 9 HOH 234 936  234 HOH WAT A . 
M 9 HOH 235 937  235 HOH WAT A . 
M 9 HOH 236 938  236 HOH WAT A . 
M 9 HOH 237 939  237 HOH WAT A . 
M 9 HOH 238 940  238 HOH WAT A . 
M 9 HOH 239 941  239 HOH WAT A . 
M 9 HOH 240 942  240 HOH WAT A . 
M 9 HOH 241 943  241 HOH WAT A . 
M 9 HOH 242 944  242 HOH WAT A . 
M 9 HOH 243 945  243 HOH WAT A . 
M 9 HOH 244 946  244 HOH WAT A . 
M 9 HOH 245 947  245 HOH WAT A . 
M 9 HOH 246 948  246 HOH WAT A . 
M 9 HOH 247 949  247 HOH WAT A . 
M 9 HOH 248 950  248 HOH WAT A . 
M 9 HOH 249 951  249 HOH WAT A . 
M 9 HOH 250 952  250 HOH WAT A . 
M 9 HOH 251 953  251 HOH WAT A . 
M 9 HOH 252 954  252 HOH WAT A . 
M 9 HOH 253 955  253 HOH WAT A . 
M 9 HOH 254 956  254 HOH WAT A . 
M 9 HOH 255 957  255 HOH WAT A . 
M 9 HOH 256 958  256 HOH WAT A . 
M 9 HOH 257 959  257 HOH WAT A . 
M 9 HOH 258 960  258 HOH WAT A . 
M 9 HOH 259 961  259 HOH WAT A . 
M 9 HOH 260 962  260 HOH WAT A . 
M 9 HOH 261 963  261 HOH WAT A . 
M 9 HOH 262 964  262 HOH WAT A . 
M 9 HOH 263 965  263 HOH WAT A . 
M 9 HOH 264 966  264 HOH WAT A . 
M 9 HOH 265 967  265 HOH WAT A . 
M 9 HOH 266 968  266 HOH WAT A . 
M 9 HOH 267 969  267 HOH WAT A . 
M 9 HOH 268 970  268 HOH WAT A . 
M 9 HOH 269 971  269 HOH WAT A . 
M 9 HOH 270 972  270 HOH WAT A . 
M 9 HOH 271 973  271 HOH WAT A . 
M 9 HOH 272 974  272 HOH WAT A . 
M 9 HOH 273 975  273 HOH WAT A . 
M 9 HOH 274 976  274 HOH WAT A . 
M 9 HOH 275 977  275 HOH WAT A . 
M 9 HOH 276 978  276 HOH WAT A . 
M 9 HOH 277 979  277 HOH WAT A . 
M 9 HOH 278 980  278 HOH WAT A . 
M 9 HOH 279 981  279 HOH WAT A . 
M 9 HOH 280 982  280 HOH WAT A . 
M 9 HOH 281 983  281 HOH WAT A . 
M 9 HOH 282 984  282 HOH WAT A . 
M 9 HOH 283 985  283 HOH WAT A . 
M 9 HOH 284 986  284 HOH WAT A . 
M 9 HOH 285 987  285 HOH WAT A . 
M 9 HOH 286 988  286 HOH WAT A . 
M 9 HOH 287 989  287 HOH WAT A . 
M 9 HOH 288 990  288 HOH WAT A . 
M 9 HOH 289 991  289 HOH WAT A . 
M 9 HOH 290 992  290 HOH WAT A . 
M 9 HOH 291 993  291 HOH WAT A . 
M 9 HOH 292 994  292 HOH WAT A . 
M 9 HOH 293 995  293 HOH WAT A . 
M 9 HOH 294 996  294 HOH WAT A . 
M 9 HOH 295 997  295 HOH WAT A . 
M 9 HOH 296 998  296 HOH WAT A . 
M 9 HOH 297 999  297 HOH WAT A . 
M 9 HOH 298 1000 298 HOH WAT A . 
M 9 HOH 299 1001 299 HOH WAT A . 
M 9 HOH 300 1002 300 HOH WAT A . 
M 9 HOH 301 1003 301 HOH WAT A . 
M 9 HOH 302 1004 302 HOH WAT A . 
M 9 HOH 303 1005 303 HOH WAT A . 
M 9 HOH 304 1006 304 HOH WAT A . 
M 9 HOH 305 1007 305 HOH WAT A . 
M 9 HOH 306 1008 306 HOH WAT A . 
M 9 HOH 307 1009 307 HOH WAT A . 
M 9 HOH 308 1010 308 HOH WAT A . 
M 9 HOH 309 1011 309 HOH WAT A . 
M 9 HOH 310 1012 310 HOH WAT A . 
M 9 HOH 311 1013 311 HOH WAT A . 
M 9 HOH 312 1014 312 HOH WAT A . 
M 9 HOH 313 1015 313 HOH WAT A . 
M 9 HOH 314 1016 314 HOH WAT A . 
M 9 HOH 315 1017 315 HOH WAT A . 
M 9 HOH 316 1018 316 HOH WAT A . 
M 9 HOH 317 1019 317 HOH WAT A . 
M 9 HOH 318 1020 318 HOH WAT A . 
M 9 HOH 319 1021 319 HOH WAT A . 
M 9 HOH 320 1022 320 HOH WAT A . 
M 9 HOH 321 1023 321 HOH WAT A . 
M 9 HOH 322 1024 322 HOH WAT A . 
M 9 HOH 323 1025 323 HOH WAT A . 
M 9 HOH 324 1026 324 HOH WAT A . 
M 9 HOH 325 1027 325 HOH WAT A . 
M 9 HOH 326 1028 326 HOH WAT A . 
M 9 HOH 327 1029 327 HOH WAT A . 
M 9 HOH 328 1030 328 HOH WAT A . 
M 9 HOH 329 1031 329 HOH WAT A . 
M 9 HOH 330 1032 330 HOH WAT A . 
M 9 HOH 331 1033 331 HOH WAT A . 
M 9 HOH 332 1034 332 HOH WAT A . 
M 9 HOH 333 1035 333 HOH WAT A . 
M 9 HOH 334 1036 334 HOH WAT A . 
M 9 HOH 335 1037 335 HOH WAT A . 
M 9 HOH 336 1038 336 HOH WAT A . 
M 9 HOH 337 1039 337 HOH WAT A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 57  A ASN 57  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 106 A ASN 106 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 241 A ASN 241 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 341 A ASN 341 ? ASN 'GLYCOSYLATION SITE' 
5 A ASN 485 A ASN 485 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA octameric 8 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1               A,B,C,D,E,F,G,H,I,J,K,L,M 
2 1,2,3,4,5,6,7,8 A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 45570  ? 
2 MORE         -28    ? 
2 'SSA (A^2)'  155910 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_775 -x+2,-y+2,z    -1.0000000000 0.0000000000  0.0000000000 309.8480000000 0.0000000000  
-1.0000000000 0.0000000000 309.8480000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
3 'crystal symmetry operation' 3_755 -y+2,x,z       0.0000000000  -1.0000000000 0.0000000000 309.8480000000 1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
4 'crystal symmetry operation' 4_575 y,-x+2,z       0.0000000000  1.0000000000  0.0000000000 0.0000000000   -1.0000000000 
0.0000000000  0.0000000000 309.8480000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
5 'crystal symmetry operation' 5_756 -x+2,y,-z+1    -1.0000000000 0.0000000000  0.0000000000 309.8480000000 0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 127.9090000000 
6 'crystal symmetry operation' 6_576 x,-y+2,-z+1    1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 309.8480000000 0.0000000000 0.0000000000 -1.0000000000 127.9090000000 
7 'crystal symmetry operation' 7_556 y,x,-z+1       0.0000000000  1.0000000000  0.0000000000 0.0000000000   1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 127.9090000000 
8 'crystal symmetry operation' 8_776 -y+2,-x+2,-z+1 0.0000000000  -1.0000000000 0.0000000000 309.8480000000 -1.0000000000 
0.0000000000  0.0000000000 309.8480000000 0.0000000000 0.0000000000 -1.0000000000 127.9090000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CL  702 ? I CL  . 
2 1 A HOH 725 ? M HOH . 
3 1 A HOH 839 ? M HOH . 
4 1 A HOH 914 ? M HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-05 
2 'Structure model' 1 1 2008-04-02 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 2 1 2021-10-27 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Atomic model'              
6  4 'Structure model' 'Data collection'           
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Structure summary'         
9  5 'Structure model' Advisory                    
10 5 'Structure model' 'Database references'       
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' pdbx_struct_special_symmetry  
14 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
19 5 'Structure model' chem_comp                     
20 5 'Structure model' database_2                    
21 5 'Structure model' pdbx_unobs_or_zero_occ_atoms  
22 5 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                     
2  4 'Structure model' '_atom_site.auth_seq_id'                      
3  4 'Structure model' '_atom_site.label_asym_id'                    
4  4 'Structure model' '_atom_site.label_entity_id'                  
5  4 'Structure model' '_chem_comp.name'                             
6  4 'Structure model' '_chem_comp.type'                             
7  4 'Structure model' '_entity.formula_weight'                      
8  4 'Structure model' '_entity.pdbx_description'                    
9  4 'Structure model' '_entity.pdbx_number_of_molecules'            
10 4 'Structure model' '_entity.src_method'                          
11 4 'Structure model' '_entity.type'                                
12 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
13 4 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
14 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
15 4 'Structure model' '_struct_conn.pdbx_role'                      
16 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
19 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
20 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
21 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
22 5 'Structure model' '_chem_comp.pdbx_synonyms'                    
23 5 'Structure model' '_database_2.pdbx_DOI'                        
24 5 'Structure model' '_database_2.pdbx_database_accession'         
25 5 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       0.9       ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
CNS    phasing          .         ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  A SER 198 ? ? P1 A VXA 601  ? ? 1.63 
2 1 OE1 A GLN 176 ? ? O  A HOH 968  ? ? 2.14 
3 1 N   A ARG 453 ? ? O  A HOH 1017 ? ? 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 43  ? ? 79.79   -7.94   
2  1 ASP A 54  ? ? 86.60   178.93  
3  1 ALA A 58  ? ? -105.35 63.67   
4  1 ASN A 106 ? ? -165.43 62.03   
5  1 PRO A 157 ? ? -39.32  125.26  
6  1 ALA A 162 ? ? -161.66 70.75   
7  1 SER A 198 ? ? 56.40   -118.69 
8  1 SER A 287 ? ? 35.35   56.59   
9  1 PHE A 398 ? ? -130.08 -61.06  
10 1 PRO A 480 ? ? -71.04  44.59   
11 1 ASN A 485 ? ? -97.57  48.27   
12 1 GLU A 506 ? ? -53.90  -83.11  
13 1 PHE A 525 ? ? -75.23  -70.42  
14 1 PRO A 527 ? ? -58.51  -9.89   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 0 A ILE 4   ? CG1 ? A ILE 4   CG1 
2   1 Y 0 A ILE 4   ? CG2 ? A ILE 4   CG2 
3   1 Y 0 A ILE 5   ? CD1 ? A ILE 5   CD1 
4   1 Y 0 A LYS 9   ? NZ  ? A LYS 9   NZ  
5   1 Y 0 A LYS 12  ? CE  ? A LYS 12  CE  
6   1 Y 0 A LYS 12  ? NZ  ? A LYS 12  NZ  
7   1 Y 0 A GLN 17  ? OE1 ? A GLN 17  OE1 
8   1 Y 0 A GLN 17  ? NE2 ? A GLN 17  NE2 
9   1 Y 0 A GLN 35  ? CD  ? A GLN 35  CD  
10  1 Y 0 A GLN 35  ? OE1 ? A GLN 35  OE1 
11  1 Y 0 A ARG 40  ? CZ  ? A ARG 40  CZ  
12  1 Y 0 A ARG 40  ? NH1 ? A ARG 40  NH1 
13  1 Y 0 A ARG 40  ? NH2 ? A ARG 40  NH2 
14  1 Y 0 A LYS 44  ? CE  ? A LYS 44  CE  
15  1 Y 0 A LYS 44  ? NZ  ? A LYS 44  NZ  
16  1 Y 0 A GLN 47  ? OE1 ? A GLN 47  OE1 
17  1 Y 0 A SER 48  ? OG  ? A SER 48  OG  
18  1 Y 0 A LEU 49  ? CD2 ? A LEU 49  CD2 
19  1 Y 0 A LYS 51  ? CB  ? A LYS 51  CB  
20  1 Y 0 A LYS 51  ? CG  ? A LYS 51  CG  
21  1 Y 0 A LYS 51  ? CD  ? A LYS 51  CD  
22  1 Y 0 A LYS 51  ? CE  ? A LYS 51  CE  
23  1 Y 0 A LYS 51  ? NZ  ? A LYS 51  NZ  
24  1 Y 0 A ASP 54  ? CB  ? A ASP 54  CB  
25  1 Y 0 A ASP 54  ? CG  ? A ASP 54  CG  
26  1 Y 0 A ASP 54  ? OD1 ? A ASP 54  OD1 
27  1 Y 0 A ASP 54  ? OD2 ? A ASP 54  OD2 
28  1 Y 0 A LYS 60  ? CD  ? A LYS 60  CD  
29  1 Y 0 A LYS 60  ? CE  ? A LYS 60  CE  
30  1 Y 0 A GLN 71  ? NE2 ? A GLN 71  NE2 
31  1 Y 0 A GLN 176 ? CD  ? A GLN 176 CD  
32  1 Y 0 A GLN 176 ? NE2 ? A GLN 176 NE2 
33  1 Y 0 A LYS 190 ? CD  ? A LYS 190 CD  
34  1 Y 0 A LYS 190 ? NZ  ? A LYS 190 NZ  
35  1 Y 0 A LEU 236 ? CD1 ? A LEU 236 CD1 
36  1 Y 0 A LEU 236 ? CD2 ? A LEU 236 CD2 
37  1 Y 0 A TYR 237 ? CG  ? A TYR 237 CG  
38  1 Y 0 A TYR 237 ? CD1 ? A TYR 237 CD1 
39  1 Y 0 A TYR 237 ? CE1 ? A TYR 237 CE1 
40  1 Y 0 A TYR 237 ? CZ  ? A TYR 237 CZ  
41  1 Y 0 A TYR 237 ? OH  ? A TYR 237 OH  
42  1 Y 0 A ARG 240 ? CD  ? A ARG 240 CD  
43  1 Y 0 A LYS 248 ? CG  ? A LYS 248 CG  
44  1 Y 0 A LYS 248 ? CE  ? A LYS 248 CE  
45  1 Y 0 A LYS 248 ? NZ  ? A LYS 248 NZ  
46  1 Y 0 A ASN 256 ? OD1 ? A ASN 256 OD1 
47  1 Y 0 A GLU 259 ? CG  ? A GLU 259 CG  
48  1 Y 0 A GLU 259 ? CD  ? A GLU 259 CD  
49  1 Y 0 A GLU 259 ? OE1 ? A GLU 259 OE1 
50  1 Y 0 A GLU 259 ? OE2 ? A GLU 259 OE2 
51  1 Y 0 A LYS 262 ? NZ  ? A LYS 262 NZ  
52  1 Y 0 A ASP 268 ? OD1 ? A ASP 268 OD1 
53  1 Y 0 A ASP 268 ? OD2 ? A ASP 268 OD2 
54  1 Y 0 A LEU 274 ? CD1 ? A LEU 274 CD1 
55  1 Y 0 A LEU 274 ? CD2 ? A LEU 274 CD2 
56  1 Y 0 A PHE 278 ? CZ  ? A PHE 278 CZ  
57  1 Y 0 A PRO 281 ? CG  ? A PRO 281 CG  
58  1 Y 0 A PRO 281 ? CD  ? A PRO 281 CD  
59  1 Y 0 A TYR 282 ? CD2 ? A TYR 282 CD2 
60  1 Y 0 A TYR 282 ? CZ  ? A TYR 282 CZ  
61  1 Y 0 A TYR 282 ? OH  ? A TYR 282 OH  
62  1 Y 0 A ASP 304 ? OD1 ? A ASP 304 OD1 
63  1 Y 0 A ASP 304 ? OD2 ? A ASP 304 OD2 
64  1 Y 0 A LYS 323 ? NZ  ? A LYS 323 NZ  
65  1 Y 0 A ASN 342 ? ND2 ? A ASN 342 ND2 
66  1 Y 0 A LYS 348 ? CD  ? A LYS 348 CD  
67  1 Y 0 A LYS 348 ? CE  ? A LYS 348 CE  
68  1 Y 0 A LYS 348 ? NZ  ? A LYS 348 NZ  
69  1 Y 0 A GLU 352 ? OE1 ? A GLU 352 OE1 
70  1 Y 0 A GLU 352 ? OE2 ? A GLU 352 OE2 
71  1 Y 0 A GLU 367 ? OE2 ? A GLU 367 OE2 
72  1 Y 0 A ASP 375 ? OD1 ? A ASP 375 OD1 
73  1 Y 0 A ASP 375 ? OD2 ? A ASP 375 OD2 
74  1 Y 0 A VAL 377 ? CG1 ? A VAL 377 CG1 
75  1 Y 0 A VAL 377 ? CG2 ? A VAL 377 CG2 
76  1 Y 0 A GLU 383 ? CD  ? A GLU 383 CD  
77  1 Y 0 A GLU 383 ? OE2 ? A GLU 383 OE2 
78  1 Y 0 A LYS 407 ? CD  ? A LYS 407 CD  
79  1 Y 0 A LYS 407 ? CE  ? A LYS 407 CE  
80  1 Y 0 A LYS 407 ? NZ  ? A LYS 407 NZ  
81  1 Y 0 A LYS 408 ? CD  ? A LYS 408 CD  
82  1 Y 0 A GLU 432 ? OE1 ? A GLU 432 OE1 
83  1 Y 0 A GLU 432 ? OE2 ? A GLU 432 OE2 
84  1 Y 0 A GLU 451 ? CD  ? A GLU 451 CD  
85  1 Y 0 A GLU 451 ? OE1 ? A GLU 451 OE1 
86  1 Y 0 A ARG 452 ? NE  ? A ARG 452 NE  
87  1 Y 0 A ARG 453 ? CG  ? A ARG 453 CG  
88  1 Y 0 A LYS 458 ? CE  ? A LYS 458 CE  
89  1 Y 0 A GLU 461 ? CD  ? A GLU 461 CD  
90  1 Y 1 A GLN 486 ? CG  ? A GLN 486 CG  
91  1 Y 1 A GLN 486 ? CD  ? A GLN 486 CD  
92  1 Y 1 A GLN 486 ? OE1 ? A GLN 486 OE1 
93  1 Y 1 A GLN 486 ? NE2 ? A GLN 486 NE2 
94  1 Y 0 A GLU 497 ? OE1 ? A GLU 497 OE1 
95  1 Y 0 A GLU 497 ? OE2 ? A GLU 497 OE2 
96  1 Y 0 A GLN 498 ? NE2 ? A GLN 498 NE2 
97  1 Y 0 A GLU 506 ? O   ? A GLU 506 O   
98  1 Y 0 A GLU 506 ? CD  ? A GLU 506 CD  
99  1 Y 0 A GLU 506 ? OE1 ? A GLU 506 OE1 
100 1 Y 0 A GLU 506 ? OE2 ? A GLU 506 OE2 
101 1 Y 0 A SER 507 ? CB  ? A SER 507 CB  
102 1 Y 0 A SER 507 ? OG  ? A SER 507 OG  
103 1 Y 0 A PHE 525 ? CD1 ? A PHE 525 CD1 
104 1 Y 0 A PHE 525 ? CZ  ? A PHE 525 CZ  
105 1 N 0 B NAG 1   ? C7  ? B NAG ?   C7  
106 1 N 0 B NAG 1   ? C8  ? B NAG ?   C8  
107 1 N 0 B NAG 2   ? O3  ? B NAG ?   O3  
108 1 N 0 B NAG 2   ? O4  ? B NAG ?   O4  
109 1 N 0 B NAG 2   ? O6  ? B NAG ?   O6  
110 1 N 0 B FUC 3   ? O2  ? B FUC ?   O2  
111 1 N 0 C NAG 2   ? C5  ? C NAG ?   C5  
112 1 N 0 C NAG 2   ? O4  ? C NAG ?   O4  
113 1 N 0 C NAG 2   ? O6  ? C NAG ?   O6  
114 1 N 0 C NAG 2   ? O7  ? C NAG ?   O7  
115 1 N 0 C FUC 3   ? C2  ? C FUC ?   C2  
116 1 N 0 A NAG 537 ? C4  ? E NAG ?   C4  
117 1 N 0 A NAG 537 ? C8  ? E NAG ?   C8  
118 1 N 0 A NAG 537 ? O3  ? E NAG ?   O3  
119 1 N 0 A NAG 538 ? C4  ? F NAG ?   C4  
120 1 N 0 A NAG 538 ? C6  ? F NAG ?   C6  
121 1 N 0 A NAG 538 ? O3  ? F NAG ?   O3  
122 1 N 0 A NAG 538 ? O5  ? F NAG ?   O5  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 1   ? A GLU 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A ASP 3   ? A ASP 3   
4 1 Y 1 A GLU 255 ? A GLU 255 
5 1 Y 1 A ASP 378 ? A ASP 378 
6 1 Y 1 A ASP 379 ? A ASP 379 
7 1 Y 1 A GLN 455 ? A GLN 455 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 S NAG 1  n 
B 2 NAG 2 B NAG 2 S NAG 2  n 
B 2 FUC 3 B FUC 3 S FUC 3  n 
C 2 NAG 1 C NAG 1 S NAG 11 n 
C 2 NAG 2 C NAG 2 S NAG 12 n 
C 2 FUC 3 C FUC 3 S FUC 13 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose          NAG 
4 'SULFATE ION'                                     SO4 
5 'CHLORIDE ION'                                    CL  
6 'METHYLPHOSPHONIC ACID ESTER GROUP'               VXA 
7 '2-(BUTYRYLSULFANYL)-N,N,N-TRIMETHYLETHANAMINIUM' BCH 
8 GLYCEROL                                          GOL 
9 water                                             HOH 
#