data_1P3A
# 
_entry.id   1P3A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P3A         
NDB   PD0414       
RCSB  RCSB018953   
WWPDB D_1000018953 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'X-ray structure of the Nucleosome Core Particle at 2.8 A' unspecified 
PDB 1F66 '2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2A.Z' unspecified 
PDB 1ID3 
;Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental 
Differences In Inter-Nucleosome Interactions
;
unspecified 
PDB 1KX3 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution' unspecified 
PDB 1KX4 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146B, At 2.6 A Resolution' unspecified 
PDB 1KX5 'X-Ray Structure Of The Nucleosome Core Particle, Ncp147, At 1.9 A Resolution' unspecified 
PDB 1P34 . unspecified 
PDB 1P3B . unspecified 
PDB 1P3F . unspecified 
PDB 1P3G . unspecified 
PDB 1P3I . unspecified 
PDB 1P3K . unspecified 
PDB 1P3L . unspecified 
PDB 1P3M . unspecified 
PDB 1P3O . unspecified 
PDB 1P3P . unspecified 
# 
_pdbx_database_status.entry_id                        1P3A 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muthurajan, U.M.'       1 
'Bao, Y.'                2 
'Forsberg, L.J.'         3 
'Edayathumangalam, R.S.' 4 
'Dyer, P.N.'             5 
'White, C.L.'            6 
'Luger, K.'              7 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            23 
_citation.page_first                260 
_citation.page_last                 271 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14739929 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muthurajan, U.M.'       1 
primary 'Bao, Y.'                2 
primary 'Forsberg, L.J.'         3 
primary 'Edayathumangalam, R.S.' 4 
primary 'Dyer, P.N.'             5 
primary 'White, C.L.'            6 
primary 'Luger, K.'              7 
# 
_cell.entry_id           1P3A 
_cell.length_a           105.423 
_cell.length_b           109.721 
_cell.length_c           180.902 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P3A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Palindromic 146bp Human Alpha-Satellite DNA fragment' 45054.844 2   ? ? ? ? 
2 polymer man 'Histone H3'                                           15344.893 2   ? ? ? ? 
3 polymer man 'Histone H4'                                           11263.231 2   ? ? ? ? 
4 polymer man 'Histone H2A'                                          13962.241 2   ? ? ? ? 
5 polymer man 'Histone H2B'                                          13834.070 2   ? ? ? ? 
6 water   nat water                                                  18.015    104 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKHVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKHVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLU n 
2 35  SER n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 HIS n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 ALA n 
4 124 LYS n 
4 125 SER n 
4 126 ALA n 
4 127 LYS n 
4 128 SER n 
4 129 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'HB 101'         ? ? ? ? ? ? Plasmid ? ? ? pUC ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q7ZT64_9ZZZZ Q7ZT64 2 2 ? ? 
2 UNP H4_XENLA     P62799 3 1 ? ? 
3 UNP Q7ZT66_9ZZZZ Q7ZT66 4 2 ? ? 
4 UNP H2B1_XENLA   P02281 5 1 ? ? 
5 PDB 1P3A         1P3A   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1P3A A 1 ? 135 ? Q7ZT64 2   ? 136 ? 401  535  
2  2 1P3A B 1 ? 102 ? P62799 1   ? 102 ? 1    102  
3  3 1P3A C 1 ? 129 ? Q7ZT66 2   ? 130 ? 801  929  
4  4 1P3A D 1 ? 125 ? P02281 1   ? 125 ? 1198 1322 
5  1 1P3A E 1 ? 135 ? Q7ZT64 2   ? 136 ? 601  735  
6  2 1P3A F 1 ? 102 ? P62799 1   ? 102 ? 201  302  
7  3 1P3A G 1 ? 129 ? Q7ZT66 2   ? 130 ? 1001 1129 
8  4 1P3A H 1 ? 125 ? P02281 1   ? 125 ? 1398 1522 
9  5 1P3A I 1 ? 146 ? 1P3A   1   ? 146 ? 1    146  
10 5 1P3A J 1 ? 146 ? 1P3A   147 ? 292 ? 147  292  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P3A GLU A 34  ? UNP Q7ZT64 GLY 35  CONFLICT 434  1  
1 1P3A SER A 35  ? UNP Q7ZT64 VAL 36  CONFLICT 435  2  
1 1P3A ALA A 102 ? UNP Q7ZT64 GLY 103 CONFLICT 502  3  
1 1P3A HIS A 116 ? UNP Q7ZT64 ARG 117 CONFLICT 516  4  
5 1P3A GLU E 34  ? UNP Q7ZT64 GLY 35  CONFLICT 634  5  
5 1P3A SER E 35  ? UNP Q7ZT64 VAL 36  CONFLICT 635  6  
5 1P3A ALA E 102 ? UNP Q7ZT64 GLY 103 CONFLICT 702  7  
5 1P3A HIS E 116 ? UNP Q7ZT64 ARG 117 CONFLICT 716  8  
3 1P3A ALA C 14  ? UNP Q7ZT66 SER 15  CONFLICT 814  9  
3 1P3A GLY C 67  ? UNP Q7ZT66 TRP 68  CONFLICT 867  10 
3 1P3A ASN C 68  ? UNP Q7ZT66 GLU 69  CONFLICT 868  11 
3 1P3A ALA C 69  ? UNP Q7ZT66 ARG 70  CONFLICT 869  12 
3 1P3A ALA C 70  ? UNP Q7ZT66 LEU 71  CONFLICT 870  13 
3 1P3A ARG C 71  ? UNP Q7ZT66 PRO 72  CONFLICT 871  14 
3 1P3A ASP C 72  ? UNP Q7ZT66 GLU 73  CONFLICT 872  15 
3 1P3A ASN C 73  ? UNP Q7ZT66 ILE 74  CONFLICT 873  16 
3 1P3A LYS C 74  ? UNP Q7ZT66 TRP 75  CONFLICT 874  17 
3 1P3A THR C 76  ? UNP Q7ZT66 ARG 77  CONFLICT 876  18 
3 1P3A ARG C 77  ? UNP Q7ZT66 PRO 78  CONFLICT 877  19 
3 1P3A ILE C 78  ? UNP Q7ZT66 VAL 79  CONFLICT 878  20 
3 1P3A ILE C 79  ? UNP Q7ZT66 LEU 80  CONFLICT 879  21 
3 1P3A PRO C 80  ? UNP Q7ZT66 SER 81  CONFLICT 880  22 
3 1P3A ARG C 81  ? UNP Q7ZT66 PRO 82  CONFLICT 881  23 
3 1P3A HIS C 82  ? UNP Q7ZT66 GLY 83  CONFLICT 882  24 
3 1P3A LEU C 83  ? UNP Q7ZT66 TRP 84  CONFLICT 883  25 
3 1P3A GLN C 84  ? UNP Q7ZT66 CYS 85  CONFLICT 884  26 
3 1P3A LEU C 85  ? UNP Q7ZT66 ASN 86  CONFLICT 885  27 
3 1P3A ALA C 86  ? UNP Q7ZT66 SER 87  CONFLICT 886  28 
3 1P3A VAL C 87  ? UNP Q7ZT66 LEU 88  CONFLICT 887  29 
3 1P3A ARG C 88  ? UNP Q7ZT66 CYS 89  CONFLICT 888  30 
3 1P3A ALA C 123 ? UNP Q7ZT66 SER 124 CONFLICT 923  31 
3 1P3A ALA C 126 ? UNP Q7ZT66 THR 127 CONFLICT 926  32 
7 1P3A ALA G 14  ? UNP Q7ZT66 SER 15  CONFLICT 1014 33 
7 1P3A GLY G 67  ? UNP Q7ZT66 TRP 68  CONFLICT 1067 34 
7 1P3A ASN G 68  ? UNP Q7ZT66 GLU 69  CONFLICT 1068 35 
7 1P3A ALA G 69  ? UNP Q7ZT66 ARG 70  CONFLICT 1069 36 
7 1P3A ALA G 70  ? UNP Q7ZT66 LEU 71  CONFLICT 1070 37 
7 1P3A ARG G 71  ? UNP Q7ZT66 PRO 72  CONFLICT 1071 38 
7 1P3A ASP G 72  ? UNP Q7ZT66 GLU 73  CONFLICT 1072 39 
7 1P3A ASN G 73  ? UNP Q7ZT66 ILE 74  CONFLICT 1073 40 
7 1P3A LYS G 74  ? UNP Q7ZT66 TRP 75  CONFLICT 1074 41 
7 1P3A THR G 76  ? UNP Q7ZT66 ARG 77  CONFLICT 1076 42 
7 1P3A ARG G 77  ? UNP Q7ZT66 PRO 78  CONFLICT 1077 43 
7 1P3A ILE G 78  ? UNP Q7ZT66 VAL 79  CONFLICT 1078 44 
7 1P3A ILE G 79  ? UNP Q7ZT66 LEU 80  CONFLICT 1079 45 
7 1P3A PRO G 80  ? UNP Q7ZT66 SER 81  CONFLICT 1080 46 
7 1P3A ARG G 81  ? UNP Q7ZT66 PRO 82  CONFLICT 1081 47 
7 1P3A HIS G 82  ? UNP Q7ZT66 GLY 83  CONFLICT 1082 48 
7 1P3A LEU G 83  ? UNP Q7ZT66 TRP 84  CONFLICT 1083 49 
7 1P3A GLN G 84  ? UNP Q7ZT66 CYS 85  CONFLICT 1084 50 
7 1P3A LEU G 85  ? UNP Q7ZT66 ASN 86  CONFLICT 1085 51 
7 1P3A ALA G 86  ? UNP Q7ZT66 SER 87  CONFLICT 1086 52 
7 1P3A VAL G 87  ? UNP Q7ZT66 LEU 88  CONFLICT 1087 53 
7 1P3A ARG G 88  ? UNP Q7ZT66 CYS 89  CONFLICT 1088 54 
7 1P3A ALA G 123 ? UNP Q7ZT66 SER 124 CONFLICT 1123 55 
7 1P3A ALA G 126 ? UNP Q7ZT66 THR 127 CONFLICT 1126 56 
4 1P3A GLN D 22  ? UNP P02281 PRO 23  CONFLICT 1219 57 
4 1P3A LEU D 45  ? UNP P02281 MET 46  CONFLICT 1242 58 
4 1P3A SER D 60  ? UNP P02281 GLY 61  CONFLICT 1257 59 
4 1P3A VAL D 69  ? UNP P02281 ILE 70  CONFLICT 1266 60 
8 1P3A GLN H 22  ? UNP P02281 PRO 23  CONFLICT 1419 61 
8 1P3A LEU H 45  ? UNP P02281 MET 46  CONFLICT 1442 62 
8 1P3A SER H 60  ? UNP P02281 GLY 61  CONFLICT 1457 63 
8 1P3A VAL H 69  ? UNP P02281 ILE 70  CONFLICT 1466 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1P3A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.45 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'MnCl2, KCl, Potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'Potassium cacodylate' ? ? ? 
1 4 2 MnCl2                  ? ? ? 
1 5 2 KCl                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-11-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
# 
_reflns.entry_id                     1P3A 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3. 
_reflns.d_resolution_high            3.00 
_reflns.d_resolution_low             50. 
_reflns.number_all                   ? 
_reflns.number_obs                   35511 
_reflns.percent_possible_obs         83.3 
_reflns.pdbx_Rmerge_I_obs            0.1 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.07 
_reflns_shell.percent_possible_all   86.8 
_reflns_shell.Rmerge_I_obs           0.282 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P3A 
_refine.ls_d_res_high                            3.00 
_refine.ls_d_res_low                             50. 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     35141 
_refine.ls_number_reflns_obs                     33739 
_refine.ls_number_reflns_R_free                  1402 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.26 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 4.4 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5945 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               12029 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d   1.41  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.41  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P3A 
_struct.title                     
;Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
;
_struct.pdbx_descriptor           'Nucleosome Core Particle/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P3A 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
'Sin mutants, Nucleosome Core Particle, chromatin, protein/DNA interaction, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 463  ASP A 477  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 520  ARG A 531  1 ? 12 
HELX_P HELX_P5  5  ASN D 25  ? ILE D 29  ? ASN B 25   ILE B 29   5 ? 5  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLY D 94  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9  9  THR E 16  ? GLY E 22  ? THR C 816  GLY C 822  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASP E 72  ? ALA C 845  ASP C 872  1 ? 28 
HELX_P HELX_P12 12 ILE E 79  ? ASP E 90  ? ILE C 879  ASP C 890  1 ? 12 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? SER F 123 ? PRO D 1300 SER D 1320 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? ASP G 77  ? ARG E 663  ASP E 677  1 ? 15 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? ARG G 131 ? MET E 720  ARG E 731  1 ? 12 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? ALA I 21  ? THR G 1016 ALA G 1021 1 ? 6  
HELX_P HELX_P28 28 PRO I 26  ? LYS I 36  ? PRO G 1026 LYS G 1036 1 ? 11 
HELX_P HELX_P29 29 GLY I 46  ? ASN I 73  ? GLY G 1046 ASN G 1073 1 ? 28 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P36 36 PRO J 103 ? SER J 123 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog4   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog10  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog15  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 137 N1 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B DG 137 O6 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT 136 N3 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog21  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog22  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 N3 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DG 15  N2 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DG 15  O6 ? ? ? 1_555 B DC 132 N4 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog28  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? A DG 18  N2 ? ? ? 1_555 B DC 129 O2 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? A DG 18  O6 ? ? ? 1_555 B DC 129 N4 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 21  J DA 272 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog36  hydrog ? ? A DC 22  N3 ? ? ? 1_555 B DG 125 N1 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 125 N2 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA 124 N6 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog40  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog41  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 25  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog42  hydrog ? ? A DC 26  N3 ? ? ? 1_555 B DG 121 N1 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DC 26  N4 ? ? ? 1_555 B DG 121 O6 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DG 121 N2 ? ? I DA 27  J DG 267 1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
hydrog46  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 28  J DT 264 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog47  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 116 N4 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B DA 115 N1 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B DA 115 N6 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DG 33  N2 ? ? ? 1_555 B DC 114 O2 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DG 33  O6 ? ? ? 1_555 B DC 114 N4 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DC 108 N4 ? ? I DT 38  J DC 254 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog68  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 108 N4 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog74  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog75  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog78  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DA 102 N6 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B DC 101 O2 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B DC 101 N4 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DA 99  N6 ? ? I DC 47  J DA 245 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ? ? 
hydrog84  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog85  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DC 49  N3 ? ? ? 1_555 B DG 98  N1 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DC 49  N4 ? ? ? 1_555 B DG 98  O6 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? A DC 50  N3 ? ? ? 1_555 B DG 97  N1 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DC 50  N4 ? ? ? 1_555 B DG 97  O6 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog94  hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog97  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DA 56  N1 ? ? ? 1_555 B DT 91  N3 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog109 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DA 61  N6 ? ? ? 1_555 B DT 86  O4 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog112 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DC 69  N3 ? ? ? 1_555 B DG 78  N1 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B DG 78  O6 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog131 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N1 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog143 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog144 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 58  N1 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 58  O6 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog178 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog179 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 45  O4 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 44  O2 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DG 103 O6 ? ? ? 1_555 B DC 44  N4 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N2 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog214 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog224 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog227 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B DA 30  N6 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 28  N6 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog241 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DA 27  N1 ? ? I DG 121 J DA 173 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ? ? 
hydrog242 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B DC 25  N3 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 25  O2 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 122 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog246 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DA 124 N6 ? ? ? 1_555 B DT 23  O4 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DG 125 N2 ? ? ? 1_555 B DC 22  O2 ? ? I DG 125 J DC 168 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog249 hydrog ? ? A DA 126 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 127 J DT 167 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog254 hydrog ? ? A DT 128 N3 ? ? ? 1_555 B DA 19  N1 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DT 128 O4 ? ? ? 1_555 B DA 19  N6 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B DG 18  N1 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DC 129 N4 ? ? ? 1_555 B DG 18  O6 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DC 16  N3 ? ? I DT 130 J DC 162 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog260 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DC 16  N4 ? ? I DT 130 J DC 162 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog261 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog262 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog270 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog271 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B DC 13  O2 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? A DG 134 O6 ? ? ? 1_555 B DC 13  N4 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog282 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog283 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog292 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog293 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog294 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog295 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog296 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog297 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 80  ? VAL D 81  ? THR B 80   VAL B 81   
B 1 THR C 118 ? ILE C 119 ? THR A 518  ILE A 519  
B 2 ARG D 45  ? ILE D 46  ? ARG B 45   ILE B 46   
C 1 LEU D 97  ? TYR D 98  ? LEU B 97   TYR B 98   
C 2 THR I 101 ? ILE I 102 ? THR G 1101 ILE G 1102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 842  VAL C 843  
D 2 THR F 88  ? ILE F 89  ? THR D 1285 ILE D 1286 
E 1 ARG E 77  ? ILE E 78  ? ARG C 877  ILE C 878  
E 2 GLY F 53  ? ILE F 54  ? GLY D 1250 ILE D 1251 
F 1 VAL E 100 ? ILE E 102 ? VAL C 900  ILE C 902  
F 2 THR H 96  ? TYR H 98  ? THR F 296  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 80  ? VAL H 81  ? THR F 280  VAL F 281  
H 1 THR G 118 ? ILE G 119 ? THR E 718  ILE E 719  
H 2 ARG H 45  ? ILE H 46  ? ARG F 245  ILE F 246  
I 1 ARG I 42  ? VAL I 43  ? ARG G 1042 VAL G 1043 
I 2 THR J 88  ? ILE J 89  ? THR H 1485 ILE H 1486 
J 1 ARG I 77  ? ILE I 78  ? ARG G 1077 ILE G 1078 
J 2 GLY J 53  ? ILE J 54  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 81  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O ARG D 45  ? O ARG B 45   
C 1 2 N TYR D 98  ? N TYR B 98   O THR I 101 ? O THR G 1101 
D 1 2 N ARG E 42  ? N ARG C 842  O ILE F 89  ? O ILE D 1286 
E 1 2 N ILE E 78  ? N ILE C 878  O GLY F 53  ? O GLY D 1250 
F 1 2 N THR E 101 ? N THR C 901  O TYR H 98  ? O TYR F 298  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 81  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O ARG H 45  ? O ARG F 245  
I 1 2 N ARG I 42  ? N ARG G 1042 O ILE J 89  ? O ILE H 1486 
J 1 2 N ILE I 78  ? N ILE G 1078 O GLY J 53  ? O GLY H 1450 
# 
_atom_sites.entry_id                    1P3A 
_atom_sites.fract_transf_matrix[1][1]   0.009486 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009114 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005528 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? 51.219  54.741 -91.928 1.00 173.82 ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? 50.801  55.275 -93.188 1.00 173.02 ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? 49.533  54.626 -93.695 1.00 171.99 ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? 49.784  53.226 -93.988 1.00 171.51 ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? 48.381  54.647 -92.690 1.00 171.41 ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? 47.134  54.893 -93.342 1.00 170.74 ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? 48.386  53.244 -92.115 1.00 171.26 ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? 48.846  52.412 -93.296 1.00 170.29 ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? 49.513  51.169 -92.899 1.00 131.59 ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? 50.732  51.023 -92.275 1.00 130.91 ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? 51.043  49.776 -92.006 1.00 130.22 ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? 49.963  49.050 -92.492 1.00 129.94 ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? 49.679  47.672 -92.510 1.00 129.01 ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? 50.480  46.739 -91.990 1.00 128.44 ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? 48.523  47.282 -93.083 1.00 128.65 ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? 47.710  48.217 -93.593 1.00 129.11 ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? 47.861  49.537 -93.629 1.00 129.68 ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? 49.019  49.895 -93.057 1.00 130.40 ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? 45.773  54.867 -92.486 1.00 160.19 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? 44.883  55.944 -92.976 1.00 156.10 ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? 46.126  54.809 -91.045 1.00 155.72 ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? 45.110  53.482 -92.886 1.00 158.09 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? 44.815  53.196 -94.245 1.00 154.87 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? 43.811  52.074 -94.324 1.00 152.89 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? 44.426  50.845 -93.872 1.00 152.14 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? 42.589  52.283 -93.439 1.00 151.62 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? 41.458  51.720 -94.094 1.00 150.81 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? 42.936  51.514 -92.177 1.00 151.30 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? 43.758  50.352 -92.719 1.00 150.55 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? 44.792  49.820 -91.802 1.00 144.34 ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? 44.837  48.460 -91.591 1.00 143.07 ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? 44.047  47.678 -92.099 1.00 142.72 ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? 45.848  48.046 -90.757 1.00 141.85 ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? 46.788  48.838 -90.126 1.00 141.29 ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? 47.650  48.325 -89.417 1.00 140.19 ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? 46.667  50.248 -90.373 1.00 141.92 ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? 47.626  51.178 -89.707 1.00 141.28 ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? 45.692  50.666 -91.189 1.00 143.01 ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? 40.078  51.583 -93.303 1.00 173.06 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? 38.959  51.564 -94.281 1.00 131.17 ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? 40.122  52.615 -92.239 1.00 131.75 ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? 40.170  50.146 -92.625 1.00 171.55 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? 40.249  48.965 -93.423 1.00 168.06 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? 40.043  47.740 -92.563 1.00 165.11 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? 41.204  47.515 -91.728 1.00 163.80 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? 38.858  47.858 -91.609 1.00 163.28 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? 38.221  46.595 -91.456 1.00 160.83 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? 39.504  48.255 -90.297 1.00 162.64 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? 40.813  47.490 -90.362 1.00 161.78 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? 41.909  48.062 -89.560 1.00 117.36 ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? 42.799  47.196 -88.932 1.00 115.40 ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? 42.642  45.983 -89.070 1.00 114.42 ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? 43.808  47.701 -88.193 1.00 114.21 ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? 43.946  49.023 -88.071 1.00 113.82 ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? 44.966  49.483 -87.335 1.00 112.85 ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? 43.048  49.935 -88.700 1.00 114.35 ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? 42.054  49.415 -89.429 1.00 116.00 ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? 36.722  46.542 -90.901 1.00 130.56 ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? 35.801  46.364 -92.052 1.00 120.60 ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? 36.580  47.714 -89.999 1.00 119.72 ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? 36.655  45.219 -90.027 1.00 126.26 ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? 37.101  43.984 -90.559 1.00 119.50 ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? 37.559  43.086 -89.438 1.00 114.80 ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? 38.729  43.653 -88.796 1.00 112.84 ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? 36.518  42.908 -88.336 1.00 112.39 ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? 36.579  41.565 -87.879 1.00 109.38 ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? 36.980  43.864 -87.252 1.00 111.80 ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? 38.487  43.785 -87.401 1.00 111.36 ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? 39.237  44.947 -86.915 1.00 98.68  ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? 38.962  46.285 -87.070 1.00 98.01  ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? 39.863  47.076 -86.534 1.00 97.57  ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? 40.789  46.198 -85.981 1.00 97.08  ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? 41.998  46.402 -85.275 1.00 96.65  ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? 42.511  47.601 -84.992 1.00 96.29  ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? 42.673  45.309 -84.866 1.00 96.22  ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? 42.170  44.101 -85.148 1.00 96.09  ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? 41.059  43.781 -85.800 1.00 95.74  ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? 40.408  44.886 -86.199 1.00 97.55  ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? 35.517  41.040 -86.805 1.00 97.16  ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? 34.747  39.942 -87.426 1.00 95.22  ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? 34.807  42.201 -86.190 1.00 95.06  ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? 36.447  40.401 -85.696 1.00 96.36  ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? 37.658  39.747 -86.065 1.00 93.54  ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? 38.523  39.554 -84.846 1.00 91.90  ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? 39.291  40.750 -84.562 1.00 88.72  ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? 37.689  39.261 -83.603 1.00 91.78  ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? 38.313  38.221 -82.853 1.00 93.45  ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? 37.648  40.599 -82.882 1.00 88.44  ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? 38.982  41.237 -83.266 1.00 87.74  ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? 38.976  42.699 -83.338 1.00 83.70  ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? 38.108  43.500 -84.042 1.00 84.08  ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? 38.366  44.783 -83.938 1.00 82.45  ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? 39.472  44.831 -83.104 1.00 81.29  ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? 40.236  45.903 -82.612 1.00 80.11  ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? 39.997  47.181 -82.903 1.00 78.66  ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? 41.275  45.614 -81.804 1.00 80.97  ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? 41.529  44.331 -81.525 1.00 80.86  ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? 40.887  43.232 -81.931 1.00 81.44  ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? 39.856  43.556 -82.725 1.00 82.51  ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? 37.534  37.548 -81.627 1.00 104.21 ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? 37.607  36.068 -81.758 1.00 91.15  ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? 36.209  38.232 -81.493 1.00 90.75  ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? 38.435  37.984 -80.400 1.00 103.23 ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? 38.984  39.282 -80.400 1.00 99.85  ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? 39.978  39.441 -79.287 1.00 95.93  ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? 40.466  40.793 -79.403 1.00 95.50  ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? 39.347  39.334 -77.907 1.00 95.19  ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? 40.317  38.831 -76.986 1.00 96.07  ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? 38.946  40.764 -77.609 1.00 93.45  ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? 40.029  41.571 -78.306 1.00 93.31  ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? 39.586  42.877 -78.827 1.00 77.26  ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? 40.349  43.989 -78.527 1.00 75.21  ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? 41.401  43.934 -77.900 1.00 75.30  ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? 39.844  45.169 -78.998 1.00 75.24  ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? 38.701  45.344 -79.733 1.00 77.08  ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? 38.369  46.464 -80.066 1.00 77.03  ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? 37.970  44.140 -80.045 1.00 77.40  ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? 36.730  44.241 -80.867 1.00 78.73  ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? 38.440  42.980 -79.581 1.00 77.65  ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? 39.942  38.674 -75.436 1.00 81.28  ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? 40.180  37.267 -75.038 1.00 92.74  ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? 38.611  39.278 -75.211 1.00 95.50  ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? 41.039  39.578 -74.737 1.00 80.02  ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? 42.336  39.666 -75.298 1.00 79.79  ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? 42.997  40.946 -74.860 1.00 79.39  ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? 42.308  42.082 -75.435 1.00 78.69  ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? 42.955  41.156 -73.350 1.00 79.64  ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? 44.149  41.851 -72.964 1.00 82.87  ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? 41.711  42.011 -73.166 1.00 78.11  ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? 41.787  42.908 -74.391 1.00 77.93  ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? 40.512  43.484 -74.844 1.00 88.27  ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? 39.333  42.827 -75.100 1.00 87.74  ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? 38.375  43.609 -75.543 1.00 87.77  ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? 38.953  44.869 -75.565 1.00 85.16  ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? 38.457  46.127 -75.941 1.00 84.47  ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? 37.216  46.327 -76.383 1.00 82.40  ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? 39.291  47.187 -75.845 1.00 82.35  ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? 40.536  46.986 -75.396 1.00 84.36  ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? 41.122  45.852 -75.013 1.00 83.47  ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? 40.267  44.815 -75.125 1.00 85.16  ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? 44.391  42.238 -71.433 1.00 96.11  ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? 45.832  42.070 -71.151 1.00 81.90  ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? 43.381  41.539 -70.594 1.00 79.26  ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? 44.113  43.796 -71.424 1.00 98.08  ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? 45.018  44.684 -72.060 1.00 100.43 ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? 44.841  46.071 -71.495 1.00 101.98 ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? 43.603  46.619 -72.005 1.00 101.77 ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? 44.716  46.084 -69.968 1.00 103.33 ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? 45.540  47.113 -69.385 1.00 105.95 ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? 43.222  46.264 -69.721 1.00 101.27 ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? 42.758  47.035 -70.940 1.00 99.79  ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? 41.354  46.789 -71.347 1.00 80.42  ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? 40.605  47.833 -71.904 1.00 78.91  ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? 41.019  48.981 -72.038 1.00 77.85  ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? 39.334  47.479 -72.289 1.00 76.69  ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? 38.732  46.240 -72.158 1.00 77.94  ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? 37.573  46.068 -72.547 1.00 75.29  ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? 39.554  45.217 -71.546 1.00 77.72  ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? 38.969  43.855 -71.342 1.00 78.25  ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? 40.809  45.538 -71.182 1.00 78.56  ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? 45.060  47.864 -68.048 1.00 151.46 ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? 46.173  48.715 -67.564 1.00 88.84  ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? 44.410  46.905 -67.117 1.00 87.67  ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? 43.945  48.827 -68.629 1.00 152.11 ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? 44.182  49.531 -69.845 1.00 152.68 ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? 43.521  50.881 -69.773 1.00 152.84 ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? 42.145  50.794 -70.222 1.00 151.30 ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? 43.485  51.362 -68.328 1.00 153.91 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? 43.858  52.737 -68.233 1.00 157.26 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? 42.066  51.059 -67.874 1.00 151.16 ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? 41.242  51.057 -69.159 1.00 148.80 ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? 40.200  50.010 -69.193 1.00 82.18  ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? 38.900  50.351 -69.575 1.00 80.18  ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? 38.647  51.529 -69.883 1.00 81.38  ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? 37.946  49.390 -69.597 1.00 78.25  ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? 38.251  48.140 -69.254 1.00 77.77  ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? 37.281  47.234 -69.299 1.00 76.16  ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? 39.559  47.766 -68.858 1.00 77.29  ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? 40.497  48.721 -68.847 1.00 80.29  ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? 44.087  53.400 -66.787 1.00 139.15 ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? 44.954  54.599 -66.961 1.00 128.08 ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? 44.483  52.344 -65.811 1.00 126.99 ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? 42.618  53.879 -66.438 1.00 138.68 ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? 41.742  54.272 -67.483 1.00 139.36 ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? 40.409  54.668 -66.905 1.00 140.04 ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? 39.391  53.655 -67.096 1.00 138.79 ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? 40.462  54.935 -65.403 1.00 140.81 ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? 39.623  56.050 -65.130 1.00 143.96 ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? 39.813  53.694 -64.820 1.00 139.25 ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? 38.733  53.474 -65.855 1.00 137.89 ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? 38.076  52.161 -65.857 1.00 124.99 ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? 36.854  52.031 -66.527 1.00 125.16 ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? 36.392  53.014 -67.122 1.00 126.52 ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? 36.211  50.841 -66.512 1.00 124.58 ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? 36.746  49.806 -65.861 1.00 123.97 ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? 36.065  48.661 -65.849 1.00 123.70 ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? 38.001  49.905 -65.187 1.00 123.71 ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? 38.626  51.090 -65.210 1.00 124.09 ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? 39.977  57.044 -63.927 1.00 102.63 ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? 40.889  58.095 -64.462 1.00 141.83 ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? 40.399  56.226 -62.760 1.00 142.59 ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? 38.560  57.699 -63.619 1.00 100.25 ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? 37.791  58.276 -64.666 1.00 97.71  ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? 36.323  58.018 -64.434 1.00 97.08  ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? 35.993  56.648 -64.776 1.00 95.94  ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? 35.851  58.228 -62.990 1.00 96.84  ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? 34.590  58.918 -62.990 1.00 96.70  ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? 35.685  56.810 -62.474 1.00 96.91  ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? 35.209  56.101 -63.725 1.00 96.62  ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? 35.368  54.642 -63.718 1.00 136.59 ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? 36.489  53.909 -63.410 1.00 136.58 ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? 36.307  52.611 -63.476 1.00 136.37 ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? 34.977  52.476 -63.855 1.00 135.89 ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? 34.169  51.348 -64.096 1.00 135.69 ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? 34.597  50.096 -63.969 1.00 135.12 ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? 32.888  51.555 -64.470 1.00 135.42 ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? 32.454  52.811 -64.584 1.00 135.09 ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? 33.112  53.955 -64.379 1.00 134.96 ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? 34.387  53.716 -64.014 1.00 135.81 ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? 33.730  59.048 -61.636 1.00 118.79 ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? 33.219  60.430 -61.628 1.00 104.00 ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? 34.515  58.552 -60.482 1.00 102.84 ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? 32.479  58.085 -61.867 1.00 120.66 ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? 31.519  58.361 -62.890 1.00 121.27 ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? 30.297  57.491 -62.710 1.00 122.43 ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? 30.661  56.101 -62.907 1.00 122.31 ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? 29.665  57.559 -61.316 1.00 122.85 ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? 28.235  57.452 -61.414 1.00 124.21 ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? 30.223  56.329 -60.629 1.00 122.52 ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? 30.238  55.346 -61.780 1.00 121.58 ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? 31.160  54.214 -61.595 1.00 101.31 ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? 30.660  52.913 -61.727 1.00 99.30  ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? 29.470  52.760 -62.036 1.00 100.00 ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? 31.488  51.863 -61.513 1.00 97.16  ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? 32.764  52.079 -61.175 1.00 97.25  ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? 33.532  51.023 -60.930 1.00 94.80  ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? 33.303  53.391 -61.061 1.00 98.15  ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? 32.476  54.420 -61.281 1.00 100.43 ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? 27.371  57.045 -60.115 1.00 123.99 ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? 25.961  57.439 -60.339 1.00 132.33 ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? 28.090  57.539 -58.908 1.00 131.46 ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? 27.410  55.455 -60.111 1.00 124.61 ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? 26.467  54.703 -60.858 1.00 127.54 ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? 26.088  53.461 -60.092 1.00 129.73 ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? 27.235  52.578 -60.001 1.00 130.07 ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? 25.652  53.733 -58.651 1.00 131.67 ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? 24.628  52.809 -58.279 1.00 135.70 ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? 26.905  53.431 -57.853 1.00 130.74 ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? 27.462  52.257 -58.637 1.00 129.66 ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? 28.900  52.000 -58.444 1.00 136.51 ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? 29.324  50.686 -58.220 1.00 136.21 ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? 28.483  49.774 -58.235 1.00 136.66 ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? 30.634  50.444 -58.000 1.00 135.10 ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? 31.508  51.452 -58.012 1.00 134.89 ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? 32.788  51.172 -57.787 1.00 134.04 ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? 31.108  52.793 -58.255 1.00 135.41 ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? 29.807  53.021 -58.466 1.00 135.98 ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? 23.760  53.074 -56.958 1.00 176.43 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? 22.374  53.318 -57.430 1.00 128.73 ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? 24.456  54.113 -56.150 1.00 127.78 ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? 23.801  51.677 -56.181 1.00 177.75 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? 23.356  50.471 -56.814 1.00 179.96 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? 23.979  49.256 -56.161 1.00 181.95 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? 25.423  49.340 -56.229 1.00 182.27 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? 23.652  49.027 -54.683 1.00 183.65 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? 23.624  47.612 -54.447 1.00 185.78 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? 24.859  49.617 -53.979 1.00 183.05 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? 25.954  49.163 -54.923 1.00 182.23 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? 27.249  49.874 -54.833 1.00 133.25 ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? 28.382  49.095 -54.743 1.00 132.84 ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? 28.347  47.872 -54.703 1.00 132.94 ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? 29.562  49.803 -54.697 1.00 131.96 ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? 29.717  51.177 -54.728 1.00 131.69 ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? 30.842  51.671 -54.714 1.00 131.63 ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? 28.488  51.932 -54.789 1.00 131.61 ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? 28.559  53.427 -54.784 1.00 131.15 ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? 27.329  51.253 -54.845 1.00 132.08 ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? 22.800  47.016 -53.203 1.00 202.22 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? 21.779  46.091 -53.756 1.00 143.40 ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? 22.392  48.119 -52.289 1.00 142.93 ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? 23.863  46.124 -52.429 1.00 202.22 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? 24.431  44.971 -53.037 1.00 202.22 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? 25.409  44.328 -52.084 1.00 202.22 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? 26.603  45.143 -51.967 1.00 202.22 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? 24.860  44.188 -50.665 1.00 202.22 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? 25.364  42.991 -50.081 1.00 201.39 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? 25.444  45.391 -49.947 1.00 202.22 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? 26.807  45.506 -50.605 1.00 202.22 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? 27.396  46.842 -50.579 1.00 141.43 ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? 26.739  48.040 -50.440 1.00 141.17 ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? 27.538  49.070 -50.500 1.00 141.20 ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? 28.797  48.518 -50.684 1.00 140.50 ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? 30.049  49.141 -50.840 1.00 139.93 ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? 30.306  50.348 -50.880 1.00 139.44 ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? 31.071  48.206 -50.973 1.00 139.62 ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? 30.901  46.843 -50.971 1.00 139.91 ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? 32.015  46.102 -51.093 1.00 139.67 ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? 29.731  46.251 -50.854 1.00 140.48 ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? 28.729  47.143 -50.713 1.00 140.92 ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? 24.558  42.282 -48.889 1.00 126.61 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? 23.450  41.524 -49.528 1.00 100.38 ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? 24.253  43.284 -47.822 1.00 100.09 ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? 25.626  41.238 -48.333 1.00 124.68 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? 26.594  40.656 -49.210 1.00 120.14 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? 27.998  40.882 -48.688 1.00 116.90 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? 28.417  42.268 -48.808 1.00 115.83 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? 28.240  40.496 -47.230 1.00 115.20 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? 29.491  39.830 -47.152 1.00 112.75 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? 28.332  41.834 -46.516 1.00 115.21 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? 28.979  42.699 -47.580 1.00 115.08 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? 28.744  44.146 -47.450 1.00 88.04  ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? 29.841  45.005 -47.490 1.00 87.74  ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? 30.976  44.515 -47.623 1.00 88.42  ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? 29.644  46.343 -47.379 1.00 86.72  ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? 28.410  46.823 -47.231 1.00 86.10  ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? 28.253  48.148 -47.141 1.00 84.81  ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? 27.278  45.968 -47.175 1.00 86.08  ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? 27.487  44.647 -47.291 1.00 87.14  ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? 29.809  38.882 -45.904 1.00 113.43 ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? 29.559  37.480 -46.325 1.00 111.47 ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? 29.135  39.425 -44.692 1.00 110.96 ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? 31.376  39.052 -45.724 1.00 111.96 ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? 32.194  39.458 -46.819 1.00 108.01 ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? 33.178  40.504 -46.355 1.00 105.45 ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? 32.504  41.770 -46.135 1.00 104.19 ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? 33.821  40.135 -45.022 1.00 103.71 ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? 35.187  40.536 -45.013 1.00 102.60 ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? 33.023  40.943 -44.016 1.00 103.12 ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? 32.744  42.204 -44.807 1.00 102.83 ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? 31.594  42.990 -44.358 1.00 99.30  ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? 30.409  42.553 -43.820 1.00 98.95  ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? 29.575  43.521 -43.519 1.00 98.96  ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? 30.257  44.675 -43.886 1.00 99.75  ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? 29.907  46.043 -43.851 1.00 99.91  ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? 28.731  46.497 -43.415 1.00 99.69  ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? 30.818  46.938 -44.297 1.00 100.04 ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? 31.987  46.486 -44.751 1.00 100.65 ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? 32.427  45.233 -44.847 1.00 100.25 ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? 31.503  44.364 -44.395 1.00 99.78  ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? 36.287  39.592 -44.319 1.00 111.34 ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? 37.006  38.855 -45.389 1.00 110.68 ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? 35.642  38.848 -43.205 1.00 111.01 ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? 37.315  40.630 -43.708 1.00 106.25 ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? 37.702  41.752 -44.467 1.00 98.29  ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? 37.493  43.016 -43.672 1.00 94.22  ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? 36.092  43.278 -43.400 1.00 94.37  ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? 38.198  43.061 -42.317 1.00 91.31  ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? 38.718  44.368 -42.185 1.00 86.36  ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? 37.052  42.944 -41.327 1.00 92.03  ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? 36.014  43.755 -42.065 1.00 93.94  ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? 34.629  43.681 -41.595 1.00 94.82  ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? 33.913  42.561 -41.242 1.00 95.71  ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? 32.689  42.830 -40.872 1.00 95.87  ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? 32.589  44.209 -40.987 1.00 96.48  ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? 31.497  45.071 -40.738 1.00 97.35  ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? 30.353  44.783 -40.379 1.00 98.89  ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? 31.835  46.396 -40.960 1.00 97.30  ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? 33.054  46.836 -41.383 1.00 96.69  ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? 33.174  48.154 -41.531 1.00 96.61  ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? 34.076  46.047 -41.638 1.00 96.27  ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? 33.777  44.752 -41.419 1.00 95.72  ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? 40.181  44.596 -41.605 1.00 69.49  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? 41.095  44.419 -42.763 1.00 67.44  ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? 40.339  43.763 -40.399 1.00 67.45  ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? 40.094  46.124 -41.156 1.00 71.37  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? 39.625  47.112 -42.095 1.00 77.93  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? 38.877  48.237 -41.412 1.00 82.83  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? 37.541  47.831 -41.027 1.00 82.64  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? 39.543  48.798 -40.159 1.00 85.70  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? 39.552  50.216 -40.195 1.00 91.34  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? 38.654  48.314 -39.027 1.00 84.68  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? 37.292  48.245 -39.690 1.00 85.12  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? 36.365  47.294 -39.069 1.00 84.95  ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? 36.558  45.962 -38.793 1.00 85.93  ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? 35.531  45.387 -38.210 1.00 86.54  ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? 34.599  46.408 -38.099 1.00 87.85  ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? 33.291  46.451 -37.564 1.00 89.33  ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? 32.671  45.400 -37.017 1.00 89.06  ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? 32.635  47.631 -37.610 1.00 89.10  ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? 33.252  48.687 -38.151 1.00 89.68  ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? 34.472  48.774 -38.681 1.00 88.45  ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? 35.099  47.587 -38.626 1.00 87.01  ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? 40.688  51.010 -39.396 1.00 137.53 ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? 41.584  51.684 -40.372 1.00 108.27 ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? 41.260  50.064 -38.409 1.00 109.29 ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? 39.868  52.108 -38.600 1.00 141.37 ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? 38.923  52.917 -39.271 1.00 145.97 ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? 37.821  53.312 -38.321 1.00 150.09 ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? 36.960  52.169 -38.062 1.00 149.80 ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? 38.307  53.809 -36.952 1.00 152.52 ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? 37.645  55.039 -36.603 1.00 156.18 ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? 37.920  52.681 -36.007 1.00 151.52 ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? 36.673  52.139 -36.678 1.00 150.07 ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? 36.259  50.771 -36.293 1.00 119.78 ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? 34.927  50.591 -35.998 1.00 118.96 ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? 34.104  51.475 -36.118 1.00 119.39 ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? 34.589  49.334 -35.563 1.00 118.52 ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? 35.427  48.253 -35.412 1.00 118.41 ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? 34.974  47.190 -34.984 1.00 117.91 ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? 36.819  48.493 -35.783 1.00 118.29 ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? 37.805  47.370 -35.690 1.00 117.10 ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? 37.157  49.728 -36.200 1.00 119.15 ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? 37.620  55.536 -35.073 1.00 114.54 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? 37.406  57.001 -35.078 1.00 126.90 ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? 38.809  54.979 -34.386 1.00 126.98 ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? 36.315  54.822 -34.500 1.00 116.12 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? 35.123  54.760 -35.293 1.00 118.92 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? 33.910  54.508 -34.424 1.00 120.64 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? 33.685  53.094 -34.201 1.00 120.76 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? 33.964  55.151 -33.040 1.00 121.96 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? 32.696  55.724 -32.719 1.00 123.97 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? 34.263  53.978 -32.118 1.00 121.54 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? 33.524  52.847 -32.809 1.00 120.62 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? 34.029  51.482 -32.516 1.00 132.15 ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? 33.109  50.516 -32.156 1.00 131.45 ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? 31.916  50.741 -32.045 1.00 130.76 ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? 33.644  49.270 -31.924 1.00 131.08 ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? 34.977  48.904 -32.004 1.00 130.67 ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? 35.308  47.739 -31.771 1.00 130.19 ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? 35.890  49.972 -32.371 1.00 130.49 ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? 37.352  49.677 -32.468 1.00 129.93 ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? 35.376  51.188 -32.607 1.00 131.08 ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? 32.517  56.522 -31.344 1.00 138.63 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? 31.218  57.241 -31.410 1.00 132.05 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? 33.773  57.281 -31.100 1.00 131.75 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? 32.419  55.361 -30.257 1.00 139.51 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? 32.814  55.586 -28.909 1.00 141.59 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? 31.908  54.824 -27.971 1.00 142.76 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? 32.022  53.405 -28.242 1.00 142.91 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? 32.234  54.999 -26.489 1.00 143.88 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? 31.018  55.079 -25.741 1.00 145.99 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? 33.023  53.749 -26.146 1.00 143.36 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? 32.416  52.707 -27.066 1.00 142.94 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? 33.357  51.637 -27.455 1.00 136.62 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? 32.900  50.307 -27.479 1.00 136.40 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? 31.712  50.070 -27.189 1.00 136.38 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? 33.762  49.319 -27.822 1.00 136.01 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? 35.027  49.615 -28.139 1.00 135.70 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? 35.836  48.607 -28.477 1.00 135.25 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? 35.516  50.955 -28.128 1.00 135.47 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? 34.656  51.925 -27.785 1.00 135.89 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? 31.013  54.728 -24.174 1.00 195.14 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? 29.919  55.503 -23.542 1.00 175.84 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? 32.395  54.845 -23.641 1.00 174.99 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? 30.592  53.194 -24.155 1.00 196.88 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? 29.256  52.813 -23.850 1.00 199.76 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? 29.231  52.102 -22.520 1.00 201.73 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? 29.940  50.849 -22.665 1.00 202.22 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? 29.966  52.876 -21.427 1.00 202.22 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? 29.329  52.694 -20.159 1.00 202.22 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? 31.363  52.284 -21.448 1.00 202.22 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? 31.124  50.844 -21.874 1.00 202.22 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? 32.212  50.266 -22.696 1.00 183.54 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? 32.264  48.896 -22.843 1.00 183.71 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? 31.474  48.134 -22.306 1.00 183.67 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? 33.286  48.448 -23.643 1.00 183.97 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? 34.243  49.212 -24.286 1.00 183.82 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? 35.095  48.669 -24.981 1.00 183.89 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? 34.144  50.633 -24.068 1.00 183.45 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? 35.161  51.532 -24.695 1.00 182.92 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? 33.144  51.085 -23.302 1.00 183.18 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? 30.106  53.098 -18.811 1.00 202.15 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? 29.100  53.426 -17.768 1.00 185.66 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? 31.155  54.094 -19.157 1.00 184.86 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? 30.816  51.737 -18.395 1.00 202.15 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? 30.081  50.516 -18.409 1.00 202.15 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? 30.988  49.352 -18.092 1.00 202.15 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? 31.912  49.127 -19.185 1.00 202.15 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? 31.846  49.534 -16.840 1.00 202.15 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? 31.916  48.293 -16.135 1.00 202.15 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? 33.206  49.904 -17.403 1.00 202.15 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? 33.236  49.091 -18.682 1.00 202.15 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? 34.136  49.599 -19.720 1.00 186.46 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? 34.372  50.903 -20.086 1.00 186.45 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? 35.268  51.031 -21.036 1.00 186.09 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? 35.644  49.725 -21.319 1.00 185.89 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? 36.566  49.180 -22.232 1.00 185.54 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? 37.315  49.915 -23.061 1.00 184.98 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? 36.693  47.835 -22.267 1.00 185.22 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? 35.943  47.097 -21.436 1.00 185.21 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? 35.048  47.491 -20.534 1.00 185.56 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? 34.945  48.832 -20.524 1.00 186.03 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? 32.645  48.221 -14.705 1.00 200.24 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? 31.634  47.826 -13.688 1.00 144.74 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? 33.468  49.441 -14.496 1.00 145.01 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? 33.643  47.001 -14.882 1.00 199.18 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? 33.170  45.738 -15.323 1.00 197.37 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? 34.324  44.772 -15.390 1.00 195.74 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? 35.116  45.043 -16.571 1.00 195.44 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? 35.263  44.937 -14.199 1.00 194.70 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? 35.737  43.668 -13.763 1.00 193.36 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? 36.391  45.791 -14.748 1.00 194.64 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? 36.449  45.374 -16.208 1.00 194.78 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? 36.914  46.437 -17.116 1.00 139.02 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? 37.921  46.146 -18.041 1.00 138.50 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? 38.388  44.994 -18.079 1.00 137.96 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? 38.361  47.129 -18.870 1.00 138.51 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? 37.832  48.353 -18.796 1.00 138.82 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? 38.301  49.293 -19.623 1.00 138.54 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? 36.802  48.671 -17.869 1.00 138.90 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? 36.375  47.694 -17.057 1.00 138.96 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? 36.671  43.575 -12.466 1.00 163.43 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? 36.026  42.683 -11.473 1.00 153.94 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? 37.044  44.958 -12.073 1.00 153.32 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? 37.962  42.850 -13.037 1.00 161.52 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? 38.562  43.313 -14.236 1.00 158.62 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? 40.057  43.354 -14.064 1.00 155.89 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? 40.635  44.189 -15.091 1.00 155.53 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? 40.462  43.975 -12.732 1.00 154.22 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? 41.632  43.310 -12.264 1.00 151.36 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? 40.740  45.424 -13.090 1.00 154.57 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? 41.265  45.323 -14.514 1.00 154.92 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? 40.977  46.478 -15.385 1.00 144.57 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? 41.541  46.497 -16.652 1.00 143.99 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? 42.261  45.547 -16.994 1.00 144.28 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? 41.290  47.542 -17.477 1.00 143.04 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? 40.503  48.538 -17.069 1.00 142.15 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? 40.276  49.543 -17.916 1.00 140.72 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? 39.913  48.546 -15.778 1.00 142.78 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? 40.175  47.507 -14.973 1.00 143.79 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? 41.535  41.780 -11.777 1.00 130.99 ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? 40.466  41.084 -12.538 1.00 170.45 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? 41.470  41.822 -10.291 1.00 170.50 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? 42.943  41.165 -12.204 1.00 128.85 ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? 43.024  40.042 -13.083 1.00 124.02 ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? 44.423  39.910 -13.643 1.00 121.12 ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? 44.664  41.045 -14.500 1.00 120.81 ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? 45.539  39.924 -12.599 1.00 119.97 ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? 46.451  38.811 -12.710 1.00 119.21 ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? 46.110  41.328 -12.628 1.00 120.28 ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? 45.706  41.878 -13.987 1.00 121.55 ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? 45.199  43.256 -13.916 1.00 161.98 ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? 44.671  43.889 -12.813 1.00 162.41 ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? 44.305  45.129 -13.038 1.00 163.10 ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? 44.607  45.329 -14.376 1.00 163.04 ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? 44.454  46.439 -15.219 1.00 163.51 ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? 43.926  47.597 -14.824 1.00 163.44 ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? 44.861  46.317 -16.501 1.00 164.14 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? 45.381  45.149 -16.901 1.00 164.17 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? 45.572  44.030 -16.205 1.00 163.79 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? 45.160  44.186 -14.933 1.00 163.12 ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? 47.644  38.763 -13.813 1.00 118.70 ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? 47.215  37.713 -14.777 1.00 124.52 ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? 48.943  38.620 -13.093 1.00 124.57 ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? 47.702  40.131 -14.624 1.00 117.47 ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? 47.941  40.099 -16.041 1.00 114.31 ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? 48.794  41.267 -16.494 1.00 111.86 ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? 48.304  42.507 -15.934 1.00 110.36 ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? 50.297  41.250 -16.204 1.00 110.37 ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? 50.944  41.869 -17.333 1.00 108.89 ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? 50.415  42.151 -14.987 1.00 109.91 ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? 49.367  43.204 -15.298 1.00 109.91 ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? 48.801  43.915 -14.150 1.00 115.35 ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? 48.594  43.445 -12.877 1.00 115.04 ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? 48.004  44.308 -12.081 1.00 114.39 ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? 47.824  45.429 -12.879 1.00 114.30 ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? 47.241  46.687 -12.631 1.00 114.18 ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? 46.718  47.045 -11.460 1.00 113.70 ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? 47.216  47.576 -13.644 1.00 114.53 ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? 47.751  47.223 -14.823 1.00 115.08 ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? 48.329  46.076 -15.179 1.00 115.30 ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? 48.329  45.209 -14.153 1.00 114.77 ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? 52.512  41.639 -17.615 1.00 95.54  ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? 52.650  41.190 -19.025 1.00 112.18 ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? 53.125  40.850 -16.519 1.00 112.36 ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? 53.120  43.093 -17.505 1.00 92.52  ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? 52.349  44.110 -16.931 1.00 87.87  ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? 52.268  45.291 -17.862 1.00 84.53  ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? 51.346  46.216 -17.265 1.00 83.48  ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? 53.576  46.054 -17.974 1.00 83.02  ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? 53.589  46.769 -19.211 1.00 81.75  ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? 53.538  46.970 -16.760 1.00 83.48  ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? 52.046  47.209 -16.526 1.00 83.81  ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? 51.617  47.077 -15.133 1.00 99.47  ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? 51.803  45.995 -14.309 1.00 98.65  ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? 51.290  46.142 -13.118 1.00 98.02  ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? 50.731  47.408 -13.153 1.00 99.31  ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? 50.037  48.139 -12.204 1.00 99.42  ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? 49.758  47.682 -10.984 1.00 100.24 ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? 49.618  49.374 -12.549 1.00 100.02 ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? 49.879  49.820 -13.778 1.00 99.80  ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? 50.518  49.220 -14.766 1.00 100.03 ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? 50.928  47.997 -14.383 1.00 99.08  ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? 54.777  47.803 -19.523 1.00 72.39  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? 54.554  48.306 -20.899 1.00 86.22  ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? 56.089  47.208 -19.135 1.00 85.58  ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? 54.515  49.002 -18.526 1.00 67.37  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? 53.706  50.071 -18.913 1.00 64.77  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? 53.925  51.219 -17.968 1.00 62.70  ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? 53.429  50.825 -16.669 1.00 62.86  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? 55.388  51.623 -17.770 1.00 60.96  ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? 55.477  53.046 -17.797 1.00 58.27  ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? 55.725  51.087 -16.392 1.00 62.70  ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? 54.385  51.143 -15.685 1.00 62.95  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? 54.217  50.192 -14.590 1.00 78.39  ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? 54.732  48.931 -14.466 1.00 79.71  ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? 54.415  48.342 -13.341 1.00 79.24  ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? 53.631  49.279 -12.681 1.00 78.13  ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? 52.985  49.270 -11.432 1.00 76.88  ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? 53.031  48.249 -10.570 1.00 75.46  ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? 52.276  50.364 -11.088 1.00 76.95  ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? 52.225  51.391 -11.936 1.00 78.11  ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? 52.789  51.521 -13.130 1.00 78.72  ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? 53.489  50.417 -13.447 1.00 78.82  ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? 56.800  53.777 -17.276 1.00 69.67  ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? 57.176  54.834 -18.257 1.00 79.06  ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? 57.794  52.751 -16.871 1.00 77.77  ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? 56.289  54.508 -15.970 1.00 74.68  ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? 55.016  55.140 -15.957 1.00 79.22  ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? 54.773  55.771 -14.609 1.00 82.67  ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? 54.387  54.752 -13.653 1.00 82.87  ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? 56.022  56.443 -14.049 1.00 84.55  ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? 55.729  57.721 -13.510 1.00 87.03  ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? 56.503  55.491 -12.969 1.00 84.64  ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? 55.234  54.789 -12.518 1.00 84.88  ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? 55.459  53.412 -12.091 1.00 95.16  ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? 55.977  52.391 -12.846 1.00 96.37  ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? 56.092  51.271 -12.185 1.00 96.24  ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? 55.617  51.570 -10.917 1.00 96.89  ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? 55.520  50.758 -9.753  1.00 96.94  ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? 55.842  49.578 -9.605  1.00 94.99  ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? 54.994  51.466 -8.682  1.00 98.04  ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? 54.613  52.788 -8.719  1.00 98.76  ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? 54.134  53.304 -7.569  1.00 99.66  ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? 54.698  53.552 -9.796  1.00 97.75  ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? 55.209  52.885 -10.848 1.00 96.81  ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? 56.884  58.524 -12.754 1.00 81.43  ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? 56.534  59.959 -12.800 1.00 91.90  ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? 58.204  58.078 -13.274 1.00 91.65  ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? 56.717  58.019 -11.257 1.00 88.07  ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? 55.513  58.274 -10.538 1.00 93.47  ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? 55.771  58.214 -9.050  1.00 97.72  ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? 55.803  56.840 -8.606  1.00 98.11  ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? 57.091  58.838 -8.595  1.00 99.97  ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? 56.901  59.615 -7.418  1.00 104.72 ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? 57.974  57.639 -8.287  1.00 98.69  ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? 56.961  56.617 -7.817  1.00 98.13  ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? 57.354  55.204 -7.992  1.00 107.34 ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? 57.145  54.335 -6.938  1.00 107.42 ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? 56.687  54.688 -5.863  1.00 108.03 ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? 57.499  53.034 -7.190  1.00 107.36 ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? 58.034  52.528 -8.361  1.00 107.12 ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? 58.285  51.328 -8.450  1.00 107.04 ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? 58.247  53.499 -9.414  1.00 107.26 ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? 58.840  53.044 -10.709 1.00 106.78 ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? 57.901  54.769 -9.180  1.00 107.42 ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? 58.177  60.202 -6.657  1.00 137.54 ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? 57.750  61.371 -5.857  1.00 125.83 ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? 59.265  60.357 -7.658  1.00 124.56 ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? 58.572  59.016 -5.673  1.00 139.73 ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? 57.699  58.627 -4.616  1.00 142.18 ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? 58.479  57.901 -3.546  1.00 144.05 ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? 58.763  56.547 -3.969  1.00 143.51 ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? 59.831  58.545 -3.248  1.00 145.72 ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? 60.134  58.458 -1.857  1.00 149.40 ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? 60.804  57.705 -4.052  1.00 144.44 ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? 60.168  56.330 -3.975  1.00 143.16 ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? 60.486  55.449 -5.095  1.00 129.53 ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? 60.637  55.792 -6.418  1.00 129.42 ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? 60.917  54.772 -7.183  1.00 129.37 ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? 60.951  53.691 -6.313  1.00 129.53 ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? 61.197  52.317 -6.562  1.00 129.61 ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? 61.434  51.757 -7.643  1.00 130.00 ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? 61.144  51.570 -5.387  1.00 130.20 ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? 60.887  52.076 -4.136  1.00 129.93 ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? 60.899  51.201 -3.124  1.00 130.05 ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? 60.644  53.349 -3.895  1.00 129.51 ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? 60.693  54.095 -5.020  1.00 129.50 ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? 61.446  59.190 -1.285  1.00 168.73 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? 61.208  59.523 0.142   1.00 141.19 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? 61.815  60.268 -2.242  1.00 140.96 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? 62.560  58.056 -1.346  1.00 169.25 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? 63.575  57.967 -0.351  1.00 169.19 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? 63.322  56.775 0.543   1.00 169.25 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? 62.798  55.679 -0.241  1.00 168.56 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? 64.587  56.249 1.205   1.00 169.71 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? 64.305  55.701 2.490   1.00 170.40 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? 65.048  55.167 0.250   1.00 169.40 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? 63.748  54.626 -0.331  1.00 168.69 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? 63.855  54.252 -1.757  1.00 139.62 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? 63.887  52.919 -2.096  1.00 139.23 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? 63.832  52.021 -1.276  1.00 139.13 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? 63.989  52.677 -3.445  1.00 138.67 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? 64.063  53.613 -4.463  1.00 138.64 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? 64.157  53.247 -5.631  1.00 138.57 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? 64.023  54.988 -4.036  1.00 138.84 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? 64.092  56.070 -5.067  1.00 138.54 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? 63.922  55.236 -2.723  1.00 139.09 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? 65.521  55.245 3.427   1.00 189.78 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? 64.976  54.887 4.757   1.00 120.95 ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? 66.581  56.285 3.313   1.00 120.68 ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? 66.026  53.893 2.754   1.00 189.71 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? 65.364  52.659 3.029   1.00 188.83 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? 66.193  51.493 2.543   1.00 188.61 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? 66.115  51.381 1.101   1.00 188.32 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? 67.682  51.567 2.888   1.00 188.28 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? 68.158  50.274 3.265   1.00 187.80 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? 68.323  51.994 1.580   1.00 188.15 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? 67.426  51.325 0.556   1.00 187.86 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? 67.402  51.989 -0.747  1.00 117.56 ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? 67.179  53.318 -1.005  1.00 117.51 ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? 67.203  53.622 -2.279  1.00 116.73 ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? 67.463  52.412 -2.904  1.00 116.68 ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? 67.608  52.060 -4.255  1.00 116.58 ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? 67.491  52.929 -5.260  1.00 116.95 ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? 67.873  50.769 -4.542  1.00 116.16 ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? 67.975  49.899 -3.532  1.00 116.18 ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? 67.854  50.106 -2.224  1.00 116.65 ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? 67.595  51.398 -1.973  1.00 116.90 ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? 69.677  50.095 3.753   1.00 182.22 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? 69.654  49.208 4.943   1.00 126.10 ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? 70.328  51.430 3.836   1.00 126.29 ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? 70.352  49.297 2.557   1.00 180.60 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? 69.861  48.018 2.180   1.00 177.47 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? 70.717  47.440 1.080   1.00 175.02 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? 70.459  48.124 -0.173  1.00 174.40 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? 72.220  47.568 1.330   1.00 172.85 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? 72.866  46.380 0.876   1.00 169.54 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? 72.612  48.755 0.471   1.00 173.03 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? 71.687  48.582 -0.715  1.00 173.13 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? 71.427  49.813 -1.489  1.00 115.57 ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? 71.454  49.716 -2.862  1.00 114.58 ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? 71.677  48.665 -3.454  1.00 113.36 ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? 71.216  50.900 -3.522  1.00 114.06 ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? 70.964  52.135 -2.958  1.00 114.45 ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? 70.770  53.103 -3.673  1.00 112.85 ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? 70.953  52.165 -1.520  1.00 114.86 ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? 70.698  53.466 -0.829  1.00 114.52 ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? 71.177  51.018 -0.862  1.00 115.00 ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? 74.463  46.335 0.750   1.00 166.06 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? 74.918  45.156 1.530   1.00 111.11 ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? 75.011  47.683 1.056   1.00 111.77 ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? 74.681  46.018 -0.795  1.00 163.61 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? 73.782  45.143 -1.475  1.00 159.55 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? 74.078  45.126 -2.955  1.00 156.29 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? 73.768  46.410 -3.546  1.00 155.82 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? 75.536  44.842 -3.301  1.00 153.85 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? 75.584  44.016 -4.460  1.00 149.97 ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? 76.104  46.219 -3.593  1.00 153.82 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? 74.913  46.925 -4.211  1.00 154.96 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? 74.907  48.390 -4.049  1.00 101.05 ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? 75.038  49.170 -5.178  1.00 101.24 ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? 75.232  48.705 -6.293  1.00 102.22 ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? 74.950  50.524 -4.949  1.00 100.62 ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? 74.771  51.158 -3.729  1.00 99.94  ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? 74.693  52.385 -3.677  1.00 98.55  ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? 74.685  50.281 -2.586  1.00 100.36 ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? 74.522  50.882 -1.225  1.00 100.23 ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? 74.754  48.958 -2.800  1.00 100.79 ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? 76.997  43.498 -5.002  1.00 105.61 ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? 76.765  42.174 -5.637  1.00 95.23  ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? 77.989  43.631 -3.903  1.00 97.04  ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? 77.361  44.549 -6.144  1.00 104.49 ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? 76.522  44.690 -7.292  1.00 99.74  ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? 77.169  45.592 -8.315  1.00 95.58  ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? 77.035  46.981 -7.921  1.00 94.98  ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? 78.663  45.332 -8.523  1.00 93.08  ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? 78.972  45.335 -9.927  1.00 88.31  ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? 79.318  46.511 -7.813  1.00 93.88  ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? 78.296  47.619 -8.017  1.00 95.28  ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? 78.326  48.753 -7.054  1.00 86.94  ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? 78.265  50.028 -7.573  1.00 87.48  ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? 78.194  50.258 -8.770  1.00 86.68  ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? 78.292  51.035 -6.634  1.00 87.59  ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? 78.372  50.904 -5.263  1.00 88.15  ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? 78.386  51.910 -4.553  1.00 88.19  ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? 78.433  49.537 -4.784  1.00 88.53  ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? 78.518  49.288 -3.310  1.00 89.27  ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? 78.409  48.545 -5.693  1.00 87.55  ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? 79.111  43.941 -10.737 1.00 83.97  ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? 77.956  43.062 -10.422 1.00 87.20  ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? 80.484  43.438 -10.534 1.00 87.98  ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? 79.004  44.391 -12.257 1.00 84.46  ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? 77.846  45.058 -12.728 1.00 80.76  ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? 78.218  46.349 -13.419 1.00 79.00  ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? 78.660  47.335 -12.457 1.00 79.85  ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? 79.318  46.250 -14.477 1.00 76.97  ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? 78.969  47.098 -15.577 1.00 70.60  ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? 80.550  46.771 -13.755 1.00 78.35  ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? 79.969  47.796 -12.782 1.00 82.17  ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? 80.713  47.964 -11.528 1.00 90.89  ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? 81.395  46.994 -10.815 1.00 91.51  ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? 81.960  47.457 -9.731  1.00 93.35  ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? 81.634  48.811 -9.722  1.00 93.44  ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? 81.968  49.827 -8.800  1.00 94.54  ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? 82.640  49.736 -7.771  1.00 96.03  ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? 81.439  51.056 -9.178  1.00 93.84  ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? 80.690  51.278 -10.299 1.00 93.42  ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? 80.294  52.533 -10.503 1.00 93.08  ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? 80.361  50.343 -11.163 1.00 91.71  ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? 80.866  49.141 -10.821 1.00 92.41  ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? 79.488  46.758 -17.056 1.00 60.77  ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? 78.316  46.762 -17.960 1.00 82.57  ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? 80.365  45.561 -16.992 1.00 79.46  ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? 80.376  48.031 -17.387 1.00 63.09  ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? 79.873  49.335 -17.116 1.00 64.85  ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? 80.999  50.293 -16.807 1.00 69.28  ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? 81.500  50.094 -15.470 1.00 70.30  ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? 82.212  50.228 -17.729 1.00 71.18  ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? 82.655  51.541 -17.981 1.00 72.72  ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? 83.271  49.571 -16.873 1.00 72.36  ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? 82.921  50.121 -15.508 1.00 72.89  ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? 83.428  49.349 -14.371 1.00 93.00  ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? 83.681  47.995 -14.319 1.00 92.54  ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? 84.113  47.599 -13.153 1.00 91.89  ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? 84.145  48.756 -12.389 1.00 95.28  ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? 84.510  48.949 -11.036 1.00 95.39  ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? 84.873  48.103 -10.203 1.00 94.94  ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? 84.407  50.286 -10.669 1.00 95.11  ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? 83.996  51.304 -11.494 1.00 97.47  ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? 83.972  52.529 -10.959 1.00 97.36  ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? 83.639  51.134 -12.750 1.00 95.79  ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? 83.737  49.846 -13.130 1.00 94.43  ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? 82.835  52.029 -19.486 1.00 76.94  ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? 81.476  51.933 -20.093 1.00 74.22  ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? 83.987  51.333 -20.110 1.00 75.44  ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? 83.213  53.561 -19.349 1.00 78.34  ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? 82.226  54.497 -18.953 1.00 81.99  ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? 82.827  55.485 -17.987 1.00 84.68  ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? 83.335  54.783 -16.829 1.00 84.36  ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? 84.017  56.235 -18.563 1.00 86.46  ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? 83.976  57.566 -18.068 1.00 91.36  ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? 85.216  55.460 -18.041 1.00 84.37  ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? 84.732  54.997 -16.685 1.00 83.02  ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? 85.309  53.747 -16.188 1.00 81.18  ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? 85.341  52.519 -16.807 1.00 80.58  ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? 85.832  51.559 -16.056 1.00 80.34  ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? 86.173  52.204 -14.875 1.00 81.92  ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? 86.736  51.742 -13.671 1.00 81.30  ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? 87.066  50.473 -13.447 1.00 81.56  ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? 86.949  52.643 -12.692 1.00 80.37  ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? 86.618  53.915 -12.912 1.00 80.92  ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? 86.085  54.475 -13.996 1.00 81.26  ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? 85.880  53.556 -14.952 1.00 81.48  ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? 85.039  58.625 -18.596 1.00 110.08 ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? 84.428  59.964 -18.469 1.00 107.97 ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? 85.539  58.160 -19.915 1.00 106.78 ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? 86.216  58.490 -17.540 1.00 111.55 ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? 86.052  58.966 -16.211 1.00 113.94 ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? 87.386  58.966 -15.511 1.00 115.27 ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? 87.692  57.635 -15.027 1.00 113.08 ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? 88.530  59.358 -16.448 1.00 116.25 ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? 89.482  60.169 -15.762 1.00 119.69 ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? 89.151  58.024 -16.813 1.00 115.01 ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? 88.958  57.240 -15.527 1.00 112.83 ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? 88.952  55.789 -15.696 1.00 107.51 ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? 88.507  55.065 -16.770 1.00 105.91 ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? 88.648  53.770 -16.628 1.00 104.63 ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? 89.224  53.634 -15.374 1.00 103.70 ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? 89.620  52.508 -14.633 1.00 102.09 ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? 89.518  51.255 -15.077 1.00 99.34  ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? 90.135  52.716 -13.404 1.00 101.85 ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? 90.255  53.974 -12.968 1.00 103.21 ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? 89.933  55.112 -13.576 1.00 104.36 ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? 89.412  54.869 -14.787 1.00 105.16 ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? 90.464  61.124 -16.597 1.00 144.11 ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? 89.868  62.481 -16.591 1.00 114.74 ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? 90.792  60.467 -17.891 1.00 115.40 ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? 91.783  61.141 -15.709 1.00 143.79 ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? 91.698  61.026 -14.293 1.00 142.57 ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? 92.787  60.118 -13.775 1.00 141.18 ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? 92.478  58.723 -14.026 1.00 140.01 ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? 94.159  60.367 -14.398 1.00 140.74 ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? 95.162  60.310 -13.390 1.00 140.42 ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? 94.333  59.203 -15.358 1.00 139.47 ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? 93.604  58.095 -14.625 1.00 139.29 ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? 93.132  56.981 -15.460 1.00 108.64 ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? 92.413  57.027 -16.631 1.00 108.71 ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? 92.137  55.844 -17.129 1.00 107.54 ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? 92.714  54.959 -16.228 1.00 107.05 ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? 92.776  53.554 -16.185 1.00 106.71 ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? 92.230  52.761 -17.107 1.00 106.44 ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? 93.428  52.982 -15.148 1.00 106.08 ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? 93.979  53.773 -14.226 1.00 106.50 ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? 93.992  55.101 -14.156 1.00 107.09 ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? 93.333  55.643 -15.198 1.00 107.71 ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? 96.658  60.747 -13.745 1.00 123.87 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? 97.103  61.718 -12.700 1.00 100.11 ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? 96.680  61.150 -15.176 1.00 98.17  ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? 97.468  59.381 -13.611 1.00 123.13 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? 97.491  58.663 -12.380 1.00 124.19 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? 98.328  57.409 -12.509 1.00 125.71 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? 97.576  56.352 -13.163 1.00 125.25 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? 99.645  57.550 -13.284 1.00 126.43 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? 100.706 56.890 -12.574 1.00 129.11 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? 99.353  56.841 -14.596 1.00 125.52 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? 98.396  55.747 -14.153 1.00 124.19 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? 97.531  55.184 -15.214 1.00 99.06  ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? 97.361  53.786 -15.285 1.00 98.10  ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? 97.901  53.068 -14.424 1.00 98.01  ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? 96.610  53.257 -16.286 1.00 97.83  ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? 96.035  54.060 -17.186 1.00 98.34  ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? 95.332  53.498 -18.171 1.00 98.17  ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? 96.162  55.480 -17.120 1.00 98.58  ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? 96.914  55.995 -16.128 1.00 98.65  ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? 102.075 56.507 -13.333 1.00 129.66 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? 103.116 56.285 -12.305 1.00 87.32  ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? 102.324 57.470 -14.440 1.00 87.20  ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? 101.760 55.086 -13.969 1.00 130.37 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? 101.706 53.924 -13.144 1.00 131.24 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? 102.194 52.720 -13.913 1.00 130.59 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? 101.203 52.324 -14.896 1.00 129.99 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? 103.488 52.974 -14.689 1.00 130.52 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? 104.309 51.813 -14.662 1.00 129.98 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? 103.002 53.220 -16.105 1.00 130.24 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? 101.807 52.285 -16.183 1.00 129.68 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? 100.785 52.648 -17.193 1.00 85.45  ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? 100.074 51.622 -17.772 1.00 84.68  ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? 100.219 50.447 -17.451 1.00 83.89  ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? 99.178  52.025 -18.738 1.00 84.21  ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? 98.920  53.325 -19.151 1.00 83.95  ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? 98.092  53.547 -20.033 1.00 83.48  ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? 99.676  54.343 -18.482 1.00 83.94  ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? 99.434  55.770 -18.854 1.00 83.35  ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? 100.564 53.964 -17.551 1.00 84.65  ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? 105.819 51.898 -15.188 1.00 112.98 ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? 106.655 52.308 -14.036 1.00 116.07 ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? 105.872 52.678 -16.444 1.00 115.24 ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? 106.150 50.383 -15.528 1.00 112.85 ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? 105.540 49.326 -14.784 1.00 112.37 ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? 105.212 48.173 -15.702 1.00 112.91 ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? 104.153 48.563 -16.604 1.00 113.08 ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? 106.375 47.753 -16.599 1.00 112.89 ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? 106.278 46.361 -16.883 1.00 112.88 ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? 106.124 48.536 -17.872 1.00 112.86 ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? 104.614 48.469 -17.948 1.00 112.47 ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? 103.994 49.544 -18.711 1.00 114.02 ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? 104.235 50.894 -18.607 1.00 114.28 ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? 103.492 51.608 -19.405 1.00 114.02 ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? 102.719 50.672 -20.079 1.00 113.86 ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? 101.714 50.847 -21.066 1.00 113.68 ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? 101.276 51.908 -21.548 1.00 113.38 ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? 101.198 49.622 -21.489 1.00 113.81 ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? 101.586 48.393 -21.014 1.00 114.18 ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? 100.975 47.326 -21.551 1.00 113.83 ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? 102.506 48.221 -20.083 1.00 114.24 ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? 103.028 49.394 -19.667 1.00 113.94 ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? 107.513 45.608 -17.568 1.00 116.00 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? 107.994 44.611 -16.584 1.00 102.18 ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? 108.464 46.599 -18.151 1.00 101.86 ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? 106.857 44.832 -18.788 1.00 114.68 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? 105.711 44.012 -18.603 1.00 112.87 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? 105.054 43.758 -19.938 1.00 109.95 ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? 104.582 45.023 -20.453 1.00 109.18 ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? 106.006 43.204 -20.998 1.00 108.08 ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? 105.290 42.346 -21.880 1.00 106.58 ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? 106.441 44.446 -21.747 1.00 107.02 ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? 105.170 45.269 -21.721 1.00 106.49 ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? 105.350 46.724 -21.868 1.00 90.09  ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? 104.665 47.396 -22.895 1.00 89.32  ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? 103.916 46.755 -23.656 1.00 89.08  ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? 104.833 48.727 -23.032 1.00 88.78  ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? 105.629 49.389 -22.197 1.00 88.36  ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? 105.761 50.703 -22.373 1.00 86.91  ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? 106.325 48.735 -21.146 1.00 88.39  ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? 106.162 47.414 -21.021 1.00 89.21  ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? 105.570 40.766 -21.867 1.00 114.79 ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? 104.391 40.071 -21.268 1.00 122.05 ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? 106.911 40.561 -21.282 1.00 122.01 ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? 105.651 40.412 -23.415 1.00 112.05 ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? 105.801 41.455 -24.378 1.00 106.43 ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? 104.449 41.858 -24.927 1.00 102.58 ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? 104.293 43.284 -24.789 1.00 101.93 ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? 104.229 41.566 -26.408 1.00 99.99  ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? 102.829 41.351 -26.644 1.00 97.01  ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? 104.735 42.841 -27.063 1.00 100.53 ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? 104.340 43.911 -26.058 1.00 101.69 ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? 105.233 45.074 -25.932 1.00 110.63 ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? 104.930 46.194 -26.658 1.00 111.52 ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? 104.029 46.231 -27.477 1.00 112.96 ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? 105.725 47.279 -26.393 1.00 111.02 ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? 106.774 47.352 -25.501 1.00 111.20 ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? 107.360 48.419 -25.335 1.00 112.27 ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? 107.076 46.116 -24.812 1.00 111.17 ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? 108.214 46.086 -23.843 1.00 110.40 ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? 106.308 45.049 -25.069 1.00 110.74 ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? 102.346 40.302 -27.769 1.00 88.04  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? 100.964 39.851 -27.456 1.00 78.90  ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? 103.423 39.287 -27.916 1.00 80.26  ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? 102.282 41.191 -29.093 1.00 86.19  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? 101.284 42.201 -29.249 1.00 83.87  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? 101.672 43.173 -30.339 1.00 81.46  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? 102.748 44.032 -29.903 1.00 83.78  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? 102.147 42.558 -31.659 1.00 78.96  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? 101.845 43.469 -32.721 1.00 75.10  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? 103.655 42.623 -31.515 1.00 83.17  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? 103.760 44.010 -30.907 1.00 85.66  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? 105.047 44.396 -30.293 1.00 79.88  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? 105.283 45.750 -30.031 1.00 80.53  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? 104.467 46.592 -30.425 1.00 80.21  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? 106.402 46.105 -29.369 1.00 83.97  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? 107.283 45.172 -28.997 1.00 84.61  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? 108.342 45.563 -28.298 1.00 86.05  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? 107.106 43.797 -29.313 1.00 84.43  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? 105.982 43.454 -29.956 1.00 82.02  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? 100.423 43.424 -33.457 1.00 46.56  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? 99.334  43.534 -32.452 1.00 63.11  ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? 100.457 42.260 -34.365 1.00 67.72  ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? 100.439 44.752 -34.326 1.00 44.86  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? 99.896  45.949 -33.806 1.00 45.98  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? 100.681 47.142 -34.300 1.00 47.35  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? 101.963 47.193 -33.627 1.00 52.03  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? 100.981 47.210 -35.806 1.00 48.37  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? 100.770 48.544 -36.266 1.00 44.13  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? 102.464 46.878 -35.897 1.00 51.38  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? 102.993 47.442 -34.587 1.00 53.18  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? 104.253 46.861 -34.072 1.00 79.29  ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? 105.332 47.717 -33.774 1.00 80.45  ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? 105.209 48.935 -33.949 1.00 79.16  ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? 106.472 47.192 -33.303 1.00 80.52  ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? 106.571 45.876 -33.114 1.00 82.77  ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? 107.723 45.399 -32.638 1.00 83.39  ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? 105.499 44.987 -33.403 1.00 82.26  ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? 104.371 45.515 -33.879 1.00 80.15  ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? 100.524 48.824 -37.827 1.00 44.64  ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? 99.147  49.277 -38.093 1.00 39.99  ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? 101.080 47.637 -38.526 1.00 36.74  ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? 101.435 50.084 -38.139 1.00 50.16  ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? 101.481 51.199 -37.239 1.00 56.50  ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? 102.725 52.025 -37.487 1.00 63.41  ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? 103.896 51.406 -36.915 1.00 63.74  ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? 103.049 52.250 -38.961 1.00 66.17  ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? 103.553 53.561 -39.129 1.00 72.36  ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? 104.118 51.220 -39.253 1.00 65.73  ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? 104.851 51.137 -37.925 1.00 67.02  ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? 105.394 49.818 -37.642 1.00 62.31  ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? 104.791 48.612 -37.882 1.00 65.05  ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? 105.489 47.585 -37.480 1.00 66.09  ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? 106.634 48.153 -36.939 1.00 65.31  ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? 107.752 47.594 -36.325 1.00 66.76  ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? 107.880 46.284 -36.097 1.00 65.65  ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? 108.736 48.431 -35.926 1.00 67.32  ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? 108.570 49.745 -36.103 1.00 67.12  ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? 107.543 50.395 -36.638 1.00 66.45  ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? 106.598 49.528 -37.048 1.00 65.20  ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? 103.861 54.097 -40.597 1.00 80.41  ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? 103.420 55.512 -40.640 1.00 78.64  ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? 103.323 53.126 -41.572 1.00 78.45  ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? 105.449 54.039 -40.670 1.00 83.44  ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? 106.241 54.568 -39.604 1.00 87.67  ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? 107.712 54.304 -39.844 1.00 91.04  ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? 108.140 53.011 -39.342 1.00 92.01  ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? 108.184 54.383 -41.297 1.00 93.37  ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? 109.368 55.192 -41.353 1.00 98.33  ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? 108.491 52.932 -41.640 1.00 92.46  ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? 108.961 52.388 -40.304 1.00 92.24  ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? 108.843 50.935 -40.118 1.00 90.26  ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? 109.864 50.278 -39.462 1.00 91.08  ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? 110.874 50.829 -39.076 1.00 91.14  ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? 109.661 48.935 -39.285 1.00 91.39  ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? 108.574 48.190 -39.711 1.00 92.11  ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? 108.521 46.984 -39.471 1.00 92.45  ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? 107.563 48.933 -40.428 1.00 91.88  ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? 106.383 48.199 -40.975 1.00 91.54  ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? 107.739 50.254 -40.581 1.00 91.40  ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? 109.878 55.793 -42.755 1.00 115.21 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? 110.099 57.249 -42.533 1.00 105.94 ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? 108.996 55.349 -43.861 1.00 106.37 ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? 111.267 55.046 -42.949 1.00 118.84 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? 112.172 54.916 -41.859 1.00 125.09 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? 113.170 53.818 -42.139 1.00 129.74 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? 112.666 52.515 -41.754 1.00 130.75 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? 113.589 53.693 -43.607 1.00 132.48 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? 114.987 53.440 -43.680 1.00 135.33 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? 112.864 52.442 -44.066 1.00 132.40 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? 112.963 51.614 -42.804 1.00 132.13 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? 112.067 50.451 -42.709 1.00 123.60 ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? 112.500 49.345 -41.982 1.00 123.93 ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? 113.576 49.412 -41.381 1.00 124.42 ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? 111.739 48.235 -41.947 1.00 124.09 ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? 110.577 48.206 -42.597 1.00 124.12 ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? 109.876 47.071 -42.568 1.00 123.89 ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? 110.087 49.336 -43.314 1.00 124.07 ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? 110.856 50.430 -43.341 1.00 123.91 ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? 115.846 54.071 -44.873 1.00 99.93  ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? 116.359 55.370 -44.380 1.00 103.73 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? 115.050 54.022 -46.128 1.00 102.49 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? 117.050 53.044 -45.000 1.00 100.92 ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? 117.819 52.711 -43.854 1.00 102.85 ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? 118.289 51.279 -43.938 1.00 104.46 ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? 117.205 50.349 -43.694 1.00 105.21 ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? 118.884 50.882 -45.287 1.00 105.33 ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? 119.922 49.939 -45.026 1.00 106.18 ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? 117.729 50.163 -45.954 1.00 105.64 ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? 117.167 49.418 -44.759 1.00 106.42 ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? 115.800 48.919 -44.896 1.00 110.59 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? 114.634 49.616 -45.114 1.00 111.06 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? 113.573 48.851 -45.200 1.00 111.20 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? 114.073 47.566 -45.023 1.00 111.50 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? 113.458 46.309 -45.006 1.00 111.62 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? 112.150 46.129 -45.175 1.00 112.08 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? 114.242 45.225 -44.809 1.00 111.54 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? 115.553 45.406 -44.642 1.00 111.56 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? 116.249 46.537 -44.637 1.00 111.61 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? 115.439 47.595 -44.834 1.00 111.21 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? 121.200 49.859 -45.987 1.00 154.83 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? 122.345 49.723 -45.055 1.00 99.40  ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? 121.157 51.003 -46.941 1.00 99.20  ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? 121.000 48.485 -46.783 1.00 155.74 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? 121.211 47.219 -46.139 1.00 157.36 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? 120.613 46.092 -46.953 1.00 159.07 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? 119.169 46.213 -47.009 1.00 160.42 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? 121.070 45.985 -48.413 1.00 159.54 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? 121.006 44.610 -48.814 1.00 158.88 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? 119.948 46.688 -49.151 1.00 160.30 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? 118.779 46.126 -48.371 1.00 160.93 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? 117.487 46.786 -48.538 1.00 105.52 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? 117.200 48.080 -48.919 1.00 105.64 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? 115.915 48.338 -48.988 1.00 105.66 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? 115.316 47.135 -48.627 1.00 105.34 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? 113.978 46.750 -48.506 1.00 104.75 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? 112.955 47.572 -48.739 1.00 104.51 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? 113.720 45.477 -48.128 1.00 104.65 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? 114.748 44.657 -47.882 1.00 105.08 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? 116.053 44.901 -47.956 1.00 105.35 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? 116.272 46.174 -48.341 1.00 105.53 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? 122.345 43.740 -48.936 1.00 172.29 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? 123.012 43.776 -47.611 1.00 120.47 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? 123.077 44.178 -50.153 1.00 120.58 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? 121.811 42.260 -49.184 1.00 171.95 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? 121.544 41.389 -48.090 1.00 171.27 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? 120.440 40.422 -48.449 1.00 171.06 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? 119.170 41.116 -48.491 1.00 170.82 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? 120.601 39.750 -49.812 1.00 170.91 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? 120.192 38.381 -49.726 1.00 170.71 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? 119.671 40.546 -50.710 1.00 170.70 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? 118.556 40.938 -49.757 1.00 170.43 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? 117.903 42.193 -50.110 1.00 118.94 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? 118.477 43.434 -50.161 1.00 118.86 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? 117.650 44.386 -50.519 1.00 118.55 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? 116.445 43.725 -50.720 1.00 118.56 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? 115.168 44.174 -51.125 1.00 118.38 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? 114.883 45.451 -51.416 1.00 117.90 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? 114.184 43.251 -51.224 1.00 118.59 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? 114.471 41.971 -50.941 1.00 118.84 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? 115.627 41.429 -50.559 1.00 118.89 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? 116.586 42.371 -50.466 1.00 118.76 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? 119.859 37.563 -51.066 1.00 125.11 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? 119.863 36.103 -50.765 1.00 158.29 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? 120.732 38.093 -52.146 1.00 158.86 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? 118.367 38.006 -51.384 1.00 123.76 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? 117.342 37.861 -50.402 1.00 119.39 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? 116.003 37.688 -51.076 1.00 116.23 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? 115.581 38.946 -51.656 1.00 115.37 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? 116.017 36.676 -52.220 1.00 114.37 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? 114.802 35.935 -52.215 1.00 111.87 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? 116.110 37.551 -53.458 1.00 114.05 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? 115.306 38.768 -53.037 1.00 114.04 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? 115.626 40.022 -53.724 1.00 146.18 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? 116.849 40.478 -54.147 1.00 145.94 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? 116.807 41.669 -54.695 1.00 145.63 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? 115.465 42.019 -54.636 1.00 145.55 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? 114.763 43.172 -55.041 1.00 145.18 ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? 115.342 44.237 -55.593 1.00 144.63 ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? 113.428 43.196 -54.847 1.00 144.95 ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? 112.848 42.139 -54.276 1.00 145.02 ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? 113.396 41.007 -53.842 1.00 145.77 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? 114.723 41.009 -54.054 1.00 145.92 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? 114.759 34.476 -52.876 1.00 132.62 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? 114.998 33.463 -51.824 1.00 172.81 ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? 115.596 34.486 -54.102 1.00 173.15 ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? 113.252 34.339 -53.338 1.00 130.70 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? 112.231 35.057 -52.666 1.00 126.39 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? 111.200 35.533 -53.660 1.00 123.19 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? 111.590 36.802 -54.241 1.00 122.69 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? 110.971 34.563 -54.817 1.00 120.35 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? 109.576 34.238 -54.910 1.00 115.01 ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? 111.591 35.255 -56.025 1.00 120.43 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? 111.653 36.733 -55.660 1.00 121.45 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? 112.909 37.366 -56.063 1.00 162.42 ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? 114.169 36.877 -55.817 1.00 162.97 ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? 115.121 37.663 -56.243 1.00 162.02 ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? 114.455 38.736 -56.819 1.00 161.41 ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? 114.969 39.904 -57.439 1.00 160.50 ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? 116.147 40.236 -57.593 1.00 159.09 ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? 113.951 40.730 -57.897 1.00 160.77 ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? 112.611 40.473 -57.774 1.00 160.83 ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? 111.792 41.397 -58.293 1.00 160.15 ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? 112.111 39.390 -57.187 1.00 161.33 ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? 113.086 38.568 -56.734 1.00 161.98 ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? 108.883 33.981 -56.336 1.00 94.13  ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? 107.817 32.958 -56.144 1.00 118.40 ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? 109.874 33.805 -57.434 1.00 117.02 ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? 108.173 35.372 -56.545 1.00 90.16  ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? 107.147 35.491 -57.458 1.00 84.33  ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? 106.812 36.941 -57.616 1.00 80.47  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? 108.036 37.655 -57.892 1.00 82.51  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? 105.921 37.126 -58.824 1.00 77.33  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? 105.047 38.204 -58.590 1.00 68.74  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? 106.909 37.430 -59.925 1.00 79.75  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? 107.981 38.207 -59.200 1.00 84.53  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? 109.307 38.096 -59.804 1.00 111.33 ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? 110.107 36.981 -59.849 1.00 113.21 ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? 111.260 37.199 -60.421 1.00 115.34 ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? 111.216 38.539 -60.784 1.00 116.65 ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? 112.189 39.353 -61.423 1.00 118.26 ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? 113.330 39.046 -61.798 1.00 120.65 ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? 111.726 40.651 -61.608 1.00 118.62 ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? 110.494 41.114 -61.223 1.00 118.16 ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? 110.233 42.399 -61.501 1.00 118.01 ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? 109.585 40.371 -60.615 1.00 116.51 ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? 110.010 39.103 -60.427 1.00 114.22 ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? 103.621 38.220 -59.289 1.00 56.11  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? 102.659 38.405 -58.172 1.00 87.01  ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? 103.499 37.043 -60.186 1.00 83.60  ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? 103.675 39.539 -60.177 1.00 58.05  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? 104.051 40.782 -59.594 1.00 61.63  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? 104.540 41.736 -60.656 1.00 62.60  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? 105.848 41.353 -61.175 1.00 63.36  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? 103.610 41.862 -61.859 1.00 62.90  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? 103.494 43.239 -62.183 1.00 61.20  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? 104.334 41.093 -62.956 1.00 62.57  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? 105.811 41.286 -62.599 1.00 65.30  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? 106.714 40.192 -63.022 1.00 92.97  ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? 107.749 40.452 -63.935 1.00 94.60  ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? 107.850 41.581 -64.423 1.00 91.38  ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? 108.607 39.455 -64.268 1.00 95.07  ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? 108.448 38.236 -63.745 1.00 97.31  ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? 109.324 37.273 -64.081 1.00 98.91  ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? 107.387 37.941 -62.848 1.00 94.47  ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? 106.552 38.939 -62.516 1.00 92.51  ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? 102.183 43.773 -62.909 1.00 60.38  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? 101.427 44.680 -62.006 1.00 82.06  ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? 101.534 42.577 -63.480 1.00 83.76  ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? 102.759 44.633 -64.120 1.00 60.12  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? 103.745 45.636 -63.888 1.00 61.11  ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? 104.585 45.861 -65.122 1.00 62.15  ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? 105.454 44.732 -65.359 1.00 61.37  ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? 103.813 46.092 -66.417 1.00 63.76  ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? 104.391 47.203 -67.112 1.00 68.64  ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? 103.997 44.792 -67.180 1.00 63.16  ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? 105.354 44.325 -66.712 1.00 61.48  ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? 105.562 42.878 -66.747 1.00 85.18  ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? 104.825 41.907 -66.121 1.00 83.70  ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? 105.280 40.692 -66.310 1.00 84.29  ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? 106.388 40.875 -67.116 1.00 86.49  ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? 107.308 39.977 -67.663 1.00 88.36  ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? 107.272 38.658 -67.447 1.00 88.22  ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? 108.290 40.482 -68.443 1.00 90.08  ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? 108.342 41.805 -68.632 1.00 88.16  ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? 107.541 42.753 -68.161 1.00 87.13  ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? 106.570 42.216 -67.403 1.00 87.33  ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? 103.585 47.905 -68.315 1.00 84.84  ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? 103.729 49.376 -68.186 1.00 95.79  ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? 102.221 47.310 -68.415 1.00 94.55  ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? 104.415 47.437 -69.592 1.00 85.69  ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? 105.841 47.346 -69.552 1.00 87.56  ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? 106.334 46.547 -70.733 1.00 88.91  ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? 106.528 45.153 -70.386 1.00 87.89  ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? 105.368 46.572 -71.916 1.00 90.51  ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? 106.060 46.827 -73.129 1.00 94.65  ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? 104.816 45.160 -71.952 1.00 89.32  ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? 105.975 44.348 -71.409 1.00 87.60  ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? 105.587 43.039 -70.833 1.00 99.23  ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? 106.318 41.934 -71.194 1.00 99.16  ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? 107.289 41.993 -71.917 1.00 99.11  ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? 105.863 40.748 -70.679 1.00 98.92  ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? 104.769 40.562 -69.863 1.00 97.30  ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? 104.454 39.436 -69.505 1.00 95.94  ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? 104.064 41.755 -69.503 1.00 97.88  ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? 102.869 41.636 -68.615 1.00 97.70  ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? 104.505 42.924 -69.987 1.00 97.98  ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? 105.309 47.600 -74.310 1.00 139.66 ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? 105.864 48.969 -74.361 1.00 83.19  ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? 103.855 47.400 -74.109 1.00 83.98  ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? 105.737 46.803 -75.616 1.00 139.45 ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? 107.082 46.384 -75.805 1.00 140.89 ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? 107.126 45.196 -76.739 1.00 141.08 ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? 106.797 43.974 -76.029 1.00 141.19 ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? 106.157 45.287 -77.918 1.00 141.69 ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? 106.832 44.936 -79.138 1.00 141.34 ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? 105.037 44.325 -77.541 1.00 141.19 ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? 105.745 43.275 -76.692 1.00 141.18 ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? 104.920 42.615 -75.671 1.00 85.14  ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? 103.925 43.190 -74.909 1.00 84.27  ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? 103.402 42.368 -74.037 1.00 83.21  ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? 104.080 41.175 -74.236 1.00 84.15  ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? 103.959 39.923 -73.568 1.00 84.25  ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? 103.235 39.619 -72.617 1.00 85.52  ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? 104.813 38.972 -74.109 1.00 84.87  ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? 105.681 39.192 -75.146 1.00 84.77  ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? 106.380 38.127 -75.539 1.00 84.46  ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? 105.836 40.360 -75.754 1.00 84.26  ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? 105.007 41.300 -75.256 1.00 84.56  ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? 105.998 44.338 -80.376 1.00 136.59 ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? 106.773 44.509 -81.635 1.00 99.65  ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? 104.600 44.857 -80.302 1.00 99.04  ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? 105.998 42.788 -80.028 1.00 135.78 ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? 107.227 42.110 -79.792 1.00 133.61 ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? 107.138 40.712 -80.345 1.00 133.10 ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? 106.411 39.877 -79.419 1.00 131.68 ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? 106.360 40.674 -81.657 1.00 132.62 ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? 106.928 39.720 -82.547 1.00 131.91 ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? 104.958 40.282 -81.227 1.00 132.07 ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? 105.208 39.405 -80.011 1.00 131.16 ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? 104.155 39.468 -78.978 1.00 92.68  ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? 103.846 38.315 -78.301 1.00 91.83  ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? 104.361 37.237 -78.551 1.00 90.89  ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? 102.900 38.471 -77.314 1.00 91.26  ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? 102.246 39.636 -76.956 1.00 91.19  ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? 101.437 39.630 -76.032 1.00 90.57  ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? 102.596 40.793 -77.727 1.00 91.34  ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? 101.920 42.091 -77.423 1.00 89.11  ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? 103.518 40.657 -78.689 1.00 91.94  ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? 106.174 39.372 -83.914 1.00 115.92 ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? 107.193 39.052 -84.951 1.00 110.56 ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? 105.170 40.440 -84.167 1.00 108.16 ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? 105.402 38.035 -83.545 1.00 112.95 ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? 106.120 36.899 -83.080 1.00 108.27 ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? 105.214 35.694 -83.048 1.00 105.39 ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? 104.320 35.768 -81.912 1.00 103.41 ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? 104.325 35.563 -84.280 1.00 104.17 ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? 104.239 34.184 -84.639 1.00 103.22 ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? 102.986 36.104 -83.804 1.00 103.09 ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? 102.973 35.674 -82.347 1.00 101.01 ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? 102.142 36.508 -81.449 1.00 90.93  ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? 101.612 35.928 -80.307 1.00 88.05  ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? 101.802 34.762 -79.981 1.00 83.38  ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? 100.840 36.774 -79.550 1.00 87.13  ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? 100.553 38.101 -79.807 1.00 88.22  ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? 99.836  38.734 -79.037 1.00 84.66  ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? 101.145 38.640 -81.000 1.00 89.81  ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? 100.893 40.071 -81.339 1.00 89.70  ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? 101.900 37.831 -81.754 1.00 89.49  ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? 103.439 33.747 -85.961 1.00 97.67  ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? 104.333 32.902 -86.782 1.00 83.09  ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? 102.789 34.933 -86.571 1.00 83.04  ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? 102.276 32.833 -85.381 1.00 97.58  ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? 102.456 32.076 -84.185 1.00 95.26  ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? 101.110 31.731 -83.595 1.00 94.20  ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? 100.554 32.870 -82.890 1.00 93.34  ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? 100.066 31.336 -84.645 1.00 92.69  ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? 99.307  30.235 -84.183 1.00 92.52  ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? 99.157  32.547 -84.722 1.00 91.79  ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? 99.208  33.048 -83.297 1.00 92.84  ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? 98.860  34.461 -83.127 1.00 77.41  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? 98.392  34.892 -81.875 1.00 77.04  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? 98.283  34.056 -80.957 1.00 75.82  ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? 98.074  36.204 -81.700 1.00 76.32  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? 98.208  37.061 -82.717 1.00 76.17  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? 97.910  38.332 -82.506 1.00 75.24  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? 98.666  36.643 -84.003 1.00 75.72  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? 98.983  35.346 -84.161 1.00 75.96  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? 99.473  28.825 -84.900 1.00 79.55  ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? 100.932 28.530 -84.847 1.00 85.12  ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? 98.775  28.935 -86.200 1.00 87.00  ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? 98.697  27.815 -83.946 1.00 79.93  ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? 99.088  27.685 -82.578 1.00 75.04  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? 97.885  27.767 -81.666 1.00 71.26  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? 97.346  29.104 -81.619 1.00 70.56  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? 96.728  26.869 -82.072 1.00 68.10  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? 96.143  26.353 -80.887 1.00 67.40  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? 95.784  27.816 -82.793 1.00 67.47  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? 95.987  29.105 -82.027 1.00 68.14  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? 95.768  30.326 -82.793 1.00 72.76  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? 96.057  30.558 -84.110 1.00 73.28  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? 95.817  31.786 -84.497 1.00 72.43  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? 95.330  32.404 -83.356 1.00 71.09  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? 94.927  33.726 -83.094 1.00 71.78  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? 94.981  34.710 -83.996 1.00 72.74  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? 94.477  34.009 -81.856 1.00 71.34  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? 94.455  33.029 -80.945 1.00 69.76  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? 94.826  31.755 -81.062 1.00 72.06  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? 95.264  31.506 -82.307 1.00 71.87  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? 95.222  25.057 -80.966 1.00 85.58  ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? 95.789  24.020 -80.049 1.00 74.13  ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? 95.010  24.755 -82.412 1.00 75.71  ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? 93.843  25.574 -80.373 1.00 86.63  ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? 93.819  26.456 -79.261 1.00 83.51  ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? 92.632  27.378 -79.368 1.00 84.01  ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? 92.860  28.448 -80.313 1.00 83.11  ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? 91.363  26.672 -79.841 1.00 85.29  ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? 90.253  27.230 -79.146 1.00 85.07  ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? 91.271  27.086 -81.295 1.00 84.65  ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? 91.720  28.513 -81.145 1.00 86.14  ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? 92.063  29.226 -82.365 1.00 79.03  ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? 92.635  28.730 -83.511 1.00 78.60  ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? 92.835  29.648 -84.418 1.00 81.20  ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? 92.362  30.814 -83.832 1.00 81.89  ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? 92.328  32.143 -84.323 1.00 83.66  ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? 92.744  32.575 -85.402 1.00 86.34  ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? 91.747  33.009 -83.403 1.00 82.88  ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? 91.267  32.640 -82.162 1.00 81.74  ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? 90.723  33.605 -81.411 1.00 82.02  ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? 91.313  31.414 -81.692 1.00 80.22  ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? 91.869  30.560 -82.571 1.00 80.09  ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? 89.648  26.465 -77.883 1.00 80.21  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? 90.764  26.132 -76.959 1.00 61.86  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? 88.790  25.379 -78.420 1.00 62.59  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? 88.720  27.577 -77.225 1.00 82.31  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? 89.254  28.802 -76.749 1.00 76.24  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? 88.341  29.940 -77.130 1.00 75.55  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? 88.650  30.424 -78.459 1.00 73.03  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? 86.849  29.585 -77.142 1.00 73.90  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? 86.088  30.679 -76.643 1.00 72.41  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? 86.535  29.449 -78.620 1.00 74.15  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? 87.435  30.529 -79.194 1.00 74.40  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? 87.740  30.408 -80.634 1.00 55.89  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? 87.743  31.574 -81.415 1.00 54.90  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? 87.515  32.653 -80.878 1.00 54.54  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? 87.994  31.489 -82.730 1.00 57.19  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? 88.246  30.297 -83.284 1.00 56.21  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? 88.504  30.265 -84.602 1.00 59.45  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? 88.250  29.089 -82.514 1.00 55.24  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? 88.000  29.192 -81.206 1.00 55.47  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? 84.898  30.415 -75.613 1.00 51.98  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? 85.428  30.565 -74.248 1.00 59.40  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? 84.221  29.175 -76.004 1.00 58.76  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? 83.955  31.641 -75.908 1.00 50.88  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? 84.496  32.949 -75.830 1.00 51.84  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? 84.071  33.775 -77.019 1.00 52.58  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? 84.518  33.153 -78.251 1.00 49.85  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? 82.569  33.954 -77.163 1.00 55.40  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? 82.297  35.329 -77.402 1.00 59.83  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? 82.207  33.077 -78.359 1.00 52.09  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? 83.461  33.104 -79.197 1.00 50.51  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? 83.702  31.943 -80.054 1.00 57.20  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? 83.694  30.606 -79.690 1.00 56.64  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? 84.046  29.801 -80.660 1.00 57.60  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? 84.292  30.649 -81.736 1.00 58.62  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? 84.756  30.357 -83.064 1.00 57.79  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? 85.080  29.256 -83.538 1.00 62.42  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? 84.837  31.513 -83.846 1.00 58.99  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? 84.524  32.785 -83.409 1.00 58.79  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? 84.578  33.754 -84.329 1.00 64.18  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? 84.153  33.083 -82.160 1.00 58.84  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? 84.050  31.975 -81.387 1.00 57.43  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? 80.825  35.899 -77.140 1.00 89.35  ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? 80.916  37.051 -76.200 1.00 63.24  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? 79.961  34.740 -76.812 1.00 62.60  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? 80.400  36.427 -78.579 1.00 88.25  ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? 81.262  37.305 -79.303 1.00 89.21  ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? 80.817  37.415 -80.743 1.00 89.95  ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? 81.234  36.278 -81.533 1.00 87.22  ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? 79.316  37.530 -80.938 1.00 92.77  ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? 79.092  38.485 -81.962 1.00 97.20  ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? 78.911  36.132 -81.384 1.00 89.46  ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? 80.119  35.678 -82.182 1.00 87.88  ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? 80.344  34.232 -82.191 1.00 61.04  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? 80.145  33.372 -81.142 1.00 60.48  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? 80.475  32.137 -81.415 1.00 61.44  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? 80.911  32.178 -82.726 1.00 62.46  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? 81.416  31.141 -83.549 1.00 61.63  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? 81.616  29.944 -83.252 1.00 66.26  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? 81.725  31.610 -84.825 1.00 62.83  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? 81.602  32.920 -85.232 1.00 62.63  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? 81.960  33.190 -86.495 1.00 68.02  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? 81.161  33.901 -84.458 1.00 62.68  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? 80.827  33.461 -83.230 1.00 61.27  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? 77.597  38.888 -82.361 1.00 102.79 ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? 77.553  40.370 -82.283 1.00 81.12  ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? 76.608  38.072 -81.592 1.00 82.96  ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? 77.510  38.420 -83.877 1.00 101.67 ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? 78.619  38.586 -84.749 1.00 103.31 ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? 78.347  37.874 -86.048 1.00 105.87 ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? 78.745  36.488 -85.972 1.00 102.95 ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? 76.866  37.870 -86.399 1.00 107.41 ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? 76.693  38.116 -87.777 1.00 112.53 ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? 76.416  36.460 -86.072 1.00 104.19 ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? 77.665  35.662 -86.369 1.00 102.51 ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? 77.754  34.415 -85.615 1.00 84.00  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? 77.463  34.216 -84.292 1.00 82.70  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? 77.606  32.972 -83.901 1.00 80.26  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? 78.026  32.309 -85.042 1.00 79.56  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? 78.338  30.959 -85.292 1.00 78.06  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? 78.224  29.992 -84.380 1.00 74.04  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? 78.759  30.629 -86.532 1.00 78.01  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? 78.827  31.593 -87.459 1.00 80.80  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? 78.535  32.894 -87.353 1.00 81.87  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? 78.138  33.189 -86.103 1.00 81.71  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? 75.236  38.450 -88.325 1.00 86.66  ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? 75.290  39.753 -89.030 1.00 94.55  ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? 74.267  38.245 -87.220 1.00 93.85  ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? 75.013  37.304 -89.383 1.00 84.88  ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? 76.002  37.030 -90.346 1.00 84.52  ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? 75.599  35.800 -91.113 1.00 84.03  ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? 75.887  34.615 -90.332 1.00 82.79  ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? 74.099  35.773 -91.391 1.00 84.15  ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? 73.895  35.314 -92.721 1.00 85.23  ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? 73.548  34.822 -90.336 1.00 83.31  ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? 74.706  33.864 -90.097 1.00 82.96  ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? 74.797  33.330 -88.738 1.00 88.26  ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? 74.671  34.019 -87.556 1.00 88.00  ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? 74.804  33.269 -86.488 1.00 87.30  ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? 75.034  32.000 -87.000 1.00 86.24  ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? 75.252  30.760 -86.382 1.00 86.66  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? 75.262  30.587 -85.063 1.00 84.94  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? 75.458  29.686 -87.175 1.00 87.92  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? 75.439  29.859 -88.499 1.00 88.50  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? 75.236  30.975 -89.202 1.00 87.82  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? 75.037  32.023 -88.383 1.00 86.95  ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 74  ? 72.452  34.802 -93.170 1.00 116.00 ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 74  ? 72.405  34.969 -94.653 1.00 75.51  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 74  ? 71.421  35.464 -92.295 1.00 73.56  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 74  ? 72.526  33.247 -92.851 1.00 114.27 ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 74  ? 73.585  32.468 -93.381 1.00 111.19 ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 74  ? 73.203  31.012 -93.378 1.00 111.35 ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 74  ? 73.380  30.448 -92.056 1.00 110.05 ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 74  ? 71.745  30.780 -93.756 1.00 112.58 ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 74  ? 71.643  29.682 -94.664 1.00 115.82 ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 74  ? 71.078  30.471 -92.425 1.00 110.85 ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 74  ? 72.195  29.796 -91.649 1.00 108.76 ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 74  ? 72.082  29.917 -90.181 1.00 61.81  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 74  ? 72.197  28.776 -89.425 1.00 60.91  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 74  ? 72.403  27.672 -89.908 1.00 59.05  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 74  ? 72.045  28.969 -88.072 1.00 60.30  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 74  ? 71.772  30.161 -87.421 1.00 59.69  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 74  ? 71.620  30.179 -86.193 1.00 62.12  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 74  ? 71.675  31.314 -88.277 1.00 59.67  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 74  ? 71.376  32.644 -87.663 1.00 55.98  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 74  ? 71.849  31.139 -89.593 1.00 59.71  ? 74   DT  I C6    1 
ATOM   1512  P P     . DT  A 1 75  ? 70.209  29.276 -95.259 1.00 115.73 ? 75   DT  I P     1 
ATOM   1513  O OP1   . DT  A 1 75  ? 70.395  28.966 -96.697 1.00 93.67  ? 75   DT  I OP1   1 
ATOM   1514  O OP2   . DT  A 1 75  ? 69.238  30.331 -94.853 1.00 91.76  ? 75   DT  I OP2   1 
ATOM   1515  O "O5'" . DT  A 1 75  ? 69.883  27.925 -94.480 1.00 112.55 ? 75   DT  I "O5'" 1 
ATOM   1516  C "C5'" . DT  A 1 75  ? 70.877  26.906 -94.382 1.00 112.30 ? 75   DT  I "C5'" 1 
ATOM   1517  C "C4'" . DT  A 1 75  ? 70.321  25.692 -93.681 1.00 111.46 ? 75   DT  I "C4'" 1 
ATOM   1518  O "O4'" . DT  A 1 75  ? 70.456  25.781 -92.240 1.00 109.71 ? 75   DT  I "O4'" 1 
ATOM   1519  C "C3'" . DT  A 1 75  ? 68.843  25.460 -93.962 1.00 110.84 ? 75   DT  I "C3'" 1 
ATOM   1520  O "O3'" . DT  A 1 75  ? 68.624  24.070 -94.131 1.00 113.48 ? 75   DT  I "O3'" 1 
ATOM   1521  C "C2'" . DT  A 1 75  ? 68.167  25.954 -92.697 1.00 108.90 ? 75   DT  I "C2'" 1 
ATOM   1522  C "C1'" . DT  A 1 75  ? 69.187  25.596 -91.624 1.00 107.43 ? 75   DT  I "C1'" 1 
ATOM   1523  N N1    . DT  A 1 75  ? 69.134  26.443 -90.395 1.00 80.76  ? 75   DT  I N1    1 
ATOM   1524  C C2    . DT  A 1 75  ? 69.335  25.847 -89.158 1.00 78.95  ? 75   DT  I C2    1 
ATOM   1525  O O2    . DT  A 1 75  ? 69.542  24.655 -89.008 1.00 79.16  ? 75   DT  I O2    1 
ATOM   1526  N N3    . DT  A 1 75  ? 69.285  26.708 -88.097 1.00 75.79  ? 75   DT  I N3    1 
ATOM   1527  C C4    . DT  A 1 75  ? 69.061  28.063 -88.134 1.00 74.46  ? 75   DT  I C4    1 
ATOM   1528  O O4    . DT  A 1 75  ? 69.073  28.709 -87.094 1.00 72.08  ? 75   DT  I O4    1 
ATOM   1529  C C5    . DT  A 1 75  ? 68.836  28.618 -89.446 1.00 75.00  ? 75   DT  I C5    1 
ATOM   1530  C C7    . DT  A 1 75  ? 68.548  30.079 -89.573 1.00 73.14  ? 75   DT  I C7    1 
ATOM   1531  C C6    . DT  A 1 75  ? 68.890  27.797 -90.496 1.00 77.81  ? 75   DT  I C6    1 
ATOM   1532  P P     . DC  A 1 76  ? 67.245  23.553 -94.753 1.00 128.98 ? 76   DC  I P     1 
ATOM   1533  O OP1   . DC  A 1 76  ? 67.586  22.695 -95.910 1.00 103.57 ? 76   DC  I OP1   1 
ATOM   1534  O OP2   . DC  A 1 76  ? 66.336  24.709 -94.941 1.00 102.38 ? 76   DC  I OP2   1 
ATOM   1535  O "O5'" . DC  A 1 76  ? 66.675  22.632 -93.590 1.00 127.45 ? 76   DC  I "O5'" 1 
ATOM   1536  C "C5'" . DC  A 1 76  ? 67.543  21.756 -92.869 1.00 124.12 ? 76   DC  I "C5'" 1 
ATOM   1537  C "C4'" . DC  A 1 76  ? 66.962  21.449 -91.508 1.00 121.87 ? 76   DC  I "C4'" 1 
ATOM   1538  O "O4'" . DC  A 1 76  ? 67.097  22.584 -90.616 1.00 117.47 ? 76   DC  I "O4'" 1 
ATOM   1539  C "C3'" . DC  A 1 76  ? 65.471  21.105 -91.534 1.00 120.30 ? 76   DC  I "C3'" 1 
ATOM   1540  O "O3'" . DC  A 1 76  ? 65.203  20.061 -90.600 1.00 121.83 ? 76   DC  I "O3'" 1 
ATOM   1541  C "C2'" . DC  A 1 76  ? 64.810  22.383 -91.054 1.00 118.48 ? 76   DC  I "C2'" 1 
ATOM   1542  C "C1'" . DC  A 1 76  ? 65.827  22.880 -90.045 1.00 114.94 ? 76   DC  I "C1'" 1 
ATOM   1543  N N1    . DC  A 1 76  ? 65.767  24.324 -89.788 1.00 84.34  ? 76   DC  I N1    1 
ATOM   1544  C C2    . DC  A 1 76  ? 65.815  24.785 -88.455 1.00 82.05  ? 76   DC  I C2    1 
ATOM   1545  O O2    . DC  A 1 76  ? 65.915  23.957 -87.536 1.00 78.63  ? 76   DC  I O2    1 
ATOM   1546  N N3    . DC  A 1 76  ? 65.756  26.114 -88.212 1.00 79.53  ? 76   DC  I N3    1 
ATOM   1547  C C4    . DC  A 1 76  ? 65.656  26.974 -89.236 1.00 78.39  ? 76   DC  I C4    1 
ATOM   1548  N N4    . DC  A 1 76  ? 65.590  28.289 -88.962 1.00 71.71  ? 76   DC  I N4    1 
ATOM   1549  C C5    . DC  A 1 76  ? 65.612  26.529 -90.599 1.00 79.06  ? 76   DC  I C5    1 
ATOM   1550  C C6    . DC  A 1 76  ? 65.666  25.210 -90.823 1.00 80.98  ? 76   DC  I C6    1 
ATOM   1551  P P     . DC  A 1 77  ? 64.988  18.564 -91.128 1.00 129.06 ? 77   DC  I P     1 
ATOM   1552  O OP1   . DC  A 1 77  ? 66.322  18.000 -91.468 1.00 118.47 ? 77   DC  I OP1   1 
ATOM   1553  O OP2   . DC  A 1 77  ? 63.923  18.623 -92.155 1.00 117.28 ? 77   DC  I OP2   1 
ATOM   1554  O "O5'" . DC  A 1 77  ? 64.392  17.790 -89.874 1.00 127.53 ? 77   DC  I "O5'" 1 
ATOM   1555  C "C5'" . DC  A 1 77  ? 65.146  17.615 -88.676 1.00 124.20 ? 77   DC  I "C5'" 1 
ATOM   1556  C "C4'" . DC  A 1 77  ? 64.278  17.928 -87.479 1.00 121.95 ? 77   DC  I "C4'" 1 
ATOM   1557  O "O4'" . DC  A 1 77  ? 64.221  19.347 -87.196 1.00 117.55 ? 77   DC  I "O4'" 1 
ATOM   1558  C "C3'" . DC  A 1 77  ? 62.816  17.509 -87.639 1.00 120.38 ? 77   DC  I "C3'" 1 
ATOM   1559  O "O3'" . DC  A 1 77  ? 62.280  17.340 -86.340 1.00 121.91 ? 77   DC  I "O3'" 1 
ATOM   1560  C "C2'" . DC  A 1 77  ? 62.171  18.797 -88.092 1.00 118.56 ? 77   DC  I "C2'" 1 
ATOM   1561  C "C1'" . DC  A 1 77  ? 62.847  19.675 -87.074 1.00 115.02 ? 77   DC  I "C1'" 1 
ATOM   1562  N N1    . DC  A 1 77  ? 62.678  21.119 -87.215 1.00 99.24  ? 77   DC  I N1    1 
ATOM   1563  C C2    . DC  A 1 77  ? 62.919  21.928 -86.101 1.00 96.95  ? 77   DC  I C2    1 
ATOM   1564  O O2    . DC  A 1 77  ? 63.286  21.397 -85.041 1.00 93.53  ? 77   DC  I O2    1 
ATOM   1565  N N3    . DC  A 1 77  ? 62.751  23.262 -86.209 1.00 94.43  ? 77   DC  I N3    1 
ATOM   1566  C C4    . DC  A 1 77  ? 62.367  23.792 -87.374 1.00 93.29  ? 77   DC  I C4    1 
ATOM   1567  N N4    . DC  A 1 77  ? 62.221  25.111 -87.445 1.00 86.61  ? 77   DC  I N4    1 
ATOM   1568  C C5    . DC  A 1 77  ? 62.118  22.991 -88.522 1.00 93.96  ? 77   DC  I C5    1 
ATOM   1569  C C6    . DC  A 1 77  ? 62.284  21.672 -88.400 1.00 95.88  ? 77   DC  I C6    1 
ATOM   1570  P P     . DG  A 1 78  ? 62.217  15.900 -85.692 1.00 107.32 ? 78   DG  I P     1 
ATOM   1571  O OP1   . DG  A 1 78  ? 63.611  15.375 -85.727 1.00 88.96  ? 78   DG  I OP1   1 
ATOM   1572  O OP2   . DG  A 1 78  ? 61.114  15.177 -86.378 1.00 86.98  ? 78   DG  I OP2   1 
ATOM   1573  O "O5'" . DG  A 1 78  ? 61.806  16.212 -84.191 1.00 106.17 ? 78   DG  I "O5'" 1 
ATOM   1574  C "C5'" . DG  A 1 78  ? 62.727  16.860 -83.324 1.00 102.56 ? 78   DG  I "C5'" 1 
ATOM   1575  C "C4'" . DG  A 1 78  ? 62.028  17.918 -82.507 1.00 101.88 ? 78   DG  I "C4'" 1 
ATOM   1576  O "O4'" . DG  A 1 78  ? 61.680  19.074 -83.304 1.00 99.97  ? 78   DG  I "O4'" 1 
ATOM   1577  C "C3'" . DG  A 1 78  ? 60.732  17.470 -81.845 1.00 101.52 ? 78   DG  I "C3'" 1 
ATOM   1578  O "O3'" . DG  A 1 78  ? 60.702  18.074 -80.563 1.00 99.85  ? 78   DG  I "O3'" 1 
ATOM   1579  C "C2'" . DG  A 1 78  ? 59.660  18.103 -82.717 1.00 101.37 ? 78   DG  I "C2'" 1 
ATOM   1580  C "C1'" . DG  A 1 78  ? 60.326  19.419 -83.052 1.00 100.43 ? 78   DG  I "C1'" 1 
ATOM   1581  N N9    . DG  A 1 78  ? 59.815  20.126 -84.221 1.00 81.29  ? 78   DG  I N9    1 
ATOM   1582  C C8    . DG  A 1 78  ? 59.440  19.569 -85.415 1.00 80.55  ? 78   DG  I C8    1 
ATOM   1583  N N7    . DG  A 1 78  ? 59.085  20.453 -86.307 1.00 81.73  ? 78   DG  I N7    1 
ATOM   1584  C C5    . DG  A 1 78  ? 59.224  21.671 -85.661 1.00 82.31  ? 78   DG  I C5    1 
ATOM   1585  C C6    . DG  A 1 78  ? 59.008  22.980 -86.139 1.00 83.25  ? 78   DG  I C6    1 
ATOM   1586  O O6    . DG  A 1 78  ? 58.674  23.331 -87.266 1.00 82.73  ? 78   DG  I O6    1 
ATOM   1587  N N1    . DG  A 1 78  ? 59.240  23.932 -85.156 1.00 84.41  ? 78   DG  I N1    1 
ATOM   1588  C C2    . DG  A 1 78  ? 59.654  23.656 -83.874 1.00 85.12  ? 78   DG  I C2    1 
ATOM   1589  N N2    . DG  A 1 78  ? 59.830  24.724 -83.073 1.00 83.42  ? 78   DG  I N2    1 
ATOM   1590  N N3    . DG  A 1 78  ? 59.881  22.428 -83.414 1.00 82.21  ? 78   DG  I N3    1 
ATOM   1591  C C4    . DG  A 1 78  ? 59.647  21.489 -84.360 1.00 82.59  ? 78   DG  I C4    1 
ATOM   1592  P P     . DC  A 1 79  ? 60.520  17.168 -79.255 1.00 83.52  ? 79   DC  I P     1 
ATOM   1593  O OP1   . DC  A 1 79  ? 61.847  16.589 -78.839 1.00 69.56  ? 79   DC  I OP1   1 
ATOM   1594  O OP2   . DC  A 1 79  ? 59.338  16.281 -79.489 1.00 68.47  ? 79   DC  I OP2   1 
ATOM   1595  O "O5'" . DC  A 1 79  ? 60.159  18.246 -78.147 1.00 81.18  ? 79   DC  I "O5'" 1 
ATOM   1596  C "C5'" . DC  A 1 79  ? 60.981  19.395 -77.949 1.00 75.05  ? 79   DC  I "C5'" 1 
ATOM   1597  C "C4'" . DC  A 1 79  ? 60.102  20.601 -77.764 1.00 74.78  ? 79   DC  I "C4'" 1 
ATOM   1598  O "O4'" . DC  A 1 79  ? 59.599  21.034 -79.046 1.00 73.33  ? 79   DC  I "O4'" 1 
ATOM   1599  C "C3'" . DC  A 1 79  ? 58.868  20.245 -76.941 1.00 70.47  ? 79   DC  I "C3'" 1 
ATOM   1600  O "O3'" . DC  A 1 79  ? 58.490  21.381 -76.194 1.00 74.00  ? 79   DC  I "O3'" 1 
ATOM   1601  C "C2'" . DC  A 1 79  ? 57.814  20.020 -78.002 1.00 73.51  ? 79   DC  I "C2'" 1 
ATOM   1602  C "C1'" . DC  A 1 79  ? 58.202  21.120 -78.947 1.00 72.34  ? 79   DC  I "C1'" 1 
ATOM   1603  N N1    . DC  A 1 79  ? 57.617  21.079 -80.286 1.00 58.03  ? 79   DC  I N1    1 
ATOM   1604  C C2    . DC  A 1 79  ? 57.316  22.301 -80.902 1.00 58.95  ? 79   DC  I C2    1 
ATOM   1605  O O2    . DC  A 1 79  ? 57.633  23.350 -80.330 1.00 60.35  ? 79   DC  I O2    1 
ATOM   1606  N N3    . DC  A 1 79  ? 56.688  22.306 -82.097 1.00 60.18  ? 79   DC  I N3    1 
ATOM   1607  C C4    . DC  A 1 79  ? 56.367  21.153 -82.684 1.00 60.98  ? 79   DC  I C4    1 
ATOM   1608  N N4    . DC  A 1 79  ? 55.711  21.221 -83.835 1.00 61.46  ? 79   DC  I N4    1 
ATOM   1609  C C5    . DC  A 1 79  ? 56.699  19.885 -82.103 1.00 61.02  ? 79   DC  I C5    1 
ATOM   1610  C C6    . DC  A 1 79  ? 57.327  19.896 -80.915 1.00 59.73  ? 79   DC  I C6    1 
ATOM   1611  P P     . DT  A 1 80  ? 58.786  21.441 -74.630 1.00 72.14  ? 80   DT  I P     1 
ATOM   1612  O OP1   . DT  A 1 80  ? 60.276  21.446 -74.464 1.00 64.79  ? 80   DT  I OP1   1 
ATOM   1613  O OP2   . DT  A 1 80  ? 57.932  20.418 -73.945 1.00 62.68  ? 80   DT  I OP2   1 
ATOM   1614  O "O5'" . DT  A 1 80  ? 58.231  22.872 -74.247 1.00 68.90  ? 80   DT  I "O5'" 1 
ATOM   1615  C "C5'" . DT  A 1 80  ? 58.816  24.015 -74.828 1.00 64.94  ? 80   DT  I "C5'" 1 
ATOM   1616  C "C4'" . DT  A 1 80  ? 57.754  24.931 -75.377 1.00 62.84  ? 80   DT  I "C4'" 1 
ATOM   1617  O "O4'" . DT  A 1 80  ? 57.219  24.491 -76.646 1.00 62.75  ? 80   DT  I "O4'" 1 
ATOM   1618  C "C3'" . DT  A 1 80  ? 56.553  25.151 -74.464 1.00 62.61  ? 80   DT  I "C3'" 1 
ATOM   1619  O "O3'" . DT  A 1 80  ? 56.249  26.531 -74.496 1.00 57.76  ? 80   DT  I "O3'" 1 
ATOM   1620  C "C2'" . DT  A 1 80  ? 55.437  24.399 -75.164 1.00 64.24  ? 80   DT  I "C2'" 1 
ATOM   1621  C "C1'" . DT  A 1 80  ? 55.809  24.653 -76.597 1.00 66.86  ? 80   DT  I "C1'" 1 
ATOM   1622  N N1    . DT  A 1 80  ? 55.179  23.785 -77.620 1.00 61.53  ? 80   DT  I N1    1 
ATOM   1623  C C2    . DT  A 1 80  ? 54.666  24.429 -78.719 1.00 63.01  ? 80   DT  I C2    1 
ATOM   1624  O O2    . DT  A 1 80  ? 54.603  25.649 -78.808 1.00 57.15  ? 80   DT  I O2    1 
ATOM   1625  N N3    . DT  A 1 80  ? 54.208  23.609 -79.695 1.00 66.63  ? 80   DT  I N3    1 
ATOM   1626  C C4    . DT  A 1 80  ? 54.168  22.242 -79.665 1.00 68.36  ? 80   DT  I C4    1 
ATOM   1627  O O4    . DT  A 1 80  ? 53.777  21.627 -80.639 1.00 73.20  ? 80   DT  I O4    1 
ATOM   1628  C C5    . DT  A 1 80  ? 54.624  21.632 -78.457 1.00 67.64  ? 80   DT  I C5    1 
ATOM   1629  C C7    . DT  A 1 80  ? 54.509  20.152 -78.314 1.00 64.42  ? 80   DT  I C7    1 
ATOM   1630  C C6    . DT  A 1 80  ? 55.120  22.418 -77.507 1.00 62.09  ? 80   DT  I C6    1 
ATOM   1631  P P     . DG  A 1 81  ? 55.174  27.126 -73.495 1.00 42.37  ? 81   DG  I P     1 
ATOM   1632  O OP1   . DG  A 1 81  ? 55.882  28.025 -72.559 1.00 48.61  ? 81   DG  I OP1   1 
ATOM   1633  O OP2   . DG  A 1 81  ? 54.280  26.085 -72.992 1.00 48.87  ? 81   DG  I OP2   1 
ATOM   1634  O "O5'" . DG  A 1 81  ? 54.301  28.014 -74.452 1.00 44.21  ? 81   DG  I "O5'" 1 
ATOM   1635  C "C5'" . DG  A 1 81  ? 54.921  28.974 -75.307 1.00 41.90  ? 81   DG  I "C5'" 1 
ATOM   1636  C "C4'" . DG  A 1 81  ? 53.867  29.647 -76.153 1.00 44.64  ? 81   DG  I "C4'" 1 
ATOM   1637  O "O4'" . DG  A 1 81  ? 53.323  28.695 -77.088 1.00 41.88  ? 81   DG  I "O4'" 1 
ATOM   1638  C "C3'" . DG  A 1 81  ? 52.664  30.177 -75.380 1.00 46.44  ? 81   DG  I "C3'" 1 
ATOM   1639  O "O3'" . DG  A 1 81  ? 52.165  31.244 -76.153 1.00 46.25  ? 81   DG  I "O3'" 1 
ATOM   1640  C "C2'" . DG  A 1 81  ? 51.694  29.016 -75.408 1.00 43.14  ? 81   DG  I "C2'" 1 
ATOM   1641  C "C1'" . DG  A 1 81  ? 51.960  28.396 -76.764 1.00 45.73  ? 81   DG  I "C1'" 1 
ATOM   1642  N N9    . DG  A 1 81  ? 51.831  26.964 -76.816 1.00 50.90  ? 81   DG  I N9    1 
ATOM   1643  C C8    . DG  A 1 81  ? 52.197  26.058 -75.852 1.00 54.90  ? 81   DG  I C8    1 
ATOM   1644  N N7    . DG  A 1 81  ? 52.037  24.827 -76.216 1.00 54.17  ? 81   DG  I N7    1 
ATOM   1645  C C5    . DG  A 1 81  ? 51.504  24.927 -77.489 1.00 57.43  ? 81   DG  I C5    1 
ATOM   1646  C C6    . DG  A 1 81  ? 51.115  23.935 -78.361 1.00 57.83  ? 81   DG  I C6    1 
ATOM   1647  O O6    . DG  A 1 81  ? 51.105  22.729 -78.175 1.00 55.55  ? 81   DG  I O6    1 
ATOM   1648  N N1    . DG  A 1 81  ? 50.671  24.457 -79.564 1.00 57.43  ? 81   DG  I N1    1 
ATOM   1649  C C2    . DG  A 1 81  ? 50.583  25.784 -79.860 1.00 56.99  ? 81   DG  I C2    1 
ATOM   1650  N N2    . DG  A 1 81  ? 50.127  26.085 -81.079 1.00 53.21  ? 81   DG  I N2    1 
ATOM   1651  N N3    . DG  A 1 81  ? 50.918  26.740 -79.023 1.00 53.98  ? 81   DG  I N3    1 
ATOM   1652  C C4    . DG  A 1 81  ? 51.373  26.227 -77.861 1.00 54.64  ? 81   DG  I C4    1 
ATOM   1653  P P     . DA  A 1 82  ? 50.964  32.129 -75.615 1.00 45.16  ? 82   DA  I P     1 
ATOM   1654  O OP1   . DA  A 1 82  ? 51.519  33.484 -75.323 1.00 52.22  ? 82   DA  I OP1   1 
ATOM   1655  O OP2   . DA  A 1 82  ? 50.188  31.373 -74.583 1.00 47.69  ? 82   DA  I OP2   1 
ATOM   1656  O "O5'" . DA  A 1 82  ? 50.036  32.263 -76.888 1.00 50.31  ? 82   DA  I "O5'" 1 
ATOM   1657  C "C5'" . DA  A 1 82  ? 49.717  31.107 -77.619 1.00 52.08  ? 82   DA  I "C5'" 1 
ATOM   1658  C "C4'" . DA  A 1 82  ? 48.510  31.341 -78.480 1.00 51.10  ? 82   DA  I "C4'" 1 
ATOM   1659  O "O4'" . DA  A 1 82  ? 48.139  30.035 -78.940 1.00 50.69  ? 82   DA  I "O4'" 1 
ATOM   1660  C "C3'" . DA  A 1 82  ? 47.284  31.878 -77.763 1.00 49.76  ? 82   DA  I "C3'" 1 
ATOM   1661  O "O3'" . DA  A 1 82  ? 46.488  32.536 -78.760 1.00 47.82  ? 82   DA  I "O3'" 1 
ATOM   1662  C "C2'" . DA  A 1 82  ? 46.662  30.622 -77.196 1.00 48.32  ? 82   DA  I "C2'" 1 
ATOM   1663  C "C1'" . DA  A 1 82  ? 47.027  29.554 -78.213 1.00 49.62  ? 82   DA  I "C1'" 1 
ATOM   1664  N N9    . DA  A 1 82  ? 47.420  28.272 -77.635 1.00 55.99  ? 82   DA  I N9    1 
ATOM   1665  C C8    . DA  A 1 82  ? 47.960  28.019 -76.402 1.00 55.05  ? 82   DA  I C8    1 
ATOM   1666  N N7    . DA  A 1 82  ? 48.195  26.748 -76.176 1.00 54.81  ? 82   DA  I N7    1 
ATOM   1667  C C5    . DA  A 1 82  ? 47.784  26.128 -77.344 1.00 56.40  ? 82   DA  I C5    1 
ATOM   1668  C C6    . DA  A 1 82  ? 47.767  24.791 -77.741 1.00 55.02  ? 82   DA  I C6    1 
ATOM   1669  N N6    . DA  A 1 82  ? 48.168  23.792 -76.966 1.00 49.42  ? 82   DA  I N6    1 
ATOM   1670  N N1    . DA  A 1 82  ? 47.311  24.507 -78.975 1.00 52.70  ? 82   DA  I N1    1 
ATOM   1671  C C2    . DA  A 1 82  ? 46.899  25.503 -79.744 1.00 54.16  ? 82   DA  I C2    1 
ATOM   1672  N N3    . DA  A 1 82  ? 46.858  26.804 -79.486 1.00 56.82  ? 82   DA  I N3    1 
ATOM   1673  C C4    . DA  A 1 82  ? 47.316  27.053 -78.253 1.00 54.88  ? 82   DA  I C4    1 
ATOM   1674  P P     . DA  A 1 83  ? 44.939  32.863 -78.507 1.00 41.20  ? 83   DA  I P     1 
ATOM   1675  O OP1   . DA  A 1 83  ? 44.659  33.907 -79.506 1.00 50.20  ? 83   DA  I OP1   1 
ATOM   1676  O OP2   . DA  A 1 83  ? 44.653  33.109 -77.057 1.00 47.12  ? 83   DA  I OP2   1 
ATOM   1677  O "O5'" . DA  A 1 83  ? 44.158  31.529 -78.902 1.00 42.61  ? 83   DA  I "O5'" 1 
ATOM   1678  C "C5'" . DA  A 1 83  ? 44.119  31.039 -80.234 1.00 46.79  ? 83   DA  I "C5'" 1 
ATOM   1679  C "C4'" . DA  A 1 83  ? 43.078  29.949 -80.351 1.00 50.64  ? 83   DA  I "C4'" 1 
ATOM   1680  O "O4'" . DA  A 1 83  ? 43.574  28.760 -79.704 1.00 48.34  ? 83   DA  I "O4'" 1 
ATOM   1681  C "C3'" . DA  A 1 83  ? 41.736  30.248 -79.679 1.00 50.31  ? 83   DA  I "C3'" 1 
ATOM   1682  O "O3'" . DA  A 1 83  ? 40.637  29.739 -80.474 1.00 58.58  ? 83   DA  I "O3'" 1 
ATOM   1683  C "C2'" . DA  A 1 83  ? 41.852  29.531 -78.342 1.00 49.94  ? 83   DA  I "C2'" 1 
ATOM   1684  C "C1'" . DA  A 1 83  ? 42.636  28.306 -78.745 1.00 51.88  ? 83   DA  I "C1'" 1 
ATOM   1685  N N9    . DA  A 1 83  ? 43.366  27.628 -77.673 1.00 57.11  ? 83   DA  I N9    1 
ATOM   1686  C C8    . DA  A 1 83  ? 43.872  28.148 -76.502 1.00 57.93  ? 83   DA  I C8    1 
ATOM   1687  N N7    . DA  A 1 83  ? 44.452  27.255 -75.732 1.00 56.52  ? 83   DA  I N7    1 
ATOM   1688  C C5    . DA  A 1 83  ? 44.323  26.069 -76.442 1.00 56.55  ? 83   DA  I C5    1 
ATOM   1689  C C6    . DA  A 1 83  ? 44.701  24.745 -76.155 1.00 56.80  ? 83   DA  I C6    1 
ATOM   1690  N N6    . DA  A 1 83  ? 45.321  24.382 -75.050 1.00 54.64  ? 83   DA  I N6    1 
ATOM   1691  N N1    . DA  A 1 83  ? 44.406  23.794 -77.062 1.00 57.80  ? 83   DA  I N1    1 
ATOM   1692  C C2    . DA  A 1 83  ? 43.778  24.158 -78.186 1.00 56.77  ? 83   DA  I C2    1 
ATOM   1693  N N3    . DA  A 1 83  ? 43.372  25.368 -78.578 1.00 58.04  ? 83   DA  I N3    1 
ATOM   1694  C C4    . DA  A 1 83  ? 43.670  26.288 -77.647 1.00 56.26  ? 83   DA  I C4    1 
ATOM   1695  P P     . DC  A 1 84  ? 39.105  29.913 -79.959 1.00 62.81  ? 84   DC  I P     1 
ATOM   1696  O OP1   . DC  A 1 84  ? 38.290  30.207 -81.147 1.00 72.29  ? 84   DC  I OP1   1 
ATOM   1697  O OP2   . DC  A 1 84  ? 39.011  30.809 -78.770 1.00 67.53  ? 84   DC  I OP2   1 
ATOM   1698  O "O5'" . DC  A 1 84  ? 38.719  28.452 -79.477 1.00 63.38  ? 84   DC  I "O5'" 1 
ATOM   1699  C "C5'" . DC  A 1 84  ? 39.010  27.348 -80.314 1.00 68.60  ? 84   DC  I "C5'" 1 
ATOM   1700  C "C4'" . DC  A 1 84  ? 38.454  26.086 -79.715 1.00 69.27  ? 84   DC  I "C4'" 1 
ATOM   1701  O "O4'" . DC  A 1 84  ? 39.414  25.457 -78.833 1.00 69.69  ? 84   DC  I "O4'" 1 
ATOM   1702  C "C3'" . DC  A 1 84  ? 37.184  26.328 -78.898 1.00 69.27  ? 84   DC  I "C3'" 1 
ATOM   1703  O "O3'" . DC  A 1 84  ? 36.243  25.297 -79.222 1.00 71.81  ? 84   DC  I "O3'" 1 
ATOM   1704  C "C2'" . DC  A 1 84  ? 37.670  26.207 -77.464 1.00 68.90  ? 84   DC  I "C2'" 1 
ATOM   1705  C "C1'" . DC  A 1 84  ? 38.791  25.180 -77.586 1.00 67.81  ? 84   DC  I "C1'" 1 
ATOM   1706  N N1    . DC  A 1 84  ? 39.820  25.226 -76.515 1.00 69.99  ? 84   DC  I N1    1 
ATOM   1707  C C2    . DC  A 1 84  ? 40.435  24.034 -76.112 1.00 70.91  ? 84   DC  I C2    1 
ATOM   1708  O O2    . DC  A 1 84  ? 40.136  22.991 -76.674 1.00 67.01  ? 84   DC  I O2    1 
ATOM   1709  N N3    . DC  A 1 84  ? 41.339  24.057 -75.116 1.00 70.41  ? 84   DC  I N3    1 
ATOM   1710  C C4    . DC  A 1 84  ? 41.646  25.208 -74.527 1.00 68.40  ? 84   DC  I C4    1 
ATOM   1711  N N4    . DC  A 1 84  ? 42.532  25.179 -73.549 1.00 65.38  ? 84   DC  I N4    1 
ATOM   1712  C C5    . DC  A 1 84  ? 41.054  26.439 -74.921 1.00 67.17  ? 84   DC  I C5    1 
ATOM   1713  C C6    . DC  A 1 84  ? 40.157  26.404 -75.913 1.00 67.76  ? 84   DC  I C6    1 
ATOM   1714  P P     . DA  A 1 85  ? 34.730  25.366 -78.679 1.00 68.62  ? 85   DA  I P     1 
ATOM   1715  O OP1   . DA  A 1 85  ? 33.862  25.621 -79.856 1.00 68.18  ? 85   DA  I OP1   1 
ATOM   1716  O OP2   . DA  A 1 85  ? 34.622  26.231 -77.470 1.00 63.36  ? 85   DA  I OP2   1 
ATOM   1717  O "O5'" . DA  A 1 85  ? 34.514  23.869 -78.205 1.00 67.70  ? 85   DA  I "O5'" 1 
ATOM   1718  C "C5'" . DA  A 1 85  ? 35.237  22.811 -78.822 1.00 63.08  ? 85   DA  I "C5'" 1 
ATOM   1719  C "C4'" . DA  A 1 85  ? 35.116  21.575 -77.974 1.00 65.38  ? 85   DA  I "C4'" 1 
ATOM   1720  O "O4'" . DA  A 1 85  ? 36.124  21.583 -76.939 1.00 65.01  ? 85   DA  I "O4'" 1 
ATOM   1721  C "C3'" . DA  A 1 85  ? 33.767  21.497 -77.264 1.00 66.38  ? 85   DA  I "C3'" 1 
ATOM   1722  O "O3'" . DA  A 1 85  ? 33.265  20.150 -77.330 1.00 69.33  ? 85   DA  I "O3'" 1 
ATOM   1723  C "C2'" . DA  A 1 85  ? 34.062  22.011 -75.861 1.00 63.83  ? 85   DA  I "C2'" 1 
ATOM   1724  C "C1'" . DA  A 1 85  ? 35.528  21.652 -75.640 1.00 65.06  ? 85   DA  I "C1'" 1 
ATOM   1725  N N9    . DA  A 1 85  ? 36.319  22.605 -74.830 1.00 60.28  ? 85   DA  I N9    1 
ATOM   1726  C C8    . DA  A 1 85  ? 36.274  23.986 -74.851 1.00 59.38  ? 85   DA  I C8    1 
ATOM   1727  N N7    . DA  A 1 85  ? 37.121  24.559 -74.033 1.00 57.95  ? 85   DA  I N7    1 
ATOM   1728  C C5    . DA  A 1 85  ? 37.766  23.493 -73.422 1.00 58.12  ? 85   DA  I C5    1 
ATOM   1729  C C6    . DA  A 1 85  ? 38.776  23.432 -72.443 1.00 58.34  ? 85   DA  I C6    1 
ATOM   1730  N N6    . DA  A 1 85  ? 39.336  24.500 -71.884 1.00 50.65  ? 85   DA  I N6    1 
ATOM   1731  N N1    . DA  A 1 85  ? 39.194  22.213 -72.051 1.00 58.40  ? 85   DA  I N1    1 
ATOM   1732  C C2    . DA  A 1 85  ? 38.632  21.136 -72.600 1.00 58.61  ? 85   DA  I C2    1 
ATOM   1733  N N3    . DA  A 1 85  ? 37.680  21.061 -73.522 1.00 57.32  ? 85   DA  I N3    1 
ATOM   1734  C C4    . DA  A 1 85  ? 37.283  22.286 -73.898 1.00 59.80  ? 85   DA  I C4    1 
ATOM   1735  P P     . DT  A 1 86  ? 31.942  19.731 -76.506 1.00 68.23  ? 86   DT  I P     1 
ATOM   1736  O OP1   . DT  A 1 86  ? 31.326  18.561 -77.199 1.00 71.26  ? 86   DT  I OP1   1 
ATOM   1737  O OP2   . DT  A 1 86  ? 31.117  20.927 -76.173 1.00 67.66  ? 86   DT  I OP2   1 
ATOM   1738  O "O5'" . DT  A 1 86  ? 32.566  19.212 -75.143 1.00 68.23  ? 86   DT  I "O5'" 1 
ATOM   1739  C "C5'" . DT  A 1 86  ? 33.645  18.272 -75.137 1.00 64.29  ? 86   DT  I "C5'" 1 
ATOM   1740  C "C4'" . DT  A 1 86  ? 34.019  17.952 -73.712 1.00 64.02  ? 86   DT  I "C4'" 1 
ATOM   1741  O "O4'" . DT  A 1 86  ? 34.839  18.991 -73.124 1.00 64.23  ? 86   DT  I "O4'" 1 
ATOM   1742  C "C3'" . DT  A 1 86  ? 32.822  17.790 -72.778 1.00 63.12  ? 86   DT  I "C3'" 1 
ATOM   1743  O "O3'" . DT  A 1 86  ? 33.086  16.638 -72.006 1.00 63.37  ? 86   DT  I "O3'" 1 
ATOM   1744  C "C2'" . DT  A 1 86  ? 32.860  19.051 -71.917 1.00 62.47  ? 86   DT  I "C2'" 1 
ATOM   1745  C "C1'" . DT  A 1 86  ? 34.346  19.308 -71.826 1.00 63.72  ? 86   DT  I "C1'" 1 
ATOM   1746  N N1    . DT  A 1 86  ? 34.816  20.684 -71.456 1.00 63.53  ? 86   DT  I N1    1 
ATOM   1747  C C2    . DT  A 1 86  ? 35.820  20.825 -70.492 1.00 62.37  ? 86   DT  I C2    1 
ATOM   1748  O O2    . DT  A 1 86  ? 36.347  19.891 -69.913 1.00 60.90  ? 86   DT  I O2    1 
ATOM   1749  N N3    . DT  A 1 86  ? 36.186  22.109 -70.237 1.00 62.86  ? 86   DT  I N3    1 
ATOM   1750  C C4    . DT  A 1 86  ? 35.682  23.247 -70.811 1.00 63.22  ? 86   DT  I C4    1 
ATOM   1751  O O4    . DT  A 1 86  ? 36.104  24.326 -70.472 1.00 61.70  ? 86   DT  I O4    1 
ATOM   1752  C C5    . DT  A 1 86  ? 34.659  23.053 -71.792 1.00 62.68  ? 86   DT  I C5    1 
ATOM   1753  C C7    . DT  A 1 86  ? 34.069  24.255 -72.452 1.00 57.82  ? 86   DT  I C7    1 
ATOM   1754  C C6    . DT  A 1 86  ? 34.274  21.796 -72.067 1.00 62.79  ? 86   DT  I C6    1 
ATOM   1755  P P     . DG  A 1 87  ? 31.891  15.775 -71.387 1.00 54.30  ? 87   DG  I P     1 
ATOM   1756  O OP1   . DG  A 1 87  ? 32.088  14.380 -71.868 1.00 56.77  ? 87   DG  I OP1   1 
ATOM   1757  O OP2   . DG  A 1 87  ? 30.600  16.484 -71.616 1.00 55.78  ? 87   DG  I OP2   1 
ATOM   1758  O "O5'" . DG  A 1 87  ? 32.216  15.786 -69.820 1.00 52.85  ? 87   DG  I "O5'" 1 
ATOM   1759  C "C5'" . DG  A 1 87  ? 33.548  15.505 -69.333 1.00 53.15  ? 87   DG  I "C5'" 1 
ATOM   1760  C "C4'" . DG  A 1 87  ? 33.741  16.063 -67.938 1.00 55.00  ? 87   DG  I "C4'" 1 
ATOM   1761  O "O4'" . DG  A 1 87  ? 34.128  17.458 -67.944 1.00 54.83  ? 87   DG  I "O4'" 1 
ATOM   1762  C "C3'" . DG  A 1 87  ? 32.489  15.979 -67.061 1.00 56.08  ? 87   DG  I "C3'" 1 
ATOM   1763  O "O3'" . DG  A 1 87  ? 32.858  15.746 -65.706 1.00 60.97  ? 87   DG  I "O3'" 1 
ATOM   1764  C "C2'" . DG  A 1 87  ? 31.928  17.377 -67.166 1.00 55.92  ? 87   DG  I "C2'" 1 
ATOM   1765  C "C1'" . DG  A 1 87  ? 33.217  18.151 -67.102 1.00 55.46  ? 87   DG  I "C1'" 1 
ATOM   1766  N N9    . DG  A 1 87  ? 33.129  19.533 -67.537 1.00 59.66  ? 87   DG  I N9    1 
ATOM   1767  C C8    . DG  A 1 87  ? 32.185  20.112 -68.354 1.00 59.92  ? 87   DG  I C8    1 
ATOM   1768  N N7    . DG  A 1 87  ? 32.389  21.388 -68.541 1.00 61.01  ? 87   DG  I N7    1 
ATOM   1769  C C5    . DG  A 1 87  ? 33.536  21.660 -67.797 1.00 60.72  ? 87   DG  I C5    1 
ATOM   1770  C C6    . DG  A 1 87  ? 34.242  22.876 -67.585 1.00 61.71  ? 87   DG  I C6    1 
ATOM   1771  O O6    . DG  A 1 87  ? 33.986  24.004 -68.014 1.00 59.06  ? 87   DG  I O6    1 
ATOM   1772  N N1    . DG  A 1 87  ? 35.345  22.689 -66.764 1.00 62.58  ? 87   DG  I N1    1 
ATOM   1773  C C2    . DG  A 1 87  ? 35.724  21.506 -66.202 1.00 62.96  ? 87   DG  I C2    1 
ATOM   1774  N N2    . DG  A 1 87  ? 36.824  21.547 -65.435 1.00 57.44  ? 87   DG  I N2    1 
ATOM   1775  N N3    . DG  A 1 87  ? 35.073  20.368 -66.376 1.00 61.62  ? 87   DG  I N3    1 
ATOM   1776  C C4    . DG  A 1 87  ? 33.999  20.520 -67.179 1.00 60.99  ? 87   DG  I C4    1 
ATOM   1777  P P     . DC  A 1 88  ? 33.256  14.275 -65.246 1.00 67.36  ? 88   DC  I P     1 
ATOM   1778  O OP1   . DC  A 1 88  ? 34.012  13.644 -66.363 1.00 58.16  ? 88   DC  I OP1   1 
ATOM   1779  O OP2   . DC  A 1 88  ? 32.075  13.604 -64.689 1.00 60.43  ? 88   DC  I OP2   1 
ATOM   1780  O "O5'" . DC  A 1 88  ? 34.252  14.530 -64.035 1.00 72.71  ? 88   DC  I "O5'" 1 
ATOM   1781  C "C5'" . DC  A 1 88  ? 35.664  14.601 -64.255 1.00 68.17  ? 88   DC  I "C5'" 1 
ATOM   1782  C "C4'" . DC  A 1 88  ? 36.285  15.565 -63.278 1.00 69.03  ? 88   DC  I "C4'" 1 
ATOM   1783  O "O4'" . DC  A 1 88  ? 35.819  16.900 -63.572 1.00 68.82  ? 88   DC  I "O4'" 1 
ATOM   1784  C "C3'" . DC  A 1 88  ? 35.878  15.306 -61.827 1.00 68.02  ? 88   DC  I "C3'" 1 
ATOM   1785  O "O3'" . DC  A 1 88  ? 36.930  15.761 -60.987 1.00 67.01  ? 88   DC  I "O3'" 1 
ATOM   1786  C "C2'" . DC  A 1 88  ? 34.706  16.249 -61.637 1.00 69.12  ? 88   DC  I "C2'" 1 
ATOM   1787  C "C1'" . DC  A 1 88  ? 35.260  17.437 -62.378 1.00 70.48  ? 88   DC  I "C1'" 1 
ATOM   1788  N N1    . DC  A 1 88  ? 34.331  18.510 -62.742 1.00 60.15  ? 88   DC  I N1    1 
ATOM   1789  C C2    . DC  A 1 88  ? 34.850  19.796 -62.896 1.00 63.64  ? 88   DC  I C2    1 
ATOM   1790  O O2    . DC  A 1 88  ? 36.048  20.003 -62.620 1.00 65.77  ? 88   DC  I O2    1 
ATOM   1791  N N3    . DC  A 1 88  ? 34.040  20.776 -63.344 1.00 64.45  ? 88   DC  I N3    1 
ATOM   1792  C C4    . DC  A 1 88  ? 32.768  20.508 -63.631 1.00 66.42  ? 88   DC  I C4    1 
ATOM   1793  N N4    . DC  A 1 88  ? 32.042  21.478 -64.172 1.00 67.91  ? 88   DC  I N4    1 
ATOM   1794  C C5    . DC  A 1 88  ? 32.197  19.229 -63.405 1.00 64.05  ? 88   DC  I C5    1 
ATOM   1795  C C6    . DC  A 1 88  ? 33.005  18.266 -62.964 1.00 63.39  ? 88   DC  I C6    1 
ATOM   1796  P P     . DC  A 1 89  ? 37.956  14.715 -60.345 1.00 74.05  ? 89   DC  I P     1 
ATOM   1797  O OP1   . DC  A 1 89  ? 38.903  14.278 -61.401 1.00 65.65  ? 89   DC  I OP1   1 
ATOM   1798  O OP2   . DC  A 1 89  ? 37.159  13.708 -59.584 1.00 64.44  ? 89   DC  I OP2   1 
ATOM   1799  O "O5'" . DC  A 1 89  ? 38.757  15.628 -59.319 1.00 69.83  ? 89   DC  I "O5'" 1 
ATOM   1800  C "C5'" . DC  A 1 89  ? 39.367  16.837 -59.754 1.00 66.90  ? 89   DC  I "C5'" 1 
ATOM   1801  C "C4'" . DC  A 1 89  ? 38.914  18.000 -58.904 1.00 64.05  ? 89   DC  I "C4'" 1 
ATOM   1802  O "O4'" . DC  A 1 89  ? 37.642  18.509 -59.348 1.00 62.94  ? 89   DC  I "O4'" 1 
ATOM   1803  C "C3'" . DC  A 1 89  ? 38.762  17.733 -57.404 1.00 65.12  ? 89   DC  I "C3'" 1 
ATOM   1804  O "O3'" . DC  A 1 89  ? 39.179  18.876 -56.675 1.00 67.01  ? 89   DC  I "O3'" 1 
ATOM   1805  C "C2'" . DC  A 1 89  ? 37.264  17.662 -57.224 1.00 66.07  ? 89   DC  I "C2'" 1 
ATOM   1806  C "C1'" . DC  A 1 89  ? 36.848  18.736 -58.197 1.00 64.19  ? 89   DC  I "C1'" 1 
ATOM   1807  N N1    . DC  A 1 89  ? 35.418  18.761 -58.587 1.00 60.13  ? 89   DC  I N1    1 
ATOM   1808  C C2    . DC  A 1 89  ? 34.825  20.010 -58.812 1.00 62.64  ? 89   DC  I C2    1 
ATOM   1809  O O2    . DC  A 1 89  ? 35.522  21.040 -58.676 1.00 57.85  ? 89   DC  I O2    1 
ATOM   1810  N N3    . DC  A 1 89  ? 33.518  20.066 -59.161 1.00 64.19  ? 89   DC  I N3    1 
ATOM   1811  C C4    . DC  A 1 89  ? 32.809  18.943 -59.273 1.00 63.85  ? 89   DC  I C4    1 
ATOM   1812  N N4    . DC  A 1 89  ? 31.522  19.054 -59.615 1.00 64.33  ? 89   DC  I N4    1 
ATOM   1813  C C5    . DC  A 1 89  ? 33.387  17.662 -59.043 1.00 60.97  ? 89   DC  I C5    1 
ATOM   1814  C C6    . DC  A 1 89  ? 34.680  17.615 -58.713 1.00 62.35  ? 89   DC  I C6    1 
ATOM   1815  P P     . DT  A 1 90  ? 40.503  18.814 -55.782 1.00 51.54  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 90  ? 41.599  18.335 -56.637 1.00 51.47  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 90  ? 40.169  18.084 -54.530 1.00 52.63  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 90  ? 40.762  20.347 -55.478 1.00 47.35  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 90  ? 40.967  21.257 -56.551 1.00 42.98  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 90  ? 40.048  22.456 -56.442 1.00 43.30  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 90  ? 38.653  22.098 -56.691 1.00 44.39  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 90  ? 40.074  23.170 -55.094 1.00 45.92  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 90  ? 40.321  24.575 -55.251 1.00 34.82  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 90  ? 38.703  22.873 -54.487 1.00 43.79  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 90  ? 37.821  22.713 -55.708 1.00 45.72  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 90  ? 36.598  21.876 -55.537 1.00 57.02  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 90  ? 35.373  22.420 -55.863 1.00 61.49  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 90  ? 35.225  23.583 -56.192 1.00 58.39  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 90  ? 34.321  21.555 -55.770 1.00 63.55  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 90  ? 34.351  20.247 -55.364 1.00 63.26  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 90  ? 33.328  19.584 -55.367 1.00 63.85  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 90  ? 35.639  19.758 -54.972 1.00 62.53  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 90  ? 35.752  18.368 -54.449 1.00 58.86  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 90  ? 36.691  20.579 -55.086 1.00 58.70  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 91  ? 40.588  25.474 -53.935 1.00 45.98  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 91  ? 41.699  26.434 -54.179 1.00 40.69  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 91  ? 40.609  24.597 -52.737 1.00 35.54  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 91  ? 39.237  26.287 -53.788 1.00 48.47  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 91  ? 38.748  27.030 -54.877 1.00 51.37  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 91  ? 37.366  27.522 -54.569 1.00 53.86  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 91  ? 36.472  26.389 -54.505 1.00 53.17  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 91  ? 37.244  28.240 -53.235 1.00 58.79  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 91  ? 36.509  29.422 -53.463 1.00 63.49  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 91  ? 36.468  27.271 -52.349 1.00 57.89  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 91  ? 35.652  26.469 -53.346 1.00 55.97  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 91  ? 35.289  25.075 -52.968 1.00 51.14  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 91  ? 34.031  24.618 -53.312 1.00 51.80  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 91  ? 33.200  25.316 -53.876 1.00 53.06  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 91  ? 33.784  23.305 -52.981 1.00 50.24  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 91  ? 34.646  22.428 -52.365 1.00 50.15  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 91  ? 34.297  21.273 -52.144 1.00 47.67  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 91  ? 35.932  22.969 -52.028 1.00 48.39  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 91  ? 36.932  22.074 -51.370 1.00 40.30  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 91  ? 36.186  24.251 -52.328 1.00 48.07  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 92  ? 36.305  30.463 -52.275 1.00 60.99  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 92  ? 36.362  31.815 -52.897 1.00 62.77  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 92  ? 37.216  30.116 -51.164 1.00 60.65  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 92  ? 34.837  30.163 -51.757 1.00 63.72  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 92  ? 33.744  30.203 -52.657 1.00 65.75  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 92  ? 32.478  29.811 -51.944 1.00 66.80  ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 92  ? 32.355  28.376 -51.861 1.00 65.40  ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 92  ? 32.386  30.344 -50.516 1.00 68.19  ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 92  ? 31.122  30.968 -50.349 1.00 71.81  ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 92  ? 32.490  29.101 -49.648 1.00 66.06  ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 92  ? 31.954  28.010 -50.553 1.00 65.15  ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 92  ? 32.492  26.665 -50.279 1.00 65.26  ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 92  ? 31.677  25.574 -50.453 1.00 65.56  ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 92  ? 30.522  25.655 -50.829 1.00 66.62  ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 92  ? 32.273  24.368 -50.175 1.00 64.64  ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 92  ? 33.570  24.155 -49.753 1.00 64.49  ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 92  ? 33.976  23.022 -49.555 1.00 65.76  ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 92  ? 34.353  25.330 -49.580 1.00 63.71  ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 92  ? 35.749  25.191 -49.083 1.00 61.57  ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 92  ? 33.792  26.512 -49.855 1.00 64.75  ? 92   DT  I C6    1 
ATOM   1875  P P     . DT  A 1 93  ? 30.841  31.878 -49.067 1.00 99.43  ? 93   DT  I P     1 
ATOM   1876  O OP1   . DT  A 1 93  ? 30.426  33.208 -49.569 1.00 72.12  ? 93   DT  I OP1   1 
ATOM   1877  O OP2   . DT  A 1 93  ? 31.966  31.759 -48.098 1.00 73.05  ? 93   DT  I OP2   1 
ATOM   1878  O "O5'" . DT  A 1 93  ? 29.575  31.164 -48.446 1.00 102.44 ? 93   DT  I "O5'" 1 
ATOM   1879  C "C5'" . DT  A 1 93  ? 28.582  30.597 -49.288 1.00 107.96 ? 93   DT  I "C5'" 1 
ATOM   1880  C "C4'" . DT  A 1 93  ? 27.659  29.761 -48.445 1.00 111.15 ? 93   DT  I "C4'" 1 
ATOM   1881  O "O4'" . DT  A 1 93  ? 28.174  28.412 -48.336 1.00 109.99 ? 93   DT  I "O4'" 1 
ATOM   1882  C "C3'" . DT  A 1 93  ? 27.639  30.326 -47.025 1.00 114.38 ? 93   DT  I "C3'" 1 
ATOM   1883  O "O3'" . DT  A 1 93  ? 26.339  30.274 -46.448 1.00 120.76 ? 93   DT  I "O3'" 1 
ATOM   1884  C "C2'" . DT  A 1 93  ? 28.600  29.428 -46.276 1.00 112.33 ? 93   DT  I "C2'" 1 
ATOM   1885  C "C1'" . DT  A 1 93  ? 28.381  28.101 -46.968 1.00 110.01 ? 93   DT  I "C1'" 1 
ATOM   1886  N N1    . DT  A 1 93  ? 29.523  27.184 -46.868 1.00 81.67  ? 93   DT  I N1    1 
ATOM   1887  C C2    . DT  A 1 93  ? 29.282  25.841 -47.006 1.00 81.49  ? 93   DT  I C2    1 
ATOM   1888  O O2    . DT  A 1 93  ? 28.189  25.396 -47.274 1.00 83.31  ? 93   DT  I O2    1 
ATOM   1889  N N3    . DT  A 1 93  ? 30.384  25.036 -46.830 1.00 79.82  ? 93   DT  I N3    1 
ATOM   1890  C C4    . DT  A 1 93  ? 31.676  25.445 -46.551 1.00 78.44  ? 93   DT  I C4    1 
ATOM   1891  O O4    . DT  A 1 93  ? 32.555  24.613 -46.379 1.00 75.85  ? 93   DT  I O4    1 
ATOM   1892  C C5    . DT  A 1 93  ? 31.866  26.873 -46.469 1.00 79.41  ? 93   DT  I C5    1 
ATOM   1893  C C7    . DT  A 1 93  ? 33.233  27.408 -46.219 1.00 79.11  ? 93   DT  I C7    1 
ATOM   1894  C C6    . DT  A 1 93  ? 30.796  27.661 -46.625 1.00 80.89  ? 93   DT  I C6    1 
ATOM   1895  P P     . DG  A 1 94  ? 26.110  30.864 -44.977 1.00 134.39 ? 94   DG  I P     1 
ATOM   1896  O OP1   . DG  A 1 94  ? 24.927  31.758 -45.036 1.00 107.64 ? 94   DG  I OP1   1 
ATOM   1897  O OP2   . DG  A 1 94  ? 27.405  31.385 -44.466 1.00 107.27 ? 94   DG  I OP2   1 
ATOM   1898  O "O5'" . DG  A 1 94  ? 25.759  29.566 -44.132 1.00 133.72 ? 94   DG  I "O5'" 1 
ATOM   1899  C "C5'" . DG  A 1 94  ? 26.467  28.352 -44.360 1.00 135.01 ? 94   DG  I "C5'" 1 
ATOM   1900  C "C4'" . DG  A 1 94  ? 25.874  27.239 -43.534 1.00 135.81 ? 94   DG  I "C4'" 1 
ATOM   1901  O "O4'" . DG  A 1 94  ? 26.645  26.034 -43.769 1.00 135.23 ? 94   DG  I "O4'" 1 
ATOM   1902  C "C3'" . DG  A 1 94  ? 25.946  27.509 -42.032 1.00 136.56 ? 94   DG  I "C3'" 1 
ATOM   1903  O "O3'" . DG  A 1 94  ? 24.768  27.007 -41.390 1.00 138.80 ? 94   DG  I "O3'" 1 
ATOM   1904  C "C2'" . DG  A 1 94  ? 27.201  26.772 -41.602 1.00 135.58 ? 94   DG  I "C2'" 1 
ATOM   1905  C "C1'" . DG  A 1 94  ? 27.245  25.591 -42.560 1.00 134.73 ? 94   DG  I "C1'" 1 
ATOM   1906  N N9    . DG  A 1 94  ? 28.597  25.121 -42.862 1.00 106.51 ? 94   DG  I N9    1 
ATOM   1907  C C8    . DG  A 1 94  ? 29.705  25.888 -43.146 1.00 105.50 ? 94   DG  I C8    1 
ATOM   1908  N N7    . DG  A 1 94  ? 30.784  25.178 -43.345 1.00 104.21 ? 94   DG  I N7    1 
ATOM   1909  C C5    . DG  A 1 94  ? 30.360  23.863 -43.196 1.00 104.55 ? 94   DG  I C5    1 
ATOM   1910  C C6    . DG  A 1 94  ? 31.077  22.652 -43.309 1.00 103.97 ? 94   DG  I C6    1 
ATOM   1911  O O6    . DG  A 1 94  ? 32.262  22.485 -43.591 1.00 103.87 ? 94   DG  I O6    1 
ATOM   1912  N N1    . DG  A 1 94  ? 30.267  21.553 -43.062 1.00 104.05 ? 94   DG  I N1    1 
ATOM   1913  C C2    . DG  A 1 94  ? 28.935  21.608 -42.759 1.00 104.86 ? 94   DG  I C2    1 
ATOM   1914  N N2    . DG  A 1 94  ? 28.335  20.433 -42.532 1.00 104.98 ? 94   DG  I N2    1 
ATOM   1915  N N3    . DG  A 1 94  ? 28.244  22.728 -42.676 1.00 104.82 ? 94   DG  I N3    1 
ATOM   1916  C C4    . DG  A 1 94  ? 29.014  23.811 -42.899 1.00 105.18 ? 94   DG  I C4    1 
ATOM   1917  P P     . DA  A 1 95  ? 24.565  27.202 -39.804 1.00 119.91 ? 95   DA  I P     1 
ATOM   1918  O OP1   . DA  A 1 95  ? 23.133  27.543 -39.596 1.00 95.24  ? 95   DA  I OP1   1 
ATOM   1919  O OP2   . DA  A 1 95  ? 25.629  28.092 -39.253 1.00 94.96  ? 95   DA  I OP2   1 
ATOM   1920  O "O5'" . DA  A 1 95  ? 24.802  25.733 -39.251 1.00 118.09 ? 95   DA  I "O5'" 1 
ATOM   1921  C "C5'" . DA  A 1 95  ? 24.149  24.630 -39.870 1.00 117.48 ? 95   DA  I "C5'" 1 
ATOM   1922  C "C4'" . DA  A 1 95  ? 24.659  23.339 -39.285 1.00 117.66 ? 95   DA  I "C4'" 1 
ATOM   1923  O "O4'" . DA  A 1 95  ? 25.952  23.009 -39.847 1.00 117.52 ? 95   DA  I "O4'" 1 
ATOM   1924  C "C3'" . DA  A 1 95  ? 24.856  23.417 -37.772 1.00 117.80 ? 95   DA  I "C3'" 1 
ATOM   1925  O "O3'" . DA  A 1 95  ? 24.466  22.184 -37.173 1.00 118.02 ? 95   DA  I "O3'" 1 
ATOM   1926  C "C2'" . DA  A 1 95  ? 26.351  23.629 -37.631 1.00 116.93 ? 95   DA  I "C2'" 1 
ATOM   1927  C "C1'" . DA  A 1 95  ? 26.881  22.812 -38.794 1.00 116.30 ? 95   DA  I "C1'" 1 
ATOM   1928  N N9    . DA  A 1 95  ? 28.213  23.203 -39.264 1.00 91.07  ? 95   DA  I N9    1 
ATOM   1929  C C8    . DA  A 1 95  ? 28.681  24.456 -39.587 1.00 90.48  ? 95   DA  I C8    1 
ATOM   1930  N N7    . DA  A 1 95  ? 29.945  24.475 -39.936 1.00 88.86  ? 95   DA  I N7    1 
ATOM   1931  C C5    . DA  A 1 95  ? 30.335  23.147 -39.842 1.00 89.67  ? 95   DA  I C5    1 
ATOM   1932  C C6    . DA  A 1 95  ? 31.557  22.506 -40.071 1.00 89.92  ? 95   DA  I C6    1 
ATOM   1933  N N6    . DA  A 1 95  ? 32.664  23.142 -40.460 1.00 88.78  ? 95   DA  I N6    1 
ATOM   1934  N N1    . DA  A 1 95  ? 31.609  21.169 -39.888 1.00 90.23  ? 95   DA  I N1    1 
ATOM   1935  C C2    . DA  A 1 95  ? 30.499  20.531 -39.504 1.00 90.35  ? 95   DA  I C2    1 
ATOM   1936  N N3    . DA  A 1 95  ? 29.292  21.021 -39.257 1.00 90.29  ? 95   DA  I N3    1 
ATOM   1937  C C4    . DA  A 1 95  ? 29.276  22.351 -39.444 1.00 90.13  ? 95   DA  I C4    1 
ATOM   1938  P P     . DT  A 1 96  ? 24.542  22.011 -35.582 1.00 125.29 ? 96   DT  I P     1 
ATOM   1939  O OP1   . DT  A 1 96  ? 23.198  21.556 -35.124 1.00 89.47  ? 96   DT  I OP1   1 
ATOM   1940  O OP2   . DT  A 1 96  ? 25.156  23.221 -34.978 1.00 88.23  ? 96   DT  I OP2   1 
ATOM   1941  O "O5'" . DT  A 1 96  ? 25.597  20.838 -35.404 1.00 123.68 ? 96   DT  I "O5'" 1 
ATOM   1942  C "C5'" . DT  A 1 96  ? 25.395  19.560 -36.005 1.00 121.70 ? 96   DT  I "C5'" 1 
ATOM   1943  C "C4'" . DT  A 1 96  ? 26.396  18.590 -35.433 1.00 121.15 ? 96   DT  I "C4'" 1 
ATOM   1944  O "O4'" . DT  A 1 96  ? 27.699  18.893 -35.989 1.00 119.49 ? 96   DT  I "O4'" 1 
ATOM   1945  C "C3'" . DT  A 1 96  ? 26.532  18.786 -33.922 1.00 121.36 ? 96   DT  I "C3'" 1 
ATOM   1946  O "O3'" . DT  A 1 96  ? 26.820  17.560 -33.251 1.00 121.98 ? 96   DT  I "O3'" 1 
ATOM   1947  C "C2'" . DT  A 1 96  ? 27.707  19.736 -33.801 1.00 119.90 ? 96   DT  I "C2'" 1 
ATOM   1948  C "C1'" . DT  A 1 96  ? 28.588  19.263 -34.940 1.00 118.29 ? 96   DT  I "C1'" 1 
ATOM   1949  N N1    . DT  A 1 96  ? 29.541  20.272 -35.458 1.00 80.16  ? 96   DT  I N1    1 
ATOM   1950  C C2    . DT  A 1 96  ? 30.657  19.809 -36.114 1.00 78.65  ? 96   DT  I C2    1 
ATOM   1951  O O2    . DT  A 1 96  ? 30.867  18.624 -36.304 1.00 78.74  ? 96   DT  I O2    1 
ATOM   1952  N N3    . DT  A 1 96  ? 31.517  20.786 -36.544 1.00 76.69  ? 96   DT  I N3    1 
ATOM   1953  C C4    . DT  A 1 96  ? 31.370  22.150 -36.401 1.00 76.75  ? 96   DT  I C4    1 
ATOM   1954  O O4    . DT  A 1 96  ? 32.230  22.903 -36.848 1.00 74.21  ? 96   DT  I O4    1 
ATOM   1955  C C5    . DT  A 1 96  ? 30.165  22.576 -35.710 1.00 76.65  ? 96   DT  I C5    1 
ATOM   1956  C C7    . DT  A 1 96  ? 29.914  24.038 -35.513 1.00 75.95  ? 96   DT  I C7    1 
ATOM   1957  C C6    . DT  A 1 96  ? 29.324  21.627 -35.278 1.00 78.12  ? 96   DT  I C6    1 
ATOM   1958  P P     . DG  A 1 97  ? 26.793  17.511 -31.639 1.00 109.33 ? 97   DG  I P     1 
ATOM   1959  O OP1   . DG  A 1 97  ? 25.466  17.007 -31.170 1.00 83.36  ? 97   DG  I OP1   1 
ATOM   1960  O OP2   . DG  A 1 97  ? 27.310  18.799 -31.115 1.00 81.68  ? 97   DG  I OP2   1 
ATOM   1961  O "O5'" . DG  A 1 97  ? 27.887  16.412 -31.297 1.00 107.37 ? 97   DG  I "O5'" 1 
ATOM   1962  C "C5'" . DG  A 1 97  ? 28.192  15.371 -32.223 1.00 104.92 ? 97   DG  I "C5'" 1 
ATOM   1963  C "C4'" . DG  A 1 97  ? 29.667  15.066 -32.165 1.00 102.87 ? 97   DG  I "C4'" 1 
ATOM   1964  O "O4'" . DG  A 1 97  ? 30.419  16.162 -32.736 1.00 102.35 ? 97   DG  I "O4'" 1 
ATOM   1965  C "C3'" . DG  A 1 97  ? 30.176  14.920 -30.739 1.00 100.68 ? 97   DG  I "C3'" 1 
ATOM   1966  O "O3'" . DG  A 1 97  ? 31.241  13.983 -30.763 1.00 98.65  ? 97   DG  I "O3'" 1 
ATOM   1967  C "C2'" . DG  A 1 97  ? 30.679  16.316 -30.418 1.00 101.45 ? 97   DG  I "C2'" 1 
ATOM   1968  C "C1'" . DG  A 1 97  ? 31.272  16.709 -31.754 1.00 101.56 ? 97   DG  I "C1'" 1 
ATOM   1969  N N9    . DG  A 1 97  ? 31.439  18.132 -32.037 1.00 74.12  ? 97   DG  I N9    1 
ATOM   1970  C C8    . DG  A 1 97  ? 30.613  19.185 -31.712 1.00 73.98  ? 97   DG  I C8    1 
ATOM   1971  N N7    . DG  A 1 97  ? 31.082  20.346 -32.103 1.00 73.00  ? 97   DG  I N7    1 
ATOM   1972  C C5    . DG  A 1 97  ? 32.288  20.032 -32.726 1.00 73.10  ? 97   DG  I C5    1 
ATOM   1973  C C6    . DG  A 1 97  ? 33.268  20.865 -33.357 1.00 71.92  ? 97   DG  I C6    1 
ATOM   1974  O O6    . DG  A 1 97  ? 33.276  22.092 -33.502 1.00 70.52  ? 97   DG  I O6    1 
ATOM   1975  N N1    . DG  A 1 97  ? 34.321  20.119 -33.851 1.00 71.17  ? 97   DG  I N1    1 
ATOM   1976  C C2    . DG  A 1 97  ? 34.434  18.760 -33.768 1.00 72.88  ? 97   DG  I C2    1 
ATOM   1977  N N2    . DG  A 1 97  ? 35.532  18.222 -34.301 1.00 71.53  ? 97   DG  I N2    1 
ATOM   1978  N N3    . DG  A 1 97  ? 33.546  17.978 -33.202 1.00 73.39  ? 97   DG  I N3    1 
ATOM   1979  C C4    . DG  A 1 97  ? 32.510  18.672 -32.700 1.00 73.69  ? 97   DG  I C4    1 
ATOM   1980  P P     . DG  A 1 98  ? 31.464  12.997 -29.521 1.00 87.47  ? 98   DG  I P     1 
ATOM   1981  O OP1   . DG  A 1 98  ? 31.039  11.624 -29.917 1.00 92.70  ? 98   DG  I OP1   1 
ATOM   1982  O OP2   . DG  A 1 98  ? 30.852  13.659 -28.329 1.00 92.66  ? 98   DG  I OP2   1 
ATOM   1983  O "O5'" . DG  A 1 98  ? 33.048  12.987 -29.334 1.00 86.55  ? 98   DG  I "O5'" 1 
ATOM   1984  C "C5'" . DG  A 1 98  ? 33.928  13.156 -30.453 1.00 83.52  ? 98   DG  I "C5'" 1 
ATOM   1985  C "C4'" . DG  A 1 98  ? 34.999  14.181 -30.142 1.00 81.98  ? 98   DG  I "C4'" 1 
ATOM   1986  O "O4'" . DG  A 1 98  ? 34.632  15.556 -30.444 1.00 81.48  ? 98   DG  I "O4'" 1 
ATOM   1987  C "C3'" . DG  A 1 98  ? 35.502  14.196 -28.699 1.00 81.28  ? 98   DG  I "C3'" 1 
ATOM   1988  O "O3'" . DG  A 1 98  ? 36.902  14.268 -28.729 1.00 82.13  ? 98   DG  I "O3'" 1 
ATOM   1989  C "C2'" . DG  A 1 98  ? 35.013  15.528 -28.169 1.00 81.44  ? 98   DG  I "C2'" 1 
ATOM   1990  C "C1'" . DG  A 1 98  ? 35.165  16.366 -29.413 1.00 81.94  ? 98   DG  I "C1'" 1 
ATOM   1991  N N9    . DG  A 1 98  ? 34.461  17.641 -29.392 1.00 89.23  ? 98   DG  I N9    1 
ATOM   1992  C C8    . DG  A 1 98  ? 33.231  17.896 -28.847 1.00 90.03  ? 98   DG  I C8    1 
ATOM   1993  N N7    . DG  A 1 98  ? 32.863  19.141 -28.975 1.00 89.93  ? 98   DG  I N7    1 
ATOM   1994  C C5    . DG  A 1 98  ? 33.918  19.743 -29.648 1.00 90.15  ? 98   DG  I C5    1 
ATOM   1995  C C6    . DG  A 1 98  ? 34.084  21.082 -30.085 1.00 90.94  ? 98   DG  I C6    1 
ATOM   1996  O O6    . DG  A 1 98  ? 33.308  22.040 -29.959 1.00 91.63  ? 98   DG  I O6    1 
ATOM   1997  N N1    . DG  A 1 98  ? 35.289  21.259 -30.735 1.00 90.67  ? 98   DG  I N1    1 
ATOM   1998  C C2    . DG  A 1 98  ? 36.211  20.286 -30.945 1.00 90.78  ? 98   DG  I C2    1 
ATOM   1999  N N2    . DG  A 1 98  ? 37.296  20.670 -31.610 1.00 90.47  ? 98   DG  I N2    1 
ATOM   2000  N N3    . DG  A 1 98  ? 36.079  19.033 -30.544 1.00 90.20  ? 98   DG  I N3    1 
ATOM   2001  C C4    . DG  A 1 98  ? 34.912  18.834 -29.909 1.00 90.47  ? 98   DG  I C4    1 
ATOM   2002  P P     . DA  A 1 99  ? 37.743  13.159 -27.981 1.00 106.75 ? 99   DA  I P     1 
ATOM   2003  O OP1   . DA  A 1 99  ? 37.284  11.846 -28.505 1.00 83.04  ? 99   DA  I OP1   1 
ATOM   2004  O OP2   . DA  A 1 99  ? 37.624  13.476 -26.537 1.00 82.53  ? 99   DA  I OP2   1 
ATOM   2005  O "O5'" . DA  A 1 99  ? 39.216  13.420 -28.501 1.00 105.16 ? 99   DA  I "O5'" 1 
ATOM   2006  C "C5'" . DA  A 1 99  ? 39.474  13.403 -29.895 1.00 101.00 ? 99   DA  I "C5'" 1 
ATOM   2007  C "C4'" . DA  A 1 99  ? 40.290  14.607 -30.289 1.00 99.50  ? 99   DA  I "C4'" 1 
ATOM   2008  O "O4'" . DA  A 1 99  ? 39.541  15.837 -30.134 1.00 98.13  ? 99   DA  I "O4'" 1 
ATOM   2009  C "C3'" . DA  A 1 99  ? 41.548  14.786 -29.458 1.00 97.72  ? 99   DA  I "C3'" 1 
ATOM   2010  O "O3'" . DA  A 1 99  ? 42.546  15.305 -30.323 1.00 96.70  ? 99   DA  I "O3'" 1 
ATOM   2011  C "C2'" . DA  A 1 99  ? 41.133  15.820 -28.426 1.00 97.29  ? 99   DA  I "C2'" 1 
ATOM   2012  C "C1'" . DA  A 1 99  ? 40.218  16.712 -29.239 1.00 97.05  ? 99   DA  I "C1'" 1 
ATOM   2013  N N9    . DA  A 1 99  ? 39.197  17.432 -28.479 1.00 72.24  ? 99   DA  I N9    1 
ATOM   2014  C C8    . DA  A 1 99  ? 38.216  16.890 -27.683 1.00 72.01  ? 99   DA  I C8    1 
ATOM   2015  N N7    . DA  A 1 99  ? 37.363  17.771 -27.224 1.00 71.55  ? 99   DA  I N7    1 
ATOM   2016  C C5    . DA  A 1 99  ? 37.824  18.978 -27.728 1.00 71.40  ? 99   DA  I C5    1 
ATOM   2017  C C6    . DA  A 1 99  ? 37.331  20.283 -27.632 1.00 71.12  ? 99   DA  I C6    1 
ATOM   2018  N N6    . DA  A 1 99  ? 36.205  20.591 -26.995 1.00 70.55  ? 99   DA  I N6    1 
ATOM   2019  N N1    . DA  A 1 99  ? 38.029  21.267 -28.234 1.00 70.04  ? 99   DA  I N1    1 
ATOM   2020  C C2    . DA  A 1 99  ? 39.138  20.940 -28.904 1.00 70.59  ? 99   DA  I C2    1 
ATOM   2021  N N3    . DA  A 1 99  ? 39.695  19.742 -29.087 1.00 71.05  ? 99   DA  I N3    1 
ATOM   2022  C C4    . DA  A 1 99  ? 38.977  18.789 -28.469 1.00 71.50  ? 99   DA  I C4    1 
ATOM   2023  P P     . DG  A 1 100 ? 44.052  14.808 -30.177 1.00 74.82  ? 100  DG  I P     1 
ATOM   2024  O OP1   . DG  A 1 100 ? 44.535  14.402 -31.526 1.00 92.94  ? 100  DG  I OP1   1 
ATOM   2025  O OP2   . DG  A 1 100 ? 44.097  13.838 -29.048 1.00 91.04  ? 100  DG  I OP2   1 
ATOM   2026  O "O5'" . DG  A 1 100 ? 44.795  16.138 -29.716 1.00 70.39  ? 100  DG  I "O5'" 1 
ATOM   2027  C "C5'" . DG  A 1 100 ? 44.505  17.378 -30.359 1.00 65.39  ? 100  DG  I "C5'" 1 
ATOM   2028  C "C4'" . DG  A 1 100 ? 44.535  18.511 -29.365 1.00 59.44  ? 100  DG  I "C4'" 1 
ATOM   2029  O "O4'" . DG  A 1 100 ? 43.285  18.610 -28.646 1.00 58.78  ? 100  DG  I "O4'" 1 
ATOM   2030  C "C3'" . DG  A 1 100 ? 45.640  18.444 -28.305 1.00 58.51  ? 100  DG  I "C3'" 1 
ATOM   2031  O "O3'" . DG  A 1 100 ? 46.132  19.761 -28.073 1.00 53.57  ? 100  DG  I "O3'" 1 
ATOM   2032  C "C2'" . DG  A 1 100 ? 44.876  18.065 -27.052 1.00 55.94  ? 100  DG  I "C2'" 1 
ATOM   2033  C "C1'" . DG  A 1 100 ? 43.605  18.861 -27.289 1.00 60.12  ? 100  DG  I "C1'" 1 
ATOM   2034  N N9    . DG  A 1 100 ? 42.446  18.549 -26.450 1.00 77.45  ? 100  DG  I N9    1 
ATOM   2035  C C8    . DG  A 1 100 ? 42.113  17.343 -25.885 1.00 77.30  ? 100  DG  I C8    1 
ATOM   2036  N N7    . DG  A 1 100 ? 41.024  17.396 -25.165 1.00 78.53  ? 100  DG  I N7    1 
ATOM   2037  C C5    . DG  A 1 100 ? 40.614  18.714 -25.267 1.00 80.56  ? 100  DG  I C5    1 
ATOM   2038  C C6    . DG  A 1 100 ? 39.501  19.372 -24.693 1.00 81.01  ? 100  DG  I C6    1 
ATOM   2039  O O6    . DG  A 1 100 ? 38.619  18.900 -23.958 1.00 83.16  ? 100  DG  I O6    1 
ATOM   2040  N N1    . DG  A 1 100 ? 39.473  20.719 -25.045 1.00 82.67  ? 100  DG  I N1    1 
ATOM   2041  C C2    . DG  A 1 100 ? 40.408  21.348 -25.840 1.00 82.00  ? 100  DG  I C2    1 
ATOM   2042  N N2    . DG  A 1 100 ? 40.239  22.666 -26.061 1.00 81.32  ? 100  DG  I N2    1 
ATOM   2043  N N3    . DG  A 1 100 ? 41.441  20.737 -26.380 1.00 80.95  ? 100  DG  I N3    1 
ATOM   2044  C C4    . DG  A 1 100 ? 41.482  19.436 -26.057 1.00 79.51  ? 100  DG  I C4    1 
ATOM   2045  P P     . DC  A 1 101 ? 47.609  20.161 -28.528 1.00 56.67  ? 101  DC  I P     1 
ATOM   2046  O OP1   . DC  A 1 101 ? 47.740  19.935 -29.983 1.00 47.41  ? 101  DC  I OP1   1 
ATOM   2047  O OP2   . DC  A 1 101 ? 48.563  19.545 -27.595 1.00 45.70  ? 101  DC  I OP2   1 
ATOM   2048  O "O5'" . DC  A 1 101 ? 47.639  21.716 -28.275 1.00 61.18  ? 101  DC  I "O5'" 1 
ATOM   2049  C "C5'" . DC  A 1 101 ? 46.967  22.569 -29.167 1.00 65.51  ? 101  DC  I "C5'" 1 
ATOM   2050  C "C4'" . DC  A 1 101 ? 46.264  23.659 -28.400 1.00 70.55  ? 101  DC  I "C4'" 1 
ATOM   2051  O "O4'" . DC  A 1 101 ? 45.179  23.112 -27.612 1.00 70.46  ? 101  DC  I "O4'" 1 
ATOM   2052  C "C3'" . DC  A 1 101 ? 47.158  24.424 -27.423 1.00 73.69  ? 101  DC  I "C3'" 1 
ATOM   2053  O "O3'" . DC  A 1 101 ? 46.843  25.803 -27.525 1.00 78.46  ? 101  DC  I "O3'" 1 
ATOM   2054  C "C2'" . DC  A 1 101 ? 46.709  23.925 -26.065 1.00 72.50  ? 101  DC  I "C2'" 1 
ATOM   2055  C "C1'" . DC  A 1 101 ? 45.241  23.680 -26.316 1.00 71.45  ? 101  DC  I "C1'" 1 
ATOM   2056  N N1    . DC  A 1 101 ? 44.611  22.746 -25.385 1.00 60.64  ? 101  DC  I N1    1 
ATOM   2057  C C2    . DC  A 1 101 ? 43.635  23.229 -24.508 1.00 60.93  ? 101  DC  I C2    1 
ATOM   2058  O O2    . DC  A 1 101 ? 43.356  24.446 -24.529 1.00 59.91  ? 101  DC  I O2    1 
ATOM   2059  N N3    . DC  A 1 101 ? 43.035  22.368 -23.654 1.00 59.93  ? 101  DC  I N3    1 
ATOM   2060  C C4    . DC  A 1 101 ? 43.399  21.084 -23.637 1.00 60.67  ? 101  DC  I C4    1 
ATOM   2061  N N4    . DC  A 1 101 ? 42.811  20.276 -22.755 1.00 62.40  ? 101  DC  I N4    1 
ATOM   2062  C C5    . DC  A 1 101 ? 44.391  20.570 -24.518 1.00 60.54  ? 101  DC  I C5    1 
ATOM   2063  C C6    . DC  A 1 101 ? 44.965  21.426 -25.371 1.00 61.57  ? 101  DC  I C6    1 
ATOM   2064  P P     . DA  A 1 102 ? 47.923  26.897 -27.104 1.00 96.92  ? 102  DA  I P     1 
ATOM   2065  O OP1   . DA  A 1 102 ? 47.953  27.872 -28.216 1.00 70.30  ? 102  DA  I OP1   1 
ATOM   2066  O OP2   . DA  A 1 102 ? 49.177  26.236 -26.647 1.00 72.46  ? 102  DA  I OP2   1 
ATOM   2067  O "O5'" . DA  A 1 102 ? 47.245  27.591 -25.851 1.00 96.53  ? 102  DA  I "O5'" 1 
ATOM   2068  C "C5'" . DA  A 1 102 ? 45.904  28.051 -25.918 1.00 96.88  ? 102  DA  I "C5'" 1 
ATOM   2069  C "C4'" . DA  A 1 102 ? 45.353  28.209 -24.524 1.00 96.91  ? 102  DA  I "C4'" 1 
ATOM   2070  O "O4'" . DA  A 1 102 ? 45.002  26.917 -23.964 1.00 94.46  ? 102  DA  I "O4'" 1 
ATOM   2071  C "C3'" . DA  A 1 102 ? 46.360  28.834 -23.559 1.00 96.28  ? 102  DA  I "C3'" 1 
ATOM   2072  O "O3'" . DA  A 1 102 ? 45.712  29.801 -22.747 1.00 98.25  ? 102  DA  I "O3'" 1 
ATOM   2073  C "C2'" . DA  A 1 102 ? 46.820  27.659 -22.715 1.00 94.37  ? 102  DA  I "C2'" 1 
ATOM   2074  C "C1'" . DA  A 1 102 ? 45.572  26.811 -22.675 1.00 93.24  ? 102  DA  I "C1'" 1 
ATOM   2075  N N9    . DA  A 1 102 ? 45.783  25.397 -22.384 1.00 66.44  ? 102  DA  I N9    1 
ATOM   2076  C C8    . DA  A 1 102 ? 46.814  24.561 -22.744 1.00 67.34  ? 102  DA  I C8    1 
ATOM   2077  N N7    . DA  A 1 102 ? 46.679  23.333 -22.305 1.00 64.83  ? 102  DA  I N7    1 
ATOM   2078  C C5    . DA  A 1 102 ? 45.473  23.365 -21.611 1.00 64.16  ? 102  DA  I C5    1 
ATOM   2079  C C6    . DA  A 1 102 ? 44.743  22.382 -20.925 1.00 62.42  ? 102  DA  I C6    1 
ATOM   2080  N N6    . DA  A 1 102 ? 45.123  21.108 -20.835 1.00 60.37  ? 102  DA  I N6    1 
ATOM   2081  N N1    . DA  A 1 102 ? 43.583  22.752 -20.339 1.00 61.42  ? 102  DA  I N1    1 
ATOM   2082  C C2    . DA  A 1 102 ? 43.179  24.010 -20.457 1.00 61.00  ? 102  DA  I C2    1 
ATOM   2083  N N3    . DA  A 1 102 ? 43.758  25.020 -21.086 1.00 63.02  ? 102  DA  I N3    1 
ATOM   2084  C C4    . DA  A 1 102 ? 44.917  24.629 -21.648 1.00 64.63  ? 102  DA  I C4    1 
ATOM   2085  P P     . DG  A 1 103 ? 46.539  30.562 -21.609 1.00 78.31  ? 103  DG  I P     1 
ATOM   2086  O OP1   . DG  A 1 103 ? 46.609  31.985 -22.018 1.00 85.72  ? 103  DG  I OP1   1 
ATOM   2087  O OP2   . DG  A 1 103 ? 47.783  29.832 -21.256 1.00 83.13  ? 103  DG  I OP2   1 
ATOM   2088  O "O5'" . DG  A 1 103 ? 45.572  30.433 -20.352 1.00 79.57  ? 103  DG  I "O5'" 1 
ATOM   2089  C "C5'" . DG  A 1 103 ? 44.161  30.667 -20.456 1.00 79.80  ? 103  DG  I "C5'" 1 
ATOM   2090  C "C4'" . DG  A 1 103 ? 43.495  30.273 -19.161 1.00 81.90  ? 103  DG  I "C4'" 1 
ATOM   2091  O "O4'" . DG  A 1 103 ? 43.507  28.832 -19.048 1.00 81.40  ? 103  DG  I "O4'" 1 
ATOM   2092  C "C3'" . DG  A 1 103 ? 44.220  30.793 -17.915 1.00 83.92  ? 103  DG  I "C3'" 1 
ATOM   2093  O "O3'" . DG  A 1 103 ? 43.272  31.173 -16.912 1.00 88.94  ? 103  DG  I "O3'" 1 
ATOM   2094  C "C2'" . DG  A 1 103 ? 45.029  29.596 -17.449 1.00 82.49  ? 103  DG  I "C2'" 1 
ATOM   2095  C "C1'" . DG  A 1 103 ? 44.117  28.451 -17.829 1.00 81.90  ? 103  DG  I "C1'" 1 
ATOM   2096  N N9    . DG  A 1 103 ? 44.803  27.187 -18.046 1.00 89.35  ? 103  DG  I N9    1 
ATOM   2097  C C8    . DG  A 1 103 ? 45.843  26.943 -18.905 1.00 88.63  ? 103  DG  I C8    1 
ATOM   2098  N N7    . DG  A 1 103 ? 46.249  25.704 -18.880 1.00 88.71  ? 103  DG  I N7    1 
ATOM   2099  C C5    . DG  A 1 103 ? 45.423  25.094 -17.950 1.00 89.60  ? 103  DG  I C5    1 
ATOM   2100  C C6    . DG  A 1 103 ? 45.377  23.741 -17.501 1.00 90.64  ? 103  DG  I C6    1 
ATOM   2101  O O6    . DG  A 1 103 ? 46.086  22.784 -17.852 1.00 90.84  ? 103  DG  I O6    1 
ATOM   2102  N N1    . DG  A 1 103 ? 44.379  23.554 -16.544 1.00 92.08  ? 103  DG  I N1    1 
ATOM   2103  C C2    . DG  A 1 103 ? 43.534  24.538 -16.081 1.00 93.08  ? 103  DG  I C2    1 
ATOM   2104  N N2    . DG  A 1 103 ? 42.641  24.164 -15.155 1.00 93.86  ? 103  DG  I N2    1 
ATOM   2105  N N3    . DG  A 1 103 ? 43.566  25.798 -16.496 1.00 91.80  ? 103  DG  I N3    1 
ATOM   2106  C C4    . DG  A 1 103 ? 44.527  26.000 -17.424 1.00 89.86  ? 103  DG  I C4    1 
ATOM   2107  P P     . DT  A 1 104 ? 43.771  31.894 -15.565 1.00 111.14 ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 104 ? 42.739  32.888 -15.189 1.00 87.08  ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 104 ? 45.180  32.320 -15.711 1.00 87.49  ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 104 ? 43.767  30.714 -14.507 1.00 114.53 ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 104 ? 42.550  30.084 -14.146 1.00 117.17 ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 104 ? 42.777  29.166 -12.972 1.00 118.66 ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 104 ? 43.349  27.917 -13.430 1.00 117.44 ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 104 ? 43.741  29.731 -11.927 1.00 119.93 ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 104 ? 43.228  29.476 -10.616 1.00 123.14 ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 104 ? 45.027  28.960 -12.185 1.00 118.16 ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 104 ? 44.509  27.618 -12.678 1.00 116.89 ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 104 ? 45.431  26.859 -13.550 1.00 89.92  ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 104 ? 45.541  25.491 -13.376 1.00 89.68  ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 104 ? 44.915  24.864 -12.545 1.00 90.33  ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 104 ? 46.421  24.877 -14.220 1.00 89.47  ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 104 ? 47.187  25.463 -15.196 1.00 88.06  ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 104 ? 47.932  24.768 -15.879 1.00 87.82  ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 104 ? 47.031  26.896 -15.326 1.00 87.86  ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 104 ? 47.838  27.627 -16.349 1.00 86.62  ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 104 ? 46.166  27.512 -14.512 1.00 89.07  ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 105 ? 43.907  30.170 -9.332  1.00 138.50 ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 105 ? 42.853  30.981 -8.684  1.00 104.83 ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 105 ? 45.200  30.806 -9.692  1.00 105.18 ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 105 ? 44.215  28.924 -8.396  1.00 138.66 ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 105 ? 43.342  27.801 -8.398  1.00 140.04 ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 105 ? 44.067  26.574 -7.901  1.00 141.00 ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 105 ? 44.855  25.948 -8.946  1.00 140.11 ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 105 ? 45.025  26.847 -6.746  1.00 141.72 ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 105 ? 44.869  25.842 -5.750  1.00 143.62 ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 105 ? 46.396  26.745 -7.392  1.00 140.28 ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 105 ? 46.161  25.689 -8.456  1.00 138.49 ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 105 ? 47.104  25.709 -9.605  1.00 101.67 ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 105 ? 47.609  24.503 -10.054 1.00 100.44 ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 105 ? 47.368  23.432 -9.520  1.00 100.08 ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 105 ? 48.420  24.599 -11.157 1.00 98.60  ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 105 ? 48.784  25.744 -11.828 1.00 97.47  ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 105 ? 49.488  25.664 -12.820 1.00 96.24  ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 105 ? 48.268  26.970 -11.282 1.00 97.67  ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 105 ? 48.656  28.264 -11.922 1.00 96.48  ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 105 ? 47.458  26.895 -10.217 1.00 99.59  ? 105  DT  I C6    1 
ATOM   2147  P P     . DT  A 1 106 ? 45.674  25.967 -4.373  1.00 170.75 ? 106  DT  I P     1 
ATOM   2148  O OP1   . DT  A 1 106 ? 44.704  25.866 -3.259  1.00 114.70 ? 106  DT  I OP1   1 
ATOM   2149  O OP2   . DT  A 1 106 ? 46.581  27.144 -4.458  1.00 113.99 ? 106  DT  I OP2   1 
ATOM   2150  O "O5'" . DT  A 1 106 ? 46.530  24.634 -4.363  1.00 170.78 ? 106  DT  I "O5'" 1 
ATOM   2151  C "C5'" . DT  A 1 106 ? 45.920  23.405 -4.721  1.00 170.29 ? 106  DT  I "C5'" 1 
ATOM   2152  C "C4'" . DT  A 1 106 ? 46.970  22.337 -4.876  1.00 169.92 ? 106  DT  I "C4'" 1 
ATOM   2153  O "O4'" . DT  A 1 106 ? 47.726  22.544 -6.095  1.00 169.95 ? 106  DT  I "O4'" 1 
ATOM   2154  C "C3'" . DT  A 1 106 ? 47.988  22.322 -3.741  1.00 169.56 ? 106  DT  I "C3'" 1 
ATOM   2155  O "O3'" . DT  A 1 106 ? 48.248  20.972 -3.380  1.00 169.22 ? 106  DT  I "O3'" 1 
ATOM   2156  C "C2'" . DT  A 1 106 ? 49.217  22.979 -4.351  1.00 169.38 ? 106  DT  I "C2'" 1 
ATOM   2157  C "C1'" . DT  A 1 106 ? 49.113  22.539 -5.800  1.00 168.53 ? 106  DT  I "C1'" 1 
ATOM   2158  N N1    . DT  A 1 106 ? 49.814  23.371 -6.816  1.00 110.66 ? 106  DT  I N1    1 
ATOM   2159  C C2    . DT  A 1 106 ? 50.600  22.700 -7.737  1.00 109.60 ? 106  DT  I C2    1 
ATOM   2160  O O2    . DT  A 1 106 ? 50.719  21.481 -7.748  1.00 108.61 ? 106  DT  I O2    1 
ATOM   2161  N N3    . DT  A 1 106 ? 51.237  23.509 -8.651  1.00 108.23 ? 106  DT  I N3    1 
ATOM   2162  C C4    . DT  A 1 106 ? 51.160  24.884 -8.745  1.00 107.90 ? 106  DT  I C4    1 
ATOM   2163  O O4    . DT  A 1 106 ? 51.788  25.473 -9.622  1.00 107.26 ? 106  DT  I O4    1 
ATOM   2164  C C5    . DT  A 1 106 ? 50.311  25.524 -7.760  1.00 108.03 ? 106  DT  I C5    1 
ATOM   2165  C C7    . DT  A 1 106 ? 50.155  27.010 -7.801  1.00 107.62 ? 106  DT  I C7    1 
ATOM   2166  C C6    . DT  A 1 106 ? 49.694  24.747 -6.851  1.00 109.06 ? 106  DT  I C6    1 
ATOM   2167  P P     . DC  A 1 107 ? 49.192  20.664 -2.134  1.00 140.90 ? 107  DC  I P     1 
ATOM   2168  O OP1   . DC  A 1 107 ? 48.802  19.327 -1.605  1.00 93.63  ? 107  DC  I OP1   1 
ATOM   2169  O OP2   . DC  A 1 107 ? 49.177  21.850 -1.241  1.00 92.20  ? 107  DC  I OP2   1 
ATOM   2170  O "O5'" . DC  A 1 107 ? 50.635  20.585 -2.797  1.00 139.96 ? 107  DC  I "O5'" 1 
ATOM   2171  C "C5'" . DC  A 1 107 ? 50.903  19.682 -3.866  1.00 139.30 ? 107  DC  I "C5'" 1 
ATOM   2172  C "C4'" . DC  A 1 107 ? 52.370  19.735 -4.220  1.00 138.93 ? 107  DC  I "C4'" 1 
ATOM   2173  O "O4'" . DC  A 1 107 ? 52.651  20.900 -5.035  1.00 138.41 ? 107  DC  I "O4'" 1 
ATOM   2174  C "C3'" . DC  A 1 107 ? 53.278  19.835 -2.995  1.00 138.10 ? 107  DC  I "C3'" 1 
ATOM   2175  O "O3'" . DC  A 1 107 ? 54.414  18.991 -3.143  1.00 136.90 ? 107  DC  I "O3'" 1 
ATOM   2176  C "C2'" . DC  A 1 107 ? 53.696  21.294 -2.975  1.00 138.18 ? 107  DC  I "C2'" 1 
ATOM   2177  C "C1'" . DC  A 1 107 ? 53.706  21.653 -4.454  1.00 137.14 ? 107  DC  I "C1'" 1 
ATOM   2178  N N1    . DC  A 1 107 ? 53.482  23.086 -4.760  1.00 87.59  ? 107  DC  I N1    1 
ATOM   2179  C C2    . DC  A 1 107 ? 53.741  23.547 -6.061  1.00 85.92  ? 107  DC  I C2    1 
ATOM   2180  O O2    . DC  A 1 107 ? 54.106  22.729 -6.919  1.00 84.41  ? 107  DC  I O2    1 
ATOM   2181  N N3    . DC  A 1 107 ? 53.575  24.866 -6.347  1.00 84.41  ? 107  DC  I N3    1 
ATOM   2182  C C4    . DC  A 1 107 ? 53.144  25.704 -5.397  1.00 85.01  ? 107  DC  I C4    1 
ATOM   2183  N N4    . DC  A 1 107 ? 52.974  26.992 -5.719  1.00 83.72  ? 107  DC  I N4    1 
ATOM   2184  C C5    . DC  A 1 107 ? 52.859  25.258 -4.069  1.00 86.05  ? 107  DC  I C5    1 
ATOM   2185  C C6    . DC  A 1 107 ? 53.042  23.955 -3.798  1.00 86.73  ? 107  DC  I C6    1 
ATOM   2186  P P     . DC  A 1 108 ? 54.710  17.874 -2.031  1.00 115.39 ? 108  DC  I P     1 
ATOM   2187  O OP1   . DC  A 1 108 ? 53.690  16.808 -2.188  1.00 117.60 ? 108  DC  I OP1   1 
ATOM   2188  O OP2   . DC  A 1 108 ? 54.841  18.584 -0.730  1.00 115.82 ? 108  DC  I OP2   1 
ATOM   2189  O "O5'" . DC  A 1 108 ? 56.111  17.257 -2.461  1.00 113.53 ? 108  DC  I "O5'" 1 
ATOM   2190  C "C5'" . DC  A 1 108 ? 56.196  16.406 -3.601  1.00 109.78 ? 108  DC  I "C5'" 1 
ATOM   2191  C "C4'" . DC  A 1 108 ? 57.380  16.793 -4.453  1.00 106.98 ? 108  DC  I "C4'" 1 
ATOM   2192  O "O4'" . DC  A 1 108 ? 57.221  18.141 -4.957  1.00 105.49 ? 108  DC  I "O4'" 1 
ATOM   2193  C "C3'" . DC  A 1 108 ? 58.712  16.792 -3.706  1.00 105.03 ? 108  DC  I "C3'" 1 
ATOM   2194  O "O3'" . DC  A 1 108 ? 59.729  16.415 -4.621  1.00 102.46 ? 108  DC  I "O3'" 1 
ATOM   2195  C "C2'" . DC  A 1 108 ? 58.910  18.252 -3.360  1.00 104.73 ? 108  DC  I "C2'" 1 
ATOM   2196  C "C1'" . DC  A 1 108 ? 58.385  18.883 -4.626  1.00 105.74 ? 108  DC  I "C1'" 1 
ATOM   2197  N N1    . DC  A 1 108 ? 58.029  20.302 -4.534  1.00 106.73 ? 108  DC  I N1    1 
ATOM   2198  C C2    . DC  A 1 108 ? 58.119  21.077 -5.683  1.00 106.13 ? 108  DC  I C2    1 
ATOM   2199  O O2    . DC  A 1 108 ? 58.482  20.536 -6.739  1.00 105.85 ? 108  DC  I O2    1 
ATOM   2200  N N3    . DC  A 1 108 ? 57.813  22.393 -5.620  1.00 105.97 ? 108  DC  I N3    1 
ATOM   2201  C C4    . DC  A 1 108 ? 57.429  22.932 -4.463  1.00 105.95 ? 108  DC  I C4    1 
ATOM   2202  N N4    . DC  A 1 108 ? 57.140  24.233 -4.443  1.00 105.21 ? 108  DC  I N4    1 
ATOM   2203  C C5    . DC  A 1 108 ? 57.326  22.161 -3.275  1.00 106.42 ? 108  DC  I C5    1 
ATOM   2204  C C6    . DC  A 1 108 ? 57.629  20.860 -3.354  1.00 106.76 ? 108  DC  I C6    1 
ATOM   2205  P P     . DA  A 1 109 ? 60.431  14.988 -4.480  1.00 109.53 ? 109  DA  I P     1 
ATOM   2206  O OP1   . DA  A 1 109 ? 59.364  13.957 -4.612  1.00 98.98  ? 109  DA  I OP1   1 
ATOM   2207  O OP2   . DA  A 1 109 ? 61.285  15.024 -3.263  1.00 99.82  ? 109  DA  I OP2   1 
ATOM   2208  O "O5'" . DA  A 1 109 ? 61.362  14.917 -5.765  1.00 109.10 ? 109  DA  I "O5'" 1 
ATOM   2209  C "C5'" . DA  A 1 109 ? 60.783  14.840 -7.058  1.00 105.93 ? 109  DA  I "C5'" 1 
ATOM   2210  C "C4'" . DA  A 1 109 ? 61.532  15.733 -8.016  1.00 104.35 ? 109  DA  I "C4'" 1 
ATOM   2211  O "O4'" . DA  A 1 109 ? 61.270  17.127 -7.741  1.00 102.63 ? 109  DA  I "O4'" 1 
ATOM   2212  C "C3'" . DA  A 1 109 ? 63.046  15.572 -7.959  1.00 103.77 ? 109  DA  I "C3'" 1 
ATOM   2213  O "O3'" . DA  A 1 109 ? 63.564  15.662 -9.282  1.00 102.82 ? 109  DA  I "O3'" 1 
ATOM   2214  C "C2'" . DA  A 1 109 ? 63.501  16.740 -7.104  1.00 102.41 ? 109  DA  I "C2'" 1 
ATOM   2215  C "C1'" . DA  A 1 109 ? 62.478  17.811 -7.431  1.00 102.13 ? 109  DA  I "C1'" 1 
ATOM   2216  N N9    . DA  A 1 109 ? 62.188  18.696 -6.309  1.00 91.31  ? 109  DA  I N9    1 
ATOM   2217  C C8    . DA  A 1 109 ? 62.034  18.343 -4.995  1.00 91.89  ? 109  DA  I C8    1 
ATOM   2218  N N7    . DA  A 1 109 ? 61.694  19.339 -4.219  1.00 92.05  ? 109  DA  I N7    1 
ATOM   2219  C C5    . DA  A 1 109 ? 61.637  20.426 -5.079  1.00 90.94  ? 109  DA  I C5    1 
ATOM   2220  C C6    . DA  A 1 109 ? 61.305  21.774 -4.875  1.00 90.37  ? 109  DA  I C6    1 
ATOM   2221  N N6    . DA  A 1 109 ? 60.926  22.277 -3.695  1.00 88.83  ? 109  DA  I N6    1 
ATOM   2222  N N1    . DA  A 1 109 ? 61.361  22.598 -5.939  1.00 90.07  ? 109  DA  I N1    1 
ATOM   2223  C C2    . DA  A 1 109 ? 61.711  22.090 -7.122  1.00 90.20  ? 109  DA  I C2    1 
ATOM   2224  N N3    . DA  A 1 109 ? 62.025  20.840 -7.442  1.00 90.75  ? 109  DA  I N3    1 
ATOM   2225  C C4    . DA  A 1 109 ? 61.966  20.049 -6.363  1.00 90.99  ? 109  DA  I C4    1 
ATOM   2226  P P     . DA  A 1 110 ? 65.141  15.658 -9.511  1.00 106.98 ? 110  DA  I P     1 
ATOM   2227  O OP1   . DA  A 1 110 ? 65.366  14.857 -10.744 1.00 90.68  ? 110  DA  I OP1   1 
ATOM   2228  O OP2   . DA  A 1 110 ? 65.801  15.267 -8.241  1.00 90.40  ? 110  DA  I OP2   1 
ATOM   2229  O "O5'" . DA  A 1 110 ? 65.458  17.189 -9.801  1.00 107.27 ? 110  DA  I "O5'" 1 
ATOM   2230  C "C5'" . DA  A 1 110 ? 64.766  17.872 -10.842 1.00 104.27 ? 110  DA  I "C5'" 1 
ATOM   2231  C "C4'" . DA  A 1 110 ? 65.181  19.322 -10.891 1.00 103.76 ? 110  DA  I "C4'" 1 
ATOM   2232  O "O4'" . DA  A 1 110 ? 64.683  20.011 -9.721  1.00 104.01 ? 110  DA  I "O4'" 1 
ATOM   2233  C "C3'" . DA  A 1 110 ? 66.690  19.556 -10.915 1.00 103.63 ? 110  DA  I "C3'" 1 
ATOM   2234  O "O3'" . DA  A 1 110 ? 66.990  20.623 -11.817 1.00 102.64 ? 110  DA  I "O3'" 1 
ATOM   2235  C "C2'" . DA  A 1 110 ? 67.000  19.953 -9.485  1.00 103.47 ? 110  DA  I "C2'" 1 
ATOM   2236  C "C1'" . DA  A 1 110 ? 65.744  20.698 -9.092  1.00 103.12 ? 110  DA  I "C1'" 1 
ATOM   2237  N N9    . DA  A 1 110 ? 65.477  20.720 -7.658  1.00 85.40  ? 110  DA  I N9    1 
ATOM   2238  C C8    . DA  A 1 110 ? 65.543  19.682 -6.767  1.00 85.74  ? 110  DA  I C8    1 
ATOM   2239  N N7    . DA  A 1 110 ? 65.265  20.026 -5.533  1.00 86.01  ? 110  DA  I N7    1 
ATOM   2240  C C5    . DA  A 1 110 ? 64.991  21.383 -5.619  1.00 86.04  ? 110  DA  I C5    1 
ATOM   2241  C C6    . DA  A 1 110 ? 64.622  22.344 -4.654  1.00 85.96  ? 110  DA  I C6    1 
ATOM   2242  N N6    . DA  A 1 110 ? 64.441  22.069 -3.355  1.00 86.18  ? 110  DA  I N6    1 
ATOM   2243  N N1    . DA  A 1 110 ? 64.432  23.616 -5.079  1.00 84.84  ? 110  DA  I N1    1 
ATOM   2244  C C2    . DA  A 1 110 ? 64.584  23.887 -6.384  1.00 84.62  ? 110  DA  I C2    1 
ATOM   2245  N N3    . DA  A 1 110 ? 64.913  23.071 -7.381  1.00 84.87  ? 110  DA  I N3    1 
ATOM   2246  C C4    . DA  A 1 110 ? 65.112  21.822 -6.926  1.00 85.11  ? 110  DA  I C4    1 
ATOM   2247  P P     . DA  A 1 111 ? 68.505  21.141 -11.974 1.00 84.41  ? 111  DA  I P     1 
ATOM   2248  O OP1   . DA  A 1 111 ? 68.813  21.174 -13.426 1.00 83.19  ? 111  DA  I OP1   1 
ATOM   2249  O OP2   . DA  A 1 111 ? 69.400  20.383 -11.051 1.00 84.15  ? 111  DA  I OP2   1 
ATOM   2250  O "O5'" . DA  A 1 111 ? 68.389  22.640 -11.455 1.00 82.49  ? 111  DA  I "O5'" 1 
ATOM   2251  C "C5'" . DA  A 1 111 ? 67.335  23.493 -11.907 1.00 79.89  ? 111  DA  I "C5'" 1 
ATOM   2252  C "C4'" . DA  A 1 111 ? 67.482  24.861 -11.281 1.00 79.55  ? 111  DA  I "C4'" 1 
ATOM   2253  O "O4'" . DA  A 1 111 ? 67.059  24.794 -9.901  1.00 80.07  ? 111  DA  I "O4'" 1 
ATOM   2254  C "C3'" . DA  A 1 111 ? 68.934  25.339 -11.250 1.00 76.93  ? 111  DA  I "C3'" 1 
ATOM   2255  O "O3'" . DA  A 1 111 ? 69.043  26.750 -11.417 1.00 72.59  ? 111  DA  I "O3'" 1 
ATOM   2256  C "C2'" . DA  A 1 111 ? 69.395  24.951 -9.863  1.00 79.56  ? 111  DA  I "C2'" 1 
ATOM   2257  C "C1'" . DA  A 1 111 ? 68.135  25.129 -9.047  1.00 81.15  ? 111  DA  I "C1'" 1 
ATOM   2258  N N9    . DA  A 1 111 ? 68.083  24.248 -7.887  1.00 82.83  ? 111  DA  I N9    1 
ATOM   2259  C C8    . DA  A 1 111 ? 68.275  22.892 -7.824  1.00 82.94  ? 111  DA  I C8    1 
ATOM   2260  N N7    . DA  A 1 111 ? 68.178  22.403 -6.615  1.00 84.52  ? 111  DA  I N7    1 
ATOM   2261  C C5    . DA  A 1 111 ? 67.902  23.513 -5.827  1.00 83.66  ? 111  DA  I C5    1 
ATOM   2262  C C6    . DA  A 1 111 ? 67.690  23.672 -4.445  1.00 83.79  ? 111  DA  I C6    1 
ATOM   2263  N N6    . DA  A 1 111 ? 67.725  22.668 -3.569  1.00 82.24  ? 111  DA  I N6    1 
ATOM   2264  N N1    . DA  A 1 111 ? 67.435  24.920 -3.986  1.00 83.68  ? 111  DA  I N1    1 
ATOM   2265  C C2    . DA  A 1 111 ? 67.398  25.932 -4.861  1.00 84.59  ? 111  DA  I C2    1 
ATOM   2266  N N3    . DA  A 1 111 ? 67.585  25.909 -6.176  1.00 83.50  ? 111  DA  I N3    1 
ATOM   2267  C C4    . DA  A 1 111 ? 67.836  24.654 -6.600  1.00 83.10  ? 111  DA  I C4    1 
ATOM   2268  P P     . DT  A 1 112 ? 70.492  27.410 -11.601 1.00 69.75  ? 112  DT  I P     1 
ATOM   2269  O OP1   . DT  A 1 112 ? 70.732  27.895 -12.982 1.00 70.66  ? 112  DT  I OP1   1 
ATOM   2270  O OP2   . DT  A 1 112 ? 71.434  26.467 -10.994 1.00 68.74  ? 112  DT  I OP2   1 
ATOM   2271  O "O5'" . DT  A 1 112 ? 70.429  28.674 -10.657 1.00 73.58  ? 112  DT  I "O5'" 1 
ATOM   2272  C "C5'" . DT  A 1 112 ? 69.287  29.513 -10.654 1.00 81.48  ? 112  DT  I "C5'" 1 
ATOM   2273  C "C4'" . DT  A 1 112 ? 69.222  30.268 -9.352  1.00 85.44  ? 112  DT  I "C4'" 1 
ATOM   2274  O "O4'" . DT  A 1 112 ? 69.072  29.310 -8.278  1.00 85.53  ? 112  DT  I "O4'" 1 
ATOM   2275  C "C3'" . DT  A 1 112 ? 70.486  31.073 -9.026  1.00 88.57  ? 112  DT  I "C3'" 1 
ATOM   2276  O "O3'" . DT  A 1 112 ? 70.112  32.329 -8.441  1.00 94.29  ? 112  DT  I "O3'" 1 
ATOM   2277  C "C2'" . DT  A 1 112 ? 71.218  30.192 -8.024  1.00 88.58  ? 112  DT  I "C2'" 1 
ATOM   2278  C "C1'" . DT  A 1 112 ? 70.053  29.571 -7.293  1.00 86.94  ? 112  DT  I "C1'" 1 
ATOM   2279  N N1    . DT  A 1 112 ? 70.313  28.329 -6.567  1.00 84.11  ? 112  DT  I N1    1 
ATOM   2280  C C2    . DT  A 1 112 ? 70.079  28.380 -5.226  1.00 84.16  ? 112  DT  I C2    1 
ATOM   2281  O O2    . DT  A 1 112 ? 69.752  29.411 -4.664  1.00 84.04  ? 112  DT  I O2    1 
ATOM   2282  N N3    . DT  A 1 112 ? 70.250  27.193 -4.563  1.00 83.47  ? 112  DT  I N3    1 
ATOM   2283  C C4    . DT  A 1 112 ? 70.646  25.988 -5.108  1.00 82.89  ? 112  DT  I C4    1 
ATOM   2284  O O4    . DT  A 1 112 ? 70.722  24.989 -4.397  1.00 81.88  ? 112  DT  I O4    1 
ATOM   2285  C C5    . DT  A 1 112 ? 70.928  26.019 -6.525  1.00 83.07  ? 112  DT  I C5    1 
ATOM   2286  C C7    . DT  A 1 112 ? 71.412  24.773 -7.189  1.00 83.15  ? 112  DT  I C7    1 
ATOM   2287  C C6    . DT  A 1 112 ? 70.743  27.174 -7.180  1.00 84.36  ? 112  DT  I C6    1 
ATOM   2288  P P     . DA  A 1 113 ? 71.227  33.264 -7.773  1.00 120.23 ? 113  DA  I P     1 
ATOM   2289  O OP1   . DA  A 1 113 ? 70.626  34.612 -7.612  1.00 96.07  ? 113  DA  I OP1   1 
ATOM   2290  O OP2   . DA  A 1 113 ? 72.480  33.110 -8.565  1.00 94.41  ? 113  DA  I OP2   1 
ATOM   2291  O "O5'" . DA  A 1 113 ? 71.396  32.625 -6.320  1.00 123.33 ? 113  DA  I "O5'" 1 
ATOM   2292  C "C5'" . DA  A 1 113 ? 70.453  32.914 -5.279  1.00 126.83 ? 113  DA  I "C5'" 1 
ATOM   2293  C "C4'" . DA  A 1 113 ? 71.153  32.959 -3.940  1.00 129.30 ? 113  DA  I "C4'" 1 
ATOM   2294  O "O4'" . DA  A 1 113 ? 71.346  31.614 -3.441  1.00 129.65 ? 113  DA  I "O4'" 1 
ATOM   2295  C "C3'" . DA  A 1 113 ? 72.543  33.597 -4.002  1.00 131.12 ? 113  DA  I "C3'" 1 
ATOM   2296  O "O3'" . DA  A 1 113 ? 72.808  34.408 -2.854  1.00 134.90 ? 113  DA  I "O3'" 1 
ATOM   2297  C "C2'" . DA  A 1 113 ? 73.476  32.401 -4.032  1.00 129.96 ? 113  DA  I "C2'" 1 
ATOM   2298  C "C1'" . DA  A 1 113 ? 72.728  31.374 -3.199  1.00 129.37 ? 113  DA  I "C1'" 1 
ATOM   2299  N N9    . DA  A 1 113 ? 73.021  29.989 -3.574  1.00 104.79 ? 113  DA  I N9    1 
ATOM   2300  C C8    . DA  A 1 113 ? 73.288  29.508 -4.833  1.00 104.89 ? 113  DA  I C8    1 
ATOM   2301  N N7    . DA  A 1 113 ? 73.519  28.217 -4.871  1.00 105.13 ? 113  DA  I N7    1 
ATOM   2302  C C5    . DA  A 1 113 ? 73.395  27.819 -3.552  1.00 105.23 ? 113  DA  I C5    1 
ATOM   2303  C C6    . DA  A 1 113 ? 73.528  26.564 -2.931  1.00 105.65 ? 113  DA  I C6    1 
ATOM   2304  N N6    . DA  A 1 113 ? 73.828  25.442 -3.588  1.00 105.63 ? 113  DA  I N6    1 
ATOM   2305  N N1    . DA  A 1 113 ? 73.345  26.503 -1.594  1.00 105.85 ? 113  DA  I N1    1 
ATOM   2306  C C2    . DA  A 1 113 ? 73.053  27.640 -0.936  1.00 105.62 ? 113  DA  I C2    1 
ATOM   2307  N N3    . DA  A 1 113 ? 72.903  28.880 -1.410  1.00 105.36 ? 113  DA  I N3    1 
ATOM   2308  C C4    . DA  A 1 113 ? 73.088  28.900 -2.739  1.00 104.84 ? 113  DA  I C4    1 
ATOM   2309  P P     . DC  A 1 114 ? 74.044  35.441 -2.878  1.00 135.15 ? 114  DC  I P     1 
ATOM   2310  O OP1   . DC  A 1 114 ? 74.196  35.961 -1.502  1.00 99.25  ? 114  DC  I OP1   1 
ATOM   2311  O OP2   . DC  A 1 114 ? 73.862  36.391 -4.007  1.00 99.32  ? 114  DC  I OP2   1 
ATOM   2312  O "O5'" . DC  A 1 114 ? 75.313  34.533 -3.194  1.00 137.55 ? 114  DC  I "O5'" 1 
ATOM   2313  C "C5'" . DC  A 1 114 ? 76.505  34.652 -2.424  1.00 140.73 ? 114  DC  I "C5'" 1 
ATOM   2314  C "C4'" . DC  A 1 114 ? 76.286  34.089 -1.038  1.00 142.79 ? 114  DC  I "C4'" 1 
ATOM   2315  O "O4'" . DC  A 1 114 ? 75.740  32.751 -1.116  1.00 142.43 ? 114  DC  I "O4'" 1 
ATOM   2316  C "C3'" . DC  A 1 114 ? 77.552  33.973 -0.196  1.00 144.48 ? 114  DC  I "C3'" 1 
ATOM   2317  O "O3'" . DC  A 1 114 ? 77.251  34.251 1.173   1.00 148.45 ? 114  DC  I "O3'" 1 
ATOM   2318  C "C2'" . DC  A 1 114 ? 77.952  32.521 -0.368  1.00 142.99 ? 114  DC  I "C2'" 1 
ATOM   2319  C "C1'" . DC  A 1 114 ? 76.607  31.831 -0.470  1.00 141.10 ? 114  DC  I "C1'" 1 
ATOM   2320  N N1    . DC  A 1 114 ? 76.632  30.597 -1.270  1.00 103.03 ? 114  DC  I N1    1 
ATOM   2321  C C2    . DC  A 1 114 ? 76.585  29.368 -0.612  1.00 101.93 ? 114  DC  I C2    1 
ATOM   2322  O O2    . DC  A 1 114 ? 76.565  29.352 0.625   1.00 101.91 ? 114  DC  I O2    1 
ATOM   2323  N N3    . DC  A 1 114 ? 76.573  28.230 -1.336  1.00 100.28 ? 114  DC  I N3    1 
ATOM   2324  C C4    . DC  A 1 114 ? 76.626  28.287 -2.665  1.00 99.71  ? 114  DC  I C4    1 
ATOM   2325  N N4    . DC  A 1 114 ? 76.609  27.139 -3.335  1.00 98.68  ? 114  DC  I N4    1 
ATOM   2326  C C5    . DC  A 1 114 ? 76.698  29.524 -3.363  1.00 99.77  ? 114  DC  I C5    1 
ATOM   2327  C C6    . DC  A 1 114 ? 76.696  30.645 -2.634  1.00 101.30 ? 114  DC  I C6    1 
ATOM   2328  P P     . DA  A 1 115 ? 78.449  34.440 2.221   1.00 139.69 ? 115  DA  I P     1 
ATOM   2329  O OP1   . DA  A 1 115 ? 77.865  34.871 3.518   1.00 130.63 ? 115  DA  I OP1   1 
ATOM   2330  O OP2   . DA  A 1 115 ? 79.486  35.281 1.561   1.00 130.06 ? 115  DA  I OP2   1 
ATOM   2331  O "O5'" . DA  A 1 115 ? 79.020  32.963 2.386   1.00 140.72 ? 115  DA  I "O5'" 1 
ATOM   2332  C "C5'" . DA  A 1 115 ? 78.497  32.084 3.379   1.00 141.93 ? 115  DA  I "C5'" 1 
ATOM   2333  C "C4'" . DA  A 1 115 ? 79.462  30.949 3.620   1.00 142.75 ? 115  DA  I "C4'" 1 
ATOM   2334  O "O4'" . DA  A 1 115 ? 79.332  29.972 2.557   1.00 142.39 ? 115  DA  I "O4'" 1 
ATOM   2335  C "C3'" . DA  A 1 115 ? 80.928  31.393 3.621   1.00 143.55 ? 115  DA  I "C3'" 1 
ATOM   2336  O "O3'" . DA  A 1 115 ? 81.672  30.699 4.628   1.00 144.77 ? 115  DA  I "O3'" 1 
ATOM   2337  C "C2'" . DA  A 1 115 ? 81.414  30.988 2.243   1.00 143.18 ? 115  DA  I "C2'" 1 
ATOM   2338  C "C1'" . DA  A 1 115 ? 80.611  29.725 1.994   1.00 142.39 ? 115  DA  I "C1'" 1 
ATOM   2339  N N9    . DA  A 1 115 ? 80.447  29.373 0.580   1.00 132.07 ? 115  DA  I N9    1 
ATOM   2340  C C8    . DA  A 1 115 ? 80.398  30.221 -0.501  1.00 131.40 ? 115  DA  I C8    1 
ATOM   2341  N N7    . DA  A 1 115 ? 80.314  29.602 -1.654  1.00 131.04 ? 115  DA  I N7    1 
ATOM   2342  C C5    . DA  A 1 115 ? 80.292  28.257 -1.312  1.00 131.04 ? 115  DA  I C5    1 
ATOM   2343  C C6    . DA  A 1 115 ? 80.228  27.079 -2.088  1.00 130.69 ? 115  DA  I C6    1 
ATOM   2344  N N6    . DA  A 1 115 ? 80.169  27.072 -3.424  1.00 130.38 ? 115  DA  I N6    1 
ATOM   2345  N N1    . DA  A 1 115 ? 80.230  25.895 -1.436  1.00 130.43 ? 115  DA  I N1    1 
ATOM   2346  C C2    . DA  A 1 115 ? 80.291  25.903 -0.099  1.00 130.77 ? 115  DA  I C2    1 
ATOM   2347  N N3    . DA  A 1 115 ? 80.354  26.940 0.739   1.00 130.98 ? 115  DA  I N3    1 
ATOM   2348  C C4    . DA  A 1 115 ? 80.355  28.101 0.061   1.00 131.28 ? 115  DA  I C4    1 
ATOM   2349  P P     . DC  A 1 116 ? 83.234  31.031 4.844   1.00 144.71 ? 116  DC  I P     1 
ATOM   2350  O OP1   . DC  A 1 116 ? 83.425  31.554 6.221   1.00 139.30 ? 116  DC  I OP1   1 
ATOM   2351  O OP2   . DC  A 1 116 ? 83.717  31.826 3.686   1.00 139.31 ? 116  DC  I OP2   1 
ATOM   2352  O "O5'" . DC  A 1 116 ? 83.914  29.598 4.764   1.00 143.87 ? 116  DC  I "O5'" 1 
ATOM   2353  C "C5'" . DC  A 1 116 ? 83.263  28.455 5.312   1.00 142.49 ? 116  DC  I "C5'" 1 
ATOM   2354  C "C4'" . DC  A 1 116 ? 83.877  27.194 4.753   1.00 141.19 ? 116  DC  I "C4'" 1 
ATOM   2355  O "O4'" . DC  A 1 116 ? 83.429  26.948 3.394   1.00 141.06 ? 116  DC  I "O4'" 1 
ATOM   2356  C "C3'" . DC  A 1 116 ? 85.402  27.248 4.688   1.00 140.16 ? 116  DC  I "C3'" 1 
ATOM   2357  O "O3'" . DC  A 1 116 ? 85.953  25.996 5.069   1.00 138.12 ? 116  DC  I "O3'" 1 
ATOM   2358  C "C2'" . DC  A 1 116 ? 85.690  27.509 3.220   1.00 140.18 ? 116  DC  I "C2'" 1 
ATOM   2359  C "C1'" . DC  A 1 116 ? 84.556  26.761 2.547   1.00 140.22 ? 116  DC  I "C1'" 1 
ATOM   2360  N N1    . DC  A 1 116 ? 84.220  27.261 1.202   1.00 133.68 ? 116  DC  I N1    1 
ATOM   2361  C C2    . DC  A 1 116 ? 84.137  26.343 0.142   1.00 132.83 ? 116  DC  I C2    1 
ATOM   2362  O O2    . DC  A 1 116 ? 84.329  25.139 0.373   1.00 132.34 ? 116  DC  I O2    1 
ATOM   2363  N N3    . DC  A 1 116 ? 83.851  26.795 -1.101  1.00 132.09 ? 116  DC  I N3    1 
ATOM   2364  C C4    . DC  A 1 116 ? 83.647  28.100 -1.306  1.00 132.05 ? 116  DC  I C4    1 
ATOM   2365  N N4    . DC  A 1 116 ? 83.370  28.500 -2.548  1.00 131.00 ? 116  DC  I N4    1 
ATOM   2366  C C5    . DC  A 1 116 ? 83.716  29.052 -0.246  1.00 132.28 ? 116  DC  I C5    1 
ATOM   2367  C C6    . DC  A 1 116 ? 84.001  28.593 0.980   1.00 133.08 ? 116  DC  I C6    1 
ATOM   2368  P P     . DT  A 1 117 ? 87.539  25.810 5.067   1.00 160.33 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 117 ? 87.893  25.087 6.306   1.00 113.21 ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 117 ? 88.169  27.121 4.772   1.00 112.33 ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 117 ? 87.794  24.860 3.823   1.00 158.88 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 117 ? 87.351  23.513 3.845   1.00 157.33 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 117 ? 87.982  22.743 2.710   1.00 156.25 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 117 ? 87.460  23.257 1.459   1.00 156.09 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 117 ? 89.508  22.853 2.620   1.00 155.39 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 117 ? 90.078  21.564 2.336   1.00 154.05 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 117 ? 89.728  23.850 1.494   1.00 155.19 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 117 ? 88.525  23.617 0.597   1.00 154.50 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 117 ? 88.107  24.802 -0.186  1.00 105.47 ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 117 ? 87.782  24.612 -1.515  1.00 104.14 ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 117 ? 87.742  23.512 -2.043  1.00 102.47 ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 117 ? 87.501  25.766 -2.203  1.00 103.28 ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 117 ? 87.488  27.055 -1.703  1.00 103.61 ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 117 ? 87.255  27.997 -2.450  1.00 102.70 ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 117 ? 87.771  27.175 -0.293  1.00 103.71 ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 117 ? 87.704  28.526 0.343   1.00 103.19 ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 117 ? 88.072  26.059 0.387   1.00 104.20 ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? 91.591  21.440 1.783   1.00 126.53 ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? 92.199  20.252 2.435   1.00 126.48 ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? 92.307  22.743 1.823   1.00 126.69 ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? 91.343  21.046 0.268   1.00 123.56 ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? 90.245  20.205 -0.060  1.00 117.83 ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? 90.172  20.011 -1.551  1.00 113.43 ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? 89.797  21.260 -2.177  1.00 112.95 ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? 91.509  19.613 -2.165  1.00 111.00 ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? 91.287  18.654 -3.193  1.00 108.12 ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? 92.045  20.922 -2.718  1.00 111.02 ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? 90.769  21.616 -3.141  1.00 111.90 ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? 90.828  23.078 -3.189  1.00 112.03 ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? 90.724  23.675 -4.419  1.00 112.07 ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? 90.655  23.042 -5.458  1.00 111.48 ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? 90.716  25.042 -4.393  1.00 112.19 ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? 90.818  25.854 -3.284  1.00 112.43 ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? 90.777  27.070 -3.414  1.00 111.83 ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? 90.964  25.162 -2.023  1.00 112.73 ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? 91.114  25.964 -0.768  1.00 113.14 ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? 90.960  23.821 -2.039  1.00 112.56 ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 119 ? 92.534  18.057 -3.995  1.00 108.55 ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 119 ? 92.306  16.612 -4.230  1.00 112.67 ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 119 ? 93.788  18.501 -3.329  1.00 113.03 ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 119 ? 92.427  18.795 -5.396  1.00 109.14 ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 119 ? 91.386  18.457 -6.302  1.00 108.77 ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 119 ? 91.747  18.889 -7.703  1.00 108.08 ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 119 ? 91.550  20.323 -7.777  1.00 108.30 ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 119 ? 93.203  18.622 -8.093  1.00 108.12 ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 119 ? 93.379  17.765 -9.244  1.00 107.01 ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 119 ? 93.853  19.993 -8.177  1.00 108.77 ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 119 ? 92.693  20.970 -8.300  1.00 108.95 ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 119 ? 92.884  22.221 -7.541  1.00 114.11 ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 119 ? 92.531  23.399 -8.146  1.00 114.75 ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 119 ? 92.019  23.451 -9.252  1.00 115.79 ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 119 ? 92.789  24.524 -7.402  1.00 114.88 ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 119 ? 93.335  24.583 -6.137  1.00 114.83 ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 119 ? 93.512  25.668 -5.596  1.00 113.90 ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 119 ? 93.655  23.311 -5.550  1.00 115.36 ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 119 ? 94.231  23.280 -4.169  1.00 115.86 ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 119 ? 93.417  22.206 -6.271  1.00 115.10 ? 119  DT  I C6    1 
ATOM   2428  P P     . DT  A 1 120 ? 92.482  17.955 -10.563 1.00 103.10 ? 120  DT  I P     1 
ATOM   2429  O OP1   . DT  A 1 120 ? 91.081  17.579 -10.222 1.00 102.29 ? 120  DT  I OP1   1 
ATOM   2430  O OP2   . DT  A 1 120 ? 93.181  17.251 -11.665 1.00 102.52 ? 120  DT  I OP2   1 
ATOM   2431  O "O5'" . DT  A 1 120 ? 92.555  19.511 -10.899 1.00 101.98 ? 120  DT  I "O5'" 1 
ATOM   2432  C "C5'" . DT  A 1 120 ? 91.467  20.157 -11.564 1.00 98.57  ? 120  DT  I "C5'" 1 
ATOM   2433  C "C4'" . DT  A 1 120 ? 91.975  21.221 -12.507 1.00 95.72  ? 120  DT  I "C4'" 1 
ATOM   2434  O "O4'" . DT  A 1 120 ? 92.548  22.316 -11.757 1.00 95.56  ? 120  DT  I "O4'" 1 
ATOM   2435  C "C3'" . DT  A 1 120 ? 93.058  20.761 -13.483 1.00 94.84  ? 120  DT  I "C3'" 1 
ATOM   2436  O "O3'" . DT  A 1 120 ? 92.879  21.447 -14.727 1.00 92.69  ? 120  DT  I "O3'" 1 
ATOM   2437  C "C2'" . DT  A 1 120 ? 94.331  21.262 -12.824 1.00 95.89  ? 120  DT  I "C2'" 1 
ATOM   2438  C "C1'" . DT  A 1 120 ? 93.858  22.576 -12.230 1.00 96.07  ? 120  DT  I "C1'" 1 
ATOM   2439  N N1    . DT  A 1 120 ? 94.648  23.108 -11.104 1.00 95.66  ? 120  DT  I N1    1 
ATOM   2440  C C2    . DT  A 1 120 ? 94.757  24.472 -10.998 1.00 95.53  ? 120  DT  I C2    1 
ATOM   2441  O O2    . DT  A 1 120 ? 94.311  25.235 -11.825 1.00 94.23  ? 120  DT  I O2    1 
ATOM   2442  N N3    . DT  A 1 120 ? 95.422  24.912 -9.886  1.00 96.57  ? 120  DT  I N3    1 
ATOM   2443  C C4    . DT  A 1 120 ? 96.000  24.142 -8.902  1.00 97.23  ? 120  DT  I C4    1 
ATOM   2444  O O4    . DT  A 1 120 ? 96.533  24.688 -7.936  1.00 97.09  ? 120  DT  I O4    1 
ATOM   2445  C C5    . DT  A 1 120 ? 95.905  22.710 -9.109  1.00 96.77  ? 120  DT  I C5    1 
ATOM   2446  C C7    . DT  A 1 120 ? 96.566  21.788 -8.136  1.00 96.46  ? 120  DT  I C7    1 
ATOM   2447  C C6    . DT  A 1 120 ? 95.233  22.272 -10.180 1.00 96.35  ? 120  DT  I C6    1 
ATOM   2448  P P     . DG  A 1 121 ? 92.724  20.620 -16.095 1.00 100.99 ? 121  DG  I P     1 
ATOM   2449  O OP1   . DG  A 1 121 ? 91.526  19.739 -16.044 1.00 100.58 ? 121  DG  I OP1   1 
ATOM   2450  O OP2   . DG  A 1 121 ? 94.052  20.036 -16.406 1.00 100.54 ? 121  DG  I OP2   1 
ATOM   2451  O "O5'" . DG  A 1 121 ? 92.439  21.760 -17.169 1.00 96.76  ? 121  DG  I "O5'" 1 
ATOM   2452  C "C5'" . DG  A 1 121 ? 91.506  22.806 -16.906 1.00 92.47  ? 121  DG  I "C5'" 1 
ATOM   2453  C "C4'" . DG  A 1 121 ? 92.159  24.151 -17.123 1.00 89.29  ? 121  DG  I "C4'" 1 
ATOM   2454  O "O4'" . DG  A 1 121 ? 93.145  24.360 -16.090 1.00 89.83  ? 121  DG  I "O4'" 1 
ATOM   2455  C "C3'" . DG  A 1 121 ? 92.899  24.302 -18.450 1.00 87.09  ? 121  DG  I "C3'" 1 
ATOM   2456  O "O3'" . DG  A 1 121 ? 92.789  25.638 -18.930 1.00 82.33  ? 121  DG  I "O3'" 1 
ATOM   2457  C "C2'" . DG  A 1 121 ? 94.341  24.002 -18.089 1.00 88.68  ? 121  DG  I "C2'" 1 
ATOM   2458  C "C1'" . DG  A 1 121 ? 94.448  24.472 -16.647 1.00 90.69  ? 121  DG  I "C1'" 1 
ATOM   2459  N N9    . DG  A 1 121 ? 95.347  23.647 -15.842 1.00 93.46  ? 121  DG  I N9    1 
ATOM   2460  C C8    . DG  A 1 121 ? 95.564  22.295 -15.979 1.00 92.77  ? 121  DG  I C8    1 
ATOM   2461  N N7    . DG  A 1 121 ? 96.435  21.824 -15.129 1.00 93.48  ? 121  DG  I N7    1 
ATOM   2462  C C5    . DG  A 1 121 ? 96.815  22.928 -14.382 1.00 94.75  ? 121  DG  I C5    1 
ATOM   2463  C C6    . DG  A 1 121 ? 97.738  23.031 -13.323 1.00 95.46  ? 121  DG  I C6    1 
ATOM   2464  O O6    . DG  A 1 121 ? 98.442  22.137 -12.829 1.00 96.91  ? 121  DG  I O6    1 
ATOM   2465  N N1    . DG  A 1 121 ? 97.812  24.337 -12.840 1.00 94.43  ? 121  DG  I N1    1 
ATOM   2466  C C2    . DG  A 1 121 ? 97.093  25.406 -13.335 1.00 94.20  ? 121  DG  I C2    1 
ATOM   2467  N N2    . DG  A 1 121 ? 97.294  26.595 -12.751 1.00 93.15  ? 121  DG  I N2    1 
ATOM   2468  N N3    . DG  A 1 121 ? 96.241  25.317 -14.333 1.00 94.25  ? 121  DG  I N3    1 
ATOM   2469  C C4    . DG  A 1 121 ? 96.149  24.061 -14.805 1.00 94.58  ? 121  DG  I C4    1 
ATOM   2470  P P     . DG  A 1 122 ? 93.240  25.990 -20.435 1.00 46.89  ? 122  DG  I P     1 
ATOM   2471  O OP1   . DG  A 1 122 ? 92.000  26.365 -21.160 1.00 82.38  ? 122  DG  I OP1   1 
ATOM   2472  O OP2   . DG  A 1 122 ? 94.124  24.931 -20.979 1.00 81.44  ? 122  DG  I OP2   1 
ATOM   2473  O "O5'" . DG  A 1 122 ? 94.148  27.285 -20.266 1.00 47.00  ? 122  DG  I "O5'" 1 
ATOM   2474  C "C5'" . DG  A 1 122 ? 93.726  28.397 -19.464 1.00 54.25  ? 122  DG  I "C5'" 1 
ATOM   2475  C "C4'" . DG  A 1 122 ? 94.908  29.277 -19.114 1.00 58.49  ? 122  DG  I "C4'" 1 
ATOM   2476  O "O4'" . DG  A 1 122 ? 95.675  28.731 -18.018 1.00 59.12  ? 122  DG  I "O4'" 1 
ATOM   2477  C "C3'" . DG  A 1 122 ? 95.920  29.534 -20.233 1.00 62.37  ? 122  DG  I "C3'" 1 
ATOM   2478  O "O3'" . DG  A 1 122 ? 96.247  30.915 -20.245 1.00 66.32  ? 122  DG  I "O3'" 1 
ATOM   2479  C "C2'" . DG  A 1 122 ? 97.137  28.717 -19.826 1.00 61.04  ? 122  DG  I "C2'" 1 
ATOM   2480  C "C1'" . DG  A 1 122 ? 97.060  28.823 -18.326 1.00 60.61  ? 122  DG  I "C1'" 1 
ATOM   2481  N N9    . DG  A 1 122 ? 97.763  27.787 -17.576 1.00 96.02  ? 122  DG  I N9    1 
ATOM   2482  C C8    . DG  A 1 122 ? 97.801  26.442 -17.844 1.00 97.35  ? 122  DG  I C8    1 
ATOM   2483  N N7    . DG  A 1 122 ? 98.505  25.765 -16.977 1.00 98.33  ? 122  DG  I N7    1 
ATOM   2484  C C5    . DG  A 1 122 ? 98.962  26.722 -16.087 1.00 96.82  ? 122  DG  I C5    1 
ATOM   2485  C C6    . DG  A 1 122 ? 99.765  26.584 -14.950 1.00 98.13  ? 122  DG  I C6    1 
ATOM   2486  O O6    . DG  A 1 122 ? 100.265 25.547 -14.484 1.00 96.23  ? 122  DG  I O6    1 
ATOM   2487  N N1    . DG  A 1 122 ? 99.982  27.812 -14.326 1.00 96.84  ? 122  DG  I N1    1 
ATOM   2488  C C2    . DG  A 1 122 ? 99.491  29.017 -14.755 1.00 97.31  ? 122  DG  I C2    1 
ATOM   2489  N N2    . DG  A 1 122 ? 99.804  30.089 -14.013 1.00 96.80  ? 122  DG  I N2    1 
ATOM   2490  N N3    . DG  A 1 122 ? 98.746  29.160 -15.830 1.00 97.45  ? 122  DG  I N3    1 
ATOM   2491  C C4    . DG  A 1 122 ? 98.517  27.977 -16.442 1.00 97.24  ? 122  DG  I C4    1 
ATOM   2492  P P     . DT  A 1 123 ? 97.433  31.438 -21.173 1.00 94.90  ? 123  DT  I P     1 
ATOM   2493  O OP1   . DT  A 1 123 ? 97.021  32.766 -21.688 1.00 78.85  ? 123  DT  I OP1   1 
ATOM   2494  O OP2   . DT  A 1 123 ? 97.818  30.366 -22.122 1.00 78.69  ? 123  DT  I OP2   1 
ATOM   2495  O "O5'" . DT  A 1 123 ? 98.619  31.620 -20.127 1.00 100.23 ? 123  DT  I "O5'" 1 
ATOM   2496  C "C5'" . DT  A 1 123 ? 98.442  32.419 -18.952 1.00 105.14 ? 123  DT  I "C5'" 1 
ATOM   2497  C "C4'" . DT  A 1 123 ? 99.783  32.749 -18.344 1.00 108.70 ? 123  DT  I "C4'" 1 
ATOM   2498  O "O4'" . DT  A 1 123 ? 100.324 31.553 -17.745 1.00 108.47 ? 123  DT  I "O4'" 1 
ATOM   2499  C "C3'" . DT  A 1 123 ? 100.823 33.232 -19.358 1.00 111.40 ? 123  DT  I "C3'" 1 
ATOM   2500  O "O3'" . DT  A 1 123 ? 101.593 34.321 -18.828 1.00 116.36 ? 123  DT  I "O3'" 1 
ATOM   2501  C "C2'" . DT  A 1 123 ? 101.669 31.999 -19.627 1.00 109.56 ? 123  DT  I "C2'" 1 
ATOM   2502  C "C1'" . DT  A 1 123 ? 101.573 31.219 -18.327 1.00 107.67 ? 123  DT  I "C1'" 1 
ATOM   2503  N N1    . DT  A 1 123 ? 101.603 29.755 -18.481 1.00 90.29  ? 123  DT  I N1    1 
ATOM   2504  C C2    . DT  A 1 123 ? 102.209 29.016 -17.489 1.00 89.61  ? 123  DT  I C2    1 
ATOM   2505  O O2    . DT  A 1 123 ? 102.719 29.530 -16.509 1.00 89.26  ? 123  DT  I O2    1 
ATOM   2506  N N3    . DT  A 1 123 ? 102.192 27.646 -17.687 1.00 87.58  ? 123  DT  I N3    1 
ATOM   2507  C C4    . DT  A 1 123 ? 101.631 26.965 -18.753 1.00 87.50  ? 123  DT  I C4    1 
ATOM   2508  O O4    . DT  A 1 123 ? 101.691 25.738 -18.799 1.00 85.45  ? 123  DT  I O4    1 
ATOM   2509  C C5    . DT  A 1 123 ? 101.001 27.809 -19.754 1.00 87.93  ? 123  DT  I C5    1 
ATOM   2510  C C7    . DT  A 1 123 ? 100.342 27.167 -20.932 1.00 88.14  ? 123  DT  I C7    1 
ATOM   2511  C C6    . DT  A 1 123 ? 101.030 29.142 -19.576 1.00 88.87  ? 123  DT  I C6    1 
ATOM   2512  P P     . DA  A 1 124 ? 102.545 35.182 -19.800 1.00 128.26 ? 124  DA  I P     1 
ATOM   2513  O OP1   . DA  A 1 124 ? 102.295 36.635 -19.606 1.00 81.33  ? 124  DA  I OP1   1 
ATOM   2514  O OP2   . DA  A 1 124 ? 102.503 34.608 -21.165 1.00 82.12  ? 124  DA  I OP2   1 
ATOM   2515  O "O5'" . DA  A 1 124 ? 103.976 34.858 -19.215 1.00 131.45 ? 124  DA  I "O5'" 1 
ATOM   2516  C "C5'" . DA  A 1 124 ? 104.186 34.853 -17.815 1.00 135.14 ? 124  DA  I "C5'" 1 
ATOM   2517  C "C4'" . DA  A 1 124 ? 105.505 34.194 -17.517 1.00 137.81 ? 124  DA  I "C4'" 1 
ATOM   2518  O "O4'" . DA  A 1 124 ? 105.347 32.754 -17.457 1.00 136.67 ? 124  DA  I "O4'" 1 
ATOM   2519  C "C3'" . DA  A 1 124 ? 106.523 34.470 -18.624 1.00 140.47 ? 124  DA  I "C3'" 1 
ATOM   2520  O "O3'" . DA  A 1 124 ? 107.782 34.814 -18.056 1.00 145.44 ? 124  DA  I "O3'" 1 
ATOM   2521  C "C2'" . DA  A 1 124 ? 106.593 33.154 -19.380 1.00 138.86 ? 124  DA  I "C2'" 1 
ATOM   2522  C "C1'" . DA  A 1 124 ? 106.333 32.154 -18.274 1.00 136.62 ? 124  DA  I "C1'" 1 
ATOM   2523  N N9    . DA  A 1 124 ? 105.848 30.842 -18.708 1.00 88.06  ? 124  DA  I N9    1 
ATOM   2524  C C8    . DA  A 1 124 ? 105.189 30.515 -19.866 1.00 87.25  ? 124  DA  I C8    1 
ATOM   2525  N N7    . DA  A 1 124 ? 104.926 29.235 -19.985 1.00 86.45  ? 124  DA  I N7    1 
ATOM   2526  C C5    . DA  A 1 124 ? 105.440 28.682 -18.821 1.00 86.57  ? 124  DA  I C5    1 
ATOM   2527  C C6    . DA  A 1 124 ? 105.485 27.357 -18.339 1.00 86.34  ? 124  DA  I C6    1 
ATOM   2528  N N6    . DA  A 1 124 ? 104.988 26.311 -18.997 1.00 86.40  ? 124  DA  I N6    1 
ATOM   2529  N N1    . DA  A 1 124 ? 106.068 27.147 -17.137 1.00 86.23  ? 124  DA  I N1    1 
ATOM   2530  C C2    . DA  A 1 124 ? 106.564 28.204 -16.471 1.00 85.48  ? 124  DA  I C2    1 
ATOM   2531  N N3    . DA  A 1 124 ? 106.580 29.488 -16.818 1.00 85.77  ? 124  DA  I N3    1 
ATOM   2532  C C4    . DA  A 1 124 ? 105.999 29.663 -18.020 1.00 86.79  ? 124  DA  I C4    1 
ATOM   2533  P P     . DG  A 1 125 ? 109.024 35.153 -19.015 1.00 160.76 ? 125  DG  I P     1 
ATOM   2534  O OP1   . DG  A 1 125 ? 109.584 36.447 -18.554 1.00 135.73 ? 125  DG  I OP1   1 
ATOM   2535  O OP2   . DG  A 1 125 ? 108.648 34.983 -20.444 1.00 135.03 ? 125  DG  I OP2   1 
ATOM   2536  O "O5'" . DG  A 1 125 ? 110.045 34.000 -18.637 1.00 161.78 ? 125  DG  I "O5'" 1 
ATOM   2537  C "C5'" . DG  A 1 125 ? 110.283 33.674 -17.272 1.00 163.64 ? 125  DG  I "C5'" 1 
ATOM   2538  C "C4'" . DG  A 1 125 ? 111.343 32.609 -17.195 1.00 164.96 ? 125  DG  I "C4'" 1 
ATOM   2539  O "O4'" . DG  A 1 125 ? 110.751 31.315 -17.462 1.00 164.76 ? 125  DG  I "O4'" 1 
ATOM   2540  C "C3'" . DG  A 1 125 ? 112.400 32.825 -18.272 1.00 166.16 ? 125  DG  I "C3'" 1 
ATOM   2541  O "O3'" . DG  A 1 125 ? 113.696 32.515 -17.779 1.00 168.34 ? 125  DG  I "O3'" 1 
ATOM   2542  C "C2'" . DG  A 1 125 ? 111.978 31.875 -19.378 1.00 165.70 ? 125  DG  I "C2'" 1 
ATOM   2543  C "C1'" . DG  A 1 125 ? 111.346 30.731 -18.607 1.00 164.91 ? 125  DG  I "C1'" 1 
ATOM   2544  N N9    . DG  A 1 125 ? 110.301 30.029 -19.339 1.00 139.25 ? 125  DG  I N9    1 
ATOM   2545  C C8    . DG  A 1 125 ? 109.546 30.513 -20.382 1.00 139.16 ? 125  DG  I C8    1 
ATOM   2546  N N7    . DG  A 1 125 ? 108.683 29.644 -20.836 1.00 139.32 ? 125  DG  I N7    1 
ATOM   2547  C C5    . DG  A 1 125 ? 108.880 28.519 -20.047 1.00 139.40 ? 125  DG  I C5    1 
ATOM   2548  C C6    . DG  A 1 125 ? 108.232 27.252 -20.069 1.00 139.35 ? 125  DG  I C6    1 
ATOM   2549  O O6    . DG  A 1 125 ? 107.324 26.862 -20.813 1.00 139.46 ? 125  DG  I O6    1 
ATOM   2550  N N1    . DG  A 1 125 ? 108.742 26.401 -19.094 1.00 138.82 ? 125  DG  I N1    1 
ATOM   2551  C C2    . DG  A 1 125 ? 109.745 26.723 -18.207 1.00 138.45 ? 125  DG  I C2    1 
ATOM   2552  N N2    . DG  A 1 125 ? 110.097 25.766 -17.336 1.00 137.86 ? 125  DG  I N2    1 
ATOM   2553  N N3    . DG  A 1 125 ? 110.356 27.899 -18.177 1.00 138.63 ? 125  DG  I N3    1 
ATOM   2554  C C4    . DG  A 1 125 ? 109.876 28.741 -19.117 1.00 139.17 ? 125  DG  I C4    1 
ATOM   2555  P P     . DA  A 1 126 ? 114.882 32.244 -18.817 1.00 145.85 ? 126  DA  I P     1 
ATOM   2556  O OP1   . DA  A 1 126 ? 116.157 32.458 -18.083 1.00 142.86 ? 126  DA  I OP1   1 
ATOM   2557  O OP2   . DA  A 1 126 ? 114.599 33.021 -20.055 1.00 142.42 ? 126  DA  I OP2   1 
ATOM   2558  O "O5'" . DA  A 1 126 ? 114.725 30.690 -19.125 1.00 146.47 ? 126  DA  I "O5'" 1 
ATOM   2559  C "C5'" . DA  A 1 126 ? 114.711 29.754 -18.052 1.00 147.75 ? 126  DA  I "C5'" 1 
ATOM   2560  C "C4'" . DA  A 1 126 ? 115.245 28.422 -18.517 1.00 148.37 ? 126  DA  I "C4'" 1 
ATOM   2561  O "O4'" . DA  A 1 126 ? 114.165 27.544 -18.909 1.00 148.22 ? 126  DA  I "O4'" 1 
ATOM   2562  C "C3'" . DA  A 1 126 ? 116.192 28.513 -19.714 1.00 149.05 ? 126  DA  I "C3'" 1 
ATOM   2563  O "O3'" . DA  A 1 126 ? 117.310 27.639 -19.510 1.00 150.28 ? 126  DA  I "O3'" 1 
ATOM   2564  C "C2'" . DA  A 1 126 ? 115.323 28.057 -20.874 1.00 148.67 ? 126  DA  I "C2'" 1 
ATOM   2565  C "C1'" . DA  A 1 126 ? 114.415 27.039 -20.208 1.00 148.35 ? 126  DA  I "C1'" 1 
ATOM   2566  N N9    . DA  A 1 126 ? 113.124 26.840 -20.867 1.00 145.23 ? 126  DA  I N9    1 
ATOM   2567  C C8    . DA  A 1 126 ? 112.368 27.760 -21.555 1.00 144.99 ? 126  DA  I C8    1 
ATOM   2568  N N7    . DA  A 1 126 ? 111.247 27.272 -22.032 1.00 144.82 ? 126  DA  I N7    1 
ATOM   2569  C C5    . DA  A 1 126 ? 111.266 25.941 -21.633 1.00 144.94 ? 126  DA  I C5    1 
ATOM   2570  C C6    . DA  A 1 126 ? 110.361 24.880 -21.823 1.00 144.88 ? 126  DA  I C6    1 
ATOM   2571  N N6    . DA  A 1 126 ? 109.213 24.995 -22.492 1.00 144.84 ? 126  DA  I N6    1 
ATOM   2572  N N1    . DA  A 1 126 ? 110.680 23.679 -21.298 1.00 144.86 ? 126  DA  I N1    1 
ATOM   2573  C C2    . DA  A 1 126 ? 111.829 23.561 -20.630 1.00 144.66 ? 126  DA  I C2    1 
ATOM   2574  N N3    . DA  A 1 126 ? 112.762 24.479 -20.383 1.00 144.67 ? 126  DA  I N3    1 
ATOM   2575  C C4    . DA  A 1 126 ? 112.416 25.662 -20.917 1.00 145.00 ? 126  DA  I C4    1 
ATOM   2576  P P     . DA  A 1 127 ? 118.382 27.409 -20.689 1.00 145.86 ? 127  DA  I P     1 
ATOM   2577  O OP1   . DA  A 1 127 ? 119.743 27.494 -20.100 1.00 139.91 ? 127  DA  I OP1   1 
ATOM   2578  O OP2   . DA  A 1 127 ? 118.018 28.306 -21.823 1.00 139.33 ? 127  DA  I OP2   1 
ATOM   2579  O "O5'" . DA  A 1 127 ? 118.111 25.892 -21.097 1.00 145.78 ? 127  DA  I "O5'" 1 
ATOM   2580  C "C5'" . DA  A 1 127 ? 117.912 24.905 -20.085 1.00 145.07 ? 127  DA  I "C5'" 1 
ATOM   2581  C "C4'" . DA  A 1 127 ? 117.548 23.578 -20.705 1.00 144.67 ? 127  DA  I "C4'" 1 
ATOM   2582  O "O4'" . DA  A 1 127 ? 116.171 23.589 -21.158 1.00 145.09 ? 127  DA  I "O4'" 1 
ATOM   2583  C "C3'" . DA  A 1 127 ? 118.397 23.186 -21.916 1.00 144.28 ? 127  DA  I "C3'" 1 
ATOM   2584  O "O3'" . DA  A 1 127 ? 118.741 21.800 -21.840 1.00 142.63 ? 127  DA  I "O3'" 1 
ATOM   2585  C "C2'" . DA  A 1 127 ? 117.475 23.451 -23.092 1.00 144.71 ? 127  DA  I "C2'" 1 
ATOM   2586  C "C1'" . DA  A 1 127 ? 116.109 23.142 -22.505 1.00 145.23 ? 127  DA  I "C1'" 1 
ATOM   2587  N N9    . DA  A 1 127 ? 115.002 23.834 -23.174 1.00 139.02 ? 127  DA  I N9    1 
ATOM   2588  C C8    . DA  A 1 127 ? 114.946 25.153 -23.567 1.00 138.86 ? 127  DA  I C8    1 
ATOM   2589  N N7    . DA  A 1 127 ? 113.832 25.476 -24.178 1.00 138.67 ? 127  DA  I N7    1 
ATOM   2590  C C5    . DA  A 1 127 ? 113.098 24.295 -24.182 1.00 138.42 ? 127  DA  I C5    1 
ATOM   2591  C C6    . DA  A 1 127 ? 111.828 23.971 -24.693 1.00 137.81 ? 127  DA  I C6    1 
ATOM   2592  N N6    . DA  A 1 127 ? 111.041 24.840 -25.331 1.00 137.38 ? 127  DA  I N6    1 
ATOM   2593  N N1    . DA  A 1 127 ? 111.390 22.704 -24.530 1.00 137.38 ? 127  DA  I N1    1 
ATOM   2594  C C2    . DA  A 1 127 ? 112.183 21.827 -23.902 1.00 137.49 ? 127  DA  I C2    1 
ATOM   2595  N N3    . DA  A 1 127 ? 113.396 22.006 -23.387 1.00 138.15 ? 127  DA  I N3    1 
ATOM   2596  C C4    . DA  A 1 127 ? 113.803 23.277 -23.560 1.00 138.67 ? 127  DA  I C4    1 
ATOM   2597  P P     . DT  A 1 128 ? 119.392 21.059 -23.113 1.00 199.50 ? 128  DT  I P     1 
ATOM   2598  O OP1   . DT  A 1 128 ? 120.360 20.067 -22.581 1.00 100.69 ? 128  DT  I OP1   1 
ATOM   2599  O OP2   . DT  A 1 128 ? 119.846 22.054 -24.124 1.00 101.59 ? 128  DT  I OP2   1 
ATOM   2600  O "O5'" . DT  A 1 128 ? 118.159 20.242 -23.700 1.00 199.50 ? 128  DT  I "O5'" 1 
ATOM   2601  C "C5'" . DT  A 1 128 ? 117.399 19.394 -22.842 1.00 198.17 ? 128  DT  I "C5'" 1 
ATOM   2602  C "C4'" . DT  A 1 128 ? 116.482 18.507 -23.649 1.00 196.39 ? 128  DT  I "C4'" 1 
ATOM   2603  O "O4'" . DT  A 1 128 ? 115.351 19.267 -24.140 1.00 196.05 ? 128  DT  I "O4'" 1 
ATOM   2604  C "C3'" . DT  A 1 128 ? 117.130 17.859 -24.870 1.00 195.38 ? 128  DT  I "C3'" 1 
ATOM   2605  O "O3'" . DT  A 1 128 ? 116.701 16.497 -24.969 1.00 194.00 ? 128  DT  I "O3'" 1 
ATOM   2606  C "C2'" . DT  A 1 128 ? 116.614 18.696 -26.028 1.00 195.31 ? 128  DT  I "C2'" 1 
ATOM   2607  C "C1'" . DT  A 1 128 ? 115.230 19.106 -25.545 1.00 195.66 ? 128  DT  I "C1'" 1 
ATOM   2608  N N1    . DT  A 1 128 ? 114.716 20.379 -26.104 1.00 95.41  ? 128  DT  I N1    1 
ATOM   2609  C C2    . DT  A 1 128 ? 113.393 20.434 -26.547 1.00 94.94  ? 128  DT  I C2    1 
ATOM   2610  O O2    . DT  A 1 128 ? 112.633 19.471 -26.554 1.00 94.43  ? 128  DT  I O2    1 
ATOM   2611  N N3    . DT  A 1 128 ? 112.995 21.669 -26.999 1.00 94.63  ? 128  DT  I N3    1 
ATOM   2612  C C4    . DT  A 1 128 ? 113.760 22.820 -27.078 1.00 94.52  ? 128  DT  I C4    1 
ATOM   2613  O O4    . DT  A 1 128 ? 113.254 23.857 -27.493 1.00 93.67  ? 128  DT  I O4    1 
ATOM   2614  C C5    . DT  A 1 128 ? 115.139 22.685 -26.637 1.00 94.66  ? 128  DT  I C5    1 
ATOM   2615  C C7    . DT  A 1 128 ? 116.048 23.872 -26.723 1.00 94.73  ? 128  DT  I C7    1 
ATOM   2616  C C6    . DT  A 1 128 ? 115.540 21.489 -26.171 1.00 95.12  ? 128  DT  I C6    1 
ATOM   2617  P P     . DC  A 1 129 ? 117.117 15.620 -26.248 1.00 143.32 ? 129  DC  I P     1 
ATOM   2618  O OP1   . DC  A 1 129 ? 117.191 14.195 -25.825 1.00 135.66 ? 129  DC  I OP1   1 
ATOM   2619  O OP2   . DC  A 1 129 ? 118.293 16.260 -26.894 1.00 136.40 ? 129  DC  I OP2   1 
ATOM   2620  O "O5'" . DC  A 1 129 ? 115.864 15.783 -27.220 1.00 140.86 ? 129  DC  I "O5'" 1 
ATOM   2621  C "C5'" . DC  A 1 129 ? 114.536 15.508 -26.757 1.00 134.87 ? 129  DC  I "C5'" 1 
ATOM   2622  C "C4'" . DC  A 1 129 ? 113.525 15.708 -27.866 1.00 130.63 ? 129  DC  I "C4'" 1 
ATOM   2623  O "O4'" . DC  A 1 129 ? 113.361 17.114 -28.171 1.00 129.55 ? 129  DC  I "O4'" 1 
ATOM   2624  C "C3'" . DC  A 1 129 ? 113.850 15.025 -29.195 1.00 127.08 ? 129  DC  I "C3'" 1 
ATOM   2625  O "O3'" . DC  A 1 129 ? 112.649 14.522 -29.776 1.00 121.47 ? 129  DC  I "O3'" 1 
ATOM   2626  C "C2'" . DC  A 1 129 ? 114.369 16.163 -30.050 1.00 127.02 ? 129  DC  I "C2'" 1 
ATOM   2627  C "C1'" . DC  A 1 129 ? 113.499 17.307 -29.569 1.00 127.93 ? 129  DC  I "C1'" 1 
ATOM   2628  N N1    . DC  A 1 129 ? 114.046 18.653 -29.784 1.00 119.54 ? 129  DC  I N1    1 
ATOM   2629  C C2    . DC  A 1 129 ? 113.308 19.575 -30.546 1.00 119.01 ? 129  DC  I C2    1 
ATOM   2630  O O2    . DC  A 1 129 ? 112.228 19.223 -31.052 1.00 118.80 ? 129  DC  I O2    1 
ATOM   2631  N N3    . DC  A 1 129 ? 113.788 20.823 -30.712 1.00 118.32 ? 129  DC  I N3    1 
ATOM   2632  C C4    . DC  A 1 129 ? 114.951 21.168 -30.158 1.00 118.08 ? 129  DC  I C4    1 
ATOM   2633  N N4    . DC  A 1 129 ? 115.372 22.423 -30.324 1.00 117.74 ? 129  DC  I N4    1 
ATOM   2634  C C5    . DC  A 1 129 ? 115.730 20.246 -29.401 1.00 118.03 ? 129  DC  I C5    1 
ATOM   2635  C C6    . DC  A 1 129 ? 115.244 19.011 -29.241 1.00 118.90 ? 129  DC  I C6    1 
ATOM   2636  P P     . DT  A 1 130 ? 112.671 13.112 -30.536 1.00 103.40 ? 130  DT  I P     1 
ATOM   2637  O OP1   . DT  A 1 130 ? 112.057 12.056 -29.692 1.00 100.89 ? 130  DT  I OP1   1 
ATOM   2638  O OP2   . DT  A 1 130 ? 114.041 12.936 -31.078 1.00 101.51 ? 130  DT  I OP2   1 
ATOM   2639  O "O5'" . DT  A 1 130 ? 111.729 13.331 -31.788 1.00 100.32 ? 130  DT  I "O5'" 1 
ATOM   2640  C "C5'" . DT  A 1 130 ? 110.510 14.036 -31.670 1.00 93.07  ? 130  DT  I "C5'" 1 
ATOM   2641  C "C4'" . DT  A 1 130 ? 110.271 14.815 -32.937 1.00 88.15  ? 130  DT  I "C4'" 1 
ATOM   2642  O "O4'" . DT  A 1 130 ? 111.039 16.037 -32.919 1.00 87.03  ? 130  DT  I "O4'" 1 
ATOM   2643  C "C3'" . DT  A 1 130 ? 110.713 14.065 -34.194 1.00 84.48  ? 130  DT  I "C3'" 1 
ATOM   2644  O "O3'" . DT  A 1 130 ? 109.718 14.212 -35.191 1.00 78.90  ? 130  DT  I "O3'" 1 
ATOM   2645  C "C2'" . DT  A 1 130 ? 111.964 14.812 -34.626 1.00 85.45  ? 130  DT  I "C2'" 1 
ATOM   2646  C "C1'" . DT  A 1 130 ? 111.597 16.206 -34.197 1.00 87.99  ? 130  DT  I "C1'" 1 
ATOM   2647  N N1    . DT  A 1 130 ? 112.667 17.189 -34.090 1.00 88.27  ? 130  DT  I N1    1 
ATOM   2648  C C2    . DT  A 1 130 ? 112.509 18.367 -34.778 1.00 89.71  ? 130  DT  I C2    1 
ATOM   2649  O O2    . DT  A 1 130 ? 111.555 18.590 -35.511 1.00 89.59  ? 130  DT  I O2    1 
ATOM   2650  N N3    . DT  A 1 130 ? 113.519 19.283 -34.579 1.00 91.07  ? 130  DT  I N3    1 
ATOM   2651  C C4    . DT  A 1 130 ? 114.643 19.127 -33.792 1.00 91.46  ? 130  DT  I C4    1 
ATOM   2652  O O4    . DT  A 1 130 ? 115.453 20.039 -33.692 1.00 91.48  ? 130  DT  I O4    1 
ATOM   2653  C C5    . DT  A 1 130 ? 114.755 17.854 -33.137 1.00 90.95  ? 130  DT  I C5    1 
ATOM   2654  C C7    . DT  A 1 130 ? 115.957 17.587 -32.294 1.00 91.93  ? 130  DT  I C7    1 
ATOM   2655  C C6    . DT  A 1 130 ? 113.774 16.957 -33.314 1.00 89.87  ? 130  DT  I C6    1 
ATOM   2656  P P     . DG  A 1 131 ? 108.644 13.049 -35.418 1.00 77.50  ? 131  DG  I P     1 
ATOM   2657  O OP1   . DG  A 1 131 ? 107.882 12.900 -34.155 1.00 72.44  ? 131  DG  I OP1   1 
ATOM   2658  O OP2   . DG  A 1 131 ? 109.291 11.866 -36.035 1.00 73.75  ? 131  DG  I OP2   1 
ATOM   2659  O "O5'" . DG  A 1 131 ? 107.685 13.693 -36.508 1.00 77.77  ? 131  DG  I "O5'" 1 
ATOM   2660  C "C5'" . DG  A 1 131 ? 106.699 14.651 -36.141 1.00 71.65  ? 131  DG  I "C5'" 1 
ATOM   2661  C "C4'" . DG  A 1 131 ? 106.487 15.636 -37.264 1.00 69.91  ? 131  DG  I "C4'" 1 
ATOM   2662  O "O4'" . DG  A 1 131 ? 107.656 16.469 -37.365 1.00 67.82  ? 131  DG  I "O4'" 1 
ATOM   2663  C "C3'" . DG  A 1 131 ? 106.273 15.023 -38.645 1.00 67.64  ? 131  DG  I "C3'" 1 
ATOM   2664  O "O3'" . DG  A 1 131 ? 105.295 15.799 -39.362 1.00 64.09  ? 131  DG  I "O3'" 1 
ATOM   2665  C "C2'" . DG  A 1 131 ? 107.659 15.090 -39.264 1.00 67.00  ? 131  DG  I "C2'" 1 
ATOM   2666  C "C1'" . DG  A 1 131 ? 108.278 16.323 -38.623 1.00 69.03  ? 131  DG  I "C1'" 1 
ATOM   2667  N N9    . DG  A 1 131 ? 109.704 16.219 -38.359 1.00 67.15  ? 131  DG  I N9    1 
ATOM   2668  C C8    . DG  A 1 131 ? 110.384 15.103 -37.946 1.00 66.85  ? 131  DG  I C8    1 
ATOM   2669  N N7    . DG  A 1 131 ? 111.635 15.338 -37.668 1.00 66.40  ? 131  DG  I N7    1 
ATOM   2670  C C5    . DG  A 1 131 ? 111.797 16.686 -37.942 1.00 68.10  ? 131  DG  I C5    1 
ATOM   2671  C C6    . DG  A 1 131 ? 112.936 17.522 -37.808 1.00 68.43  ? 131  DG  I C6    1 
ATOM   2672  O O6    . DG  A 1 131 ? 114.057 17.235 -37.395 1.00 69.33  ? 131  DG  I O6    1 
ATOM   2673  N N1    . DG  A 1 131 ? 112.666 18.822 -38.199 1.00 68.65  ? 131  DG  I N1    1 
ATOM   2674  C C2    . DG  A 1 131 ? 111.457 19.273 -38.650 1.00 68.84  ? 131  DG  I C2    1 
ATOM   2675  N N2    . DG  A 1 131 ? 111.404 20.574 -38.976 1.00 68.31  ? 131  DG  I N2    1 
ATOM   2676  N N3    . DG  A 1 131 ? 110.377 18.506 -38.774 1.00 66.95  ? 131  DG  I N3    1 
ATOM   2677  C C4    . DG  A 1 131 ? 110.620 17.234 -38.402 1.00 67.47  ? 131  DG  I C4    1 
ATOM   2678  P P     . DC  A 1 132 ? 104.806 15.351 -40.825 1.00 68.25  ? 132  DC  I P     1 
ATOM   2679  O OP1   . DC  A 1 132 ? 103.366 15.687 -40.876 1.00 88.17  ? 132  DC  I OP1   1 
ATOM   2680  O OP2   . DC  A 1 132 ? 105.241 13.965 -41.098 1.00 88.83  ? 132  DC  I OP2   1 
ATOM   2681  O "O5'" . DC  A 1 132 ? 105.627 16.325 -41.789 1.00 67.38  ? 132  DC  I "O5'" 1 
ATOM   2682  C "C5'" . DC  A 1 132 ? 105.643 17.728 -41.528 1.00 68.67  ? 132  DC  I "C5'" 1 
ATOM   2683  C "C4'" . DC  A 1 132 ? 106.727 18.432 -42.313 1.00 72.21  ? 132  DC  I "C4'" 1 
ATOM   2684  O "O4'" . DC  A 1 132 ? 108.019 18.221 -41.707 1.00 71.63  ? 132  DC  I "O4'" 1 
ATOM   2685  C "C3'" . DC  A 1 132 ? 106.881 18.092 -43.800 1.00 71.55  ? 132  DC  I "C3'" 1 
ATOM   2686  O "O3'" . DC  A 1 132 ? 107.100 19.308 -44.549 1.00 73.31  ? 132  DC  I "O3'" 1 
ATOM   2687  C "C2'" . DC  A 1 132 ? 108.160 17.273 -43.821 1.00 71.64  ? 132  DC  I "C2'" 1 
ATOM   2688  C "C1'" . DC  A 1 132 ? 108.957 17.971 -42.734 1.00 72.73  ? 132  DC  I "C1'" 1 
ATOM   2689  N N1    . DC  A 1 132 ? 110.069 17.213 -42.146 1.00 92.54  ? 132  DC  I N1    1 
ATOM   2690  C C2    . DC  A 1 132 ? 111.278 17.864 -41.917 1.00 93.83  ? 132  DC  I C2    1 
ATOM   2691  O O2    . DC  A 1 132 ? 111.391 19.047 -42.249 1.00 91.95  ? 132  DC  I O2    1 
ATOM   2692  N N3    . DC  A 1 132 ? 112.293 17.191 -41.348 1.00 93.70  ? 132  DC  I N3    1 
ATOM   2693  C C4    . DC  A 1 132 ? 112.142 15.908 -41.031 1.00 94.70  ? 132  DC  I C4    1 
ATOM   2694  N N4    . DC  A 1 132 ? 113.180 15.270 -40.488 1.00 95.01  ? 132  DC  I N4    1 
ATOM   2695  C C5    . DC  A 1 132 ? 110.924 15.216 -41.259 1.00 93.23  ? 132  DC  I C5    1 
ATOM   2696  C C6    . DC  A 1 132 ? 109.922 15.900 -41.814 1.00 92.32  ? 132  DC  I C6    1 
ATOM   2697  P P     . DA  A 1 133 ? 105.910 19.946 -45.441 1.00 53.37  ? 133  DA  I P     1 
ATOM   2698  O OP1   . DA  A 1 133 ? 104.731 20.107 -44.554 1.00 60.00  ? 133  DA  I OP1   1 
ATOM   2699  O OP2   . DA  A 1 133 ? 105.778 19.138 -46.674 1.00 59.80  ? 133  DA  I OP2   1 
ATOM   2700  O "O5'" . DA  A 1 133 ? 106.476 21.389 -45.805 1.00 55.18  ? 133  DA  I "O5'" 1 
ATOM   2701  C "C5'" . DA  A 1 133 ? 107.021 22.231 -44.788 1.00 58.65  ? 133  DA  I "C5'" 1 
ATOM   2702  C "C4'" . DA  A 1 133 ? 108.328 22.837 -45.252 1.00 63.11  ? 133  DA  I "C4'" 1 
ATOM   2703  O "O4'" . DA  A 1 133 ? 109.453 21.949 -45.068 1.00 62.96  ? 133  DA  I "O4'" 1 
ATOM   2704  C "C3'" . DA  A 1 133 ? 108.368 23.220 -46.730 1.00 66.55  ? 133  DA  I "C3'" 1 
ATOM   2705  O "O3'" . DA  A 1 133 ? 109.335 24.268 -46.896 1.00 72.00  ? 133  DA  I "O3'" 1 
ATOM   2706  C "C2'" . DA  A 1 133 ? 108.898 21.953 -47.368 1.00 64.24  ? 133  DA  I "C2'" 1 
ATOM   2707  C "C1'" . DA  A 1 133 ? 109.957 21.541 -46.344 1.00 63.21  ? 133  DA  I "C1'" 1 
ATOM   2708  N N9    . DA  A 1 133 ? 110.188 20.106 -46.258 1.00 68.43  ? 133  DA  I N9    1 
ATOM   2709  C C8    . DA  A 1 133 ? 109.411 19.041 -46.672 1.00 67.75  ? 133  DA  I C8    1 
ATOM   2710  N N7    . DA  A 1 133 ? 109.879 17.880 -46.305 1.00 67.39  ? 133  DA  I N7    1 
ATOM   2711  C C5    . DA  A 1 133 ? 111.054 18.199 -45.625 1.00 66.25  ? 133  DA  I C5    1 
ATOM   2712  C C6    . DA  A 1 133 ? 112.009 17.420 -44.966 1.00 65.38  ? 133  DA  I C6    1 
ATOM   2713  N N6    . DA  A 1 133 ? 111.920 16.106 -44.837 1.00 65.36  ? 133  DA  I N6    1 
ATOM   2714  N N1    . DA  A 1 133 ? 113.068 18.053 -44.422 1.00 64.90  ? 133  DA  I N1    1 
ATOM   2715  C C2    . DA  A 1 133 ? 113.148 19.383 -44.526 1.00 64.81  ? 133  DA  I C2    1 
ATOM   2716  N N3    . DA  A 1 133 ? 112.309 20.228 -45.101 1.00 64.85  ? 133  DA  I N3    1 
ATOM   2717  C C4    . DA  A 1 133 ? 111.270 19.563 -45.633 1.00 67.11  ? 133  DA  I C4    1 
ATOM   2718  P P     . DG  A 1 134 ? 108.907 25.640 -47.594 1.00 102.28 ? 134  DG  I P     1 
ATOM   2719  O OP1   . DG  A 1 134 ? 108.590 26.611 -46.519 1.00 96.74  ? 134  DG  I OP1   1 
ATOM   2720  O OP2   . DG  A 1 134 ? 107.909 25.332 -48.652 1.00 94.83  ? 134  DG  I OP2   1 
ATOM   2721  O "O5'" . DG  A 1 134 ? 110.234 26.109 -48.312 1.00 104.00 ? 134  DG  I "O5'" 1 
ATOM   2722  C "C5'" . DG  A 1 134 ? 110.690 25.422 -49.458 1.00 105.97 ? 134  DG  I "C5'" 1 
ATOM   2723  C "C4'" . DG  A 1 134 ? 112.112 24.962 -49.253 1.00 106.30 ? 134  DG  I "C4'" 1 
ATOM   2724  O "O4'" . DG  A 1 134 ? 112.158 23.648 -48.636 1.00 105.00 ? 134  DG  I "O4'" 1 
ATOM   2725  C "C3'" . DG  A 1 134 ? 112.836 24.822 -50.584 1.00 107.15 ? 134  DG  I "C3'" 1 
ATOM   2726  O "O3'" . DG  A 1 134 ? 114.147 25.329 -50.470 1.00 109.90 ? 134  DG  I "O3'" 1 
ATOM   2727  C "C2'" . DG  A 1 134 ? 112.862 23.334 -50.850 1.00 104.90 ? 134  DG  I "C2'" 1 
ATOM   2728  C "C1'" . DG  A 1 134 ? 112.917 22.763 -49.454 1.00 102.25 ? 134  DG  I "C1'" 1 
ATOM   2729  N N9    . DG  A 1 134 ? 112.359 21.412 -49.356 1.00 91.76  ? 134  DG  I N9    1 
ATOM   2730  C C8    . DG  A 1 134 ? 111.086 20.981 -49.676 1.00 90.31  ? 134  DG  I C8    1 
ATOM   2731  N N7    . DG  A 1 134 ? 110.915 19.699 -49.489 1.00 86.99  ? 134  DG  I N7    1 
ATOM   2732  C C5    . DG  A 1 134 ? 112.144 19.263 -49.013 1.00 85.92  ? 134  DG  I C5    1 
ATOM   2733  C C6    . DG  A 1 134 ? 112.570 17.977 -48.623 1.00 83.36  ? 134  DG  I C6    1 
ATOM   2734  O O6    . DG  A 1 134 ? 111.926 16.930 -48.601 1.00 76.68  ? 134  DG  I O6    1 
ATOM   2735  N N1    . DG  A 1 134 ? 113.898 17.979 -48.220 1.00 83.63  ? 134  DG  I N1    1 
ATOM   2736  C C2    . DG  A 1 134 ? 114.716 19.081 -48.195 1.00 85.13  ? 134  DG  I C2    1 
ATOM   2737  N N2    . DG  A 1 134 ? 115.971 18.883 -47.783 1.00 85.47  ? 134  DG  I N2    1 
ATOM   2738  N N3    . DG  A 1 134 ? 114.332 20.288 -48.546 1.00 86.40  ? 134  DG  I N3    1 
ATOM   2739  C C4    . DG  A 1 134 ? 113.043 20.308 -48.937 1.00 88.50  ? 134  DG  I C4    1 
ATOM   2740  P P     . DG  A 1 135 ? 115.012 25.513 -51.789 1.00 110.07 ? 135  DG  I P     1 
ATOM   2741  O OP1   . DG  A 1 135 ? 115.887 26.691 -51.561 1.00 98.21  ? 135  DG  I OP1   1 
ATOM   2742  O OP2   . DG  A 1 135 ? 114.079 25.498 -52.943 1.00 97.49  ? 135  DG  I OP2   1 
ATOM   2743  O "O5'" . DG  A 1 135 ? 115.846 24.162 -51.833 1.00 109.63 ? 135  DG  I "O5'" 1 
ATOM   2744  C "C5'" . DG  A 1 135 ? 116.920 23.930 -50.930 1.00 108.55 ? 135  DG  I "C5'" 1 
ATOM   2745  C "C4'" . DG  A 1 135 ? 117.763 22.795 -51.452 1.00 108.06 ? 135  DG  I "C4'" 1 
ATOM   2746  O "O4'" . DG  A 1 135 ? 117.212 21.523 -51.019 1.00 106.99 ? 135  DG  I "O4'" 1 
ATOM   2747  C "C3'" . DG  A 1 135 ? 117.754 22.769 -52.981 1.00 108.26 ? 135  DG  I "C3'" 1 
ATOM   2748  O "O3'" . DG  A 1 135 ? 119.051 22.491 -53.502 1.00 110.36 ? 135  DG  I "O3'" 1 
ATOM   2749  C "C2'" . DG  A 1 135 ? 116.779 21.653 -53.309 1.00 106.81 ? 135  DG  I "C2'" 1 
ATOM   2750  C "C1'" . DG  A 1 135 ? 117.010 20.697 -52.153 1.00 104.88 ? 135  DG  I "C1'" 1 
ATOM   2751  N N9    . DG  A 1 135 ? 115.904 19.775 -51.892 1.00 89.13  ? 135  DG  I N9    1 
ATOM   2752  C C8    . DG  A 1 135 ? 114.583 19.983 -52.172 1.00 87.55  ? 135  DG  I C8    1 
ATOM   2753  N N7    . DG  A 1 135 ? 113.835 18.950 -51.909 1.00 86.46  ? 135  DG  I N7    1 
ATOM   2754  C C5    . DG  A 1 135 ? 114.712 18.003 -51.412 1.00 86.46  ? 135  DG  I C5    1 
ATOM   2755  C C6    . DG  A 1 135 ? 114.476 16.660 -50.975 1.00 86.05  ? 135  DG  I C6    1 
ATOM   2756  O O6    . DG  A 1 135 ? 113.414 16.030 -50.958 1.00 84.50  ? 135  DG  I O6    1 
ATOM   2757  N N1    . DG  A 1 135 ? 115.647 16.048 -50.532 1.00 86.48  ? 135  DG  I N1    1 
ATOM   2758  C C2    . DG  A 1 135 ? 116.880 16.642 -50.516 1.00 86.59  ? 135  DG  I C2    1 
ATOM   2759  N N2    . DG  A 1 135 ? 117.870 15.894 -50.034 1.00 86.48  ? 135  DG  I N2    1 
ATOM   2760  N N3    . DG  A 1 135 ? 117.118 17.884 -50.939 1.00 86.20  ? 135  DG  I N3    1 
ATOM   2761  C C4    . DG  A 1 135 ? 115.992 18.501 -51.368 1.00 87.67  ? 135  DG  I C4    1 
ATOM   2762  P P     . DT  A 1 136 ? 119.240 22.259 -55.083 1.00 114.30 ? 136  DT  I P     1 
ATOM   2763  O OP1   . DT  A 1 136 ? 120.417 23.049 -55.530 1.00 127.37 ? 136  DT  I OP1   1 
ATOM   2764  O OP2   . DT  A 1 136 ? 117.930 22.426 -55.771 1.00 127.45 ? 136  DT  I OP2   1 
ATOM   2765  O "O5'" . DT  A 1 136 ? 119.604 20.717 -55.167 1.00 113.77 ? 136  DT  I "O5'" 1 
ATOM   2766  C "C5'" . DT  A 1 136 ? 120.555 20.156 -54.271 1.00 113.57 ? 136  DT  I "C5'" 1 
ATOM   2767  C "C4'" . DT  A 1 136 ? 120.897 18.761 -54.718 1.00 114.30 ? 136  DT  I "C4'" 1 
ATOM   2768  O "O4'" . DT  A 1 136 ? 119.860 17.854 -54.281 1.00 112.72 ? 136  DT  I "O4'" 1 
ATOM   2769  C "C3'" . DT  A 1 136 ? 120.957 18.653 -56.242 1.00 114.90 ? 136  DT  I "C3'" 1 
ATOM   2770  O "O3'" . DT  A 1 136 ? 122.051 17.834 -56.657 1.00 117.42 ? 136  DT  I "O3'" 1 
ATOM   2771  C "C2'" . DT  A 1 136 ? 119.627 18.022 -56.602 1.00 114.21 ? 136  DT  I "C2'" 1 
ATOM   2772  C "C1'" . DT  A 1 136 ? 119.337 17.152 -55.394 1.00 112.60 ? 136  DT  I "C1'" 1 
ATOM   2773  N N1    . DT  A 1 136 ? 117.899 16.930 -55.162 1.00 124.14 ? 136  DT  I N1    1 
ATOM   2774  C C2    . DT  A 1 136 ? 117.497 15.735 -54.618 1.00 123.47 ? 136  DT  I C2    1 
ATOM   2775  O O2    . DT  A 1 136 ? 118.270 14.858 -54.296 1.00 123.16 ? 136  DT  I O2    1 
ATOM   2776  N N3    . DT  A 1 136 ? 116.146 15.604 -54.462 1.00 122.35 ? 136  DT  I N3    1 
ATOM   2777  C C4    . DT  A 1 136 ? 115.178 16.530 -54.782 1.00 122.96 ? 136  DT  I C4    1 
ATOM   2778  O O4    . DT  A 1 136 ? 113.999 16.269 -54.582 1.00 123.31 ? 136  DT  I O4    1 
ATOM   2779  C C5    . DT  A 1 136 ? 115.670 17.767 -55.342 1.00 122.94 ? 136  DT  I C5    1 
ATOM   2780  C C7    . DT  A 1 136 ? 114.695 18.835 -55.724 1.00 122.49 ? 136  DT  I C7    1 
ATOM   2781  C C6    . DT  A 1 136 ? 116.987 17.903 -55.498 1.00 122.98 ? 136  DT  I C6    1 
ATOM   2782  P P     . DG  A 1 137 ? 122.069 17.222 -58.142 1.00 124.56 ? 137  DG  I P     1 
ATOM   2783  O OP1   . DG  A 1 137 ? 123.480 17.040 -58.561 1.00 108.45 ? 137  DG  I OP1   1 
ATOM   2784  O OP2   . DG  A 1 137 ? 121.152 18.019 -58.995 1.00 108.20 ? 137  DG  I OP2   1 
ATOM   2785  O "O5'" . DG  A 1 137 ? 121.419 15.789 -57.922 1.00 123.41 ? 137  DG  I "O5'" 1 
ATOM   2786  C "C5'" . DG  A 1 137 ? 121.989 14.872 -56.995 1.00 120.85 ? 137  DG  I "C5'" 1 
ATOM   2787  C "C4'" . DG  A 1 137 ? 121.759 13.464 -57.482 1.00 118.91 ? 137  DG  I "C4'" 1 
ATOM   2788  O "O4'" . DG  A 1 137 ? 120.366 13.130 -57.290 1.00 117.47 ? 137  DG  I "O4'" 1 
ATOM   2789  C "C3'" . DG  A 1 137 ? 122.018 13.343 -58.979 1.00 118.41 ? 137  DG  I "C3'" 1 
ATOM   2790  O "O3'" . DG  A 1 137 ? 122.538 12.053 -59.295 1.00 118.44 ? 137  DG  I "O3'" 1 
ATOM   2791  C "C2'" . DG  A 1 137 ? 120.649 13.570 -59.591 1.00 116.94 ? 137  DG  I "C2'" 1 
ATOM   2792  C "C1'" . DG  A 1 137 ? 119.701 13.008 -58.541 1.00 115.94 ? 137  DG  I "C1'" 1 
ATOM   2793  N N9    . DG  A 1 137 ? 118.435 13.730 -58.437 1.00 96.74  ? 137  DG  I N9    1 
ATOM   2794  C C8    . DG  A 1 137 ? 118.220 15.075 -58.661 1.00 96.21  ? 137  DG  I C8    1 
ATOM   2795  N N7    . DG  A 1 137 ? 116.977 15.436 -58.475 1.00 94.60  ? 137  DG  I N7    1 
ATOM   2796  C C5    . DG  A 1 137 ? 116.328 14.260 -58.108 1.00 94.23  ? 137  DG  I C5    1 
ATOM   2797  C C6    . DG  A 1 137 ? 114.966 14.020 -57.774 1.00 92.73  ? 137  DG  I C6    1 
ATOM   2798  O O6    . DG  A 1 137 ? 114.031 14.819 -57.729 1.00 90.83  ? 137  DG  I O6    1 
ATOM   2799  N N1    . DG  A 1 137 ? 114.745 12.685 -57.470 1.00 92.49  ? 137  DG  I N1    1 
ATOM   2800  C C2    . DG  A 1 137 ? 115.703 11.703 -57.475 1.00 92.74  ? 137  DG  I C2    1 
ATOM   2801  N N2    . DG  A 1 137 ? 115.288 10.485 -57.149 1.00 92.65  ? 137  DG  I N2    1 
ATOM   2802  N N3    . DG  A 1 137 ? 116.972 11.904 -57.778 1.00 93.18  ? 137  DG  I N3    1 
ATOM   2803  C C4    . DG  A 1 137 ? 117.215 13.197 -58.084 1.00 94.98  ? 137  DG  I C4    1 
ATOM   2804  P P     . DG  A 1 138 ? 122.557 11.558 -60.821 1.00 136.35 ? 138  DG  I P     1 
ATOM   2805  O OP1   . DG  A 1 138 ? 123.528 10.438 -60.933 1.00 95.29  ? 138  DG  I OP1   1 
ATOM   2806  O OP2   . DG  A 1 138 ? 122.666 12.736 -61.729 1.00 94.57  ? 138  DG  I OP2   1 
ATOM   2807  O "O5'" . DG  A 1 138 ? 121.106 10.954 -61.001 1.00 134.23 ? 138  DG  I "O5'" 1 
ATOM   2808  C "C5'" . DG  A 1 138 ? 120.658 9.903  -60.164 1.00 130.99 ? 138  DG  I "C5'" 1 
ATOM   2809  C "C4'" . DG  A 1 138 ? 119.415 9.306  -60.764 1.00 129.25 ? 138  DG  I "C4'" 1 
ATOM   2810  O "O4'" . DG  A 1 138 ? 118.317 10.240 -60.607 1.00 128.22 ? 138  DG  I "O4'" 1 
ATOM   2811  C "C3'" . DG  A 1 138 ? 119.571 9.088  -62.267 1.00 128.47 ? 138  DG  I "C3'" 1 
ATOM   2812  O "O3'" . DG  A 1 138 ? 118.881 7.900  -62.636 1.00 128.97 ? 138  DG  I "O3'" 1 
ATOM   2813  C "C2'" . DG  A 1 138 ? 118.904 10.313 -62.866 1.00 127.54 ? 138  DG  I "C2'" 1 
ATOM   2814  C "C1'" . DG  A 1 138 ? 117.778 10.561 -61.879 1.00 126.10 ? 138  DG  I "C1'" 1 
ATOM   2815  N N9    . DG  A 1 138 ? 117.262 11.930 -61.829 1.00 82.26  ? 138  DG  I N9    1 
ATOM   2816  C C8    . DG  A 1 138 ? 117.904 13.084 -62.222 1.00 80.77  ? 138  DG  I C8    1 
ATOM   2817  N N7    . DG  A 1 138 ? 117.183 14.161 -62.044 1.00 78.73  ? 138  DG  I N7    1 
ATOM   2818  C C5    . DG  A 1 138 ? 115.991 13.689 -61.506 1.00 78.71  ? 138  DG  I C5    1 
ATOM   2819  C C6    . DG  A 1 138 ? 114.825 14.386 -61.101 1.00 77.79  ? 138  DG  I C6    1 
ATOM   2820  O O6    . DG  A 1 138 ? 114.595 15.608 -61.136 1.00 75.39  ? 138  DG  I O6    1 
ATOM   2821  N N1    . DG  A 1 138 ? 113.863 13.519 -60.610 1.00 76.98  ? 138  DG  I N1    1 
ATOM   2822  C C2    . DG  A 1 138 ? 113.998 12.169 -60.519 1.00 78.24  ? 138  DG  I C2    1 
ATOM   2823  N N2    . DG  A 1 138 ? 112.960 11.515 -60.016 1.00 78.01  ? 138  DG  I N2    1 
ATOM   2824  N N3    . DG  A 1 138 ? 115.068 11.505 -60.891 1.00 79.40  ? 138  DG  I N3    1 
ATOM   2825  C C4    . DG  A 1 138 ? 116.022 12.319 -61.371 1.00 80.14  ? 138  DG  I C4    1 
ATOM   2826  P P     . DA  A 1 139 ? 118.963 7.362  -64.143 1.00 118.66 ? 139  DA  I P     1 
ATOM   2827  O OP1   . DA  A 1 139 ? 120.141 6.455  -64.238 1.00 103.22 ? 139  DA  I OP1   1 
ATOM   2828  O OP2   . DA  A 1 139 ? 118.846 8.527  -65.061 1.00 103.62 ? 139  DA  I OP2   1 
ATOM   2829  O "O5'" . DA  A 1 139 ? 117.630 6.504  -64.271 1.00 115.40 ? 139  DA  I "O5'" 1 
ATOM   2830  C "C5'" . DA  A 1 139 ? 117.050 5.916  -63.112 1.00 110.59 ? 139  DA  I "C5'" 1 
ATOM   2831  C "C4'" . DA  A 1 139 ? 115.561 6.144  -63.106 1.00 108.35 ? 139  DA  I "C4'" 1 
ATOM   2832  O "O4'" . DA  A 1 139 ? 115.244 7.539  -62.874 1.00 106.43 ? 139  DA  I "O4'" 1 
ATOM   2833  C "C3'" . DA  A 1 139 ? 114.910 5.788  -64.434 1.00 107.85 ? 139  DA  I "C3'" 1 
ATOM   2834  O "O3'" . DA  A 1 139 ? 113.655 5.178  -64.179 1.00 109.20 ? 139  DA  I "O3'" 1 
ATOM   2835  C "C2'" . DA  A 1 139 ? 114.711 7.134  -65.104 1.00 105.80 ? 139  DA  I "C2'" 1 
ATOM   2836  C "C1'" . DA  A 1 139 ? 114.372 7.993  -63.904 1.00 104.12 ? 139  DA  I "C1'" 1 
ATOM   2837  N N9    . DA  A 1 139 ? 114.540 9.445  -64.054 1.00 83.97  ? 139  DA  I N9    1 
ATOM   2838  C C8    . DA  A 1 139 ? 115.707 10.147 -64.236 1.00 84.12  ? 139  DA  I C8    1 
ATOM   2839  N N7    . DA  A 1 139 ? 115.543 11.449 -64.266 1.00 81.72  ? 139  DA  I N7    1 
ATOM   2840  C C5    . DA  A 1 139 ? 114.172 11.619 -64.110 1.00 80.74  ? 139  DA  I C5    1 
ATOM   2841  C C6    . DA  A 1 139 ? 113.368 12.762 -64.046 1.00 78.34  ? 139  DA  I C6    1 
ATOM   2842  N N6    . DA  A 1 139 ? 113.847 14.001 -64.140 1.00 74.22  ? 139  DA  I N6    1 
ATOM   2843  N N1    . DA  A 1 139 ? 112.043 12.590 -63.881 1.00 75.61  ? 139  DA  I N1    1 
ATOM   2844  C C2    . DA  A 1 139 ? 111.566 11.351 -63.797 1.00 78.16  ? 139  DA  I C2    1 
ATOM   2845  N N3    . DA  A 1 139 ? 112.215 10.193 -63.848 1.00 80.33  ? 139  DA  I N3    1 
ATOM   2846  C C4    . DA  A 1 139 ? 113.537 10.396 -64.001 1.00 81.78  ? 139  DA  I C4    1 
ATOM   2847  P P     . DT  A 1 140 ? 112.912 4.420  -65.367 1.00 90.73  ? 140  DT  I P     1 
ATOM   2848  O OP1   . DT  A 1 140 ? 112.374 3.098  -64.928 1.00 93.37  ? 140  DT  I OP1   1 
ATOM   2849  O OP2   . DT  A 1 140 ? 113.842 4.509  -66.519 1.00 91.22  ? 140  DT  I OP2   1 
ATOM   2850  O "O5'" . DT  A 1 140 ? 111.683 5.354  -65.704 1.00 88.32  ? 140  DT  I "O5'" 1 
ATOM   2851  C "C5'" . DT  A 1 140 ? 110.685 5.618  -64.737 1.00 84.47  ? 140  DT  I "C5'" 1 
ATOM   2852  C "C4'" . DT  A 1 140 ? 109.698 6.610  -65.299 1.00 82.76  ? 140  DT  I "C4'" 1 
ATOM   2853  O "O4'" . DT  A 1 140 ? 110.312 7.919  -65.369 1.00 80.81  ? 140  DT  I "O4'" 1 
ATOM   2854  C "C3'" . DT  A 1 140 ? 109.238 6.289  -66.727 1.00 82.01  ? 140  DT  I "C3'" 1 
ATOM   2855  O "O3'" . DT  A 1 140 ? 107.874 6.673  -66.850 1.00 84.41  ? 140  DT  I "O3'" 1 
ATOM   2856  C "C2'" . DT  A 1 140 ? 110.063 7.243  -67.572 1.00 79.16  ? 140  DT  I "C2'" 1 
ATOM   2857  C "C1'" . DT  A 1 140 ? 110.047 8.438  -66.654 1.00 77.73  ? 140  DT  I "C1'" 1 
ATOM   2858  N N1    . DT  A 1 140 ? 110.980 9.527  -66.913 1.00 77.45  ? 140  DT  I N1    1 
ATOM   2859  C C2    . DT  A 1 140 ? 110.466 10.810 -66.846 1.00 75.23  ? 140  DT  I C2    1 
ATOM   2860  O O2    . DT  A 1 140 ? 109.289 11.051 -66.585 1.00 75.35  ? 140  DT  I O2    1 
ATOM   2861  N N3    . DT  A 1 140 ? 111.379 11.802 -67.084 1.00 73.15  ? 140  DT  I N3    1 
ATOM   2862  C C4    . DT  A 1 140 ? 112.720 11.643 -67.354 1.00 72.82  ? 140  DT  I C4    1 
ATOM   2863  O O4    . DT  A 1 140 ? 113.425 12.629 -67.522 1.00 69.61  ? 140  DT  I O4    1 
ATOM   2864  C C5    . DT  A 1 140 ? 113.186 10.271 -67.407 1.00 72.89  ? 140  DT  I C5    1 
ATOM   2865  C C7    . DT  A 1 140 ? 114.633 10.010 -67.682 1.00 72.94  ? 140  DT  I C7    1 
ATOM   2866  C C6    . DT  A 1 140 ? 112.299 9.294  -67.197 1.00 73.45  ? 140  DT  I C6    1 
ATOM   2867  P P     . DA  A 1 141 ? 106.816 5.682  -67.528 1.00 90.45  ? 141  DA  I P     1 
ATOM   2868  O OP1   . DA  A 1 141 ? 106.784 4.466  -66.659 1.00 69.04  ? 141  DA  I OP1   1 
ATOM   2869  O OP2   . DA  A 1 141 ? 107.145 5.551  -68.975 1.00 68.65  ? 141  DA  I OP2   1 
ATOM   2870  O "O5'" . DA  A 1 141 ? 105.449 6.490  -67.390 1.00 89.46  ? 141  DA  I "O5'" 1 
ATOM   2871  C "C5'" . DA  A 1 141 ? 105.159 7.211  -66.189 1.00 85.02  ? 141  DA  I "C5'" 1 
ATOM   2872  C "C4'" . DA  A 1 141 ? 104.705 8.627  -66.491 1.00 82.74  ? 141  DA  I "C4'" 1 
ATOM   2873  O "O4'" . DA  A 1 141 ? 105.799 9.547  -66.729 1.00 80.02  ? 141  DA  I "O4'" 1 
ATOM   2874  C "C3'" . DA  A 1 141 ? 103.745 8.793  -67.666 1.00 81.06  ? 141  DA  I "C3'" 1 
ATOM   2875  O "O3'" . DA  A 1 141 ? 102.669 9.638  -67.287 1.00 80.98  ? 141  DA  I "O3'" 1 
ATOM   2876  C "C2'" . DA  A 1 141 ? 104.582 9.474  -68.732 1.00 78.72  ? 141  DA  I "C2'" 1 
ATOM   2877  C "C1'" . DA  A 1 141 ? 105.539 10.306 -67.904 1.00 76.47  ? 141  DA  I "C1'" 1 
ATOM   2878  N N9    . DA  A 1 141 ? 106.820 10.546 -68.567 1.00 53.23  ? 141  DA  I N9    1 
ATOM   2879  C C8    . DA  A 1 141 ? 107.751 9.619  -68.955 1.00 53.74  ? 141  DA  I C8    1 
ATOM   2880  N N7    . DA  A 1 141 ? 108.823 10.143 -69.486 1.00 52.92  ? 141  DA  I N7    1 
ATOM   2881  C C5    . DA  A 1 141 ? 108.583 11.506 -69.452 1.00 51.31  ? 141  DA  I C5    1 
ATOM   2882  C C6    . DA  A 1 141 ? 109.352 12.595 -69.840 1.00 50.23  ? 141  DA  I C6    1 
ATOM   2883  N N6    . DA  A 1 141 ? 110.575 12.486 -70.336 1.00 49.66  ? 141  DA  I N6    1 
ATOM   2884  N N1    . DA  A 1 141 ? 108.824 13.824 -69.686 1.00 48.06  ? 141  DA  I N1    1 
ATOM   2885  C C2    . DA  A 1 141 ? 107.598 13.932 -69.160 1.00 49.16  ? 141  DA  I C2    1 
ATOM   2886  N N3    . DA  A 1 141 ? 106.775 12.973 -68.736 1.00 50.88  ? 141  DA  I N3    1 
ATOM   2887  C C4    . DA  A 1 141 ? 107.343 11.768 -68.910 1.00 51.14  ? 141  DA  I C4    1 
ATOM   2888  P P     . DT  A 1 142 ? 101.451 9.852  -68.298 1.00 89.42  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 142 ? 100.233 9.962  -67.455 1.00 80.94  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 142 ? 101.503 8.840  -69.394 1.00 79.65  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 142 ? 101.800 11.263 -68.929 1.00 86.73  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 142 ? 102.255 12.305 -68.092 1.00 83.22  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 142 ? 102.394 13.574 -68.889 1.00 82.67  ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 142 ? 103.720 13.686 -69.445 1.00 81.31  ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 142 ? 101.420 13.716 -70.055 1.00 81.43  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 142 ? 100.903 15.039 -70.031 1.00 82.02  ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 142 ? 102.301 13.518 -71.279 1.00 81.69  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 142 ? 103.617 14.082 -70.797 1.00 82.57  ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 142 ? 104.837 13.632 -71.484 1.00 73.16  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 142 ? 105.707 14.616 -71.904 1.00 73.55  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 142 ? 105.466 15.812 -71.793 1.00 73.34  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 142 ? 106.876 14.151 -72.458 1.00 74.44  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 142 ? 107.246 12.831 -72.638 1.00 73.34  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 142 ? 108.347 12.563 -73.112 1.00 74.09  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 142 ? 106.266 11.854 -72.220 1.00 72.61  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 142 ? 106.569 10.404 -72.419 1.00 71.16  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 142 ? 105.123 12.297 -71.671 1.00 71.66  ? 142  DT  I C6    1 
ATOM   2908  P P     . DT  A 1 143 ? 99.877  15.521 -71.163 1.00 76.16  ? 143  DT  I P     1 
ATOM   2909  O OP1   . DT  A 1 143 ? 99.052  16.588 -70.535 1.00 68.20  ? 143  DT  I OP1   1 
ATOM   2910  O OP2   . DT  A 1 143 ? 99.218  14.321 -71.758 1.00 65.27  ? 143  DT  I OP2   1 
ATOM   2911  O "O5'" . DT  A 1 143 ? 100.820 16.268 -72.202 1.00 75.37  ? 143  DT  I "O5'" 1 
ATOM   2912  C "C5'" . DT  A 1 143 ? 101.460 17.458 -71.785 1.00 73.88  ? 143  DT  I "C5'" 1 
ATOM   2913  C "C4'" . DT  A 1 143 ? 102.223 18.084 -72.921 1.00 74.88  ? 143  DT  I "C4'" 1 
ATOM   2914  O "O4'" . DT  A 1 143 ? 103.361 17.284 -73.292 1.00 73.40  ? 143  DT  I "O4'" 1 
ATOM   2915  C "C3'" . DT  A 1 143 ? 101.441 18.311 -74.203 1.00 74.06  ? 143  DT  I "C3'" 1 
ATOM   2916  O "O3'" . DT  A 1 143 ? 101.928 19.534 -74.722 1.00 74.69  ? 143  DT  I "O3'" 1 
ATOM   2917  C "C2'" . DT  A 1 143 ? 101.904 17.172 -75.088 1.00 74.27  ? 143  DT  I "C2'" 1 
ATOM   2918  C "C1'" . DT  A 1 143 ? 103.365 17.110 -74.695 1.00 73.86  ? 143  DT  I "C1'" 1 
ATOM   2919  N N1    . DT  A 1 143 ? 104.101 15.864 -74.980 1.00 58.59  ? 143  DT  I N1    1 
ATOM   2920  C C2    . DT  A 1 143 ? 105.421 15.969 -75.344 1.00 58.88  ? 143  DT  I C2    1 
ATOM   2921  O O2    . DT  A 1 143 ? 105.984 17.034 -75.535 1.00 57.42  ? 143  DT  I O2    1 
ATOM   2922  N N3    . DT  A 1 143 ? 106.067 14.775 -75.477 1.00 58.08  ? 143  DT  I N3    1 
ATOM   2923  C C4    . DT  A 1 143 ? 105.539 13.513 -75.296 1.00 59.73  ? 143  DT  I C4    1 
ATOM   2924  O O4    . DT  A 1 143 ? 106.268 12.530 -75.388 1.00 62.52  ? 143  DT  I O4    1 
ATOM   2925  C C5    . DT  A 1 143 ? 104.134 13.471 -74.981 1.00 59.05  ? 143  DT  I C5    1 
ATOM   2926  C C7    . DT  A 1 143 ? 103.461 12.144 -74.821 1.00 59.71  ? 143  DT  I C7    1 
ATOM   2927  C C6    . DT  A 1 143 ? 103.494 14.636 -74.842 1.00 58.28  ? 143  DT  I C6    1 
ATOM   2928  P P     . DG  A 1 144 ? 100.984 20.444 -75.629 1.00 83.61  ? 144  DG  I P     1 
ATOM   2929  O OP1   . DG  A 1 144 ? 100.781 21.774 -74.980 1.00 59.33  ? 144  DG  I OP1   1 
ATOM   2930  O OP2   . DG  A 1 144 ? 99.821  19.613 -75.991 1.00 57.76  ? 144  DG  I OP2   1 
ATOM   2931  O "O5'" . DG  A 1 144 ? 101.880 20.687 -76.920 1.00 85.38  ? 144  DG  I "O5'" 1 
ATOM   2932  C "C5'" . DG  A 1 144 ? 103.069 21.482 -76.848 1.00 90.47  ? 144  DG  I "C5'" 1 
ATOM   2933  C "C4'" . DG  A 1 144 ? 103.935 21.224 -78.058 1.00 92.55  ? 144  DG  I "C4'" 1 
ATOM   2934  O "O4'" . DG  A 1 144 ? 104.533 19.908 -77.963 1.00 91.26  ? 144  DG  I "O4'" 1 
ATOM   2935  C "C3'" . DG  A 1 144 ? 103.147 21.234 -79.368 1.00 94.39  ? 144  DG  I "C3'" 1 
ATOM   2936  O "O3'" . DG  A 1 144 ? 103.904 21.855 -80.399 1.00 100.40 ? 144  DG  I "O3'" 1 
ATOM   2937  C "C2'" . DG  A 1 144 ? 102.966 19.761 -79.675 1.00 92.85  ? 144  DG  I "C2'" 1 
ATOM   2938  C "C1'" . DG  A 1 144 ? 104.258 19.192 -79.147 1.00 91.52  ? 144  DG  I "C1'" 1 
ATOM   2939  N N9    . DG  A 1 144 ? 104.217 17.767 -78.840 1.00 67.30  ? 144  DG  I N9    1 
ATOM   2940  C C8    . DG  A 1 144 ? 103.149 17.015 -78.390 1.00 67.60  ? 144  DG  I C8    1 
ATOM   2941  N N7    . DG  A 1 144 ? 103.420 15.733 -78.308 1.00 67.06  ? 144  DG  I N7    1 
ATOM   2942  C C5    . DG  A 1 144 ? 104.754 15.639 -78.709 1.00 67.58  ? 144  DG  I C5    1 
ATOM   2943  C C6    . DG  A 1 144 ? 105.612 14.504 -78.849 1.00 66.98  ? 144  DG  I C6    1 
ATOM   2944  O O6    . DG  A 1 144 ? 105.351 13.317 -78.663 1.00 67.22  ? 144  DG  I O6    1 
ATOM   2945  N N1    . DG  A 1 144 ? 106.889 14.873 -79.262 1.00 65.43  ? 144  DG  I N1    1 
ATOM   2946  C C2    . DG  A 1 144 ? 107.301 16.160 -79.515 1.00 67.69  ? 144  DG  I C2    1 
ATOM   2947  N N2    . DG  A 1 144 ? 108.582 16.321 -79.863 1.00 68.25  ? 144  DG  I N2    1 
ATOM   2948  N N3    . DG  A 1 144 ? 106.516 17.218 -79.420 1.00 68.79  ? 144  DG  I N3    1 
ATOM   2949  C C4    . DG  A 1 144 ? 105.265 16.890 -79.012 1.00 67.69  ? 144  DG  I C4    1 
ATOM   2950  P P     . DA  A 1 145 ? 103.319 21.905 -81.896 1.00 98.39  ? 145  DA  I P     1 
ATOM   2951  O OP1   . DA  A 1 145 ? 103.029 23.324 -82.247 1.00 79.64  ? 145  DA  I OP1   1 
ATOM   2952  O OP2   . DA  A 1 145 ? 102.254 20.871 -82.070 1.00 77.57  ? 145  DA  I OP2   1 
ATOM   2953  O "O5'" . DA  A 1 145 ? 104.591 21.470 -82.728 1.00 96.95  ? 145  DA  I "O5'" 1 
ATOM   2954  C "C5'" . DA  A 1 145 ? 105.890 21.700 -82.204 1.00 97.73  ? 145  DA  I "C5'" 1 
ATOM   2955  C "C4'" . DA  A 1 145 ? 106.870 20.831 -82.940 1.00 98.34  ? 145  DA  I "C4'" 1 
ATOM   2956  O "O4'" . DA  A 1 145 ? 106.773 19.472 -82.450 1.00 95.38  ? 145  DA  I "O4'" 1 
ATOM   2957  C "C3'" . DA  A 1 145 ? 106.508 20.771 -84.423 1.00 99.66  ? 145  DA  I "C3'" 1 
ATOM   2958  O "O3'" . DA  A 1 145 ? 107.686 20.762 -85.221 1.00 103.37 ? 145  DA  I "O3'" 1 
ATOM   2959  C "C2'" . DA  A 1 145 ? 105.788 19.445 -84.554 1.00 96.85  ? 145  DA  I "C2'" 1 
ATOM   2960  C "C1'" . DA  A 1 145 ? 106.555 18.611 -83.549 1.00 93.28  ? 145  DA  I "C1'" 1 
ATOM   2961  N N9    . DA  A 1 145 ? 105.849 17.421 -83.082 1.00 71.04  ? 145  DA  I N9    1 
ATOM   2962  C C8    . DA  A 1 145 ? 104.542 17.321 -82.702 1.00 70.13  ? 145  DA  I C8    1 
ATOM   2963  N N7    . DA  A 1 145 ? 104.163 16.105 -82.407 1.00 67.77  ? 145  DA  I N7    1 
ATOM   2964  C C5    . DA  A 1 145 ? 105.307 15.351 -82.588 1.00 67.38  ? 145  DA  I C5    1 
ATOM   2965  C C6    . DA  A 1 145 ? 105.554 13.978 -82.453 1.00 67.88  ? 145  DA  I C6    1 
ATOM   2966  N N6    . DA  A 1 145 ? 104.610 13.095 -82.129 1.00 67.01  ? 145  DA  I N6    1 
ATOM   2967  N N1    . DA  A 1 145 ? 106.814 13.536 -82.684 1.00 67.88  ? 145  DA  I N1    1 
ATOM   2968  C C2    . DA  A 1 145 ? 107.744 14.430 -83.055 1.00 66.28  ? 145  DA  I C2    1 
ATOM   2969  N N3    . DA  A 1 145 ? 107.622 15.753 -83.241 1.00 68.66  ? 145  DA  I N3    1 
ATOM   2970  C C4    . DA  A 1 145 ? 106.362 16.151 -82.984 1.00 69.04  ? 145  DA  I C4    1 
ATOM   2971  P P     . DT  A 1 146 ? 107.602 21.211 -86.758 1.00 126.75 ? 146  DT  I P     1 
ATOM   2972  O OP1   . DT  A 1 146 ? 108.503 22.393 -86.901 1.00 100.24 ? 146  DT  I OP1   1 
ATOM   2973  O OP2   . DT  A 1 146 ? 106.169 21.320 -87.148 1.00 101.27 ? 146  DT  I OP2   1 
ATOM   2974  O "O5'" . DT  A 1 146 ? 108.170 19.950 -87.550 1.00 126.33 ? 146  DT  I "O5'" 1 
ATOM   2975  C "C5'" . DT  A 1 146 ? 109.382 19.315 -87.157 1.00 126.95 ? 146  DT  I "C5'" 1 
ATOM   2976  C "C4'" . DT  A 1 146 ? 109.492 17.963 -87.822 1.00 128.32 ? 146  DT  I "C4'" 1 
ATOM   2977  O "O4'" . DT  A 1 146 ? 108.735 16.961 -87.097 1.00 126.60 ? 146  DT  I "O4'" 1 
ATOM   2978  C "C3'" . DT  A 1 146 ? 108.968 17.928 -89.260 1.00 128.79 ? 146  DT  I "C3'" 1 
ATOM   2979  O "O3'" . DT  A 1 146 ? 109.716 16.987 -90.030 1.00 129.85 ? 146  DT  I "O3'" 1 
ATOM   2980  C "C2'" . DT  A 1 146 ? 107.591 17.312 -89.095 1.00 127.29 ? 146  DT  I "C2'" 1 
ATOM   2981  C "C1'" . DT  A 1 146 ? 107.876 16.297 -88.004 1.00 125.57 ? 146  DT  I "C1'" 1 
ATOM   2982  N N1    . DT  A 1 146 ? 106.707 15.784 -87.260 1.00 101.35 ? 146  DT  I N1    1 
ATOM   2983  C C2    . DT  A 1 146 ? 106.748 14.473 -86.844 1.00 99.83  ? 146  DT  I C2    1 
ATOM   2984  O O2    . DT  A 1 146 ? 107.711 13.743 -87.032 1.00 99.22  ? 146  DT  I O2    1 
ATOM   2985  N N3    . DT  A 1 146 ? 105.619 14.043 -86.194 1.00 97.99  ? 146  DT  I N3    1 
ATOM   2986  C C4    . DT  A 1 146 ? 104.487 14.776 -85.913 1.00 97.70  ? 146  DT  I C4    1 
ATOM   2987  O O4    . DT  A 1 146 ? 103.552 14.250 -85.312 1.00 97.92  ? 146  DT  I O4    1 
ATOM   2988  C C5    . DT  A 1 146 ? 104.513 16.146 -86.369 1.00 98.60  ? 146  DT  I C5    1 
ATOM   2989  C C7    . DT  A 1 146 ? 103.323 17.019 -86.116 1.00 97.61  ? 146  DT  I C7    1 
ATOM   2990  C C6    . DT  A 1 146 ? 105.610 16.577 -87.007 1.00 100.78 ? 146  DT  I C6    1 
ATOM   2991  O "O5'" . DA  B 1 1   ? 102.636 4.363  -83.884 1.00 113.05 ? 147  DA  J "O5'" 1 
ATOM   2992  C "C5'" . DA  B 1 1   ? 103.333 3.291  -84.525 1.00 112.15 ? 147  DA  J "C5'" 1 
ATOM   2993  C "C4'" . DA  B 1 1   ? 104.665 3.751  -85.067 1.00 111.67 ? 147  DA  J "C4'" 1 
ATOM   2994  O "O4'" . DA  B 1 1   ? 104.455 4.996  -85.779 1.00 110.67 ? 147  DA  J "O4'" 1 
ATOM   2995  C "C3'" . DA  B 1 1   ? 105.706 4.049  -83.988 1.00 112.27 ? 147  DA  J "C3'" 1 
ATOM   2996  O "O3'" . DA  B 1 1   ? 107.025 3.688  -84.412 1.00 113.58 ? 147  DA  J "O3'" 1 
ATOM   2997  C "C2'" . DA  B 1 1   ? 105.622 5.551  -83.819 1.00 111.29 ? 147  DA  J "C2'" 1 
ATOM   2998  C "C1'" . DA  B 1 1   ? 105.222 6.040  -85.198 1.00 108.31 ? 147  DA  J "C1'" 1 
ATOM   2999  N N9    . DA  B 1 1   ? 104.389 7.242  -85.122 1.00 99.55  ? 147  DA  J N9    1 
ATOM   3000  C C8    . DA  B 1 1   ? 103.114 7.377  -84.611 1.00 97.94  ? 147  DA  J C8    1 
ATOM   3001  N N7    . DA  B 1 1   ? 102.671 8.613  -84.622 1.00 96.68  ? 147  DA  J N7    1 
ATOM   3002  C C5    . DA  B 1 1   ? 103.715 9.337  -85.186 1.00 95.09  ? 147  DA  J C5    1 
ATOM   3003  C C6    . DA  B 1 1   ? 103.884 10.712 -85.454 1.00 93.15  ? 147  DA  J C6    1 
ATOM   3004  N N6    . DA  B 1 1   ? 102.977 11.645 -85.151 1.00 90.48  ? 147  DA  J N6    1 
ATOM   3005  N N1    . DA  B 1 1   ? 105.043 11.100 -86.037 1.00 92.75  ? 147  DA  J N1    1 
ATOM   3006  C C2    . DA  B 1 1   ? 105.969 10.168 -86.306 1.00 94.22  ? 147  DA  J C2    1 
ATOM   3007  N N3    . DA  B 1 1   ? 105.934 8.853  -86.084 1.00 94.98  ? 147  DA  J N3    1 
ATOM   3008  C C4    . DA  B 1 1   ? 104.768 8.500  -85.517 1.00 96.63  ? 147  DA  J C4    1 
ATOM   3009  P P     . DT  B 1 2   ? 108.290 4.074  -83.491 1.00 137.43 ? 148  DT  J P     1 
ATOM   3010  O OP1   . DT  B 1 2   ? 109.387 3.105  -83.749 1.00 116.06 ? 148  DT  J OP1   1 
ATOM   3011  O OP2   . DT  B 1 2   ? 107.780 4.261  -82.104 1.00 114.46 ? 148  DT  J OP2   1 
ATOM   3012  O "O5'" . DT  B 1 2   ? 108.746 5.494  -84.042 1.00 135.27 ? 148  DT  J "O5'" 1 
ATOM   3013  C "C5'" . DT  B 1 2   ? 109.277 5.632  -85.355 1.00 133.60 ? 148  DT  J "C5'" 1 
ATOM   3014  C "C4'" . DT  B 1 2   ? 110.086 6.902  -85.439 1.00 132.29 ? 148  DT  J "C4'" 1 
ATOM   3015  O "O4'" . DT  B 1 2   ? 109.190 8.023  -85.247 1.00 130.36 ? 148  DT  J "O4'" 1 
ATOM   3016  C "C3'" . DT  B 1 2   ? 111.121 6.996  -84.322 1.00 132.98 ? 148  DT  J "C3'" 1 
ATOM   3017  O "O3'" . DT  B 1 2   ? 112.334 7.603  -84.772 1.00 135.76 ? 148  DT  J "O3'" 1 
ATOM   3018  C "C2'" . DT  B 1 2   ? 110.443 7.857  -83.272 1.00 131.14 ? 148  DT  J "C2'" 1 
ATOM   3019  C "C1'" . DT  B 1 2   ? 109.575 8.782  -84.105 1.00 128.60 ? 148  DT  J "C1'" 1 
ATOM   3020  N N1    . DT  B 1 2   ? 108.345 9.228  -83.407 1.00 102.72 ? 148  DT  J N1    1 
ATOM   3021  C C2    . DT  B 1 2   ? 108.065 10.581 -83.344 1.00 101.64 ? 148  DT  J C2    1 
ATOM   3022  O O2    . DT  B 1 2   ? 108.784 11.444 -83.834 1.00 101.08 ? 148  DT  J O2    1 
ATOM   3023  N N3    . DT  B 1 2   ? 106.901 10.889 -82.674 1.00 100.38 ? 148  DT  J N3    1 
ATOM   3024  C C4    . DT  B 1 2   ? 106.026 10.006 -82.066 1.00 99.56  ? 148  DT  J C4    1 
ATOM   3025  O O4    . DT  B 1 2   ? 105.028 10.421 -81.496 1.00 98.92  ? 148  DT  J O4    1 
ATOM   3026  C C5    . DT  B 1 2   ? 106.385 8.623  -82.161 1.00 99.69  ? 148  DT  J C5    1 
ATOM   3027  C C7    . DT  B 1 2   ? 105.503 7.612  -81.502 1.00 99.83  ? 148  DT  J C7    1 
ATOM   3028  C C6    . DT  B 1 2   ? 107.504 8.301  -82.827 1.00 100.55 ? 148  DT  J C6    1 
ATOM   3029  P P     . DC  B 1 3   ? 113.593 7.659  -83.774 1.00 148.28 ? 149  DC  J P     1 
ATOM   3030  O OP1   . DC  B 1 3   ? 114.845 7.899  -84.546 1.00 87.47  ? 149  DC  J OP1   1 
ATOM   3031  O OP2   . DC  B 1 3   ? 113.475 6.453  -82.901 1.00 87.53  ? 149  DC  J OP2   1 
ATOM   3032  O "O5'" . DC  B 1 3   ? 113.302 8.940  -82.871 1.00 146.71 ? 149  DC  J "O5'" 1 
ATOM   3033  C "C5'" . DC  B 1 3   ? 114.131 9.266  -81.758 1.00 144.33 ? 149  DC  J "C5'" 1 
ATOM   3034  C "C4'" . DC  B 1 3   ? 114.566 10.708 -81.852 1.00 142.36 ? 149  DC  J "C4'" 1 
ATOM   3035  O "O4'" . DC  B 1 3   ? 113.396 11.508 -82.133 1.00 140.41 ? 149  DC  J "O4'" 1 
ATOM   3036  C "C3'" . DC  B 1 3   ? 115.185 11.284 -80.582 1.00 141.26 ? 149  DC  J "C3'" 1 
ATOM   3037  O "O3'" . DC  B 1 3   ? 116.322 12.105 -80.880 1.00 141.87 ? 149  DC  J "O3'" 1 
ATOM   3038  C "C2'" . DC  B 1 3   ? 114.042 12.018 -79.908 1.00 139.81 ? 149  DC  J "C2'" 1 
ATOM   3039  C "C1'" . DC  B 1 3   ? 113.057 12.340 -81.030 1.00 137.39 ? 149  DC  J "C1'" 1 
ATOM   3040  N N1    . DC  B 1 3   ? 111.654 12.041 -80.659 1.00 74.30  ? 149  DC  J N1    1 
ATOM   3041  C C2    . DC  B 1 3   ? 110.683 13.051 -80.753 1.00 72.26  ? 149  DC  J C2    1 
ATOM   3042  O O2    . DC  B 1 3   ? 111.021 14.169 -81.169 1.00 72.00  ? 149  DC  J O2    1 
ATOM   3043  N N3    . DC  B 1 3   ? 109.407 12.768 -80.391 1.00 68.81  ? 149  DC  J N3    1 
ATOM   3044  C C4    . DC  B 1 3   ? 109.089 11.536 -79.965 1.00 67.72  ? 149  DC  J C4    1 
ATOM   3045  N N4    . DC  B 1 3   ? 107.828 11.287 -79.621 1.00 65.45  ? 149  DC  J N4    1 
ATOM   3046  C C5    . DC  B 1 3   ? 110.052 10.499 -79.872 1.00 68.77  ? 149  DC  J C5    1 
ATOM   3047  C C6    . DC  B 1 3   ? 111.307 10.789 -80.222 1.00 71.07  ? 149  DC  J C6    1 
ATOM   3048  P P     . DA  B 1 4   ? 116.137 13.484 -81.684 1.00 123.31 ? 150  DA  J P     1 
ATOM   3049  O OP1   . DA  B 1 4   ? 115.417 13.173 -82.948 1.00 110.46 ? 150  DA  J OP1   1 
ATOM   3050  O OP2   . DA  B 1 4   ? 117.449 14.189 -81.738 1.00 110.02 ? 150  DA  J OP2   1 
ATOM   3051  O "O5'" . DA  B 1 4   ? 115.176 14.365 -80.776 1.00 119.46 ? 150  DA  J "O5'" 1 
ATOM   3052  C "C5'" . DA  B 1 4   ? 114.695 15.616 -81.258 1.00 115.00 ? 150  DA  J "C5'" 1 
ATOM   3053  C "C4'" . DA  B 1 4   ? 114.279 16.497 -80.106 1.00 111.25 ? 150  DA  J "C4'" 1 
ATOM   3054  O "O4'" . DA  B 1 4   ? 113.089 15.969 -79.480 1.00 108.09 ? 150  DA  J "O4'" 1 
ATOM   3055  C "C3'" . DA  B 1 4   ? 115.308 16.646 -78.988 1.00 109.82 ? 150  DA  J "C3'" 1 
ATOM   3056  O "O3'" . DA  B 1 4   ? 115.223 17.988 -78.525 1.00 110.16 ? 150  DA  J "O3'" 1 
ATOM   3057  C "C2'" . DA  B 1 4   ? 114.803 15.684 -77.925 1.00 106.37 ? 150  DA  J "C2'" 1 
ATOM   3058  C "C1'" . DA  B 1 4   ? 113.306 15.846 -78.084 1.00 104.18 ? 150  DA  J "C1'" 1 
ATOM   3059  N N9    . DA  B 1 4   ? 112.453 14.761 -77.595 1.00 87.55  ? 150  DA  J N9    1 
ATOM   3060  C C8    . DA  B 1 4   ? 112.757 13.447 -77.346 1.00 85.48  ? 150  DA  J C8    1 
ATOM   3061  N N7    . DA  B 1 4   ? 111.723 12.728 -76.973 1.00 83.67  ? 150  DA  J N7    1 
ATOM   3062  C C5    . DA  B 1 4   ? 110.672 13.637 -76.962 1.00 81.42  ? 150  DA  J C5    1 
ATOM   3063  C C6    . DA  B 1 4   ? 109.298 13.503 -76.671 1.00 78.42  ? 150  DA  J C6    1 
ATOM   3064  N N6    . DA  B 1 4   ? 108.715 12.354 -76.339 1.00 74.00  ? 150  DA  J N6    1 
ATOM   3065  N N1    . DA  B 1 4   ? 108.533 14.606 -76.746 1.00 77.36  ? 150  DA  J N1    1 
ATOM   3066  C C2    . DA  B 1 4   ? 109.107 15.759 -77.099 1.00 78.59  ? 150  DA  J C2    1 
ATOM   3067  N N3    . DA  B 1 4   ? 110.371 16.012 -77.409 1.00 81.35  ? 150  DA  J N3    1 
ATOM   3068  C C4    . DA  B 1 4   ? 111.113 14.894 -77.321 1.00 84.25  ? 150  DA  J C4    1 
ATOM   3069  P P     . DA  B 1 5   ? 116.209 18.510 -77.379 1.00 93.11  ? 151  DA  J P     1 
ATOM   3070  O OP1   . DA  B 1 5   ? 117.249 19.358 -78.021 1.00 86.75  ? 151  DA  J OP1   1 
ATOM   3071  O OP2   . DA  B 1 5   ? 116.611 17.359 -76.534 1.00 86.96  ? 151  DA  J OP2   1 
ATOM   3072  O "O5'" . DA  B 1 5   ? 115.257 19.446 -76.520 1.00 93.57  ? 151  DA  J "O5'" 1 
ATOM   3073  C "C5'" . DA  B 1 5   ? 114.332 20.307 -77.177 1.00 91.70  ? 151  DA  J "C5'" 1 
ATOM   3074  C "C4'" . DA  B 1 5   ? 113.164 20.624 -76.272 1.00 89.64  ? 151  DA  J "C4'" 1 
ATOM   3075  O "O4'" . DA  B 1 5   ? 112.350 19.454 -76.017 1.00 87.88  ? 151  DA  J "O4'" 1 
ATOM   3076  C "C3'" . DA  B 1 5   ? 113.549 21.170 -74.905 1.00 89.02  ? 151  DA  J "C3'" 1 
ATOM   3077  O "O3'" . DA  B 1 5   ? 112.617 22.205 -74.594 1.00 89.68  ? 151  DA  J "O3'" 1 
ATOM   3078  C "C2'" . DA  B 1 5   ? 113.409 19.955 -74.001 1.00 86.62  ? 151  DA  J "C2'" 1 
ATOM   3079  C "C1'" . DA  B 1 5   ? 112.224 19.247 -74.626 1.00 84.75  ? 151  DA  J "C1'" 1 
ATOM   3080  N N9    . DA  B 1 5   ? 112.152 17.808 -74.422 1.00 75.08  ? 151  DA  J N9    1 
ATOM   3081  C C8    . DA  B 1 5   ? 113.134 16.881 -74.644 1.00 73.84  ? 151  DA  J C8    1 
ATOM   3082  N N7    . DA  B 1 5   ? 112.739 15.637 -74.470 1.00 72.40  ? 151  DA  J N7    1 
ATOM   3083  C C5    . DA  B 1 5   ? 111.413 15.758 -74.089 1.00 70.10  ? 151  DA  J C5    1 
ATOM   3084  C C6    . DA  B 1 5   ? 110.432 14.808 -73.782 1.00 69.40  ? 151  DA  J C6    1 
ATOM   3085  N N6    . DA  B 1 5   ? 110.636 13.500 -73.828 1.00 66.81  ? 151  DA  J N6    1 
ATOM   3086  N N1    . DA  B 1 5   ? 109.213 15.254 -73.427 1.00 69.60  ? 151  DA  J N1    1 
ATOM   3087  C C2    . DA  B 1 5   ? 109.000 16.574 -73.392 1.00 68.76  ? 151  DA  J C2    1 
ATOM   3088  N N3    . DA  B 1 5   ? 109.838 17.574 -73.671 1.00 69.58  ? 151  DA  J N3    1 
ATOM   3089  C C4    . DA  B 1 5   ? 111.044 17.092 -74.022 1.00 72.06  ? 151  DA  J C4    1 
ATOM   3090  P P     . DT  B 1 6   ? 113.024 23.351 -73.566 1.00 101.86 ? 152  DT  J P     1 
ATOM   3091  O OP1   . DT  B 1 6   ? 112.633 24.687 -74.109 1.00 101.07 ? 152  DT  J OP1   1 
ATOM   3092  O OP2   . DT  B 1 6   ? 114.427 23.075 -73.168 1.00 102.33 ? 152  DT  J OP2   1 
ATOM   3093  O "O5'" . DT  B 1 6   ? 112.126 23.017 -72.306 1.00 100.93 ? 152  DT  J "O5'" 1 
ATOM   3094  C "C5'" . DT  B 1 6   ? 111.790 21.673 -72.040 1.00 94.54  ? 152  DT  J "C5'" 1 
ATOM   3095  C "C4'" . DT  B 1 6   ? 110.465 21.599 -71.332 1.00 88.45  ? 152  DT  J "C4'" 1 
ATOM   3096  O "O4'" . DT  B 1 6   ? 110.010 20.233 -71.401 1.00 86.95  ? 152  DT  J "O4'" 1 
ATOM   3097  C "C3'" . DT  B 1 6   ? 110.559 21.946 -69.852 1.00 85.44  ? 152  DT  J "C3'" 1 
ATOM   3098  O "O3'" . DT  B 1 6   ? 109.354 22.585 -69.436 1.00 84.14  ? 152  DT  J "O3'" 1 
ATOM   3099  C "C2'" . DT  B 1 6   ? 110.773 20.596 -69.195 1.00 84.33  ? 152  DT  J "C2'" 1 
ATOM   3100  C "C1'" . DT  B 1 6   ? 110.025 19.639 -70.113 1.00 86.08  ? 152  DT  J "C1'" 1 
ATOM   3101  N N1    . DT  B 1 6   ? 110.642 18.307 -70.254 1.00 82.52  ? 152  DT  J N1    1 
ATOM   3102  C C2    . DT  B 1 6   ? 109.862 17.180 -70.048 1.00 82.26  ? 152  DT  J C2    1 
ATOM   3103  O O2    . DT  B 1 6   ? 108.674 17.220 -69.740 1.00 81.16  ? 152  DT  J O2    1 
ATOM   3104  N N3    . DT  B 1 6   ? 110.529 15.993 -70.209 1.00 82.22  ? 152  DT  J N3    1 
ATOM   3105  C C4    . DT  B 1 6   ? 111.852 15.819 -70.541 1.00 82.52  ? 152  DT  J C4    1 
ATOM   3106  O O4    . DT  B 1 6   ? 112.302 14.689 -70.654 1.00 81.54  ? 152  DT  J O4    1 
ATOM   3107  C C5    . DT  B 1 6   ? 112.606 17.037 -70.734 1.00 83.87  ? 152  DT  J C5    1 
ATOM   3108  C C7    . DT  B 1 6   ? 114.056 16.946 -71.090 1.00 85.10  ? 152  DT  J C7    1 
ATOM   3109  C C6    . DT  B 1 6   ? 111.971 18.201 -70.586 1.00 83.29  ? 152  DT  J C6    1 
ATOM   3110  P P     . DA  B 1 7   ? 109.179 23.048 -67.914 1.00 76.23  ? 153  DA  J P     1 
ATOM   3111  O OP1   . DA  B 1 7   ? 108.498 24.376 -67.890 1.00 59.57  ? 153  DA  J OP1   1 
ATOM   3112  O OP2   . DA  B 1 7   ? 110.456 22.872 -67.198 1.00 57.12  ? 153  DA  J OP2   1 
ATOM   3113  O "O5'" . DA  B 1 7   ? 108.179 21.951 -67.363 1.00 73.41  ? 153  DA  J "O5'" 1 
ATOM   3114  C "C5'" . DA  B 1 7   ? 107.104 21.498 -68.176 1.00 72.87  ? 153  DA  J "C5'" 1 
ATOM   3115  C "C4'" . DA  B 1 7   ? 106.433 20.317 -67.524 1.00 73.23  ? 153  DA  J "C4'" 1 
ATOM   3116  O "O4'" . DA  B 1 7   ? 107.206 19.111 -67.713 1.00 73.20  ? 153  DA  J "O4'" 1 
ATOM   3117  C "C3'" . DA  B 1 7   ? 106.265 20.479 -66.021 1.00 72.44  ? 153  DA  J "C3'" 1 
ATOM   3118  O "O3'" . DA  B 1 7   ? 105.011 19.917 -65.659 1.00 72.03  ? 153  DA  J "O3'" 1 
ATOM   3119  C "C2'" . DA  B 1 7   ? 107.430 19.690 -65.448 1.00 70.77  ? 153  DA  J "C2'" 1 
ATOM   3120  C "C1'" . DA  B 1 7   ? 107.598 18.567 -66.458 1.00 71.75  ? 153  DA  J "C1'" 1 
ATOM   3121  N N9    . DA  B 1 7   ? 108.971 18.090 -66.611 1.00 55.61  ? 153  DA  J N9    1 
ATOM   3122  C C8    . DA  B 1 7   ? 110.097 18.868 -66.729 1.00 54.34  ? 153  DA  J C8    1 
ATOM   3123  N N7    . DA  B 1 7   ? 111.201 18.187 -66.922 1.00 56.16  ? 153  DA  J N7    1 
ATOM   3124  C C5    . DA  B 1 7   ? 110.779 16.871 -66.921 1.00 53.14  ? 153  DA  J C5    1 
ATOM   3125  C C6    . DA  B 1 7   ? 111.471 15.682 -67.117 1.00 53.63  ? 153  DA  J C6    1 
ATOM   3126  N N6    . DA  B 1 7   ? 112.773 15.648 -67.415 1.00 49.67  ? 153  DA  J N6    1 
ATOM   3127  N N1    . DA  B 1 7   ? 110.772 14.522 -67.026 1.00 50.78  ? 153  DA  J N1    1 
ATOM   3128  C C2    . DA  B 1 7   ? 109.448 14.592 -66.795 1.00 53.21  ? 153  DA  J C2    1 
ATOM   3129  N N3    . DA  B 1 7   ? 108.670 15.666 -66.636 1.00 52.95  ? 153  DA  J N3    1 
ATOM   3130  C C4    . DA  B 1 7   ? 109.407 16.789 -66.707 1.00 54.38  ? 153  DA  J C4    1 
ATOM   3131  P P     . DT  B 1 8   ? 104.452 20.108 -64.174 1.00 70.57  ? 154  DT  J P     1 
ATOM   3132  O OP1   . DT  B 1 8   ? 103.017 20.399 -64.369 1.00 74.86  ? 154  DT  J OP1   1 
ATOM   3133  O OP2   . DT  B 1 8   ? 105.314 21.076 -63.424 1.00 69.16  ? 154  DT  J OP2   1 
ATOM   3134  O "O5'" . DT  B 1 8   ? 104.588 18.629 -63.607 1.00 69.10  ? 154  DT  J "O5'" 1 
ATOM   3135  C "C5'" . DT  B 1 8   ? 104.197 17.534 -64.437 1.00 70.83  ? 154  DT  J "C5'" 1 
ATOM   3136  C "C4'" . DT  B 1 8   ? 104.605 16.219 -63.820 1.00 73.48  ? 154  DT  J "C4'" 1 
ATOM   3137  O "O4'" . DT  B 1 8   ? 105.998 15.929 -64.080 1.00 73.91  ? 154  DT  J "O4'" 1 
ATOM   3138  C "C3'" . DT  B 1 8   ? 104.437 16.171 -62.304 1.00 74.90  ? 154  DT  J "C3'" 1 
ATOM   3139  O "O3'" . DT  B 1 8   ? 103.999 14.867 -61.923 1.00 80.14  ? 154  DT  J "O3'" 1 
ATOM   3140  C "C2'" . DT  B 1 8   ? 105.850 16.392 -61.804 1.00 73.99  ? 154  DT  J "C2'" 1 
ATOM   3141  C "C1'" . DT  B 1 8   ? 106.622 15.616 -62.847 1.00 74.12  ? 154  DT  J "C1'" 1 
ATOM   3142  N N1    . DT  B 1 8   ? 108.060 15.892 -62.961 1.00 75.03  ? 154  DT  J N1    1 
ATOM   3143  C C2    . DT  B 1 8   ? 108.878 14.802 -63.012 1.00 75.30  ? 154  DT  J C2    1 
ATOM   3144  O O2    . DT  B 1 8   ? 108.461 13.665 -62.895 1.00 76.64  ? 154  DT  J O2    1 
ATOM   3145  N N3    . DT  B 1 8   ? 110.201 15.082 -63.197 1.00 73.49  ? 154  DT  J N3    1 
ATOM   3146  C C4    . DT  B 1 8   ? 110.775 16.326 -63.321 1.00 74.03  ? 154  DT  J C4    1 
ATOM   3147  O O4    . DT  B 1 8   ? 111.979 16.427 -63.543 1.00 71.27  ? 154  DT  J O4    1 
ATOM   3148  C C5    . DT  B 1 8   ? 109.861 17.438 -63.195 1.00 73.53  ? 154  DT  J C5    1 
ATOM   3149  C C7    . DT  B 1 8   ? 110.405 18.831 -63.246 1.00 70.25  ? 154  DT  J C7    1 
ATOM   3150  C C6    . DT  B 1 8   ? 108.560 17.167 -63.030 1.00 73.70  ? 154  DT  J C6    1 
ATOM   3151  P P     . DC  B 1 9   ? 103.408 14.627 -60.453 1.00 97.84  ? 155  DC  J P     1 
ATOM   3152  O OP1   . DC  B 1 9   ? 101.993 14.222 -60.623 1.00 81.17  ? 155  DC  J OP1   1 
ATOM   3153  O OP2   . DC  B 1 9   ? 103.769 15.790 -59.590 1.00 78.62  ? 155  DC  J OP2   1 
ATOM   3154  O "O5'" . DC  B 1 9   ? 104.182 13.352 -59.942 1.00 97.96  ? 155  DC  J "O5'" 1 
ATOM   3155  C "C5'" . DC  B 1 9   ? 104.202 12.182 -60.733 1.00 96.90  ? 155  DC  J "C5'" 1 
ATOM   3156  C "C4'" . DC  B 1 9   ? 105.304 11.278 -60.250 1.00 96.69  ? 155  DC  J "C4'" 1 
ATOM   3157  O "O4'" . DC  B 1 9   ? 106.581 11.866 -60.587 1.00 95.73  ? 155  DC  J "O4'" 1 
ATOM   3158  C "C3'" . DC  B 1 9   ? 105.291 11.142 -58.729 1.00 95.59  ? 155  DC  J "C3'" 1 
ATOM   3159  O "O3'" . DC  B 1 9   ? 105.651 9.815  -58.362 1.00 95.62  ? 155  DC  J "O3'" 1 
ATOM   3160  C "C2'" . DC  B 1 9   ? 106.348 12.130 -58.278 1.00 96.45  ? 155  DC  J "C2'" 1 
ATOM   3161  C "C1'" . DC  B 1 9   ? 107.345 11.990 -59.403 1.00 94.18  ? 155  DC  J "C1'" 1 
ATOM   3162  N N1    . DC  B 1 9   ? 108.301 13.089 -59.573 1.00 73.01  ? 155  DC  J N1    1 
ATOM   3163  C C2    . DC  B 1 9   ? 109.627 12.750 -59.827 1.00 72.85  ? 155  DC  J C2    1 
ATOM   3164  O O2    . DC  B 1 9   ? 109.932 11.542 -59.912 1.00 75.78  ? 155  DC  J O2    1 
ATOM   3165  N N3    . DC  B 1 9   ? 110.543 13.723 -59.969 1.00 71.27  ? 155  DC  J N3    1 
ATOM   3166  C C4    . DC  B 1 9   ? 110.183 14.995 -59.859 1.00 70.92  ? 155  DC  J C4    1 
ATOM   3167  N N4    . DC  B 1 9   ? 111.153 15.921 -59.984 1.00 68.85  ? 155  DC  J N4    1 
ATOM   3168  C C5    . DC  B 1 9   ? 108.825 15.375 -59.612 1.00 70.64  ? 155  DC  J C5    1 
ATOM   3169  C C6    . DC  B 1 9   ? 107.925 14.397 -59.478 1.00 71.39  ? 155  DC  J C6    1 
ATOM   3170  P P     . DC  B 1 10  ? 105.209 9.247  -56.934 1.00 78.84  ? 156  DC  J P     1 
ATOM   3171  O OP1   . DC  B 1 10  ? 103.963 8.443  -57.092 1.00 79.28  ? 156  DC  J OP1   1 
ATOM   3172  O OP2   . DC  B 1 10  ? 105.227 10.394 -55.995 1.00 78.67  ? 156  DC  J OP2   1 
ATOM   3173  O "O5'" . DC  B 1 10  ? 106.432 8.306  -56.541 1.00 77.23  ? 156  DC  J "O5'" 1 
ATOM   3174  C "C5'" . DC  B 1 10  ? 107.500 8.074  -57.457 1.00 76.94  ? 156  DC  J "C5'" 1 
ATOM   3175  C "C4'" . DC  B 1 10  ? 108.829 8.121  -56.739 1.00 77.16  ? 156  DC  J "C4'" 1 
ATOM   3176  O "O4'" . DC  B 1 10  ? 109.604 9.269  -57.167 1.00 75.25  ? 156  DC  J "O4'" 1 
ATOM   3177  C "C3'" . DC  B 1 10  ? 108.772 8.186  -55.209 1.00 78.19  ? 156  DC  J "C3'" 1 
ATOM   3178  O "O3'" . DC  B 1 10  ? 109.741 7.296  -54.640 1.00 81.56  ? 156  DC  J "O3'" 1 
ATOM   3179  C "C2'" . DC  B 1 10  ? 109.198 9.611  -54.910 1.00 76.25  ? 156  DC  J "C2'" 1 
ATOM   3180  C "C1'" . DC  B 1 10  ? 110.194 9.852  -56.027 1.00 74.62  ? 156  DC  J "C1'" 1 
ATOM   3181  N N1    . DC  B 1 10  ? 110.499 11.258 -56.338 1.00 75.21  ? 156  DC  J N1    1 
ATOM   3182  C C2    . DC  B 1 10  ? 111.821 11.609 -56.582 1.00 74.17  ? 156  DC  J C2    1 
ATOM   3183  O O2    . DC  B 1 10  ? 112.684 10.721 -56.554 1.00 76.25  ? 156  DC  J O2    1 
ATOM   3184  N N3    . DC  B 1 10  ? 112.127 12.905 -56.850 1.00 74.04  ? 156  DC  J N3    1 
ATOM   3185  C C4    . DC  B 1 10  ? 111.161 13.825 -56.889 1.00 72.71  ? 156  DC  J C4    1 
ATOM   3186  N N4    . DC  B 1 10  ? 111.498 15.072 -57.174 1.00 69.96  ? 156  DC  J N4    1 
ATOM   3187  C C5    . DC  B 1 10  ? 109.804 13.497 -56.646 1.00 73.91  ? 156  DC  J C5    1 
ATOM   3188  C C6    . DC  B 1 10  ? 109.517 12.210 -56.380 1.00 74.92  ? 156  DC  J C6    1 
ATOM   3189  P P     . DA  B 1 11  ? 109.279 6.173  -53.573 1.00 85.12  ? 157  DA  J P     1 
ATOM   3190  O OP1   . DA  B 1 11  ? 108.664 5.010  -54.276 1.00 97.81  ? 157  DA  J OP1   1 
ATOM   3191  O OP2   . DA  B 1 11  ? 108.558 6.827  -52.442 1.00 94.63  ? 157  DA  J OP2   1 
ATOM   3192  O "O5'" . DA  B 1 11  ? 110.659 5.663  -53.001 1.00 86.13  ? 157  DA  J "O5'" 1 
ATOM   3193  C "C5'" . DA  B 1 11  ? 111.709 5.329  -53.878 1.00 83.03  ? 157  DA  J "C5'" 1 
ATOM   3194  C "C4'" . DA  B 1 11  ? 112.991 5.912  -53.352 1.00 82.02  ? 157  DA  J "C4'" 1 
ATOM   3195  O "O4'" . DA  B 1 11  ? 113.104 7.286  -53.778 1.00 80.18  ? 157  DA  J "O4'" 1 
ATOM   3196  C "C3'" . DA  B 1 11  ? 113.048 5.923  -51.824 1.00 80.78  ? 157  DA  J "C3'" 1 
ATOM   3197  O "O3'" . DA  B 1 11  ? 114.293 5.410  -51.365 1.00 82.50  ? 157  DA  J "O3'" 1 
ATOM   3198  C "C2'" . DA  B 1 11  ? 112.920 7.392  -51.473 1.00 79.63  ? 157  DA  J "C2'" 1 
ATOM   3199  C "C1'" . DA  B 1 11  ? 113.518 8.069  -52.681 1.00 78.33  ? 157  DA  J "C1'" 1 
ATOM   3200  N N9    . DA  B 1 11  ? 113.038 9.431  -52.902 1.00 87.25  ? 157  DA  J N9    1 
ATOM   3201  C C8    . DA  B 1 11  ? 111.748 9.905  -52.813 1.00 85.49  ? 157  DA  J C8    1 
ATOM   3202  N N7    . DA  B 1 11  ? 111.631 11.177 -53.111 1.00 83.74  ? 157  DA  J N7    1 
ATOM   3203  C C5    . DA  B 1 11  ? 112.929 11.571 -53.413 1.00 85.91  ? 157  DA  J C5    1 
ATOM   3204  C C6    . DA  B 1 11  ? 113.469 12.794 -53.832 1.00 85.63  ? 157  DA  J C6    1 
ATOM   3205  N N6    . DA  B 1 11  ? 112.736 13.879 -54.057 1.00 85.72  ? 157  DA  J N6    1 
ATOM   3206  N N1    . DA  B 1 11  ? 114.802 12.859 -54.031 1.00 84.92  ? 157  DA  J N1    1 
ATOM   3207  C C2    . DA  B 1 11  ? 115.533 11.755 -53.842 1.00 84.59  ? 157  DA  J C2    1 
ATOM   3208  N N3    . DA  B 1 11  ? 115.142 10.539 -53.470 1.00 86.02  ? 157  DA  J N3    1 
ATOM   3209  C C4    . DA  B 1 11  ? 113.810 10.512 -53.269 1.00 86.26  ? 157  DA  J C4    1 
ATOM   3210  P P     . DC  B 1 12  ? 114.631 5.413  -49.796 1.00 80.48  ? 158  DC  J P     1 
ATOM   3211  O OP1   . DC  B 1 12  ? 115.510 4.232  -49.598 1.00 63.62  ? 158  DC  J OP1   1 
ATOM   3212  O OP2   . DC  B 1 12  ? 113.384 5.532  -48.990 1.00 60.75  ? 158  DC  J OP2   1 
ATOM   3213  O "O5'" . DC  B 1 12  ? 115.499 6.737  -49.675 1.00 80.28  ? 158  DC  J "O5'" 1 
ATOM   3214  C "C5'" . DC  B 1 12  ? 116.453 7.007  -50.691 1.00 82.62  ? 158  DC  J "C5'" 1 
ATOM   3215  C "C4'" . DC  B 1 12  ? 117.289 8.209  -50.336 1.00 84.33  ? 158  DC  J "C4'" 1 
ATOM   3216  O "O4'" . DC  B 1 12  ? 116.654 9.417  -50.812 1.00 85.69  ? 158  DC  J "O4'" 1 
ATOM   3217  C "C3'" . DC  B 1 12  ? 117.538 8.406  -48.845 1.00 84.58  ? 158  DC  J "C3'" 1 
ATOM   3218  O "O3'" . DC  B 1 12  ? 118.908 8.762  -48.634 1.00 86.17  ? 158  DC  J "O3'" 1 
ATOM   3219  C "C2'" . DC  B 1 12  ? 116.623 9.568  -48.500 1.00 85.25  ? 158  DC  J "C2'" 1 
ATOM   3220  C "C1'" . DC  B 1 12  ? 116.651 10.380 -49.784 1.00 85.06  ? 158  DC  J "C1'" 1 
ATOM   3221  N N1    . DC  B 1 12  ? 115.482 11.240 -49.992 1.00 64.67  ? 158  DC  J N1    1 
ATOM   3222  C C2    . DC  B 1 12  ? 115.665 12.580 -50.446 1.00 63.11  ? 158  DC  J C2    1 
ATOM   3223  O O2    . DC  B 1 12  ? 116.817 13.003 -50.662 1.00 63.15  ? 158  DC  J O2    1 
ATOM   3224  N N3    . DC  B 1 12  ? 114.571 13.366 -50.624 1.00 61.75  ? 158  DC  J N3    1 
ATOM   3225  C C4    . DC  B 1 12  ? 113.360 12.877 -50.361 1.00 61.50  ? 158  DC  J C4    1 
ATOM   3226  N N4    . DC  B 1 12  ? 112.336 13.669 -50.516 1.00 58.43  ? 158  DC  J N4    1 
ATOM   3227  C C5    . DC  B 1 12  ? 113.156 11.539 -49.915 1.00 62.14  ? 158  DC  J C5    1 
ATOM   3228  C C6    . DC  B 1 12  ? 114.228 10.763 -49.747 1.00 63.51  ? 158  DC  J C6    1 
ATOM   3229  P P     . DC  B 1 13  ? 119.406 9.156  -47.163 1.00 78.26  ? 159  DC  J P     1 
ATOM   3230  O OP1   . DC  B 1 13  ? 120.743 8.574  -46.929 1.00 84.36  ? 159  DC  J OP1   1 
ATOM   3231  O OP2   . DC  B 1 13  ? 118.306 8.868  -46.204 1.00 83.01  ? 159  DC  J OP2   1 
ATOM   3232  O "O5'" . DC  B 1 13  ? 119.570 10.726 -47.273 1.00 79.90  ? 159  DC  J "O5'" 1 
ATOM   3233  C "C5'" . DC  B 1 13  ? 120.505 11.285 -48.172 1.00 81.84  ? 159  DC  J "C5'" 1 
ATOM   3234  C "C4'" . DC  B 1 13  ? 120.814 12.698 -47.748 1.00 84.88  ? 159  DC  J "C4'" 1 
ATOM   3235  O "O4'" . DC  B 1 13  ? 119.679 13.549 -48.045 1.00 85.38  ? 159  DC  J "O4'" 1 
ATOM   3236  C "C3'" . DC  B 1 13  ? 121.061 12.829 -46.245 1.00 85.51  ? 159  DC  J "C3'" 1 
ATOM   3237  O "O3'" . DC  B 1 13  ? 122.042 13.838 -46.004 1.00 88.41  ? 159  DC  J "O3'" 1 
ATOM   3238  C "C2'" . DC  B 1 13  ? 119.709 13.261 -45.710 1.00 85.74  ? 159  DC  J "C2'" 1 
ATOM   3239  C "C1'" . DC  B 1 13  ? 119.188 14.139 -46.844 1.00 84.47  ? 159  DC  J "C1'" 1 
ATOM   3240  N N1    . DC  B 1 13  ? 117.712 14.218 -46.933 1.00 87.14  ? 159  DC  J N1    1 
ATOM   3241  C C2    . DC  B 1 13  ? 117.097 15.483 -46.973 1.00 87.02  ? 159  DC  J C2    1 
ATOM   3242  O O2    . DC  B 1 13  ? 117.806 16.505 -46.916 1.00 85.47  ? 159  DC  J O2    1 
ATOM   3243  N N3    . DC  B 1 13  ? 115.750 15.556 -47.059 1.00 83.93  ? 159  DC  J N3    1 
ATOM   3244  C C4    . DC  B 1 13  ? 115.020 14.441 -47.081 1.00 83.33  ? 159  DC  J C4    1 
ATOM   3245  N N4    . DC  B 1 13  ? 113.698 14.565 -47.143 1.00 78.00  ? 159  DC  J N4    1 
ATOM   3246  C C5    . DC  B 1 13  ? 115.616 13.148 -47.036 1.00 84.13  ? 159  DC  J C5    1 
ATOM   3247  C C6    . DC  B 1 13  ? 116.952 13.082 -46.969 1.00 86.74  ? 159  DC  J C6    1 
ATOM   3248  P P     . DT  B 1 14  ? 122.522 14.135 -44.506 1.00 109.90 ? 160  DT  J P     1 
ATOM   3249  O OP1   . DT  B 1 14  ? 123.952 14.535 -44.561 1.00 84.55  ? 160  DT  J OP1   1 
ATOM   3250  O OP2   . DT  B 1 14  ? 122.103 13.014 -43.629 1.00 83.85  ? 160  DT  J OP2   1 
ATOM   3251  O "O5'" . DT  B 1 14  ? 121.651 15.397 -44.094 1.00 111.79 ? 160  DT  J "O5'" 1 
ATOM   3252  C "C5'" . DT  B 1 14  ? 121.787 16.642 -44.773 1.00 114.25 ? 160  DT  J "C5'" 1 
ATOM   3253  C "C4'" . DT  B 1 14  ? 121.029 17.709 -44.021 1.00 117.27 ? 160  DT  J "C4'" 1 
ATOM   3254  O "O4'" . DT  B 1 14  ? 119.607 17.618 -44.285 1.00 117.14 ? 160  DT  J "O4'" 1 
ATOM   3255  C "C3'" . DT  B 1 14  ? 121.180 17.591 -42.504 1.00 118.94 ? 160  DT  J "C3'" 1 
ATOM   3256  O "O3'" . DT  B 1 14  ? 121.227 18.890 -41.935 1.00 123.07 ? 160  DT  J "O3'" 1 
ATOM   3257  C "C2'" . DT  B 1 14  ? 119.896 16.903 -42.077 1.00 117.73 ? 160  DT  J "C2'" 1 
ATOM   3258  C "C1'" . DT  B 1 14  ? 118.907 17.509 -43.053 1.00 116.28 ? 160  DT  J "C1'" 1 
ATOM   3259  N N1    . DT  B 1 14  ? 117.677 16.726 -43.286 1.00 88.73  ? 160  DT  J N1    1 
ATOM   3260  C C2    . DT  B 1 14  ? 116.604 17.391 -43.829 1.00 86.94  ? 160  DT  J C2    1 
ATOM   3261  O O2    . DT  B 1 14  ? 116.634 18.579 -44.105 1.00 85.74  ? 160  DT  J O2    1 
ATOM   3262  N N3    . DT  B 1 14  ? 115.491 16.613 -44.033 1.00 84.91  ? 160  DT  J N3    1 
ATOM   3263  C C4    . DT  B 1 14  ? 115.350 15.266 -43.753 1.00 84.93  ? 160  DT  J C4    1 
ATOM   3264  O O4    . DT  B 1 14  ? 114.296 14.691 -44.004 1.00 82.41  ? 160  DT  J O4    1 
ATOM   3265  C C5    . DT  B 1 14  ? 116.510 14.634 -43.174 1.00 86.10  ? 160  DT  J C5    1 
ATOM   3266  C C7    . DT  B 1 14  ? 116.439 13.180 -42.827 1.00 84.71  ? 160  DT  J C7    1 
ATOM   3267  C C6    . DT  B 1 14  ? 117.606 15.383 -42.973 1.00 87.12  ? 160  DT  J C6    1 
ATOM   3268  P P     . DG  B 1 15  ? 122.319 19.234 -40.810 1.00 117.49 ? 161  DG  J P     1 
ATOM   3269  O OP1   . DG  B 1 15  ? 123.663 19.039 -41.417 1.00 121.84 ? 161  DG  J OP1   1 
ATOM   3270  O OP2   . DG  B 1 15  ? 121.961 18.496 -39.562 1.00 121.81 ? 161  DG  J OP2   1 
ATOM   3271  O "O5'" . DG  B 1 15  ? 122.084 20.795 -40.585 1.00 117.59 ? 161  DG  J "O5'" 1 
ATOM   3272  C "C5'" . DG  B 1 15  ? 122.044 21.679 -41.707 1.00 117.56 ? 161  DG  J "C5'" 1 
ATOM   3273  C "C4'" . DG  B 1 15  ? 120.809 22.553 -41.665 1.00 117.21 ? 161  DG  J "C4'" 1 
ATOM   3274  O "O4'" . DG  B 1 15  ? 119.602 21.768 -41.811 1.00 116.51 ? 161  DG  J "O4'" 1 
ATOM   3275  C "C3'" . DG  B 1 15  ? 120.631 23.358 -40.388 1.00 117.65 ? 161  DG  J "C3'" 1 
ATOM   3276  O "O3'" . DG  B 1 15  ? 120.135 24.646 -40.725 1.00 117.99 ? 161  DG  J "O3'" 1 
ATOM   3277  C "C2'" . DG  B 1 15  ? 119.590 22.573 -39.614 1.00 117.54 ? 161  DG  J "C2'" 1 
ATOM   3278  C "C1'" . DG  B 1 15  ? 118.729 21.989 -40.715 1.00 115.95 ? 161  DG  J "C1'" 1 
ATOM   3279  N N9    . DG  B 1 15  ? 118.121 20.709 -40.364 1.00 119.42 ? 161  DG  J N9    1 
ATOM   3280  C C8    . DG  B 1 15  ? 118.701 19.690 -39.649 1.00 118.38 ? 161  DG  J C8    1 
ATOM   3281  N N7    . DG  B 1 15  ? 117.918 18.658 -39.494 1.00 117.68 ? 161  DG  J N7    1 
ATOM   3282  C C5    . DG  B 1 15  ? 116.746 19.014 -40.146 1.00 116.96 ? 161  DG  J C5    1 
ATOM   3283  C C6    . DG  B 1 15  ? 115.533 18.293 -40.316 1.00 115.77 ? 161  DG  J C6    1 
ATOM   3284  O O6    . DG  B 1 15  ? 115.251 17.155 -39.928 1.00 112.84 ? 161  DG  J O6    1 
ATOM   3285  N N1    . DG  B 1 15  ? 114.597 19.033 -41.027 1.00 116.11 ? 161  DG  J N1    1 
ATOM   3286  C C2    . DG  B 1 15  ? 114.802 20.297 -41.519 1.00 117.20 ? 161  DG  J C2    1 
ATOM   3287  N N2    . DG  B 1 15  ? 113.768 20.846 -42.167 1.00 117.54 ? 161  DG  J N2    1 
ATOM   3288  N N3    . DG  B 1 15  ? 115.933 20.974 -41.383 1.00 117.82 ? 161  DG  J N3    1 
ATOM   3289  C C4    . DG  B 1 15  ? 116.853 20.280 -40.687 1.00 118.03 ? 161  DG  J C4    1 
ATOM   3290  P P     . DC  B 1 16  ? 119.933 25.740 -39.573 1.00 104.46 ? 162  DC  J P     1 
ATOM   3291  O OP1   . DC  B 1 16  ? 120.127 27.054 -40.241 1.00 111.56 ? 162  DC  J OP1   1 
ATOM   3292  O OP2   . DC  B 1 16  ? 120.752 25.391 -38.376 1.00 110.82 ? 162  DC  J OP2   1 
ATOM   3293  O "O5'" . DC  B 1 16  ? 118.397 25.581 -39.188 1.00 103.83 ? 162  DC  J "O5'" 1 
ATOM   3294  C "C5'" . DC  B 1 16  ? 117.379 25.959 -40.107 1.00 103.23 ? 162  DC  J "C5'" 1 
ATOM   3295  C "C4'" . DC  B 1 16  ? 116.027 25.883 -39.441 1.00 102.68 ? 162  DC  J "C4'" 1 
ATOM   3296  O "O4'" . DC  B 1 16  ? 115.665 24.500 -39.214 1.00 102.45 ? 162  DC  J "O4'" 1 
ATOM   3297  C "C3'" . DC  B 1 16  ? 115.954 26.571 -38.077 1.00 102.69 ? 162  DC  J "C3'" 1 
ATOM   3298  O "O3'" . DC  B 1 16  ? 114.690 27.211 -37.931 1.00 102.99 ? 162  DC  J "O3'" 1 
ATOM   3299  C "C2'" . DC  B 1 16  ? 116.026 25.411 -37.103 1.00 102.70 ? 162  DC  J "C2'" 1 
ATOM   3300  C "C1'" . DC  B 1 16  ? 115.258 24.354 -37.868 1.00 103.11 ? 162  DC  J "C1'" 1 
ATOM   3301  N N1    . DC  B 1 16  ? 115.503 22.964 -37.461 1.00 110.86 ? 162  DC  J N1    1 
ATOM   3302  C C2    . DC  B 1 16  ? 114.518 22.016 -37.716 1.00 110.86 ? 162  DC  J C2    1 
ATOM   3303  O O2    . DC  B 1 16  ? 113.492 22.373 -38.305 1.00 110.92 ? 162  DC  J O2    1 
ATOM   3304  N N3    . DC  B 1 16  ? 114.705 20.739 -37.322 1.00 110.53 ? 162  DC  J N3    1 
ATOM   3305  C C4    . DC  B 1 16  ? 115.833 20.394 -36.705 1.00 111.10 ? 162  DC  J C4    1 
ATOM   3306  N N4    . DC  B 1 16  ? 115.976 19.127 -36.334 1.00 110.43 ? 162  DC  J N4    1 
ATOM   3307  C C5    . DC  B 1 16  ? 116.866 21.337 -36.443 1.00 110.93 ? 162  DC  J C5    1 
ATOM   3308  C C6    . DC  B 1 16  ? 116.662 22.601 -36.835 1.00 110.84 ? 162  DC  J C6    1 
ATOM   3309  P P     . DA  B 1 17  ? 114.582 28.795 -38.105 1.00 114.28 ? 163  DA  J P     1 
ATOM   3310  O OP1   . DA  B 1 17  ? 115.245 29.117 -39.393 1.00 80.33  ? 163  DA  J OP1   1 
ATOM   3311  O OP2   . DA  B 1 17  ? 115.060 29.421 -36.858 1.00 80.67  ? 163  DA  J OP2   1 
ATOM   3312  O "O5'" . DA  B 1 17  ? 113.014 29.057 -38.192 1.00 114.28 ? 163  DA  J "O5'" 1 
ATOM   3313  C "C5'" . DA  B 1 17  ? 112.233 28.545 -39.272 1.00 112.78 ? 163  DA  J "C5'" 1 
ATOM   3314  C "C4'" . DA  B 1 17  ? 111.088 27.711 -38.742 1.00 112.34 ? 163  DA  J "C4'" 1 
ATOM   3315  O "O4'" . DA  B 1 17  ? 111.602 26.504 -38.129 1.00 112.09 ? 163  DA  J "O4'" 1 
ATOM   3316  C "C3'" . DA  B 1 17  ? 110.205 28.372 -37.678 1.00 111.50 ? 163  DA  J "C3'" 1 
ATOM   3317  O "O3'" . DA  B 1 17  ? 108.875 27.847 -37.804 1.00 112.11 ? 163  DA  J "O3'" 1 
ATOM   3318  C "C2'" . DA  B 1 17  ? 110.806 27.850 -36.387 1.00 111.07 ? 163  DA  J "C2'" 1 
ATOM   3319  C "C1'" . DA  B 1 17  ? 111.133 26.425 -36.792 1.00 110.62 ? 163  DA  J "C1'" 1 
ATOM   3320  N N9    . DA  B 1 17  ? 112.155 25.759 -35.989 1.00 76.77  ? 163  DA  J N9    1 
ATOM   3321  C C8    . DA  B 1 17  ? 113.193 26.309 -35.288 1.00 76.28  ? 163  DA  J C8    1 
ATOM   3322  N N7    . DA  B 1 17  ? 113.921 25.427 -34.654 1.00 75.76  ? 163  DA  J N7    1 
ATOM   3323  C C5    . DA  B 1 17  ? 113.327 24.211 -34.965 1.00 76.33  ? 163  DA  J C5    1 
ATOM   3324  C C6    . DA  B 1 17  ? 113.629 22.879 -34.604 1.00 76.45  ? 163  DA  J C6    1 
ATOM   3325  N N6    . DA  B 1 17  ? 114.650 22.533 -33.819 1.00 76.51  ? 163  DA  J N6    1 
ATOM   3326  N N1    . DA  B 1 17  ? 112.832 21.903 -35.082 1.00 76.05  ? 163  DA  J N1    1 
ATOM   3327  C C2    . DA  B 1 17  ? 111.806 22.241 -35.862 1.00 75.86  ? 163  DA  J C2    1 
ATOM   3328  N N3    . DA  B 1 17  ? 111.421 23.451 -36.277 1.00 76.14  ? 163  DA  J N3    1 
ATOM   3329  C C4    . DA  B 1 17  ? 112.238 24.403 -35.785 1.00 76.47  ? 163  DA  J C4    1 
ATOM   3330  P P     . DG  B 1 18  ? 107.597 28.741 -37.399 1.00 108.16 ? 164  DG  J P     1 
ATOM   3331  O OP1   . DG  B 1 18  ? 106.922 29.095 -38.670 1.00 97.32  ? 164  DG  J OP1   1 
ATOM   3332  O OP2   . DG  B 1 18  ? 108.023 29.818 -36.449 1.00 97.39  ? 164  DG  J OP2   1 
ATOM   3333  O "O5'" . DG  B 1 18  ? 106.664 27.711 -36.623 1.00 104.80 ? 164  DG  J "O5'" 1 
ATOM   3334  C "C5'" . DG  B 1 18  ? 106.449 26.411 -37.149 1.00 102.54 ? 164  DG  J "C5'" 1 
ATOM   3335  C "C4'" . DG  B 1 18  ? 106.573 25.367 -36.062 1.00 101.71 ? 164  DG  J "C4'" 1 
ATOM   3336  O "O4'" . DG  B 1 18  ? 107.938 25.154 -35.596 1.00 101.41 ? 164  DG  J "O4'" 1 
ATOM   3337  C "C3'" . DG  B 1 18  ? 105.747 25.618 -34.804 1.00 101.05 ? 164  DG  J "C3'" 1 
ATOM   3338  O "O3'" . DG  B 1 18  ? 105.207 24.385 -34.395 1.00 100.03 ? 164  DG  J "O3'" 1 
ATOM   3339  C "C2'" . DG  B 1 18  ? 106.790 25.959 -33.762 1.00 100.88 ? 164  DG  J "C2'" 1 
ATOM   3340  C "C1'" . DG  B 1 18  ? 107.868 24.989 -34.184 1.00 101.67 ? 164  DG  J "C1'" 1 
ATOM   3341  N N9    . DG  B 1 18  ? 109.190 25.185 -33.589 1.00 91.60  ? 164  DG  J N9    1 
ATOM   3342  C C8    . DG  B 1 18  ? 109.836 26.375 -33.362 1.00 91.01  ? 164  DG  J C8    1 
ATOM   3343  N N7    . DG  B 1 18  ? 110.987 26.228 -32.764 1.00 91.48  ? 164  DG  J N7    1 
ATOM   3344  C C5    . DG  B 1 18  ? 111.116 24.857 -32.597 1.00 91.12  ? 164  DG  J C5    1 
ATOM   3345  C C6    . DG  B 1 18  ? 112.158 24.103 -32.018 1.00 90.87  ? 164  DG  J C6    1 
ATOM   3346  O O6    . DG  B 1 18  ? 113.223 24.508 -31.533 1.00 90.96  ? 164  DG  J O6    1 
ATOM   3347  N N1    . DG  B 1 18  ? 111.880 22.739 -32.047 1.00 90.39  ? 164  DG  J N1    1 
ATOM   3348  C C2    . DG  B 1 18  ? 110.754 22.174 -32.582 1.00 89.59  ? 164  DG  J C2    1 
ATOM   3349  N N2    . DG  B 1 18  ? 110.678 20.843 -32.514 1.00 87.80  ? 164  DG  J N2    1 
ATOM   3350  N N3    . DG  B 1 18  ? 109.779 22.864 -33.139 1.00 90.18  ? 164  DG  J N3    1 
ATOM   3351  C C4    . DG  B 1 18  ? 110.021 24.195 -33.108 1.00 91.11  ? 164  DG  J C4    1 
ATOM   3352  P P     . DA  B 1 19  ? 103.669 24.298 -34.049 1.00 85.54  ? 165  DA  J P     1 
ATOM   3353  O OP1   . DA  B 1 19  ? 103.011 24.310 -35.374 1.00 65.35  ? 165  DA  J OP1   1 
ATOM   3354  O OP2   . DA  B 1 19  ? 103.350 25.334 -33.042 1.00 65.60  ? 165  DA  J OP2   1 
ATOM   3355  O "O5'" . DA  B 1 19  ? 103.505 22.862 -33.402 1.00 87.01  ? 165  DA  J "O5'" 1 
ATOM   3356  C "C5'" . DA  B 1 19  ? 103.831 21.709 -34.154 1.00 90.63  ? 165  DA  J "C5'" 1 
ATOM   3357  C "C4'" . DA  B 1 19  ? 104.488 20.688 -33.261 1.00 92.95  ? 165  DA  J "C4'" 1 
ATOM   3358  O "O4'" . DA  B 1 19  ? 105.807 21.150 -32.877 1.00 92.68  ? 165  DA  J "O4'" 1 
ATOM   3359  C "C3'" . DA  B 1 19  ? 103.722 20.451 -31.962 1.00 95.20  ? 165  DA  J "C3'" 1 
ATOM   3360  O "O3'" . DA  B 1 19  ? 103.700 19.064 -31.655 1.00 99.50  ? 165  DA  J "O3'" 1 
ATOM   3361  C "C2'" . DA  B 1 19  ? 104.528 21.216 -30.929 1.00 94.62  ? 165  DA  J "C2'" 1 
ATOM   3362  C "C1'" . DA  B 1 19  ? 105.940 21.067 -31.469 1.00 93.60  ? 165  DA  J "C1'" 1 
ATOM   3363  N N9    . DA  B 1 19  ? 106.895 22.095 -31.039 1.00 73.05  ? 165  DA  J N9    1 
ATOM   3364  C C8    . DA  B 1 19  ? 106.826 23.443 -31.269 1.00 73.74  ? 165  DA  J C8    1 
ATOM   3365  N N7    . DA  B 1 19  ? 107.836 24.113 -30.774 1.00 73.84  ? 165  DA  J N7    1 
ATOM   3366  C C5    . DA  B 1 19  ? 108.625 23.145 -30.173 1.00 73.76  ? 165  DA  J C5    1 
ATOM   3367  C C6    . DA  B 1 19  ? 109.844 23.219 -29.484 1.00 74.22  ? 165  DA  J C6    1 
ATOM   3368  N N6    . DA  B 1 19  ? 110.489 24.358 -29.268 1.00 74.80  ? 165  DA  J N6    1 
ATOM   3369  N N1    . DA  B 1 19  ? 110.380 22.073 -29.020 1.00 73.56  ? 165  DA  J N1    1 
ATOM   3370  C C2    . DA  B 1 19  ? 109.724 20.935 -29.235 1.00 73.64  ? 165  DA  J C2    1 
ATOM   3371  N N3    . DA  B 1 19  ? 108.562 20.733 -29.863 1.00 73.45  ? 165  DA  J N3    1 
ATOM   3372  C C4    . DA  B 1 19  ? 108.059 21.896 -30.320 1.00 73.51  ? 165  DA  J C4    1 
ATOM   3373  P P     . DT  B 1 20  ? 103.161 18.594 -30.231 1.00 126.15 ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 20  ? 102.581 17.239 -30.354 1.00 109.76 ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 20  ? 102.339 19.697 -29.686 1.00 109.33 ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 20  ? 104.494 18.477 -29.380 1.00 128.78 ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 20  ? 105.519 17.594 -29.799 1.00 132.53 ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 20  ? 106.419 17.252 -28.638 1.00 135.84 ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 20  ? 107.288 18.372 -28.364 1.00 136.23 ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 20  ? 105.691 16.938 -27.331 1.00 137.65 ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 20  ? 106.313 15.816 -26.695 1.00 140.12 ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 20  ? 105.860 18.211 -26.519 1.00 137.15 ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 20  ? 107.208 18.724 -26.996 1.00 136.58 ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 20  ? 107.410 20.183 -26.903 1.00 119.51 ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 20  ? 108.535 20.653 -26.253 1.00 120.29 ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 20  ? 109.378 19.919 -25.742 1.00 120.89 ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 20  ? 108.645 22.021 -26.228 1.00 120.10 ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 20  ? 107.776 22.938 -26.776 1.00 119.31 ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 20  ? 108.013 24.136 -26.680 1.00 118.96 ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 20  ? 106.626 22.376 -27.438 1.00 118.97 ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 20  ? 105.633 23.298 -28.069 1.00 118.17 ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 20  ? 106.499 21.046 -27.464 1.00 119.02 ? 166  DT  J C6    1 
ATOM   3393  P P     . DT  B 1 21  ? 105.710 15.239 -25.323 1.00 139.74 ? 167  DT  J P     1 
ATOM   3394  O OP1   . DT  B 1 21  ? 105.703 13.751 -25.369 1.00 133.04 ? 167  DT  J OP1   1 
ATOM   3395  O OP2   . DT  B 1 21  ? 104.447 15.971 -25.041 1.00 133.19 ? 167  DT  J OP2   1 
ATOM   3396  O "O5'" . DT  B 1 21  ? 106.807 15.686 -24.263 1.00 142.57 ? 167  DT  J "O5'" 1 
ATOM   3397  C "C5'" . DT  B 1 21  ? 108.173 15.319 -24.449 1.00 146.54 ? 167  DT  J "C5'" 1 
ATOM   3398  C "C4'" . DT  B 1 21  ? 108.996 15.764 -23.264 1.00 148.55 ? 167  DT  J "C4'" 1 
ATOM   3399  O "O4'" . DT  B 1 21  ? 109.306 17.174 -23.372 1.00 148.44 ? 167  DT  J "O4'" 1 
ATOM   3400  C "C3'" . DT  B 1 21  ? 108.273 15.580 -21.933 1.00 150.12 ? 167  DT  J "C3'" 1 
ATOM   3401  O "O3'" . DT  B 1 21  ? 109.161 15.098 -20.933 1.00 152.70 ? 167  DT  J "O3'" 1 
ATOM   3402  C "C2'" . DT  B 1 21  ? 107.793 16.977 -21.592 1.00 149.49 ? 167  DT  J "C2'" 1 
ATOM   3403  C "C1'" . DT  B 1 21  ? 108.868 17.857 -22.209 1.00 148.25 ? 167  DT  J "C1'" 1 
ATOM   3404  N N1    . DT  B 1 21  ? 108.394 19.196 -22.622 1.00 140.91 ? 167  DT  J N1    1 
ATOM   3405  C C2    . DT  B 1 21  ? 109.253 20.269 -22.477 1.00 139.97 ? 167  DT  J C2    1 
ATOM   3406  O O2    . DT  B 1 21  ? 110.387 20.164 -22.027 1.00 139.82 ? 167  DT  J O2    1 
ATOM   3407  N N3    . DT  B 1 21  ? 108.726 21.480 -22.881 1.00 139.08 ? 167  DT  J N3    1 
ATOM   3408  C C4    . DT  B 1 21  ? 107.458 21.713 -23.402 1.00 138.54 ? 167  DT  J C4    1 
ATOM   3409  O O4    . DT  B 1 21  ? 107.123 22.850 -23.724 1.00 137.91 ? 167  DT  J O4    1 
ATOM   3410  C C5    . DT  B 1 21  ? 106.618 20.545 -23.524 1.00 138.70 ? 167  DT  J C5    1 
ATOM   3411  C C7    . DT  B 1 21  ? 105.237 20.702 -24.073 1.00 138.31 ? 167  DT  J C7    1 
ATOM   3412  C C6    . DT  B 1 21  ? 107.120 19.363 -23.136 1.00 139.76 ? 167  DT  J C6    1 
ATOM   3413  P P     . DC  B 1 22  ? 108.688 15.100 -19.405 1.00 157.84 ? 168  DC  J P     1 
ATOM   3414  O OP1   . DC  B 1 22  ? 109.414 14.018 -18.689 1.00 144.36 ? 168  DC  J OP1   1 
ATOM   3415  O OP2   . DC  B 1 22  ? 107.202 15.130 -19.392 1.00 143.49 ? 168  DC  J OP2   1 
ATOM   3416  O "O5'" . DC  B 1 22  ? 109.231 16.495 -18.872 1.00 159.38 ? 168  DC  J "O5'" 1 
ATOM   3417  C "C5'" . DC  B 1 22  ? 110.631 16.701 -18.697 1.00 161.81 ? 168  DC  J "C5'" 1 
ATOM   3418  C "C4'" . DC  B 1 22  ? 110.872 17.699 -17.590 1.00 163.41 ? 168  DC  J "C4'" 1 
ATOM   3419  O "O4'" . DC  B 1 22  ? 110.685 19.048 -18.088 1.00 163.78 ? 168  DC  J "O4'" 1 
ATOM   3420  C "C3'" . DC  B 1 22  ? 109.919 17.536 -16.406 1.00 164.26 ? 168  DC  J "C3'" 1 
ATOM   3421  O "O3'" . DC  B 1 22  ? 110.625 17.654 -15.169 1.00 165.34 ? 168  DC  J "O3'" 1 
ATOM   3422  C "C2'" . DC  B 1 22  ? 108.920 18.665 -16.595 1.00 164.31 ? 168  DC  J "C2'" 1 
ATOM   3423  C "C1'" . DC  B 1 22  ? 109.748 19.740 -17.279 1.00 164.00 ? 168  DC  J "C1'" 1 
ATOM   3424  N N1    . DC  B 1 22  ? 108.971 20.653 -18.146 1.00 150.30 ? 168  DC  J N1    1 
ATOM   3425  C C2    . DC  B 1 22  ? 109.353 22.007 -18.221 1.00 150.25 ? 168  DC  J C2    1 
ATOM   3426  O O2    . DC  B 1 22  ? 110.354 22.388 -17.587 1.00 150.28 ? 168  DC  J O2    1 
ATOM   3427  N N3    . DC  B 1 22  ? 108.621 22.861 -18.986 1.00 149.93 ? 168  DC  J N3    1 
ATOM   3428  C C4    . DC  B 1 22  ? 107.560 22.410 -19.663 1.00 149.82 ? 168  DC  J C4    1 
ATOM   3429  N N4    . DC  B 1 22  ? 106.868 23.285 -20.399 1.00 149.58 ? 168  DC  J N4    1 
ATOM   3430  C C5    . DC  B 1 22  ? 107.161 21.039 -19.616 1.00 149.73 ? 168  DC  J C5    1 
ATOM   3431  C C6    . DC  B 1 22  ? 107.889 20.203 -18.855 1.00 149.96 ? 168  DC  J C6    1 
ATOM   3432  P P     . DT  B 1 23  ? 109.810 17.845 -13.797 1.00 162.79 ? 169  DT  J P     1 
ATOM   3433  O OP1   . DT  B 1 23  ? 110.563 17.182 -12.704 1.00 157.08 ? 169  DT  J OP1   1 
ATOM   3434  O OP2   . DT  B 1 23  ? 108.383 17.494 -14.015 1.00 156.75 ? 169  DT  J OP2   1 
ATOM   3435  O "O5'" . DT  B 1 23  ? 109.911 19.413 -13.578 1.00 163.35 ? 169  DT  J "O5'" 1 
ATOM   3436  C "C5'" . DT  B 1 23  ? 111.182 20.054 -13.579 1.00 164.62 ? 169  DT  J "C5'" 1 
ATOM   3437  C "C4'" . DT  B 1 23  ? 111.114 21.324 -12.767 1.00 165.72 ? 169  DT  J "C4'" 1 
ATOM   3438  O "O4'" . DT  B 1 23  ? 110.561 22.392 -13.572 1.00 165.91 ? 169  DT  J "O4'" 1 
ATOM   3439  C "C3'" . DT  B 1 23  ? 110.213 21.198 -11.540 1.00 166.25 ? 169  DT  J "C3'" 1 
ATOM   3440  O "O3'" . DT  B 1 23  ? 110.796 21.863 -10.417 1.00 166.85 ? 169  DT  J "O3'" 1 
ATOM   3441  C "C2'" . DT  B 1 23  ? 108.910 21.843 -11.984 1.00 166.04 ? 169  DT  J "C2'" 1 
ATOM   3442  C "C1'" . DT  B 1 23  ? 109.366 22.891 -12.987 1.00 165.72 ? 169  DT  J "C1'" 1 
ATOM   3443  N N1    . DT  B 1 23  ? 108.409 23.163 -14.083 1.00 159.79 ? 169  DT  J N1    1 
ATOM   3444  C C2    . DT  B 1 23  ? 108.249 24.469 -14.480 1.00 159.95 ? 169  DT  J C2    1 
ATOM   3445  O O2    . DT  B 1 23  ? 108.841 25.399 -13.960 1.00 160.25 ? 169  DT  J O2    1 
ATOM   3446  N N3    . DT  B 1 23  ? 107.363 24.650 -15.517 1.00 159.78 ? 169  DT  J N3    1 
ATOM   3447  C C4    . DT  B 1 23  ? 106.637 23.676 -16.177 1.00 159.49 ? 169  DT  J C4    1 
ATOM   3448  O O4    . DT  B 1 23  ? 105.883 23.991 -17.098 1.00 159.68 ? 169  DT  J O4    1 
ATOM   3449  C C5    . DT  B 1 23  ? 106.846 22.328 -15.703 1.00 159.29 ? 169  DT  J C5    1 
ATOM   3450  C C7    . DT  B 1 23  ? 106.098 21.209 -16.356 1.00 158.87 ? 169  DT  J C7    1 
ATOM   3451  C C6    . DT  B 1 23  ? 107.708 22.141 -14.691 1.00 159.39 ? 169  DT  J C6    1 
ATOM   3452  P P     . DA  B 1 24  ? 109.928 22.086 -9.083  1.00 177.28 ? 170  DA  J P     1 
ATOM   3453  O OP1   . DA  B 1 24  ? 110.864 22.192 -7.933  1.00 150.39 ? 170  DA  J OP1   1 
ATOM   3454  O OP2   . DA  B 1 24  ? 108.833 21.081 -9.048  1.00 150.37 ? 170  DA  J OP2   1 
ATOM   3455  O "O5'" . DA  B 1 24  ? 109.286 23.517 -9.336  1.00 176.66 ? 170  DA  J "O5'" 1 
ATOM   3456  C "C5'" . DA  B 1 24  ? 110.105 24.602 -9.762  1.00 175.74 ? 170  DA  J "C5'" 1 
ATOM   3457  C "C4'" . DA  B 1 24  ? 109.309 25.881 -9.744  1.00 174.82 ? 170  DA  J "C4'" 1 
ATOM   3458  O "O4'" . DA  B 1 24  ? 108.493 25.983 -10.936 1.00 175.18 ? 170  DA  J "O4'" 1 
ATOM   3459  C "C3'" . DA  B 1 24  ? 108.352 25.938 -8.558  1.00 174.17 ? 170  DA  J "C3'" 1 
ATOM   3460  O "O3'" . DA  B 1 24  ? 108.345 27.247 -8.005  1.00 172.58 ? 170  DA  J "O3'" 1 
ATOM   3461  C "C2'" . DA  B 1 24  ? 107.007 25.586 -9.169  1.00 174.41 ? 170  DA  J "C2'" 1 
ATOM   3462  C "C1'" . DA  B 1 24  ? 107.128 26.133 -10.582 1.00 175.08 ? 170  DA  J "C1'" 1 
ATOM   3463  N N9    . DA  B 1 24  ? 106.317 25.429 -11.581 1.00 148.13 ? 170  DA  J N9    1 
ATOM   3464  C C8    . DA  B 1 24  ? 106.105 24.074 -11.695 1.00 148.40 ? 170  DA  J C8    1 
ATOM   3465  N N7    . DA  B 1 24  ? 105.307 23.743 -12.684 1.00 148.25 ? 170  DA  J N7    1 
ATOM   3466  C C5    . DA  B 1 24  ? 104.975 24.959 -13.267 1.00 148.03 ? 170  DA  J C5    1 
ATOM   3467  C C6    . DA  B 1 24  ? 104.159 25.292 -14.365 1.00 147.77 ? 170  DA  J C6    1 
ATOM   3468  N N6    . DA  B 1 24  ? 103.509 24.394 -15.105 1.00 147.16 ? 170  DA  J N6    1 
ATOM   3469  N N1    . DA  B 1 24  ? 104.037 26.597 -14.683 1.00 147.71 ? 170  DA  J N1    1 
ATOM   3470  C C2    . DA  B 1 24  ? 104.697 27.500 -13.947 1.00 147.88 ? 170  DA  J C2    1 
ATOM   3471  N N3    . DA  B 1 24  ? 105.497 27.314 -12.898 1.00 148.00 ? 170  DA  J N3    1 
ATOM   3472  C C4    . DA  B 1 24  ? 105.595 26.005 -12.602 1.00 148.08 ? 170  DA  J C4    1 
ATOM   3473  P P     . DC  B 1 25  ? 107.582 27.520 -6.622  1.00 173.00 ? 171  DC  J P     1 
ATOM   3474  O OP1   . DC  B 1 25  ? 108.560 28.094 -5.664  1.00 114.29 ? 171  DC  J OP1   1 
ATOM   3475  O OP2   . DC  B 1 25  ? 106.826 26.295 -6.255  1.00 114.14 ? 171  DC  J OP2   1 
ATOM   3476  O "O5'" . DC  B 1 25  ? 106.547 28.655 -7.032  1.00 171.79 ? 171  DC  J "O5'" 1 
ATOM   3477  C "C5'" . DC  B 1 25  ? 106.955 29.717 -7.891  1.00 169.73 ? 171  DC  J "C5'" 1 
ATOM   3478  C "C4'" . DC  B 1 25  ? 105.750 30.469 -8.400  1.00 168.43 ? 171  DC  J "C4'" 1 
ATOM   3479  O "O4'" . DC  B 1 25  ? 105.128 29.769 -9.505  1.00 167.97 ? 171  DC  J "O4'" 1 
ATOM   3480  C "C3'" . DC  B 1 25  ? 104.664 30.660 -7.345  1.00 167.62 ? 171  DC  J "C3'" 1 
ATOM   3481  O "O3'" . DC  B 1 25  ? 104.175 31.997 -7.386  1.00 166.22 ? 171  DC  J "O3'" 1 
ATOM   3482  C "C2'" . DC  B 1 25  ? 103.589 29.665 -7.749  1.00 167.34 ? 171  DC  J "C2'" 1 
ATOM   3483  C "C1'" . DC  B 1 25  ? 103.738 29.629 -9.259  1.00 167.18 ? 171  DC  J "C1'" 1 
ATOM   3484  N N1    . DC  B 1 25  ? 103.282 28.383 -9.903  1.00 107.57 ? 171  DC  J N1    1 
ATOM   3485  C C2    . DC  B 1 25  ? 102.408 28.472 -11.000 1.00 106.83 ? 171  DC  J C2    1 
ATOM   3486  O O2    . DC  B 1 25  ? 102.043 29.594 -11.384 1.00 106.18 ? 171  DC  J O2    1 
ATOM   3487  N N3    . DC  B 1 25  ? 101.990 27.335 -11.610 1.00 106.15 ? 171  DC  J N3    1 
ATOM   3488  C C4    . DC  B 1 25  ? 102.408 26.147 -11.165 1.00 106.37 ? 171  DC  J C4    1 
ATOM   3489  N N4    . DC  B 1 25  ? 101.981 25.055 -11.802 1.00 105.53 ? 171  DC  J N4    1 
ATOM   3490  C C5    . DC  B 1 25  ? 103.289 26.027 -10.046 1.00 106.67 ? 171  DC  J C5    1 
ATOM   3491  C C6    . DC  B 1 25  ? 103.698 27.161 -9.451  1.00 107.35 ? 171  DC  J C6    1 
ATOM   3492  P P     . DC  B 1 26  ? 103.104 32.470 -6.299  1.00 131.78 ? 172  DC  J P     1 
ATOM   3493  O OP1   . DC  B 1 26  ? 103.232 33.937 -6.140  1.00 141.81 ? 172  DC  J OP1   1 
ATOM   3494  O OP2   . DC  B 1 26  ? 103.221 31.588 -5.109  1.00 141.55 ? 172  DC  J OP2   1 
ATOM   3495  O "O5'" . DC  B 1 26  ? 101.720 32.156 -7.015  1.00 131.07 ? 172  DC  J "O5'" 1 
ATOM   3496  C "C5'" . DC  B 1 26  ? 101.376 32.801 -8.238  1.00 129.07 ? 172  DC  J "C5'" 1 
ATOM   3497  C "C4'" . DC  B 1 26  ? 99.943  32.497 -8.597  1.00 127.95 ? 172  DC  J "C4'" 1 
ATOM   3498  O "O4'" . DC  B 1 26  ? 99.845  31.224 -9.284  1.00 128.61 ? 172  DC  J "O4'" 1 
ATOM   3499  C "C3'" . DC  B 1 26  ? 99.013  32.409 -7.387  1.00 126.73 ? 172  DC  J "C3'" 1 
ATOM   3500  O "O3'" . DC  B 1 26  ? 97.829  33.169 -7.622  1.00 124.47 ? 172  DC  J "O3'" 1 
ATOM   3501  C "C2'" . DC  B 1 26  ? 98.710  30.923 -7.271  1.00 127.14 ? 172  DC  J "C2'" 1 
ATOM   3502  C "C1'" . DC  B 1 26  ? 98.787  30.469 -8.720  1.00 127.66 ? 172  DC  J "C1'" 1 
ATOM   3503  N N1    . DC  B 1 26  ? 99.058  29.033 -8.954  1.00 136.91 ? 172  DC  J N1    1 
ATOM   3504  C C2    . DC  B 1 26  ? 98.783  28.490 -10.219 1.00 136.79 ? 172  DC  J C2    1 
ATOM   3505  O O2    . DC  B 1 26  ? 98.345  29.232 -11.109 1.00 137.31 ? 172  DC  J O2    1 
ATOM   3506  N N3    . DC  B 1 26  ? 99.003  27.173 -10.437 1.00 135.69 ? 172  DC  J N3    1 
ATOM   3507  C C4    . DC  B 1 26  ? 99.479  26.406 -9.459  1.00 135.23 ? 172  DC  J C4    1 
ATOM   3508  N N4    . DC  B 1 26  ? 99.673  25.115 -9.717  1.00 134.27 ? 172  DC  J N4    1 
ATOM   3509  C C5    . DC  B 1 26  ? 99.778  26.930 -8.169  1.00 135.69 ? 172  DC  J C5    1 
ATOM   3510  C C6    . DC  B 1 26  ? 99.555  28.237 -7.962  1.00 136.31 ? 172  DC  J C6    1 
ATOM   3511  P P     . DA  B 1 27  ? 97.628  34.566 -6.852  1.00 130.93 ? 173  DA  J P     1 
ATOM   3512  O OP1   . DA  B 1 27  ? 98.711  35.486 -7.298  1.00 133.40 ? 173  DA  J OP1   1 
ATOM   3513  O OP2   . DA  B 1 27  ? 97.462  34.255 -5.407  1.00 132.99 ? 173  DA  J OP2   1 
ATOM   3514  O "O5'" . DA  B 1 27  ? 96.245  35.138 -7.393  1.00 128.30 ? 173  DA  J "O5'" 1 
ATOM   3515  C "C5'" . DA  B 1 27  ? 96.175  35.772 -8.668  1.00 123.70 ? 173  DA  J "C5'" 1 
ATOM   3516  C "C4'" . DA  B 1 27  ? 95.188  35.047 -9.550  1.00 121.03 ? 173  DA  J "C4'" 1 
ATOM   3517  O "O4'" . DA  B 1 27  ? 95.519  33.639 -9.587  1.00 119.66 ? 173  DA  J "O4'" 1 
ATOM   3518  C "C3'" . DA  B 1 27  ? 93.746  35.090 -9.058  1.00 120.02 ? 173  DA  J "C3'" 1 
ATOM   3519  O "O3'" . DA  B 1 27  ? 92.934  34.832 -10.198 1.00 118.82 ? 173  DA  J "O3'" 1 
ATOM   3520  C "C2'" . DA  B 1 27  ? 93.672  33.852 -8.189  1.00 119.69 ? 173  DA  J "C2'" 1 
ATOM   3521  C "C1'" . DA  B 1 27  ? 94.409  32.902 -9.101  1.00 119.71 ? 173  DA  J "C1'" 1 
ATOM   3522  N N9    . DA  B 1 27  ? 94.899  31.660 -8.513  1.00 122.41 ? 173  DA  J N9    1 
ATOM   3523  C C8    . DA  B 1 27  ? 95.292  31.382 -7.226  1.00 122.90 ? 173  DA  J C8    1 
ATOM   3524  N N7    . DA  B 1 27  ? 95.706  30.147 -7.056  1.00 123.34 ? 173  DA  J N7    1 
ATOM   3525  C C5    . DA  B 1 27  ? 95.572  29.576 -8.314  1.00 123.16 ? 173  DA  J C5    1 
ATOM   3526  C C6    . DA  B 1 27  ? 95.861  28.296 -8.806  1.00 123.39 ? 173  DA  J C6    1 
ATOM   3527  N N6    . DA  B 1 27  ? 96.388  27.319 -8.061  1.00 122.76 ? 173  DA  J N6    1 
ATOM   3528  N N1    . DA  B 1 27  ? 95.598  28.053 -10.112 1.00 123.17 ? 173  DA  J N1    1 
ATOM   3529  C C2    . DA  B 1 27  ? 95.090  29.042 -10.861 1.00 123.45 ? 173  DA  J C2    1 
ATOM   3530  N N3    . DA  B 1 27  ? 94.792  30.287 -10.515 1.00 123.40 ? 173  DA  J N3    1 
ATOM   3531  C C4    . DA  B 1 27  ? 95.061  30.492 -9.215  1.00 122.98 ? 173  DA  J C4    1 
ATOM   3532  P P     . DA  B 1 28  ? 91.787  35.860 -10.634 1.00 128.08 ? 174  DA  J P     1 
ATOM   3533  O OP1   . DA  B 1 28  ? 92.442  36.911 -11.463 1.00 120.74 ? 174  DA  J OP1   1 
ATOM   3534  O OP2   . DA  B 1 28  ? 90.993  36.243 -9.433  1.00 120.66 ? 174  DA  J OP2   1 
ATOM   3535  O "O5'" . DA  B 1 28  ? 90.876  34.953 -11.575 1.00 126.36 ? 174  DA  J "O5'" 1 
ATOM   3536  C "C5'" . DA  B 1 28  ? 91.473  34.080 -12.538 1.00 123.98 ? 174  DA  J "C5'" 1 
ATOM   3537  C "C4'" . DA  B 1 28  ? 90.875  32.695 -12.443 1.00 122.42 ? 174  DA  J "C4'" 1 
ATOM   3538  O "O4'" . DA  B 1 28  ? 91.490  31.882 -11.410 1.00 121.44 ? 174  DA  J "O4'" 1 
ATOM   3539  C "C3'" . DA  B 1 28  ? 89.374  32.659 -12.169 1.00 121.52 ? 174  DA  J "C3'" 1 
ATOM   3540  O "O3'" . DA  B 1 28  ? 88.809  31.610 -12.934 1.00 120.86 ? 174  DA  J "O3'" 1 
ATOM   3541  C "C2'" . DA  B 1 28  ? 89.305  32.262 -10.708 1.00 120.81 ? 174  DA  J "C2'" 1 
ATOM   3542  C "C1'" . DA  B 1 28  ? 90.463  31.288 -10.632 1.00 120.97 ? 174  DA  J "C1'" 1 
ATOM   3543  N N9    . DA  B 1 28  ? 90.984  31.040 -9.289  1.00 113.52 ? 174  DA  J N9    1 
ATOM   3544  C C8    . DA  B 1 28  ? 90.962  31.877 -8.199  1.00 113.95 ? 174  DA  J C8    1 
ATOM   3545  N N7    . DA  B 1 28  ? 91.502  31.358 -7.122  1.00 113.58 ? 174  DA  J N7    1 
ATOM   3546  C C5    . DA  B 1 28  ? 91.908  30.094 -7.532  1.00 113.40 ? 174  DA  J C5    1 
ATOM   3547  C C6    . DA  B 1 28  ? 92.542  29.043 -6.855  1.00 113.58 ? 174  DA  J C6    1 
ATOM   3548  N N6    . DA  B 1 28  ? 92.900  29.100 -5.570  1.00 114.01 ? 174  DA  J N6    1 
ATOM   3549  N N1    . DA  B 1 28  ? 92.799  27.916 -7.549  1.00 113.11 ? 174  DA  J N1    1 
ATOM   3550  C C2    . DA  B 1 28  ? 92.444  27.863 -8.835  1.00 112.35 ? 174  DA  J C2    1 
ATOM   3551  N N3    . DA  B 1 28  ? 91.849  28.784 -9.584  1.00 112.61 ? 174  DA  J N3    1 
ATOM   3552  C C4    . DA  B 1 28  ? 91.600  29.888 -8.864  1.00 113.00 ? 174  DA  J C4    1 
ATOM   3553  P P     . DA  B 1 29  ? 87.762  31.952 -14.079 1.00 105.58 ? 175  DA  J P     1 
ATOM   3554  O OP1   . DA  B 1 29  ? 88.197  31.250 -15.302 1.00 120.24 ? 175  DA  J OP1   1 
ATOM   3555  O OP2   . DA  B 1 29  ? 87.586  33.422 -14.098 1.00 119.76 ? 175  DA  J OP2   1 
ATOM   3556  O "O5'" . DA  B 1 29  ? 86.435  31.256 -13.562 1.00 101.82 ? 175  DA  J "O5'" 1 
ATOM   3557  C "C5'" . DA  B 1 29  ? 86.505  30.273 -12.537 1.00 98.15  ? 175  DA  J "C5'" 1 
ATOM   3558  C "C4'" . DA  B 1 29  ? 87.199  29.032 -13.051 1.00 94.90  ? 175  DA  J "C4'" 1 
ATOM   3559  O "O4'" . DA  B 1 29  ? 88.337  28.760 -12.212 1.00 93.90  ? 175  DA  J "O4'" 1 
ATOM   3560  C "C3'" . DA  B 1 29  ? 86.346  27.767 -13.008 1.00 93.72  ? 175  DA  J "C3'" 1 
ATOM   3561  O "O3'" . DA  B 1 29  ? 86.715  26.879 -14.067 1.00 91.96  ? 175  DA  J "O3'" 1 
ATOM   3562  C "C2'" . DA  B 1 29  ? 86.679  27.167 -11.657 1.00 93.58  ? 175  DA  J "C2'" 1 
ATOM   3563  C "C1'" . DA  B 1 29  ? 88.105  27.616 -11.402 1.00 94.02  ? 175  DA  J "C1'" 1 
ATOM   3564  N N9    . DA  B 1 29  ? 88.342  28.009 -10.012 1.00 107.26 ? 175  DA  J N9    1 
ATOM   3565  C C8    . DA  B 1 29  ? 88.188  29.252 -9.448  1.00 106.68 ? 175  DA  J C8    1 
ATOM   3566  N N7    . DA  B 1 29  ? 88.498  29.296 -8.178  1.00 105.73 ? 175  DA  J N7    1 
ATOM   3567  C C5    . DA  B 1 29  ? 88.878  27.995 -7.885  1.00 106.95 ? 175  DA  J C5    1 
ATOM   3568  C C6    . DA  B 1 29  ? 89.327  27.393 -6.712  1.00 106.65 ? 175  DA  J C6    1 
ATOM   3569  N N6    . DA  B 1 29  ? 89.493  28.046 -5.564  1.00 108.30 ? 175  DA  J N6    1 
ATOM   3570  N N1    . DA  B 1 29  ? 89.613  26.078 -6.753  1.00 106.88 ? 175  DA  J N1    1 
ATOM   3571  C C2    . DA  B 1 29  ? 89.464  25.427 -7.908  1.00 107.25 ? 175  DA  J C2    1 
ATOM   3572  N N3    . DA  B 1 29  ? 89.059  25.883 -9.081  1.00 106.09 ? 175  DA  J N3    1 
ATOM   3573  C C4    . DA  B 1 29  ? 88.778  27.191 -9.001  1.00 106.61 ? 175  DA  J C4    1 
ATOM   3574  P P     . DA  B 1 30  ? 85.585  25.995 -14.795 1.00 91.71  ? 176  DA  J P     1 
ATOM   3575  O OP1   . DA  B 1 30  ? 86.184  25.502 -16.069 1.00 114.64 ? 176  DA  J OP1   1 
ATOM   3576  O OP2   . DA  B 1 30  ? 84.340  26.815 -14.820 1.00 113.22 ? 176  DA  J OP2   1 
ATOM   3577  O "O5'" . DA  B 1 30  ? 85.375  24.760 -13.809 1.00 90.74  ? 176  DA  J "O5'" 1 
ATOM   3578  C "C5'" . DA  B 1 30  ? 86.416  23.816 -13.613 1.00 89.07  ? 176  DA  J "C5'" 1 
ATOM   3579  C "C4'" . DA  B 1 30  ? 86.206  23.066 -12.322 1.00 88.71  ? 176  DA  J "C4'" 1 
ATOM   3580  O "O4'" . DA  B 1 30  ? 86.546  23.880 -11.172 1.00 88.06  ? 176  DA  J "O4'" 1 
ATOM   3581  C "C3'" . DA  B 1 30  ? 84.779  22.575 -12.077 1.00 88.62  ? 176  DA  J "C3'" 1 
ATOM   3582  O "O3'" . DA  B 1 30  ? 84.823  21.275 -11.504 1.00 88.90  ? 176  DA  J "O3'" 1 
ATOM   3583  C "C2'" . DA  B 1 30  ? 84.270  23.513 -11.002 1.00 88.36  ? 176  DA  J "C2'" 1 
ATOM   3584  C "C1'" . DA  B 1 30  ? 85.531  23.688 -10.194 1.00 89.36  ? 176  DA  J "C1'" 1 
ATOM   3585  N N9    . DA  B 1 30  ? 85.539  24.826 -9.274  1.00 113.14 ? 176  DA  J N9    1 
ATOM   3586  C C8    . DA  B 1 30  ? 85.002  26.073 -9.466  1.00 114.53 ? 176  DA  J C8    1 
ATOM   3587  N N7    . DA  B 1 30  ? 85.166  26.880 -8.447  1.00 114.31 ? 176  DA  J N7    1 
ATOM   3588  C C5    . DA  B 1 30  ? 85.855  26.112 -7.516  1.00 114.12 ? 176  DA  J C5    1 
ATOM   3589  C C6    . DA  B 1 30  ? 86.322  26.387 -6.214  1.00 112.82 ? 176  DA  J C6    1 
ATOM   3590  N N6    . DA  B 1 30  ? 86.159  27.557 -5.593  1.00 110.96 ? 176  DA  J N6    1 
ATOM   3591  N N1    . DA  B 1 30  ? 86.968  25.401 -5.562  1.00 112.73 ? 176  DA  J N1    1 
ATOM   3592  C C2    . DA  B 1 30  ? 87.125  24.223 -6.174  1.00 112.95 ? 176  DA  J C2    1 
ATOM   3593  N N3    . DA  B 1 30  ? 86.731  23.842 -7.387  1.00 114.17 ? 176  DA  J N3    1 
ATOM   3594  C C4    . DA  B 1 30  ? 86.095  24.845 -8.015  1.00 113.91 ? 176  DA  J C4    1 
ATOM   3595  P P     . DG  B 1 31  ? 83.463  20.457 -11.304 1.00 107.04 ? 177  DG  J P     1 
ATOM   3596  O OP1   . DG  B 1 31  ? 83.460  19.356 -12.306 1.00 94.84  ? 177  DG  J OP1   1 
ATOM   3597  O OP2   . DG  B 1 31  ? 82.324  21.414 -11.246 1.00 95.40  ? 177  DG  J OP2   1 
ATOM   3598  O "O5'" . DG  B 1 31  ? 83.607  19.820 -9.858  1.00 111.06 ? 177  DG  J "O5'" 1 
ATOM   3599  C "C5'" . DG  B 1 31  ? 84.763  19.082 -9.508  1.00 115.26 ? 177  DG  J "C5'" 1 
ATOM   3600  C "C4'" . DG  B 1 31  ? 84.855  18.962 -8.009  1.00 118.13 ? 177  DG  J "C4'" 1 
ATOM   3601  O "O4'" . DG  B 1 31  ? 85.091  20.273 -7.437  1.00 118.77 ? 177  DG  J "O4'" 1 
ATOM   3602  C "C3'" . DG  B 1 31  ? 83.575  18.438 -7.362  1.00 120.13 ? 177  DG  J "C3'" 1 
ATOM   3603  O "O3'" . DG  B 1 31  ? 83.902  17.505 -6.333  1.00 122.91 ? 177  DG  J "O3'" 1 
ATOM   3604  C "C2'" . DG  B 1 31  ? 82.931  19.685 -6.784  1.00 119.71 ? 177  DG  J "C2'" 1 
ATOM   3605  C "C1'" . DG  B 1 31  ? 84.137  20.532 -6.421  1.00 120.24 ? 177  DG  J "C1'" 1 
ATOM   3606  N N9    . DG  B 1 31  ? 83.885  21.972 -6.381  1.00 108.52 ? 177  DG  J N9    1 
ATOM   3607  C C8    . DG  B 1 31  ? 83.556  22.785 -7.438  1.00 109.07 ? 177  DG  J C8    1 
ATOM   3608  N N7    . DG  B 1 31  ? 83.357  24.028 -7.087  1.00 108.51 ? 177  DG  J N7    1 
ATOM   3609  C C5    . DG  B 1 31  ? 83.576  24.042 -5.718  1.00 109.11 ? 177  DG  J C5    1 
ATOM   3610  C C6    . DG  B 1 31  ? 83.497  25.109 -4.786  1.00 109.69 ? 177  DG  J C6    1 
ATOM   3611  O O6    . DG  B 1 31  ? 83.208  26.286 -4.989  1.00 109.71 ? 177  DG  J O6    1 
ATOM   3612  N N1    . DG  B 1 31  ? 83.799  24.688 -3.501  1.00 110.77 ? 177  DG  J N1    1 
ATOM   3613  C C2    . DG  B 1 31  ? 84.141  23.407 -3.153  1.00 111.63 ? 177  DG  J C2    1 
ATOM   3614  N N2    . DG  B 1 31  ? 84.426  23.205 -1.855  1.00 113.12 ? 177  DG  J N2    1 
ATOM   3615  N N3    . DG  B 1 31  ? 84.208  22.399 -4.009  1.00 111.19 ? 177  DG  J N3    1 
ATOM   3616  C C4    . DG  B 1 31  ? 83.915  22.785 -5.265  1.00 109.54 ? 177  DG  J C4    1 
ATOM   3617  P P     . DT  B 1 32  ? 82.727  16.730 -5.560  1.00 125.82 ? 178  DT  J P     1 
ATOM   3618  O OP1   . DT  B 1 32  ? 83.298  15.446 -5.085  1.00 119.41 ? 178  DT  J OP1   1 
ATOM   3619  O OP2   . DT  B 1 32  ? 81.512  16.718 -6.412  1.00 118.50 ? 178  DT  J OP2   1 
ATOM   3620  O "O5'" . DT  B 1 32  ? 82.462  17.648 -4.287  1.00 128.11 ? 178  DT  J "O5'" 1 
ATOM   3621  C "C5'" . DT  B 1 32  ? 83.450  17.774 -3.267  1.00 129.50 ? 178  DT  J "C5'" 1 
ATOM   3622  C "C4'" . DT  B 1 32  ? 82.841  18.388 -2.031  1.00 130.53 ? 178  DT  J "C4'" 1 
ATOM   3623  O "O4'" . DT  B 1 32  ? 82.698  19.821 -2.178  1.00 130.37 ? 178  DT  J "O4'" 1 
ATOM   3624  C "C3'" . DT  B 1 32  ? 81.446  17.860 -1.718  1.00 131.74 ? 178  DT  J "C3'" 1 
ATOM   3625  O "O3'" . DT  B 1 32  ? 81.293  17.760 -0.309  1.00 134.14 ? 178  DT  J "O3'" 1 
ATOM   3626  C "C2'" . DT  B 1 32  ? 80.538  18.951 -2.255  1.00 130.75 ? 178  DT  J "C2'" 1 
ATOM   3627  C "C1'" . DT  B 1 32  ? 81.350  20.192 -1.941  1.00 130.40 ? 178  DT  J "C1'" 1 
ATOM   3628  N N1    . DT  B 1 32  ? 81.049  21.375 -2.773  1.00 123.14 ? 178  DT  J N1    1 
ATOM   3629  C C2    . DT  B 1 32  ? 80.988  22.610 -2.159  1.00 123.82 ? 178  DT  J C2    1 
ATOM   3630  O O2    . DT  B 1 32  ? 81.135  22.767 -0.960  1.00 124.53 ? 178  DT  J O2    1 
ATOM   3631  N N3    . DT  B 1 32  ? 80.736  23.660 -3.007  1.00 123.52 ? 178  DT  J N3    1 
ATOM   3632  C C4    . DT  B 1 32  ? 80.525  23.600 -4.370  1.00 123.89 ? 178  DT  J C4    1 
ATOM   3633  O O4    . DT  B 1 32  ? 80.305  24.628 -5.000  1.00 124.21 ? 178  DT  J O4    1 
ATOM   3634  C C5    . DT  B 1 32  ? 80.585  22.275 -4.945  1.00 123.95 ? 178  DT  J C5    1 
ATOM   3635  C C7    . DT  B 1 32  ? 80.362  22.113 -6.415  1.00 123.44 ? 178  DT  J C7    1 
ATOM   3636  C C6    . DT  B 1 32  ? 80.842  21.243 -4.130  1.00 123.69 ? 178  DT  J C6    1 
ATOM   3637  P P     . DG  B 1 33  ? 80.334  16.636 0.302   1.00 153.94 ? 179  DG  J P     1 
ATOM   3638  O OP1   . DG  B 1 33  ? 81.194  15.553 0.830   1.00 113.51 ? 179  DG  J OP1   1 
ATOM   3639  O OP2   . DG  B 1 33  ? 79.294  16.317 -0.708  1.00 113.94 ? 179  DG  J OP2   1 
ATOM   3640  O "O5'" . DG  B 1 33  ? 79.634  17.379 1.521   1.00 155.44 ? 179  DG  J "O5'" 1 
ATOM   3641  C "C5'" . DG  B 1 33  ? 80.410  18.063 2.497   1.00 157.71 ? 179  DG  J "C5'" 1 
ATOM   3642  C "C4'" . DG  B 1 33  ? 79.624  19.225 3.056   1.00 159.50 ? 179  DG  J "C4'" 1 
ATOM   3643  O "O4'" . DG  B 1 33  ? 79.605  20.332 2.119   1.00 159.78 ? 179  DG  J "O4'" 1 
ATOM   3644  C "C3'" . DG  B 1 33  ? 78.158  18.892 3.337   1.00 160.48 ? 179  DG  J "C3'" 1 
ATOM   3645  O "O3'" . DG  B 1 33  ? 77.732  19.544 4.529   1.00 162.35 ? 179  DG  J "O3'" 1 
ATOM   3646  C "C2'" . DG  B 1 33  ? 77.430  19.514 2.162   1.00 160.21 ? 179  DG  J "C2'" 1 
ATOM   3647  C "C1'" . DG  B 1 33  ? 78.264  20.759 1.948   1.00 159.54 ? 179  DG  J "C1'" 1 
ATOM   3648  N N9    . DG  B 1 33  ? 78.124  21.355 0.625   1.00 117.29 ? 179  DG  J N9    1 
ATOM   3649  C C8    . DG  B 1 33  ? 78.171  20.707 -0.585  1.00 116.72 ? 179  DG  J C8    1 
ATOM   3650  N N7    . DG  B 1 33  ? 77.946  21.498 -1.597  1.00 116.16 ? 179  DG  J N7    1 
ATOM   3651  C C5    . DG  B 1 33  ? 77.749  22.747 -1.023  1.00 116.03 ? 179  DG  J C5    1 
ATOM   3652  C C6    . DG  B 1 33  ? 77.441  23.990 -1.621  1.00 116.04 ? 179  DG  J C6    1 
ATOM   3653  O O6    . DG  B 1 33  ? 77.265  24.245 -2.818  1.00 115.38 ? 179  DG  J O6    1 
ATOM   3654  N N1    . DG  B 1 33  ? 77.326  25.000 -0.671  1.00 115.75 ? 179  DG  J N1    1 
ATOM   3655  C C2    . DG  B 1 33  ? 77.482  24.835 0.681   1.00 115.88 ? 179  DG  J C2    1 
ATOM   3656  N N2    . DG  B 1 33  ? 77.335  25.935 1.433   1.00 115.94 ? 179  DG  J N2    1 
ATOM   3657  N N3    . DG  B 1 33  ? 77.762  23.677 1.253   1.00 116.02 ? 179  DG  J N3    1 
ATOM   3658  C C4    . DG  B 1 33  ? 77.878  22.681 0.347   1.00 116.57 ? 179  DG  J C4    1 
ATOM   3659  P P     . DT  B 1 34  ? 76.203  19.418 4.990   1.00 154.82 ? 180  DT  J P     1 
ATOM   3660  O OP1   . DT  B 1 34  ? 76.230  18.994 6.413   1.00 146.05 ? 180  DT  J OP1   1 
ATOM   3661  O OP2   . DT  B 1 34  ? 75.471  18.596 3.991   1.00 145.61 ? 180  DT  J OP2   1 
ATOM   3662  O "O5'" . DT  B 1 34  ? 75.666  20.914 4.924   1.00 154.28 ? 180  DT  J "O5'" 1 
ATOM   3663  C "C5'" . DT  B 1 34  ? 76.214  21.910 5.777   1.00 152.45 ? 180  DT  J "C5'" 1 
ATOM   3664  C "C4'" . DT  B 1 34  ? 75.284  23.095 5.857   1.00 151.02 ? 180  DT  J "C4'" 1 
ATOM   3665  O "O4'" . DT  B 1 34  ? 75.243  23.749 4.569   1.00 150.62 ? 180  DT  J "O4'" 1 
ATOM   3666  C "C3'" . DT  B 1 34  ? 73.835  22.760 6.209   1.00 150.49 ? 180  DT  J "C3'" 1 
ATOM   3667  O "O3'" . DT  B 1 34  ? 73.331  23.764 7.104   1.00 149.87 ? 180  DT  J "O3'" 1 
ATOM   3668  C "C2'" . DT  B 1 34  ? 73.137  22.763 4.860   1.00 150.39 ? 180  DT  J "C2'" 1 
ATOM   3669  C "C1'" . DT  B 1 34  ? 73.911  23.822 4.097   1.00 150.31 ? 180  DT  J "C1'" 1 
ATOM   3670  N N1    . DT  B 1 34  ? 73.947  23.635 2.640   1.00 140.45 ? 180  DT  J N1    1 
ATOM   3671  C C2    . DT  B 1 34  ? 73.741  24.736 1.845   1.00 140.37 ? 180  DT  J C2    1 
ATOM   3672  O O2    . DT  B 1 34  ? 73.527  25.847 2.293   1.00 140.23 ? 180  DT  J O2    1 
ATOM   3673  N N3    . DT  B 1 34  ? 73.794  24.489 0.498   1.00 140.09 ? 180  DT  J N3    1 
ATOM   3674  C C4    . DT  B 1 34  ? 74.024  23.277 -0.119  1.00 139.70 ? 180  DT  J C4    1 
ATOM   3675  O O4    . DT  B 1 34  ? 74.039  23.210 -1.347  1.00 139.39 ? 180  DT  J O4    1 
ATOM   3676  C C5    . DT  B 1 34  ? 74.233  22.160 0.779   1.00 139.72 ? 180  DT  J C5    1 
ATOM   3677  C C7    . DT  B 1 34  ? 74.494  20.803 0.204   1.00 139.25 ? 180  DT  J C7    1 
ATOM   3678  C C6    . DT  B 1 34  ? 74.183  22.394 2.096   1.00 139.91 ? 180  DT  J C6    1 
ATOM   3679  P P     . DA  B 1 35  ? 71.789  24.202 7.038   1.00 134.78 ? 181  DA  J P     1 
ATOM   3680  O OP1   . DA  B 1 35  ? 71.465  24.941 8.288   1.00 110.85 ? 181  DA  J OP1   1 
ATOM   3681  O OP2   . DA  B 1 35  ? 70.991  22.998 6.659   1.00 110.67 ? 181  DA  J OP2   1 
ATOM   3682  O "O5'" . DA  B 1 35  ? 71.758  25.228 5.819   1.00 134.26 ? 181  DA  J "O5'" 1 
ATOM   3683  C "C5'" . DA  B 1 35  ? 71.536  26.628 6.015   1.00 133.64 ? 181  DA  J "C5'" 1 
ATOM   3684  C "C4'" . DA  B 1 35  ? 70.285  27.050 5.279   1.00 133.14 ? 181  DA  J "C4'" 1 
ATOM   3685  O "O4'" . DA  B 1 35  ? 70.396  26.673 3.883   1.00 132.59 ? 181  DA  J "O4'" 1 
ATOM   3686  C "C3'" . DA  B 1 35  ? 69.028  26.328 5.780   1.00 132.71 ? 181  DA  J "C3'" 1 
ATOM   3687  O "O3'" . DA  B 1 35  ? 67.883  27.061 5.372   1.00 132.87 ? 181  DA  J "O3'" 1 
ATOM   3688  C "C2'" . DA  B 1 35  ? 68.994  25.102 4.897   1.00 131.89 ? 181  DA  J "C2'" 1 
ATOM   3689  C "C1'" . DA  B 1 35  ? 69.318  25.788 3.589   1.00 130.93 ? 181  DA  J "C1'" 1 
ATOM   3690  N N9    . DA  B 1 35  ? 69.708  24.905 2.499   1.00 105.18 ? 181  DA  J N9    1 
ATOM   3691  C C8    . DA  B 1 35  ? 69.873  23.541 2.519   1.00 104.27 ? 181  DA  J C8    1 
ATOM   3692  N N7    . DA  B 1 35  ? 70.207  23.035 1.359   1.00 102.35 ? 181  DA  J N7    1 
ATOM   3693  C C5    . DA  B 1 35  ? 70.270  24.142 0.520   1.00 102.09 ? 181  DA  J C5    1 
ATOM   3694  C C6    . DA  B 1 35  ? 70.571  24.278 -0.840  1.00 100.95 ? 181  DA  J C6    1 
ATOM   3695  N N6    . DA  B 1 35  ? 70.881  23.247 -1.635  1.00 99.38  ? 181  DA  J N6    1 
ATOM   3696  N N1    . DA  B 1 35  ? 70.540  25.525 -1.366  1.00 100.36 ? 181  DA  J N1    1 
ATOM   3697  C C2    . DA  B 1 35  ? 70.224  26.552 -0.566  1.00 100.80 ? 181  DA  J C2    1 
ATOM   3698  N N3    . DA  B 1 35  ? 69.925  26.549 0.723   1.00 101.97 ? 181  DA  J N3    1 
ATOM   3699  C C4    . DA  B 1 35  ? 69.967  25.298 1.212   1.00 103.03 ? 181  DA  J C4    1 
ATOM   3700  P P     . DT  B 1 36  ? 67.370  28.297 6.228   1.00 143.10 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 36  ? 68.504  28.919 6.950   1.00 113.57 ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 36  ? 66.207  27.780 6.986   1.00 113.65 ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 36  ? 66.893  29.302 5.087   1.00 141.84 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 36  ? 67.839  29.865 4.169   1.00 139.12 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 36  ? 67.185  30.157 2.836   1.00 137.04 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 36  ? 67.553  29.190 1.817   1.00 135.43 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 36  ? 65.656  30.214 2.841   1.00 135.35 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 36  ? 65.219  31.374 2.126   1.00 132.84 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 36  ? 65.256  28.947 2.101   1.00 134.80 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 36  ? 66.388  28.815 1.096   1.00 133.85 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 36  ? 66.590  27.455 0.544   1.00 102.68 ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 36  ? 66.832  27.306 -0.816  1.00 101.20 ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 36  ? 66.892  28.241 -1.605  1.00 100.37 ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 36  ? 66.999  26.008 -1.222  1.00 99.78  ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 36  ? 66.948  24.874 -0.440  1.00 99.98  ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 36  ? 67.115  23.773 -0.952  1.00 97.54  ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 36  ? 66.691  25.100 0.961   1.00 101.12 ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 36  ? 66.613  23.924 1.882   1.00 101.72 ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 36  ? 66.531  26.361 1.377   1.00 101.95 ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 37  ? 63.665  31.547 1.763   1.00 120.07 ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 37  ? 63.235  32.938 2.073   1.00 105.27 ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 37  ? 62.943  30.395 2.373   1.00 103.90 ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 37  ? 63.647  31.364 0.181   1.00 116.90 ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 37  ? 64.671  31.937 -0.628  1.00 112.53 ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 37  ? 64.482  31.538 -2.073  1.00 109.41 ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 37  ? 64.760  30.128 -2.239  1.00 107.72 ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 37  ? 63.080  31.764 -2.650  1.00 108.33 ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 37  ? 63.176  32.324 -3.965  1.00 106.46 ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 37  ? 62.492  30.365 -2.725  1.00 107.45 ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 37  ? 63.723  29.536 -3.008  1.00 107.56 ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 37  ? 63.632  28.114 -2.639  1.00 93.39  ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 37  ? 63.729  27.174 -3.643  1.00 93.78  ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 37  ? 63.841  27.462 -4.821  1.00 94.01  ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 37  ? 63.692  25.879 -3.219  1.00 94.10  ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 37  ? 63.567  25.435 -1.926  1.00 94.34  ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 37  ? 63.588  24.231 -1.697  1.00 94.18  ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 37  ? 63.432  26.470 -0.925  1.00 94.55  ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 37  ? 63.251  26.080 0.506   1.00 94.44  ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 37  ? 63.473  27.741 -1.328  1.00 93.99  ? 183  DT  J C6    1 
ATOM   3740  P P     . DT  B 1 38  ? 61.841  32.682 -4.782  1.00 90.13  ? 184  DT  J P     1 
ATOM   3741  O OP1   . DT  B 1 38  ? 62.074  33.946 -5.530  1.00 86.60  ? 184  DT  J OP1   1 
ATOM   3742  O OP2   . DT  B 1 38  ? 60.672  32.564 -3.873  1.00 87.63  ? 184  DT  J OP2   1 
ATOM   3743  O "O5'" . DT  B 1 38  ? 61.729  31.495 -5.832  1.00 88.69  ? 184  DT  J "O5'" 1 
ATOM   3744  C "C5'" . DT  B 1 38  ? 62.756  31.272 -6.797  1.00 85.39  ? 184  DT  J "C5'" 1 
ATOM   3745  C "C4'" . DT  B 1 38  ? 62.348  30.162 -7.734  1.00 83.92  ? 184  DT  J "C4'" 1 
ATOM   3746  O "O4'" . DT  B 1 38  ? 62.367  28.888 -7.036  1.00 83.32  ? 184  DT  J "O4'" 1 
ATOM   3747  C "C3'" . DT  B 1 38  ? 60.932  30.328 -8.291  1.00 82.37  ? 184  DT  J "C3'" 1 
ATOM   3748  O "O3'" . DT  B 1 38  ? 60.902  29.957 -9.673  1.00 79.09  ? 184  DT  J "O3'" 1 
ATOM   3749  C "C2'" . DT  B 1 38  ? 60.115  29.351 -7.459  1.00 83.00  ? 184  DT  J "C2'" 1 
ATOM   3750  C "C1'" . DT  B 1 38  ? 61.118  28.238 -7.208  1.00 83.73  ? 184  DT  J "C1'" 1 
ATOM   3751  N N1    . DT  B 1 38  ? 60.865  27.393 -6.025  1.00 83.50  ? 184  DT  J N1    1 
ATOM   3752  C C2    . DT  B 1 38  ? 61.079  26.053 -6.162  1.00 85.23  ? 184  DT  J C2    1 
ATOM   3753  O O2    . DT  B 1 38  ? 61.468  25.551 -7.197  1.00 87.28  ? 184  DT  J O2    1 
ATOM   3754  N N3    . DT  B 1 38  ? 60.819  25.310 -5.045  1.00 85.59  ? 184  DT  J N3    1 
ATOM   3755  C C4    . DT  B 1 38  ? 60.370  25.766 -3.824  1.00 86.00  ? 184  DT  J C4    1 
ATOM   3756  O O4    . DT  B 1 38  ? 60.146  24.968 -2.906  1.00 85.67  ? 184  DT  J O4    1 
ATOM   3757  C C5    . DT  B 1 38  ? 60.186  27.189 -3.738  1.00 85.77  ? 184  DT  J C5    1 
ATOM   3758  C C7    . DT  B 1 38  ? 59.737  27.778 -2.436  1.00 87.03  ? 184  DT  J C7    1 
ATOM   3759  C C6    . DT  B 1 38  ? 60.433  27.925 -4.834  1.00 84.75  ? 184  DT  J C6    1 
ATOM   3760  P P     . DG  B 1 39  ? 60.483  31.036 -10.788 1.00 81.74  ? 185  DG  J P     1 
ATOM   3761  O OP1   . DG  B 1 39  ? 61.460  32.152 -10.788 1.00 94.83  ? 185  DG  J OP1   1 
ATOM   3762  O OP2   . DG  B 1 39  ? 59.039  31.320 -10.589 1.00 94.94  ? 185  DG  J OP2   1 
ATOM   3763  O "O5'" . DG  B 1 39  ? 60.697  30.242 -12.147 1.00 80.55  ? 185  DG  J "O5'" 1 
ATOM   3764  C "C5'" . DG  B 1 39  ? 61.947  29.623 -12.426 1.00 76.43  ? 185  DG  J "C5'" 1 
ATOM   3765  C "C4'" . DG  B 1 39  ? 61.748  28.161 -12.751 1.00 74.35  ? 185  DG  J "C4'" 1 
ATOM   3766  O "O4'" . DG  B 1 39  ? 61.263  27.453 -11.590 1.00 74.19  ? 185  DG  J "O4'" 1 
ATOM   3767  C "C3'" . DG  B 1 39  ? 60.752  27.850 -13.866 1.00 72.69  ? 185  DG  J "C3'" 1 
ATOM   3768  O "O3'" . DG  B 1 39  ? 61.204  26.693 -14.555 1.00 66.87  ? 185  DG  J "O3'" 1 
ATOM   3769  C "C2'" . DG  B 1 39  ? 59.484  27.492 -13.118 1.00 73.79  ? 185  DG  J "C2'" 1 
ATOM   3770  C "C1'" . DG  B 1 39  ? 60.034  26.796 -11.890 1.00 74.03  ? 185  DG  J "C1'" 1 
ATOM   3771  N N9    . DG  B 1 39  ? 59.188  26.902 -10.707 1.00 88.67  ? 185  DG  J N9    1 
ATOM   3772  C C8    . DG  B 1 39  ? 58.515  28.019 -10.251 1.00 89.58  ? 185  DG  J C8    1 
ATOM   3773  N N7    . DG  B 1 39  ? 57.896  27.814 -9.121  1.00 92.08  ? 185  DG  J N7    1 
ATOM   3774  C C5    . DG  B 1 39  ? 58.169  26.482 -8.820  1.00 90.37  ? 185  DG  J C5    1 
ATOM   3775  C C6    . DG  B 1 39  ? 57.777  25.693 -7.718  1.00 89.63  ? 185  DG  J C6    1 
ATOM   3776  O O6    . DG  B 1 39  ? 57.112  26.027 -6.730  1.00 89.88  ? 185  DG  J O6    1 
ATOM   3777  N N1    . DG  B 1 39  ? 58.241  24.388 -7.833  1.00 88.82  ? 185  DG  J N1    1 
ATOM   3778  C C2    . DG  B 1 39  ? 58.989  23.908 -8.872  1.00 89.18  ? 185  DG  J C2    1 
ATOM   3779  N N2    . DG  B 1 39  ? 59.305  22.618 -8.817  1.00 87.38  ? 185  DG  J N2    1 
ATOM   3780  N N3    . DG  B 1 39  ? 59.386  24.637 -9.894  1.00 88.58  ? 185  DG  J N3    1 
ATOM   3781  C C4    . DG  B 1 39  ? 58.942  25.904 -9.805  1.00 88.93  ? 185  DG  J C4    1 
ATOM   3782  P P     . DG  B 1 40  ? 60.884  26.526 -16.103 1.00 67.26  ? 186  DG  J P     1 
ATOM   3783  O OP1   . DG  B 1 40  ? 62.139  26.105 -16.763 1.00 60.43  ? 186  DG  J OP1   1 
ATOM   3784  O OP2   . DG  B 1 40  ? 60.192  27.765 -16.537 1.00 58.26  ? 186  DG  J OP2   1 
ATOM   3785  O "O5'" . DG  B 1 40  ? 59.904  25.283 -16.131 1.00 67.71  ? 186  DG  J "O5'" 1 
ATOM   3786  C "C5'" . DG  B 1 40  ? 60.323  24.032 -15.604 1.00 74.01  ? 186  DG  J "C5'" 1 
ATOM   3787  C "C4'" . DG  B 1 40  ? 59.123  23.225 -15.176 1.00 77.64  ? 186  DG  J "C4'" 1 
ATOM   3788  O "O4'" . DG  B 1 40  ? 58.523  23.817 -14.000 1.00 77.53  ? 186  DG  J "O4'" 1 
ATOM   3789  C "C3'" . DG  B 1 40  ? 58.009  23.160 -16.223 1.00 80.94  ? 186  DG  J "C3'" 1 
ATOM   3790  O "O3'" . DG  B 1 40  ? 57.458  21.857 -16.240 1.00 86.34  ? 186  DG  J "O3'" 1 
ATOM   3791  C "C2'" . DG  B 1 40  ? 56.957  24.113 -15.693 1.00 79.71  ? 186  DG  J "C2'" 1 
ATOM   3792  C "C1'" . DG  B 1 40  ? 57.125  23.910 -14.207 1.00 78.71  ? 186  DG  J "C1'" 1 
ATOM   3793  N N9    . DG  B 1 40  ? 56.606  24.962 -13.344 1.00 75.20  ? 186  DG  J N9    1 
ATOM   3794  C C8    . DG  B 1 40  ? 56.426  26.290 -13.630 1.00 74.23  ? 186  DG  J C8    1 
ATOM   3795  N N7    . DG  B 1 40  ? 55.970  26.974 -12.616 1.00 73.72  ? 186  DG  J N7    1 
ATOM   3796  C C5    . DG  B 1 40  ? 55.838  26.035 -11.607 1.00 74.77  ? 186  DG  J C5    1 
ATOM   3797  C C6    . DG  B 1 40  ? 55.426  26.182 -10.252 1.00 75.42  ? 186  DG  J C6    1 
ATOM   3798  O O6    . DG  B 1 40  ? 55.127  27.223 -9.637  1.00 74.53  ? 186  DG  J O6    1 
ATOM   3799  N N1    . DG  B 1 40  ? 55.427  24.954 -9.590  1.00 74.02  ? 186  DG  J N1    1 
ATOM   3800  C C2    . DG  B 1 40  ? 55.822  23.752 -10.146 1.00 74.58  ? 186  DG  J C2    1 
ATOM   3801  N N2    . DG  B 1 40  ? 55.778  22.678 -9.357  1.00 73.27  ? 186  DG  J N2    1 
ATOM   3802  N N3    . DG  B 1 40  ? 56.235  23.616 -11.385 1.00 73.51  ? 186  DG  J N3    1 
ATOM   3803  C C4    . DG  B 1 40  ? 56.214  24.785 -12.053 1.00 74.29  ? 186  DG  J C4    1 
ATOM   3804  P P     . DA  B 1 41  ? 57.585  20.976 -17.563 1.00 88.43  ? 187  DA  J P     1 
ATOM   3805  O OP1   . DA  B 1 41  ? 59.033  20.903 -17.881 1.00 96.61  ? 187  DA  J OP1   1 
ATOM   3806  O OP2   . DA  B 1 41  ? 56.639  21.526 -18.558 1.00 97.65  ? 187  DA  J OP2   1 
ATOM   3807  O "O5'" . DA  B 1 41  ? 57.085  19.540 -17.099 1.00 90.40  ? 187  DA  J "O5'" 1 
ATOM   3808  C "C5'" . DA  B 1 41  ? 57.851  18.773 -16.179 1.00 93.53  ? 187  DA  J "C5'" 1 
ATOM   3809  C "C4'" . DA  B 1 41  ? 56.941  18.136 -15.158 1.00 95.82  ? 187  DA  J "C4'" 1 
ATOM   3810  O "O4'" . DA  B 1 41  ? 56.430  19.145 -14.257 1.00 96.04  ? 187  DA  J "O4'" 1 
ATOM   3811  C "C3'" . DA  B 1 41  ? 55.718  17.444 -15.757 1.00 96.85  ? 187  DA  J "C3'" 1 
ATOM   3812  O "O3'" . DA  B 1 41  ? 55.431  16.273 -14.996 1.00 100.72 ? 187  DA  J "O3'" 1 
ATOM   3813  C "C2'" . DA  B 1 41  ? 54.616  18.465 -15.556 1.00 96.18  ? 187  DA  J "C2'" 1 
ATOM   3814  C "C1'" . DA  B 1 41  ? 55.016  19.085 -14.236 1.00 94.47  ? 187  DA  J "C1'" 1 
ATOM   3815  N N9    . DA  B 1 41  ? 54.519  20.439 -14.027 1.00 99.24  ? 187  DA  J N9    1 
ATOM   3816  C C8    . DA  B 1 41  ? 54.532  21.505 -14.892 1.00 97.79  ? 187  DA  J C8    1 
ATOM   3817  N N7    . DA  B 1 41  ? 54.020  22.600 -14.389 1.00 97.04  ? 187  DA  J N7    1 
ATOM   3818  C C5    . DA  B 1 41  ? 53.645  22.230 -13.105 1.00 97.52  ? 187  DA  J C5    1 
ATOM   3819  C C6    . DA  B 1 41  ? 53.050  22.942 -12.047 1.00 97.04  ? 187  DA  J C6    1 
ATOM   3820  N N6    . DA  B 1 41  ? 52.741  24.241 -12.103 1.00 97.48  ? 187  DA  J N6    1 
ATOM   3821  N N1    . DA  B 1 41  ? 52.792  22.265 -10.908 1.00 96.84  ? 187  DA  J N1    1 
ATOM   3822  C C2    . DA  B 1 41  ? 53.130  20.971 -10.841 1.00 96.78  ? 187  DA  J C2    1 
ATOM   3823  N N3    . DA  B 1 41  ? 53.707  20.200 -11.757 1.00 97.03  ? 187  DA  J N3    1 
ATOM   3824  C C4    . DA  B 1 41  ? 53.938  20.898 -12.877 1.00 97.88  ? 187  DA  J C4    1 
ATOM   3825  P P     . DA  B 1 42  ? 54.612  15.061 -15.659 1.00 100.52 ? 188  DA  J P     1 
ATOM   3826  O OP1   . DA  B 1 42  ? 55.519  13.878 -15.657 1.00 93.88  ? 188  DA  J OP1   1 
ATOM   3827  O OP2   . DA  B 1 42  ? 53.989  15.518 -16.930 1.00 95.06  ? 188  DA  J OP2   1 
ATOM   3828  O "O5'" . DA  B 1 42  ? 53.428  14.825 -14.621 1.00 99.50  ? 188  DA  J "O5'" 1 
ATOM   3829  C "C5'" . DA  B 1 42  ? 53.693  14.787 -13.224 1.00 99.91  ? 188  DA  J "C5'" 1 
ATOM   3830  C "C4'" . DA  B 1 42  ? 52.454  15.154 -12.442 1.00 99.81  ? 188  DA  J "C4'" 1 
ATOM   3831  O "O4'" . DA  B 1 42  ? 52.281  16.585 -12.330 1.00 98.59  ? 188  DA  J "O4'" 1 
ATOM   3832  C "C3'" . DA  B 1 42  ? 51.142  14.606 -12.997 1.00 100.27 ? 188  DA  J "C3'" 1 
ATOM   3833  O "O3'" . DA  B 1 42  ? 50.374  14.102 -11.916 1.00 101.88 ? 188  DA  J "O3'" 1 
ATOM   3834  C "C2'" . DA  B 1 42  ? 50.460  15.828 -13.588 1.00 98.80  ? 188  DA  J "C2'" 1 
ATOM   3835  C "C1'" . DA  B 1 42  ? 50.939  16.928 -12.658 1.00 98.31  ? 188  DA  J "C1'" 1 
ATOM   3836  N N9    . DA  B 1 42  ? 50.945  18.280 -13.228 1.00 92.53  ? 188  DA  J N9    1 
ATOM   3837  C C8    . DA  B 1 42  ? 51.590  18.726 -14.362 1.00 92.23  ? 188  DA  J C8    1 
ATOM   3838  N N7    . DA  B 1 42  ? 51.426  20.007 -14.596 1.00 91.33  ? 188  DA  J N7    1 
ATOM   3839  C C5    . DA  B 1 42  ? 50.611  20.432 -13.554 1.00 91.13  ? 188  DA  J C5    1 
ATOM   3840  C C6    . DA  B 1 42  ? 50.079  21.688 -13.226 1.00 90.98  ? 188  DA  J C6    1 
ATOM   3841  N N6    . DA  B 1 42  ? 50.290  22.794 -13.944 1.00 90.55  ? 188  DA  J N6    1 
ATOM   3842  N N1    . DA  B 1 42  ? 49.311  21.772 -12.118 1.00 90.89  ? 188  DA  J N1    1 
ATOM   3843  C C2    . DA  B 1 42  ? 49.101  20.664 -11.394 1.00 90.66  ? 188  DA  J C2    1 
ATOM   3844  N N3    . DA  B 1 42  ? 49.545  19.429 -11.599 1.00 91.65  ? 188  DA  J N3    1 
ATOM   3845  C C4    . DA  B 1 42  ? 50.303  19.379 -12.708 1.00 91.92  ? 188  DA  J C4    1 
ATOM   3846  P P     . DA  B 1 43  ? 49.195  13.069 -12.201 1.00 109.39 ? 189  DA  J P     1 
ATOM   3847  O OP1   . DA  B 1 43  ? 49.301  11.998 -11.179 1.00 110.85 ? 189  DA  J OP1   1 
ATOM   3848  O OP2   . DA  B 1 43  ? 49.213  12.712 -13.645 1.00 111.26 ? 189  DA  J OP2   1 
ATOM   3849  O "O5'" . DA  B 1 43  ? 47.908  13.950 -11.897 1.00 109.93 ? 189  DA  J "O5'" 1 
ATOM   3850  C "C5'" . DA  B 1 43  ? 47.704  14.506 -10.602 1.00 109.08 ? 189  DA  J "C5'" 1 
ATOM   3851  C "C4'" . DA  B 1 43  ? 46.466  15.366 -10.604 1.00 108.65 ? 189  DA  J "C4'" 1 
ATOM   3852  O "O4'" . DA  B 1 43  ? 46.777  16.674 -11.148 1.00 107.58 ? 189  DA  J "O4'" 1 
ATOM   3853  C "C3'" . DA  B 1 43  ? 45.348  14.786 -11.474 1.00 109.27 ? 189  DA  J "C3'" 1 
ATOM   3854  O "O3'" . DA  B 1 43  ? 44.075  14.893 -10.822 1.00 110.96 ? 189  DA  J "O3'" 1 
ATOM   3855  C "C2'" . DA  B 1 43  ? 45.404  15.636 -12.731 1.00 108.03 ? 189  DA  J "C2'" 1 
ATOM   3856  C "C1'" . DA  B 1 43  ? 45.863  16.980 -12.190 1.00 106.46 ? 189  DA  J "C1'" 1 
ATOM   3857  N N9    . DA  B 1 43  ? 46.543  17.838 -13.168 1.00 106.99 ? 189  DA  J N9    1 
ATOM   3858  C C8    . DA  B 1 43  ? 47.398  17.461 -14.174 1.00 105.99 ? 189  DA  J C8    1 
ATOM   3859  N N7    . DA  B 1 43  ? 47.843  18.461 -14.893 1.00 105.27 ? 189  DA  J N7    1 
ATOM   3860  C C5    . DA  B 1 43  ? 47.245  19.572 -14.324 1.00 105.16 ? 189  DA  J C5    1 
ATOM   3861  C C6    . DA  B 1 43  ? 47.319  20.935 -14.625 1.00 104.79 ? 189  DA  J C6    1 
ATOM   3862  N N6    . DA  B 1 43  ? 48.072  21.435 -15.611 1.00 106.18 ? 189  DA  J N6    1 
ATOM   3863  N N1    . DA  B 1 43  ? 46.590  21.785 -13.869 1.00 105.11 ? 189  DA  J N1    1 
ATOM   3864  C C2    . DA  B 1 43  ? 45.852  21.287 -12.873 1.00 105.36 ? 189  DA  J C2    1 
ATOM   3865  N N3    . DA  B 1 43  ? 45.709  20.024 -12.485 1.00 106.09 ? 189  DA  J N3    1 
ATOM   3866  C C4    . DA  B 1 43  ? 46.439  19.206 -13.261 1.00 106.08 ? 189  DA  J C4    1 
ATOM   3867  P P     . DC  B 1 44  ? 42.749  14.358 -11.563 1.00 125.49 ? 190  DC  J P     1 
ATOM   3868  O OP1   . DC  B 1 44  ? 41.972  13.575 -10.575 1.00 91.71  ? 190  DC  J OP1   1 
ATOM   3869  O OP2   . DC  B 1 44  ? 43.125  13.729 -12.864 1.00 90.74  ? 190  DC  J OP2   1 
ATOM   3870  O "O5'" . DC  B 1 44  ? 41.946  15.703 -11.837 1.00 126.05 ? 190  DC  J "O5'" 1 
ATOM   3871  C "C5'" . DC  B 1 44  ? 41.728  16.623 -10.776 1.00 125.18 ? 190  DC  J "C5'" 1 
ATOM   3872  C "C4'" . DC  B 1 44  ? 40.999  17.846 -11.277 1.00 124.59 ? 190  DC  J "C4'" 1 
ATOM   3873  O "O4'" . DC  B 1 44  ? 41.892  18.720 -12.009 1.00 124.16 ? 190  DC  J "O4'" 1 
ATOM   3874  C "C3'" . DC  B 1 44  ? 39.818  17.570 -12.209 1.00 124.58 ? 190  DC  J "C3'" 1 
ATOM   3875  O "O3'" . DC  B 1 44  ? 38.714  18.407 -11.843 1.00 125.24 ? 190  DC  J "O3'" 1 
ATOM   3876  C "C2'" . DC  B 1 44  ? 40.349  17.967 -13.577 1.00 123.90 ? 190  DC  J "C2'" 1 
ATOM   3877  C "C1'" . DC  B 1 44  ? 41.255  19.124 -13.209 1.00 123.00 ? 190  DC  J "C1'" 1 
ATOM   3878  N N1    . DC  B 1 44  ? 42.300  19.477 -14.183 1.00 85.89  ? 190  DC  J N1    1 
ATOM   3879  C C2    . DC  B 1 44  ? 42.566  20.830 -14.417 1.00 84.58  ? 190  DC  J C2    1 
ATOM   3880  O O2    . DC  B 1 44  ? 41.892  21.688 -13.815 1.00 83.35  ? 190  DC  J O2    1 
ATOM   3881  N N3    . DC  B 1 44  ? 43.548  21.173 -15.290 1.00 84.44  ? 190  DC  J N3    1 
ATOM   3882  C C4    . DC  B 1 44  ? 44.240  20.223 -15.918 1.00 84.74  ? 190  DC  J C4    1 
ATOM   3883  N N4    . DC  B 1 44  ? 45.192  20.600 -16.762 1.00 84.36  ? 190  DC  J N4    1 
ATOM   3884  C C5    . DC  B 1 44  ? 43.982  18.841 -15.708 1.00 84.77  ? 190  DC  J C5    1 
ATOM   3885  C C6    . DC  B 1 44  ? 43.009  18.515 -14.840 1.00 85.20  ? 190  DC  J C6    1 
ATOM   3886  P P     . DT  B 1 45  ? 37.412  18.443 -12.772 1.00 114.90 ? 191  DT  J P     1 
ATOM   3887  O OP1   . DT  B 1 45  ? 36.256  18.942 -11.975 1.00 91.03  ? 191  DT  J OP1   1 
ATOM   3888  O OP2   . DT  B 1 45  ? 37.345  17.112 -13.433 1.00 91.88  ? 191  DT  J OP2   1 
ATOM   3889  O "O5'" . DT  B 1 45  ? 37.783  19.520 -13.887 1.00 114.63 ? 191  DT  J "O5'" 1 
ATOM   3890  C "C5'" . DT  B 1 45  ? 38.111  20.862 -13.525 1.00 112.42 ? 191  DT  J "C5'" 1 
ATOM   3891  C "C4'" . DT  B 1 45  ? 38.104  21.753 -14.745 1.00 110.78 ? 191  DT  J "C4'" 1 
ATOM   3892  O "O4'" . DT  B 1 45  ? 39.324  21.626 -15.509 1.00 109.25 ? 191  DT  J "O4'" 1 
ATOM   3893  C "C3'" . DT  B 1 45  ? 36.968  21.471 -15.725 1.00 110.22 ? 191  DT  J "C3'" 1 
ATOM   3894  O "O3'" . DT  B 1 45  ? 36.510  22.707 -16.253 1.00 111.53 ? 191  DT  J "O3'" 1 
ATOM   3895  C "C2'" . DT  B 1 45  ? 37.662  20.705 -16.835 1.00 108.55 ? 191  DT  J "C2'" 1 
ATOM   3896  C "C1'" . DT  B 1 45  ? 38.983  21.432 -16.869 1.00 107.89 ? 191  DT  J "C1'" 1 
ATOM   3897  N N1    . DT  B 1 45  ? 40.088  20.722 -17.529 1.00 82.79  ? 191  DT  J N1    1 
ATOM   3898  C C2    . DT  B 1 45  ? 40.935  21.460 -18.325 1.00 81.32  ? 191  DT  J C2    1 
ATOM   3899  O O2    . DT  B 1 45  ? 40.809  22.667 -18.504 1.00 81.24  ? 191  DT  J O2    1 
ATOM   3900  N N3    . DT  B 1 45  ? 41.944  20.734 -18.902 1.00 80.68  ? 191  DT  J N3    1 
ATOM   3901  C C4    . DT  B 1 45  ? 42.189  19.382 -18.753 1.00 81.53  ? 191  DT  J C4    1 
ATOM   3902  O O4    . DT  B 1 45  ? 43.140  18.870 -19.314 1.00 80.73  ? 191  DT  J O4    1 
ATOM   3903  C C5    . DT  B 1 45  ? 41.270  18.676 -17.914 1.00 81.45  ? 191  DT  J C5    1 
ATOM   3904  C C7    . DT  B 1 45  ? 41.472  17.210 -17.704 1.00 81.75  ? 191  DT  J C7    1 
ATOM   3905  C C6    . DT  B 1 45  ? 40.272  19.369 -17.351 1.00 82.49  ? 191  DT  J C6    1 
ATOM   3906  P P     . DG  B 1 46  ? 34.943  22.950 -16.455 1.00 98.03  ? 192  DG  J P     1 
ATOM   3907  O OP1   . DG  B 1 46  ? 34.333  22.990 -15.104 1.00 97.64  ? 192  DG  J OP1   1 
ATOM   3908  O OP2   . DG  B 1 46  ? 34.440  21.982 -17.481 1.00 96.50  ? 192  DG  J OP2   1 
ATOM   3909  O "O5'" . DG  B 1 46  ? 34.881  24.413 -17.070 1.00 97.29  ? 192  DG  J "O5'" 1 
ATOM   3910  C "C5'" . DG  B 1 46  ? 35.714  25.446 -16.565 1.00 95.04  ? 192  DG  J "C5'" 1 
ATOM   3911  C "C4'" . DG  B 1 46  ? 36.284  26.248 -17.710 1.00 93.95  ? 192  DG  J "C4'" 1 
ATOM   3912  O "O4'" . DG  B 1 46  ? 37.321  25.498 -18.394 1.00 93.54  ? 192  DG  J "O4'" 1 
ATOM   3913  C "C3'" . DG  B 1 46  ? 35.262  26.628 -18.781 1.00 93.55  ? 192  DG  J "C3'" 1 
ATOM   3914  O "O3'" . DG  B 1 46  ? 35.536  27.953 -19.236 1.00 93.67  ? 192  DG  J "O3'" 1 
ATOM   3915  C "C2'" . DG  B 1 46  ? 35.510  25.610 -19.882 1.00 93.10  ? 192  DG  J "C2'" 1 
ATOM   3916  C "C1'" . DG  B 1 46  ? 37.014  25.407 -19.785 1.00 93.07  ? 192  DG  J "C1'" 1 
ATOM   3917  N N9    . DG  B 1 46  ? 37.526  24.127 -20.267 1.00 90.32  ? 192  DG  J N9    1 
ATOM   3918  C C8    . DG  B 1 46  ? 37.113  22.876 -19.882 1.00 90.64  ? 192  DG  J C8    1 
ATOM   3919  N N7    . DG  B 1 46  ? 37.832  21.916 -20.396 1.00 89.91  ? 192  DG  J N7    1 
ATOM   3920  C C5    . DG  B 1 46  ? 38.766  22.572 -21.187 1.00 89.88  ? 192  DG  J C5    1 
ATOM   3921  C C6    . DG  B 1 46  ? 39.840  22.054 -21.969 1.00 89.53  ? 192  DG  J C6    1 
ATOM   3922  O O6    . DG  B 1 46  ? 40.209  20.874 -22.099 1.00 88.01  ? 192  DG  J O6    1 
ATOM   3923  N N1    . DG  B 1 46  ? 40.525  23.070 -22.632 1.00 88.94  ? 192  DG  J N1    1 
ATOM   3924  C C2    . DG  B 1 46  ? 40.228  24.407 -22.550 1.00 88.59  ? 192  DG  J C2    1 
ATOM   3925  N N2    . DG  B 1 46  ? 40.997  25.225 -23.289 1.00 87.72  ? 192  DG  J N2    1 
ATOM   3926  N N3    . DG  B 1 46  ? 39.249  24.904 -21.805 1.00 89.76  ? 192  DG  J N3    1 
ATOM   3927  C C4    . DG  B 1 46  ? 38.565  23.935 -21.152 1.00 89.91  ? 192  DG  J C4    1 
ATOM   3928  P P     . DC  B 1 47  ? 34.578  28.635 -20.321 1.00 115.45 ? 193  DC  J P     1 
ATOM   3929  O OP1   . DC  B 1 47  ? 34.594  30.093 -20.053 1.00 79.68  ? 193  DC  J OP1   1 
ATOM   3930  O OP2   . DC  B 1 47  ? 33.284  27.897 -20.426 1.00 80.98  ? 193  DC  J OP2   1 
ATOM   3931  O "O5'" . DC  B 1 47  ? 35.322  28.370 -21.693 1.00 114.47 ? 193  DC  J "O5'" 1 
ATOM   3932  C "C5'" . DC  B 1 47  ? 36.642  28.835 -21.917 1.00 111.57 ? 193  DC  J "C5'" 1 
ATOM   3933  C "C4'" . DC  B 1 47  ? 37.088  28.391 -23.283 1.00 108.31 ? 193  DC  J "C4'" 1 
ATOM   3934  O "O4'" . DC  B 1 47  ? 37.382  26.974 -23.268 1.00 107.50 ? 193  DC  J "O4'" 1 
ATOM   3935  C "C3'" . DC  B 1 47  ? 35.986  28.577 -24.325 1.00 106.47 ? 193  DC  J "C3'" 1 
ATOM   3936  O "O3'" . DC  B 1 47  ? 36.592  28.900 -25.566 1.00 105.57 ? 193  DC  J "O3'" 1 
ATOM   3937  C "C2'" . DC  B 1 47  ? 35.373  27.193 -24.420 1.00 106.31 ? 193  DC  J "C2'" 1 
ATOM   3938  C "C1'" . DC  B 1 47  ? 36.627  26.358 -24.295 1.00 106.76 ? 193  DC  J "C1'" 1 
ATOM   3939  N N1    . DC  B 1 47  ? 36.468  24.929 -23.977 1.00 71.18  ? 193  DC  J N1    1 
ATOM   3940  C C2    . DC  B 1 47  ? 37.405  24.030 -24.505 1.00 71.13  ? 193  DC  J C2    1 
ATOM   3941  O O2    . DC  B 1 47  ? 38.330  24.474 -25.219 1.00 70.37  ? 193  DC  J O2    1 
ATOM   3942  N N3    . DC  B 1 47  ? 37.283  22.714 -24.230 1.00 70.77  ? 193  DC  J N3    1 
ATOM   3943  C C4    . DC  B 1 47  ? 36.282  22.285 -23.464 1.00 70.79  ? 193  DC  J C4    1 
ATOM   3944  N N4    . DC  B 1 47  ? 36.207  20.975 -23.215 1.00 69.49  ? 193  DC  J N4    1 
ATOM   3945  C C5    . DC  B 1 47  ? 35.316  23.175 -22.917 1.00 70.30  ? 193  DC  J C5    1 
ATOM   3946  C C6    . DC  B 1 47  ? 35.444  24.477 -23.197 1.00 69.96  ? 193  DC  J C6    1 
ATOM   3947  P P     . DT  B 1 48  ? 36.006  30.093 -26.457 1.00 96.73  ? 194  DT  J P     1 
ATOM   3948  O OP1   . DT  B 1 48  ? 35.944  31.306 -25.604 1.00 77.94  ? 194  DT  J OP1   1 
ATOM   3949  O OP2   . DT  B 1 48  ? 34.791  29.593 -27.157 1.00 78.59  ? 194  DT  J OP2   1 
ATOM   3950  O "O5'" . DT  B 1 48  ? 37.156  30.327 -27.530 1.00 96.15  ? 194  DT  J "O5'" 1 
ATOM   3951  C "C5'" . DT  B 1 48  ? 38.527  30.345 -27.130 1.00 91.49  ? 194  DT  J "C5'" 1 
ATOM   3952  C "C4'" . DT  B 1 48  ? 39.342  29.426 -28.009 1.00 87.62  ? 194  DT  J "C4'" 1 
ATOM   3953  O "O4'" . DT  B 1 48  ? 39.084  28.047 -27.682 1.00 86.72  ? 194  DT  J "O4'" 1 
ATOM   3954  C "C3'" . DT  B 1 48  ? 39.066  29.564 -29.507 1.00 84.77  ? 194  DT  J "C3'" 1 
ATOM   3955  O "O3'" . DT  B 1 48  ? 40.299  29.470 -30.220 1.00 82.48  ? 194  DT  J "O3'" 1 
ATOM   3956  C "C2'" . DT  B 1 48  ? 38.201  28.363 -29.817 1.00 84.76  ? 194  DT  J "C2'" 1 
ATOM   3957  C "C1'" . DT  B 1 48  ? 38.796  27.347 -28.879 1.00 86.41  ? 194  DT  J "C1'" 1 
ATOM   3958  N N1    . DT  B 1 48  ? 37.930  26.208 -28.555 1.00 68.30  ? 194  DT  J N1    1 
ATOM   3959  C C2    . DT  B 1 48  ? 38.447  24.950 -28.743 1.00 70.07  ? 194  DT  J C2    1 
ATOM   3960  O O2    . DT  B 1 48  ? 39.580  24.745 -29.163 1.00 69.67  ? 194  DT  J O2    1 
ATOM   3961  N N3    . DT  B 1 48  ? 37.596  23.929 -28.425 1.00 69.84  ? 194  DT  J N3    1 
ATOM   3962  C C4    . DT  B 1 48  ? 36.314  24.035 -27.947 1.00 69.67  ? 194  DT  J C4    1 
ATOM   3963  O O4    . DT  B 1 48  ? 35.668  23.026 -27.710 1.00 69.25  ? 194  DT  J O4    1 
ATOM   3964  C C5    . DT  B 1 48  ? 35.834  25.378 -27.765 1.00 70.55  ? 194  DT  J C5    1 
ATOM   3965  C C7    . DT  B 1 48  ? 34.453  25.580 -27.224 1.00 71.48  ? 194  DT  J C7    1 
ATOM   3966  C C6    . DT  B 1 48  ? 36.656  26.390 -28.082 1.00 68.81  ? 194  DT  J C6    1 
ATOM   3967  P P     . DC  B 1 49  ? 40.420  30.086 -31.707 1.00 87.77  ? 195  DC  J P     1 
ATOM   3968  O OP1   . DC  B 1 49  ? 41.676  30.899 -31.815 1.00 78.86  ? 195  DC  J OP1   1 
ATOM   3969  O OP2   . DC  B 1 49  ? 39.101  30.700 -32.070 1.00 79.09  ? 195  DC  J OP2   1 
ATOM   3970  O "O5'" . DC  B 1 49  ? 40.592  28.778 -32.599 1.00 83.62  ? 195  DC  J "O5'" 1 
ATOM   3971  C "C5'" . DC  B 1 49  ? 41.438  27.705 -32.178 1.00 77.19  ? 195  DC  J "C5'" 1 
ATOM   3972  C "C4'" . DC  B 1 49  ? 41.124  26.475 -32.987 1.00 74.49  ? 195  DC  J "C4'" 1 
ATOM   3973  O "O4'" . DC  B 1 49  ? 40.027  25.752 -32.387 1.00 74.16  ? 195  DC  J "O4'" 1 
ATOM   3974  C "C3'" . DC  B 1 49  ? 40.682  26.827 -34.410 1.00 74.25  ? 195  DC  J "C3'" 1 
ATOM   3975  O "O3'" . DC  B 1 49  ? 41.102  25.810 -35.307 1.00 70.15  ? 195  DC  J "O3'" 1 
ATOM   3976  C "C2'" . DC  B 1 49  ? 39.174  26.750 -34.318 1.00 76.43  ? 195  DC  J "C2'" 1 
ATOM   3977  C "C1'" . DC  B 1 49  ? 39.026  25.566 -33.382 1.00 78.24  ? 195  DC  J "C1'" 1 
ATOM   3978  N N1    . DC  B 1 49  ? 37.712  25.386 -32.723 1.00 68.09  ? 195  DC  J N1    1 
ATOM   3979  C C2    . DC  B 1 49  ? 37.372  24.110 -32.248 1.00 67.61  ? 195  DC  J C2    1 
ATOM   3980  O O2    . DC  B 1 49  ? 38.137  23.174 -32.452 1.00 61.82  ? 195  DC  J O2    1 
ATOM   3981  N N3    . DC  B 1 49  ? 36.213  23.930 -31.593 1.00 69.68  ? 195  DC  J N3    1 
ATOM   3982  C C4    . DC  B 1 49  ? 35.380  24.952 -31.427 1.00 71.12  ? 195  DC  J C4    1 
ATOM   3983  N N4    . DC  B 1 49  ? 34.256  24.716 -30.760 1.00 75.10  ? 195  DC  J N4    1 
ATOM   3984  C C5    . DC  B 1 49  ? 35.671  26.257 -31.936 1.00 71.17  ? 195  DC  J C5    1 
ATOM   3985  C C6    . DC  B 1 49  ? 36.840  26.430 -32.567 1.00 70.45  ? 195  DC  J C6    1 
ATOM   3986  P P     . DC  B 1 50  ? 42.621  25.761 -35.809 1.00 52.33  ? 196  DC  J P     1 
ATOM   3987  O OP1   . DC  B 1 50  ? 43.548  26.012 -34.664 1.00 45.01  ? 196  DC  J OP1   1 
ATOM   3988  O OP2   . DC  B 1 50  ? 42.701  26.571 -37.033 1.00 49.05  ? 196  DC  J OP2   1 
ATOM   3989  O "O5'" . DC  B 1 50  ? 42.823  24.247 -36.201 1.00 52.54  ? 196  DC  J "O5'" 1 
ATOM   3990  C "C5'" . DC  B 1 50  ? 43.276  23.332 -35.234 1.00 49.99  ? 196  DC  J "C5'" 1 
ATOM   3991  C "C4'" . DC  B 1 50  ? 42.612  22.002 -35.454 1.00 53.09  ? 196  DC  J "C4'" 1 
ATOM   3992  O "O4'" . DC  B 1 50  ? 41.262  22.099 -34.960 1.00 53.95  ? 196  DC  J "O4'" 1 
ATOM   3993  C "C3'" . DC  B 1 50  ? 42.520  21.595 -36.930 1.00 48.15  ? 196  DC  J "C3'" 1 
ATOM   3994  O "O3'" . DC  B 1 50  ? 43.042  20.284 -37.148 1.00 44.45  ? 196  DC  J "O3'" 1 
ATOM   3995  C "C2'" . DC  B 1 50  ? 41.037  21.647 -37.245 1.00 52.97  ? 196  DC  J "C2'" 1 
ATOM   3996  C "C1'" . DC  B 1 50  ? 40.389  21.478 -35.885 1.00 53.51  ? 196  DC  J "C1'" 1 
ATOM   3997  N N1    . DC  B 1 50  ? 39.069  22.115 -35.748 1.00 54.27  ? 196  DC  J N1    1 
ATOM   3998  C C2    . DC  B 1 50  ? 37.980  21.341 -35.297 1.00 52.90  ? 196  DC  J C2    1 
ATOM   3999  O O2    . DC  B 1 50  ? 38.130  20.122 -35.111 1.00 54.39  ? 196  DC  J O2    1 
ATOM   4000  N N3    . DC  B 1 50  ? 36.797  21.943 -35.090 1.00 51.98  ? 196  DC  J N3    1 
ATOM   4001  C C4    . DC  B 1 50  ? 36.657  23.243 -35.329 1.00 55.81  ? 196  DC  J C4    1 
ATOM   4002  N N4    . DC  B 1 50  ? 35.483  23.791 -35.061 1.00 53.53  ? 196  DC  J N4    1 
ATOM   4003  C C5    . DC  B 1 50  ? 37.721  24.038 -35.841 1.00 55.99  ? 196  DC  J C5    1 
ATOM   4004  C C6    . DC  B 1 50  ? 38.901  23.442 -36.031 1.00 54.59  ? 196  DC  J C6    1 
ATOM   4005  P P     . DA  B 1 51  ? 43.176  19.713 -38.644 1.00 39.35  ? 197  DA  J P     1 
ATOM   4006  O OP1   . DA  B 1 51  ? 44.401  18.889 -38.750 1.00 36.08  ? 197  DA  J OP1   1 
ATOM   4007  O OP2   . DA  B 1 51  ? 42.915  20.778 -39.623 1.00 39.88  ? 197  DA  J OP2   1 
ATOM   4008  O "O5'" . DA  B 1 51  ? 41.928  18.745 -38.725 1.00 46.84  ? 197  DA  J "O5'" 1 
ATOM   4009  C "C5'" . DA  B 1 51  ? 41.758  17.751 -37.726 1.00 50.37  ? 197  DA  J "C5'" 1 
ATOM   4010  C "C4'" . DA  B 1 51  ? 40.489  16.987 -37.973 1.00 56.21  ? 197  DA  J "C4'" 1 
ATOM   4011  O "O4'" . DA  B 1 51  ? 39.380  17.861 -37.708 1.00 58.13  ? 197  DA  J "O4'" 1 
ATOM   4012  C "C3'" . DA  B 1 51  ? 40.297  16.471 -39.394 1.00 59.00  ? 197  DA  J "C3'" 1 
ATOM   4013  O "O3'" . DA  B 1 51  ? 39.794  15.141 -39.286 1.00 63.72  ? 197  DA  J "O3'" 1 
ATOM   4014  C "C2'" . DA  B 1 51  ? 39.258  17.413 -39.975 1.00 57.12  ? 197  DA  J "C2'" 1 
ATOM   4015  C "C1'" . DA  B 1 51  ? 38.448  17.774 -38.757 1.00 57.12  ? 197  DA  J "C1'" 1 
ATOM   4016  N N9    . DA  B 1 51  ? 37.731  19.041 -38.783 1.00 56.85  ? 197  DA  J N9    1 
ATOM   4017  C C8    . DA  B 1 51  ? 38.136  20.254 -39.281 1.00 57.49  ? 197  DA  J C8    1 
ATOM   4018  N N7    . DA  B 1 51  ? 37.284  21.226 -39.065 1.00 58.15  ? 197  DA  J N7    1 
ATOM   4019  C C5    . DA  B 1 51  ? 36.242  20.605 -38.398 1.00 55.93  ? 197  DA  J C5    1 
ATOM   4020  C C6    . DA  B 1 51  ? 35.038  21.085 -37.890 1.00 57.55  ? 197  DA  J C6    1 
ATOM   4021  N N6    . DA  B 1 51  ? 34.653  22.351 -37.985 1.00 55.20  ? 197  DA  J N6    1 
ATOM   4022  N N1    . DA  B 1 51  ? 34.223  20.209 -37.276 1.00 59.16  ? 197  DA  J N1    1 
ATOM   4023  C C2    . DA  B 1 51  ? 34.598  18.931 -37.203 1.00 61.56  ? 197  DA  J C2    1 
ATOM   4024  N N3    . DA  B 1 51  ? 35.705  18.352 -37.652 1.00 59.17  ? 197  DA  J N3    1 
ATOM   4025  C C4    . DA  B 1 51  ? 36.497  19.257 -38.238 1.00 57.40  ? 197  DA  J C4    1 
ATOM   4026  P P     . DT  B 1 52  ? 39.712  14.193 -40.577 1.00 74.01  ? 198  DT  J P     1 
ATOM   4027  O OP1   . DT  B 1 52  ? 40.417  12.949 -40.195 1.00 65.10  ? 198  DT  J OP1   1 
ATOM   4028  O OP2   . DT  B 1 52  ? 40.112  14.931 -41.816 1.00 63.64  ? 198  DT  J OP2   1 
ATOM   4029  O "O5'" . DT  B 1 52  ? 38.157  13.856 -40.659 1.00 76.57  ? 198  DT  J "O5'" 1 
ATOM   4030  C "C5'" . DT  B 1 52  ? 37.263  14.275 -39.627 1.00 78.16  ? 198  DT  J "C5'" 1 
ATOM   4031  C "C4'" . DT  B 1 52  ? 35.919  14.595 -40.225 1.00 80.23  ? 198  DT  J "C4'" 1 
ATOM   4032  O "O4'" . DT  B 1 52  ? 35.567  15.982 -40.000 1.00 78.06  ? 198  DT  J "O4'" 1 
ATOM   4033  C "C3'" . DT  B 1 52  ? 35.890  14.394 -41.741 1.00 81.85  ? 198  DT  J "C3'" 1 
ATOM   4034  O "O3'" . DT  B 1 52  ? 34.634  13.835 -42.126 1.00 90.02  ? 198  DT  J "O3'" 1 
ATOM   4035  C "C2'" . DT  B 1 52  ? 35.955  15.811 -42.269 1.00 80.21  ? 198  DT  J "C2'" 1 
ATOM   4036  C "C1'" . DT  B 1 52  ? 35.104  16.497 -41.231 1.00 76.86  ? 198  DT  J "C1'" 1 
ATOM   4037  N N1    . DT  B 1 52  ? 35.156  17.973 -41.219 1.00 62.30  ? 198  DT  J N1    1 
ATOM   4038  C C2    . DT  B 1 52  ? 34.089  18.642 -40.669 1.00 60.61  ? 198  DT  J C2    1 
ATOM   4039  O O2    . DT  B 1 52  ? 33.206  18.088 -40.063 1.00 56.93  ? 198  DT  J O2    1 
ATOM   4040  N N3    . DT  B 1 52  ? 34.102  19.998 -40.845 1.00 59.75  ? 198  DT  J N3    1 
ATOM   4041  C C4    . DT  B 1 52  ? 35.074  20.748 -41.462 1.00 59.91  ? 198  DT  J C4    1 
ATOM   4042  O O4    . DT  B 1 52  ? 34.923  21.958 -41.556 1.00 58.78  ? 198  DT  J O4    1 
ATOM   4043  C C5    . DT  B 1 52  ? 36.224  19.990 -41.954 1.00 59.50  ? 198  DT  J C5    1 
ATOM   4044  C C7    . DT  B 1 52  ? 37.360  20.713 -42.601 1.00 57.90  ? 198  DT  J C7    1 
ATOM   4045  C C6    . DT  B 1 52  ? 36.206  18.659 -41.801 1.00 60.16  ? 198  DT  J C6    1 
ATOM   4046  P P     . DC  B 1 53  ? 34.582  12.559 -43.100 1.00 85.17  ? 199  DC  J P     1 
ATOM   4047  O OP1   . DC  B 1 53  ? 35.078  11.373 -42.364 1.00 78.53  ? 199  DC  J OP1   1 
ATOM   4048  O OP2   . DC  B 1 53  ? 35.191  12.930 -44.408 1.00 79.12  ? 199  DC  J OP2   1 
ATOM   4049  O "O5'" . DC  B 1 53  ? 33.028  12.360 -43.286 1.00 85.37  ? 199  DC  J "O5'" 1 
ATOM   4050  C "C5'" . DC  B 1 53  ? 32.155  12.514 -42.182 1.00 87.00  ? 199  DC  J "C5'" 1 
ATOM   4051  C "C4'" . DC  B 1 53  ? 30.927  13.262 -42.632 1.00 87.46  ? 199  DC  J "C4'" 1 
ATOM   4052  O "O4'" . DC  B 1 53  ? 31.084  14.684 -42.406 1.00 86.31  ? 199  DC  J "O4'" 1 
ATOM   4053  C "C3'" . DC  B 1 53  ? 30.679  13.089 -44.134 1.00 89.09  ? 199  DC  J "C3'" 1 
ATOM   4054  O "O3'" . DC  B 1 53  ? 29.314  12.769 -44.406 1.00 92.28  ? 199  DC  J "O3'" 1 
ATOM   4055  C "C2'" . DC  B 1 53  ? 31.065  14.433 -44.719 1.00 87.37  ? 199  DC  J "C2'" 1 
ATOM   4056  C "C1'" . DC  B 1 53  ? 30.718  15.376 -43.585 1.00 84.77  ? 199  DC  J "C1'" 1 
ATOM   4057  N N1    . DC  B 1 53  ? 31.452  16.651 -43.627 1.00 75.08  ? 199  DC  J N1    1 
ATOM   4058  C C2    . DC  B 1 53  ? 30.792  17.824 -43.253 1.00 73.51  ? 199  DC  J C2    1 
ATOM   4059  O O2    . DC  B 1 53  ? 29.621  17.748 -42.844 1.00 74.07  ? 199  DC  J O2    1 
ATOM   4060  N N3    . DC  B 1 53  ? 31.447  19.009 -43.348 1.00 71.10  ? 199  DC  J N3    1 
ATOM   4061  C C4    . DC  B 1 53  ? 32.708  19.040 -43.785 1.00 69.82  ? 199  DC  J C4    1 
ATOM   4062  N N4    . DC  B 1 53  ? 33.316  20.225 -43.880 1.00 67.60  ? 199  DC  J N4    1 
ATOM   4063  C C5    . DC  B 1 53  ? 33.404  17.858 -44.148 1.00 70.41  ? 199  DC  J C5    1 
ATOM   4064  C C6    . DC  B 1 53  ? 32.749  16.695 -44.050 1.00 72.82  ? 199  DC  J C6    1 
ATOM   4065  P P     . DA  B 1 54  ? 28.730  12.972 -45.889 1.00 107.78 ? 200  DA  J P     1 
ATOM   4066  O OP1   . DA  B 1 54  ? 27.589  12.046 -46.084 1.00 103.88 ? 200  DA  J OP1   1 
ATOM   4067  O OP2   . DA  B 1 54  ? 29.844  12.969 -46.877 1.00 102.49 ? 200  DA  J OP2   1 
ATOM   4068  O "O5'" . DA  B 1 54  ? 28.136  14.441 -45.780 1.00 105.52 ? 200  DA  J "O5'" 1 
ATOM   4069  C "C5'" . DA  B 1 54  ? 26.936  14.688 -45.063 1.00 102.52 ? 200  DA  J "C5'" 1 
ATOM   4070  C "C4'" . DA  B 1 54  ? 26.120  15.687 -45.832 1.00 101.71 ? 200  DA  J "C4'" 1 
ATOM   4071  O "O4'" . DA  B 1 54  ? 26.777  16.972 -45.705 1.00 99.96  ? 200  DA  J "O4'" 1 
ATOM   4072  C "C3'" . DA  B 1 54  ? 26.112  15.350 -47.326 1.00 102.13 ? 200  DA  J "C3'" 1 
ATOM   4073  O "O3'" . DA  B 1 54  ? 24.826  15.611 -47.914 1.00 104.82 ? 200  DA  J "O3'" 1 
ATOM   4074  C "C2'" . DA  B 1 54  ? 27.203  16.242 -47.895 1.00 99.35  ? 200  DA  J "C2'" 1 
ATOM   4075  C "C1'" . DA  B 1 54  ? 27.152  17.458 -46.984 1.00 97.29  ? 200  DA  J "C1'" 1 
ATOM   4076  N N9    . DA  B 1 54  ? 28.427  18.165 -46.850 1.00 89.17  ? 200  DA  J N9    1 
ATOM   4077  C C8    . DA  B 1 54  ? 29.683  17.618 -46.737 1.00 86.78  ? 200  DA  J C8    1 
ATOM   4078  N N7    . DA  B 1 54  ? 30.642  18.508 -46.654 1.00 85.08  ? 200  DA  J N7    1 
ATOM   4079  C C5    . DA  B 1 54  ? 29.975  19.723 -46.708 1.00 84.26  ? 200  DA  J C5    1 
ATOM   4080  C C6    . DA  B 1 54  ? 30.427  21.049 -46.669 1.00 83.84  ? 200  DA  J C6    1 
ATOM   4081  N N6    . DA  B 1 54  ? 31.710  21.398 -46.563 1.00 82.10  ? 200  DA  J N6    1 
ATOM   4082  N N1    . DA  B 1 54  ? 29.502  22.026 -46.747 1.00 85.50  ? 200  DA  J N1    1 
ATOM   4083  C C2    . DA  B 1 54  ? 28.218  21.682 -46.861 1.00 86.64  ? 200  DA  J C2    1 
ATOM   4084  N N3    . DA  B 1 54  ? 27.671  20.475 -46.912 1.00 86.93  ? 200  DA  J N3    1 
ATOM   4085  C C4    . DA  B 1 54  ? 28.612  19.527 -46.827 1.00 86.15  ? 200  DA  J C4    1 
ATOM   4086  P P     . DA  B 1 55  ? 24.629  15.504 -49.512 1.00 131.80 ? 201  DA  J P     1 
ATOM   4087  O OP1   . DA  B 1 55  ? 23.246  15.040 -49.748 1.00 99.56  ? 201  DA  J OP1   1 
ATOM   4088  O OP2   . DA  B 1 55  ? 25.765  14.756 -50.117 1.00 98.74  ? 201  DA  J OP2   1 
ATOM   4089  O "O5'" . DA  B 1 55  ? 24.736  17.015 -50.000 1.00 131.33 ? 201  DA  J "O5'" 1 
ATOM   4090  C "C5'" . DA  B 1 55  ? 23.891  18.033 -49.459 1.00 130.19 ? 201  DA  J "C5'" 1 
ATOM   4091  C "C4'" . DA  B 1 55  ? 23.991  19.272 -50.312 1.00 130.17 ? 201  DA  J "C4'" 1 
ATOM   4092  O "O4'" . DA  B 1 55  ? 25.291  19.883 -50.120 1.00 129.21 ? 201  DA  J "O4'" 1 
ATOM   4093  C "C3'" . DA  B 1 55  ? 23.905  18.936 -51.800 1.00 130.85 ? 201  DA  J "C3'" 1 
ATOM   4094  O "O3'" . DA  B 1 55  ? 23.271  19.989 -52.517 1.00 133.29 ? 201  DA  J "O3'" 1 
ATOM   4095  C "C2'" . DA  B 1 55  ? 25.359  18.823 -52.217 1.00 129.79 ? 201  DA  J "C2'" 1 
ATOM   4096  C "C1'" . DA  B 1 55  ? 26.017  19.880 -51.347 1.00 127.92 ? 201  DA  J "C1'" 1 
ATOM   4097  N N9    . DA  B 1 55  ? 27.432  19.620 -51.056 1.00 92.93  ? 201  DA  J N9    1 
ATOM   4098  C C8    . DA  B 1 55  ? 28.082  18.405 -50.997 1.00 91.17  ? 201  DA  J C8    1 
ATOM   4099  N N7    . DA  B 1 55  ? 29.364  18.503 -50.735 1.00 89.77  ? 201  DA  J N7    1 
ATOM   4100  C C5    . DA  B 1 55  ? 29.573  19.871 -50.606 1.00 89.36  ? 201  DA  J C5    1 
ATOM   4101  C C6    . DA  B 1 55  ? 30.716  20.626 -50.316 1.00 86.84  ? 201  DA  J C6    1 
ATOM   4102  N N6    . DA  B 1 55  ? 31.915  20.095 -50.088 1.00 85.25  ? 201  DA  J N6    1 
ATOM   4103  N N1    . DA  B 1 55  ? 30.583  21.967 -50.259 1.00 86.24  ? 201  DA  J N1    1 
ATOM   4104  C C2    . DA  B 1 55  ? 29.377  22.504 -50.473 1.00 87.53  ? 201  DA  J C2    1 
ATOM   4105  N N3    . DA  B 1 55  ? 28.229  21.904 -50.748 1.00 88.86  ? 201  DA  J N3    1 
ATOM   4106  C C4    . DA  B 1 55  ? 28.394  20.571 -50.801 1.00 90.24  ? 201  DA  J C4    1 
ATOM   4107  P P     . DA  B 1 56  ? 22.482  19.664 -53.877 1.00 128.99 ? 202  DA  J P     1 
ATOM   4108  O OP1   . DA  B 1 56  ? 21.109  19.246 -53.499 1.00 95.40  ? 202  DA  J OP1   1 
ATOM   4109  O OP2   . DA  B 1 56  ? 23.307  18.779 -54.748 1.00 95.58  ? 202  DA  J OP2   1 
ATOM   4110  O "O5'" . DA  B 1 56  ? 22.410  21.091 -54.569 1.00 127.03 ? 202  DA  J "O5'" 1 
ATOM   4111  C "C5'" . DA  B 1 56  ? 22.419  22.280 -53.780 1.00 124.78 ? 202  DA  J "C5'" 1 
ATOM   4112  C "C4'" . DA  B 1 56  ? 23.388  23.278 -54.365 1.00 124.07 ? 202  DA  J "C4'" 1 
ATOM   4113  O "O4'" . DA  B 1 56  ? 24.752  22.972 -53.988 1.00 122.81 ? 202  DA  J "O4'" 1 
ATOM   4114  C "C3'" . DA  B 1 56  ? 23.373  23.292 -55.890 1.00 124.34 ? 202  DA  J "C3'" 1 
ATOM   4115  O "O3'" . DA  B 1 56  ? 23.509  24.627 -56.346 1.00 126.73 ? 202  DA  J "O3'" 1 
ATOM   4116  C "C2'" . DA  B 1 56  ? 24.607  22.490 -56.263 1.00 122.29 ? 202  DA  J "C2'" 1 
ATOM   4117  C "C1'" . DA  B 1 56  ? 25.556  22.916 -55.161 1.00 120.55 ? 202  DA  J "C1'" 1 
ATOM   4118  N N9    . DA  B 1 56  ? 26.694  22.031 -54.899 1.00 82.89  ? 202  DA  J N9    1 
ATOM   4119  C C8    . DA  B 1 56  ? 26.722  20.662 -54.900 1.00 82.53  ? 202  DA  J C8    1 
ATOM   4120  N N7    . DA  B 1 56  ? 27.887  20.155 -54.565 1.00 79.24  ? 202  DA  J N7    1 
ATOM   4121  C C5    . DA  B 1 56  ? 28.686  21.267 -54.334 1.00 77.79  ? 202  DA  J C5    1 
ATOM   4122  C C6    . DA  B 1 56  ? 30.031  21.408 -53.902 1.00 75.42  ? 202  DA  J C6    1 
ATOM   4123  N N6    . DA  B 1 56  ? 30.830  20.390 -53.595 1.00 70.84  ? 202  DA  J N6    1 
ATOM   4124  N N1    . DA  B 1 56  ? 30.520  22.655 -53.779 1.00 74.68  ? 202  DA  J N1    1 
ATOM   4125  C C2    . DA  B 1 56  ? 29.711  23.689 -54.052 1.00 75.99  ? 202  DA  J C2    1 
ATOM   4126  N N3    . DA  B 1 56  ? 28.430  23.690 -54.447 1.00 77.47  ? 202  DA  J N3    1 
ATOM   4127  C C4    . DA  B 1 56  ? 27.971  22.431 -54.564 1.00 79.80  ? 202  DA  J C4    1 
ATOM   4128  P P     . DA  B 1 57  ? 23.186  24.965 -57.869 1.00 121.39 ? 203  DA  J P     1 
ATOM   4129  O OP1   . DA  B 1 57  ? 22.190  26.059 -57.874 1.00 85.12  ? 203  DA  J OP1   1 
ATOM   4130  O OP2   . DA  B 1 57  ? 22.903  23.687 -58.564 1.00 85.70  ? 203  DA  J OP2   1 
ATOM   4131  O "O5'" . DA  B 1 57  ? 24.556  25.522 -58.441 1.00 120.43 ? 203  DA  J "O5'" 1 
ATOM   4132  C "C5'" . DA  B 1 57  ? 25.181  26.657 -57.859 1.00 117.21 ? 203  DA  J "C5'" 1 
ATOM   4133  C "C4'" . DA  B 1 57  ? 26.524  26.874 -58.507 1.00 115.14 ? 203  DA  J "C4'" 1 
ATOM   4134  O "O4'" . DA  B 1 57  ? 27.440  25.831 -58.095 1.00 113.19 ? 203  DA  J "O4'" 1 
ATOM   4135  C "C3'" . DA  B 1 57  ? 26.471  26.799 -60.034 1.00 114.36 ? 203  DA  J "C3'" 1 
ATOM   4136  O "O3'" . DA  B 1 57  ? 27.402  27.732 -60.564 1.00 114.32 ? 203  DA  J "O3'" 1 
ATOM   4137  C "C2'" . DA  B 1 57  ? 26.962  25.393 -60.331 1.00 112.58 ? 203  DA  J "C2'" 1 
ATOM   4138  C "C1'" . DA  B 1 57  ? 28.015  25.248 -59.256 1.00 111.26 ? 203  DA  J "C1'" 1 
ATOM   4139  N N9    . DA  B 1 57  ? 28.420  23.883 -58.933 1.00 72.60  ? 203  DA  J N9    1 
ATOM   4140  C C8    . DA  B 1 57  ? 27.794  22.702 -59.239 1.00 71.73  ? 203  DA  J C8    1 
ATOM   4141  N N7    . DA  B 1 57  ? 28.418  21.641 -58.780 1.00 71.23  ? 203  DA  J N7    1 
ATOM   4142  C C5    . DA  B 1 57  ? 29.527  22.161 -58.132 1.00 69.77  ? 203  DA  J C5    1 
ATOM   4143  C C6    . DA  B 1 57  ? 30.582  21.558 -57.432 1.00 68.33  ? 203  DA  J C6    1 
ATOM   4144  N N6    . DA  B 1 57  ? 30.700  20.245 -57.254 1.00 64.44  ? 203  DA  J N6    1 
ATOM   4145  N N1    . DA  B 1 57  ? 31.529  22.363 -56.914 1.00 67.81  ? 203  DA  J N1    1 
ATOM   4146  C C2    . DA  B 1 57  ? 31.421  23.681 -57.098 1.00 69.63  ? 203  DA  J C2    1 
ATOM   4147  N N3    . DA  B 1 57  ? 30.480  24.367 -57.737 1.00 70.18  ? 203  DA  J N3    1 
ATOM   4148  C C4    . DA  B 1 57  ? 29.548  23.539 -58.230 1.00 71.02  ? 203  DA  J C4    1 
ATOM   4149  P P     . DG  B 1 58  ? 27.069  28.503 -61.922 1.00 99.85  ? 204  DG  J P     1 
ATOM   4150  O OP1   . DG  B 1 58  ? 26.051  29.550 -61.641 1.00 82.70  ? 204  DG  J OP1   1 
ATOM   4151  O OP2   . DG  B 1 58  ? 26.850  27.486 -62.999 1.00 81.34  ? 204  DG  J OP2   1 
ATOM   4152  O "O5'" . DG  B 1 58  ? 28.412  29.281 -62.227 1.00 96.92  ? 204  DG  J "O5'" 1 
ATOM   4153  C "C5'" . DG  B 1 58  ? 29.263  29.688 -61.167 1.00 91.33  ? 204  DG  J "C5'" 1 
ATOM   4154  C "C4'" . DG  B 1 58  ? 30.661  29.192 -61.432 1.00 88.22  ? 204  DG  J "C4'" 1 
ATOM   4155  O "O4'" . DG  B 1 58  ? 30.773  27.782 -61.126 1.00 86.21  ? 204  DG  J "O4'" 1 
ATOM   4156  C "C3'" . DG  B 1 58  ? 31.084  29.347 -62.891 1.00 85.21  ? 204  DG  J "C3'" 1 
ATOM   4157  O "O3'" . DG  B 1 58  ? 32.416  29.811 -62.905 1.00 83.77  ? 204  DG  J "O3'" 1 
ATOM   4158  C "C2'" . DG  B 1 58  ? 30.995  27.934 -63.437 1.00 85.68  ? 204  DG  J "C2'" 1 
ATOM   4159  C "C1'" . DG  B 1 58  ? 31.383  27.124 -62.216 1.00 85.21  ? 204  DG  J "C1'" 1 
ATOM   4160  N N9    . DG  B 1 58  ? 30.978  25.722 -62.192 1.00 67.90  ? 204  DG  J N9    1 
ATOM   4161  C C8    . DG  B 1 58  ? 29.903  25.145 -62.813 1.00 67.91  ? 204  DG  J C8    1 
ATOM   4162  N N7    . DG  B 1 58  ? 29.822  23.860 -62.602 1.00 68.86  ? 204  DG  J N7    1 
ATOM   4163  C C5    . DG  B 1 58  ? 30.914  23.579 -61.794 1.00 69.28  ? 204  DG  J C5    1 
ATOM   4164  C C6    . DG  B 1 58  ? 31.367  22.343 -61.230 1.00 68.66  ? 204  DG  J C6    1 
ATOM   4165  O O6    . DG  B 1 58  ? 30.885  21.207 -61.332 1.00 64.88  ? 204  DG  J O6    1 
ATOM   4166  N N1    . DG  B 1 58  ? 32.510  22.523 -60.480 1.00 69.34  ? 204  DG  J N1    1 
ATOM   4167  C C2    . DG  B 1 58  ? 33.139  23.716 -60.285 1.00 69.25  ? 204  DG  J C2    1 
ATOM   4168  N N2    . DG  B 1 58  ? 34.240  23.671 -59.527 1.00 67.67  ? 204  DG  J N2    1 
ATOM   4169  N N3    . DG  B 1 58  ? 32.730  24.865 -60.791 1.00 69.05  ? 204  DG  J N3    1 
ATOM   4170  C C4    . DG  B 1 58  ? 31.626  24.721 -61.531 1.00 69.23  ? 204  DG  J C4    1 
ATOM   4171  P P     . DG  B 1 59  ? 32.705  31.338 -62.544 1.00 64.51  ? 205  DG  J P     1 
ATOM   4172  O OP1   . DG  B 1 59  ? 31.825  31.736 -61.410 1.00 70.00  ? 205  DG  J OP1   1 
ATOM   4173  O OP2   . DG  B 1 59  ? 32.644  32.065 -63.820 1.00 69.96  ? 205  DG  J OP2   1 
ATOM   4174  O "O5'" . DG  B 1 59  ? 34.223  31.375 -62.066 1.00 62.65  ? 205  DG  J "O5'" 1 
ATOM   4175  C "C5'" . DG  B 1 59  ? 34.560  31.251 -60.673 1.00 59.05  ? 205  DG  J "C5'" 1 
ATOM   4176  C "C4'" . DG  B 1 59  ? 35.694  30.269 -60.483 1.00 55.52  ? 205  DG  J "C4'" 1 
ATOM   4177  O "O4'" . DG  B 1 59  ? 35.295  28.915 -60.827 1.00 55.50  ? 205  DG  J "O4'" 1 
ATOM   4178  C "C3'" . DG  B 1 59  ? 36.913  30.566 -61.331 1.00 53.20  ? 205  DG  J "C3'" 1 
ATOM   4179  O "O3'" . DG  B 1 59  ? 38.021  30.196 -60.548 1.00 53.55  ? 205  DG  J "O3'" 1 
ATOM   4180  C "C2'" . DG  B 1 59  ? 36.755  29.625 -62.505 1.00 53.49  ? 205  DG  J "C2'" 1 
ATOM   4181  C "C1'" . DG  B 1 59  ? 36.146  28.404 -61.840 1.00 55.04  ? 205  DG  J "C1'" 1 
ATOM   4182  N N9    . DG  B 1 59  ? 35.346  27.547 -62.712 1.00 65.61  ? 205  DG  J N9    1 
ATOM   4183  C C8    . DG  B 1 59  ? 34.463  27.957 -63.680 1.00 67.19  ? 205  DG  J C8    1 
ATOM   4184  N N7    . DG  B 1 59  ? 33.857  26.966 -64.282 1.00 68.78  ? 205  DG  J N7    1 
ATOM   4185  C C5    . DG  B 1 59  ? 34.372  25.827 -63.680 1.00 68.76  ? 205  DG  J C5    1 
ATOM   4186  C C6    . DG  B 1 59  ? 34.073  24.444 -63.904 1.00 69.23  ? 205  DG  J C6    1 
ATOM   4187  O O6    . DG  B 1 59  ? 33.260  23.955 -64.665 1.00 69.74  ? 205  DG  J O6    1 
ATOM   4188  N N1    . DG  B 1 59  ? 34.835  23.614 -63.102 1.00 67.72  ? 205  DG  J N1    1 
ATOM   4189  C C2    . DG  B 1 59  ? 35.754  24.043 -62.180 1.00 67.20  ? 205  DG  J C2    1 
ATOM   4190  N N2    . DG  B 1 59  ? 36.372  23.075 -61.506 1.00 65.30  ? 205  DG  J N2    1 
ATOM   4191  N N3    . DG  B 1 59  ? 36.040  25.329 -61.935 1.00 67.50  ? 205  DG  J N3    1 
ATOM   4192  C C4    . DG  B 1 59  ? 35.311  26.163 -62.720 1.00 66.68  ? 205  DG  J C4    1 
ATOM   4193  P P     . DC  B 1 60  ? 39.503  30.444 -61.091 1.00 63.81  ? 206  DC  J P     1 
ATOM   4194  O OP1   . DC  B 1 60  ? 40.225  31.179 -60.028 1.00 62.48  ? 206  DC  J OP1   1 
ATOM   4195  O OP2   . DC  B 1 60  ? 39.438  30.987 -62.482 1.00 59.02  ? 206  DC  J OP2   1 
ATOM   4196  O "O5'" . DC  B 1 60  ? 40.091  28.979 -61.226 1.00 64.46  ? 206  DC  J "O5'" 1 
ATOM   4197  C "C5'" . DC  B 1 60  ? 39.345  28.019 -61.918 1.00 60.52  ? 206  DC  J "C5'" 1 
ATOM   4198  C "C4'" . DC  B 1 60  ? 40.086  26.716 -61.991 1.00 57.66  ? 206  DC  J "C4'" 1 
ATOM   4199  O "O4'" . DC  B 1 60  ? 39.210  25.852 -62.739 1.00 56.05  ? 206  DC  J "O4'" 1 
ATOM   4200  C "C3'" . DC  B 1 60  ? 41.371  26.775 -62.805 1.00 55.45  ? 206  DC  J "C3'" 1 
ATOM   4201  O "O3'" . DC  B 1 60  ? 42.083  25.575 -62.509 1.00 49.46  ? 206  DC  J "O3'" 1 
ATOM   4202  C "C2'" . DC  B 1 60  ? 40.839  26.721 -64.224 1.00 54.31  ? 206  DC  J "C2'" 1 
ATOM   4203  C "C1'" . DC  B 1 60  ? 39.681  25.730 -64.075 1.00 56.05  ? 206  DC  J "C1'" 1 
ATOM   4204  N N1    . DC  B 1 60  ? 38.525  25.923 -64.956 1.00 55.95  ? 206  DC  J N1    1 
ATOM   4205  C C2    . DC  B 1 60  ? 37.834  24.807 -65.353 1.00 56.50  ? 206  DC  J C2    1 
ATOM   4206  O O2    . DC  B 1 60  ? 38.228  23.697 -64.981 1.00 54.19  ? 206  DC  J O2    1 
ATOM   4207  N N3    . DC  B 1 60  ? 36.748  24.950 -66.129 1.00 58.06  ? 206  DC  J N3    1 
ATOM   4208  C C4    . DC  B 1 60  ? 36.343  26.160 -66.499 1.00 57.73  ? 206  DC  J C4    1 
ATOM   4209  N N4    . DC  B 1 60  ? 35.234  26.233 -67.231 1.00 54.61  ? 206  DC  J N4    1 
ATOM   4210  C C5    . DC  B 1 60  ? 37.045  27.331 -66.126 1.00 55.01  ? 206  DC  J C5    1 
ATOM   4211  C C6    . DC  B 1 60  ? 38.124  27.169 -65.360 1.00 55.03  ? 206  DC  J C6    1 
ATOM   4212  P P     . DA  B 1 61  ? 43.667  25.518 -62.642 1.00 38.07  ? 207  DA  J P     1 
ATOM   4213  O OP1   . DA  B 1 61  ? 44.185  25.805 -61.303 1.00 36.97  ? 207  DA  J OP1   1 
ATOM   4214  O OP2   . DA  B 1 61  ? 44.193  26.239 -63.838 1.00 39.53  ? 207  DA  J OP2   1 
ATOM   4215  O "O5'" . DA  B 1 61  ? 43.963  23.988 -62.842 1.00 38.19  ? 207  DA  J "O5'" 1 
ATOM   4216  C "C5'" . DA  B 1 61  ? 43.372  23.043 -61.970 1.00 40.56  ? 207  DA  J "C5'" 1 
ATOM   4217  C "C4'" . DA  B 1 61  ? 43.028  21.780 -62.724 1.00 36.64  ? 207  DA  J "C4'" 1 
ATOM   4218  O "O4'" . DA  B 1 61  ? 41.927  22.032 -63.630 1.00 38.90  ? 207  DA  J "O4'" 1 
ATOM   4219  C "C3'" . DA  B 1 61  ? 44.166  21.205 -63.567 1.00 38.87  ? 207  DA  J "C3'" 1 
ATOM   4220  O "O3'" . DA  B 1 61  ? 44.182  19.796 -63.402 1.00 40.75  ? 207  DA  J "O3'" 1 
ATOM   4221  C "C2'" . DA  B 1 61  ? 43.805  21.617 -64.982 1.00 38.76  ? 207  DA  J "C2'" 1 
ATOM   4222  C "C1'" . DA  B 1 61  ? 42.281  21.655 -64.943 1.00 39.21  ? 207  DA  J "C1'" 1 
ATOM   4223  N N9    . DA  B 1 61  ? 41.659  22.621 -65.838 1.00 48.12  ? 207  DA  J N9    1 
ATOM   4224  C C8    . DA  B 1 61  ? 41.884  23.961 -65.894 1.00 51.61  ? 207  DA  J C8    1 
ATOM   4225  N N7    . DA  B 1 61  ? 41.106  24.591 -66.730 1.00 51.75  ? 207  DA  J N7    1 
ATOM   4226  C C5    . DA  B 1 61  ? 40.334  23.585 -67.284 1.00 55.86  ? 207  DA  J C5    1 
ATOM   4227  C C6    . DA  B 1 61  ? 39.306  23.605 -68.214 1.00 56.09  ? 207  DA  J C6    1 
ATOM   4228  N N6    . DA  B 1 61  ? 38.860  24.718 -68.793 1.00 54.40  ? 207  DA  J N6    1 
ATOM   4229  N N1    . DA  B 1 61  ? 38.736  22.432 -68.536 1.00 55.59  ? 207  DA  J N1    1 
ATOM   4230  C C2    . DA  B 1 61  ? 39.185  21.327 -67.959 1.00 53.37  ? 207  DA  J C2    1 
ATOM   4231  N N3    . DA  B 1 61  ? 40.143  21.180 -67.074 1.00 53.50  ? 207  DA  J N3    1 
ATOM   4232  C C4    . DA  B 1 61  ? 40.682  22.366 -66.763 1.00 53.63  ? 207  DA  J C4    1 
ATOM   4233  P P     . DT  B 1 62  ? 45.309  18.915 -64.111 1.00 42.44  ? 208  DT  J P     1 
ATOM   4234  O OP1   . DT  B 1 62  ? 45.643  17.739 -63.234 1.00 45.84  ? 208  DT  J OP1   1 
ATOM   4235  O OP2   . DT  B 1 62  ? 46.373  19.771 -64.688 1.00 44.69  ? 208  DT  J OP2   1 
ATOM   4236  O "O5'" . DT  B 1 62  ? 44.581  18.349 -65.397 1.00 44.79  ? 208  DT  J "O5'" 1 
ATOM   4237  C "C5'" . DT  B 1 62  ? 43.356  17.624 -65.284 1.00 43.93  ? 208  DT  J "C5'" 1 
ATOM   4238  C "C4'" . DT  B 1 62  ? 42.870  17.222 -66.651 1.00 45.04  ? 208  DT  J "C4'" 1 
ATOM   4239  O "O4'" . DT  B 1 62  ? 42.236  18.341 -67.300 1.00 44.59  ? 208  DT  J "O4'" 1 
ATOM   4240  C "C3'" . DT  B 1 62  ? 43.992  16.775 -67.581 1.00 45.50  ? 208  DT  J "C3'" 1 
ATOM   4241  O "O3'" . DT  B 1 62  ? 43.568  15.603 -68.268 1.00 50.39  ? 208  DT  J "O3'" 1 
ATOM   4242  C "C2'" . DT  B 1 62  ? 44.120  17.936 -68.552 1.00 40.77  ? 208  DT  J "C2'" 1 
ATOM   4243  C "C1'" . DT  B 1 62  ? 42.699  18.412 -68.622 1.00 43.54  ? 208  DT  J "C1'" 1 
ATOM   4244  N N1    . DT  B 1 62  ? 42.499  19.779 -69.095 1.00 50.03  ? 208  DT  J N1    1 
ATOM   4245  C C2    . DT  B 1 62  ? 41.483  20.009 -69.997 1.00 53.69  ? 208  DT  J C2    1 
ATOM   4246  O O2    . DT  B 1 62  ? 40.760  19.121 -70.442 1.00 55.63  ? 208  DT  J O2    1 
ATOM   4247  N N3    . DT  B 1 62  ? 41.332  21.313 -70.362 1.00 54.89  ? 208  DT  J N3    1 
ATOM   4248  C C4    . DT  B 1 62  ? 42.064  22.382 -69.928 1.00 54.25  ? 208  DT  J C4    1 
ATOM   4249  O O4    . DT  B 1 62  ? 41.774  23.512 -70.313 1.00 49.51  ? 208  DT  J O4    1 
ATOM   4250  C C5    . DT  B 1 62  ? 43.135  22.062 -69.009 1.00 50.19  ? 208  DT  J C5    1 
ATOM   4251  C C7    . DT  B 1 62  ? 44.023  23.156 -68.505 1.00 54.09  ? 208  DT  J C7    1 
ATOM   4252  C C6    . DT  B 1 62  ? 43.290  20.792 -68.646 1.00 49.72  ? 208  DT  J C6    1 
ATOM   4253  P P     . DG  B 1 63  ? 44.644  14.517 -68.759 1.00 54.40  ? 209  DG  J P     1 
ATOM   4254  O OP1   . DG  B 1 63  ? 44.356  13.268 -67.999 1.00 65.69  ? 209  DG  J OP1   1 
ATOM   4255  O OP2   . DG  B 1 63  ? 46.025  15.077 -68.780 1.00 61.50  ? 209  DG  J OP2   1 
ATOM   4256  O "O5'" . DG  B 1 63  ? 44.233  14.320 -70.278 1.00 55.06  ? 209  DG  J "O5'" 1 
ATOM   4257  C "C5'" . DG  B 1 63  ? 42.879  14.462 -70.695 1.00 58.02  ? 209  DG  J "C5'" 1 
ATOM   4258  C "C4'" . DG  B 1 63  ? 42.834  14.929 -72.130 1.00 60.78  ? 209  DG  J "C4'" 1 
ATOM   4259  O "O4'" . DG  B 1 63  ? 42.683  16.364 -72.205 1.00 58.49  ? 209  DG  J "O4'" 1 
ATOM   4260  C "C3'" . DG  B 1 63  ? 44.068  14.584 -72.967 1.00 61.33  ? 209  DG  J "C3'" 1 
ATOM   4261  O "O3'" . DG  B 1 63  ? 43.620  14.190 -74.253 1.00 62.87  ? 209  DG  J "O3'" 1 
ATOM   4262  C "C2'" . DG  B 1 63  ? 44.794  15.914 -73.067 1.00 61.12  ? 209  DG  J "C2'" 1 
ATOM   4263  C "C1'" . DG  B 1 63  ? 43.624  16.871 -73.121 1.00 60.01  ? 209  DG  J "C1'" 1 
ATOM   4264  N N9    . DG  B 1 63  ? 43.869  18.264 -72.776 1.00 67.18  ? 209  DG  J N9    1 
ATOM   4265  C C8    . DG  B 1 63  ? 44.757  18.781 -71.868 1.00 66.26  ? 209  DG  J C8    1 
ATOM   4266  N N7    . DG  B 1 63  ? 44.689  20.082 -71.772 1.00 64.58  ? 209  DG  J N7    1 
ATOM   4267  C C5    . DG  B 1 63  ? 43.699  20.437 -72.678 1.00 66.21  ? 209  DG  J C5    1 
ATOM   4268  C C6    . DG  B 1 63  ? 43.166  21.705 -73.017 1.00 67.83  ? 209  DG  J C6    1 
ATOM   4269  O O6    . DG  B 1 63  ? 43.473  22.813 -72.578 1.00 62.60  ? 209  DG  J O6    1 
ATOM   4270  N N1    . DG  B 1 63  ? 42.177  21.600 -73.986 1.00 70.37  ? 209  DG  J N1    1 
ATOM   4271  C C2    . DG  B 1 63  ? 41.764  20.429 -74.567 1.00 69.88  ? 209  DG  J C2    1 
ATOM   4272  N N2    . DG  B 1 63  ? 40.811  20.524 -75.498 1.00 69.24  ? 209  DG  J N2    1 
ATOM   4273  N N3    . DG  B 1 63  ? 42.250  19.251 -74.263 1.00 66.48  ? 209  DG  J N3    1 
ATOM   4274  C C4    . DG  B 1 63  ? 43.201  19.326 -73.314 1.00 68.09  ? 209  DG  J C4    1 
ATOM   4275  P P     . DT  B 1 64  ? 44.598  13.409 -75.260 1.00 69.11  ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 64  ? 44.049  12.054 -75.353 1.00 53.85  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 64  ? 46.024  13.590 -74.926 1.00 50.50  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 64  ? 44.252  14.128 -76.634 1.00 69.35  ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 64  ? 42.886  14.463 -76.926 1.00 73.12  ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 64  ? 42.819  15.543 -77.979 1.00 75.92  ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 64  ? 42.865  16.881 -77.417 1.00 76.53  ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 64  ? 43.964  15.450 -78.983 1.00 76.91  ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 64  ? 43.484  15.689 -80.292 1.00 81.02  ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 64  ? 44.876  16.587 -78.576 1.00 75.99  ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 64  ? 43.873  17.617 -78.096 1.00 75.95  ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 64  ? 44.438  18.633 -77.182 1.00 59.56  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 64  ? 43.990  19.921 -77.333 1.00 59.67  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 64  ? 43.117  20.239 -78.120 1.00 61.37  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 64  ? 44.599  20.834 -76.524 1.00 57.13  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 64  ? 45.580  20.595 -75.587 1.00 57.27  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 64  ? 46.036  21.525 -74.940 1.00 52.26  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 64  ? 45.989  19.217 -75.460 1.00 55.55  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 64  ? 47.053  18.875 -74.473 1.00 53.11  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 64  ? 45.399  18.313 -76.244 1.00 56.94  ? 210  DT  J C6    1 
ATOM   4295  P P     . DT  B 1 65  ? 44.280  15.087 -81.536 1.00 93.21  ? 211  DT  J P     1 
ATOM   4296  O OP1   . DT  B 1 65  ? 43.568  13.859 -81.986 1.00 83.74  ? 211  DT  J OP1   1 
ATOM   4297  O OP2   . DT  B 1 65  ? 45.728  15.027 -81.152 1.00 83.97  ? 211  DT  J OP2   1 
ATOM   4298  O "O5'" . DT  B 1 65  ? 44.097  16.204 -82.651 1.00 92.70  ? 211  DT  J "O5'" 1 
ATOM   4299  C "C5'" . DT  B 1 65  ? 42.971  17.069 -82.626 1.00 89.95  ? 211  DT  J "C5'" 1 
ATOM   4300  C "C4'" . DT  B 1 65  ? 43.388  18.460 -83.032 1.00 88.84  ? 211  DT  J "C4'" 1 
ATOM   4301  O "O4'" . DT  B 1 65  ? 43.927  19.207 -81.919 1.00 87.51  ? 211  DT  J "O4'" 1 
ATOM   4302  C "C3'" . DT  B 1 65  ? 44.462  18.484 -84.116 1.00 89.47  ? 211  DT  J "C3'" 1 
ATOM   4303  O "O3'" . DT  B 1 65  ? 44.149  19.503 -85.042 1.00 92.26  ? 211  DT  J "O3'" 1 
ATOM   4304  C "C2'" . DT  B 1 65  ? 45.720  18.881 -83.367 1.00 85.65  ? 211  DT  J "C2'" 1 
ATOM   4305  C "C1'" . DT  B 1 65  ? 45.145  19.818 -82.328 1.00 83.47  ? 211  DT  J "C1'" 1 
ATOM   4306  N N1    . DT  B 1 65  ? 45.982  20.040 -81.129 1.00 70.94  ? 211  DT  J N1    1 
ATOM   4307  C C2    . DT  B 1 65  ? 46.142  21.322 -80.674 1.00 67.99  ? 211  DT  J C2    1 
ATOM   4308  O O2    . DT  B 1 65  ? 45.654  22.287 -81.220 1.00 66.27  ? 211  DT  J O2    1 
ATOM   4309  N N3    . DT  B 1 65  ? 46.901  21.432 -79.551 1.00 64.23  ? 211  DT  J N3    1 
ATOM   4310  C C4    . DT  B 1 65  ? 47.507  20.420 -78.859 1.00 65.50  ? 211  DT  J C4    1 
ATOM   4311  O O4    . DT  B 1 65  ? 48.134  20.662 -77.862 1.00 59.44  ? 211  DT  J O4    1 
ATOM   4312  C C5    . DT  B 1 65  ? 47.333  19.119 -79.392 1.00 65.71  ? 211  DT  J C5    1 
ATOM   4313  C C7    . DT  B 1 65  ? 48.013  17.974 -78.716 1.00 62.12  ? 211  DT  J C7    1 
ATOM   4314  C C6    . DT  B 1 65  ? 46.579  18.982 -80.484 1.00 67.50  ? 211  DT  J C6    1 
ATOM   4315  P P     . DC  B 1 66  ? 44.667  19.386 -86.541 1.00 95.84  ? 212  DC  J P     1 
ATOM   4316  O OP1   . DC  B 1 66  ? 43.457  19.394 -87.400 1.00 67.71  ? 212  DC  J OP1   1 
ATOM   4317  O OP2   . DC  B 1 66  ? 45.673  18.304 -86.677 1.00 70.86  ? 212  DC  J OP2   1 
ATOM   4318  O "O5'" . DC  B 1 66  ? 45.458  20.735 -86.741 1.00 98.43  ? 212  DC  J "O5'" 1 
ATOM   4319  C "C5'" . DC  B 1 66  ? 44.916  21.945 -86.275 1.00 94.01  ? 212  DC  J "C5'" 1 
ATOM   4320  C "C4'" . DC  B 1 66  ? 46.019  22.958 -86.136 1.00 91.54  ? 212  DC  J "C4'" 1 
ATOM   4321  O "O4'" . DC  B 1 66  ? 46.664  22.876 -84.840 1.00 90.90  ? 212  DC  J "O4'" 1 
ATOM   4322  C "C3'" . DC  B 1 66  ? 47.120  22.814 -87.188 1.00 89.74  ? 212  DC  J "C3'" 1 
ATOM   4323  O "O3'" . DC  B 1 66  ? 47.384  24.117 -87.679 1.00 86.43  ? 212  DC  J "O3'" 1 
ATOM   4324  C "C2'" . DC  B 1 66  ? 48.309  22.280 -86.397 1.00 91.33  ? 212  DC  J "C2'" 1 
ATOM   4325  C "C1'" . DC  B 1 66  ? 48.074  22.887 -85.019 1.00 89.55  ? 212  DC  J "C1'" 1 
ATOM   4326  N N1    . DC  B 1 66  ? 48.678  22.196 -83.863 1.00 60.49  ? 212  DC  J N1    1 
ATOM   4327  C C2    . DC  B 1 66  ? 49.057  22.961 -82.759 1.00 59.16  ? 212  DC  J C2    1 
ATOM   4328  O O2    . DC  B 1 66  ? 48.883  24.178 -82.795 1.00 53.52  ? 212  DC  J O2    1 
ATOM   4329  N N3    . DC  B 1 66  ? 49.596  22.353 -81.680 1.00 56.37  ? 212  DC  J N3    1 
ATOM   4330  C C4    . DC  B 1 66  ? 49.754  21.041 -81.671 1.00 59.44  ? 212  DC  J C4    1 
ATOM   4331  N N4    . DC  B 1 66  ? 50.276  20.501 -80.592 1.00 58.43  ? 212  DC  J N4    1 
ATOM   4332  C C5    . DC  B 1 66  ? 49.382  20.228 -82.779 1.00 58.91  ? 212  DC  J C5    1 
ATOM   4333  C C6    . DC  B 1 66  ? 48.856  20.839 -83.849 1.00 58.58  ? 212  DC  J C6    1 
ATOM   4334  P P     . DA  B 1 67  ? 48.063  24.322 -89.110 1.00 75.07  ? 213  DA  J P     1 
ATOM   4335  O OP1   . DA  B 1 67  ? 47.077  25.066 -89.957 1.00 71.34  ? 213  DA  J OP1   1 
ATOM   4336  O OP2   . DA  B 1 67  ? 48.615  23.018 -89.558 1.00 70.12  ? 213  DA  J OP2   1 
ATOM   4337  O "O5'" . DA  B 1 67  ? 49.254  25.325 -88.757 1.00 74.59  ? 213  DA  J "O5'" 1 
ATOM   4338  C "C5'" . DA  B 1 67  ? 49.011  26.470 -87.929 1.00 71.66  ? 213  DA  J "C5'" 1 
ATOM   4339  C "C4'" . DA  B 1 67  ? 50.305  26.948 -87.333 1.00 72.79  ? 213  DA  J "C4'" 1 
ATOM   4340  O "O4'" . DA  B 1 67  ? 50.708  26.035 -86.298 1.00 70.01  ? 213  DA  J "O4'" 1 
ATOM   4341  C "C3'" . DA  B 1 67  ? 51.435  26.939 -88.361 1.00 72.10  ? 213  DA  J "C3'" 1 
ATOM   4342  O "O3'" . DA  B 1 67  ? 52.333  27.995 -88.085 1.00 73.70  ? 213  DA  J "O3'" 1 
ATOM   4343  C "C2'" . DA  B 1 67  ? 52.155  25.647 -88.060 1.00 71.69  ? 213  DA  J "C2'" 1 
ATOM   4344  C "C1'" . DA  B 1 67  ? 52.040  25.641 -86.564 1.00 70.46  ? 213  DA  J "C1'" 1 
ATOM   4345  N N9    . DA  B 1 67  ? 52.244  24.336 -85.971 1.00 70.76  ? 213  DA  J N9    1 
ATOM   4346  C C8    . DA  B 1 67  ? 52.266  23.126 -86.595 1.00 70.24  ? 213  DA  J C8    1 
ATOM   4347  N N7    . DA  B 1 67  ? 52.414  22.119 -85.778 1.00 73.81  ? 213  DA  J N7    1 
ATOM   4348  C C5    . DA  B 1 67  ? 52.510  22.714 -84.533 1.00 72.29  ? 213  DA  J C5    1 
ATOM   4349  C C6    . DA  B 1 67  ? 52.653  22.191 -83.263 1.00 73.23  ? 213  DA  J C6    1 
ATOM   4350  N N6    . DA  B 1 67  ? 52.759  20.887 -83.020 1.00 71.05  ? 213  DA  J N6    1 
ATOM   4351  N N1    . DA  B 1 67  ? 52.691  23.056 -82.228 1.00 73.05  ? 213  DA  J N1    1 
ATOM   4352  C C2    . DA  B 1 67  ? 52.616  24.365 -82.479 1.00 74.08  ? 213  DA  J C2    1 
ATOM   4353  N N3    . DA  B 1 67  ? 52.491  24.980 -83.638 1.00 69.43  ? 213  DA  J N3    1 
ATOM   4354  C C4    . DA  B 1 67  ? 52.430  24.082 -84.639 1.00 72.14  ? 213  DA  J C4    1 
ATOM   4355  P P     . DG  B 1 68  ? 52.314  29.304 -88.991 1.00 75.54  ? 214  DG  J P     1 
ATOM   4356  O OP1   . DG  B 1 68  ? 50.909  29.640 -89.273 1.00 61.35  ? 214  DG  J OP1   1 
ATOM   4357  O OP2   . DG  B 1 68  ? 53.281  29.071 -90.091 1.00 64.23  ? 214  DG  J OP2   1 
ATOM   4358  O "O5'" . DG  B 1 68  ? 52.834  30.443 -88.018 1.00 77.08  ? 214  DG  J "O5'" 1 
ATOM   4359  C "C5'" . DG  B 1 68  ? 52.197  30.656 -86.751 1.00 73.63  ? 214  DG  J "C5'" 1 
ATOM   4360  C "C4'" . DG  B 1 68  ? 53.237  30.719 -85.655 1.00 72.63  ? 214  DG  J "C4'" 1 
ATOM   4361  O "O4'" . DG  B 1 68  ? 53.705  29.407 -85.242 1.00 71.34  ? 214  DG  J "O4'" 1 
ATOM   4362  C "C3'" . DG  B 1 68  ? 54.476  31.492 -86.088 1.00 69.96  ? 214  DG  J "C3'" 1 
ATOM   4363  O "O3'" . DG  B 1 68  ? 54.881  32.339 -85.011 1.00 69.95  ? 214  DG  J "O3'" 1 
ATOM   4364  C "C2'" . DG  B 1 68  ? 55.485  30.400 -86.421 1.00 69.65  ? 214  DG  J "C2'" 1 
ATOM   4365  C "C1'" . DG  B 1 68  ? 55.117  29.320 -85.422 1.00 70.76  ? 214  DG  J "C1'" 1 
ATOM   4366  N N9    . DG  B 1 68  ? 55.420  27.953 -85.820 1.00 61.29  ? 214  DG  J N9    1 
ATOM   4367  C C8    . DG  B 1 68  ? 55.359  27.417 -87.077 1.00 59.97  ? 214  DG  J C8    1 
ATOM   4368  N N7    . DG  B 1 68  ? 55.541  26.125 -87.091 1.00 60.50  ? 214  DG  J N7    1 
ATOM   4369  C C5    . DG  B 1 68  ? 55.771  25.794 -85.763 1.00 58.78  ? 214  DG  J C5    1 
ATOM   4370  C C6    . DG  B 1 68  ? 55.971  24.539 -85.153 1.00 61.23  ? 214  DG  J C6    1 
ATOM   4371  O O6    . DG  B 1 68  ? 55.973  23.439 -85.667 1.00 59.82  ? 214  DG  J O6    1 
ATOM   4372  N N1    . DG  B 1 68  ? 56.145  24.653 -83.784 1.00 60.48  ? 214  DG  J N1    1 
ATOM   4373  C C2    . DG  B 1 68  ? 56.105  25.819 -83.077 1.00 61.08  ? 214  DG  J C2    1 
ATOM   4374  N N2    . DG  B 1 68  ? 56.231  25.704 -81.760 1.00 59.58  ? 214  DG  J N2    1 
ATOM   4375  N N3    . DG  B 1 68  ? 55.929  27.006 -83.626 1.00 61.93  ? 214  DG  J N3    1 
ATOM   4376  C C4    . DG  B 1 68  ? 55.750  26.917 -84.971 1.00 61.60  ? 214  DG  J C4    1 
ATOM   4377  P P     . DC  B 1 69  ? 55.945  33.504 -85.275 1.00 83.21  ? 215  DC  J P     1 
ATOM   4378  O OP1   . DC  B 1 69  ? 55.370  34.732 -84.657 1.00 64.72  ? 215  DC  J OP1   1 
ATOM   4379  O OP2   . DC  B 1 69  ? 56.273  33.487 -86.725 1.00 66.77  ? 215  DC  J OP2   1 
ATOM   4380  O "O5'" . DC  B 1 69  ? 57.213  32.962 -84.477 1.00 82.83  ? 215  DC  J "O5'" 1 
ATOM   4381  C "C5'" . DC  B 1 69  ? 57.054  32.473 -83.148 1.00 81.34  ? 215  DC  J "C5'" 1 
ATOM   4382  C "C4'" . DC  B 1 69  ? 58.218  31.596 -82.766 1.00 84.32  ? 215  DC  J "C4'" 1 
ATOM   4383  O "O4'" . DC  B 1 69  ? 58.088  30.285 -83.356 1.00 83.11  ? 215  DC  J "O4'" 1 
ATOM   4384  C "C3'" . DC  B 1 69  ? 59.589  32.120 -83.192 1.00 83.97  ? 215  DC  J "C3'" 1 
ATOM   4385  O "O3'" . DC  B 1 69  ? 60.519  31.875 -82.137 1.00 85.30  ? 215  DC  J "O3'" 1 
ATOM   4386  C "C2'" . DC  B 1 69  ? 59.939  31.226 -84.365 1.00 84.42  ? 215  DC  J "C2'" 1 
ATOM   4387  C "C1'" . DC  B 1 69  ? 59.340  29.918 -83.892 1.00 86.07  ? 215  DC  J "C1'" 1 
ATOM   4388  N N1    . DC  B 1 69  ? 59.121  28.892 -84.925 1.00 72.21  ? 215  DC  J N1    1 
ATOM   4389  C C2    . DC  B 1 69  ? 59.346  27.542 -84.606 1.00 72.58  ? 215  DC  J C2    1 
ATOM   4390  O O2    . DC  B 1 69  ? 59.670  27.239 -83.450 1.00 65.99  ? 215  DC  J O2    1 
ATOM   4391  N N3    . DC  B 1 69  ? 59.191  26.603 -85.565 1.00 70.51  ? 215  DC  J N3    1 
ATOM   4392  C C4    . DC  B 1 69  ? 58.807  26.961 -86.795 1.00 72.23  ? 215  DC  J C4    1 
ATOM   4393  N N4    . DC  B 1 69  ? 58.665  26.006 -87.711 1.00 75.18  ? 215  DC  J N4    1 
ATOM   4394  C C5    . DC  B 1 69  ? 58.548  28.320 -87.141 1.00 72.01  ? 215  DC  J C5    1 
ATOM   4395  C C6    . DC  B 1 69  ? 58.716  29.244 -86.183 1.00 72.35  ? 215  DC  J C6    1 
ATOM   4396  P P     . DG  B 1 70  ? 60.798  33.010 -81.030 1.00 58.20  ? 216  DG  J P     1 
ATOM   4397  O OP1   . DG  B 1 70  ? 59.511  33.445 -80.417 1.00 56.96  ? 216  DG  J OP1   1 
ATOM   4398  O OP2   . DG  B 1 70  ? 61.724  34.006 -81.643 1.00 55.64  ? 216  DG  J OP2   1 
ATOM   4399  O "O5'" . DG  B 1 70  ? 61.601  32.239 -79.892 1.00 58.62  ? 216  DG  J "O5'" 1 
ATOM   4400  C "C5'" . DG  B 1 70  ? 60.985  31.188 -79.138 1.00 57.16  ? 216  DG  J "C5'" 1 
ATOM   4401  C "C4'" . DG  B 1 70  ? 61.886  29.974 -79.095 1.00 65.74  ? 216  DG  J "C4'" 1 
ATOM   4402  O "O4'" . DG  B 1 70  ? 61.820  29.213 -80.324 1.00 67.38  ? 216  DG  J "O4'" 1 
ATOM   4403  C "C3'" . DG  B 1 70  ? 63.363  30.283 -78.888 1.00 65.79  ? 216  DG  J "C3'" 1 
ATOM   4404  O "O3'" . DG  B 1 70  ? 63.939  29.187 -78.205 1.00 70.03  ? 216  DG  J "O3'" 1 
ATOM   4405  C "C2'" . DG  B 1 70  ? 63.902  30.240 -80.297 1.00 66.59  ? 216  DG  J "C2'" 1 
ATOM   4406  C "C1'" . DG  B 1 70  ? 63.131  29.060 -80.835 1.00 67.36  ? 216  DG  J "C1'" 1 
ATOM   4407  N N9    . DG  B 1 70  ? 63.041  29.024 -82.287 1.00 64.00  ? 216  DG  J N9    1 
ATOM   4408  C C8    . DG  B 1 70  ? 62.949  30.094 -83.144 1.00 61.28  ? 216  DG  J C8    1 
ATOM   4409  N N7    . DG  B 1 70  ? 62.876  29.741 -84.395 1.00 64.67  ? 216  DG  J N7    1 
ATOM   4410  C C5    . DG  B 1 70  ? 62.921  28.359 -84.354 1.00 67.80  ? 216  DG  J C5    1 
ATOM   4411  C C6    . DG  B 1 70  ? 62.862  27.435 -85.386 1.00 66.12  ? 216  DG  J C6    1 
ATOM   4412  O O6    . DG  B 1 70  ? 62.737  27.645 -86.592 1.00 65.56  ? 216  DG  J O6    1 
ATOM   4413  N N1    . DG  B 1 70  ? 62.950  26.136 -84.909 1.00 66.08  ? 216  DG  J N1    1 
ATOM   4414  C C2    . DG  B 1 70  ? 63.066  25.788 -83.592 1.00 67.50  ? 216  DG  J C2    1 
ATOM   4415  N N2    . DG  B 1 70  ? 63.141  24.487 -83.331 1.00 67.32  ? 216  DG  J N2    1 
ATOM   4416  N N3    . DG  B 1 70  ? 63.106  26.650 -82.612 1.00 65.90  ? 216  DG  J N3    1 
ATOM   4417  C C4    . DG  B 1 70  ? 63.031  27.908 -83.060 1.00 66.45  ? 216  DG  J C4    1 
ATOM   4418  P P     . DG  B 1 71  ? 65.026  29.436 -77.056 1.00 40.82  ? 217  DG  J P     1 
ATOM   4419  O OP1   . DG  B 1 71  ? 64.317  29.432 -75.750 1.00 39.20  ? 217  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 1 71  ? 65.900  30.585 -77.402 1.00 37.88  ? 217  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 1 71  ? 65.870  28.099 -77.111 1.00 41.24  ? 217  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 1 71  ? 65.259  26.884 -76.745 1.00 39.78  ? 217  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 1 71  ? 65.880  25.762 -77.524 1.00 48.36  ? 217  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 1 71  ? 65.624  25.957 -78.936 1.00 50.00  ? 217  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 1 71  ? 67.395  25.689 -77.379 1.00 48.41  ? 217  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 1 71  ? 67.733  24.320 -77.429 1.00 52.65  ? 217  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 1 71  ? 67.902  26.379 -78.633 1.00 49.21  ? 217  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 1 71  ? 66.862  25.920 -79.636 1.00 49.98  ? 217  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 1 71  ? 66.733  26.715 -80.858 1.00 46.24  ? 217  DG  J N9    1 
ATOM   4430  C C8    . DG  B 1 71  ? 66.728  28.086 -80.988 1.00 43.52  ? 217  DG  J C8    1 
ATOM   4431  N N7    . DG  B 1 71  ? 66.607  28.483 -82.227 1.00 46.91  ? 217  DG  J N7    1 
ATOM   4432  C C5    . DG  B 1 71  ? 66.525  27.302 -82.955 1.00 50.04  ? 217  DG  J C5    1 
ATOM   4433  C C6    . DG  B 1 71  ? 66.377  27.090 -84.354 1.00 48.36  ? 217  DG  J C6    1 
ATOM   4434  O O6    . DG  B 1 71  ? 66.291  27.921 -85.250 1.00 47.80  ? 217  DG  J O6    1 
ATOM   4435  N N1    . DG  B 1 71  ? 66.328  25.738 -84.660 1.00 48.32  ? 217  DG  J N1    1 
ATOM   4436  C C2    . DG  B 1 71  ? 66.408  24.707 -83.732 1.00 49.74  ? 217  DG  J C2    1 
ATOM   4437  N N2    . DG  B 1 71  ? 66.333  23.441 -84.214 1.00 49.56  ? 217  DG  J N2    1 
ATOM   4438  N N3    . DG  B 1 71  ? 66.545  24.898 -82.428 1.00 48.14  ? 217  DG  J N3    1 
ATOM   4439  C C4    . DG  B 1 71  ? 66.596  26.206 -82.117 1.00 48.69  ? 217  DG  J C4    1 
ATOM   4440  P P     . DA  B 1 72  ? 68.961  23.774 -76.583 1.00 88.05  ? 218  DA  J P     1 
ATOM   4441  O OP1   . DA  B 1 72  ? 68.386  23.004 -75.456 1.00 62.85  ? 218  DA  J OP1   1 
ATOM   4442  O OP2   . DA  B 1 72  ? 69.917  24.895 -76.321 1.00 67.12  ? 218  DA  J OP2   1 
ATOM   4443  O "O5'" . DA  B 1 72  ? 69.601  22.742 -77.601 1.00 90.94  ? 218  DA  J "O5'" 1 
ATOM   4444  C "C5'" . DA  B 1 72  ? 68.762  21.830 -78.305 1.00 93.35  ? 218  DA  J "C5'" 1 
ATOM   4445  C "C4'" . DA  B 1 72  ? 69.337  21.533 -79.670 1.00 98.17  ? 218  DA  J "C4'" 1 
ATOM   4446  O "O4'" . DA  B 1 72  ? 69.049  22.575 -80.635 1.00 98.61  ? 218  DA  J "O4'" 1 
ATOM   4447  C "C3'" . DA  B 1 72  ? 70.851  21.362 -79.679 1.00 100.24 ? 218  DA  J "C3'" 1 
ATOM   4448  O "O3'" . DA  B 1 72  ? 71.175  20.275 -80.528 1.00 106.32 ? 218  DA  J "O3'" 1 
ATOM   4449  C "C2'" . DA  B 1 72  ? 71.346  22.648 -80.314 1.00 96.60  ? 218  DA  J "C2'" 1 
ATOM   4450  C "C1'" . DA  B 1 72  ? 70.246  22.896 -81.318 1.00 95.47  ? 218  DA  J "C1'" 1 
ATOM   4451  N N9    . DA  B 1 72  ? 70.150  24.275 -81.781 1.00 69.58  ? 218  DA  J N9    1 
ATOM   4452  C C8    . DA  B 1 72  ? 70.266  25.422 -81.039 1.00 70.07  ? 218  DA  J C8    1 
ATOM   4453  N N7    . DA  B 1 72  ? 70.143  26.520 -81.743 1.00 68.22  ? 218  DA  J N7    1 
ATOM   4454  C C5    . DA  B 1 72  ? 69.924  26.064 -83.036 1.00 68.18  ? 218  DA  J C5    1 
ATOM   4455  C C6    . DA  B 1 72  ? 69.708  26.733 -84.246 1.00 67.60  ? 218  DA  J C6    1 
ATOM   4456  N N6    . DA  B 1 72  ? 69.651  28.064 -84.352 1.00 67.72  ? 218  DA  J N6    1 
ATOM   4457  N N1    . DA  B 1 72  ? 69.541  25.984 -85.359 1.00 70.27  ? 218  DA  J N1    1 
ATOM   4458  C C2    . DA  B 1 72  ? 69.567  24.653 -85.245 1.00 70.83  ? 218  DA  J C2    1 
ATOM   4459  N N3    . DA  B 1 72  ? 69.743  23.909 -84.161 1.00 69.23  ? 218  DA  J N3    1 
ATOM   4460  C C4    . DA  B 1 72  ? 69.925  24.684 -83.075 1.00 69.93  ? 218  DA  J C4    1 
ATOM   4461  P P     . DA  B 1 73  ? 72.434  19.363 -80.182 1.00 83.82  ? 219  DA  J P     1 
ATOM   4462  O OP1   . DA  B 1 73  ? 71.880  18.040 -79.806 1.00 74.35  ? 219  DA  J OP1   1 
ATOM   4463  O OP2   . DA  B 1 73  ? 73.280  20.123 -79.216 1.00 74.62  ? 219  DA  J OP2   1 
ATOM   4464  O "O5'" . DA  B 1 73  ? 73.211  19.277 -81.572 1.00 81.20  ? 219  DA  J "O5'" 1 
ATOM   4465  C "C5'" . DA  B 1 73  ? 72.516  18.994 -82.782 1.00 80.20  ? 219  DA  J "C5'" 1 
ATOM   4466  C "C4'" . DA  B 1 73  ? 73.192  19.674 -83.948 1.00 79.42  ? 219  DA  J "C4'" 1 
ATOM   4467  O "O4'" . DA  B 1 73  ? 72.767  21.050 -84.128 1.00 77.36  ? 219  DA  J "O4'" 1 
ATOM   4468  C "C3'" . DA  B 1 73  ? 74.721  19.709 -83.889 1.00 79.68  ? 219  DA  J "C3'" 1 
ATOM   4469  O "O3'" . DA  B 1 73  ? 75.222  19.399 -85.193 1.00 83.75  ? 219  DA  J "O3'" 1 
ATOM   4470  C "C2'" . DA  B 1 73  ? 75.015  21.169 -83.589 1.00 77.05  ? 219  DA  J "C2'" 1 
ATOM   4471  C "C1'" . DA  B 1 73  ? 73.922  21.817 -84.405 1.00 75.52  ? 219  DA  J "C1'" 1 
ATOM   4472  N N9    . DA  B 1 73  ? 73.652  23.228 -84.130 1.00 66.80  ? 219  DA  J N9    1 
ATOM   4473  C C8    . DA  B 1 73  ? 73.768  23.927 -82.961 1.00 66.95  ? 219  DA  J C8    1 
ATOM   4474  N N7    . DA  B 1 73  ? 73.545  25.213 -83.094 1.00 64.95  ? 219  DA  J N7    1 
ATOM   4475  C C5    . DA  B 1 73  ? 73.250  25.367 -84.441 1.00 64.07  ? 219  DA  J C5    1 
ATOM   4476  C C6    . DA  B 1 73  ? 72.970  26.504 -85.245 1.00 64.04  ? 219  DA  J C6    1 
ATOM   4477  N N6    . DA  B 1 73  ? 73.012  27.762 -84.812 1.00 61.10  ? 219  DA  J N6    1 
ATOM   4478  N N1    . DA  B 1 73  ? 72.677  26.297 -86.541 1.00 65.76  ? 219  DA  J N1    1 
ATOM   4479  C C2    . DA  B 1 73  ? 72.712  25.045 -87.011 1.00 64.12  ? 219  DA  J C2    1 
ATOM   4480  N N3    . DA  B 1 73  ? 73.011  23.910 -86.375 1.00 65.88  ? 219  DA  J N3    1 
ATOM   4481  C C4    . DA  B 1 73  ? 73.271  24.145 -85.079 1.00 66.59  ? 219  DA  J C4    1 
ATOM   4482  P P     . DT  B 1 74  ? 76.703  18.819 -85.372 1.00 98.16  ? 220  DT  J P     1 
ATOM   4483  O OP1   . DT  B 1 74  ? 76.617  17.343 -85.388 1.00 96.16  ? 220  DT  J OP1   1 
ATOM   4484  O OP2   . DT  B 1 74  ? 77.594  19.494 -84.404 1.00 93.91  ? 220  DT  J OP2   1 
ATOM   4485  O "O5'" . DT  B 1 74  ? 77.086  19.359 -86.812 1.00 98.46  ? 220  DT  J "O5'" 1 
ATOM   4486  C "C5'" . DT  B 1 74  ? 76.068  19.631 -87.767 1.00 96.44  ? 220  DT  J "C5'" 1 
ATOM   4487  C "C4'" . DT  B 1 74  ? 76.513  20.734 -88.693 1.00 96.72  ? 220  DT  J "C4'" 1 
ATOM   4488  O "O4'" . DT  B 1 74  ? 75.989  22.030 -88.308 1.00 94.35  ? 220  DT  J "O4'" 1 
ATOM   4489  C "C3'" . DT  B 1 74  ? 78.030  20.883 -88.730 1.00 97.58  ? 220  DT  J "C3'" 1 
ATOM   4490  O "O3'" . DT  B 1 74  ? 78.478  21.002 -90.074 1.00 101.59 ? 220  DT  J "O3'" 1 
ATOM   4491  C "C2'" . DT  B 1 74  ? 78.271  22.188 -87.998 1.00 95.79  ? 220  DT  J "C2'" 1 
ATOM   4492  C "C1'" . DT  B 1 74  ? 77.042  22.968 -88.398 1.00 94.78  ? 220  DT  J "C1'" 1 
ATOM   4493  N N1    . DT  B 1 74  ? 76.736  24.123 -87.529 1.00 86.58  ? 220  DT  J N1    1 
ATOM   4494  C C2    . DT  B 1 74  ? 76.412  25.324 -88.124 1.00 85.56  ? 220  DT  J C2    1 
ATOM   4495  O O2    . DT  B 1 74  ? 76.358  25.486 -89.327 1.00 86.57  ? 220  DT  J O2    1 
ATOM   4496  N N3    . DT  B 1 74  ? 76.164  26.338 -87.253 1.00 85.93  ? 220  DT  J N3    1 
ATOM   4497  C C4    . DT  B 1 74  ? 76.222  26.287 -85.881 1.00 85.97  ? 220  DT  J C4    1 
ATOM   4498  O O4    . DT  B 1 74  ? 75.968  27.289 -85.222 1.00 86.12  ? 220  DT  J O4    1 
ATOM   4499  C C5    . DT  B 1 74  ? 76.584  25.016 -85.325 1.00 85.44  ? 220  DT  J C5    1 
ATOM   4500  C C7    . DT  B 1 74  ? 76.718  24.889 -83.842 1.00 82.68  ? 220  DT  J C7    1 
ATOM   4501  C C6    . DT  B 1 74  ? 76.800  24.002 -86.164 1.00 85.91  ? 220  DT  J C6    1 
ATOM   4502  P P     . DT  B 1 75  ? 80.047  21.091 -90.370 1.00 93.03  ? 221  DT  J P     1 
ATOM   4503  O OP1   . DT  B 1 75  ? 80.329  20.210 -91.536 1.00 97.80  ? 221  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 1 75  ? 80.710  20.822 -89.070 1.00 97.73  ? 221  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 1 75  ? 80.226  22.618 -90.790 1.00 90.08  ? 221  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 1 75  ? 79.300  23.198 -91.701 1.00 89.38  ? 221  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 1 75  ? 79.667  24.628 -92.012 1.00 90.61  ? 221  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 1 75  ? 79.231  25.518 -90.963 1.00 88.44  ? 221  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 1 75  ? 81.150  24.916 -92.242 1.00 92.37  ? 221  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 1 75  ? 81.257  25.801 -93.367 1.00 96.60  ? 221  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 1 75  ? 81.565  25.596 -90.947 1.00 89.15  ? 221  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 1 75  ? 80.306  26.358 -90.569 1.00 86.25  ? 221  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 1 75  ? 80.133  26.643 -89.130 1.00 88.37  ? 221  DT  J N1    1 
ATOM   4514  C C2    . DT  B 1 75  ? 79.779  27.923 -88.733 1.00 87.41  ? 221  DT  J C2    1 
ATOM   4515  O O2    . DT  B 1 75  ? 79.719  28.878 -89.495 1.00 85.64  ? 221  DT  J O2    1 
ATOM   4516  N N3    . DT  B 1 75  ? 79.513  28.044 -87.391 1.00 87.20  ? 221  DT  J N3    1 
ATOM   4517  C C4    . DT  B 1 75  ? 79.595  27.052 -86.426 1.00 86.32  ? 221  DT  J C4    1 
ATOM   4518  O O4    . DT  B 1 75  ? 79.266  27.292 -85.261 1.00 86.80  ? 221  DT  J O4    1 
ATOM   4519  C C5    . DT  B 1 75  ? 80.057  25.772 -86.901 1.00 85.83  ? 221  DT  J C5    1 
ATOM   4520  C C7    . DT  B 1 75  ? 80.265  24.668 -85.915 1.00 85.41  ? 221  DT  J C7    1 
ATOM   4521  C C6    . DT  B 1 75  ? 80.288  25.630 -88.211 1.00 87.54  ? 221  DT  J C6    1 
ATOM   4522  P P     . DC  B 1 76  ? 82.698  26.256 -93.918 1.00 140.42 ? 222  DC  J P     1 
ATOM   4523  O OP1   . DC  B 1 76  ? 82.580  26.460 -95.384 1.00 78.65  ? 222  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 1 76  ? 83.760  25.368 -93.381 1.00 75.86  ? 222  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 1 76  ? 82.853  27.704 -93.293 1.00 140.30 ? 222  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 1 76  ? 81.896  28.710 -93.603 1.00 139.98 ? 222  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 1 76  ? 82.315  30.021 -92.992 1.00 138.88 ? 222  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 1 76  ? 82.037  30.038 -91.570 1.00 136.50 ? 222  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 1 76  ? 83.812  30.270 -93.133 1.00 138.98 ? 222  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 1 76  ? 84.029  31.648 -93.390 1.00 140.92 ? 222  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 1 76  ? 84.359  29.894 -91.767 1.00 137.66 ? 222  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 1 76  ? 83.229  30.342 -90.863 1.00 134.13 ? 222  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 1 76  ? 83.157  29.687 -89.546 1.00 66.68  ? 222  DC  J N1    1 
ATOM   4534  C C2    . DC  B 1 76  ? 82.758  30.456 -88.445 1.00 64.28  ? 222  DC  J C2    1 
ATOM   4535  O O2    . DC  B 1 76  ? 82.568  31.682 -88.614 1.00 62.82  ? 222  DC  J O2    1 
ATOM   4536  N N3    . DC  B 1 76  ? 82.608  29.847 -87.228 1.00 61.07  ? 222  DC  J N3    1 
ATOM   4537  C C4    . DC  B 1 76  ? 82.878  28.539 -87.097 1.00 60.95  ? 222  DC  J C4    1 
ATOM   4538  N N4    . DC  B 1 76  ? 82.712  27.973 -85.896 1.00 58.03  ? 222  DC  J N4    1 
ATOM   4539  C C5    . DC  B 1 76  ? 83.328  27.748 -88.197 1.00 61.38  ? 222  DC  J C5    1 
ATOM   4540  C C6    . DC  B 1 76  ? 83.450  28.357 -89.391 1.00 63.68  ? 222  DC  J C6    1 
ATOM   4541  P P     . DC  B 1 77  ? 85.450  32.135 -93.939 1.00 138.69 ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 77  ? 85.240  32.657 -95.310 1.00 92.17  ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 77  ? 86.459  31.067 -93.688 1.00 89.38  ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 77  ? 85.783  33.366 -92.999 1.00 138.57 ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 77  ? 84.770  34.308 -92.670 1.00 138.25 ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 77  ? 85.165  35.057 -91.422 1.00 137.15 ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 77  ? 84.934  34.248 -90.242 1.00 134.77 ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 77  ? 86.648  35.411 -91.420 1.00 137.25 ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 77  ? 86.821  36.727 -90.916 1.00 139.19 ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 77  ? 87.260  34.375 -90.495 1.00 135.93 ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 77  ? 86.138  34.115 -89.503 1.00 132.40 ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 77  ? 86.153  32.772 -88.887 1.00 80.20  ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 77  ? 85.719  32.629 -87.570 1.00 77.80  ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 77  ? 85.289  33.628 -86.970 1.00 76.34  ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 77  ? 85.765  31.407 -86.987 1.00 74.59  ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 77  ? 86.194  30.353 -87.680 1.00 74.47  ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 77  ? 86.202  29.163 -87.076 1.00 71.55  ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 77  ? 86.625  30.467 -89.024 1.00 74.90  ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 77  ? 86.592  31.683 -89.585 1.00 77.20  ? 223  DC  J C6    1 
ATOM   4560  P P     . DG  B 1 78  ? 87.597  37.817 -91.801 1.00 119.13 ? 224  DG  J P     1 
ATOM   4561  O OP1   . DG  B 1 78  ? 86.682  38.351 -92.847 1.00 100.35 ? 224  DG  J OP1   1 
ATOM   4562  O OP2   . DG  B 1 78  ? 88.894  37.184 -92.203 1.00 99.06  ? 224  DG  J OP2   1 
ATOM   4563  O "O5'" . DG  B 1 78  ? 87.856  38.994 -90.759 1.00 118.44 ? 224  DG  J "O5'" 1 
ATOM   4564  C "C5'" . DG  B 1 78  ? 86.783  39.536 -89.998 1.00 115.86 ? 224  DG  J "C5'" 1 
ATOM   4565  C "C4'" . DG  B 1 78  ? 87.087  39.440 -88.521 1.00 114.00 ? 224  DG  J "C4'" 1 
ATOM   4566  O "O4'" . DG  B 1 78  ? 87.305  38.056 -88.153 1.00 113.09 ? 224  DG  J "O4'" 1 
ATOM   4567  C "C3'" . DG  B 1 78  ? 88.322  40.192 -88.029 1.00 113.02 ? 224  DG  J "C3'" 1 
ATOM   4568  O "O3'" . DG  B 1 78  ? 88.018  40.765 -86.757 1.00 114.23 ? 224  DG  J "O3'" 1 
ATOM   4569  C "C2'" . DG  B 1 78  ? 89.355  39.092 -87.841 1.00 111.03 ? 224  DG  J "C2'" 1 
ATOM   4570  C "C1'" . DG  B 1 78  ? 88.487  37.943 -87.372 1.00 111.37 ? 224  DG  J "C1'" 1 
ATOM   4571  N N9    . DG  B 1 78  ? 89.028  36.596 -87.563 1.00 92.06  ? 224  DG  J N9    1 
ATOM   4572  C C8    . DG  B 1 78  ? 89.767  36.155 -88.633 1.00 91.60  ? 224  DG  J C8    1 
ATOM   4573  N N7    . DG  B 1 78  ? 90.064  34.884 -88.567 1.00 91.74  ? 224  DG  J N7    1 
ATOM   4574  C C5    . DG  B 1 78  ? 89.496  34.455 -87.373 1.00 91.83  ? 224  DG  J C5    1 
ATOM   4575  C C6    . DG  B 1 78  ? 89.480  33.160 -86.770 1.00 91.74  ? 224  DG  J C6    1 
ATOM   4576  O O6    . DG  B 1 78  ? 89.953  32.097 -87.201 1.00 92.04  ? 224  DG  J O6    1 
ATOM   4577  N N1    . DG  B 1 78  ? 88.826  33.175 -85.548 1.00 92.17  ? 224  DG  J N1    1 
ATOM   4578  C C2    . DG  B 1 78  ? 88.256  34.276 -84.975 1.00 91.89  ? 224  DG  J C2    1 
ATOM   4579  N N2    . DG  B 1 78  ? 87.713  34.075 -83.768 1.00 93.78  ? 224  DG  J N2    1 
ATOM   4580  N N3    . DG  B 1 78  ? 88.232  35.483 -85.534 1.00 91.88  ? 224  DG  J N3    1 
ATOM   4581  C C4    . DG  B 1 78  ? 88.872  35.501 -86.725 1.00 91.80  ? 224  DG  J C4    1 
ATOM   4582  P P     . DC  B 1 79  ? 88.630  42.186 -86.359 1.00 116.00 ? 225  DC  J P     1 
ATOM   4583  O OP1   . DC  B 1 79  ? 87.715  43.274 -86.786 1.00 88.00  ? 225  DC  J OP1   1 
ATOM   4584  O OP2   . DC  B 1 79  ? 90.047  42.165 -86.821 1.00 89.43  ? 225  DC  J OP2   1 
ATOM   4585  O "O5'" . DC  B 1 79  ? 88.619  42.171 -84.775 1.00 116.31 ? 225  DC  J "O5'" 1 
ATOM   4586  C "C5'" . DC  B 1 79  ? 87.674  41.391 -84.062 1.00 115.80 ? 225  DC  J "C5'" 1 
ATOM   4587  C "C4'" . DC  B 1 79  ? 88.384  40.584 -83.003 1.00 115.21 ? 225  DC  J "C4'" 1 
ATOM   4588  O "O4'" . DC  B 1 79  ? 88.875  39.320 -83.514 1.00 115.02 ? 225  DC  J "O4'" 1 
ATOM   4589  C "C3'" . DC  B 1 79  ? 89.601  41.298 -82.410 1.00 115.40 ? 225  DC  J "C3'" 1 
ATOM   4590  O "O3'" . DC  B 1 79  ? 89.673  40.999 -81.031 1.00 113.54 ? 225  DC  J "O3'" 1 
ATOM   4591  C "C2'" . DC  B 1 79  ? 90.764  40.574 -83.057 1.00 116.15 ? 225  DC  J "C2'" 1 
ATOM   4592  C "C1'" . DC  B 1 79  ? 90.210  39.169 -83.069 1.00 116.42 ? 225  DC  J "C1'" 1 
ATOM   4593  N N1    . DC  B 1 79  ? 90.896  38.219 -83.946 1.00 90.94  ? 225  DC  J N1    1 
ATOM   4594  C C2    . DC  B 1 79  ? 91.059  36.913 -83.502 1.00 91.49  ? 225  DC  J C2    1 
ATOM   4595  O O2    . DC  B 1 79  ? 90.613  36.605 -82.384 1.00 90.25  ? 225  DC  J O2    1 
ATOM   4596  N N3    . DC  B 1 79  ? 91.700  36.019 -84.295 1.00 92.02  ? 225  DC  J N3    1 
ATOM   4597  C C4    . DC  B 1 79  ? 92.167  36.401 -85.489 1.00 92.56  ? 225  DC  J C4    1 
ATOM   4598  N N4    . DC  B 1 79  ? 92.788  35.490 -86.248 1.00 93.44  ? 225  DC  J N4    1 
ATOM   4599  C C5    . DC  B 1 79  ? 92.016  37.732 -85.961 1.00 92.52  ? 225  DC  J C5    1 
ATOM   4600  C C6    . DC  B 1 79  ? 91.376  38.600 -85.166 1.00 91.66  ? 225  DC  J C6    1 
ATOM   4601  P P     . DT  B 1 80  ? 89.153  42.056 -79.959 1.00 93.68  ? 226  DT  J P     1 
ATOM   4602  O OP1   . DT  B 1 80  ? 87.710  42.354 -80.200 1.00 95.40  ? 226  DT  J OP1   1 
ATOM   4603  O OP2   . DT  B 1 80  ? 90.152  43.153 -79.959 1.00 93.30  ? 226  DT  J OP2   1 
ATOM   4604  O "O5'" . DT  B 1 80  ? 89.263  41.218 -78.609 1.00 90.47  ? 226  DT  J "O5'" 1 
ATOM   4605  C "C5'" . DT  B 1 80  ? 88.601  39.949 -78.484 1.00 83.65  ? 226  DT  J "C5'" 1 
ATOM   4606  C "C4'" . DT  B 1 80  ? 89.537  38.911 -77.904 1.00 80.83  ? 226  DT  J "C4'" 1 
ATOM   4607  O "O4'" . DT  B 1 80  ? 90.280  38.195 -78.918 1.00 79.32  ? 226  DT  J "O4'" 1 
ATOM   4608  C "C3'" . DT  B 1 80  ? 90.575  39.463 -76.929 1.00 78.99  ? 226  DT  J "C3'" 1 
ATOM   4609  O "O3'" . DT  B 1 80  ? 90.746  38.536 -75.871 1.00 76.41  ? 226  DT  J "O3'" 1 
ATOM   4610  C "C2'" . DT  B 1 80  ? 91.848  39.421 -77.744 1.00 79.89  ? 226  DT  J "C2'" 1 
ATOM   4611  C "C1'" . DT  B 1 80  ? 91.628  38.134 -78.496 1.00 79.76  ? 226  DT  J "C1'" 1 
ATOM   4612  N N1    . DT  B 1 80  ? 92.490  37.933 -79.672 1.00 81.57  ? 226  DT  J N1    1 
ATOM   4613  C C2    . DT  B 1 80  ? 92.978  36.665 -79.895 1.00 80.45  ? 226  DT  J C2    1 
ATOM   4614  O O2    . DT  B 1 80  ? 92.720  35.712 -79.183 1.00 82.42  ? 226  DT  J O2    1 
ATOM   4615  N N3    . DT  B 1 80  ? 93.784  36.553 -80.995 1.00 82.69  ? 226  DT  J N3    1 
ATOM   4616  C C4    . DT  B 1 80  ? 94.136  37.553 -81.878 1.00 83.42  ? 226  DT  J C4    1 
ATOM   4617  O O4    . DT  B 1 80  ? 94.859  37.295 -82.834 1.00 85.49  ? 226  DT  J O4    1 
ATOM   4618  C C5    . DT  B 1 80  ? 93.596  38.852 -81.584 1.00 82.97  ? 226  DT  J C5    1 
ATOM   4619  C C7    . DT  B 1 80  ? 93.941  39.996 -82.479 1.00 84.18  ? 226  DT  J C7    1 
ATOM   4620  C C6    . DT  B 1 80  ? 92.807  38.977 -80.513 1.00 82.19  ? 226  DT  J C6    1 
ATOM   4621  P P     . DG  B 1 81  ? 89.918  38.707 -74.512 1.00 70.78  ? 227  DG  J P     1 
ATOM   4622  O OP1   . DG  B 1 81  ? 88.480  38.948 -74.798 1.00 73.59  ? 227  DG  J OP1   1 
ATOM   4623  O OP2   . DG  B 1 81  ? 90.671  39.616 -73.613 1.00 68.94  ? 227  DG  J OP2   1 
ATOM   4624  O "O5'" . DG  B 1 81  ? 90.062  37.276 -73.870 1.00 67.23  ? 227  DG  J "O5'" 1 
ATOM   4625  C "C5'" . DG  B 1 81  ? 91.161  37.016 -73.048 1.00 63.97  ? 227  DG  J "C5'" 1 
ATOM   4626  C "C4'" . DG  B 1 81  ? 91.945  35.838 -73.560 1.00 63.90  ? 227  DG  J "C4'" 1 
ATOM   4627  O "O4'" . DG  B 1 81  ? 92.475  36.054 -74.890 1.00 65.62  ? 227  DG  J "O4'" 1 
ATOM   4628  C "C3'" . DG  B 1 81  ? 93.155  35.689 -72.661 1.00 61.18  ? 227  DG  J "C3'" 1 
ATOM   4629  O "O3'" . DG  B 1 81  ? 93.429  34.337 -72.473 1.00 54.08  ? 227  DG  J "O3'" 1 
ATOM   4630  C "C2'" . DG  B 1 81  ? 94.274  36.341 -73.430 1.00 62.22  ? 227  DG  J "C2'" 1 
ATOM   4631  C "C1'" . DG  B 1 81  ? 93.900  35.958 -74.838 1.00 65.29  ? 227  DG  J "C1'" 1 
ATOM   4632  N N9    . DG  B 1 81  ? 94.475  36.855 -75.835 1.00 68.44  ? 227  DG  J N9    1 
ATOM   4633  C C8    . DG  B 1 81  ? 94.350  38.221 -75.895 1.00 69.56  ? 227  DG  J C8    1 
ATOM   4634  N N7    . DG  B 1 81  ? 94.974  38.750 -76.909 1.00 70.16  ? 227  DG  J N7    1 
ATOM   4635  C C5    . DG  B 1 81  ? 95.538  37.663 -77.560 1.00 70.43  ? 227  DG  J C5    1 
ATOM   4636  C C6    . DG  B 1 81  ? 96.298  37.611 -78.738 1.00 71.18  ? 227  DG  J C6    1 
ATOM   4637  O O6    . DG  B 1 81  ? 96.609  38.547 -79.490 1.00 76.38  ? 227  DG  J O6    1 
ATOM   4638  N N1    . DG  B 1 81  ? 96.695  36.308 -79.030 1.00 69.64  ? 227  DG  J N1    1 
ATOM   4639  C C2    . DG  B 1 81  ? 96.374  35.206 -78.289 1.00 70.09  ? 227  DG  J C2    1 
ATOM   4640  N N2    . DG  B 1 81  ? 96.876  34.051 -78.709 1.00 68.73  ? 227  DG  J N2    1 
ATOM   4641  N N3    . DG  B 1 81  ? 95.629  35.238 -77.210 1.00 66.15  ? 227  DG  J N3    1 
ATOM   4642  C C4    . DG  B 1 81  ? 95.252  36.491 -76.900 1.00 68.71  ? 227  DG  J C4    1 
ATOM   4643  P P     . DA  B 1 82  ? 94.006  33.898 -71.086 1.00 51.91  ? 228  DA  J P     1 
ATOM   4644  O OP1   . DA  B 1 82  ? 92.929  33.372 -70.211 1.00 44.05  ? 228  DA  J OP1   1 
ATOM   4645  O OP2   . DA  B 1 82  ? 94.818  35.066 -70.659 1.00 42.03  ? 228  DA  J OP2   1 
ATOM   4646  O "O5'" . DA  B 1 82  ? 94.967  32.713 -71.460 1.00 48.00  ? 228  DA  J "O5'" 1 
ATOM   4647  C "C5'" . DA  B 1 82  ? 94.590  31.748 -72.421 1.00 47.36  ? 228  DA  J "C5'" 1 
ATOM   4648  C "C4'" . DA  B 1 82  ? 95.831  31.173 -73.060 1.00 51.44  ? 228  DA  J "C4'" 1 
ATOM   4649  O "O4'" . DA  B 1 82  ? 96.333  32.076 -74.068 1.00 55.13  ? 228  DA  J "O4'" 1 
ATOM   4650  C "C3'" . DA  B 1 82  ? 96.983  30.950 -72.077 1.00 50.97  ? 228  DA  J "C3'" 1 
ATOM   4651  O "O3'" . DA  B 1 82  ? 97.585  29.704 -72.393 1.00 51.33  ? 228  DA  J "O3'" 1 
ATOM   4652  C "C2'" . DA  B 1 82  ? 97.909  32.129 -72.321 1.00 50.90  ? 228  DA  J "C2'" 1 
ATOM   4653  C "C1'" . DA  B 1 82  ? 97.674  32.411 -73.790 1.00 54.92  ? 228  DA  J "C1'" 1 
ATOM   4654  N N9    . DA  B 1 82  ? 97.867  33.783 -74.223 1.00 54.46  ? 228  DA  J N9    1 
ATOM   4655  C C8    . DA  B 1 82  ? 97.488  34.958 -73.629 1.00 55.60  ? 228  DA  J C8    1 
ATOM   4656  N N7    . DA  B 1 82  ? 97.784  36.025 -74.328 1.00 55.85  ? 228  DA  J N7    1 
ATOM   4657  C C5    . DA  B 1 82  ? 98.421  35.519 -75.455 1.00 55.16  ? 228  DA  J C5    1 
ATOM   4658  C C6    . DA  B 1 82  ? 98.983  36.137 -76.586 1.00 55.13  ? 228  DA  J C6    1 
ATOM   4659  N N6    . DA  B 1 82  ? 98.999  37.458 -76.780 1.00 53.48  ? 228  DA  J N6    1 
ATOM   4660  N N1    . DA  B 1 82  ? 99.539  35.334 -77.526 1.00 56.17  ? 228  DA  J N1    1 
ATOM   4661  C C2    . DA  B 1 82  ? 99.526  34.004 -77.331 1.00 56.89  ? 228  DA  J C2    1 
ATOM   4662  N N3    . DA  B 1 82  ? 99.029  33.307 -76.311 1.00 57.78  ? 228  DA  J N3    1 
ATOM   4663  C C4    . DA  B 1 82  ? 98.482  34.139 -75.397 1.00 56.11  ? 228  DA  J C4    1 
ATOM   4664  P P     . DA  B 1 83  ? 98.593  29.023 -71.365 1.00 45.86  ? 229  DA  J P     1 
ATOM   4665  O OP1   . DA  B 1 83  ? 98.309  27.564 -71.382 1.00 65.48  ? 229  DA  J OP1   1 
ATOM   4666  O OP2   . DA  B 1 83  ? 98.623  29.764 -70.083 1.00 64.06  ? 229  DA  J OP2   1 
ATOM   4667  O "O5'" . DA  B 1 83  ? 99.984  29.281 -72.076 1.00 49.93  ? 229  DA  J "O5'" 1 
ATOM   4668  C "C5'" . DA  B 1 83  ? 100.210 28.778 -73.398 1.00 49.42  ? 229  DA  J "C5'" 1 
ATOM   4669  C "C4'" . DA  B 1 83  ? 101.530 29.274 -73.937 1.00 50.66  ? 229  DA  J "C4'" 1 
ATOM   4670  O "O4'" . DA  B 1 83  ? 101.429 30.652 -74.380 1.00 47.40  ? 229  DA  J "O4'" 1 
ATOM   4671  C "C3'" . DA  B 1 83  ? 102.714 29.188 -72.976 1.00 52.64  ? 229  DA  J "C3'" 1 
ATOM   4672  O "O3'" . DA  B 1 83  ? 103.786 28.517 -73.654 1.00 59.67  ? 229  DA  J "O3'" 1 
ATOM   4673  C "C2'" . DA  B 1 83  ? 103.015 30.649 -72.661 1.00 49.90  ? 229  DA  J "C2'" 1 
ATOM   4674  C "C1'" . DA  B 1 83  ? 102.517 31.403 -73.893 1.00 50.67  ? 229  DA  J "C1'" 1 
ATOM   4675  N N9    . DA  B 1 83  ? 102.032 32.768 -73.658 1.00 72.20  ? 229  DA  J N9    1 
ATOM   4676  C C8    . DA  B 1 83  ? 101.328 33.234 -72.578 1.00 74.94  ? 229  DA  J C8    1 
ATOM   4677  N N7    . DA  B 1 83  ? 101.028 34.512 -72.647 1.00 72.14  ? 229  DA  J N7    1 
ATOM   4678  C C5    . DA  B 1 83  ? 101.570 34.915 -73.854 1.00 72.57  ? 229  DA  J C5    1 
ATOM   4679  C C6    . DA  B 1 83  ? 101.605 36.162 -74.504 1.00 73.63  ? 229  DA  J C6    1 
ATOM   4680  N N6    . DA  B 1 83  ? 101.063 37.272 -74.008 1.00 71.57  ? 229  DA  J N6    1 
ATOM   4681  N N1    . DA  B 1 83  ? 102.235 36.232 -75.699 1.00 73.90  ? 229  DA  J N1    1 
ATOM   4682  C C2    . DA  B 1 83  ? 102.792 35.124 -76.196 1.00 74.12  ? 229  DA  J C2    1 
ATOM   4683  N N3    . DA  B 1 83  ? 102.828 33.893 -75.679 1.00 75.24  ? 229  DA  J N3    1 
ATOM   4684  C C4    . DA  B 1 83  ? 102.192 33.853 -74.491 1.00 73.84  ? 229  DA  J C4    1 
ATOM   4685  P P     . DC  B 1 84  ? 105.110 28.068 -72.856 1.00 64.40  ? 230  DC  J P     1 
ATOM   4686  O OP1   . DC  B 1 84  ? 105.405 26.666 -73.210 1.00 56.62  ? 230  DC  J OP1   1 
ATOM   4687  O OP2   . DC  B 1 84  ? 104.949 28.452 -71.424 1.00 54.76  ? 230  DC  J OP2   1 
ATOM   4688  O "O5'" . DC  B 1 84  ? 106.219 28.983 -73.534 1.00 65.38  ? 230  DC  J "O5'" 1 
ATOM   4689  C "C5'" . DC  B 1 84  ? 105.837 30.250 -74.041 1.00 70.78  ? 230  DC  J "C5'" 1 
ATOM   4690  C "C4'" . DC  B 1 84  ? 107.018 30.983 -74.618 1.00 74.62  ? 230  DC  J "C4'" 1 
ATOM   4691  O "O4'" . DC  B 1 84  ? 106.573 32.349 -74.795 1.00 74.93  ? 230  DC  J "O4'" 1 
ATOM   4692  C "C3'" . DC  B 1 84  ? 108.214 31.045 -73.672 1.00 78.86  ? 230  DC  J "C3'" 1 
ATOM   4693  O "O3'" . DC  B 1 84  ? 109.438 31.130 -74.413 1.00 87.67  ? 230  DC  J "O3'" 1 
ATOM   4694  C "C2'" . DC  B 1 84  ? 107.954 32.303 -72.874 1.00 77.24  ? 230  DC  J "C2'" 1 
ATOM   4695  C "C1'" . DC  B 1 84  ? 107.191 33.199 -73.843 1.00 73.90  ? 230  DC  J "C1'" 1 
ATOM   4696  N N1    . DC  B 1 84  ? 106.141 34.010 -73.189 1.00 64.51  ? 230  DC  J N1    1 
ATOM   4697  C C2    . DC  B 1 84  ? 105.797 35.240 -73.750 1.00 63.70  ? 230  DC  J C2    1 
ATOM   4698  O O2    . DC  B 1 84  ? 106.307 35.573 -74.824 1.00 65.44  ? 230  DC  J O2    1 
ATOM   4699  N N3    . DC  B 1 84  ? 104.916 36.030 -73.114 1.00 63.27  ? 230  DC  J N3    1 
ATOM   4700  C C4    . DC  B 1 84  ? 104.370 35.629 -71.970 1.00 62.10  ? 230  DC  J C4    1 
ATOM   4701  N N4    . DC  B 1 84  ? 103.542 36.467 -71.361 1.00 59.63  ? 230  DC  J N4    1 
ATOM   4702  C C5    . DC  B 1 84  ? 104.659 34.357 -71.398 1.00 62.62  ? 230  DC  J C5    1 
ATOM   4703  C C6    . DC  B 1 84  ? 105.538 33.586 -72.034 1.00 62.44  ? 230  DC  J C6    1 
ATOM   4704  P P     . DA  B 1 85  ? 110.808 30.604 -73.762 1.00 120.86 ? 231  DA  J P     1 
ATOM   4705  O OP1   . DA  B 1 85  ? 111.326 29.550 -74.672 1.00 107.91 ? 231  DA  J OP1   1 
ATOM   4706  O OP2   . DA  B 1 85  ? 110.609 30.302 -72.322 1.00 108.33 ? 231  DA  J OP2   1 
ATOM   4707  O "O5'" . DA  B 1 85  ? 111.762 31.875 -73.843 1.00 125.88 ? 231  DA  J "O5'" 1 
ATOM   4708  C "C5'" . DA  B 1 85  ? 112.031 32.508 -75.092 1.00 135.52 ? 231  DA  J "C5'" 1 
ATOM   4709  C "C4'" . DA  B 1 85  ? 112.463 33.939 -74.869 1.00 141.97 ? 231  DA  J "C4'" 1 
ATOM   4710  O "O4'" . DA  B 1 85  ? 111.336 34.697 -74.367 1.00 143.75 ? 231  DA  J "O4'" 1 
ATOM   4711  C "C3'" . DA  B 1 85  ? 113.589 34.123 -73.846 1.00 145.61 ? 231  DA  J "C3'" 1 
ATOM   4712  O "O3'" . DA  B 1 85  ? 114.474 35.176 -74.257 1.00 150.46 ? 231  DA  J "O3'" 1 
ATOM   4713  C "C2'" . DA  B 1 85  ? 112.847 34.508 -72.584 1.00 145.36 ? 231  DA  J "C2'" 1 
ATOM   4714  C "C1'" . DA  B 1 85  ? 111.684 35.307 -73.134 1.00 144.99 ? 231  DA  J "C1'" 1 
ATOM   4715  N N9    . DA  B 1 85  ? 110.514 35.278 -72.262 1.00 133.81 ? 231  DA  J N9    1 
ATOM   4716  C C8    . DA  B 1 85  ? 110.048 34.223 -71.515 1.00 133.84 ? 231  DA  J C8    1 
ATOM   4717  N N7    . DA  B 1 85  ? 108.995 34.514 -70.792 1.00 133.43 ? 231  DA  J N7    1 
ATOM   4718  C C5    . DA  B 1 85  ? 108.745 35.847 -71.089 1.00 133.77 ? 231  DA  J C5    1 
ATOM   4719  C C6    . DA  B 1 85  ? 107.768 36.750 -70.636 1.00 133.83 ? 231  DA  J C6    1 
ATOM   4720  N N6    . DA  B 1 85  ? 106.814 36.424 -69.761 1.00 132.89 ? 231  DA  J N6    1 
ATOM   4721  N N1    . DA  B 1 85  ? 107.805 38.013 -71.120 1.00 134.59 ? 231  DA  J N1    1 
ATOM   4722  C C2    . DA  B 1 85  ? 108.760 38.332 -72.005 1.00 135.06 ? 231  DA  J C2    1 
ATOM   4723  N N3    . DA  B 1 85  ? 109.730 37.570 -72.509 1.00 134.50 ? 231  DA  J N3    1 
ATOM   4724  C C4    . DA  B 1 85  ? 109.668 36.327 -72.001 1.00 134.12 ? 231  DA  J C4    1 
ATOM   4725  P P     . DT  B 1 86  ? 115.438 35.895 -73.181 1.00 171.45 ? 232  DT  J P     1 
ATOM   4726  O OP1   . DT  B 1 86  ? 116.736 36.151 -73.850 1.00 121.15 ? 232  DT  J OP1   1 
ATOM   4727  O OP2   . DT  B 1 86  ? 115.422 35.160 -71.884 1.00 121.48 ? 232  DT  J OP2   1 
ATOM   4728  O "O5'" . DT  B 1 86  ? 114.733 37.306 -72.968 1.00 173.92 ? 232  DT  J "O5'" 1 
ATOM   4729  C "C5'" . DT  B 1 86  ? 114.582 38.214 -74.059 1.00 178.95 ? 232  DT  J "C5'" 1 
ATOM   4730  C "C4'" . DT  B 1 86  ? 114.532 39.631 -73.542 1.00 182.72 ? 232  DT  J "C4'" 1 
ATOM   4731  O "O4'" . DT  B 1 86  ? 113.295 39.817 -72.813 1.00 183.76 ? 232  DT  J "O4'" 1 
ATOM   4732  C "C3'" . DT  B 1 86  ? 115.653 39.943 -72.552 1.00 184.91 ? 232  DT  J "C3'" 1 
ATOM   4733  O "O3'" . DT  B 1 86  ? 116.068 41.310 -72.677 1.00 187.28 ? 232  DT  J "O3'" 1 
ATOM   4734  C "C2'" . DT  B 1 86  ? 115.003 39.683 -71.206 1.00 185.18 ? 232  DT  J "C2'" 1 
ATOM   4735  C "C1'" . DT  B 1 86  ? 113.572 40.131 -71.455 1.00 185.38 ? 232  DT  J "C1'" 1 
ATOM   4736  N N1    . DT  B 1 86  ? 112.562 39.455 -70.613 1.00 137.19 ? 232  DT  J N1    1 
ATOM   4737  C C2    . DT  B 1 86  ? 111.517 40.205 -70.118 1.00 137.57 ? 232  DT  J C2    1 
ATOM   4738  O O2    . DT  B 1 86  ? 111.373 41.395 -70.360 1.00 137.33 ? 232  DT  J O2    1 
ATOM   4739  N N3    . DT  B 1 86  ? 110.638 39.501 -69.322 1.00 138.03 ? 232  DT  J N3    1 
ATOM   4740  C C4    . DT  B 1 86  ? 110.700 38.157 -68.988 1.00 138.32 ? 232  DT  J C4    1 
ATOM   4741  O O4    . DT  B 1 86  ? 109.847 37.662 -68.252 1.00 138.49 ? 232  DT  J O4    1 
ATOM   4742  C C5    . DT  B 1 86  ? 111.810 37.434 -69.556 1.00 138.32 ? 232  DT  J C5    1 
ATOM   4743  C C7    . DT  B 1 86  ? 111.947 35.974 -69.264 1.00 138.44 ? 232  DT  J C7    1 
ATOM   4744  C C6    . DT  B 1 86  ? 112.675 38.110 -70.328 1.00 138.11 ? 232  DT  J C6    1 
ATOM   4745  P P     . DG  B 1 87  ? 116.828 42.025 -71.454 1.00 202.22 ? 233  DG  J P     1 
ATOM   4746  O OP1   . DG  B 1 87  ? 117.467 43.274 -71.938 1.00 172.82 ? 233  DG  J OP1   1 
ATOM   4747  O OP2   . DG  B 1 87  ? 117.653 40.993 -70.768 1.00 173.50 ? 233  DG  J OP2   1 
ATOM   4748  O "O5'" . DG  B 1 87  ? 115.643 42.424 -70.468 1.00 202.22 ? 233  DG  J "O5'" 1 
ATOM   4749  C "C5'" . DG  B 1 87  ? 114.759 43.502 -70.769 1.00 202.22 ? 233  DG  J "C5'" 1 
ATOM   4750  C "C4'" . DG  B 1 87  ? 114.418 44.244 -69.500 1.00 202.22 ? 233  DG  J "C4'" 1 
ATOM   4751  O "O4'" . DG  B 1 87  ? 113.607 43.392 -68.651 1.00 202.22 ? 233  DG  J "O4'" 1 
ATOM   4752  C "C3'" . DG  B 1 87  ? 115.662 44.598 -68.686 1.00 202.22 ? 233  DG  J "C3'" 1 
ATOM   4753  O "O3'" . DG  B 1 87  ? 115.514 45.878 -68.079 1.00 202.22 ? 233  DG  J "O3'" 1 
ATOM   4754  C "C2'" . DG  B 1 87  ? 115.735 43.496 -67.644 1.00 202.22 ? 233  DG  J "C2'" 1 
ATOM   4755  C "C1'" . DG  B 1 87  ? 114.281 43.110 -67.427 1.00 202.22 ? 233  DG  J "C1'" 1 
ATOM   4756  N N9    . DG  B 1 87  ? 114.115 41.687 -67.133 1.00 180.63 ? 233  DG  J N9    1 
ATOM   4757  C C8    . DG  B 1 87  ? 114.874 40.651 -67.627 1.00 181.16 ? 233  DG  J C8    1 
ATOM   4758  N N7    . DG  B 1 87  ? 114.500 39.481 -67.184 1.00 181.18 ? 233  DG  J N7    1 
ATOM   4759  C C5    . DG  B 1 87  ? 113.429 39.758 -66.349 1.00 181.50 ? 233  DG  J C5    1 
ATOM   4760  C C6    . DG  B 1 87  ? 112.615 38.885 -65.589 1.00 181.69 ? 233  DG  J C6    1 
ATOM   4761  O O6    . DG  B 1 87  ? 112.679 37.652 -65.502 1.00 181.49 ? 233  DG  J O6    1 
ATOM   4762  N N1    . DG  B 1 87  ? 111.643 39.583 -64.880 1.00 182.08 ? 233  DG  J N1    1 
ATOM   4763  C C2    . DG  B 1 87  ? 111.474 40.949 -64.904 1.00 181.89 ? 233  DG  J C2    1 
ATOM   4764  N N2    . DG  B 1 87  ? 110.477 41.437 -64.154 1.00 182.16 ? 233  DG  J N2    1 
ATOM   4765  N N3    . DG  B 1 87  ? 112.226 41.774 -65.612 1.00 181.50 ? 233  DG  J N3    1 
ATOM   4766  C C4    . DG  B 1 87  ? 113.177 41.116 -66.305 1.00 181.27 ? 233  DG  J C4    1 
ATOM   4767  P P     . DC  B 1 88  ? 116.691 46.475 -67.159 1.00 153.80 ? 234  DC  J P     1 
ATOM   4768  O OP1   . DC  B 1 88  ? 117.369 47.543 -67.924 1.00 135.54 ? 234  DC  J OP1   1 
ATOM   4769  O OP2   . DC  B 1 88  ? 117.496 45.371 -66.570 1.00 135.46 ? 234  DC  J OP2   1 
ATOM   4770  O "O5'" . DC  B 1 88  ? 115.864 47.153 -65.980 1.00 152.60 ? 234  DC  J "O5'" 1 
ATOM   4771  C "C5'" . DC  B 1 88  ? 114.455 47.357 -66.117 1.00 148.85 ? 234  DC  J "C5'" 1 
ATOM   4772  C "C4'" . DC  B 1 88  ? 113.759 47.156 -64.792 1.00 146.15 ? 234  DC  J "C4'" 1 
ATOM   4773  O "O4'" . DC  B 1 88  ? 113.568 45.754 -64.475 1.00 146.68 ? 234  DC  J "O4'" 1 
ATOM   4774  C "C3'" . DC  B 1 88  ? 114.500 47.769 -63.609 1.00 143.58 ? 234  DC  J "C3'" 1 
ATOM   4775  O "O3'" . DC  B 1 88  ? 113.571 48.503 -62.825 1.00 139.00 ? 234  DC  J "O3'" 1 
ATOM   4776  C "C2'" . DC  B 1 88  ? 115.053 46.565 -62.863 1.00 144.88 ? 234  DC  J "C2'" 1 
ATOM   4777  C "C1'" . DC  B 1 88  ? 114.014 45.497 -63.150 1.00 147.04 ? 234  DC  J "C1'" 1 
ATOM   4778  N N1    . DC  B 1 88  ? 114.505 44.106 -63.095 1.00 130.05 ? 234  DC  J N1    1 
ATOM   4779  C C2    . DC  B 1 88  ? 113.688 43.124 -62.518 1.00 130.91 ? 234  DC  J C2    1 
ATOM   4780  O O2    . DC  B 1 88  ? 112.580 43.457 -62.061 1.00 131.27 ? 234  DC  J O2    1 
ATOM   4781  N N3    . DC  B 1 88  ? 114.124 41.840 -62.478 1.00 131.43 ? 234  DC  J N3    1 
ATOM   4782  C C4    . DC  B 1 88  ? 115.316 41.522 -62.988 1.00 131.87 ? 234  DC  J C4    1 
ATOM   4783  N N4    . DC  B 1 88  ? 115.699 40.245 -62.939 1.00 132.89 ? 234  DC  J N4    1 
ATOM   4784  C C5    . DC  B 1 88  ? 116.168 42.500 -63.573 1.00 131.51 ? 234  DC  J C5    1 
ATOM   4785  C C6    . DC  B 1 88  ? 115.729 43.769 -63.603 1.00 130.54 ? 234  DC  J C6    1 
ATOM   4786  P P     . DC  B 1 89  ? 113.268 50.032 -63.206 1.00 125.02 ? 235  DC  J P     1 
ATOM   4787  O OP1   . DC  B 1 89  ? 113.126 50.127 -64.684 1.00 119.51 ? 235  DC  J OP1   1 
ATOM   4788  O OP2   . DC  B 1 89  ? 114.276 50.864 -62.500 1.00 119.69 ? 235  DC  J OP2   1 
ATOM   4789  O "O5'" . DC  B 1 89  ? 111.848 50.324 -62.548 1.00 121.77 ? 235  DC  J "O5'" 1 
ATOM   4790  C "C5'" . DC  B 1 89  ? 110.679 49.622 -62.975 1.00 115.71 ? 235  DC  J "C5'" 1 
ATOM   4791  C "C4'" . DC  B 1 89  ? 109.986 48.993 -61.787 1.00 111.63 ? 235  DC  J "C4'" 1 
ATOM   4792  O "O4'" . DC  B 1 89  ? 110.631 47.747 -61.414 1.00 110.23 ? 235  DC  J "O4'" 1 
ATOM   4793  C "C3'" . DC  B 1 89  ? 109.979 49.868 -60.531 1.00 109.58 ? 235  DC  J "C3'" 1 
ATOM   4794  O "O3'" . DC  B 1 89  ? 108.683 49.846 -59.928 1.00 105.91 ? 235  DC  J "O3'" 1 
ATOM   4795  C "C2'" . DC  B 1 89  ? 111.032 49.223 -59.642 1.00 109.74 ? 235  DC  J "C2'" 1 
ATOM   4796  C "C1'" . DC  B 1 89  ? 110.932 47.763 -60.029 1.00 110.47 ? 235  DC  J "C1'" 1 
ATOM   4797  N N1    . DC  B 1 89  ? 112.144 46.959 -59.822 1.00 106.43 ? 235  DC  J N1    1 
ATOM   4798  C C2    . DC  B 1 89  ? 111.989 45.624 -59.472 1.00 107.45 ? 235  DC  J C2    1 
ATOM   4799  O O2    . DC  B 1 89  ? 110.850 45.184 -59.315 1.00 108.45 ? 235  DC  J O2    1 
ATOM   4800  N N3    . DC  B 1 89  ? 113.078 44.841 -59.314 1.00 108.28 ? 235  DC  J N3    1 
ATOM   4801  C C4    . DC  B 1 89  ? 114.294 45.353 -59.493 1.00 109.14 ? 235  DC  J C4    1 
ATOM   4802  N N4    . DC  B 1 89  ? 115.337 44.525 -59.361 1.00 109.68 ? 235  DC  J N4    1 
ATOM   4803  C C5    . DC  B 1 89  ? 114.489 46.729 -59.823 1.00 108.35 ? 235  DC  J C5    1 
ATOM   4804  C C6    . DC  B 1 89  ? 113.393 47.489 -59.978 1.00 107.18 ? 235  DC  J C6    1 
ATOM   4805  P P     . DT  B 1 90  ? 108.450 50.533 -58.500 1.00 109.84 ? 236  DT  J P     1 
ATOM   4806  O OP1   . DT  B 1 90  ? 107.380 51.549 -58.657 1.00 118.29 ? 236  DT  J OP1   1 
ATOM   4807  O OP2   . DT  B 1 90  ? 109.759 50.922 -57.913 1.00 117.96 ? 236  DT  J OP2   1 
ATOM   4808  O "O5'" . DT  B 1 90  ? 107.901 49.331 -57.618 1.00 107.26 ? 236  DT  J "O5'" 1 
ATOM   4809  C "C5'" . DT  B 1 90  ? 106.998 48.386 -58.179 1.00 100.60 ? 236  DT  J "C5'" 1 
ATOM   4810  C "C4'" . DT  B 1 90  ? 106.857 47.183 -57.277 1.00 95.85  ? 236  DT  J "C4'" 1 
ATOM   4811  O "O4'" . DT  B 1 90  ? 108.095 46.430 -57.254 1.00 95.41  ? 236  DT  J "O4'" 1 
ATOM   4812  C "C3'" . DT  B 1 90  ? 106.495 47.474 -55.818 1.00 92.47  ? 236  DT  J "C3'" 1 
ATOM   4813  O "O3'" . DT  B 1 90  ? 105.497 46.530 -55.399 1.00 88.16  ? 236  DT  J "O3'" 1 
ATOM   4814  C "C2'" . DT  B 1 90  ? 107.814 47.282 -55.082 1.00 93.00  ? 236  DT  J "C2'" 1 
ATOM   4815  C "C1'" . DT  B 1 90  ? 108.530 46.224 -55.916 1.00 94.81  ? 236  DT  J "C1'" 1 
ATOM   4816  N N1    . DT  B 1 90  ? 110.017 46.298 -55.911 1.00 103.67 ? 236  DT  J N1    1 
ATOM   4817  C C2    . DT  B 1 90  ? 110.750 45.209 -55.450 1.00 103.75 ? 236  DT  J C2    1 
ATOM   4818  O O2    . DT  B 1 90  ? 110.243 44.197 -55.002 1.00 102.78 ? 236  DT  J O2    1 
ATOM   4819  N N3    . DT  B 1 90  ? 112.113 45.361 -55.531 1.00 104.71 ? 236  DT  J N3    1 
ATOM   4820  C C4    . DT  B 1 90  ? 112.804 46.464 -56.000 1.00 106.33 ? 236  DT  J C4    1 
ATOM   4821  O O4    . DT  B 1 90  ? 114.038 46.461 -56.015 1.00 107.05 ? 236  DT  J O4    1 
ATOM   4822  C C5    . DT  B 1 90  ? 111.978 47.565 -56.448 1.00 105.17 ? 236  DT  J C5    1 
ATOM   4823  C C7    . DT  B 1 90  ? 112.642 48.795 -56.970 1.00 105.26 ? 236  DT  J C7    1 
ATOM   4824  C C6    . DT  B 1 90  ? 110.648 47.432 -56.378 1.00 104.33 ? 236  DT  J C6    1 
ATOM   4825  P P     . DT  B 1 91  ? 104.736 46.717 -53.996 1.00 69.86  ? 237  DT  J P     1 
ATOM   4826  O OP1   . DT  B 1 91  ? 103.289 46.870 -54.281 1.00 81.30  ? 237  DT  J OP1   1 
ATOM   4827  O OP2   . DT  B 1 91  ? 105.451 47.767 -53.232 1.00 81.58  ? 237  DT  J OP2   1 
ATOM   4828  O "O5'" . DT  B 1 91  ? 104.965 45.303 -53.301 1.00 68.62  ? 237  DT  J "O5'" 1 
ATOM   4829  C "C5'" . DT  B 1 91  ? 104.829 44.122 -54.081 1.00 64.98  ? 237  DT  J "C5'" 1 
ATOM   4830  C "C4'" . DT  B 1 91  ? 105.713 43.019 -53.551 1.00 63.11  ? 237  DT  J "C4'" 1 
ATOM   4831  O "O4'" . DT  B 1 91  ? 107.106 43.400 -53.657 1.00 65.41  ? 237  DT  J "O4'" 1 
ATOM   4832  C "C3'" . DT  B 1 91  ? 105.483 42.666 -52.084 1.00 60.33  ? 237  DT  J "C3'" 1 
ATOM   4833  O "O3'" . DT  B 1 91  ? 105.557 41.253 -51.901 1.00 53.01  ? 237  DT  J "O3'" 1 
ATOM   4834  C "C2'" . DT  B 1 91  ? 106.657 43.312 -51.384 1.00 63.04  ? 237  DT  J "C2'" 1 
ATOM   4835  C "C1'" . DT  B 1 91  ? 107.744 43.133 -52.421 1.00 66.90  ? 237  DT  J "C1'" 1 
ATOM   4836  N N1    . DT  B 1 91  ? 108.891 44.054 -52.273 1.00 78.52  ? 237  DT  J N1    1 
ATOM   4837  C C2    . DT  B 1 91  ? 110.132 43.513 -52.000 1.00 80.01  ? 237  DT  J C2    1 
ATOM   4838  O O2    . DT  B 1 91  ? 110.330 42.320 -51.848 1.00 79.71  ? 237  DT  J O2    1 
ATOM   4839  N N3    . DT  B 1 91  ? 111.135 44.429 -51.890 1.00 81.38  ? 237  DT  J N3    1 
ATOM   4840  C C4    . DT  B 1 91  ? 111.034 45.796 -51.994 1.00 82.66  ? 237  DT  J C4    1 
ATOM   4841  O O4    . DT  B 1 91  ? 112.036 46.491 -51.883 1.00 82.38  ? 237  DT  J O4    1 
ATOM   4842  C C5    . DT  B 1 91  ? 109.707 46.301 -52.240 1.00 82.96  ? 237  DT  J C5    1 
ATOM   4843  C C7    . DT  B 1 91  ? 109.495 47.779 -52.299 1.00 83.97  ? 237  DT  J C7    1 
ATOM   4844  C C6    . DT  B 1 91  ? 108.715 45.416 -52.389 1.00 81.07  ? 237  DT  J C6    1 
ATOM   4845  P P     . DT  B 1 92  ? 105.300 40.643 -50.448 1.00 56.30  ? 238  DT  J P     1 
ATOM   4846  O OP1   . DT  B 1 92  ? 104.508 39.393 -50.612 1.00 40.77  ? 238  DT  J OP1   1 
ATOM   4847  O OP2   . DT  B 1 92  ? 104.803 41.732 -49.564 1.00 35.89  ? 238  DT  J OP2   1 
ATOM   4848  O "O5'" . DT  B 1 92  ? 106.754 40.235 -49.970 1.00 63.21  ? 238  DT  J "O5'" 1 
ATOM   4849  C "C5'" . DT  B 1 92  ? 107.474 39.244 -50.686 1.00 66.96  ? 238  DT  J "C5'" 1 
ATOM   4850  C "C4'" . DT  B 1 92  ? 108.784 38.945 -50.000 1.00 73.98  ? 238  DT  J "C4'" 1 
ATOM   4851  O "O4'" . DT  B 1 92  ? 109.620 40.123 -50.086 1.00 75.18  ? 238  DT  J "O4'" 1 
ATOM   4852  C "C3'" . DT  B 1 92  ? 108.675 38.591 -48.519 1.00 75.53  ? 238  DT  J "C3'" 1 
ATOM   4853  O "O3'" . DT  B 1 92  ? 109.539 37.495 -48.224 1.00 79.57  ? 238  DT  J "O3'" 1 
ATOM   4854  C "C2'" . DT  B 1 92  ? 109.114 39.861 -47.813 1.00 78.04  ? 238  DT  J "C2'" 1 
ATOM   4855  C "C1'" . DT  B 1 92  ? 110.082 40.497 -48.803 1.00 78.18  ? 238  DT  J "C1'" 1 
ATOM   4856  N N1    . DT  B 1 92  ? 110.173 41.982 -48.774 1.00 62.67  ? 238  DT  J N1    1 
ATOM   4857  C C2    . DT  B 1 92  ? 111.426 42.572 -48.707 1.00 64.53  ? 238  DT  J C2    1 
ATOM   4858  O O2    . DT  B 1 92  ? 112.471 41.939 -48.603 1.00 63.49  ? 238  DT  J O2    1 
ATOM   4859  N N3    . DT  B 1 92  ? 111.409 43.944 -48.750 1.00 64.36  ? 238  DT  J N3    1 
ATOM   4860  C C4    . DT  B 1 92  ? 110.304 44.764 -48.818 1.00 65.21  ? 238  DT  J C4    1 
ATOM   4861  O O4    . DT  B 1 92  ? 110.438 45.982 -48.868 1.00 64.72  ? 238  DT  J O4    1 
ATOM   4862  C C5    . DT  B 1 92  ? 109.042 44.092 -48.832 1.00 64.33  ? 238  DT  J C5    1 
ATOM   4863  C C7    . DT  B 1 92  ? 107.796 44.921 -48.839 1.00 65.14  ? 238  DT  J C7    1 
ATOM   4864  C C6    . DT  B 1 92  ? 109.034 42.751 -48.826 1.00 63.94  ? 238  DT  J C6    1 
ATOM   4865  P P     . DT  B 1 93  ? 109.393 36.717 -46.827 1.00 97.54  ? 239  DT  J P     1 
ATOM   4866  O OP1   . DT  B 1 93  ? 109.510 35.240 -47.028 1.00 70.14  ? 239  DT  J OP1   1 
ATOM   4867  O OP2   . DT  B 1 93  ? 108.207 37.282 -46.129 1.00 72.72  ? 239  DT  J OP2   1 
ATOM   4868  O "O5'" . DT  B 1 93  ? 110.680 37.175 -46.018 1.00 103.37 ? 239  DT  J "O5'" 1 
ATOM   4869  C "C5'" . DT  B 1 93  ? 111.977 36.893 -46.517 1.00 109.77 ? 239  DT  J "C5'" 1 
ATOM   4870  C "C4'" . DT  B 1 93  ? 113.009 37.643 -45.714 1.00 114.70 ? 239  DT  J "C4'" 1 
ATOM   4871  O "O4'" . DT  B 1 93  ? 112.932 39.055 -46.016 1.00 114.12 ? 239  DT  J "O4'" 1 
ATOM   4872  C "C3'" . DT  B 1 93  ? 112.835 37.518 -44.200 1.00 118.53 ? 239  DT  J "C3'" 1 
ATOM   4873  O "O3'" . DT  B 1 93  ? 114.113 37.368 -43.576 1.00 126.31 ? 239  DT  J "O3'" 1 
ATOM   4874  C "C2'" . DT  B 1 93  ? 112.222 38.850 -43.812 1.00 116.62 ? 239  DT  J "C2'" 1 
ATOM   4875  C "C1'" . DT  B 1 93  ? 112.869 39.785 -44.809 1.00 114.58 ? 239  DT  J "C1'" 1 
ATOM   4876  N N1    . DT  B 1 93  ? 112.143 41.039 -45.074 1.00 88.08  ? 239  DT  J N1    1 
ATOM   4877  C C2    . DT  B 1 93  ? 112.893 42.162 -45.324 1.00 88.41  ? 239  DT  J C2    1 
ATOM   4878  O O2    . DT  B 1 93  ? 114.114 42.163 -45.311 1.00 89.44  ? 239  DT  J O2    1 
ATOM   4879  N N3    . DT  B 1 93  ? 112.157 43.294 -45.582 1.00 87.66  ? 239  DT  J N3    1 
ATOM   4880  C C4    . DT  B 1 93  ? 110.780 43.408 -45.591 1.00 87.41  ? 239  DT  J C4    1 
ATOM   4881  O O4    . DT  B 1 93  ? 110.255 44.482 -45.829 1.00 86.60  ? 239  DT  J O4    1 
ATOM   4882  C C5    . DT  B 1 93  ? 110.066 42.204 -45.305 1.00 87.69  ? 239  DT  J C5    1 
ATOM   4883  C C7    . DT  B 1 93  ? 108.576 42.253 -45.274 1.00 87.38  ? 239  DT  J C7    1 
ATOM   4884  C C6    . DT  B 1 93  ? 110.767 41.088 -45.070 1.00 88.03  ? 239  DT  J C6    1 
ATOM   4885  P P     . DG  B 1 94  ? 114.285 36.369 -42.327 1.00 137.29 ? 240  DG  J P     1 
ATOM   4886  O OP1   . DG  B 1 94  ? 115.165 35.255 -42.758 1.00 123.84 ? 240  DG  J OP1   1 
ATOM   4887  O OP2   . DG  B 1 94  ? 112.943 36.066 -41.764 1.00 123.65 ? 240  DG  J OP2   1 
ATOM   4888  O "O5'" . DG  B 1 94  ? 115.088 37.255 -41.274 1.00 139.76 ? 240  DG  J "O5'" 1 
ATOM   4889  C "C5'" . DG  B 1 94  ? 116.371 37.782 -41.599 1.00 143.70 ? 240  DG  J "C5'" 1 
ATOM   4890  C "C4'" . DG  B 1 94  ? 116.622 39.067 -40.846 1.00 146.02 ? 240  DG  J "C4'" 1 
ATOM   4891  O "O4'" . DG  B 1 94  ? 115.791 40.130 -41.377 1.00 146.01 ? 240  DG  J "O4'" 1 
ATOM   4892  C "C3'" . DG  B 1 94  ? 116.345 39.016 -39.340 1.00 147.53 ? 240  DG  J "C3'" 1 
ATOM   4893  O "O3'" . DG  B 1 94  ? 117.397 39.707 -38.647 1.00 149.78 ? 240  DG  J "O3'" 1 
ATOM   4894  C "C2'" . DG  B 1 94  ? 115.020 39.750 -39.208 1.00 146.68 ? 240  DG  J "C2'" 1 
ATOM   4895  C "C1'" . DG  B 1 94  ? 115.135 40.791 -40.306 1.00 146.36 ? 240  DG  J "C1'" 1 
ATOM   4896  N N9    . DG  B 1 94  ? 113.867 41.326 -40.799 1.00 132.96 ? 240  DG  J N9    1 
ATOM   4897  C C8    . DG  B 1 94  ? 112.735 40.617 -41.122 1.00 132.73 ? 240  DG  J C8    1 
ATOM   4898  N N7    . DG  B 1 94  ? 111.749 41.377 -41.518 1.00 132.56 ? 240  DG  J N7    1 
ATOM   4899  C C5    . DG  B 1 94  ? 112.259 42.665 -41.456 1.00 132.62 ? 240  DG  J C5    1 
ATOM   4900  C C6    . DG  B 1 94  ? 111.649 43.908 -41.758 1.00 132.72 ? 240  DG  J C6    1 
ATOM   4901  O O6    . DG  B 1 94  ? 110.498 44.125 -42.157 1.00 132.88 ? 240  DG  J O6    1 
ATOM   4902  N N1    . DG  B 1 94  ? 112.522 44.971 -41.551 1.00 132.74 ? 240  DG  J N1    1 
ATOM   4903  C C2    . DG  B 1 94  ? 113.815 44.854 -41.111 1.00 132.55 ? 240  DG  J C2    1 
ATOM   4904  N N2    . DG  B 1 94  ? 114.495 46.001 -40.963 1.00 132.02 ? 240  DG  J N2    1 
ATOM   4905  N N3    . DG  B 1 94  ? 114.400 43.699 -40.832 1.00 132.50 ? 240  DG  J N3    1 
ATOM   4906  C C4    . DG  B 1 94  ? 113.567 42.654 -41.021 1.00 132.70 ? 240  DG  J C4    1 
ATOM   4907  P P     . DA  B 1 95  ? 117.303 39.946 -37.057 1.00 150.17 ? 241  DA  J P     1 
ATOM   4908  O OP1   . DA  B 1 95  ? 118.556 39.436 -36.453 1.00 131.60 ? 241  DA  J OP1   1 
ATOM   4909  O OP2   . DA  B 1 95  ? 116.002 39.438 -36.561 1.00 131.20 ? 241  DA  J OP2   1 
ATOM   4910  O "O5'" . DA  B 1 95  ? 117.312 41.536 -36.934 1.00 150.72 ? 241  DA  J "O5'" 1 
ATOM   4911  C "C5'" . DA  B 1 95  ? 118.248 42.317 -37.681 1.00 151.62 ? 241  DA  J "C5'" 1 
ATOM   4912  C "C4'" . DA  B 1 95  ? 118.059 43.790 -37.396 1.00 152.62 ? 241  DA  J "C4'" 1 
ATOM   4913  O "O4'" . DA  B 1 95  ? 116.835 44.266 -38.005 1.00 152.91 ? 241  DA  J "O4'" 1 
ATOM   4914  C "C3'" . DA  B 1 95  ? 117.950 44.140 -35.912 1.00 152.77 ? 241  DA  J "C3'" 1 
ATOM   4915  O "O3'" . DA  B 1 95  ? 118.569 45.403 -35.654 1.00 152.21 ? 241  DA  J "O3'" 1 
ATOM   4916  C "C2'" . DA  B 1 95  ? 116.454 44.250 -35.691 1.00 153.17 ? 241  DA  J "C2'" 1 
ATOM   4917  C "C1'" . DA  B 1 95  ? 116.001 44.845 -37.010 1.00 153.29 ? 241  DA  J "C1'" 1 
ATOM   4918  N N9    . DA  B 1 95  ? 114.613 44.557 -37.360 1.00 134.41 ? 241  DA  J N9    1 
ATOM   4919  C C8    . DA  B 1 95  ? 114.007 43.334 -37.523 1.00 134.43 ? 241  DA  J C8    1 
ATOM   4920  N N7    . DA  B 1 95  ? 112.745 43.413 -37.864 1.00 134.19 ? 241  DA  J N7    1 
ATOM   4921  C C5    . DA  B 1 95  ? 112.502 44.779 -37.924 1.00 134.06 ? 241  DA  J C5    1 
ATOM   4922  C C6    . DA  B 1 95  ? 111.355 45.519 -38.235 1.00 133.73 ? 241  DA  J C6    1 
ATOM   4923  N N6    . DA  B 1 95  ? 110.191 44.967 -38.578 1.00 133.07 ? 241  DA  J N6    1 
ATOM   4924  N N1    . DA  B 1 95  ? 111.446 46.866 -38.189 1.00 133.62 ? 241  DA  J N1    1 
ATOM   4925  C C2    . DA  B 1 95  ? 112.621 47.421 -37.864 1.00 133.90 ? 241  DA  J C2    1 
ATOM   4926  N N3    . DA  B 1 95  ? 113.772 46.831 -37.561 1.00 134.10 ? 241  DA  J N3    1 
ATOM   4927  C C4    . DA  B 1 95  ? 113.642 45.494 -37.608 1.00 134.29 ? 241  DA  J C4    1 
ATOM   4928  P P     . DT  B 1 96  ? 118.661 45.940 -34.149 1.00 155.76 ? 242  DT  J P     1 
ATOM   4929  O OP1   . DT  B 1 96  ? 119.997 46.553 -33.983 1.00 131.70 ? 242  DT  J OP1   1 
ATOM   4930  O OP2   . DT  B 1 96  ? 118.228 44.853 -33.241 1.00 131.42 ? 242  DT  J OP2   1 
ATOM   4931  O "O5'" . DT  B 1 96  ? 117.580 47.100 -34.087 1.00 154.64 ? 242  DT  J "O5'" 1 
ATOM   4932  C "C5'" . DT  B 1 96  ? 117.782 48.317 -34.791 1.00 152.89 ? 242  DT  J "C5'" 1 
ATOM   4933  C "C4'" . DT  B 1 96  ? 116.765 49.340 -34.345 1.00 151.63 ? 242  DT  J "C4'" 1 
ATOM   4934  O "O4'" . DT  B 1 96  ? 115.440 48.940 -34.780 1.00 151.73 ? 242  DT  J "O4'" 1 
ATOM   4935  C "C3'" . DT  B 1 96  ? 116.675 49.507 -32.827 1.00 150.54 ? 242  DT  J "C3'" 1 
ATOM   4936  O "O3'" . DT  B 1 96  ? 116.411 50.872 -32.506 1.00 148.17 ? 242  DT  J "O3'" 1 
ATOM   4937  C "C2'" . DT  B 1 96  ? 115.466 48.668 -32.455 1.00 150.84 ? 242  DT  J "C2'" 1 
ATOM   4938  C "C1'" . DT  B 1 96  ? 114.567 48.887 -33.659 1.00 151.45 ? 242  DT  J "C1'" 1 
ATOM   4939  N N1    . DT  B 1 96  ? 113.593 47.811 -33.889 1.00 127.37 ? 242  DT  J N1    1 
ATOM   4940  C C2    . DT  B 1 96  ? 112.335 48.156 -34.322 1.00 127.26 ? 242  DT  J C2    1 
ATOM   4941  O O2    . DT  B 1 96  ? 111.993 49.313 -34.518 1.00 126.59 ? 242  DT  J O2    1 
ATOM   4942  N N3    . DT  B 1 96  ? 111.487 47.090 -34.514 1.00 127.64 ? 242  DT  J N3    1 
ATOM   4943  C C4    . DT  B 1 96  ? 111.770 45.744 -34.317 1.00 127.98 ? 242  DT  J C4    1 
ATOM   4944  O O4    . DT  B 1 96  ? 110.911 44.893 -34.529 1.00 128.39 ? 242  DT  J O4    1 
ATOM   4945  C C5    . DT  B 1 96  ? 113.107 45.460 -33.862 1.00 128.01 ? 242  DT  J C5    1 
ATOM   4946  C C7    . DT  B 1 96  ? 113.503 44.036 -33.624 1.00 127.62 ? 242  DT  J C7    1 
ATOM   4947  C C6    . DT  B 1 96  ? 113.941 46.492 -33.674 1.00 127.96 ? 242  DT  J C6    1 
ATOM   4948  P P     . DG  B 1 97  ? 116.592 51.382 -30.999 1.00 129.66 ? 243  DG  J P     1 
ATOM   4949  O OP1   . DG  B 1 97  ? 118.054 51.326 -30.729 1.00 103.57 ? 243  DG  J OP1   1 
ATOM   4950  O OP2   . DG  B 1 97  ? 115.654 50.626 -30.125 1.00 102.77 ? 243  DG  J OP2   1 
ATOM   4951  O "O5'" . DG  B 1 97  ? 116.124 52.903 -31.068 1.00 127.44 ? 243  DG  J "O5'" 1 
ATOM   4952  C "C5'" . DG  B 1 97  ? 115.182 53.420 -30.143 1.00 123.86 ? 243  DG  J "C5'" 1 
ATOM   4953  C "C4'" . DG  B 1 97  ? 113.969 53.941 -30.876 1.00 121.12 ? 243  DG  J "C4'" 1 
ATOM   4954  O "O4'" . DG  B 1 97  ? 113.343 52.859 -31.617 1.00 120.78 ? 243  DG  J "O4'" 1 
ATOM   4955  C "C3'" . DG  B 1 97  ? 112.893 54.488 -29.944 1.00 118.95 ? 243  DG  J "C3'" 1 
ATOM   4956  O "O3'" . DG  B 1 97  ? 112.281 55.647 -30.495 1.00 115.61 ? 243  DG  J "O3'" 1 
ATOM   4957  C "C2'" . DG  B 1 97  ? 111.884 53.360 -29.843 1.00 119.37 ? 243  DG  J "C2'" 1 
ATOM   4958  C "C1'" . DG  B 1 97  ? 111.991 52.683 -31.197 1.00 119.52 ? 243  DG  J "C1'" 1 
ATOM   4959  N N9    . DG  B 1 97  ? 111.705 51.248 -31.161 1.00 92.50  ? 243  DG  J N9    1 
ATOM   4960  C C8    . DG  B 1 97  ? 112.566 50.229 -30.821 1.00 92.46  ? 243  DG  J C8    1 
ATOM   4961  N N7    . DG  B 1 97  ? 112.028 49.044 -30.917 1.00 91.86  ? 243  DG  J N7    1 
ATOM   4962  C C5    . DG  B 1 97  ? 110.733 49.294 -31.342 1.00 92.43  ? 243  DG  J C5    1 
ATOM   4963  C C6    . DG  B 1 97  ? 109.685 48.398 -31.653 1.00 91.83  ? 243  DG  J C6    1 
ATOM   4964  O O6    . DG  B 1 97  ? 109.689 47.162 -31.596 1.00 91.90  ? 243  DG  J O6    1 
ATOM   4965  N N1    . DG  B 1 97  ? 108.542 49.076 -32.072 1.00 91.63  ? 243  DG  J N1    1 
ATOM   4966  C C2    . DG  B 1 97  ? 108.424 50.448 -32.172 1.00 91.23  ? 243  DG  J C2    1 
ATOM   4967  N N2    . DG  B 1 97  ? 107.255 50.919 -32.616 1.00 90.14  ? 243  DG  J N2    1 
ATOM   4968  N N3    . DG  B 1 97  ? 109.389 51.293 -31.869 1.00 92.17  ? 243  DG  J N3    1 
ATOM   4969  C C4    . DG  B 1 97  ? 110.513 50.653 -31.477 1.00 92.69  ? 243  DG  J C4    1 
ATOM   4970  P P     . DG  B 1 98  ? 111.381 56.569 -29.550 1.00 104.52 ? 244  DG  J P     1 
ATOM   4971  O OP1   . DG  B 1 98  ? 111.307 57.938 -30.134 1.00 112.34 ? 244  DG  J OP1   1 
ATOM   4972  O OP2   . DG  B 1 98  ? 111.875 56.381 -28.164 1.00 113.54 ? 244  DG  J OP2   1 
ATOM   4973  O "O5'" . DG  B 1 98  ? 109.941 55.897 -29.628 1.00 102.89 ? 244  DG  J "O5'" 1 
ATOM   4974  C "C5'" . DG  B 1 98  ? 108.981 56.333 -30.595 1.00 99.36  ? 244  DG  J "C5'" 1 
ATOM   4975  C "C4'" . DG  B 1 98  ? 107.608 55.819 -30.233 1.00 96.36  ? 244  DG  J "C4'" 1 
ATOM   4976  O "O4'" . DG  B 1 98  ? 107.672 54.373 -30.177 1.00 95.59  ? 244  DG  J "O4'" 1 
ATOM   4977  C "C3'" . DG  B 1 98  ? 107.115 56.269 -28.859 1.00 94.77  ? 244  DG  J "C3'" 1 
ATOM   4978  O "O3'" . DG  B 1 98  ? 105.690 56.364 -28.879 1.00 92.30  ? 244  DG  J "O3'" 1 
ATOM   4979  C "C2'" . DG  B 1 98  ? 107.526 55.112 -27.965 1.00 94.63  ? 244  DG  J "C2'" 1 
ATOM   4980  C "C1'" . DG  B 1 98  ? 107.315 53.922 -28.884 1.00 94.86  ? 244  DG  J "C1'" 1 
ATOM   4981  N N9    . DG  B 1 98  ? 108.110 52.733 -28.590 1.00 103.36 ? 244  DG  J N9    1 
ATOM   4982  C C8    . DG  B 1 98  ? 109.356 52.689 -28.022 1.00 103.47 ? 244  DG  J C8    1 
ATOM   4983  N N7    . DG  B 1 98  ? 109.818 51.473 -27.886 1.00 103.65 ? 244  DG  J N7    1 
ATOM   4984  C C5    . DG  B 1 98  ? 108.813 50.664 -28.394 1.00 102.98 ? 244  DG  J C5    1 
ATOM   4985  C C6    . DG  B 1 98  ? 108.745 49.256 -28.505 1.00 102.54 ? 244  DG  J C6    1 
ATOM   4986  O O6    . DG  B 1 98  ? 109.589 48.422 -28.182 1.00 100.54 ? 244  DG  J O6    1 
ATOM   4987  N N1    . DG  B 1 98  ? 107.547 48.846 -29.072 1.00 102.44 ? 244  DG  J N1    1 
ATOM   4988  C C2    . DG  B 1 98  ? 106.548 49.684 -29.498 1.00 102.72 ? 244  DG  J C2    1 
ATOM   4989  N N2    . DG  B 1 98  ? 105.480 49.095 -30.056 1.00 102.09 ? 244  DG  J N2    1 
ATOM   4990  N N3    . DG  B 1 98  ? 106.594 51.003 -29.395 1.00 102.40 ? 244  DG  J N3    1 
ATOM   4991  C C4    . DG  B 1 98  ? 107.750 51.423 -28.835 1.00 103.48 ? 244  DG  J C4    1 
ATOM   4992  P P     . DA  B 1 99  ? 104.976 57.772 -29.183 1.00 107.69 ? 245  DA  J P     1 
ATOM   4993  O OP1   . DA  B 1 99  ? 105.835 58.518 -30.138 1.00 104.27 ? 245  DA  J OP1   1 
ATOM   4994  O OP2   . DA  B 1 99  ? 104.586 58.389 -27.888 1.00 103.41 ? 245  DA  J OP2   1 
ATOM   4995  O "O5'" . DA  B 1 99  ? 103.625 57.368 -29.917 1.00 105.62 ? 245  DA  J "O5'" 1 
ATOM   4996  C "C5'" . DA  B 1 99  ? 103.645 56.532 -31.074 1.00 102.46 ? 245  DA  J "C5'" 1 
ATOM   4997  C "C4'" . DA  B 1 99  ? 102.738 55.336 -30.876 1.00 100.44 ? 245  DA  J "C4'" 1 
ATOM   4998  O "O4'" . DA  B 1 99  ? 103.361 54.248 -30.146 1.00 99.36  ? 245  DA  J "O4'" 1 
ATOM   4999  C "C3'" . DA  B 1 99  ? 101.446 55.642 -30.124 1.00 97.92  ? 245  DA  J "C3'" 1 
ATOM   5000  O "O3'" . DA  B 1 99  ? 100.414 54.854 -30.683 1.00 96.84  ? 245  DA  J "O3'" 1 
ATOM   5001  C "C2'" . DA  B 1 99  ? 101.727 55.122 -28.729 1.00 98.11  ? 245  DA  J "C2'" 1 
ATOM   5002  C "C1'" . DA  B 1 99  ? 102.515 53.879 -29.060 1.00 99.12  ? 245  DA  J "C1'" 1 
ATOM   5003  N N9    . DA  B 1 99  ? 103.360 53.393 -27.980 1.00 96.23  ? 245  DA  J N9    1 
ATOM   5004  C C8    . DA  B 1 99  ? 103.997 54.109 -26.999 1.00 96.52  ? 245  DA  J C8    1 
ATOM   5005  N N7    . DA  B 1 99  ? 104.743 53.374 -26.213 1.00 97.81  ? 245  DA  J N7    1 
ATOM   5006  C C5    . DA  B 1 99  ? 104.575 52.090 -26.705 1.00 97.68  ? 245  DA  J C5    1 
ATOM   5007  C C6    . DA  B 1 99  ? 105.102 50.866 -26.316 1.00 98.19  ? 245  DA  J C6    1 
ATOM   5008  N N6    . DA  B 1 99  ? 105.995 50.728 -25.329 1.00 100.86 ? 245  DA  J N6    1 
ATOM   5009  N N1    . DA  B 1 99  ? 104.691 49.766 -26.989 1.00 97.79  ? 245  DA  J N1    1 
ATOM   5010  C C2    . DA  B 1 99  ? 103.827 49.914 -27.996 1.00 96.41  ? 245  DA  J C2    1 
ATOM   5011  N N3    . DA  B 1 99  ? 103.288 51.015 -28.474 1.00 96.26  ? 245  DA  J N3    1 
ATOM   5012  C C4    . DA  B 1 99  ? 103.704 52.083 -27.774 1.00 97.33  ? 245  DA  J C4    1 
ATOM   5013  P P     . DG  B 1 100 ? 98.975  55.487 -30.898 1.00 82.97  ? 246  DG  J P     1 
ATOM   5014  O OP1   . DG  B 1 100 ? 98.929  56.131 -32.240 1.00 92.69  ? 246  DG  J OP1   1 
ATOM   5015  O OP2   . DG  B 1 100 ? 98.628  56.273 -29.682 1.00 91.37  ? 246  DG  J OP2   1 
ATOM   5016  O "O5'" . DG  B 1 100 ? 98.050  54.202 -30.916 1.00 81.02  ? 246  DG  J "O5'" 1 
ATOM   5017  C "C5'" . DG  B 1 100 ? 97.171  53.953 -29.839 1.00 77.43  ? 246  DG  J "C5'" 1 
ATOM   5018  C "C4'" . DG  B 1 100 ? 97.445  52.594 -29.247 1.00 73.13  ? 246  DG  J "C4'" 1 
ATOM   5019  O "O4'" . DG  B 1 100 ? 98.754  52.532 -28.631 1.00 74.32  ? 246  DG  J "O4'" 1 
ATOM   5020  C "C3'" . DG  B 1 100 ? 96.462  52.246 -28.141 1.00 70.29  ? 246  DG  J "C3'" 1 
ATOM   5021  O "O3'" . DG  B 1 100 ? 96.197  50.861 -28.186 1.00 66.26  ? 246  DG  J "O3'" 1 
ATOM   5022  C "C2'" . DG  B 1 100 ? 97.241  52.521 -26.884 1.00 72.54  ? 246  DG  J "C2'" 1 
ATOM   5023  C "C1'" . DG  B 1 100 ? 98.596  52.027 -27.311 1.00 73.68  ? 246  DG  J "C1'" 1 
ATOM   5024  N N9    . DG  B 1 100 ? 99.659  52.560 -26.475 1.00 81.91  ? 246  DG  J N9    1 
ATOM   5025  C C8    . DG  B 1 100 ? 99.899  53.882 -26.205 1.00 81.91  ? 246  DG  J C8    1 
ATOM   5026  N N7    . DG  B 1 100 ? 100.914 54.067 -25.421 1.00 82.08  ? 246  DG  J N7    1 
ATOM   5027  C C5    . DG  B 1 100 ? 101.376 52.795 -25.163 1.00 83.02  ? 246  DG  J C5    1 
ATOM   5028  C C6    . DG  B 1 100 ? 102.464 52.387 -24.402 1.00 83.26  ? 246  DG  J C6    1 
ATOM   5029  O O6    . DG  B 1 100 ? 103.266 53.096 -23.785 1.00 86.07  ? 246  DG  J O6    1 
ATOM   5030  N N1    . DG  B 1 100 ? 102.596 50.997 -24.401 1.00 82.70  ? 246  DG  J N1    1 
ATOM   5031  C C2    . DG  B 1 100 ? 101.770 50.125 -25.068 1.00 82.47  ? 246  DG  J C2    1 
ATOM   5032  N N2    . DG  B 1 100 ? 102.079 48.828 -24.961 1.00 80.12  ? 246  DG  J N2    1 
ATOM   5033  N N3    . DG  B 1 100 ? 100.728 50.508 -25.790 1.00 80.29  ? 246  DG  J N3    1 
ATOM   5034  C C4    . DG  B 1 100 ? 100.601 51.850 -25.799 1.00 82.12  ? 246  DG  J C4    1 
ATOM   5035  P P     . DC  B 1 101 ? 94.762  50.372 -28.630 1.00 59.94  ? 247  DC  J P     1 
ATOM   5036  O OP1   . DC  B 1 101 ? 94.682  50.802 -30.044 1.00 69.11  ? 247  DC  J OP1   1 
ATOM   5037  O OP2   . DC  B 1 101 ? 93.755  50.833 -27.639 1.00 68.77  ? 247  DC  J OP2   1 
ATOM   5038  O "O5'" . DC  B 1 101 ? 94.858  48.807 -28.518 1.00 64.28  ? 247  DC  J "O5'" 1 
ATOM   5039  C "C5'" . DC  B 1 101 ? 96.003  48.121 -28.982 1.00 66.16  ? 247  DC  J "C5'" 1 
ATOM   5040  C "C4'" . DC  B 1 101 ? 96.389  47.063 -27.979 1.00 69.90  ? 247  DC  J "C4'" 1 
ATOM   5041  O "O4'" . DC  B 1 101 ? 97.288  47.627 -26.999 1.00 70.18  ? 247  DC  J "O4'" 1 
ATOM   5042  C "C3'" . DC  B 1 101 ? 95.198  46.499 -27.200 1.00 70.96  ? 247  DC  J "C3'" 1 
ATOM   5043  O "O3'" . DC  B 1 101 ? 95.327  45.073 -27.099 1.00 70.79  ? 247  DC  J "O3'" 1 
ATOM   5044  C "C2'" . DC  B 1 101 ? 95.276  47.225 -25.860 1.00 70.21  ? 247  DC  J "C2'" 1 
ATOM   5045  C "C1'" . DC  B 1 101 ? 96.776  47.422 -25.689 1.00 70.39  ? 247  DC  J "C1'" 1 
ATOM   5046  N N1    . DC  B 1 101 ? 97.221  48.567 -24.868 1.00 80.48  ? 247  DC  J N1    1 
ATOM   5047  C C2    . DC  B 1 101 ? 98.267  48.377 -23.935 1.00 81.01  ? 247  DC  J C2    1 
ATOM   5048  O O2    . DC  B 1 101 ? 98.716  47.234 -23.751 1.00 79.56  ? 247  DC  J O2    1 
ATOM   5049  N N3    . DC  B 1 101 ? 98.753  49.446 -23.267 1.00 81.56  ? 247  DC  J N3    1 
ATOM   5050  C C4    . DC  B 1 101 ? 98.242  50.659 -23.485 1.00 83.03  ? 247  DC  J C4    1 
ATOM   5051  N N4    . DC  B 1 101 ? 98.791  51.697 -22.849 1.00 85.18  ? 247  DC  J N4    1 
ATOM   5052  C C5    . DC  B 1 101 ? 97.150  50.869 -24.374 1.00 81.98  ? 247  DC  J C5    1 
ATOM   5053  C C6    . DC  B 1 101 ? 96.670  49.807 -25.036 1.00 81.95  ? 247  DC  J C6    1 
ATOM   5054  P P     . DA  B 1 102 ? 94.207  44.217 -26.337 1.00 88.36  ? 248  DA  J P     1 
ATOM   5055  O OP1   . DA  B 1 102 ? 93.815  43.055 -27.167 1.00 91.61  ? 248  DA  J OP1   1 
ATOM   5056  O OP2   . DA  B 1 102 ? 93.168  45.147 -25.838 1.00 89.97  ? 248  DA  J OP2   1 
ATOM   5057  O "O5'" . DA  B 1 102 ? 95.011  43.672 -25.087 1.00 90.36  ? 248  DA  J "O5'" 1 
ATOM   5058  C "C5'" . DA  B 1 102 ? 94.421  43.670 -23.808 1.00 95.17  ? 248  DA  J "C5'" 1 
ATOM   5059  C "C4'" . DA  B 1 102 ? 95.474  43.862 -22.743 1.00 97.71  ? 248  DA  J "C4'" 1 
ATOM   5060  O "O4'" . DA  B 1 102 ? 96.026  45.201 -22.775 1.00 97.64  ? 248  DA  J "O4'" 1 
ATOM   5061  C "C3'" . DA  B 1 102 ? 94.869  43.716 -21.355 1.00 99.67  ? 248  DA  J "C3'" 1 
ATOM   5062  O "O3'" . DA  B 1 102 ? 95.827  43.137 -20.502 1.00 103.78 ? 248  DA  J "O3'" 1 
ATOM   5063  C "C2'" . DA  B 1 102 ? 94.613  45.142 -20.929 1.00 98.55  ? 248  DA  J "C2'" 1 
ATOM   5064  C "C1'" . DA  B 1 102 ? 95.833  45.803 -21.500 1.00 98.80  ? 248  DA  J "C1'" 1 
ATOM   5065  N N9    . DA  B 1 102 ? 95.669  47.234 -21.666 1.00 99.66  ? 248  DA  J N9    1 
ATOM   5066  C C8    . DA  B 1 102 ? 94.791  47.934 -22.451 1.00 98.93  ? 248  DA  J C8    1 
ATOM   5067  N N7    . DA  B 1 102 ? 94.884  49.230 -22.318 1.00 98.67  ? 248  DA  J N7    1 
ATOM   5068  C C5    . DA  B 1 102 ? 95.904  49.392 -21.386 1.00 99.54  ? 248  DA  J C5    1 
ATOM   5069  C C6    . DA  B 1 102 ? 96.484  50.531 -20.808 1.00 99.83  ? 248  DA  J C6    1 
ATOM   5070  N N6    . DA  B 1 102 ? 96.093  51.785 -21.077 1.00 97.89  ? 248  DA  J N6    1 
ATOM   5071  N N1    . DA  B 1 102 ? 97.493  50.339 -19.923 1.00 100.00 ? 248  DA  J N1    1 
ATOM   5072  C C2    . DA  B 1 102 ? 97.865  49.090 -19.640 1.00 100.12 ? 248  DA  J C2    1 
ATOM   5073  N N3    . DA  B 1 102 ? 97.386  47.945 -20.107 1.00 100.34 ? 248  DA  J N3    1 
ATOM   5074  C C4    . DA  B 1 102 ? 96.395  48.174 -20.992 1.00 99.99  ? 248  DA  J C4    1 
ATOM   5075  P P     . DG  B 1 103 ? 95.393  41.918 -19.586 1.00 98.19  ? 249  DG  J P     1 
ATOM   5076  O OP1   . DG  B 1 103 ? 96.061  40.724 -20.170 1.00 89.84  ? 249  DG  J OP1   1 
ATOM   5077  O OP2   . DG  B 1 103 ? 93.913  41.959 -19.464 1.00 88.11  ? 249  DG  J OP2   1 
ATOM   5078  O "O5'" . DG  B 1 103 ? 96.005  42.287 -18.168 1.00 99.68  ? 249  DG  J "O5'" 1 
ATOM   5079  C "C5'" . DG  B 1 103 ? 97.401  42.233 -17.932 1.00 101.95 ? 249  DG  J "C5'" 1 
ATOM   5080  C "C4'" . DG  B 1 103 ? 97.707  42.955 -16.646 1.00 102.95 ? 249  DG  J "C4'" 1 
ATOM   5081  O "O4'" . DG  B 1 103 ? 97.595  44.376 -16.882 1.00 103.31 ? 249  DG  J "O4'" 1 
ATOM   5082  C "C3'" . DG  B 1 103 ? 96.718  42.629 -15.529 1.00 104.68 ? 249  DG  J "C3'" 1 
ATOM   5083  O "O3'" . DG  B 1 103 ? 97.415  42.523 -14.286 1.00 107.96 ? 249  DG  J "O3'" 1 
ATOM   5084  C "C2'" . DG  B 1 103 ? 95.739  43.793 -15.563 1.00 103.21 ? 249  DG  J "C2'" 1 
ATOM   5085  C "C1'" . DG  B 1 103 ? 96.597  44.951 -16.048 1.00 103.57 ? 249  DG  J "C1'" 1 
ATOM   5086  N N9    . DG  B 1 103 ? 95.898  45.962 -16.841 1.00 93.84  ? 249  DG  J N9    1 
ATOM   5087  C C8    . DG  B 1 103 ? 95.053  45.732 -17.896 1.00 93.93  ? 249  DG  J C8    1 
ATOM   5088  N N7    . DG  B 1 103 ? 94.602  46.827 -18.446 1.00 94.03  ? 249  DG  J N7    1 
ATOM   5089  C C5    . DG  B 1 103 ? 95.174  47.848 -17.701 1.00 93.81  ? 249  DG  J C5    1 
ATOM   5090  C C6    . DG  B 1 103 ? 95.050  49.261 -17.827 1.00 93.71  ? 249  DG  J C6    1 
ATOM   5091  O O6    . DG  B 1 103 ? 94.396  49.915 -18.653 1.00 93.69  ? 249  DG  J O6    1 
ATOM   5092  N N1    . DG  B 1 103 ? 95.792  49.923 -16.858 1.00 94.06  ? 249  DG  J N1    1 
ATOM   5093  C C2    . DG  B 1 103 ? 96.553  49.314 -15.894 1.00 93.78  ? 249  DG  J C2    1 
ATOM   5094  N N2    . DG  B 1 103 ? 97.177  50.133 -15.048 1.00 93.18  ? 249  DG  J N2    1 
ATOM   5095  N N3    . DG  B 1 103 ? 96.686  48.002 -15.770 1.00 93.07  ? 249  DG  J N3    1 
ATOM   5096  C C4    . DG  B 1 103 ? 95.972  47.333 -16.699 1.00 93.85  ? 249  DG  J C4    1 
ATOM   5097  P P     . DT  B 1 104 ? 96.606  42.191 -12.938 1.00 107.79 ? 250  DT  J P     1 
ATOM   5098  O OP1   . DT  B 1 104 ? 97.570  41.453 -12.082 1.00 99.48  ? 250  DT  J OP1   1 
ATOM   5099  O OP2   . DT  B 1 104 ? 95.279  41.578 -13.258 1.00 100.38 ? 250  DT  J OP2   1 
ATOM   5100  O "O5'" . DT  B 1 104 ? 96.389  43.637 -12.304 1.00 110.02 ? 250  DT  J "O5'" 1 
ATOM   5101  C "C5'" . DT  B 1 104 ? 97.511  44.499 -12.108 1.00 113.29 ? 250  DT  J "C5'" 1 
ATOM   5102  C "C4'" . DT  B 1 104 ? 97.105  45.759 -11.382 1.00 116.07 ? 250  DT  J "C4'" 1 
ATOM   5103  O "O4'" . DT  B 1 104 ? 96.553  46.742 -12.285 1.00 115.94 ? 250  DT  J "O4'" 1 
ATOM   5104  C "C3'" . DT  B 1 104 ? 96.078  45.575 -10.270 1.00 117.96 ? 250  DT  J "C3'" 1 
ATOM   5105  O "O3'" . DT  B 1 104 ? 96.467  46.361 -9.147  1.00 122.45 ? 250  DT  J "O3'" 1 
ATOM   5106  C "C2'" . DT  B 1 104 ? 94.804  46.138 -10.875 1.00 117.05 ? 250  DT  J "C2'" 1 
ATOM   5107  C "C1'" . DT  B 1 104 ? 95.354  47.256 -11.732 1.00 116.00 ? 250  DT  J "C1'" 1 
ATOM   5108  N N1    . DT  B 1 104 ? 94.496  47.687 -12.846 1.00 107.24 ? 250  DT  J N1    1 
ATOM   5109  C C2    . DT  B 1 104 ? 94.257  49.031 -12.983 1.00 107.16 ? 250  DT  J C2    1 
ATOM   5110  O O2    . DT  B 1 104 ? 94.675  49.858 -12.199 1.00 107.40 ? 250  DT  J O2    1 
ATOM   5111  N N3    . DT  B 1 104 ? 93.501  49.373 -14.074 1.00 106.71 ? 250  DT  J N3    1 
ATOM   5112  C C4    . DT  B 1 104 ? 92.965  48.520 -15.014 1.00 106.40 ? 250  DT  J C4    1 
ATOM   5113  O O4    . DT  B 1 104 ? 92.330  48.974 -15.956 1.00 106.39 ? 250  DT  J O4    1 
ATOM   5114  C C5    . DT  B 1 104 ? 93.226  47.116 -14.791 1.00 106.37 ? 250  DT  J C5    1 
ATOM   5115  C C7    . DT  B 1 104 ? 92.658  46.112 -15.739 1.00 106.56 ? 250  DT  J C7    1 
ATOM   5116  C C6    . DT  B 1 104 ? 93.970  46.773 -13.733 1.00 106.54 ? 250  DT  J C6    1 
ATOM   5117  P P     . DT  B 1 105 ? 95.785  46.101 -7.723  1.00 156.22 ? 251  DT  J P     1 
ATOM   5118  O OP1   . DT  B 1 105 ? 96.841  45.670 -6.771  1.00 107.30 ? 251  DT  J OP1   1 
ATOM   5119  O OP2   . DT  B 1 105 ? 94.581  45.250 -7.938  1.00 107.08 ? 251  DT  J OP2   1 
ATOM   5120  O "O5'" . DT  B 1 105 ? 95.287  47.547 -7.300  1.00 157.27 ? 251  DT  J "O5'" 1 
ATOM   5121  C "C5'" . DT  B 1 105 ? 96.173  48.656 -7.346  1.00 158.31 ? 251  DT  J "C5'" 1 
ATOM   5122  C "C4'" . DT  B 1 105 ? 95.394  49.933 -7.153  1.00 158.99 ? 251  DT  J "C4'" 1 
ATOM   5123  O "O4'" . DT  B 1 105 ? 94.718  50.284 -8.387  1.00 158.93 ? 251  DT  J "O4'" 1 
ATOM   5124  C "C3'" . DT  B 1 105 ? 94.308  49.803 -6.085  1.00 159.39 ? 251  DT  J "C3'" 1 
ATOM   5125  O "O3'" . DT  B 1 105 ? 94.306  50.945 -5.229  1.00 159.33 ? 251  DT  J "O3'" 1 
ATOM   5126  C "C2'" . DT  B 1 105 ? 93.024  49.696 -6.891  1.00 159.15 ? 251  DT  J "C2'" 1 
ATOM   5127  C "C1'" . DT  B 1 105 ? 93.347  50.515 -8.126  1.00 159.15 ? 251  DT  J "C1'" 1 
ATOM   5128  N N1    . DT  B 1 105 ? 92.572  50.152 -9.334  1.00 109.03 ? 251  DT  J N1    1 
ATOM   5129  C C2    . DT  B 1 105 ? 91.990  51.172 -10.056 1.00 108.66 ? 251  DT  J C2    1 
ATOM   5130  O O2    . DT  B 1 105 ? 92.101  52.344 -9.757  1.00 108.51 ? 251  DT  J O2    1 
ATOM   5131  N N3    . DT  B 1 105 ? 91.265  50.767 -11.146 1.00 108.35 ? 251  DT  J N3    1 
ATOM   5132  C C4    . DT  B 1 105 ? 91.067  49.476 -11.580 1.00 108.37 ? 251  DT  J C4    1 
ATOM   5133  O O4    . DT  B 1 105 ? 90.386  49.266 -12.577 1.00 107.80 ? 251  DT  J O4    1 
ATOM   5134  C C5    . DT  B 1 105 ? 91.708  48.454 -10.783 1.00 108.56 ? 251  DT  J C5    1 
ATOM   5135  C C7    . DT  B 1 105 ? 91.541  47.023 -11.177 1.00 108.52 ? 251  DT  J C7    1 
ATOM   5136  C C6    . DT  B 1 105 ? 92.425  48.838 -9.717  1.00 108.82 ? 251  DT  J C6    1 
ATOM   5137  P P     . DT  B 1 106 ? 93.110  51.152 -4.177  1.00 152.80 ? 252  DT  J P     1 
ATOM   5138  O OP1   . DT  B 1 106 ? 93.686  51.678 -2.910  1.00 107.76 ? 252  DT  J OP1   1 
ATOM   5139  O OP2   . DT  B 1 106 ? 92.272  49.923 -4.155  1.00 107.19 ? 252  DT  J OP2   1 
ATOM   5140  O "O5'" . DT  B 1 106 ? 92.264  52.305 -4.865  1.00 152.54 ? 252  DT  J "O5'" 1 
ATOM   5141  C "C5'" . DT  B 1 106 ? 92.924  53.346 -5.580  1.00 151.63 ? 252  DT  J "C5'" 1 
ATOM   5142  C "C4'" . DT  B 1 106 ? 91.911  54.342 -6.081  1.00 150.68 ? 252  DT  J "C4'" 1 
ATOM   5143  O "O4'" . DT  B 1 106 ? 91.262  53.862 -7.282  1.00 150.00 ? 252  DT  J "O4'" 1 
ATOM   5144  C "C3'" . DT  B 1 106 ? 90.798  54.595 -5.071  1.00 150.00 ? 252  DT  J "C3'" 1 
ATOM   5145  O "O3'" . DT  B 1 106 ? 90.488  55.981 -5.057  1.00 149.05 ? 252  DT  J "O3'" 1 
ATOM   5146  C "C2'" . DT  B 1 106 ? 89.638  53.764 -5.595  1.00 150.02 ? 252  DT  J "C2'" 1 
ATOM   5147  C "C1'" . DT  B 1 106 ? 89.850  53.828 -7.099  1.00 149.86 ? 252  DT  J "C1'" 1 
ATOM   5148  N N1    . DT  B 1 106 ? 89.317  52.685 -7.883  1.00 104.58 ? 252  DT  J N1    1 
ATOM   5149  C C2    . DT  B 1 106 ? 88.570  52.961 -9.009  1.00 104.38 ? 252  DT  J C2    1 
ATOM   5150  O O2    . DT  B 1 106 ? 88.265  54.094 -9.350  1.00 104.61 ? 252  DT  J O2    1 
ATOM   5151  N N3    . DT  B 1 106 ? 88.185  51.852 -9.725  1.00 104.04 ? 252  DT  J N3    1 
ATOM   5152  C C4    . DT  B 1 106 ? 88.452  50.529 -9.427  1.00 103.63 ? 252  DT  J C4    1 
ATOM   5153  O O4    . DT  B 1 106 ? 88.061  49.641 -10.180 1.00 102.93 ? 252  DT  J O4    1 
ATOM   5154  C C5    . DT  B 1 106 ? 89.201  50.312 -8.214  1.00 103.83 ? 252  DT  J C5    1 
ATOM   5155  C C7    . DT  B 1 106 ? 89.515  48.911 -7.798  1.00 103.61 ? 252  DT  J C7    1 
ATOM   5156  C C6    . DT  B 1 106 ? 89.587  51.385 -7.510  1.00 104.33 ? 252  DT  J C6    1 
ATOM   5157  P P     . DC  B 1 107 ? 89.453  56.539 -3.981  1.00 131.26 ? 253  DC  J P     1 
ATOM   5158  O OP1   . DC  B 1 107 ? 89.811  57.958 -3.744  1.00 119.59 ? 253  DC  J OP1   1 
ATOM   5159  O OP2   . DC  B 1 107 ? 89.389  55.588 -2.841  1.00 119.01 ? 253  DC  J OP2   1 
ATOM   5160  O "O5'" . DC  B 1 107 ? 88.069  56.478 -4.756  1.00 130.43 ? 253  DC  J "O5'" 1 
ATOM   5161  C "C5'" . DC  B 1 107 ? 87.889  57.189 -5.973  1.00 127.41 ? 253  DC  J "C5'" 1 
ATOM   5162  C "C4'" . DC  B 1 107 ? 86.439  57.133 -6.383  1.00 125.76 ? 253  DC  J "C4'" 1 
ATOM   5163  O "O4'" . DC  B 1 107 ? 86.112  55.844 -6.949  1.00 125.07 ? 253  DC  J "O4'" 1 
ATOM   5164  C "C3'" . DC  B 1 107 ? 85.449  57.351 -5.241  1.00 124.57 ? 253  DC  J "C3'" 1 
ATOM   5165  O "O3'" . DC  B 1 107 ? 84.346  58.076 -5.759  1.00 123.06 ? 253  DC  J "O3'" 1 
ATOM   5166  C "C2'" . DC  B 1 107 ? 84.992  55.942 -4.904  1.00 124.33 ? 253  DC  J "C2'" 1 
ATOM   5167  C "C1'" . DC  B 1 107 ? 84.985  55.300 -6.280  1.00 124.16 ? 253  DC  J "C1'" 1 
ATOM   5168  N N1    . DC  B 1 107 ? 85.120  53.837 -6.317  1.00 110.45 ? 253  DC  J N1    1 
ATOM   5169  C C2    . DC  B 1 107 ? 84.854  53.177 -7.517  1.00 110.38 ? 253  DC  J C2    1 
ATOM   5170  O O2    . DC  B 1 107 ? 84.443  53.838 -8.483  1.00 110.06 ? 253  DC  J O2    1 
ATOM   5171  N N3    . DC  B 1 107 ? 85.045  51.842 -7.596  1.00 109.77 ? 253  DC  J N3    1 
ATOM   5172  C C4    . DC  B 1 107 ? 85.459  51.165 -6.526  1.00 109.89 ? 253  DC  J C4    1 
ATOM   5173  N N4    . DC  B 1 107 ? 85.638  49.851 -6.653  1.00 109.17 ? 253  DC  J N4    1 
ATOM   5174  C C5    . DC  B 1 107 ? 85.706  51.807 -5.279  1.00 110.15 ? 253  DC  J C5    1 
ATOM   5175  C C6    . DC  B 1 107 ? 85.523  53.132 -5.218  1.00 110.51 ? 253  DC  J C6    1 
ATOM   5176  P P     . DC  B 1 108 ? 83.910  59.454 -5.084  1.00 125.97 ? 254  DC  J P     1 
ATOM   5177  O OP1   . DC  B 1 108 ? 85.051  60.401 -5.220  1.00 110.68 ? 254  DC  J OP1   1 
ATOM   5178  O OP2   . DC  B 1 108 ? 83.353  59.134 -3.741  1.00 110.21 ? 254  DC  J OP2   1 
ATOM   5179  O "O5'" . DC  B 1 108 ? 82.721  59.944 -6.018  1.00 124.18 ? 254  DC  J "O5'" 1 
ATOM   5180  C "C5'" . DC  B 1 108 ? 82.916  60.089 -7.423  1.00 120.57 ? 254  DC  J "C5'" 1 
ATOM   5181  C "C4'" . DC  B 1 108 ? 81.776  59.447 -8.179  1.00 118.79 ? 254  DC  J "C4'" 1 
ATOM   5182  O "O4'" . DC  B 1 108 ? 81.902  58.006 -8.214  1.00 117.39 ? 254  DC  J "O4'" 1 
ATOM   5183  C "C3'" . DC  B 1 108 ? 80.385  59.725 -7.610  1.00 117.82 ? 254  DC  J "C3'" 1 
ATOM   5184  O "O3'" . DC  B 1 108 ? 79.480  59.832 -8.696  1.00 116.73 ? 254  DC  J "O3'" 1 
ATOM   5185  C "C2'" . DC  B 1 108 ? 80.054  58.443 -6.874  1.00 117.37 ? 254  DC  J "C2'" 1 
ATOM   5186  C "C1'" . DC  B 1 108 ? 80.657  57.442 -7.832  1.00 117.19 ? 254  DC  J "C1'" 1 
ATOM   5187  N N1    . DC  B 1 108 ? 80.897  56.100 -7.287  1.00 100.19 ? 254  DC  J N1    1 
ATOM   5188  C C2    . DC  B 1 108 ? 80.546  54.994 -8.061  1.00 99.57  ? 254  DC  J C2    1 
ATOM   5189  O O2    . DC  B 1 108 ? 80.075  55.181 -9.196  1.00 97.42  ? 254  DC  J O2    1 
ATOM   5190  N N3    . DC  B 1 108 ? 80.731  53.755 -7.558  1.00 99.31  ? 254  DC  J N3    1 
ATOM   5191  C C4    . DC  B 1 108 ? 81.248  53.598 -6.337  1.00 99.90  ? 254  DC  J C4    1 
ATOM   5192  N N4    . DC  B 1 108 ? 81.385  52.355 -5.866  1.00 99.95  ? 254  DC  J N4    1 
ATOM   5193  C C5    . DC  B 1 108 ? 81.638  54.709 -5.538  1.00 100.16 ? 254  DC  J C5    1 
ATOM   5194  C C6    . DC  B 1 108 ? 81.443  55.931 -6.046  1.00 100.27 ? 254  DC  J C6    1 
ATOM   5195  P P     . DA  B 1 109 ? 78.420  61.020 -8.729  1.00 90.15  ? 255  DA  J P     1 
ATOM   5196  O OP1   . DA  B 1 109 ? 79.207  62.282 -8.761  1.00 103.65 ? 255  DA  J OP1   1 
ATOM   5197  O OP2   . DA  B 1 109 ? 77.407  60.788 -7.655  1.00 101.99 ? 255  DA  J OP2   1 
ATOM   5198  O "O5'" . DA  B 1 109 ? 77.735  60.828 -10.146 1.00 88.33  ? 255  DA  J "O5'" 1 
ATOM   5199  C "C5'" . DA  B 1 109 ? 78.515  60.471 -11.287 1.00 83.77  ? 255  DA  J "C5'" 1 
ATOM   5200  C "C4'" . DA  B 1 109 ? 77.857  59.337 -12.041 1.00 80.45  ? 255  DA  J "C4'" 1 
ATOM   5201  O "O4'" . DA  B 1 109 ? 77.982  58.092 -11.309 1.00 78.83  ? 255  DA  J "O4'" 1 
ATOM   5202  C "C3'" . DA  B 1 109 ? 76.364  59.513 -12.313 1.00 79.07  ? 255  DA  J "C3'" 1 
ATOM   5203  O "O3'" . DA  B 1 109 ? 76.070  59.038 -13.624 1.00 78.42  ? 255  DA  J "O3'" 1 
ATOM   5204  C "C2'" . DA  B 1 109 ? 75.698  58.645 -11.255 1.00 78.34  ? 255  DA  J "C2'" 1 
ATOM   5205  C "C1'" . DA  B 1 109 ? 76.698  57.517 -11.096 1.00 77.64  ? 255  DA  J "C1'" 1 
ATOM   5206  N N9    . DA  B 1 109 ? 76.711  56.895 -9.777  1.00 89.49  ? 255  DA  J N9    1 
ATOM   5207  C C8    . DA  B 1 109 ? 76.464  57.476 -8.563  1.00 88.95  ? 255  DA  J C8    1 
ATOM   5208  N N7    . DA  B 1 109 ? 76.596  56.655 -7.548  1.00 89.87  ? 255  DA  J N7    1 
ATOM   5209  C C5    . DA  B 1 109 ? 76.947  55.449 -8.137  1.00 90.31  ? 255  DA  J C5    1 
ATOM   5210  C C6    . DA  B 1 109 ? 77.236  54.176 -7.602  1.00 90.43  ? 255  DA  J C6    1 
ATOM   5211  N N6    . DA  B 1 109 ? 77.250  53.893 -6.298  1.00 90.34  ? 255  DA  J N6    1 
ATOM   5212  N N1    . DA  B 1 109 ? 77.524  53.191 -8.469  1.00 90.28  ? 255  DA  J N1    1 
ATOM   5213  C C2    . DA  B 1 109 ? 77.537  53.471 -9.778  1.00 90.13  ? 255  DA  J C2    1 
ATOM   5214  N N3    . DA  B 1 109 ? 77.302  54.624 -10.400 1.00 90.30  ? 255  DA  J N3    1 
ATOM   5215  C C4    . DA  B 1 109 ? 77.007  55.582 -9.512  1.00 90.04  ? 255  DA  J C4    1 
ATOM   5216  P P     . DA  B 1 110 ? 74.550  58.785 -14.052 1.00 101.56 ? 256  DA  J P     1 
ATOM   5217  O OP1   . DA  B 1 110 ? 74.505  59.020 -15.516 1.00 96.17  ? 256  DA  J OP1   1 
ATOM   5218  O OP2   . DA  B 1 110 ? 73.651  59.556 -13.145 1.00 96.42  ? 256  DA  J OP2   1 
ATOM   5219  O "O5'" . DA  B 1 110 ? 74.318  57.241 -13.747 1.00 101.02 ? 256  DA  J "O5'" 1 
ATOM   5220  C "C5'" . DA  B 1 110 ? 75.169  56.257 -14.319 1.00 97.93  ? 256  DA  J "C5'" 1 
ATOM   5221  C "C4'" . DA  B 1 110 ? 74.677  54.878 -13.958 1.00 95.93  ? 256  DA  J "C4'" 1 
ATOM   5222  O "O4'" . DA  B 1 110 ? 74.958  54.580 -12.568 1.00 95.36  ? 256  DA  J "O4'" 1 
ATOM   5223  C "C3'" . DA  B 1 110 ? 73.167  54.702 -14.125 1.00 94.45  ? 256  DA  J "C3'" 1 
ATOM   5224  O "O3'" . DA  B 1 110 ? 72.896  53.367 -14.549 1.00 90.92  ? 256  DA  J "O3'" 1 
ATOM   5225  C "C2'" . DA  B 1 110 ? 72.653  54.857 -12.710 1.00 95.35  ? 256  DA  J "C2'" 1 
ATOM   5226  C "C1'" . DA  B 1 110 ? 73.754  54.144 -11.958 1.00 96.47  ? 256  DA  J "C1'" 1 
ATOM   5227  N N9    . DA  B 1 110 ? 73.823  54.428 -10.530 1.00 92.76  ? 256  DA  J N9    1 
ATOM   5228  C C8    . DA  B 1 110 ? 73.739  55.637 -9.896  1.00 93.63  ? 256  DA  J C8    1 
ATOM   5229  N N7    . DA  B 1 110 ? 73.837  55.556 -8.594  1.00 94.00  ? 256  DA  J N7    1 
ATOM   5230  C C5    . DA  B 1 110 ? 73.998  54.201 -8.357  1.00 94.07  ? 256  DA  J C5    1 
ATOM   5231  C C6    . DA  B 1 110 ? 74.170  53.468 -7.180  1.00 94.94  ? 256  DA  J C6    1 
ATOM   5232  N N6    . DA  B 1 110 ? 74.217  54.017 -5.968  1.00 94.79  ? 256  DA  J N6    1 
ATOM   5233  N N1    . DA  B 1 110 ? 74.301  52.135 -7.289  1.00 95.05  ? 256  DA  J N1    1 
ATOM   5234  C C2    . DA  B 1 110 ? 74.269  51.586 -8.507  1.00 94.43  ? 256  DA  J C2    1 
ATOM   5235  N N3    . DA  B 1 110 ? 74.118  52.170 -9.687  1.00 93.57  ? 256  DA  J N3    1 
ATOM   5236  C C4    . DA  B 1 110 ? 73.988  53.495 -9.540  1.00 93.05  ? 256  DA  J C4    1 
ATOM   5237  P P     . DA  B 1 111 ? 71.531  53.038 -15.306 1.00 69.84  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 111 ? 71.835  53.212 -16.749 1.00 73.79  ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 111 ? 70.442  53.819 -14.671 1.00 71.30  ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 111 ? 71.290  51.497 -14.994 1.00 70.38  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 111 ? 72.373  50.573 -15.027 1.00 70.37  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 111 ? 72.187  49.503 -13.972 1.00 70.00  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 111 ? 72.536  50.019 -12.666 1.00 69.88  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 111 ? 70.769  48.932 -13.849 1.00 69.68  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 111 ? 70.801  47.538 -13.599 1.00 68.38  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 111 ? 70.237  49.581 -12.599 1.00 70.98  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 111 ? 71.493  49.721 -11.759 1.00 70.95  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 111 ? 71.378  50.825 -10.811 1.00 75.92  ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 111 ? 71.131  52.149 -11.076 1.00 76.64  ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 111 ? 70.951  52.873 -10.004 1.00 77.33  ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 111 ? 71.116  51.973 -8.960  1.00 77.66  ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 111 ? 71.027  52.112 -7.569  1.00 78.46  ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 111 ? 70.706  53.262 -6.966  1.00 77.96  ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 111 ? 71.267  51.016 -6.805  1.00 77.07  ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 111 ? 71.561  49.863 -7.415  1.00 77.70  ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 111 ? 71.659  49.604 -8.716  1.00 78.05  ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 111 ? 71.419  50.716 -9.443  1.00 76.97  ? 257  DA  J C4    1 
ATOM   5258  P P     . DT  B 1 112 ? 69.487  46.666 -13.867 1.00 61.42  ? 258  DT  J P     1 
ATOM   5259  O OP1   . DT  B 1 112 ? 69.867  45.238 -13.986 1.00 80.06  ? 258  DT  J OP1   1 
ATOM   5260  O OP2   . DT  B 1 112 ? 68.701  47.298 -14.941 1.00 77.90  ? 258  DT  J OP2   1 
ATOM   5261  O "O5'" . DT  B 1 112 ? 68.646  46.875 -12.545 1.00 67.87  ? 258  DT  J "O5'" 1 
ATOM   5262  C "C5'" . DT  B 1 112 ? 68.056  45.775 -11.878 1.00 77.00  ? 258  DT  J "C5'" 1 
ATOM   5263  C "C4'" . DT  B 1 112 ? 69.036  45.178 -10.894 1.00 82.90  ? 258  DT  J "C4'" 1 
ATOM   5264  O "O4'" . DT  B 1 112 ? 69.742  46.224 -10.180 1.00 83.67  ? 258  DT  J "O4'" 1 
ATOM   5265  C "C3'" . DT  B 1 112 ? 68.315  44.355 -9.839  1.00 86.27  ? 258  DT  J "C3'" 1 
ATOM   5266  O "O3'" . DT  B 1 112 ? 69.061  43.211 -9.446  1.00 90.90  ? 258  DT  J "O3'" 1 
ATOM   5267  C "C2'" . DT  B 1 112 ? 68.134  45.324 -8.689  1.00 86.08  ? 258  DT  J "C2'" 1 
ATOM   5268  C "C1'" . DT  B 1 112 ? 69.278  46.318 -8.835  1.00 84.98  ? 258  DT  J "C1'" 1 
ATOM   5269  N N1    . DT  B 1 112 ? 68.832  47.717 -8.594  1.00 101.22 ? 258  DT  J N1    1 
ATOM   5270  C C2    . DT  B 1 112 ? 68.571  48.098 -7.299  1.00 100.84 ? 258  DT  J C2    1 
ATOM   5271  O O2    . DT  B 1 112 ? 68.648  47.338 -6.357  1.00 102.62 ? 258  DT  J O2    1 
ATOM   5272  N N3    . DT  B 1 112 ? 68.197  49.403 -7.148  1.00 99.68  ? 258  DT  J N3    1 
ATOM   5273  C C4    . DT  B 1 112 ? 68.035  50.338 -8.139  1.00 99.31  ? 258  DT  J C4    1 
ATOM   5274  O O4    . DT  B 1 112 ? 67.706  51.476 -7.852  1.00 98.48  ? 258  DT  J O4    1 
ATOM   5275  C C5    . DT  B 1 112 ? 68.283  49.872 -9.473  1.00 99.55  ? 258  DT  J C5    1 
ATOM   5276  C C7    . DT  B 1 112 ? 68.078  50.816 -10.611 1.00 99.28  ? 258  DT  J C7    1 
ATOM   5277  C C6    . DT  B 1 112 ? 68.678  48.604 -9.635  1.00 100.15 ? 258  DT  J C6    1 
ATOM   5278  P P     . DA  B 1 113 ? 68.298  41.991 -8.744  1.00 129.22 ? 259  DA  J P     1 
ATOM   5279  O OP1   . DA  B 1 113 ? 69.348  41.066 -8.224  1.00 111.68 ? 259  DA  J OP1   1 
ATOM   5280  O OP2   . DA  B 1 113 ? 67.266  41.483 -9.696  1.00 110.30 ? 259  DA  J OP2   1 
ATOM   5281  O "O5'" . DA  B 1 113 ? 67.554  42.697 -7.520  1.00 131.25 ? 259  DA  J "O5'" 1 
ATOM   5282  C "C5'" . DA  B 1 113 ? 68.267  43.034 -6.323  1.00 135.24 ? 259  DA  J "C5'" 1 
ATOM   5283  C "C4'" . DA  B 1 113 ? 67.304  43.364 -5.204  1.00 137.79 ? 259  DA  J "C4'" 1 
ATOM   5284  O "O4'" . DA  B 1 113 ? 67.040  44.785 -5.119  1.00 138.44 ? 259  DA  J "O4'" 1 
ATOM   5285  C "C3'" . DA  B 1 113 ? 65.943  42.678 -5.300  1.00 139.22 ? 259  DA  J "C3'" 1 
ATOM   5286  O "O3'" . DA  B 1 113 ? 65.550  42.200 -4.012  1.00 140.74 ? 259  DA  J "O3'" 1 
ATOM   5287  C "C2'" . DA  B 1 113 ? 65.026  43.786 -5.787  1.00 139.01 ? 259  DA  J "C2'" 1 
ATOM   5288  C "C1'" . DA  B 1 113 ? 65.638  45.022 -5.151  1.00 139.28 ? 259  DA  J "C1'" 1 
ATOM   5289  N N9    . DA  B 1 113 ? 65.412  46.267 -5.891  1.00 122.82 ? 259  DA  J N9    1 
ATOM   5290  C C8    . DA  B 1 113 ? 65.425  46.447 -7.253  1.00 123.22 ? 259  DA  J C8    1 
ATOM   5291  N N7    . DA  B 1 113 ? 65.232  47.690 -7.625  1.00 123.58 ? 259  DA  J N7    1 
ATOM   5292  C C5    . DA  B 1 113 ? 65.070  48.373 -6.429  1.00 123.66 ? 259  DA  J C5    1 
ATOM   5293  C C6    . DA  B 1 113 ? 64.844  49.728 -6.139  1.00 123.85 ? 259  DA  J C6    1 
ATOM   5294  N N6    . DA  B 1 113 ? 64.757  50.679 -7.072  1.00 124.00 ? 259  DA  J N6    1 
ATOM   5295  N N1    . DA  B 1 113 ? 64.715  50.081 -4.843  1.00 123.61 ? 259  DA  J N1    1 
ATOM   5296  C C2    . DA  B 1 113 ? 64.816  49.134 -3.912  1.00 123.43 ? 259  DA  J C2    1 
ATOM   5297  N N3    . DA  B 1 113 ? 65.040  47.830 -4.056  1.00 123.18 ? 259  DA  J N3    1 
ATOM   5298  C C4    . DA  B 1 113 ? 65.161  47.509 -5.354  1.00 123.22 ? 259  DA  J C4    1 
ATOM   5299  P P     . DC  B 1 114 ? 64.076  41.602 -3.799  1.00 151.08 ? 260  DC  J P     1 
ATOM   5300  O OP1   . DC  B 1 114 ? 64.178  40.569 -2.737  1.00 148.21 ? 260  DC  J OP1   1 
ATOM   5301  O OP2   . DC  B 1 114 ? 63.478  41.245 -5.117  1.00 147.87 ? 260  DC  J OP2   1 
ATOM   5302  O "O5'" . DC  B 1 114 ? 63.298  42.845 -3.179  1.00 152.17 ? 260  DC  J "O5'" 1 
ATOM   5303  C "C5'" . DC  B 1 114 ? 63.761  43.444 -1.968  1.00 155.14 ? 260  DC  J "C5'" 1 
ATOM   5304  C "C4'" . DC  B 1 114 ? 62.712  44.370 -1.400  1.00 157.39 ? 260  DC  J "C4'" 1 
ATOM   5305  O "O4'" . DC  B 1 114 ? 62.758  45.652 -2.070  1.00 157.68 ? 260  DC  J "O4'" 1 
ATOM   5306  C "C3'" . DC  B 1 114 ? 61.273  43.865 -1.530  1.00 158.66 ? 260  DC  J "C3'" 1 
ATOM   5307  O "O3'" . DC  B 1 114 ? 60.540  44.136 -0.331  1.00 160.13 ? 260  DC  J "O3'" 1 
ATOM   5308  C "C2'" . DC  B 1 114 ? 60.719  44.689 -2.677  1.00 158.29 ? 260  DC  J "C2'" 1 
ATOM   5309  C "C1'" . DC  B 1 114 ? 61.453  46.004 -2.488  1.00 158.18 ? 260  DC  J "C1'" 1 
ATOM   5310  N N1    . DC  B 1 114 ? 61.567  46.830 -3.698  1.00 156.53 ? 260  DC  J N1    1 
ATOM   5311  C C2    . DC  B 1 114 ? 61.413  48.215 -3.579  1.00 156.64 ? 260  DC  J C2    1 
ATOM   5312  O O2    . DC  B 1 114 ? 61.212  48.704 -2.454  1.00 156.71 ? 260  DC  J O2    1 
ATOM   5313  N N3    . DC  B 1 114 ? 61.487  48.984 -4.690  1.00 156.66 ? 260  DC  J N3    1 
ATOM   5314  C C4    . DC  B 1 114 ? 61.707  48.418 -5.881  1.00 156.14 ? 260  DC  J C4    1 
ATOM   5315  N N4    . DC  B 1 114 ? 61.756  49.211 -6.953  1.00 155.60 ? 260  DC  J N4    1 
ATOM   5316  C C5    . DC  B 1 114 ? 61.883  47.013 -6.026  1.00 155.92 ? 260  DC  J C5    1 
ATOM   5317  C C6    . DC  B 1 114 ? 61.807  46.264 -4.919  1.00 156.16 ? 260  DC  J C6    1 
ATOM   5318  P P     . DA  B 1 115 ? 59.047  43.560 -0.159  1.00 135.40 ? 261  DA  J P     1 
ATOM   5319  O OP1   . DA  B 1 115 ? 59.001  42.828 1.131   1.00 153.01 ? 261  DA  J OP1   1 
ATOM   5320  O OP2   . DA  B 1 115 ? 58.646  42.871 -1.413  1.00 152.05 ? 261  DA  J OP2   1 
ATOM   5321  O "O5'" . DA  B 1 115 ? 58.158  44.871 -0.023  1.00 135.69 ? 261  DA  J "O5'" 1 
ATOM   5322  C "C5'" . DA  B 1 115 ? 58.496  45.878 0.924   1.00 135.74 ? 261  DA  J "C5'" 1 
ATOM   5323  C "C4'" . DA  B 1 115 ? 57.726  47.139 0.627   1.00 135.89 ? 261  DA  J "C4'" 1 
ATOM   5324  O "O4'" . DA  B 1 115 ? 58.189  47.707 -0.625  1.00 136.14 ? 261  DA  J "O4'" 1 
ATOM   5325  C "C3'" . DA  B 1 115 ? 56.223  46.908 0.455   1.00 136.18 ? 261  DA  J "C3'" 1 
ATOM   5326  O "O3'" . DA  B 1 115 ? 55.505  48.019 1.008   1.00 136.09 ? 261  DA  J "O3'" 1 
ATOM   5327  C "C2'" . DA  B 1 115 ? 56.057  46.870 -1.055  1.00 136.26 ? 261  DA  J "C2'" 1 
ATOM   5328  C "C1'" . DA  B 1 115 ? 57.069  47.919 -1.474  1.00 136.55 ? 261  DA  J "C1'" 1 
ATOM   5329  N N9    . DA  B 1 115 ? 57.514  47.868 -2.871  1.00 153.51 ? 261  DA  J N9    1 
ATOM   5330  C C8    . DA  B 1 115 ? 57.927  46.776 -3.596  1.00 153.19 ? 261  DA  J C8    1 
ATOM   5331  N N7    . DA  B 1 115 ? 58.258  47.057 -4.835  1.00 153.21 ? 261  DA  J N7    1 
ATOM   5332  C C5    . DA  B 1 115 ? 58.051  48.426 -4.935  1.00 153.48 ? 261  DA  J C5    1 
ATOM   5333  C C6    . DA  B 1 115 ? 58.219  49.335 -5.999  1.00 153.55 ? 261  DA  J C6    1 
ATOM   5334  N N6    . DA  B 1 115 ? 58.645  48.981 -7.214  1.00 153.08 ? 261  DA  J N6    1 
ATOM   5335  N N1    . DA  B 1 115 ? 57.927  50.635 -5.768  1.00 153.42 ? 261  DA  J N1    1 
ATOM   5336  C C2    . DA  B 1 115 ? 57.493  50.988 -4.552  1.00 153.54 ? 261  DA  J C2    1 
ATOM   5337  N N3    . DA  B 1 115 ? 57.291  50.227 -3.474  1.00 153.70 ? 261  DA  J N3    1 
ATOM   5338  C C4    . DA  B 1 115 ? 57.594  48.941 -3.734  1.00 153.44 ? 261  DA  J C4    1 
ATOM   5339  P P     . DC  B 1 116 ? 54.082  47.783 1.718   1.00 139.32 ? 262  DC  J P     1 
ATOM   5340  O OP1   . DC  B 1 116 ? 53.894  48.849 2.737   1.00 128.13 ? 262  DC  J OP1   1 
ATOM   5341  O OP2   . DC  B 1 116 ? 54.034  46.358 2.124   1.00 128.07 ? 262  DC  J OP2   1 
ATOM   5342  O "O5'" . DC  B 1 116 ? 53.023  48.005 0.552   1.00 138.89 ? 262  DC  J "O5'" 1 
ATOM   5343  C "C5'" . DC  B 1 116 ? 53.461  48.413 -0.732  1.00 138.64 ? 262  DC  J "C5'" 1 
ATOM   5344  C "C4'" . DC  B 1 116 ? 53.106  49.860 -0.966  1.00 138.33 ? 262  DC  J "C4'" 1 
ATOM   5345  O "O4'" . DC  B 1 116 ? 53.887  50.359 -2.074  1.00 138.86 ? 262  DC  J "O4'" 1 
ATOM   5346  C "C3'" . DC  B 1 116 ? 51.648  50.070 -1.348  1.00 138.14 ? 262  DC  J "C3'" 1 
ATOM   5347  O "O3'" . DC  B 1 116 ? 51.181  51.328 -0.859  1.00 137.41 ? 262  DC  J "O3'" 1 
ATOM   5348  C "C2'" . DC  B 1 116 ? 51.683  50.030 -2.864  1.00 138.77 ? 262  DC  J "C2'" 1 
ATOM   5349  C "C1'" . DC  B 1 116 ? 53.067  50.567 -3.213  1.00 139.29 ? 262  DC  J "C1'" 1 
ATOM   5350  N N1    . DC  B 1 116 ? 53.710  49.869 -4.332  1.00 129.08 ? 262  DC  J N1    1 
ATOM   5351  C C2    . DC  B 1 116 ? 53.959  50.567 -5.511  1.00 129.48 ? 262  DC  J C2    1 
ATOM   5352  O O2    . DC  B 1 116 ? 53.604  51.747 -5.591  1.00 129.67 ? 262  DC  J O2    1 
ATOM   5353  N N3    . DC  B 1 116 ? 54.582  49.939 -6.532  1.00 129.98 ? 262  DC  J N3    1 
ATOM   5354  C C4    . DC  B 1 116 ? 54.951  48.664 -6.403  1.00 130.15 ? 262  DC  J C4    1 
ATOM   5355  N N4    . DC  B 1 116 ? 55.589  48.092 -7.427  1.00 130.76 ? 262  DC  J N4    1 
ATOM   5356  C C5    . DC  B 1 116 ? 54.691  47.921 -5.215  1.00 130.01 ? 262  DC  J C5    1 
ATOM   5357  C C6    . DC  B 1 116 ? 54.073  48.557 -4.215  1.00 129.66 ? 262  DC  J C6    1 
ATOM   5358  P P     . DT  B 1 117 ? 49.656  51.757 -1.114  1.00 113.02 ? 263  DT  J P     1 
ATOM   5359  O OP1   . DT  B 1 117 ? 49.289  52.721 -0.039  1.00 98.08  ? 263  DT  J OP1   1 
ATOM   5360  O OP2   . DT  B 1 117 ? 48.833  50.533 -1.339  1.00 98.21  ? 263  DT  J OP2   1 
ATOM   5361  O "O5'" . DT  B 1 117 ? 49.721  52.556 -2.483  1.00 111.50 ? 263  DT  J "O5'" 1 
ATOM   5362  C "C5'" . DT  B 1 117 ? 50.473  53.757 -2.583  1.00 109.11 ? 263  DT  J "C5'" 1 
ATOM   5363  C "C4'" . DT  B 1 117 ? 50.199  54.418 -3.910  1.00 107.33 ? 263  DT  J "C4'" 1 
ATOM   5364  O "O4'" . DT  B 1 117 ? 50.830  53.672 -4.980  1.00 106.50 ? 263  DT  J "O4'" 1 
ATOM   5365  C "C3'" . DT  B 1 117 ? 48.715  54.470 -4.252  1.00 106.45 ? 263  DT  J "C3'" 1 
ATOM   5366  O "O3'" . DT  B 1 117 ? 48.427  55.732 -4.855  1.00 105.37 ? 263  DT  J "O3'" 1 
ATOM   5367  C "C2'" . DT  B 1 117 ? 48.530  53.295 -5.203  1.00 106.04 ? 263  DT  J "C2'" 1 
ATOM   5368  C "C1'" . DT  B 1 117 ? 49.862  53.255 -5.928  1.00 106.34 ? 263  DT  J "C1'" 1 
ATOM   5369  N N1    . DT  B 1 117 ? 50.287  51.938 -6.461  1.00 91.49  ? 263  DT  J N1    1 
ATOM   5370  C C2    . DT  B 1 117 ? 50.685  51.889 -7.779  1.00 91.59  ? 263  DT  J C2    1 
ATOM   5371  O O2    . DT  B 1 117 ? 50.653  52.857 -8.522  1.00 91.76  ? 263  DT  J O2    1 
ATOM   5372  N N3    . DT  B 1 117 ? 51.125  50.659 -8.198  1.00 91.13  ? 263  DT  J N3    1 
ATOM   5373  C C4    . DT  B 1 117 ? 51.205  49.499 -7.456  1.00 91.22  ? 263  DT  J C4    1 
ATOM   5374  O O4    . DT  B 1 117 ? 51.661  48.474 -7.962  1.00 91.10  ? 263  DT  J O4    1 
ATOM   5375  C C5    . DT  B 1 117 ? 50.741  49.606 -6.100  1.00 91.10  ? 263  DT  J C5    1 
ATOM   5376  C C7    . DT  B 1 117 ? 50.759  48.382 -5.242  1.00 90.59  ? 263  DT  J C7    1 
ATOM   5377  C C6    . DT  B 1 117 ? 50.309  50.805 -5.670  1.00 91.06  ? 263  DT  J C6    1 
ATOM   5378  P P     . DT  B 1 118 ? 47.099  55.914 -5.735  1.00 115.45 ? 264  DT  J P     1 
ATOM   5379  O OP1   . DT  B 1 118 ? 46.639  57.310 -5.520  1.00 120.65 ? 264  DT  J OP1   1 
ATOM   5380  O OP2   . DT  B 1 118 ? 46.162  54.776 -5.499  1.00 119.73 ? 264  DT  J OP2   1 
ATOM   5381  O "O5'" . DT  B 1 118 ? 47.640  55.789 -7.224  1.00 113.48 ? 264  DT  J "O5'" 1 
ATOM   5382  C "C5'" . DT  B 1 118 ? 48.852  56.431 -7.614  1.00 108.86 ? 264  DT  J "C5'" 1 
ATOM   5383  C "C4'" . DT  B 1 118 ? 49.003  56.361 -9.112  1.00 105.14 ? 264  DT  J "C4'" 1 
ATOM   5384  O "O4'" . DT  B 1 118 ? 49.310  55.009 -9.510  1.00 104.07 ? 264  DT  J "O4'" 1 
ATOM   5385  C "C3'" . DT  B 1 118 ? 47.723  56.728 -9.851  1.00 102.76 ? 264  DT  J "C3'" 1 
ATOM   5386  O "O3'" . DT  B 1 118 ? 48.058  57.412 -11.046 1.00 100.06 ? 264  DT  J "O3'" 1 
ATOM   5387  C "C2'" . DT  B 1 118 ? 47.086  55.383 -10.155 1.00 101.96 ? 264  DT  J "C2'" 1 
ATOM   5388  C "C1'" . DT  B 1 118 ? 48.298  54.503 -10.373 1.00 102.38 ? 264  DT  J "C1'" 1 
ATOM   5389  N N1    . DT  B 1 118 ? 48.115  53.073 -10.051 1.00 105.56 ? 264  DT  J N1    1 
ATOM   5390  C C2    . DT  B 1 118 ? 48.463  52.154 -11.005 1.00 104.86 ? 264  DT  J C2    1 
ATOM   5391  O O2    . DT  B 1 118 ? 48.869  52.467 -12.111 1.00 105.29 ? 264  DT  J O2    1 
ATOM   5392  N N3    . DT  B 1 118 ? 48.319  50.847 -10.616 1.00 103.55 ? 264  DT  J N3    1 
ATOM   5393  C C4    . DT  B 1 118 ? 47.870  50.380 -9.399  1.00 102.79 ? 264  DT  J C4    1 
ATOM   5394  O O4    . DT  B 1 118 ? 47.818  49.174 -9.187  1.00 100.60 ? 264  DT  J O4    1 
ATOM   5395  C C5    . DT  B 1 118 ? 47.499  51.394 -8.455  1.00 103.16 ? 264  DT  J C5    1 
ATOM   5396  C C7    . DT  B 1 118 ? 46.988  50.978 -7.112  1.00 103.32 ? 264  DT  J C7    1 
ATOM   5397  C C6    . DT  B 1 118 ? 47.632  52.675 -8.822  1.00 104.48 ? 264  DT  J C6    1 
ATOM   5398  P P     . DT  B 1 119 ? 46.906  58.133 -11.891 1.00 101.01 ? 265  DT  J P     1 
ATOM   5399  O OP1   . DT  B 1 119 ? 47.228  59.579 -11.918 1.00 115.27 ? 265  DT  J OP1   1 
ATOM   5400  O OP2   . DT  B 1 119 ? 45.573  57.675 -11.416 1.00 115.52 ? 265  DT  J OP2   1 
ATOM   5401  O "O5'" . DT  B 1 119 ? 47.144  57.569 -13.355 1.00 100.03 ? 265  DT  J "O5'" 1 
ATOM   5402  C "C5'" . DT  B 1 119 ? 48.465  57.481 -13.876 1.00 95.20  ? 265  DT  J "C5'" 1 
ATOM   5403  C "C4'" . DT  B 1 119 ? 48.516  56.487 -15.011 1.00 92.30  ? 265  DT  J "C4'" 1 
ATOM   5404  O "O4'" . DT  B 1 119 ? 48.331  55.142 -14.516 1.00 91.24  ? 265  DT  J "O4'" 1 
ATOM   5405  C "C3'" . DT  B 1 119 ? 47.467  56.690 -16.101 1.00 90.77  ? 265  DT  J "C3'" 1 
ATOM   5406  O "O3'" . DT  B 1 119 ? 48.136  56.654 -17.354 1.00 88.82  ? 265  DT  J "O3'" 1 
ATOM   5407  C "C2'" . DT  B 1 119 ? 46.490  55.535 -15.906 1.00 90.42  ? 265  DT  J "C2'" 1 
ATOM   5408  C "C1'" . DT  B 1 119 ? 47.380  54.458 -15.315 1.00 91.51  ? 265  DT  J "C1'" 1 
ATOM   5409  N N1    . DT  B 1 119 ? 46.730  53.447 -14.454 1.00 107.21 ? 265  DT  J N1    1 
ATOM   5410  C C2    . DT  B 1 119 ? 46.796  52.121 -14.827 1.00 109.15 ? 265  DT  J C2    1 
ATOM   5411  O O2    . DT  B 1 119 ? 47.350  51.739 -15.841 1.00 111.30 ? 265  DT  J O2    1 
ATOM   5412  N N3    . DT  B 1 119 ? 46.195  51.251 -13.957 1.00 109.45 ? 265  DT  J N3    1 
ATOM   5413  C C4    . DT  B 1 119 ? 45.557  51.561 -12.776 1.00 111.06 ? 265  DT  J C4    1 
ATOM   5414  O O4    . DT  B 1 119 ? 45.068  50.674 -12.092 1.00 111.98 ? 265  DT  J O4    1 
ATOM   5415  C C5    . DT  B 1 119 ? 45.526  52.959 -12.444 1.00 110.31 ? 265  DT  J C5    1 
ATOM   5416  C C7    . DT  B 1 119 ? 44.870  53.380 -11.170 1.00 110.95 ? 265  DT  J C7    1 
ATOM   5417  C C6    . DT  B 1 119 ? 46.096  53.825 -13.293 1.00 108.99 ? 265  DT  J C6    1 
ATOM   5418  P P     . DT  B 1 120 ? 47.290  56.562 -18.697 1.00 96.11  ? 266  DT  J P     1 
ATOM   5419  O OP1   . DT  B 1 120 ? 48.074  57.259 -19.749 1.00 108.11 ? 266  DT  J OP1   1 
ATOM   5420  O OP2   . DT  B 1 120 ? 45.885  56.955 -18.423 1.00 110.20 ? 266  DT  J OP2   1 
ATOM   5421  O "O5'" . DT  B 1 120 ? 47.309  55.007 -19.001 1.00 96.43  ? 266  DT  J "O5'" 1 
ATOM   5422  C "C5'" . DT  B 1 120 ? 48.531  54.287 -18.959 1.00 95.22  ? 266  DT  J "C5'" 1 
ATOM   5423  C "C4'" . DT  B 1 120 ? 48.341  52.930 -19.586 1.00 94.14  ? 266  DT  J "C4'" 1 
ATOM   5424  O "O4'" . DT  B 1 120 ? 47.640  52.045 -18.680 1.00 94.21  ? 266  DT  J "O4'" 1 
ATOM   5425  C "C3'" . DT  B 1 120 ? 47.515  52.982 -20.866 1.00 94.45  ? 266  DT  J "C3'" 1 
ATOM   5426  O "O3'" . DT  B 1 120 ? 48.082  52.097 -21.827 1.00 93.97  ? 266  DT  J "O3'" 1 
ATOM   5427  C "C2'" . DT  B 1 120 ? 46.148  52.491 -20.420 1.00 95.13  ? 266  DT  J "C2'" 1 
ATOM   5428  C "C1'" . DT  B 1 120 ? 46.497  51.501 -19.319 1.00 94.81  ? 266  DT  J "C1'" 1 
ATOM   5429  N N1    . DT  B 1 120 ? 45.445  51.316 -18.289 1.00 108.24 ? 266  DT  J N1    1 
ATOM   5430  C C2    . DT  B 1 120 ? 45.264  50.069 -17.720 1.00 108.90 ? 266  DT  J C2    1 
ATOM   5431  O O2    . DT  B 1 120 ? 45.923  49.090 -18.014 1.00 106.62 ? 266  DT  J O2    1 
ATOM   5432  N N3    . DT  B 1 120 ? 44.272  50.015 -16.780 1.00 110.68 ? 266  DT  J N3    1 
ATOM   5433  C C4    . DT  B 1 120 ? 43.465  51.048 -16.352 1.00 111.20 ? 266  DT  J C4    1 
ATOM   5434  O O4    . DT  B 1 120 ? 42.625  50.844 -15.490 1.00 113.03 ? 266  DT  J O4    1 
ATOM   5435  C C5    . DT  B 1 120 ? 43.703  52.319 -16.985 1.00 110.19 ? 266  DT  J C5    1 
ATOM   5436  C C7    . DT  B 1 120 ? 42.878  53.499 -16.585 1.00 110.40 ? 266  DT  J C7    1 
ATOM   5437  C C6    . DT  B 1 120 ? 44.664  52.388 -17.910 1.00 109.18 ? 266  DT  J C6    1 
ATOM   5438  P P     . DG  B 1 121 ? 48.382  52.616 -23.315 1.00 105.13 ? 267  DG  J P     1 
ATOM   5439  O OP1   . DG  B 1 121 ? 49.656  53.389 -23.312 1.00 92.54  ? 267  DG  J OP1   1 
ATOM   5440  O OP2   . DG  B 1 121 ? 47.126  53.217 -23.860 1.00 91.22  ? 267  DG  J OP2   1 
ATOM   5441  O "O5'" . DG  B 1 121 ? 48.651  51.270 -24.109 1.00 101.77 ? 267  DG  J "O5'" 1 
ATOM   5442  C "C5'" . DG  B 1 121 ? 49.493  50.277 -23.555 1.00 94.52  ? 267  DG  J "C5'" 1 
ATOM   5443  C "C4'" . DG  B 1 121 ? 48.775  48.951 -23.530 1.00 90.79  ? 267  DG  J "C4'" 1 
ATOM   5444  O "O4'" . DG  B 1 121 ? 47.673  48.999 -22.593 1.00 90.52  ? 267  DG  J "O4'" 1 
ATOM   5445  C "C3'" . DG  B 1 121 ? 48.191  48.503 -24.867 1.00 88.45  ? 267  DG  J "C3'" 1 
ATOM   5446  O "O3'" . DG  B 1 121 ? 48.424  47.100 -25.000 1.00 84.41  ? 267  DG  J "O3'" 1 
ATOM   5447  C "C2'" . DG  B 1 121 ? 46.711  48.805 -24.721 1.00 88.64  ? 267  DG  J "C2'" 1 
ATOM   5448  C "C1'" . DG  B 1 121 ? 46.465  48.622 -23.229 1.00 90.93  ? 267  DG  J "C1'" 1 
ATOM   5449  N N9    . DG  B 1 121 ? 45.397  49.454 -22.668 1.00 80.35  ? 267  DG  J N9    1 
ATOM   5450  C C8    . DG  B 1 121 ? 45.042  50.728 -23.067 1.00 81.13  ? 267  DG  J C8    1 
ATOM   5451  N N7    . DG  B 1 121 ? 44.088  51.252 -22.338 1.00 81.43  ? 267  DG  J N7    1 
ATOM   5452  C C5    . DG  B 1 121 ? 43.789  50.266 -21.406 1.00 80.88  ? 267  DG  J C5    1 
ATOM   5453  C C6    . DG  B 1 121 ? 42.864  50.273 -20.334 1.00 80.73  ? 267  DG  J C6    1 
ATOM   5454  O O6    . DG  B 1 121 ? 42.117  51.195 -19.972 1.00 78.37  ? 267  DG  J O6    1 
ATOM   5455  N N1    . DG  B 1 121 ? 42.871  49.059 -19.646 1.00 81.03  ? 267  DG  J N1    1 
ATOM   5456  C C2    . DG  B 1 121 ? 43.676  47.988 -19.950 1.00 83.02  ? 267  DG  J C2    1 
ATOM   5457  N N2    . DG  B 1 121 ? 43.534  46.906 -19.191 1.00 82.81  ? 267  DG  J N2    1 
ATOM   5458  N N3    . DG  B 1 121 ? 44.558  47.979 -20.931 1.00 83.00  ? 267  DG  J N3    1 
ATOM   5459  C C4    . DG  B 1 121 ? 44.567  49.138 -21.613 1.00 81.41  ? 267  DG  J C4    1 
ATOM   5460  P P     . DG  B 1 122 ? 48.099  46.352 -26.382 1.00 60.83  ? 268  DG  J P     1 
ATOM   5461  O OP1   . DG  B 1 122 ? 49.360  45.778 -26.924 1.00 94.71  ? 268  DG  J OP1   1 
ATOM   5462  O OP2   . DG  B 1 122 ? 47.304  47.298 -27.204 1.00 92.19  ? 268  DG  J OP2   1 
ATOM   5463  O "O5'" . DG  B 1 122 ? 47.121  45.176 -25.926 1.00 64.47  ? 268  DG  J "O5'" 1 
ATOM   5464  C "C5'" . DG  B 1 122 ? 47.388  44.391 -24.743 1.00 66.90  ? 268  DG  J "C5'" 1 
ATOM   5465  C "C4'" . DG  B 1 122 ? 46.173  43.574 -24.346 1.00 70.90  ? 268  DG  J "C4'" 1 
ATOM   5466  O "O4'" . DG  B 1 122 ? 45.273  44.281 -23.464 1.00 72.56  ? 268  DG  J "O4'" 1 
ATOM   5467  C "C3'" . DG  B 1 122 ? 45.307  43.066 -25.493 1.00 72.15  ? 268  DG  J "C3'" 1 
ATOM   5468  O "O3'" . DG  B 1 122 ? 44.882  41.753 -25.219 1.00 74.58  ? 268  DG  J "O3'" 1 
ATOM   5469  C "C2'" . DG  B 1 122 ? 44.099  43.974 -25.466 1.00 74.19  ? 268  DG  J "C2'" 1 
ATOM   5470  C "C1'" . DG  B 1 122 ? 43.954  44.274 -23.996 1.00 75.86  ? 268  DG  J "C1'" 1 
ATOM   5471  N N9    . DG  B 1 122 ? 43.376  45.590 -23.765 1.00 114.39 ? 268  DG  J N9    1 
ATOM   5472  C C8    . DG  B 1 122 ? 43.681  46.762 -24.422 1.00 116.96 ? 268  DG  J C8    1 
ATOM   5473  N N7    . DG  B 1 122 ? 42.989  47.784 -23.999 1.00 119.13 ? 268  DG  J N7    1 
ATOM   5474  C C5    . DG  B 1 122 ? 42.181  47.255 -23.001 1.00 119.69 ? 268  DG  J C5    1 
ATOM   5475  C C6    . DG  B 1 122 ? 41.208  47.879 -22.180 1.00 121.96 ? 268  DG  J C6    1 
ATOM   5476  O O6    . DG  B 1 122 ? 40.854  49.072 -22.170 1.00 123.19 ? 268  DG  J O6    1 
ATOM   5477  N N1    . DG  B 1 122 ? 40.618  46.967 -21.306 1.00 121.77 ? 268  DG  J N1    1 
ATOM   5478  C C2    . DG  B 1 122 ? 40.918  45.625 -21.236 1.00 121.48 ? 268  DG  J C2    1 
ATOM   5479  N N2    . DG  B 1 122 ? 40.228  44.904 -20.338 1.00 123.00 ? 268  DG  J N2    1 
ATOM   5480  N N3    . DG  B 1 122 ? 41.824  45.034 -21.995 1.00 119.79 ? 268  DG  J N3    1 
ATOM   5481  C C4    . DG  B 1 122 ? 42.411  45.901 -22.848 1.00 118.15 ? 268  DG  J C4    1 
ATOM   5482  P P     . DT  B 1 123 ? 43.881  41.031 -26.222 1.00 79.05  ? 269  DT  J P     1 
ATOM   5483  O OP1   . DT  B 1 123 ? 44.170  39.579 -26.097 1.00 73.63  ? 269  DT  J OP1   1 
ATOM   5484  O OP2   . DT  B 1 123 ? 43.871  41.668 -27.556 1.00 73.33  ? 269  DT  J OP2   1 
ATOM   5485  O "O5'" . DT  B 1 123 ? 42.466  41.362 -25.590 1.00 84.54  ? 269  DT  J "O5'" 1 
ATOM   5486  C "C5'" . DT  B 1 123 ? 42.132  40.910 -24.279 1.00 92.29  ? 269  DT  J "C5'" 1 
ATOM   5487  C "C4'" . DT  B 1 123 ? 40.643  40.995 -24.098 1.00 99.08  ? 269  DT  J "C4'" 1 
ATOM   5488  O "O4'" . DT  B 1 123 ? 40.276  42.374 -23.847 1.00 99.15  ? 269  DT  J "O4'" 1 
ATOM   5489  C "C3'" . DT  B 1 123 ? 39.938  40.587 -25.392 1.00 103.57 ? 269  DT  J "C3'" 1 
ATOM   5490  O "O3'" . DT  B 1 123 ? 38.760  39.844 -25.099 1.00 112.09 ? 269  DT  J "O3'" 1 
ATOM   5491  C "C2'" . DT  B 1 123 ? 39.608  41.918 -26.044 1.00 102.59 ? 269  DT  J "C2'" 1 
ATOM   5492  C "C1'" . DT  B 1 123 ? 39.332  42.780 -24.823 1.00 101.69 ? 269  DT  J "C1'" 1 
ATOM   5493  N N1    . DT  B 1 123 ? 39.421  44.255 -25.000 1.00 97.42  ? 269  DT  J N1    1 
ATOM   5494  C C2    . DT  B 1 123 ? 38.714  45.041 -24.119 1.00 97.48  ? 269  DT  J C2    1 
ATOM   5495  O O2    . DT  B 1 123 ? 38.115  44.588 -23.163 1.00 98.12  ? 269  DT  J O2    1 
ATOM   5496  N N3    . DT  B 1 123 ? 38.744  46.383 -24.387 1.00 96.84  ? 269  DT  J N3    1 
ATOM   5497  C C4    . DT  B 1 123 ? 39.422  47.013 -25.402 1.00 97.33  ? 269  DT  J C4    1 
ATOM   5498  O O4    . DT  B 1 123 ? 39.319  48.234 -25.538 1.00 95.15  ? 269  DT  J O4    1 
ATOM   5499  C C5    . DT  B 1 123 ? 40.211  46.137 -26.251 1.00 98.05  ? 269  DT  J C5    1 
ATOM   5500  C C7    . DT  B 1 123 ? 41.055  46.737 -27.333 1.00 100.49 ? 269  DT  J C7    1 
ATOM   5501  C C6    . DT  B 1 123 ? 40.158  44.818 -26.019 1.00 98.06  ? 269  DT  J C6    1 
ATOM   5502  P P     . DA  B 1 124 ? 38.778  38.251 -25.259 1.00 153.16 ? 270  DA  J P     1 
ATOM   5503  O OP1   . DA  B 1 124 ? 39.556  37.670 -24.141 1.00 134.50 ? 270  DA  J OP1   1 
ATOM   5504  O OP2   . DA  B 1 124 ? 39.185  37.983 -26.661 1.00 134.46 ? 270  DA  J OP2   1 
ATOM   5505  O "O5'" . DA  B 1 124 ? 37.256  37.820 -25.091 1.00 156.59 ? 270  DA  J "O5'" 1 
ATOM   5506  C "C5'" . DA  B 1 124 ? 36.572  37.922 -23.839 1.00 160.99 ? 270  DA  J "C5'" 1 
ATOM   5507  C "C4'" . DA  B 1 124 ? 35.146  38.358 -24.086 1.00 163.93 ? 270  DA  J "C4'" 1 
ATOM   5508  O "O4'" . DA  B 1 124 ? 35.115  39.810 -24.077 1.00 164.08 ? 270  DA  J "O4'" 1 
ATOM   5509  C "C3'" . DA  B 1 124 ? 34.680  37.911 -25.481 1.00 165.86 ? 270  DA  J "C3'" 1 
ATOM   5510  O "O3'" . DA  B 1 124 ? 33.309  37.446 -25.645 1.00 168.23 ? 270  DA  J "O3'" 1 
ATOM   5511  C "C2'" . DA  B 1 124 ? 34.886  39.161 -26.318 1.00 165.37 ? 270  DA  J "C2'" 1 
ATOM   5512  C "C1'" . DA  B 1 124 ? 34.636  40.284 -25.320 1.00 164.35 ? 270  DA  J "C1'" 1 
ATOM   5513  N N9    . DA  B 1 124 ? 35.341  41.518 -25.643 1.00 144.34 ? 270  DA  J N9    1 
ATOM   5514  C C8    . DA  B 1 124 ? 36.410  41.651 -26.495 1.00 143.86 ? 270  DA  J C8    1 
ATOM   5515  N N7    . DA  B 1 124 ? 36.801  42.887 -26.668 1.00 143.64 ? 270  DA  J N7    1 
ATOM   5516  C C5    . DA  B 1 124 ? 35.942  43.623 -25.860 1.00 143.82 ? 270  DA  J C5    1 
ATOM   5517  C C6    . DA  B 1 124 ? 35.830  45.004 -25.621 1.00 143.71 ? 270  DA  J C6    1 
ATOM   5518  N N6    . DA  B 1 124 ? 36.600  45.922 -26.215 1.00 142.81 ? 270  DA  J N6    1 
ATOM   5519  N N1    . DA  B 1 124 ? 34.879  45.415 -24.751 1.00 143.99 ? 270  DA  J N1    1 
ATOM   5520  C C2    . DA  B 1 124 ? 34.093  44.491 -24.180 1.00 143.92 ? 270  DA  J C2    1 
ATOM   5521  N N3    . DA  B 1 124 ? 34.092  43.164 -24.339 1.00 144.05 ? 270  DA  J N3    1 
ATOM   5522  C C4    . DA  B 1 124 ? 35.056  42.790 -25.206 1.00 143.99 ? 270  DA  J C4    1 
ATOM   5523  P P     . DG  B 1 125 ? 32.228  37.534 -24.450 1.00 141.16 ? 271  DG  J P     1 
ATOM   5524  O OP1   . DG  B 1 125 ? 32.882  37.456 -23.119 1.00 154.31 ? 271  DG  J OP1   1 
ATOM   5525  O OP2   . DG  B 1 125 ? 31.142  36.575 -24.778 1.00 153.61 ? 271  DG  J OP2   1 
ATOM   5526  O "O5'" . DG  B 1 125 ? 31.627  38.998 -24.640 1.00 142.90 ? 271  DG  J "O5'" 1 
ATOM   5527  C "C5'" . DG  B 1 125 ? 30.748  39.565 -23.676 1.00 145.91 ? 271  DG  J "C5'" 1 
ATOM   5528  C "C4'" . DG  B 1 125 ? 29.807  40.542 -24.339 1.00 147.92 ? 271  DG  J "C4'" 1 
ATOM   5529  O "O4'" . DG  B 1 125 ? 30.533  41.722 -24.772 1.00 148.01 ? 271  DG  J "O4'" 1 
ATOM   5530  C "C3'" . DG  B 1 125 ? 29.088  40.002 -25.579 1.00 149.22 ? 271  DG  J "C3'" 1 
ATOM   5531  O "O3'" . DG  B 1 125 ? 27.708  40.394 -25.544 1.00 151.29 ? 271  DG  J "O3'" 1 
ATOM   5532  C "C2'" . DG  B 1 125 ? 29.831  40.657 -26.731 1.00 148.93 ? 271  DG  J "C2'" 1 
ATOM   5533  C "C1'" . DG  B 1 125 ? 30.235  41.992 -26.134 1.00 148.38 ? 271  DG  J "C1'" 1 
ATOM   5534  N N9    . DG  B 1 125 ? 31.418  42.585 -26.750 1.00 161.23 ? 271  DG  J N9    1 
ATOM   5535  C C8    . DG  B 1 125 ? 32.512  41.915 -27.238 1.00 161.30 ? 271  DG  J C8    1 
ATOM   5536  N N7    . DG  B 1 125 ? 33.418  42.709 -27.744 1.00 160.85 ? 271  DG  J N7    1 
ATOM   5537  C C5    . DG  B 1 125 ? 32.894  43.983 -27.580 1.00 160.44 ? 271  DG  J C5    1 
ATOM   5538  C C6    . DG  B 1 125 ? 33.431  45.254 -27.937 1.00 160.06 ? 271  DG  J C6    1 
ATOM   5539  O O6    . DG  B 1 125 ? 34.512  45.513 -28.483 1.00 159.40 ? 271  DG  J O6    1 
ATOM   5540  N N1    . DG  B 1 125 ? 32.567  46.285 -27.592 1.00 160.35 ? 271  DG  J N1    1 
ATOM   5541  C C2    . DG  B 1 125 ? 31.347  46.124 -26.984 1.00 160.31 ? 271  DG  J C2    1 
ATOM   5542  N N2    . DG  B 1 125 ? 30.663  47.248 -26.739 1.00 160.27 ? 271  DG  J N2    1 
ATOM   5543  N N3    . DG  B 1 125 ? 30.835  44.949 -26.642 1.00 160.45 ? 271  DG  J N3    1 
ATOM   5544  C C4    . DG  B 1 125 ? 31.657  43.928 -26.968 1.00 160.84 ? 271  DG  J C4    1 
ATOM   5545  P P     . DA  B 1 126 ? 26.851  40.466 -26.906 1.00 198.09 ? 272  DA  J P     1 
ATOM   5546  O OP1   . DA  B 1 126 ? 25.419  40.316 -26.542 1.00 197.65 ? 272  DA  J OP1   1 
ATOM   5547  O OP2   . DA  B 1 126 ? 27.450  39.550 -27.913 1.00 197.39 ? 272  DA  J OP2   1 
ATOM   5548  O "O5'" . DA  B 1 126 ? 27.060  41.969 -27.393 1.00 198.81 ? 272  DA  J "O5'" 1 
ATOM   5549  C "C5'" . DA  B 1 126 ? 26.436  43.045 -26.695 1.00 199.85 ? 272  DA  J "C5'" 1 
ATOM   5550  C "C4'" . DA  B 1 126 ? 25.813  44.010 -27.674 1.00 200.48 ? 272  DA  J "C4'" 1 
ATOM   5551  O "O4'" . DA  B 1 126 ? 26.823  44.921 -28.165 1.00 200.93 ? 272  DA  J "O4'" 1 
ATOM   5552  C "C3'" . DA  B 1 126 ? 25.186  43.343 -28.894 1.00 201.04 ? 272  DA  J "C3'" 1 
ATOM   5553  O "O3'" . DA  B 1 126 ? 23.792  43.686 -29.014 1.00 201.61 ? 272  DA  J "O3'" 1 
ATOM   5554  C "C2'" . DA  B 1 126 ? 26.140  43.633 -30.044 1.00 201.24 ? 272  DA  J "C2'" 1 
ATOM   5555  C "C1'" . DA  B 1 126 ? 26.999  44.810 -29.571 1.00 201.54 ? 272  DA  J "C1'" 1 
ATOM   5556  N N9    . DA  B 1 126 ? 28.440  44.655 -29.826 1.00 202.03 ? 272  DA  J N9    1 
ATOM   5557  C C8    . DA  B 1 126 ? 29.147  43.475 -29.865 1.00 202.18 ? 272  DA  J C8    1 
ATOM   5558  N N7    . DA  B 1 126 ? 30.426  43.628 -30.119 1.00 202.22 ? 272  DA  J N7    1 
ATOM   5559  C C5    . DA  B 1 126 ? 30.579  45.001 -30.259 1.00 202.22 ? 272  DA  J C5    1 
ATOM   5560  C C6    . DA  B 1 126 ? 31.703  45.806 -30.543 1.00 202.22 ? 272  DA  J C6    1 
ATOM   5561  N N6    . DA  B 1 126 ? 32.932  45.323 -30.751 1.00 202.12 ? 272  DA  J N6    1 
ATOM   5562  N N1    . DA  B 1 126 ? 31.518  47.142 -30.610 1.00 202.12 ? 272  DA  J N1    1 
ATOM   5563  C C2    . DA  B 1 126 ? 30.288  47.628 -30.408 1.00 202.22 ? 272  DA  J C2    1 
ATOM   5564  N N3    . DA  B 1 126 ? 29.152  46.978 -30.140 1.00 202.22 ? 272  DA  J N3    1 
ATOM   5565  C C4    . DA  B 1 126 ? 29.366  45.650 -30.077 1.00 202.22 ? 272  DA  J C4    1 
ATOM   5566  P P     . DA  B 1 127 ? 23.297  44.922 -29.916 1.00 195.81 ? 273  DA  J P     1 
ATOM   5567  O OP1   . DA  B 1 127 ? 22.354  45.678 -29.051 1.00 200.65 ? 273  DA  J OP1   1 
ATOM   5568  O OP2   . DA  B 1 127 ? 22.829  44.386 -31.217 1.00 200.69 ? 273  DA  J OP2   1 
ATOM   5569  O "O5'" . DA  B 1 127 ? 24.567  45.847 -30.169 1.00 195.77 ? 273  DA  J "O5'" 1 
ATOM   5570  C "C5'" . DA  B 1 127 ? 24.521  47.243 -29.867 1.00 195.88 ? 273  DA  J "C5'" 1 
ATOM   5571  C "C4'" . DA  B 1 127 ? 25.012  48.067 -31.038 1.00 195.86 ? 273  DA  J "C4'" 1 
ATOM   5572  O "O4'" . DA  B 1 127 ? 26.389  47.749 -31.354 1.00 196.59 ? 273  DA  J "O4'" 1 
ATOM   5573  C "C3'" . DA  B 1 127 ? 24.249  47.936 -32.359 1.00 195.49 ? 273  DA  J "C3'" 1 
ATOM   5574  O "O3'" . DA  B 1 127 ? 24.332  49.208 -33.010 1.00 193.47 ? 273  DA  J "O3'" 1 
ATOM   5575  C "C2'" . DA  B 1 127 ? 25.115  46.965 -33.141 1.00 196.25 ? 273  DA  J "C2'" 1 
ATOM   5576  C "C1'" . DA  B 1 127 ? 26.485  47.480 -32.746 1.00 196.92 ? 273  DA  J "C1'" 1 
ATOM   5577  N N9    . DA  B 1 127 ? 27.629  46.593 -32.968 1.00 202.22 ? 273  DA  J N9    1 
ATOM   5578  C C8    . DA  B 1 127 ? 27.699  45.223 -32.886 1.00 202.22 ? 273  DA  J C8    1 
ATOM   5579  N N7    . DA  B 1 127 ? 28.901  44.743 -33.109 1.00 202.22 ? 273  DA  J N7    1 
ATOM   5580  C C5    . DA  B 1 127 ? 29.670  45.871 -33.364 1.00 201.92 ? 273  DA  J C5    1 
ATOM   5581  C C6    . DA  B 1 127 ? 31.035  46.043 -33.657 1.00 201.62 ? 273  DA  J C6    1 
ATOM   5582  N N6    . DA  B 1 127 ? 31.908  45.038 -33.730 1.00 201.39 ? 273  DA  J N6    1 
ATOM   5583  N N1    . DA  B 1 127 ? 31.480  47.301 -33.864 1.00 201.42 ? 273  DA  J N1    1 
ATOM   5584  C C2    . DA  B 1 127 ? 30.609  48.311 -33.772 1.00 201.43 ? 273  DA  J C2    1 
ATOM   5585  N N3    . DA  B 1 127 ? 29.309  48.279 -33.492 1.00 201.76 ? 273  DA  J N3    1 
ATOM   5586  C C4    . DA  B 1 127 ? 28.897  47.014 -33.295 1.00 201.99 ? 273  DA  J C4    1 
ATOM   5587  P P     . DT  B 1 128 ? 23.096  49.775 -33.864 1.00 170.46 ? 274  DT  J P     1 
ATOM   5588  O OP1   . DT  B 1 128 ? 22.137  50.372 -32.905 1.00 143.23 ? 274  DT  J OP1   1 
ATOM   5589  O OP2   . DT  B 1 128 ? 22.630  48.744 -34.827 1.00 143.04 ? 274  DT  J OP2   1 
ATOM   5590  O "O5'" . DT  B 1 128 ? 23.769  50.975 -34.666 1.00 168.95 ? 274  DT  J "O5'" 1 
ATOM   5591  C "C5'" . DT  B 1 128 ? 24.470  52.005 -33.961 1.00 165.96 ? 274  DT  J "C5'" 1 
ATOM   5592  C "C4'" . DT  B 1 128 ? 25.607  52.553 -34.796 1.00 163.86 ? 274  DT  J "C4'" 1 
ATOM   5593  O "O4'" . DT  B 1 128 ? 26.740  51.643 -34.818 1.00 163.66 ? 274  DT  J "O4'" 1 
ATOM   5594  C "C3'" . DT  B 1 128 ? 25.261  52.842 -36.258 1.00 162.22 ? 274  DT  J "C3'" 1 
ATOM   5595  O "O3'" . DT  B 1 128 ? 25.829  54.092 -36.653 1.00 159.21 ? 274  DT  J "O3'" 1 
ATOM   5596  C "C2'" . DT  B 1 128 ? 25.937  51.709 -37.006 1.00 162.66 ? 274  DT  J "C2'" 1 
ATOM   5597  C "C1'" . DT  B 1 128 ? 27.178  51.492 -36.161 1.00 163.26 ? 274  DT  J "C1'" 1 
ATOM   5598  N N1    . DT  B 1 128 ? 27.808  50.158 -36.315 1.00 136.49 ? 274  DT  J N1    1 
ATOM   5599  C C2    . DT  B 1 128 ? 29.158  50.102 -36.636 1.00 136.60 ? 274  DT  J C2    1 
ATOM   5600  O O2    . DT  B 1 128 ? 29.863  51.095 -36.784 1.00 136.53 ? 274  DT  J O2    1 
ATOM   5601  N N3    . DT  B 1 128 ? 29.653  48.831 -36.786 1.00 136.27 ? 274  DT  J N3    1 
ATOM   5602  C C4    . DT  B 1 128 ? 28.961  47.642 -36.657 1.00 135.98 ? 274  DT  J C4    1 
ATOM   5603  O O4    . DT  B 1 128 ? 29.542  46.575 -36.831 1.00 135.92 ? 274  DT  J O4    1 
ATOM   5604  C C5    . DT  B 1 128 ? 27.566  47.771 -36.317 1.00 135.80 ? 274  DT  J C5    1 
ATOM   5605  C C7    . DT  B 1 128 ? 26.747  46.530 -36.158 1.00 135.36 ? 274  DT  J C7    1 
ATOM   5606  C C6    . DT  B 1 128 ? 27.065  49.004 -36.159 1.00 136.03 ? 274  DT  J C6    1 
ATOM   5607  P P     . DC  B 1 129 ? 25.732  54.565 -38.187 1.00 153.66 ? 275  DC  J P     1 
ATOM   5608  O OP1   . DC  B 1 129 ? 25.338  55.995 -38.180 1.00 118.92 ? 275  DC  J OP1   1 
ATOM   5609  O OP2   . DC  B 1 129 ? 24.910  53.584 -38.939 1.00 118.59 ? 275  DC  J OP2   1 
ATOM   5610  O "O5'" . DC  B 1 129 ? 27.244  54.471 -38.698 1.00 150.65 ? 275  DC  J "O5'" 1 
ATOM   5611  C "C5'" . DC  B 1 129 ? 28.322  55.001 -37.909 1.00 144.36 ? 275  DC  J "C5'" 1 
ATOM   5612  C "C4'" . DC  B 1 129 ? 29.661  54.721 -38.560 1.00 139.42 ? 275  DC  J "C4'" 1 
ATOM   5613  O "O4'" . DC  B 1 129 ? 29.960  53.303 -38.523 1.00 137.87 ? 275  DC  J "O4'" 1 
ATOM   5614  C "C3'" . DC  B 1 129 ? 29.786  55.144 -40.024 1.00 135.86 ? 275  DC  J "C3'" 1 
ATOM   5615  O "O3'" . DC  B 1 129 ? 31.085  55.696 -40.261 1.00 130.02 ? 275  DC  J "O3'" 1 
ATOM   5616  C "C2'" . DC  B 1 129 ? 29.623  53.839 -40.779 1.00 135.64 ? 275  DC  J "C2'" 1 
ATOM   5617  C "C1'" . DC  B 1 129 ? 30.268  52.846 -39.829 1.00 136.52 ? 275  DC  J "C1'" 1 
ATOM   5618  N N1    . DC  B 1 129 ? 29.778  51.466 -39.957 1.00 101.08 ? 275  DC  J N1    1 
ATOM   5619  C C2    . DC  B 1 129 ? 30.696  50.449 -40.249 1.00 101.01 ? 275  DC  J C2    1 
ATOM   5620  O O2    . DC  B 1 129 ? 31.891  50.738 -40.369 1.00 100.79 ? 275  DC  J O2    1 
ATOM   5621  N N3    . DC  B 1 129 ? 30.261  49.176 -40.388 1.00 100.71 ? 275  DC  J N3    1 
ATOM   5622  C C4    . DC  B 1 129 ? 28.969  48.896 -40.227 1.00 101.13 ? 275  DC  J C4    1 
ATOM   5623  N N4    . DC  B 1 129 ? 28.590  47.622 -40.349 1.00 101.23 ? 275  DC  J N4    1 
ATOM   5624  C C5    . DC  B 1 129 ? 28.010  49.911 -39.927 1.00 100.95 ? 275  DC  J C5    1 
ATOM   5625  C C6    . DC  B 1 129 ? 28.455  51.171 -39.802 1.00 100.92 ? 275  DC  J C6    1 
ATOM   5626  P P     . DT  B 1 130 ? 31.349  56.583 -41.580 1.00 99.85  ? 276  DT  J P     1 
ATOM   5627  O OP1   . DT  B 1 130 ? 32.261  57.709 -41.227 1.00 79.95  ? 276  DT  J OP1   1 
ATOM   5628  O OP2   . DT  B 1 130 ? 30.037  56.866 -42.214 1.00 80.57  ? 276  DT  J OP2   1 
ATOM   5629  O "O5'" . DT  B 1 130 ? 32.142  55.604 -42.558 1.00 94.82  ? 276  DT  J "O5'" 1 
ATOM   5630  C "C5'" . DT  B 1 130 ? 33.493  55.227 -42.292 1.00 84.41  ? 276  DT  J "C5'" 1 
ATOM   5631  C "C4'" . DT  B 1 130 ? 33.958  54.210 -43.307 1.00 77.70  ? 276  DT  J "C4'" 1 
ATOM   5632  O "O4'" . DT  B 1 130 ? 33.231  52.970 -43.140 1.00 76.08  ? 276  DT  J "O4'" 1 
ATOM   5633  C "C3'" . DT  B 1 130 ? 33.764  54.608 -44.770 1.00 73.70  ? 276  DT  J "C3'" 1 
ATOM   5634  O "O3'" . DT  B 1 130 ? 34.917  54.202 -45.514 1.00 67.58  ? 276  DT  J "O3'" 1 
ATOM   5635  C "C2'" . DT  B 1 130 ? 32.562  53.778 -45.197 1.00 73.58  ? 276  DT  J "C2'" 1 
ATOM   5636  C "C1'" . DT  B 1 130 ? 32.778  52.520 -44.398 1.00 76.62  ? 276  DT  J "C1'" 1 
ATOM   5637  N N1    . DT  B 1 130 ? 31.597  51.685 -44.176 1.00 59.72  ? 276  DT  J N1    1 
ATOM   5638  C C2    . DT  B 1 130 ? 31.686  50.321 -44.421 1.00 61.95  ? 276  DT  J C2    1 
ATOM   5639  O O2    . DT  B 1 130 ? 32.703  49.772 -44.790 1.00 61.47  ? 276  DT  J O2    1 
ATOM   5640  N N3    . DT  B 1 130 ? 30.527  49.616 -44.203 1.00 63.58  ? 276  DT  J N3    1 
ATOM   5641  C C4    . DT  B 1 130 ? 29.314  50.114 -43.758 1.00 65.57  ? 276  DT  J C4    1 
ATOM   5642  O O4    . DT  B 1 130 ? 28.357  49.353 -43.604 1.00 67.63  ? 276  DT  J O4    1 
ATOM   5643  C C5    . DT  B 1 130 ? 29.295  51.549 -43.504 1.00 65.46  ? 276  DT  J C5    1 
ATOM   5644  C C7    . DT  B 1 130 ? 28.036  52.181 -43.005 1.00 65.53  ? 276  DT  J C7    1 
ATOM   5645  C C6    . DT  B 1 130 ? 30.424  52.250 -43.729 1.00 63.23  ? 276  DT  J C6    1 
ATOM   5646  P P     . DG  B 1 131 ? 35.866  55.306 -46.191 1.00 67.79  ? 277  DG  J P     1 
ATOM   5647  O OP1   . DG  B 1 131 ? 36.470  56.094 -45.088 1.00 53.33  ? 277  DG  J OP1   1 
ATOM   5648  O OP2   . DG  B 1 131 ? 35.129  56.001 -47.279 1.00 52.73  ? 277  DG  J OP2   1 
ATOM   5649  O "O5'" . DG  B 1 131 ? 36.999  54.441 -46.891 1.00 66.49  ? 277  DG  J "O5'" 1 
ATOM   5650  C "C5'" . DG  B 1 131 ? 37.844  53.579 -46.137 1.00 59.02  ? 277  DG  J "C5'" 1 
ATOM   5651  C "C4'" . DG  B 1 131 ? 38.069  52.293 -46.894 1.00 55.96  ? 277  DG  J "C4'" 1 
ATOM   5652  O "O4'" . DG  B 1 131 ? 36.855  51.528 -46.829 1.00 57.89  ? 277  DG  J "O4'" 1 
ATOM   5653  C "C3'" . DG  B 1 131 ? 38.395  52.466 -48.385 1.00 54.11  ? 277  DG  J "C3'" 1 
ATOM   5654  O "O3'" . DG  B 1 131 ? 39.344  51.479 -48.789 1.00 48.35  ? 277  DG  J "O3'" 1 
ATOM   5655  C "C2'" . DG  B 1 131 ? 37.059  52.263 -49.074 1.00 54.79  ? 277  DG  J "C2'" 1 
ATOM   5656  C "C1'" . DG  B 1 131 ? 36.358  51.292 -48.141 1.00 59.35  ? 277  DG  J "C1'" 1 
ATOM   5657  N N9    . DG  B 1 131 ? 34.905  51.420 -48.093 1.00 50.30  ? 277  DG  J N9    1 
ATOM   5658  C C8    . DG  B 1 131 ? 34.153  52.570 -48.026 1.00 51.91  ? 277  DG  J C8    1 
ATOM   5659  N N7    . DG  B 1 131 ? 32.872  52.337 -47.966 1.00 53.68  ? 277  DG  J N7    1 
ATOM   5660  C C5    . DG  B 1 131 ? 32.775  50.954 -47.997 1.00 55.75  ? 277  DG  J C5    1 
ATOM   5661  C C6    . DG  B 1 131 ? 31.644  50.108 -47.923 1.00 59.04  ? 277  DG  J C6    1 
ATOM   5662  O O6    . DG  B 1 131 ? 30.437  50.419 -47.815 1.00 61.90  ? 277  DG  J O6    1 
ATOM   5663  N N1    . DG  B 1 131 ? 32.017  48.764 -47.975 1.00 58.64  ? 277  DG  J N1    1 
ATOM   5664  C C2    . DG  B 1 131 ? 33.300  48.300 -48.078 1.00 58.19  ? 277  DG  J C2    1 
ATOM   5665  N N2    . DG  B 1 131 ? 33.456  46.971 -48.101 1.00 57.23  ? 277  DG  J N2    1 
ATOM   5666  N N3    . DG  B 1 131 ? 34.350  49.074 -48.145 1.00 55.97  ? 277  DG  J N3    1 
ATOM   5667  C C4    . DG  B 1 131 ? 34.021  50.378 -48.091 1.00 53.43  ? 277  DG  J C4    1 
ATOM   5668  P P     . DC  B 1 132 ? 40.159  51.648 -50.161 1.00 43.58  ? 278  DC  J P     1 
ATOM   5669  O OP1   . DC  B 1 132 ? 41.582  51.542 -49.785 1.00 44.81  ? 278  DC  J OP1   1 
ATOM   5670  O OP2   . DC  B 1 132 ? 39.701  52.824 -50.929 1.00 46.96  ? 278  DC  J OP2   1 
ATOM   5671  O "O5'" . DC  B 1 132 ? 39.736  50.324 -50.932 1.00 44.05  ? 278  DC  J "O5'" 1 
ATOM   5672  C "C5'" . DC  B 1 132 ? 39.393  49.155 -50.179 1.00 44.53  ? 278  DC  J "C5'" 1 
ATOM   5673  C "C4'" . DC  B 1 132 ? 38.472  48.238 -50.955 1.00 50.31  ? 278  DC  J "C4'" 1 
ATOM   5674  O "O4'" . DC  B 1 132 ? 37.082  48.477 -50.706 1.00 48.37  ? 278  DC  J "O4'" 1 
ATOM   5675  C "C3'" . DC  B 1 132 ? 38.609  48.192 -52.470 1.00 50.98  ? 278  DC  J "C3'" 1 
ATOM   5676  O "O3'" . DC  B 1 132 ? 38.303  46.863 -52.848 1.00 54.12  ? 278  DC  J "O3'" 1 
ATOM   5677  C "C2'" . DC  B 1 132 ? 37.477  49.081 -52.940 1.00 51.86  ? 278  DC  J "C2'" 1 
ATOM   5678  C "C1'" . DC  B 1 132 ? 36.407  48.665 -51.955 1.00 52.02  ? 278  DC  J "C1'" 1 
ATOM   5679  N N1    . DC  B 1 132 ? 35.342  49.652 -51.736 1.00 55.73  ? 278  DC  J N1    1 
ATOM   5680  C C2    . DC  B 1 132 ? 34.038  49.190 -51.442 1.00 57.03  ? 278  DC  J C2    1 
ATOM   5681  O O2    . DC  B 1 132 ? 33.826  47.964 -51.394 1.00 55.43  ? 278  DC  J O2    1 
ATOM   5682  N N3    . DC  B 1 132 ? 33.064  50.083 -51.214 1.00 59.64  ? 278  DC  J N3    1 
ATOM   5683  C C4    . DC  B 1 132 ? 33.334  51.387 -51.263 1.00 60.12  ? 278  DC  J C4    1 
ATOM   5684  N N4    . DC  B 1 132 ? 32.334  52.241 -51.025 1.00 63.38  ? 278  DC  J N4    1 
ATOM   5685  C C5    . DC  B 1 132 ? 34.648  51.884 -51.559 1.00 59.55  ? 278  DC  J C5    1 
ATOM   5686  C C6    . DC  B 1 132 ? 35.607  50.991 -51.790 1.00 56.35  ? 278  DC  J C6    1 
ATOM   5687  P P     . DA  B 1 133 ? 39.459  45.918 -53.390 1.00 68.77  ? 279  DA  J P     1 
ATOM   5688  O OP1   . DA  B 1 133 ? 40.437  45.877 -52.285 1.00 50.95  ? 279  DA  J OP1   1 
ATOM   5689  O OP2   . DA  B 1 133 ? 39.874  46.375 -54.743 1.00 43.50  ? 279  DA  J OP2   1 
ATOM   5690  O "O5'" . DA  B 1 133 ? 38.744  44.504 -53.493 1.00 72.98  ? 279  DA  J "O5'" 1 
ATOM   5691  C "C5'" . DA  B 1 133 ? 38.258  43.852 -52.335 1.00 76.02  ? 279  DA  J "C5'" 1 
ATOM   5692  C "C4'" . DA  B 1 133 ? 37.020  43.063 -52.684 1.00 80.38  ? 279  DA  J "C4'" 1 
ATOM   5693  O "O4'" . DA  B 1 133 ? 35.883  43.940 -52.770 1.00 79.85  ? 279  DA  J "O4'" 1 
ATOM   5694  C "C3'" . DA  B 1 133 ? 37.112  42.369 -54.037 1.00 81.37  ? 279  DA  J "C3'" 1 
ATOM   5695  O "O3'" . DA  B 1 133 ? 36.365  41.149 -54.005 1.00 88.39  ? 279  DA  J "O3'" 1 
ATOM   5696  C "C2'" . DA  B 1 133 ? 36.485  43.378 -54.976 1.00 79.83  ? 279  DA  J "C2'" 1 
ATOM   5697  C "C1'" . DA  B 1 133 ? 35.417  44.025 -54.106 1.00 78.84  ? 279  DA  J "C1'" 1 
ATOM   5698  N N9    . DA  B 1 133 ? 35.217  45.441 -54.391 1.00 56.09  ? 279  DA  J N9    1 
ATOM   5699  C C8    . DA  B 1 133 ? 36.201  46.381 -54.532 1.00 53.55  ? 279  DA  J C8    1 
ATOM   5700  N N7    . DA  B 1 133 ? 35.755  47.592 -54.715 1.00 52.83  ? 279  DA  J N7    1 
ATOM   5701  C C5    . DA  B 1 133 ? 34.381  47.442 -54.715 1.00 56.18  ? 279  DA  J C5    1 
ATOM   5702  C C6    . DA  B 1 133 ? 33.351  48.360 -54.865 1.00 56.37  ? 279  DA  J C6    1 
ATOM   5703  N N6    . DA  B 1 133 ? 33.556  49.666 -55.022 1.00 56.20  ? 279  DA  J N6    1 
ATOM   5704  N N1    . DA  B 1 133 ? 32.092  47.896 -54.846 1.00 57.91  ? 279  DA  J N1    1 
ATOM   5705  C C2    . DA  B 1 133 ? 31.898  46.583 -54.680 1.00 55.82  ? 279  DA  J C2    1 
ATOM   5706  N N3    . DA  B 1 133 ? 32.789  45.613 -54.515 1.00 57.68  ? 279  DA  J N3    1 
ATOM   5707  C C4    . DA  B 1 133 ? 34.032  46.118 -54.539 1.00 56.19  ? 279  DA  J C4    1 
ATOM   5708  P P     . DG  B 1 134 ? 36.540  40.089 -55.188 1.00 113.73 ? 280  DG  J P     1 
ATOM   5709  O OP1   . DG  B 1 134 ? 36.423  38.743 -54.581 1.00 96.12  ? 280  DG  J OP1   1 
ATOM   5710  O OP2   . DG  B 1 134 ? 37.748  40.450 -55.959 1.00 94.02  ? 280  DG  J OP2   1 
ATOM   5711  O "O5'" . DG  B 1 134 ? 35.268  40.357 -56.095 1.00 115.27 ? 280  DG  J "O5'" 1 
ATOM   5712  C "C5'" . DG  B 1 134 ? 33.970  40.405 -55.519 1.00 118.60 ? 280  DG  J "C5'" 1 
ATOM   5713  C "C4'" . DG  B 1 134 ? 33.007  41.015 -56.504 1.00 120.40 ? 280  DG  J "C4'" 1 
ATOM   5714  O "O4'" . DG  B 1 134 ? 33.161  42.455 -56.549 1.00 120.26 ? 280  DG  J "O4'" 1 
ATOM   5715  C "C3'" . DG  B 1 134 ? 33.240  40.528 -57.936 1.00 122.18 ? 280  DG  J "C3'" 1 
ATOM   5716  O "O3'" . DG  B 1 134 ? 31.985  40.505 -58.614 1.00 124.73 ? 280  DG  J "O3'" 1 
ATOM   5717  C "C2'" . DG  B 1 134 ? 34.079  41.642 -58.533 1.00 120.94 ? 280  DG  J "C2'" 1 
ATOM   5718  C "C1'" . DG  B 1 134 ? 33.380  42.829 -57.904 1.00 119.70 ? 280  DG  J "C1'" 1 
ATOM   5719  N N9    . DG  B 1 134 ? 34.095  44.100 -57.938 1.00 99.60  ? 280  DG  J N9    1 
ATOM   5720  C C8    . DG  B 1 134 ? 35.454  44.300 -57.975 1.00 98.28  ? 280  DG  J C8    1 
ATOM   5721  N N7    . DG  B 1 134 ? 35.784  45.559 -58.017 1.00 95.86  ? 280  DG  J N7    1 
ATOM   5722  C C5    . DG  B 1 134 ? 34.572  46.232 -58.007 1.00 96.65  ? 280  DG  J C5    1 
ATOM   5723  C C6    . DG  B 1 134 ? 34.296  47.617 -58.041 1.00 96.90  ? 280  DG  J C6    1 
ATOM   5724  O O6    . DG  B 1 134 ? 35.097  48.558 -58.108 1.00 93.84  ? 280  DG  J O6    1 
ATOM   5725  N N1    . DG  B 1 134 ? 32.926  47.864 -57.998 1.00 97.90  ? 280  DG  J N1    1 
ATOM   5726  C C2    . DG  B 1 134 ? 31.948  46.893 -57.946 1.00 98.24  ? 280  DG  J C2    1 
ATOM   5727  N N2    . DG  B 1 134 ? 30.680  47.317 -57.920 1.00 98.78  ? 280  DG  J N2    1 
ATOM   5728  N N3    . DG  B 1 134 ? 32.196  45.599 -57.923 1.00 98.54  ? 280  DG  J N3    1 
ATOM   5729  C C4    . DG  B 1 134 ? 33.520  45.343 -57.953 1.00 98.07  ? 280  DG  J C4    1 
ATOM   5730  P P     . DG  B 1 135 ? 31.600  39.268 -59.555 1.00 142.08 ? 281  DG  J P     1 
ATOM   5731  O OP1   . DG  B 1 135 ? 31.063  38.232 -58.631 1.00 83.56  ? 281  DG  J OP1   1 
ATOM   5732  O OP2   . DG  B 1 135 ? 32.745  38.944 -60.456 1.00 81.52  ? 281  DG  J OP2   1 
ATOM   5733  O "O5'" . DG  B 1 135 ? 30.404  39.865 -60.423 1.00 145.31 ? 281  DG  J "O5'" 1 
ATOM   5734  C "C5'" . DG  B 1 135 ? 29.299  40.519 -59.796 1.00 149.93 ? 281  DG  J "C5'" 1 
ATOM   5735  C "C4'" . DG  B 1 135 ? 28.722  41.567 -60.719 1.00 153.99 ? 281  DG  J "C4'" 1 
ATOM   5736  O "O4'" . DG  B 1 135 ? 29.307  42.872 -60.471 1.00 153.79 ? 281  DG  J "O4'" 1 
ATOM   5737  C "C3'" . DG  B 1 135 ? 28.936  41.272 -62.204 1.00 157.06 ? 281  DG  J "C3'" 1 
ATOM   5738  O "O3'" . DG  B 1 135 ? 27.719  41.430 -62.935 1.00 162.46 ? 281  DG  J "O3'" 1 
ATOM   5739  C "C2'" . DG  B 1 135 ? 29.967  42.304 -62.633 1.00 155.89 ? 281  DG  J "C2'" 1 
ATOM   5740  C "C1'" . DG  B 1 135 ? 29.687  43.472 -61.702 1.00 154.01 ? 281  DG  J "C1'" 1 
ATOM   5741  N N9    . DG  B 1 135 ? 30.855  44.326 -61.465 1.00 92.50  ? 281  DG  J N9    1 
ATOM   5742  C C8    . DG  B 1 135 ? 32.141  43.899 -61.245 1.00 91.97  ? 281  DG  J C8    1 
ATOM   5743  N N7    . DG  B 1 135 ? 32.998  44.877 -61.110 1.00 91.71  ? 281  DG  J N7    1 
ATOM   5744  C C5    . DG  B 1 135 ? 32.237  46.028 -61.242 1.00 91.33  ? 281  DG  J C5    1 
ATOM   5745  C C6    . DG  B 1 135 ? 32.627  47.392 -61.198 1.00 90.57  ? 281  DG  J C6    1 
ATOM   5746  O O6    . DG  B 1 135 ? 33.760  47.865 -61.057 1.00 89.55  ? 281  DG  J O6    1 
ATOM   5747  N N1    . DG  B 1 135 ? 31.538  48.242 -61.348 1.00 91.23  ? 281  DG  J N1    1 
ATOM   5748  C C2    . DG  B 1 135 ? 30.241  47.840 -61.526 1.00 91.50  ? 281  DG  J C2    1 
ATOM   5749  N N2    . DG  B 1 135 ? 29.340  48.831 -61.621 1.00 92.34  ? 281  DG  J N2    1 
ATOM   5750  N N3    . DG  B 1 135 ? 29.857  46.565 -61.597 1.00 91.64  ? 281  DG  J N3    1 
ATOM   5751  C C4    . DG  B 1 135 ? 30.904  45.715 -61.444 1.00 92.15  ? 281  DG  J C4    1 
ATOM   5752  P P     . DT  B 1 136 ? 27.775  41.658 -64.523 1.00 158.55 ? 282  DT  J P     1 
ATOM   5753  O OP1   . DT  B 1 136 ? 26.455  41.279 -65.097 1.00 94.64  ? 282  DT  J OP1   1 
ATOM   5754  O OP2   . DT  B 1 136 ? 29.018  41.005 -65.035 1.00 94.35  ? 282  DT  J OP2   1 
ATOM   5755  O "O5'" . DT  B 1 136 ? 27.938  43.238 -64.631 1.00 159.36 ? 282  DT  J "O5'" 1 
ATOM   5756  C "C5'" . DT  B 1 136 ? 26.980  44.103 -64.026 1.00 161.74 ? 282  DT  J "C5'" 1 
ATOM   5757  C "C4'" . DT  B 1 136 ? 26.737  45.294 -64.917 1.00 163.42 ? 282  DT  J "C4'" 1 
ATOM   5758  O "O4'" . DT  B 1 136 ? 27.690  46.342 -64.620 1.00 162.72 ? 282  DT  J "O4'" 1 
ATOM   5759  C "C3'" . DT  B 1 136 ? 26.914  44.954 -66.393 1.00 165.28 ? 282  DT  J "C3'" 1 
ATOM   5760  O "O3'" . DT  B 1 136 ? 25.902  45.566 -67.183 1.00 169.13 ? 282  DT  J "O3'" 1 
ATOM   5761  C "C2'" . DT  B 1 136 ? 28.287  45.506 -66.730 1.00 163.78 ? 282  DT  J "C2'" 1 
ATOM   5762  C "C1'" . DT  B 1 136 ? 28.432  46.683 -65.779 1.00 161.71 ? 282  DT  J "C1'" 1 
ATOM   5763  N N1    . DT  B 1 136 ? 29.824  46.933 -65.358 1.00 95.57  ? 282  DT  J N1    1 
ATOM   5764  C C2    . DT  B 1 136 ? 30.261  48.228 -65.249 1.00 94.46  ? 282  DT  J C2    1 
ATOM   5765  O O2    . DT  B 1 136 ? 29.562  49.185 -65.494 1.00 94.54  ? 282  DT  J O2    1 
ATOM   5766  N N3    . DT  B 1 136 ? 31.562  48.358 -64.843 1.00 93.80  ? 282  DT  J N3    1 
ATOM   5767  C C4    . DT  B 1 136 ? 32.452  47.339 -64.549 1.00 93.41  ? 282  DT  J C4    1 
ATOM   5768  O O4    . DT  B 1 136 ? 33.592  47.596 -64.192 1.00 92.69  ? 282  DT  J O4    1 
ATOM   5769  C C5    . DT  B 1 136 ? 31.936  46.017 -64.693 1.00 93.81  ? 282  DT  J C5    1 
ATOM   5770  C C7    . DT  B 1 136 ? 32.837  44.860 -64.410 1.00 93.35  ? 282  DT  J C7    1 
ATOM   5771  C C6    . DT  B 1 136 ? 30.661  45.877 -65.081 1.00 94.62  ? 282  DT  J C6    1 
ATOM   5772  P P     . DG  B 1 137 ? 25.981  45.462 -68.780 1.00 164.21 ? 283  DG  J P     1 
ATOM   5773  O OP1   . DG  B 1 137 ? 24.590  45.380 -69.296 1.00 144.08 ? 283  DG  J OP1   1 
ATOM   5774  O OP2   . DG  B 1 137 ? 26.953  44.393 -69.129 1.00 143.64 ? 283  DG  J OP2   1 
ATOM   5775  O "O5'" . DG  B 1 137 ? 26.612  46.866 -69.189 1.00 164.49 ? 283  DG  J "O5'" 1 
ATOM   5776  C "C5'" . DG  B 1 137 ? 26.125  48.080 -68.618 1.00 165.67 ? 283  DG  J "C5'" 1 
ATOM   5777  C "C4'" . DG  B 1 137 ? 26.908  49.249 -69.164 1.00 166.35 ? 283  DG  J "C4'" 1 
ATOM   5778  O "O4'" . DG  B 1 137 ? 28.228  49.267 -68.566 1.00 166.24 ? 283  DG  J "O4'" 1 
ATOM   5779  C "C3'" . DG  B 1 137 ? 27.125  49.153 -70.673 1.00 166.99 ? 283  DG  J "C3'" 1 
ATOM   5780  O "O3'" . DG  B 1 137 ? 27.039  50.441 -71.282 1.00 168.24 ? 283  DG  J "O3'" 1 
ATOM   5781  C "C2'" . DG  B 1 137 ? 28.532  48.600 -70.792 1.00 166.67 ? 283  DG  J "C2'" 1 
ATOM   5782  C "C1'" . DG  B 1 137 ? 29.226  49.188 -69.573 1.00 165.65 ? 283  DG  J "C1'" 1 
ATOM   5783  N N9    . DG  B 1 137 ? 30.319  48.361 -69.064 1.00 143.59 ? 283  DG  J N9    1 
ATOM   5784  C C8    . DG  B 1 137 ? 30.322  46.991 -68.941 1.00 142.92 ? 283  DG  J C8    1 
ATOM   5785  N N7    . DG  B 1 137 ? 31.447  46.518 -68.475 1.00 142.33 ? 283  DG  J N7    1 
ATOM   5786  C C5    . DG  B 1 137 ? 32.237  47.641 -68.270 1.00 141.85 ? 283  DG  J C5    1 
ATOM   5787  C C6    . DG  B 1 137 ? 33.569  47.750 -67.782 1.00 141.33 ? 283  DG  J C6    1 
ATOM   5788  O O6    . DG  B 1 137 ? 34.331  46.846 -67.418 1.00 141.15 ? 283  DG  J O6    1 
ATOM   5789  N N1    . DG  B 1 137 ? 33.995  49.077 -67.744 1.00 140.35 ? 283  DG  J N1    1 
ATOM   5790  C C2    . DG  B 1 137 ? 33.241  50.162 -68.127 1.00 140.25 ? 283  DG  J C2    1 
ATOM   5791  N N2    . DG  B 1 137 ? 33.845  51.362 -68.030 1.00 139.02 ? 283  DG  J N2    1 
ATOM   5792  N N3    . DG  B 1 137 ? 31.991  50.075 -68.577 1.00 140.88 ? 283  DG  J N3    1 
ATOM   5793  C C4    . DG  B 1 137 ? 31.557  48.792 -68.625 1.00 142.11 ? 283  DG  J C4    1 
ATOM   5794  P P     . DG  B 1 138 ? 26.588  50.565 -72.820 1.00 200.25 ? 284  DG  J P     1 
ATOM   5795  O OP1   . DG  B 1 138 ? 25.213  51.122 -72.872 1.00 140.82 ? 284  DG  J OP1   1 
ATOM   5796  O OP2   . DG  B 1 138 ? 26.879  49.272 -73.490 1.00 141.21 ? 284  DG  J OP2   1 
ATOM   5797  O "O5'" . DG  B 1 138 ? 27.585  51.657 -73.401 1.00 200.09 ? 284  DG  J "O5'" 1 
ATOM   5798  C "C5'" . DG  B 1 138 ? 28.015  52.745 -72.591 1.00 200.84 ? 284  DG  J "C5'" 1 
ATOM   5799  C "C4'" . DG  B 1 138 ? 29.480  53.015 -72.832 1.00 201.69 ? 284  DG  J "C4'" 1 
ATOM   5800  O "O4'" . DG  B 1 138 ? 30.291  51.970 -72.236 1.00 202.05 ? 284  DG  J "O4'" 1 
ATOM   5801  C "C3'" . DG  B 1 138 ? 29.850  53.041 -74.314 1.00 201.94 ? 284  DG  J "C3'" 1 
ATOM   5802  O "O3'" . DG  B 1 138 ? 30.820  54.058 -74.552 1.00 202.22 ? 284  DG  J "O3'" 1 
ATOM   5803  C "C2'" . DG  B 1 138 ? 30.472  51.675 -74.542 1.00 201.80 ? 284  DG  J "C2'" 1 
ATOM   5804  C "C1'" . DG  B 1 138 ? 31.180  51.456 -73.219 1.00 201.50 ? 284  DG  J "C1'" 1 
ATOM   5805  N N9    . DG  B 1 138 ? 31.514  50.070 -72.877 1.00 141.46 ? 284  DG  J N9    1 
ATOM   5806  C C8    . DG  B 1 138 ? 30.790  48.931 -73.160 1.00 141.05 ? 284  DG  J C8    1 
ATOM   5807  N N7    . DG  B 1 138 ? 31.355  47.838 -72.718 1.00 140.46 ? 284  DG  J N7    1 
ATOM   5808  C C5    . DG  B 1 138 ? 32.524  48.278 -72.107 1.00 140.59 ? 284  DG  J C5    1 
ATOM   5809  C C6    . DG  B 1 138 ? 33.544  47.549 -71.435 1.00 140.23 ? 284  DG  J C6    1 
ATOM   5810  O O6    . DG  B 1 138 ? 33.610  46.328 -71.230 1.00 140.33 ? 284  DG  J O6    1 
ATOM   5811  N N1    . DG  B 1 138 ? 34.556  48.393 -70.971 1.00 139.48 ? 284  DG  J N1    1 
ATOM   5812  C C2    . DG  B 1 138 ? 34.579  49.762 -71.120 1.00 139.29 ? 284  DG  J C2    1 
ATOM   5813  N N2    . DG  B 1 138 ? 35.637  50.402 -70.602 1.00 138.68 ? 284  DG  J N2    1 
ATOM   5814  N N3    . DG  B 1 138 ? 33.631  50.452 -71.733 1.00 139.70 ? 284  DG  J N3    1 
ATOM   5815  C C4    . DG  B 1 138 ? 32.641  49.653 -72.199 1.00 140.49 ? 284  DG  J C4    1 
ATOM   5816  P P     . DA  B 1 139 ? 30.682  54.991 -75.846 1.00 160.01 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 139 ? 29.609  55.980 -75.567 1.00 173.88 ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 139 ? 30.566  54.096 -77.026 1.00 173.60 ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 139 ? 32.075  55.760 -75.908 1.00 158.16 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 139 ? 32.395  56.761 -74.946 1.00 154.70 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 139 ? 33.885  56.794 -74.709 1.00 152.51 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 139 ? 34.285  55.582 -74.021 1.00 151.54 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 139 ? 34.717  56.849 -75.990 1.00 151.30 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 139 ? 35.856  57.693 -75.806 1.00 149.69 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 139 ? 35.149  55.408 -76.189 1.00 151.02 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 139 ? 35.301  54.918 -74.760 1.00 150.44 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 139 ? 35.116  53.472 -74.595 1.00 162.46 ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 139 ? 33.973  52.746 -74.820 1.00 161.99 ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 139 ? 34.109  51.459 -74.598 1.00 160.74 ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 139 ? 35.431  51.327 -74.197 1.00 160.06 ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 139 ? 36.198  50.208 -73.820 1.00 159.17 ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 139 ? 35.730  48.958 -73.796 1.00 158.07 ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 139 ? 37.482  50.421 -73.466 1.00 158.55 ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 139 ? 37.958  51.672 -73.501 1.00 159.14 ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 139 ? 37.342  52.800 -73.845 1.00 159.28 ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 139 ? 36.064  52.558 -74.185 1.00 160.60 ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 140 ? 37.036  57.679 -76.894 1.00 160.45 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 140 ? 37.707  59.007 -76.923 1.00 121.62 ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 140 ? 36.459  57.116 -78.145 1.00 120.96 ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 140 ? 38.087  56.654 -76.280 1.00 158.08 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 140 ? 38.666  56.897 -74.999 1.00 153.08 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 140 ? 39.984  56.169 -74.861 1.00 149.91 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 140 ? 39.768  54.742 -74.744 1.00 147.78 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 140 ? 40.969  56.352 -76.017 1.00 148.33 ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 140 ? 42.287  56.524 -75.498 1.00 146.40 ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 140 ? 40.868  55.044 -76.785 1.00 146.78 ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 140 ? 40.599  54.052 -75.670 1.00 144.99 ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 140 ? 39.895  52.814 -76.074 1.00 102.48 ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 140 ? 40.508  51.595 -75.828 1.00 100.24 ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 140 ? 41.622  51.493 -75.332 1.00 97.61  ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 140 ? 39.760  50.497 -76.189 1.00 99.11  ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 140 ? 38.500  50.501 -76.763 1.00 99.17  ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 140 ? 37.934  49.447 -77.006 1.00 97.60  ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 140 ? 37.942  51.804 -77.025 1.00 100.43 ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 140 ? 36.607  51.894 -77.686 1.00 101.02 ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 140 ? 38.652  52.882 -76.668 1.00 101.33 ? 286  DT  J C6    1 
ATOM   5857  P P     . DA  B 1 141 ? 43.546  56.347 -76.473 1.00 133.79 ? 287  DA  J P     1 
ATOM   5858  O OP1   . DA  B 1 141 ? 44.763  56.977 -75.879 1.00 86.61  ? 287  DA  J OP1   1 
ATOM   5859  O OP2   . DA  B 1 141 ? 43.111  56.725 -77.842 1.00 87.13  ? 287  DA  J OP2   1 
ATOM   5860  O "O5'" . DA  B 1 141 ? 43.772  54.778 -76.491 1.00 130.55 ? 287  DA  J "O5'" 1 
ATOM   5861  C "C5'" . DA  B 1 141 ? 44.965  54.243 -77.022 1.00 124.76 ? 287  DA  J "C5'" 1 
ATOM   5862  C "C4'" . DA  B 1 141 ? 45.440  53.090 -76.173 1.00 120.65 ? 287  DA  J "C4'" 1 
ATOM   5863  O "O4'" . DA  B 1 141 ? 44.376  52.118 -76.058 1.00 117.35 ? 287  DA  J "O4'" 1 
ATOM   5864  C "C3'" . DA  B 1 141 ? 46.589  52.372 -76.860 1.00 118.18 ? 287  DA  J "C3'" 1 
ATOM   5865  O "O3'" . DA  B 1 141 ? 47.542  51.850 -75.942 1.00 115.03 ? 287  DA  J "O3'" 1 
ATOM   5866  C "C2'" . DA  B 1 141 ? 45.904  51.281 -77.657 1.00 116.74 ? 287  DA  J "C2'" 1 
ATOM   5867  C "C1'" . DA  B 1 141 ? 44.664  50.965 -76.846 1.00 114.32 ? 287  DA  J "C1'" 1 
ATOM   5868  N N9    . DA  B 1 141 ? 43.482  50.675 -77.663 1.00 64.38  ? 287  DA  J N9    1 
ATOM   5869  C C8    . DA  B 1 141 ? 42.663  51.560 -78.324 1.00 63.63  ? 287  DA  J C8    1 
ATOM   5870  N N7    . DA  B 1 141 ? 41.618  50.998 -78.882 1.00 62.26  ? 287  DA  J N7    1 
ATOM   5871  C C5    . DA  B 1 141 ? 41.775  49.652 -78.597 1.00 62.02  ? 287  DA  J C5    1 
ATOM   5872  C C6    . DA  B 1 141 ? 41.002  48.526 -78.910 1.00 61.35  ? 287  DA  J C6    1 
ATOM   5873  N N6    . DA  B 1 141 ? 39.888  48.568 -79.629 1.00 60.38  ? 287  DA  J N6    1 
ATOM   5874  N N1    . DA  B 1 141 ? 41.429  47.328 -78.462 1.00 61.02  ? 287  DA  J N1    1 
ATOM   5875  C C2    . DA  B 1 141 ? 42.577  47.274 -77.776 1.00 61.18  ? 287  DA  J C2    1 
ATOM   5876  N N3    . DA  B 1 141 ? 43.404  48.256 -77.440 1.00 61.87  ? 287  DA  J N3    1 
ATOM   5877  C C4    . DA  B 1 141 ? 42.934  49.435 -77.873 1.00 62.94  ? 287  DA  J C4    1 
ATOM   5878  P P     . DT  B 1 142 ? 48.851  51.132 -76.524 1.00 105.97 ? 288  DT  J P     1 
ATOM   5879  O OP1   . DT  B 1 142 ? 49.913  51.030 -75.481 1.00 104.33 ? 288  DT  J OP1   1 
ATOM   5880  O OP2   . DT  B 1 142 ? 49.159  51.796 -77.818 1.00 104.00 ? 288  DT  J OP2   1 
ATOM   5881  O "O5'" . DT  B 1 142 ? 48.320  49.667 -76.847 1.00 101.24 ? 288  DT  J "O5'" 1 
ATOM   5882  C "C5'" . DT  B 1 142 ? 47.865  48.816 -75.798 1.00 93.19  ? 288  DT  J "C5'" 1 
ATOM   5883  C "C4'" . DT  B 1 142 ? 47.761  47.399 -76.300 1.00 87.90  ? 288  DT  J "C4'" 1 
ATOM   5884  O "O4'" . DT  B 1 142 ? 46.545  47.221 -77.059 1.00 86.76  ? 288  DT  J "O4'" 1 
ATOM   5885  C "C3'" . DT  B 1 142 ? 48.900  47.015 -77.234 1.00 85.52  ? 288  DT  J "C3'" 1 
ATOM   5886  O "O3'" . DT  B 1 142 ? 49.233  45.658 -76.979 1.00 80.23  ? 288  DT  J "O3'" 1 
ATOM   5887  C "C2'" . DT  B 1 142 ? 48.292  47.195 -78.613 1.00 84.64  ? 288  DT  J "C2'" 1 
ATOM   5888  C "C1'" . DT  B 1 142 ? 46.859  46.772 -78.367 1.00 85.23  ? 288  DT  J "C1'" 1 
ATOM   5889  N N1    . DT  B 1 142 ? 45.836  47.317 -79.294 1.00 83.27  ? 288  DT  J N1    1 
ATOM   5890  C C2    . DT  B 1 142 ? 44.902  46.438 -79.799 1.00 82.81  ? 288  DT  J C2    1 
ATOM   5891  O O2    . DT  B 1 142 ? 44.904  45.244 -79.556 1.00 85.61  ? 288  DT  J O2    1 
ATOM   5892  N N3    . DT  B 1 142 ? 43.959  47.009 -80.609 1.00 84.12  ? 288  DT  J N3    1 
ATOM   5893  C C4    . DT  B 1 142 ? 43.864  48.332 -80.976 1.00 83.45  ? 288  DT  J C4    1 
ATOM   5894  O O4    . DT  B 1 142 ? 42.948  48.692 -81.705 1.00 83.41  ? 288  DT  J O4    1 
ATOM   5895  C C5    . DT  B 1 142 ? 44.887  49.193 -80.440 1.00 82.47  ? 288  DT  J C5    1 
ATOM   5896  C C7    . DT  B 1 142 ? 44.879  50.640 -80.808 1.00 81.47  ? 288  DT  J C7    1 
ATOM   5897  C C6    . DT  B 1 142 ? 45.808  48.651 -79.632 1.00 82.37  ? 288  DT  J C6    1 
ATOM   5898  P P     . DT  B 1 143 ? 50.553  45.018 -77.629 1.00 67.99  ? 289  DT  J P     1 
ATOM   5899  O OP1   . DT  B 1 143 ? 51.364  44.448 -76.532 1.00 77.63  ? 289  DT  J OP1   1 
ATOM   5900  O OP2   . DT  B 1 143 ? 51.169  46.004 -78.555 1.00 71.81  ? 289  DT  J OP2   1 
ATOM   5901  O "O5'" . DT  B 1 143 ? 49.931  43.839 -78.494 1.00 64.96  ? 289  DT  J "O5'" 1 
ATOM   5902  C "C5'" . DT  B 1 143 ? 48.718  44.082 -79.199 1.00 63.36  ? 289  DT  J "C5'" 1 
ATOM   5903  C "C4'" . DT  B 1 143 ? 48.270  42.860 -79.961 1.00 57.83  ? 289  DT  J "C4'" 1 
ATOM   5904  O "O4'" . DT  B 1 143 ? 47.101  43.277 -80.692 1.00 58.76  ? 289  DT  J "O4'" 1 
ATOM   5905  C "C3'" . DT  B 1 143 ? 49.244  42.308 -81.006 1.00 56.04  ? 289  DT  J "C3'" 1 
ATOM   5906  O "O3'" . DT  B 1 143 ? 49.022  40.892 -81.129 1.00 48.33  ? 289  DT  J "O3'" 1 
ATOM   5907  C "C2'" . DT  B 1 143 ? 48.849  43.060 -82.264 1.00 54.89  ? 289  DT  J "C2'" 1 
ATOM   5908  C "C1'" . DT  B 1 143 ? 47.354  43.278 -82.082 1.00 56.70  ? 289  DT  J "C1'" 1 
ATOM   5909  N N1    . DT  B 1 143 ? 46.841  44.548 -82.602 1.00 65.18  ? 289  DT  J N1    1 
ATOM   5910  C C2    . DT  B 1 143 ? 45.675  44.511 -83.326 1.00 64.65  ? 289  DT  J C2    1 
ATOM   5911  O O2    . DT  B 1 143 ? 45.089  43.470 -83.581 1.00 60.32  ? 289  DT  J O2    1 
ATOM   5912  N N3    . DT  B 1 143 ? 45.221  45.735 -83.745 1.00 66.85  ? 289  DT  J N3    1 
ATOM   5913  C C4    . DT  B 1 143 ? 45.815  46.963 -83.528 1.00 67.09  ? 289  DT  J C4    1 
ATOM   5914  O O4    . DT  B 1 143 ? 45.277  47.980 -83.947 1.00 72.67  ? 289  DT  J O4    1 
ATOM   5915  C C5    . DT  B 1 143 ? 47.063  46.928 -82.791 1.00 66.92  ? 289  DT  J C5    1 
ATOM   5916  C C7    . DT  B 1 143 ? 47.807  48.202 -82.561 1.00 64.77  ? 289  DT  J C7    1 
ATOM   5917  C C6    . DT  B 1 143 ? 47.501  45.737 -82.357 1.00 65.48  ? 289  DT  J C6    1 
ATOM   5918  P P     . DG  B 1 144 ? 50.158  39.931 -81.738 1.00 53.46  ? 290  DG  J P     1 
ATOM   5919  O OP1   . DG  B 1 144 ? 50.237  38.758 -80.833 1.00 56.00  ? 290  DG  J OP1   1 
ATOM   5920  O OP2   . DG  B 1 144 ? 51.392  40.639 -82.127 1.00 54.73  ? 290  DG  J OP2   1 
ATOM   5921  O "O5'" . DG  B 1 144 ? 49.485  39.467 -83.098 1.00 52.09  ? 290  DG  J "O5'" 1 
ATOM   5922  C "C5'" . DG  B 1 144 ? 48.142  38.974 -83.114 1.00 56.27  ? 290  DG  J "C5'" 1 
ATOM   5923  C "C4'" . DG  B 1 144 ? 47.544  39.147 -84.489 1.00 62.98  ? 290  DG  J "C4'" 1 
ATOM   5924  O "O4'" . DG  B 1 144 ? 47.176  40.529 -84.730 1.00 63.15  ? 290  DG  J "O4'" 1 
ATOM   5925  C "C3'" . DG  B 1 144 ? 48.478  38.753 -85.633 1.00 65.14  ? 290  DG  J "C3'" 1 
ATOM   5926  O "O3'" . DG  B 1 144 ? 47.711  38.047 -86.608 1.00 70.51  ? 290  DG  J "O3'" 1 
ATOM   5927  C "C2'" . DG  B 1 144 ? 48.947  40.094 -86.175 1.00 62.96  ? 290  DG  J "C2'" 1 
ATOM   5928  C "C1'" . DG  B 1 144 ? 47.695  40.919 -85.985 1.00 62.75  ? 290  DG  J "C1'" 1 
ATOM   5929  N N9    . DG  B 1 144 ? 47.832  42.371 -86.003 1.00 67.05  ? 290  DG  J N9    1 
ATOM   5930  C C8    . DG  B 1 144 ? 48.840  43.140 -85.472 1.00 66.96  ? 290  DG  J C8    1 
ATOM   5931  N N7    . DG  B 1 144 ? 48.669  44.422 -85.670 1.00 68.38  ? 290  DG  J N7    1 
ATOM   5932  C C5    . DG  B 1 144 ? 47.474  44.500 -86.369 1.00 70.21  ? 290  DG  J C5    1 
ATOM   5933  C C6    . DG  B 1 144 ? 46.774  45.620 -86.862 1.00 72.44  ? 290  DG  J C6    1 
ATOM   5934  O O6    . DG  B 1 144 ? 47.080  46.808 -86.779 1.00 75.25  ? 290  DG  J O6    1 
ATOM   5935  N N1    . DG  B 1 144 ? 45.603  45.248 -87.514 1.00 70.32  ? 290  DG  J N1    1 
ATOM   5936  C C2    . DG  B 1 144 ? 45.169  43.962 -87.678 1.00 70.68  ? 290  DG  J C2    1 
ATOM   5937  N N2    . DG  B 1 144 ? 44.025  43.798 -88.332 1.00 69.45  ? 290  DG  J N2    1 
ATOM   5938  N N3    . DG  B 1 144 ? 45.813  42.907 -87.229 1.00 68.42  ? 290  DG  J N3    1 
ATOM   5939  C C4    . DG  B 1 144 ? 46.948  43.245 -86.584 1.00 68.49  ? 290  DG  J C4    1 
ATOM   5940  P P     . DA  B 1 145 ? 48.444  37.350 -87.846 1.00 90.30  ? 291  DA  J P     1 
ATOM   5941  O OP1   . DA  B 1 145 ? 48.380  35.878 -87.684 1.00 72.24  ? 291  DA  J OP1   1 
ATOM   5942  O OP2   . DA  B 1 145 ? 49.760  38.020 -88.058 1.00 67.47  ? 291  DA  J OP2   1 
ATOM   5943  O "O5'" . DA  B 1 145 ? 47.464  37.683 -89.044 1.00 92.32  ? 291  DA  J "O5'" 1 
ATOM   5944  C "C5'" . DA  B 1 145 ? 46.092  37.317 -88.966 1.00 93.86  ? 291  DA  J "C5'" 1 
ATOM   5945  C "C4'" . DA  B 1 145 ? 45.324  38.027 -90.050 1.00 96.27  ? 291  DA  J "C4'" 1 
ATOM   5946  O "O4'" . DA  B 1 145 ? 45.384  39.443 -89.757 1.00 93.70  ? 291  DA  J "O4'" 1 
ATOM   5947  C "C3'" . DA  B 1 145 ? 45.960  37.846 -91.427 1.00 95.71  ? 291  DA  J "C3'" 1 
ATOM   5948  O "O3'" . DA  B 1 145 ? 44.971  37.728 -92.457 1.00 100.90 ? 291  DA  J "O3'" 1 
ATOM   5949  C "C2'" . DA  B 1 145 ? 46.799  39.097 -91.598 1.00 94.64  ? 291  DA  J "C2'" 1 
ATOM   5950  C "C1'" . DA  B 1 145 ? 46.031  40.140 -90.806 1.00 91.03  ? 291  DA  J "C1'" 1 
ATOM   5951  N N9    . DA  B 1 145 ? 46.915  41.144 -90.213 1.00 67.99  ? 291  DA  J N9    1 
ATOM   5952  C C8    . DA  B 1 145 ? 48.041  40.912 -89.462 1.00 66.34  ? 291  DA  J C8    1 
ATOM   5953  N N7    . DA  B 1 145 ? 48.698  42.000 -89.139 1.00 65.62  ? 291  DA  J N7    1 
ATOM   5954  C C5    . DA  B 1 145 ? 47.944  43.017 -89.698 1.00 65.03  ? 291  DA  J C5    1 
ATOM   5955  C C6    . DA  B 1 145 ? 48.122  44.391 -89.730 1.00 63.84  ? 291  DA  J C6    1 
ATOM   5956  N N6    . DA  B 1 145 ? 49.165  45.004 -89.178 1.00 64.81  ? 291  DA  J N6    1 
ATOM   5957  N N1    . DA  B 1 145 ? 47.191  45.128 -90.358 1.00 61.75  ? 291  DA  J N1    1 
ATOM   5958  C C2    . DA  B 1 145 ? 46.155  44.505 -90.921 1.00 63.70  ? 291  DA  J C2    1 
ATOM   5959  N N3    . DA  B 1 145 ? 45.881  43.215 -90.970 1.00 66.59  ? 291  DA  J N3    1 
ATOM   5960  C C4    . DA  B 1 145 ? 46.828  42.510 -90.336 1.00 66.21  ? 291  DA  J C4    1 
ATOM   5961  P P     . DT  B 1 146 ? 45.419  37.345 -93.959 1.00 119.19 ? 292  DT  J P     1 
ATOM   5962  O OP1   . DT  B 1 146 ? 44.339  36.510 -94.531 1.00 81.22  ? 292  DT  J OP1   1 
ATOM   5963  O OP2   . DT  B 1 146 ? 46.822  36.838 -93.951 1.00 78.03  ? 292  DT  J OP2   1 
ATOM   5964  O "O5'" . DT  B 1 146 ? 45.429  38.741 -94.722 1.00 117.69 ? 292  DT  J "O5'" 1 
ATOM   5965  C "C5'" . DT  B 1 146 ? 44.251  39.538 -94.785 1.00 115.48 ? 292  DT  J "C5'" 1 
ATOM   5966  C "C4'" . DT  B 1 146 ? 44.549  40.869 -95.434 1.00 116.27 ? 292  DT  J "C4'" 1 
ATOM   5967  O "O4'" . DT  B 1 146 ? 45.338  41.699 -94.544 1.00 114.01 ? 292  DT  J "O4'" 1 
ATOM   5968  C "C3'" . DT  B 1 146 ? 45.334  40.792 -96.746 1.00 115.98 ? 292  DT  J "C3'" 1 
ATOM   5969  O "O3'" . DT  B 1 146 ? 44.844  41.809 -97.622 1.00 116.97 ? 292  DT  J "O3'" 1 
ATOM   5970  C "C2'" . DT  B 1 146 ? 46.738  41.191 -96.325 1.00 113.83 ? 292  DT  J "C2'" 1 
ATOM   5971  C "C1'" . DT  B 1 146 ? 46.421  42.235 -95.274 1.00 111.58 ? 292  DT  J "C1'" 1 
ATOM   5972  N N1    . DT  B 1 146 ? 47.507  42.570 -94.337 1.00 71.46  ? 292  DT  J N1    1 
ATOM   5973  C C2    . DT  B 1 146 ? 47.766  43.910 -94.110 1.00 72.40  ? 292  DT  J C2    1 
ATOM   5974  O O2    . DT  B 1 146 ? 47.109  44.815 -94.596 1.00 74.10  ? 292  DT  J O2    1 
ATOM   5975  N N3    . DT  B 1 146 ? 48.836  44.156 -93.291 1.00 70.04  ? 292  DT  J N3    1 
ATOM   5976  C C4    . DT  B 1 146 ? 49.660  43.226 -92.690 1.00 68.08  ? 292  DT  J C4    1 
ATOM   5977  O O4    . DT  B 1 146 ? 50.608  43.605 -92.008 1.00 67.30  ? 292  DT  J O4    1 
ATOM   5978  C C5    . DT  B 1 146 ? 49.314  41.836 -92.946 1.00 67.62  ? 292  DT  J C5    1 
ATOM   5979  C C7    . DT  B 1 146 ? 50.147  40.754 -92.328 1.00 67.05  ? 292  DT  J C7    1 
ATOM   5980  C C6    . DT  B 1 146 ? 48.258  41.585 -93.739 1.00 71.32  ? 292  DT  J C6    1 
ATOM   5981  N N     . PRO C 2 38  ? 112.548 25.428 -81.072 1.00 171.66 ? 438  PRO A N     1 
ATOM   5982  C CA    . PRO C 2 38  ? 111.843 26.145 -79.984 1.00 170.28 ? 438  PRO A CA    1 
ATOM   5983  C C     . PRO C 2 38  ? 110.510 25.588 -79.478 1.00 168.16 ? 438  PRO A C     1 
ATOM   5984  O O     . PRO C 2 38  ? 109.450 26.163 -79.726 1.00 168.05 ? 438  PRO A O     1 
ATOM   5985  C CB    . PRO C 2 38  ? 111.676 27.580 -80.450 1.00 84.38  ? 438  PRO A CB    1 
ATOM   5986  C CG    . PRO C 2 38  ? 112.965 27.776 -81.241 1.00 85.26  ? 438  PRO A CG    1 
ATOM   5987  C CD    . PRO C 2 38  ? 113.363 26.385 -81.849 1.00 85.39  ? 438  PRO A CD    1 
ATOM   5988  N N     . HIS C 2 39  ? 110.578 24.477 -78.753 1.00 149.15 ? 439  HIS A N     1 
ATOM   5989  C CA    . HIS C 2 39  ? 109.399 23.847 -78.163 1.00 145.50 ? 439  HIS A CA    1 
ATOM   5990  C C     . HIS C 2 39  ? 108.567 24.912 -77.439 1.00 141.98 ? 439  HIS A C     1 
ATOM   5991  O O     . HIS C 2 39  ? 109.092 25.669 -76.622 1.00 141.60 ? 439  HIS A O     1 
ATOM   5992  C CB    . HIS C 2 39  ? 109.857 22.766 -77.176 1.00 103.02 ? 439  HIS A CB    1 
ATOM   5993  C CG    . HIS C 2 39  ? 108.909 22.524 -76.040 1.00 104.34 ? 439  HIS A CG    1 
ATOM   5994  N ND1   . HIS C 2 39  ? 108.006 23.470 -75.604 1.00 104.12 ? 439  HIS A ND1   1 
ATOM   5995  C CD2   . HIS C 2 39  ? 108.776 21.466 -75.206 1.00 104.80 ? 439  HIS A CD2   1 
ATOM   5996  C CE1   . HIS C 2 39  ? 107.359 23.007 -74.552 1.00 104.18 ? 439  HIS A CE1   1 
ATOM   5997  N NE2   . HIS C 2 39  ? 107.807 21.793 -74.288 1.00 104.50 ? 439  HIS A NE2   1 
ATOM   5998  N N     . ARG C 2 40  ? 107.270 24.947 -77.730 1.00 68.81  ? 440  ARG A N     1 
ATOM   5999  C CA    . ARG C 2 40  ? 106.339 25.902 -77.127 1.00 64.76  ? 440  ARG A CA    1 
ATOM   6000  C C     . ARG C 2 40  ? 105.044 25.158 -76.692 1.00 60.72  ? 440  ARG A C     1 
ATOM   6001  O O     . ARG C 2 40  ? 104.580 24.239 -77.382 1.00 59.58  ? 440  ARG A O     1 
ATOM   6002  C CB    . ARG C 2 40  ? 106.024 26.994 -78.156 1.00 82.60  ? 440  ARG A CB    1 
ATOM   6003  C CG    . ARG C 2 40  ? 104.973 28.027 -77.757 1.00 82.27  ? 440  ARG A CG    1 
ATOM   6004  C CD    . ARG C 2 40  ? 104.862 29.083 -78.873 1.00 79.32  ? 440  ARG A CD    1 
ATOM   6005  N NE    . ARG C 2 40  ? 103.848 30.134 -78.674 1.00 77.37  ? 440  ARG A NE    1 
ATOM   6006  C CZ    . ARG C 2 40  ? 103.933 31.141 -77.796 1.00 76.53  ? 440  ARG A CZ    1 
ATOM   6007  N NH1   . ARG C 2 40  ? 104.986 31.268 -76.988 1.00 75.40  ? 440  ARG A NH1   1 
ATOM   6008  N NH2   . ARG C 2 40  ? 102.977 32.060 -77.757 1.00 74.98  ? 440  ARG A NH2   1 
ATOM   6009  N N     . TYR C 2 41  ? 104.457 25.514 -75.549 1.00 139.57 ? 441  TYR A N     1 
ATOM   6010  C CA    . TYR C 2 41  ? 103.228 24.820 -75.133 1.00 134.91 ? 441  TYR A CA    1 
ATOM   6011  C C     . TYR C 2 41  ? 102.003 25.448 -75.785 1.00 131.62 ? 441  TYR A C     1 
ATOM   6012  O O     . TYR C 2 41  ? 102.033 26.607 -76.197 1.00 130.46 ? 441  TYR A O     1 
ATOM   6013  C CB    . TYR C 2 41  ? 103.061 24.818 -73.608 1.00 42.85  ? 441  TYR A CB    1 
ATOM   6014  C CG    . TYR C 2 41  ? 103.917 23.801 -72.879 1.00 41.13  ? 441  TYR A CG    1 
ATOM   6015  C CD1   . TYR C 2 41  ? 104.939 24.214 -72.026 1.00 40.20  ? 441  TYR A CD1   1 
ATOM   6016  C CD2   . TYR C 2 41  ? 103.731 22.428 -73.084 1.00 40.26  ? 441  TYR A CD2   1 
ATOM   6017  C CE1   . TYR C 2 41  ? 105.773 23.302 -71.394 1.00 40.25  ? 441  TYR A CE1   1 
ATOM   6018  C CE2   . TYR C 2 41  ? 104.554 21.485 -72.456 1.00 40.58  ? 441  TYR A CE2   1 
ATOM   6019  C CZ    . TYR C 2 41  ? 105.587 21.935 -71.605 1.00 39.89  ? 441  TYR A CZ    1 
ATOM   6020  O OH    . TYR C 2 41  ? 106.438 21.031 -70.983 1.00 43.07  ? 441  TYR A OH    1 
ATOM   6021  N N     . ARG C 2 42  ? 100.922 24.685 -75.880 1.00 76.51  ? 442  ARG A N     1 
ATOM   6022  C CA    . ARG C 2 42  ? 99.717  25.196 -76.517 1.00 78.18  ? 442  ARG A CA    1 
ATOM   6023  C C     . ARG C 2 42  ? 98.785  25.905 -75.551 1.00 76.76  ? 442  ARG A C     1 
ATOM   6024  O O     . ARG C 2 42  ? 98.814  25.660 -74.346 1.00 74.79  ? 442  ARG A O     1 
ATOM   6025  C CB    . ARG C 2 42  ? 98.987  24.062 -77.228 1.00 65.83  ? 442  ARG A CB    1 
ATOM   6026  C CG    . ARG C 2 42  ? 99.851  23.370 -78.268 1.00 72.74  ? 442  ARG A CG    1 
ATOM   6027  C CD    . ARG C 2 42  ? 99.029  22.498 -79.150 1.00 78.58  ? 442  ARG A CD    1 
ATOM   6028  N NE    . ARG C 2 42  ? 98.212  21.629 -78.331 1.00 84.64  ? 442  ARG A NE    1 
ATOM   6029  C CZ    . ARG C 2 42  ? 97.272  20.836 -78.816 1.00 87.87  ? 442  ARG A CZ    1 
ATOM   6030  N NH1   . ARG C 2 42  ? 97.048  20.822 -80.125 1.00 89.08  ? 442  ARG A NH1   1 
ATOM   6031  N NH2   . ARG C 2 42  ? 96.562  20.063 -77.996 1.00 89.51  ? 442  ARG A NH2   1 
ATOM   6032  N N     . PRO C 2 43  ? 97.932  26.798 -76.071 1.00 63.40  ? 443  PRO A N     1 
ATOM   6033  C CA    . PRO C 2 43  ? 96.997  27.540 -75.223 1.00 61.29  ? 443  PRO A CA    1 
ATOM   6034  C C     . PRO C 2 43  ? 96.256  26.621 -74.275 1.00 59.97  ? 443  PRO A C     1 
ATOM   6035  O O     . PRO C 2 43  ? 95.731  25.577 -74.685 1.00 57.74  ? 443  PRO A O     1 
ATOM   6036  C CB    . PRO C 2 43  ? 96.051  28.182 -76.226 1.00 61.32  ? 443  PRO A CB    1 
ATOM   6037  C CG    . PRO C 2 43  ? 96.887  28.348 -77.432 1.00 60.12  ? 443  PRO A CG    1 
ATOM   6038  C CD    . PRO C 2 43  ? 97.663  27.055 -77.496 1.00 60.99  ? 443  PRO A CD    1 
ATOM   6039  N N     . GLY C 2 44  ? 96.231  27.001 -73.003 1.00 67.97  ? 444  GLY A N     1 
ATOM   6040  C CA    . GLY C 2 44  ? 95.510  26.217 -72.013 1.00 67.53  ? 444  GLY A CA    1 
ATOM   6041  C C     . GLY C 2 44  ? 96.225  25.038 -71.399 1.00 67.95  ? 444  GLY A C     1 
ATOM   6042  O O     . GLY C 2 44  ? 95.749  24.453 -70.431 1.00 67.72  ? 444  GLY A O     1 
ATOM   6043  N N     . THR C 2 45  ? 97.364  24.669 -71.954 1.00 58.19  ? 445  THR A N     1 
ATOM   6044  C CA    . THR C 2 45  ? 98.083  23.541 -71.399 1.00 57.13  ? 445  THR A CA    1 
ATOM   6045  C C     . THR C 2 45  ? 98.781  23.899 -70.099 1.00 56.61  ? 445  THR A C     1 
ATOM   6046  O O     . THR C 2 45  ? 98.762  23.124 -69.137 1.00 57.12  ? 445  THR A O     1 
ATOM   6047  C CB    . THR C 2 45  ? 99.093  22.969 -72.416 1.00 50.76  ? 445  THR A CB    1 
ATOM   6048  O OG1   . THR C 2 45  ? 98.382  22.120 -73.322 1.00 51.05  ? 445  THR A OG1   1 
ATOM   6049  C CG2   . THR C 2 45  ? 100.201 22.156 -71.711 1.00 48.63  ? 445  THR A CG2   1 
ATOM   6050  N N     . VAL C 2 46  ? 99.393  25.076 -70.086 1.00 68.81  ? 446  VAL A N     1 
ATOM   6051  C CA    . VAL C 2 46  ? 100.093 25.580 -68.916 1.00 70.89  ? 446  VAL A CA    1 
ATOM   6052  C C     . VAL C 2 46  ? 99.092  25.998 -67.847 1.00 70.02  ? 446  VAL A C     1 
ATOM   6053  O O     . VAL C 2 46  ? 99.303  25.792 -66.652 1.00 70.76  ? 446  VAL A O     1 
ATOM   6054  C CB    . VAL C 2 46  ? 100.935 26.803 -69.276 1.00 58.84  ? 446  VAL A CB    1 
ATOM   6055  C CG1   . VAL C 2 46  ? 101.635 27.341 -68.034 1.00 60.67  ? 446  VAL A CG1   1 
ATOM   6056  C CG2   . VAL C 2 46  ? 101.915 26.439 -70.364 1.00 60.77  ? 446  VAL A CG2   1 
ATOM   6057  N N     . ALA C 2 47  ? 98.000  26.602 -68.287 1.00 58.68  ? 447  ALA A N     1 
ATOM   6058  C CA    . ALA C 2 47  ? 96.980  27.050 -67.362 1.00 59.12  ? 447  ALA A CA    1 
ATOM   6059  C C     . ALA C 2 47  ? 96.439  25.854 -66.611 1.00 59.81  ? 447  ALA A C     1 
ATOM   6060  O O     . ALA C 2 47  ? 96.323  25.854 -65.394 1.00 58.48  ? 447  ALA A O     1 
ATOM   6061  C CB    . ALA C 2 47  ? 95.857  27.735 -68.113 1.00 34.63  ? 447  ALA A CB    1 
ATOM   6062  N N     . LEU C 2 48  ? 96.108  24.828 -67.364 1.00 42.35  ? 448  LEU A N     1 
ATOM   6063  C CA    . LEU C 2 48  ? 95.565  23.630 -66.791 1.00 42.79  ? 448  LEU A CA    1 
ATOM   6064  C C     . LEU C 2 48  ? 96.562  23.075 -65.786 1.00 42.97  ? 448  LEU A C     1 
ATOM   6065  O O     . LEU C 2 48  ? 96.182  22.570 -64.736 1.00 40.82  ? 448  LEU A O     1 
ATOM   6066  C CB    . LEU C 2 48  ? 95.289  22.636 -67.915 1.00 48.80  ? 448  LEU A CB    1 
ATOM   6067  C CG    . LEU C 2 48  ? 94.209  21.575 -67.778 1.00 52.41  ? 448  LEU A CG    1 
ATOM   6068  C CD1   . LEU C 2 48  ? 93.295  21.815 -66.600 1.00 52.38  ? 448  LEU A CD1   1 
ATOM   6069  C CD2   . LEU C 2 48  ? 93.446  21.610 -69.070 1.00 52.59  ? 448  LEU A CD2   1 
ATOM   6070  N N     . ARG C 2 49  ? 97.847  23.183 -66.095 1.00 51.13  ? 449  ARG A N     1 
ATOM   6071  C CA    . ARG C 2 49  ? 98.839  22.660 -65.182 1.00 51.27  ? 449  ARG A CA    1 
ATOM   6072  C C     . ARG C 2 49  ? 98.850  23.579 -63.968 1.00 48.92  ? 449  ARG A C     1 
ATOM   6073  O O     . ARG C 2 49  ? 99.050  23.108 -62.850 1.00 48.68  ? 449  ARG A O     1 
ATOM   6074  C CB    . ARG C 2 49  ? 100.230 22.540 -65.855 1.00 64.16  ? 449  ARG A CB    1 
ATOM   6075  C CG    . ARG C 2 49  ? 101.145 23.754 -65.721 1.00 67.14  ? 449  ARG A CG    1 
ATOM   6076  C CD    . ARG C 2 49  ? 102.669 23.420 -65.811 1.00 69.01  ? 449  ARG A CD    1 
ATOM   6077  N NE    . ARG C 2 49  ? 103.204 23.216 -67.169 1.00 68.86  ? 449  ARG A NE    1 
ATOM   6078  C CZ    . ARG C 2 49  ? 102.948 22.148 -67.930 1.00 70.70  ? 449  ARG A CZ    1 
ATOM   6079  N NH1   . ARG C 2 49  ? 102.158 21.168 -67.484 1.00 72.17  ? 449  ARG A NH1   1 
ATOM   6080  N NH2   . ARG C 2 49  ? 103.489 22.050 -69.138 1.00 68.05  ? 449  ARG A NH2   1 
ATOM   6081  N N     . GLU C 2 50  ? 98.613  24.877 -64.183 1.00 50.39  ? 450  GLU A N     1 
ATOM   6082  C CA    . GLU C 2 50  ? 98.545  25.847 -63.084 1.00 50.15  ? 450  GLU A CA    1 
ATOM   6083  C C     . GLU C 2 50  ? 97.336  25.546 -62.144 1.00 49.51  ? 450  GLU A C     1 
ATOM   6084  O O     . GLU C 2 50  ? 97.455  25.658 -60.921 1.00 50.35  ? 450  GLU A O     1 
ATOM   6085  C CB    . GLU C 2 50  ? 98.411  27.269 -63.629 1.00 68.80  ? 450  GLU A CB    1 
ATOM   6086  C CG    . GLU C 2 50  ? 99.531  27.747 -64.521 1.00 73.59  ? 450  GLU A CG    1 
ATOM   6087  C CD    . GLU C 2 50  ? 99.232  29.112 -65.181 1.00 76.78  ? 450  GLU A CD    1 
ATOM   6088  O OE1   . GLU C 2 50  ? 99.033  30.117 -64.447 1.00 78.85  ? 450  GLU A OE1   1 
ATOM   6089  O OE2   . GLU C 2 50  ? 99.191  29.181 -66.440 1.00 79.77  ? 450  GLU A OE2   1 
ATOM   6090  N N     . ILE C 2 51  ? 96.182  25.189 -62.724 1.00 42.15  ? 451  ILE A N     1 
ATOM   6091  C CA    . ILE C 2 51  ? 94.983  24.854 -61.957 1.00 39.95  ? 451  ILE A CA    1 
ATOM   6092  C C     . ILE C 2 51  ? 95.436  23.781 -61.001 1.00 41.24  ? 451  ILE A C     1 
ATOM   6093  O O     . ILE C 2 51  ? 95.433  23.980 -59.792 1.00 38.93  ? 451  ILE A O     1 
ATOM   6094  C CB    . ILE C 2 51  ? 93.842  24.273 -62.850 1.00 36.90  ? 451  ILE A CB    1 
ATOM   6095  C CG1   . ILE C 2 51  ? 93.374  25.324 -63.859 1.00 34.63  ? 451  ILE A CG1   1 
ATOM   6096  C CG2   . ILE C 2 51  ? 92.663  23.826 -61.992 1.00 33.61  ? 451  ILE A CG2   1 
ATOM   6097  C CD1   . ILE C 2 51  ? 92.441  24.807 -64.913 1.00 34.30  ? 451  ILE A CD1   1 
ATOM   6098  N N     . ARG C 2 52  ? 95.845  22.648 -61.557 1.00 29.73  ? 452  ARG A N     1 
ATOM   6099  C CA    . ARG C 2 52  ? 96.361  21.521 -60.774 1.00 31.31  ? 452  ARG A CA    1 
ATOM   6100  C C     . ARG C 2 52  ? 97.252  22.034 -59.636 1.00 30.57  ? 452  ARG A C     1 
ATOM   6101  O O     . ARG C 2 52  ? 97.037  21.755 -58.451 1.00 31.79  ? 452  ARG A O     1 
ATOM   6102  C CB    . ARG C 2 52  ? 97.201  20.601 -61.672 1.00 70.67  ? 452  ARG A CB    1 
ATOM   6103  C CG    . ARG C 2 52  ? 96.485  20.055 -62.883 1.00 73.65  ? 452  ARG A CG    1 
ATOM   6104  C CD    . ARG C 2 52  ? 95.683  18.789 -62.579 1.00 79.32  ? 452  ARG A CD    1 
ATOM   6105  N NE    . ARG C 2 52  ? 94.816  18.411 -63.699 1.00 83.01  ? 452  ARG A NE    1 
ATOM   6106  C CZ    . ARG C 2 52  ? 95.248  18.170 -64.934 1.00 84.65  ? 452  ARG A CZ    1 
ATOM   6107  N NH1   . ARG C 2 52  ? 96.547  18.255 -65.216 1.00 85.93  ? 452  ARG A NH1   1 
ATOM   6108  N NH2   . ARG C 2 52  ? 94.377  17.882 -65.893 1.00 86.37  ? 452  ARG A NH2   1 
ATOM   6109  N N     . ARG C 2 53  ? 98.264  22.786 -60.033 1.00 45.95  ? 453  ARG A N     1 
ATOM   6110  C CA    . ARG C 2 53  ? 99.201  23.335 -59.104 1.00 47.20  ? 453  ARG A CA    1 
ATOM   6111  C C     . ARG C 2 53  ? 98.561  24.050 -57.934 1.00 44.90  ? 453  ARG A C     1 
ATOM   6112  O O     . ARG C 2 53  ? 98.700  23.621 -56.788 1.00 43.54  ? 453  ARG A O     1 
ATOM   6113  C CB    . ARG C 2 53  ? 100.125 24.283 -59.817 1.00 60.69  ? 453  ARG A CB    1 
ATOM   6114  C CG    . ARG C 2 53  ? 101.015 25.001 -58.878 1.00 65.40  ? 453  ARG A CG    1 
ATOM   6115  C CD    . ARG C 2 53  ? 101.968 25.841 -59.639 1.00 73.67  ? 453  ARG A CD    1 
ATOM   6116  N NE    . ARG C 2 53  ? 102.689 26.705 -58.727 1.00 79.46  ? 453  ARG A NE    1 
ATOM   6117  C CZ    . ARG C 2 53  ? 103.414 27.739 -59.127 1.00 83.20  ? 453  ARG A CZ    1 
ATOM   6118  N NH1   . ARG C 2 53  ? 103.495 28.010 -60.425 1.00 85.64  ? 453  ARG A NH1   1 
ATOM   6119  N NH2   . ARG C 2 53  ? 104.045 28.503 -58.240 1.00 84.69  ? 453  ARG A NH2   1 
ATOM   6120  N N     . TYR C 2 54  ? 97.846  25.133 -58.206 1.00 44.25  ? 454  TYR A N     1 
ATOM   6121  C CA    . TYR C 2 54  ? 97.239  25.904 -57.125 1.00 43.70  ? 454  TYR A CA    1 
ATOM   6122  C C     . TYR C 2 54  ? 96.089  25.279 -56.302 1.00 43.40  ? 454  TYR A C     1 
ATOM   6123  O O     . TYR C 2 54  ? 95.755  25.764 -55.214 1.00 42.47  ? 454  TYR A O     1 
ATOM   6124  C CB    . TYR C 2 54  ? 96.833  27.264 -57.665 1.00 43.93  ? 454  TYR A CB    1 
ATOM   6125  C CG    . TYR C 2 54  ? 98.006  28.083 -58.143 1.00 45.02  ? 454  TYR A CG    1 
ATOM   6126  C CD1   . TYR C 2 54  ? 98.252  28.260 -59.509 1.00 45.33  ? 454  TYR A CD1   1 
ATOM   6127  C CD2   . TYR C 2 54  ? 98.869  28.679 -57.242 1.00 46.40  ? 454  TYR A CD2   1 
ATOM   6128  C CE1   . TYR C 2 54  ? 99.333  29.015 -59.965 1.00 46.84  ? 454  TYR A CE1   1 
ATOM   6129  C CE2   . TYR C 2 54  ? 99.953  29.430 -57.688 1.00 47.53  ? 454  TYR A CE2   1 
ATOM   6130  C CZ    . TYR C 2 54  ? 100.178 29.587 -59.053 1.00 49.30  ? 454  TYR A CZ    1 
ATOM   6131  O OH    . TYR C 2 54  ? 101.282 30.268 -59.498 1.00 49.56  ? 454  TYR A OH    1 
ATOM   6132  N N     . GLN C 2 55  ? 95.487  24.212 -56.803 1.00 41.42  ? 455  GLN A N     1 
ATOM   6133  C CA    . GLN C 2 55  ? 94.438  23.581 -56.039 1.00 41.64  ? 455  GLN A CA    1 
ATOM   6134  C C     . GLN C 2 55  ? 95.015  22.631 -54.978 1.00 42.69  ? 455  GLN A C     1 
ATOM   6135  O O     . GLN C 2 55  ? 94.281  22.064 -54.146 1.00 41.65  ? 455  GLN A O     1 
ATOM   6136  C CB    . GLN C 2 55  ? 93.490  22.852 -56.959 1.00 40.65  ? 455  GLN A CB    1 
ATOM   6137  C CG    . GLN C 2 55  ? 92.875  23.762 -57.967 1.00 40.86  ? 455  GLN A CG    1 
ATOM   6138  C CD    . GLN C 2 55  ? 91.545  23.251 -58.466 1.00 44.96  ? 455  GLN A CD    1 
ATOM   6139  O OE1   . GLN C 2 55  ? 91.376  22.050 -58.733 1.00 43.65  ? 455  GLN A OE1   1 
ATOM   6140  N NE2   . GLN C 2 55  ? 90.584  24.162 -58.611 1.00 42.13  ? 455  GLN A NE2   1 
ATOM   6141  N N     . LYS C 2 56  ? 96.334  22.463 -55.000 1.00 47.00  ? 456  LYS A N     1 
ATOM   6142  C CA    . LYS C 2 56  ? 96.995  21.627 -54.014 1.00 50.47  ? 456  LYS A CA    1 
ATOM   6143  C C     . LYS C 2 56  ? 97.508  22.522 -52.891 1.00 48.34  ? 456  LYS A C     1 
ATOM   6144  O O     . LYS C 2 56  ? 97.296  22.228 -51.725 1.00 49.95  ? 456  LYS A O     1 
ATOM   6145  C CB    . LYS C 2 56  ? 98.162  20.863 -54.634 1.00 72.94  ? 456  LYS A CB    1 
ATOM   6146  C CG    . LYS C 2 56  ? 97.746  19.870 -55.681 1.00 81.42  ? 456  LYS A CG    1 
ATOM   6147  C CD    . LYS C 2 56  ? 98.933  19.090 -56.209 1.00 84.97  ? 456  LYS A CD    1 
ATOM   6148  C CE    . LYS C 2 56  ? 98.506  18.099 -57.295 1.00 88.17  ? 456  LYS A CE    1 
ATOM   6149  N NZ    . LYS C 2 56  ? 99.691  17.511 -57.993 1.00 89.93  ? 456  LYS A NZ    1 
ATOM   6150  N N     . SER C 2 57  ? 98.181  23.609 -53.248 1.00 37.79  ? 457  SER A N     1 
ATOM   6151  C CA    . SER C 2 57  ? 98.715  24.559 -52.269 1.00 36.35  ? 457  SER A CA    1 
ATOM   6152  C C     . SER C 2 57  ? 97.619  25.292 -51.487 1.00 35.86  ? 457  SER A C     1 
ATOM   6153  O O     . SER C 2 57  ? 96.446  25.269 -51.881 1.00 36.96  ? 457  SER A O     1 
ATOM   6154  C CB    . SER C 2 57  ? 99.556  25.603 -52.987 1.00 39.53  ? 457  SER A CB    1 
ATOM   6155  O OG    . SER C 2 57  ? 98.826  26.113 -54.083 1.00 42.16  ? 457  SER A OG    1 
ATOM   6156  N N     . THR C 2 58  ? 97.991  25.954 -50.396 1.00 41.42  ? 458  THR A N     1 
ATOM   6157  C CA    . THR C 2 58  ? 96.992  26.667 -49.618 1.00 41.76  ? 458  THR A CA    1 
ATOM   6158  C C     . THR C 2 58  ? 97.398  28.094 -49.391 1.00 42.52  ? 458  THR A C     1 
ATOM   6159  O O     . THR C 2 58  ? 96.680  28.859 -48.744 1.00 41.79  ? 458  THR A O     1 
ATOM   6160  C CB    . THR C 2 58  ? 96.720  26.041 -48.180 1.00 39.20  ? 458  THR A CB    1 
ATOM   6161  O OG1   . THR C 2 58  ? 97.892  26.152 -47.357 1.00 41.20  ? 458  THR A OG1   1 
ATOM   6162  C CG2   . THR C 2 58  ? 96.283  24.594 -48.273 1.00 35.37  ? 458  THR A CG2   1 
ATOM   6163  N N     . GLU C 2 59  ? 98.538  28.481 -49.918 1.00 35.42  ? 459  GLU A N     1 
ATOM   6164  C CA    . GLU C 2 59  ? 98.972  29.833 -49.650 1.00 37.40  ? 459  GLU A CA    1 
ATOM   6165  C C     . GLU C 2 59  ? 98.263  30.962 -50.371 1.00 35.48  ? 459  GLU A C     1 
ATOM   6166  O O     . GLU C 2 59  ? 97.620  30.786 -51.419 1.00 34.62  ? 459  GLU A O     1 
ATOM   6167  C CB    . GLU C 2 59  ? 100.494 29.960 -49.818 1.00 58.42  ? 459  GLU A CB    1 
ATOM   6168  C CG    . GLU C 2 59  ? 101.116 29.015 -50.804 1.00 69.75  ? 459  GLU A CG    1 
ATOM   6169  C CD    . GLU C 2 59  ? 100.745 29.345 -52.213 1.00 72.33  ? 459  GLU A CD    1 
ATOM   6170  O OE1   . GLU C 2 59  ? 101.036 30.484 -52.629 1.00 78.54  ? 459  GLU A OE1   1 
ATOM   6171  O OE2   . GLU C 2 59  ? 100.168 28.473 -52.901 1.00 74.05  ? 459  GLU A OE2   1 
ATOM   6172  N N     . LEU C 2 60  ? 98.378  32.139 -49.772 1.00 36.83  ? 460  LEU A N     1 
ATOM   6173  C CA    . LEU C 2 60  ? 97.766  33.309 -50.341 1.00 37.32  ? 460  LEU A CA    1 
ATOM   6174  C C     . LEU C 2 60  ? 98.330  33.440 -51.750 1.00 37.62  ? 460  LEU A C     1 
ATOM   6175  O O     . LEU C 2 60  ? 99.469  33.078 -51.991 1.00 38.35  ? 460  LEU A O     1 
ATOM   6176  C CB    . LEU C 2 60  ? 98.073  34.514 -49.468 1.00 56.68  ? 460  LEU A CB    1 
ATOM   6177  C CG    . LEU C 2 60  ? 97.792  34.146 -48.005 1.00 58.19  ? 460  LEU A CG    1 
ATOM   6178  C CD1   . LEU C 2 60  ? 98.328  35.255 -47.074 1.00 57.98  ? 460  LEU A CD1   1 
ATOM   6179  C CD2   . LEU C 2 60  ? 96.300  33.917 -47.796 1.00 59.64  ? 460  LEU A CD2   1 
ATOM   6180  N N     . LEU C 2 61  ? 97.504  33.920 -52.674 1.00 51.47  ? 461  LEU A N     1 
ATOM   6181  C CA    . LEU C 2 61  ? 97.887  34.074 -54.060 1.00 50.10  ? 461  LEU A CA    1 
ATOM   6182  C C     . LEU C 2 61  ? 98.118  35.537 -54.354 1.00 50.95  ? 461  LEU A C     1 
ATOM   6183  O O     . LEU C 2 61  ? 98.604  35.902 -55.426 1.00 51.15  ? 461  LEU A O     1 
ATOM   6184  C CB    . LEU C 2 61  ? 96.807  33.489 -54.962 1.00 39.48  ? 461  LEU A CB    1 
ATOM   6185  C CG    . LEU C 2 61  ? 96.417  32.028 -54.669 1.00 37.08  ? 461  LEU A CG    1 
ATOM   6186  C CD1   . LEU C 2 61  ? 95.439  31.584 -55.751 1.00 39.04  ? 461  LEU A CD1   1 
ATOM   6187  C CD2   . LEU C 2 61  ? 97.630  31.110 -54.604 1.00 38.85  ? 461  LEU A CD2   1 
ATOM   6188  N N     . ILE C 2 62  ? 97.765  36.377 -53.390 1.00 40.46  ? 462  ILE A N     1 
ATOM   6189  C CA    . ILE C 2 62  ? 98.015  37.810 -53.500 1.00 42.56  ? 462  ILE A CA    1 
ATOM   6190  C C     . ILE C 2 62  ? 99.197  38.213 -52.579 1.00 44.56  ? 462  ILE A C     1 
ATOM   6191  O O     . ILE C 2 62  ? 99.319  37.735 -51.457 1.00 46.16  ? 462  ILE A O     1 
ATOM   6192  C CB    . ILE C 2 62  ? 96.809  38.593 -53.090 1.00 46.91  ? 462  ILE A CB    1 
ATOM   6193  C CG1   . ILE C 2 62  ? 95.658  38.261 -54.028 1.00 49.00  ? 462  ILE A CG1   1 
ATOM   6194  C CG2   . ILE C 2 62  ? 97.133  40.066 -53.118 1.00 45.88  ? 462  ILE A CG2   1 
ATOM   6195  C CD1   . ILE C 2 62  ? 94.363  38.937 -53.630 1.00 43.24  ? 462  ILE A CD1   1 
ATOM   6196  N N     . ARG C 2 63  ? 100.073 39.084 -53.065 1.00 48.34  ? 463  ARG A N     1 
ATOM   6197  C CA    . ARG C 2 63  ? 101.224 39.525 -52.275 1.00 50.40  ? 463  ARG A CA    1 
ATOM   6198  C C     . ARG C 2 63  ? 100.770 40.331 -51.057 1.00 50.76  ? 463  ARG A C     1 
ATOM   6199  O O     . ARG C 2 63  ? 99.904  41.216 -51.163 1.00 49.58  ? 463  ARG A O     1 
ATOM   6200  C CB    . ARG C 2 63  ? 102.189 40.350 -53.144 1.00 90.14  ? 463  ARG A CB    1 
ATOM   6201  C CG    . ARG C 2 63  ? 103.033 39.525 -54.124 1.00 93.39  ? 463  ARG A CG    1 
ATOM   6202  C CD    . ARG C 2 63  ? 102.920 40.060 -55.549 1.00 100.61 ? 463  ARG A CD    1 
ATOM   6203  N NE    . ARG C 2 63  ? 103.274 41.480 -55.644 1.00 108.35 ? 463  ARG A NE    1 
ATOM   6204  C CZ    . ARG C 2 63  ? 102.903 42.292 -56.640 1.00 110.85 ? 463  ARG A CZ    1 
ATOM   6205  N NH1   . ARG C 2 63  ? 102.160 41.823 -57.639 1.00 114.57 ? 463  ARG A NH1   1 
ATOM   6206  N NH2   . ARG C 2 63  ? 103.257 43.579 -56.630 1.00 110.28 ? 463  ARG A NH2   1 
ATOM   6207  N N     . LYS C 2 64  ? 101.376 40.036 -49.907 1.00 43.81  ? 464  LYS A N     1 
ATOM   6208  C CA    . LYS C 2 64  ? 101.008 40.703 -48.668 1.00 45.46  ? 464  LYS A CA    1 
ATOM   6209  C C     . LYS C 2 64  ? 100.974 42.237 -48.667 1.00 44.27  ? 464  LYS A C     1 
ATOM   6210  O O     . LYS C 2 64  ? 99.957  42.823 -48.293 1.00 43.38  ? 464  LYS A O     1 
ATOM   6211  C CB    . LYS C 2 64  ? 101.861 40.166 -47.520 1.00 62.98  ? 464  LYS A CB    1 
ATOM   6212  C CG    . LYS C 2 64  ? 101.646 38.677 -47.366 1.00 71.88  ? 464  LYS A CG    1 
ATOM   6213  C CD    . LYS C 2 64  ? 102.080 38.090 -46.020 1.00 75.73  ? 464  LYS A CD    1 
ATOM   6214  C CE    . LYS C 2 64  ? 101.757 36.571 -45.982 1.00 77.96  ? 464  LYS A CE    1 
ATOM   6215  N NZ    . LYS C 2 64  ? 102.150 35.877 -44.716 1.00 78.50  ? 464  LYS A NZ    1 
ATOM   6216  N N     . LEU C 2 65  ? 102.040 42.890 -49.116 1.00 53.66  ? 465  LEU A N     1 
ATOM   6217  C CA    . LEU C 2 65  ? 102.069 44.340 -49.097 1.00 51.37  ? 465  LEU A CA    1 
ATOM   6218  C C     . LEU C 2 65  ? 101.054 45.086 -49.965 1.00 50.26  ? 465  LEU A C     1 
ATOM   6219  O O     . LEU C 2 65  ? 100.384 45.988 -49.481 1.00 51.40  ? 465  LEU A O     1 
ATOM   6220  C CB    . LEU C 2 65  ? 103.472 44.851 -49.422 1.00 59.80  ? 465  LEU A CB    1 
ATOM   6221  C CG    . LEU C 2 65  ? 103.722 46.313 -49.000 1.00 60.88  ? 465  LEU A CG    1 
ATOM   6222  C CD1   . LEU C 2 65  ? 103.978 46.344 -47.509 1.00 60.10  ? 465  LEU A CD1   1 
ATOM   6223  C CD2   . LEU C 2 65  ? 104.907 46.898 -49.748 1.00 63.33  ? 465  LEU A CD2   1 
ATOM   6224  N N     . PRO C 2 66  ? 100.922 44.739 -51.252 1.00 48.18  ? 466  PRO A N     1 
ATOM   6225  C CA    . PRO C 2 66  ? 99.939  45.483 -52.038 1.00 47.56  ? 466  PRO A CA    1 
ATOM   6226  C C     . PRO C 2 66  ? 98.583  45.416 -51.363 1.00 47.75  ? 466  PRO A C     1 
ATOM   6227  O O     . PRO C 2 66  ? 97.811  46.374 -51.397 1.00 47.87  ? 466  PRO A O     1 
ATOM   6228  C CB    . PRO C 2 66  ? 99.926  44.744 -53.370 1.00 38.39  ? 466  PRO A CB    1 
ATOM   6229  C CG    . PRO C 2 66  ? 101.260 44.134 -53.447 1.00 41.30  ? 466  PRO A CG    1 
ATOM   6230  C CD    . PRO C 2 66  ? 101.454 43.625 -52.043 1.00 39.75  ? 466  PRO A CD    1 
ATOM   6231  N N     . PHE C 2 67  ? 98.319  44.269 -50.743 1.00 43.03  ? 467  PHE A N     1 
ATOM   6232  C CA    . PHE C 2 67  ? 97.057  44.018 -50.066 1.00 42.64  ? 467  PHE A CA    1 
ATOM   6233  C C     . PHE C 2 67  ? 96.896  44.804 -48.788 1.00 42.29  ? 467  PHE A C     1 
ATOM   6234  O O     . PHE C 2 67  ? 95.802  45.289 -48.480 1.00 38.83  ? 467  PHE A O     1 
ATOM   6235  C CB    . PHE C 2 67  ? 96.923  42.532 -49.721 1.00 42.18  ? 467  PHE A CB    1 
ATOM   6236  C CG    . PHE C 2 67  ? 95.548  42.132 -49.276 1.00 41.86  ? 467  PHE A CG    1 
ATOM   6237  C CD1   . PHE C 2 67  ? 94.555  41.855 -50.208 1.00 40.56  ? 467  PHE A CD1   1 
ATOM   6238  C CD2   . PHE C 2 67  ? 95.216  42.124 -47.939 1.00 39.97  ? 467  PHE A CD2   1 
ATOM   6239  C CE1   . PHE C 2 67  ? 93.265  41.549 -49.806 1.00 38.52  ? 467  PHE A CE1   1 
ATOM   6240  C CE2   . PHE C 2 67  ? 93.923  41.819 -47.532 1.00 41.32  ? 467  PHE A CE2   1 
ATOM   6241  C CZ    . PHE C 2 67  ? 92.947  41.549 -48.468 1.00 38.39  ? 467  PHE A CZ    1 
ATOM   6242  N N     . GLN C 2 68  ? 97.982  44.905 -48.025 1.00 51.82  ? 468  GLN A N     1 
ATOM   6243  C CA    . GLN C 2 68  ? 97.903  45.603 -46.764 1.00 53.81  ? 468  GLN A CA    1 
ATOM   6244  C C     . GLN C 2 68  ? 97.592  47.032 -47.074 1.00 51.95  ? 468  GLN A C     1 
ATOM   6245  O O     . GLN C 2 68  ? 96.817  47.686 -46.367 1.00 51.13  ? 468  GLN A O     1 
ATOM   6246  C CB    . GLN C 2 68  ? 99.202  45.492 -45.968 1.00 50.42  ? 468  GLN A CB    1 
ATOM   6247  C CG    . GLN C 2 68  ? 98.948  45.672 -44.461 1.00 58.66  ? 468  GLN A CG    1 
ATOM   6248  C CD    . GLN C 2 68  ? 100.078 45.152 -43.564 1.00 62.93  ? 468  GLN A CD    1 
ATOM   6249  O OE1   . GLN C 2 68  ? 101.110 45.798 -43.427 1.00 68.64  ? 468  GLN A OE1   1 
ATOM   6250  N NE2   . GLN C 2 68  ? 99.877  43.987 -42.951 1.00 66.16  ? 468  GLN A NE2   1 
ATOM   6251  N N     . ARG C 2 69  ? 98.171  47.516 -48.162 1.00 36.34  ? 469  ARG A N     1 
ATOM   6252  C CA    . ARG C 2 69  ? 97.930  48.885 -48.551 1.00 37.65  ? 469  ARG A CA    1 
ATOM   6253  C C     . ARG C 2 69  ? 96.472  49.119 -48.922 1.00 36.24  ? 469  ARG A C     1 
ATOM   6254  O O     . ARG C 2 69  ? 95.900  50.141 -48.550 1.00 34.21  ? 469  ARG A O     1 
ATOM   6255  C CB    . ARG C 2 69  ? 98.819  49.295 -49.726 1.00 50.26  ? 469  ARG A CB    1 
ATOM   6256  C CG    . ARG C 2 69  ? 100.194 49.769 -49.367 1.00 54.92  ? 469  ARG A CG    1 
ATOM   6257  C CD    . ARG C 2 69  ? 100.703 50.668 -50.467 1.00 56.31  ? 469  ARG A CD    1 
ATOM   6258  N NE    . ARG C 2 69  ? 100.769 50.009 -51.770 1.00 55.83  ? 469  ARG A NE    1 
ATOM   6259  C CZ    . ARG C 2 69  ? 101.681 49.099 -52.135 1.00 56.08  ? 469  ARG A CZ    1 
ATOM   6260  N NH1   . ARG C 2 69  ? 102.641 48.700 -51.299 1.00 57.51  ? 469  ARG A NH1   1 
ATOM   6261  N NH2   . ARG C 2 69  ? 101.646 48.590 -53.364 1.00 53.63  ? 469  ARG A NH2   1 
ATOM   6262  N N     . LEU C 2 70  ? 95.871  48.187 -49.657 1.00 32.15  ? 470  LEU A N     1 
ATOM   6263  C CA    . LEU C 2 70  ? 94.484  48.348 -50.057 1.00 31.76  ? 470  LEU A CA    1 
ATOM   6264  C C     . LEU C 2 70  ? 93.558  48.382 -48.832 1.00 29.44  ? 470  LEU A C     1 
ATOM   6265  O O     . LEU C 2 70  ? 92.669  49.243 -48.722 1.00 30.70  ? 470  LEU A O     1 
ATOM   6266  C CB    . LEU C 2 70  ? 94.069  47.213 -50.993 1.00 36.05  ? 470  LEU A CB    1 
ATOM   6267  C CG    . LEU C 2 70  ? 92.641  47.260 -51.562 1.00 36.58  ? 470  LEU A CG    1 
ATOM   6268  C CD1   . LEU C 2 70  ? 92.418  48.472 -52.473 1.00 34.36  ? 470  LEU A CD1   1 
ATOM   6269  C CD2   . LEU C 2 70  ? 92.439  45.983 -52.316 1.00 33.49  ? 470  LEU A CD2   1 
ATOM   6270  N N     . VAL C 2 71  ? 93.776  47.442 -47.917 1.00 29.43  ? 471  VAL A N     1 
ATOM   6271  C CA    . VAL C 2 71  ? 92.994  47.363 -46.684 1.00 31.00  ? 471  VAL A CA    1 
ATOM   6272  C C     . VAL C 2 71  ? 93.061  48.667 -45.899 1.00 31.59  ? 471  VAL A C     1 
ATOM   6273  O O     . VAL C 2 71  ? 92.045  49.215 -45.489 1.00 31.78  ? 471  VAL A O     1 
ATOM   6274  C CB    . VAL C 2 71  ? 93.519  46.239 -45.791 1.00 44.26  ? 471  VAL A CB    1 
ATOM   6275  C CG1   . VAL C 2 71  ? 92.793  46.245 -44.471 1.00 44.58  ? 471  VAL A CG1   1 
ATOM   6276  C CG2   . VAL C 2 71  ? 93.365  44.923 -46.490 1.00 46.15  ? 471  VAL A CG2   1 
ATOM   6277  N N     . ARG C 2 72  ? 94.272  49.164 -45.704 1.00 47.48  ? 472  ARG A N     1 
ATOM   6278  C CA    . ARG C 2 72  ? 94.476  50.401 -44.966 1.00 47.07  ? 472  ARG A CA    1 
ATOM   6279  C C     . ARG C 2 72  ? 93.786  51.656 -45.523 1.00 45.91  ? 472  ARG A C     1 
ATOM   6280  O O     . ARG C 2 72  ? 93.270  52.479 -44.755 1.00 43.97  ? 472  ARG A O     1 
ATOM   6281  C CB    . ARG C 2 72  ? 95.964  50.651 -44.845 1.00 44.70  ? 472  ARG A CB    1 
ATOM   6282  C CG    . ARG C 2 72  ? 96.604  49.689 -43.895 1.00 46.29  ? 472  ARG A CG    1 
ATOM   6283  C CD    . ARG C 2 72  ? 98.104  49.896 -43.793 1.00 49.61  ? 472  ARG A CD    1 
ATOM   6284  N NE    . ARG C 2 72  ? 98.674  48.884 -42.917 1.00 51.88  ? 472  ARG A NE    1 
ATOM   6285  C CZ    . ARG C 2 72  ? 98.697  48.990 -41.597 1.00 52.16  ? 472  ARG A CZ    1 
ATOM   6286  N NH1   . ARG C 2 72  ? 98.191  50.072 -41.006 1.00 52.83  ? 472  ARG A NH1   1 
ATOM   6287  N NH2   . ARG C 2 72  ? 99.208  48.001 -40.874 1.00 54.64  ? 472  ARG A NH2   1 
ATOM   6288  N N     . GLU C 2 73  ? 93.797  51.788 -46.849 1.00 41.01  ? 473  GLU A N     1 
ATOM   6289  C CA    . GLU C 2 73  ? 93.205  52.915 -47.541 1.00 43.59  ? 473  GLU A CA    1 
ATOM   6290  C C     . GLU C 2 73  ? 91.705  52.867 -47.410 1.00 43.93  ? 473  GLU A C     1 
ATOM   6291  O O     . GLU C 2 73  ? 91.035  53.878 -47.266 1.00 44.55  ? 473  GLU A O     1 
ATOM   6292  C CB    . GLU C 2 73  ? 93.571  52.873 -49.016 1.00 56.34  ? 473  GLU A CB    1 
ATOM   6293  C CG    . GLU C 2 73  ? 92.882  53.924 -49.844 1.00 61.98  ? 473  GLU A CG    1 
ATOM   6294  C CD    . GLU C 2 73  ? 93.112  53.743 -51.331 1.00 65.60  ? 473  GLU A CD    1 
ATOM   6295  O OE1   . GLU C 2 73  ? 94.272  53.902 -51.804 1.00 68.87  ? 473  GLU A OE1   1 
ATOM   6296  O OE2   . GLU C 2 73  ? 92.119  53.434 -52.031 1.00 71.43  ? 473  GLU A OE2   1 
ATOM   6297  N N     . ILE C 2 74  ? 91.149  51.682 -47.474 1.00 52.41  ? 474  ILE A N     1 
ATOM   6298  C CA    . ILE C 2 74  ? 89.725  51.607 -47.361 1.00 49.47  ? 474  ILE A CA    1 
ATOM   6299  C C     . ILE C 2 74  ? 89.330  51.906 -45.929 1.00 49.58  ? 474  ILE A C     1 
ATOM   6300  O O     . ILE C 2 74  ? 88.311  52.550 -45.684 1.00 48.86  ? 474  ILE A O     1 
ATOM   6301  C CB    . ILE C 2 74  ? 89.258  50.247 -47.763 1.00 34.07  ? 474  ILE A CB    1 
ATOM   6302  C CG1   . ILE C 2 74  ? 89.633  50.009 -49.220 1.00 34.44  ? 474  ILE A CG1   1 
ATOM   6303  C CG2   . ILE C 2 74  ? 87.782  50.132 -47.526 1.00 32.24  ? 474  ILE A CG2   1 
ATOM   6304  C CD1   . ILE C 2 74  ? 89.247  48.653 -49.710 1.00 32.28  ? 474  ILE A CD1   1 
ATOM   6305  N N     . ALA C 2 75  ? 90.147  51.464 -44.978 1.00 33.57  ? 475  ALA A N     1 
ATOM   6306  C CA    . ALA C 2 75  ? 89.837  51.703 -43.571 1.00 36.33  ? 475  ALA A CA    1 
ATOM   6307  C C     . ALA C 2 75  ? 89.868  53.199 -43.244 1.00 40.12  ? 475  ALA A C     1 
ATOM   6308  O O     . ALA C 2 75  ? 89.013  53.719 -42.544 1.00 39.34  ? 475  ALA A O     1 
ATOM   6309  C CB    . ALA C 2 75  ? 90.810  50.915 -42.673 1.00 19.42  ? 475  ALA A CB    1 
ATOM   6310  N N     . GLN C 2 76  ? 90.864  53.881 -43.784 1.00 44.34  ? 476  GLN A N     1 
ATOM   6311  C CA    . GLN C 2 76  ? 91.042  55.311 -43.592 1.00 47.81  ? 476  GLN A CA    1 
ATOM   6312  C C     . GLN C 2 76  ? 89.755  56.109 -43.840 1.00 48.33  ? 476  GLN A C     1 
ATOM   6313  O O     . GLN C 2 76  ? 89.514  57.093 -43.163 1.00 49.45  ? 476  GLN A O     1 
ATOM   6314  C CB    . GLN C 2 76  ? 92.166  55.802 -44.522 1.00 76.52  ? 476  GLN A CB    1 
ATOM   6315  C CG    . GLN C 2 76  ? 92.541  57.287 -44.448 1.00 81.48  ? 476  GLN A CG    1 
ATOM   6316  C CD    . GLN C 2 76  ? 93.119  57.714 -43.101 1.00 84.57  ? 476  GLN A CD    1 
ATOM   6317  O OE1   . GLN C 2 76  ? 93.689  56.911 -42.364 1.00 85.42  ? 476  GLN A OE1   1 
ATOM   6318  N NE2   . GLN C 2 76  ? 92.987  58.995 -42.791 1.00 87.60  ? 476  GLN A NE2   1 
ATOM   6319  N N     . ASP C 2 77  ? 88.937  55.685 -44.802 1.00 44.18  ? 477  ASP A N     1 
ATOM   6320  C CA    . ASP C 2 77  ? 87.683  56.369 -45.139 1.00 43.13  ? 477  ASP A CA    1 
ATOM   6321  C C     . ASP C 2 77  ? 86.680  56.144 -44.033 1.00 42.76  ? 477  ASP A C     1 
ATOM   6322  O O     . ASP C 2 77  ? 85.673  56.824 -43.940 1.00 43.40  ? 477  ASP A O     1 
ATOM   6323  C CB    . ASP C 2 77  ? 87.107  55.812 -46.437 1.00 123.95 ? 477  ASP A CB    1 
ATOM   6324  C CG    . ASP C 2 77  ? 88.135  55.742 -47.544 1.00 128.31 ? 477  ASP A CG    1 
ATOM   6325  O OD1   . ASP C 2 77  ? 87.854  55.081 -48.570 1.00 130.88 ? 477  ASP A OD1   1 
ATOM   6326  O OD2   . ASP C 2 77  ? 89.221  56.348 -47.392 1.00 131.17 ? 477  ASP A OD2   1 
ATOM   6327  N N     . PHE C 2 78  ? 86.955  55.183 -43.175 1.00 40.07  ? 478  PHE A N     1 
ATOM   6328  C CA    . PHE C 2 78  ? 86.027  54.912 -42.111 1.00 39.54  ? 478  PHE A CA    1 
ATOM   6329  C C     . PHE C 2 78  ? 86.473  55.500 -40.779 1.00 39.92  ? 478  PHE A C     1 
ATOM   6330  O O     . PHE C 2 78  ? 85.672  55.908 -39.964 1.00 39.65  ? 478  PHE A O     1 
ATOM   6331  C CB    . PHE C 2 78  ? 85.824  53.397 -41.996 1.00 44.32  ? 478  PHE A CB    1 
ATOM   6332  C CG    . PHE C 2 78  ? 85.132  52.782 -43.187 1.00 43.96  ? 478  PHE A CG    1 
ATOM   6333  C CD1   . PHE C 2 78  ? 85.675  51.668 -43.827 1.00 41.24  ? 478  PHE A CD1   1 
ATOM   6334  C CD2   . PHE C 2 78  ? 83.908  53.283 -43.639 1.00 45.03  ? 478  PHE A CD2   1 
ATOM   6335  C CE1   . PHE C 2 78  ? 84.997  51.067 -44.886 1.00 41.13  ? 478  PHE A CE1   1 
ATOM   6336  C CE2   . PHE C 2 78  ? 83.230  52.680 -44.694 1.00 43.75  ? 478  PHE A CE2   1 
ATOM   6337  C CZ    . PHE C 2 78  ? 83.770  51.579 -45.319 1.00 41.84  ? 478  PHE A CZ    1 
ATOM   6338  N N     . LYS C 2 79  ? 87.756  55.530 -40.525 1.00 48.77  ? 479  LYS A N     1 
ATOM   6339  C CA    . LYS C 2 79  ? 88.185  56.090 -39.272 1.00 49.00  ? 479  LYS A CA    1 
ATOM   6340  C C     . LYS C 2 79  ? 89.659  56.293 -39.429 1.00 48.72  ? 479  LYS A C     1 
ATOM   6341  O O     . LYS C 2 79  ? 90.399  55.348 -39.704 1.00 45.43  ? 479  LYS A O     1 
ATOM   6342  C CB    . LYS C 2 79  ? 87.893  55.148 -38.108 1.00 59.87  ? 479  LYS A CB    1 
ATOM   6343  C CG    . LYS C 2 79  ? 88.189  55.771 -36.766 1.00 61.96  ? 479  LYS A CG    1 
ATOM   6344  C CD    . LYS C 2 79  ? 88.207  54.754 -35.628 1.00 70.37  ? 479  LYS A CD    1 
ATOM   6345  C CE    . LYS C 2 79  ? 88.615  55.420 -34.297 1.00 73.89  ? 479  LYS A CE    1 
ATOM   6346  N NZ    . LYS C 2 79  ? 88.988  54.464 -33.195 1.00 78.51  ? 479  LYS A NZ    1 
ATOM   6347  N N     . THR C 2 80  ? 90.082  57.538 -39.264 1.00 47.68  ? 480  THR A N     1 
ATOM   6348  C CA    . THR C 2 80  ? 91.479  57.902 -39.417 1.00 47.39  ? 480  THR A CA    1 
ATOM   6349  C C     . THR C 2 80  ? 92.414  57.482 -38.277 1.00 48.27  ? 480  THR A C     1 
ATOM   6350  O O     . THR C 2 80  ? 91.983  57.186 -37.150 1.00 48.35  ? 480  THR A O     1 
ATOM   6351  C CB    . THR C 2 80  ? 91.585  59.403 -39.605 1.00 54.58  ? 480  THR A CB    1 
ATOM   6352  O OG1   . THR C 2 80  ? 90.886  60.030 -38.538 1.00 55.01  ? 480  THR A OG1   1 
ATOM   6353  C CG2   . THR C 2 80  ? 90.946  59.838 -40.909 1.00 55.42  ? 480  THR A CG2   1 
ATOM   6354  N N     . ASP C 2 81  ? 93.703  57.467 -38.609 1.00 81.06  ? 481  ASP A N     1 
ATOM   6355  C CA    . ASP C 2 81  ? 94.772  57.121 -37.682 1.00 81.74  ? 481  ASP A CA    1 
ATOM   6356  C C     . ASP C 2 81  ? 94.566  55.718 -37.116 1.00 82.78  ? 481  ASP A C     1 
ATOM   6357  O O     . ASP C 2 81  ? 94.552  55.523 -35.902 1.00 82.84  ? 481  ASP A O     1 
ATOM   6358  C CB    . ASP C 2 81  ? 94.840  58.182 -36.561 1.00 97.64  ? 481  ASP A CB    1 
ATOM   6359  C CG    . ASP C 2 81  ? 96.112  58.089 -35.713 1.00 98.14  ? 481  ASP A CG    1 
ATOM   6360  O OD1   . ASP C 2 81  ? 97.213  57.871 -36.271 1.00 99.12  ? 481  ASP A OD1   1 
ATOM   6361  O OD2   . ASP C 2 81  ? 96.008  58.257 -34.480 1.00 101.72 ? 481  ASP A OD2   1 
ATOM   6362  N N     . LEU C 2 82  ? 94.419  54.734 -37.998 1.00 55.01  ? 482  LEU A N     1 
ATOM   6363  C CA    . LEU C 2 82  ? 94.208  53.368 -37.536 1.00 52.11  ? 482  LEU A CA    1 
ATOM   6364  C C     . LEU C 2 82  ? 95.425  52.469 -37.647 1.00 51.42  ? 482  LEU A C     1 
ATOM   6365  O O     . LEU C 2 82  ? 96.265  52.638 -38.523 1.00 52.33  ? 482  LEU A O     1 
ATOM   6366  C CB    . LEU C 2 82  ? 93.026  52.714 -38.276 1.00 39.55  ? 482  LEU A CB    1 
ATOM   6367  C CG    . LEU C 2 82  ? 91.612  53.050 -37.787 1.00 39.84  ? 482  LEU A CG    1 
ATOM   6368  C CD1   . LEU C 2 82  ? 90.585  52.538 -38.789 1.00 41.60  ? 482  LEU A CD1   1 
ATOM   6369  C CD2   . LEU C 2 82  ? 91.371  52.450 -36.397 1.00 37.03  ? 482  LEU A CD2   1 
ATOM   6370  N N     . ARG C 2 83  ? 95.499  51.505 -36.744 1.00 74.33  ? 483  ARG A N     1 
ATOM   6371  C CA    . ARG C 2 83  ? 96.586  50.552 -36.742 1.00 74.65  ? 483  ARG A CA    1 
ATOM   6372  C C     . ARG C 2 83  ? 95.956  49.164 -36.803 1.00 74.48  ? 483  ARG A C     1 
ATOM   6373  O O     . ARG C 2 83  ? 94.972  48.897 -36.107 1.00 69.92  ? 483  ARG A O     1 
ATOM   6374  C CB    . ARG C 2 83  ? 97.418  50.727 -35.476 1.00 95.33  ? 483  ARG A CB    1 
ATOM   6375  C CG    . ARG C 2 83  ? 97.783  52.175 -35.244 1.00 101.96 ? 483  ARG A CG    1 
ATOM   6376  C CD    . ARG C 2 83  ? 98.641  52.339 -34.029 1.00 105.60 ? 483  ARG A CD    1 
ATOM   6377  N NE    . ARG C 2 83  ? 100.036 52.075 -34.330 1.00 114.43 ? 483  ARG A NE    1 
ATOM   6378  C CZ    . ARG C 2 83  ? 100.945 51.809 -33.405 1.00 116.09 ? 483  ARG A CZ    1 
ATOM   6379  N NH1   . ARG C 2 83  ? 100.584 51.772 -32.131 1.00 118.07 ? 483  ARG A NH1   1 
ATOM   6380  N NH2   . ARG C 2 83  ? 102.205 51.583 -33.750 1.00 118.30 ? 483  ARG A NH2   1 
ATOM   6381  N N     . PHE C 2 84  ? 96.515  48.298 -37.651 1.00 52.60  ? 484  PHE A N     1 
ATOM   6382  C CA    . PHE C 2 84  ? 96.023  46.938 -37.836 1.00 52.77  ? 484  PHE A CA    1 
ATOM   6383  C C     . PHE C 2 84  ? 96.909  45.846 -37.234 1.00 53.76  ? 484  PHE A C     1 
ATOM   6384  O O     . PHE C 2 84  ? 98.107  45.852 -37.452 1.00 54.37  ? 484  PHE A O     1 
ATOM   6385  C CB    . PHE C 2 84  ? 95.892  46.650 -39.327 1.00 56.62  ? 484  PHE A CB    1 
ATOM   6386  C CG    . PHE C 2 84  ? 94.654  47.205 -39.953 1.00 55.66  ? 484  PHE A CG    1 
ATOM   6387  C CD1   . PHE C 2 84  ? 94.711  48.357 -40.715 1.00 57.03  ? 484  PHE A CD1   1 
ATOM   6388  C CD2   . PHE C 2 84  ? 93.427  46.547 -39.790 1.00 56.58  ? 484  PHE A CD2   1 
ATOM   6389  C CE1   . PHE C 2 84  ? 93.582  48.855 -41.310 1.00 54.40  ? 484  PHE A CE1   1 
ATOM   6390  C CE2   . PHE C 2 84  ? 92.264  47.028 -40.381 1.00 53.71  ? 484  PHE A CE2   1 
ATOM   6391  C CZ    . PHE C 2 84  ? 92.334  48.185 -41.147 1.00 54.04  ? 484  PHE A CZ    1 
ATOM   6392  N N     . GLN C 2 85  ? 96.342  44.903 -36.487 1.00 33.41  ? 485  GLN A N     1 
ATOM   6393  C CA    . GLN C 2 85  ? 97.160  43.815 -35.970 1.00 32.52  ? 485  GLN A CA    1 
ATOM   6394  C C     . GLN C 2 85  ? 97.641  42.973 -37.149 1.00 33.28  ? 485  GLN A C     1 
ATOM   6395  O O     . GLN C 2 85  ? 96.987  42.890 -38.187 1.00 31.88  ? 485  GLN A O     1 
ATOM   6396  C CB    . GLN C 2 85  ? 96.390  42.886 -35.048 1.00 42.53  ? 485  GLN A CB    1 
ATOM   6397  C CG    . GLN C 2 85  ? 95.934  43.490 -33.763 1.00 42.98  ? 485  GLN A CG    1 
ATOM   6398  C CD    . GLN C 2 85  ? 95.371  42.436 -32.804 1.00 47.38  ? 485  GLN A CD    1 
ATOM   6399  O OE1   . GLN C 2 85  ? 94.773  41.430 -33.230 1.00 45.86  ? 485  GLN A OE1   1 
ATOM   6400  N NE2   . GLN C 2 85  ? 95.551  42.666 -31.497 1.00 47.26  ? 485  GLN A NE2   1 
ATOM   6401  N N     . SER C 2 86  ? 98.786  42.333 -36.972 1.00 45.61  ? 486  SER A N     1 
ATOM   6402  C CA    . SER C 2 86  ? 99.375  41.482 -37.978 1.00 43.89  ? 486  SER A CA    1 
ATOM   6403  C C     . SER C 2 86  ? 98.331  40.458 -38.408 1.00 42.13  ? 486  SER A C     1 
ATOM   6404  O O     . SER C 2 86  ? 98.137  40.226 -39.599 1.00 41.65  ? 486  SER A O     1 
ATOM   6405  C CB    . SER C 2 86  ? 100.581 40.767 -37.370 1.00 65.12  ? 486  SER A CB    1 
ATOM   6406  O OG    . SER C 2 86  ? 101.264 39.978 -38.319 1.00 73.96  ? 486  SER A OG    1 
ATOM   6407  N N     . SER C 2 87  ? 97.655  39.869 -37.417 1.00 41.80  ? 487  SER A N     1 
ATOM   6408  C CA    . SER C 2 87  ? 96.631  38.845 -37.635 1.00 42.87  ? 487  SER A CA    1 
ATOM   6409  C C     . SER C 2 87  ? 95.347  39.324 -38.248 1.00 41.53  ? 487  SER A C     1 
ATOM   6410  O O     . SER C 2 87  ? 94.685  38.561 -38.950 1.00 40.01  ? 487  SER A O     1 
ATOM   6411  C CB    . SER C 2 87  ? 96.273  38.130 -36.326 1.00 37.12  ? 487  SER A CB    1 
ATOM   6412  O OG    . SER C 2 87  ? 96.025  39.057 -35.286 1.00 45.04  ? 487  SER A OG    1 
ATOM   6413  N N     . ALA C 2 88  ? 94.971  40.563 -37.959 1.00 44.55  ? 488  ALA A N     1 
ATOM   6414  C CA    . ALA C 2 88  ? 93.746  41.081 -38.504 1.00 42.90  ? 488  ALA A CA    1 
ATOM   6415  C C     . ALA C 2 88  ? 93.850  41.164 -40.036 1.00 43.40  ? 488  ALA A C     1 
ATOM   6416  O O     . ALA C 2 88  ? 92.905  40.799 -40.758 1.00 42.81  ? 488  ALA A O     1 
ATOM   6417  C CB    . ALA C 2 88  ? 93.454  42.409 -37.908 1.00 41.95  ? 488  ALA A CB    1 
ATOM   6418  N N     . VAL C 2 89  ? 94.993  41.620 -40.545 1.00 29.30  ? 489  VAL A N     1 
ATOM   6419  C CA    . VAL C 2 89  ? 95.165  41.688 -41.994 1.00 30.12  ? 489  VAL A CA    1 
ATOM   6420  C C     . VAL C 2 89  ? 95.212  40.280 -42.604 1.00 32.16  ? 489  VAL A C     1 
ATOM   6421  O O     . VAL C 2 89  ? 94.688  40.037 -43.687 1.00 34.05  ? 489  VAL A O     1 
ATOM   6422  C CB    . VAL C 2 89  ? 96.448  42.438 -42.368 1.00 25.12  ? 489  VAL A CB    1 
ATOM   6423  C CG1   . VAL C 2 89  ? 96.488  42.697 -43.871 1.00 22.27  ? 489  VAL A CG1   1 
ATOM   6424  C CG2   . VAL C 2 89  ? 96.512  43.727 -41.615 1.00 23.97  ? 489  VAL A CG2   1 
ATOM   6425  N N     . MET C 2 90  ? 95.851  39.346 -41.916 1.00 43.89  ? 490  MET A N     1 
ATOM   6426  C CA    . MET C 2 90  ? 95.895  37.999 -42.439 1.00 45.59  ? 490  MET A CA    1 
ATOM   6427  C C     . MET C 2 90  ? 94.463  37.483 -42.626 1.00 42.50  ? 490  MET A C     1 
ATOM   6428  O O     . MET C 2 90  ? 94.058  37.139 -43.734 1.00 41.49  ? 490  MET A O     1 
ATOM   6429  C CB    . MET C 2 90  ? 96.715  37.093 -41.516 1.00 72.09  ? 490  MET A CB    1 
ATOM   6430  C CG    . MET C 2 90  ? 98.215  37.210 -41.764 1.00 82.49  ? 490  MET A CG    1 
ATOM   6431  S SD    . MET C 2 90  ? 98.631  36.884 -43.491 1.00 92.23  ? 490  MET A SD    1 
ATOM   6432  C CE    . MET C 2 90  ? 98.400  35.094 -43.449 1.00 92.80  ? 490  MET A CE    1 
ATOM   6433  N N     . ALA C 2 91  ? 93.700  37.457 -41.541 1.00 45.35  ? 491  ALA A N     1 
ATOM   6434  C CA    . ALA C 2 91  ? 92.303  37.043 -41.584 1.00 43.17  ? 491  ALA A CA    1 
ATOM   6435  C C     . ALA C 2 91  ? 91.587  37.667 -42.799 1.00 42.56  ? 491  ALA A C     1 
ATOM   6436  O O     . ALA C 2 91  ? 91.053  36.967 -43.643 1.00 42.98  ? 491  ALA A O     1 
ATOM   6437  C CB    . ALA C 2 91  ? 91.618  37.461 -40.289 1.00 13.98  ? 491  ALA A CB    1 
ATOM   6438  N N     . LEU C 2 92  ? 91.581  38.987 -42.887 1.00 36.75  ? 492  LEU A N     1 
ATOM   6439  C CA    . LEU C 2 92  ? 90.950  39.653 -44.017 1.00 38.17  ? 492  LEU A CA    1 
ATOM   6440  C C     . LEU C 2 92  ? 91.423  39.143 -45.364 1.00 37.98  ? 492  LEU A C     1 
ATOM   6441  O O     . LEU C 2 92  ? 90.620  39.048 -46.299 1.00 37.86  ? 492  LEU A O     1 
ATOM   6442  C CB    . LEU C 2 92  ? 91.211  41.152 -43.977 1.00 46.43  ? 492  LEU A CB    1 
ATOM   6443  C CG    . LEU C 2 92  ? 90.321  42.041 -43.114 1.00 50.25  ? 492  LEU A CG    1 
ATOM   6444  C CD1   . LEU C 2 92  ? 90.945  43.410 -43.084 1.00 50.83  ? 492  LEU A CD1   1 
ATOM   6445  C CD2   . LEU C 2 92  ? 88.913  42.114 -43.670 1.00 48.05  ? 492  LEU A CD2   1 
ATOM   6446  N N     . GLN C 2 93  ? 92.718  38.843 -45.493 1.00 40.74  ? 493  GLN A N     1 
ATOM   6447  C CA    . GLN C 2 93  ? 93.220  38.348 -46.775 1.00 43.20  ? 493  GLN A CA    1 
ATOM   6448  C C     . GLN C 2 93  ? 92.735  36.916 -47.027 1.00 40.84  ? 493  GLN A C     1 
ATOM   6449  O O     . GLN C 2 93  ? 92.320  36.559 -48.140 1.00 41.74  ? 493  GLN A O     1 
ATOM   6450  C CB    . GLN C 2 93  ? 94.759  38.399 -46.840 1.00 43.87  ? 493  GLN A CB    1 
ATOM   6451  C CG    . GLN C 2 93  ? 95.265  38.083 -48.268 1.00 44.72  ? 493  GLN A CG    1 
ATOM   6452  C CD    . GLN C 2 93  ? 96.712  38.512 -48.598 1.00 49.04  ? 493  GLN A CD    1 
ATOM   6453  O OE1   . GLN C 2 93  ? 97.158  39.618 -48.252 1.00 47.43  ? 493  GLN A OE1   1 
ATOM   6454  N NE2   . GLN C 2 93  ? 97.430  37.642 -49.310 1.00 43.63  ? 493  GLN A NE2   1 
ATOM   6455  N N     . GLU C 2 94  ? 92.780  36.120 -45.961 1.00 24.79  ? 494  GLU A N     1 
ATOM   6456  C CA    . GLU C 2 94  ? 92.385  34.739 -45.990 1.00 27.03  ? 494  GLU A CA    1 
ATOM   6457  C C     . GLU C 2 94  ? 90.975  34.675 -46.414 1.00 25.88  ? 494  GLU A C     1 
ATOM   6458  O O     . GLU C 2 94  ? 90.611  33.811 -47.191 1.00 23.76  ? 494  GLU A O     1 
ATOM   6459  C CB    . GLU C 2 94  ? 92.516  34.110 -44.616 1.00 66.93  ? 494  GLU A CB    1 
ATOM   6460  C CG    . GLU C 2 94  ? 93.870  33.530 -44.351 1.00 73.29  ? 494  GLU A CG    1 
ATOM   6461  C CD    . GLU C 2 94  ? 94.075  32.233 -45.078 1.00 74.53  ? 494  GLU A CD    1 
ATOM   6462  O OE1   . GLU C 2 94  ? 95.246  31.804 -45.130 1.00 74.90  ? 494  GLU A OE1   1 
ATOM   6463  O OE2   . GLU C 2 94  ? 93.080  31.647 -45.587 1.00 73.38  ? 494  GLU A OE2   1 
ATOM   6464  N N     . ALA C 2 95  ? 90.175  35.590 -45.894 1.00 30.08  ? 495  ALA A N     1 
ATOM   6465  C CA    . ALA C 2 95  ? 88.762  35.650 -46.220 1.00 31.65  ? 495  ALA A CA    1 
ATOM   6466  C C     . ALA C 2 95  ? 88.560  36.149 -47.629 1.00 30.50  ? 495  ALA A C     1 
ATOM   6467  O O     . ALA C 2 95  ? 87.792  35.580 -48.370 1.00 28.18  ? 495  ALA A O     1 
ATOM   6468  C CB    . ALA C 2 95  ? 88.013  36.561 -45.229 1.00 20.20  ? 495  ALA A CB    1 
ATOM   6469  N N     . SER C 2 96  ? 89.238  37.215 -48.011 1.00 41.71  ? 496  SER A N     1 
ATOM   6470  C CA    . SER C 2 96  ? 89.057  37.745 -49.362 1.00 42.89  ? 496  SER A CA    1 
ATOM   6471  C C     . SER C 2 96  ? 89.399  36.770 -50.477 1.00 43.12  ? 496  SER A C     1 
ATOM   6472  O O     . SER C 2 96  ? 88.666  36.640 -51.444 1.00 41.49  ? 496  SER A O     1 
ATOM   6473  C CB    . SER C 2 96  ? 89.883  39.013 -49.544 1.00 40.96  ? 496  SER A CB    1 
ATOM   6474  O OG    . SER C 2 96  ? 89.405  39.999 -48.664 1.00 43.39  ? 496  SER A OG    1 
ATOM   6475  N N     . GLU C 2 97  ? 90.529  36.099 -50.365 1.00 43.26  ? 497  GLU A N     1 
ATOM   6476  C CA    . GLU C 2 97  ? 90.871  35.174 -51.406 1.00 44.41  ? 497  GLU A CA    1 
ATOM   6477  C C     . GLU C 2 97  ? 89.836  34.066 -51.375 1.00 44.49  ? 497  GLU A C     1 
ATOM   6478  O O     . GLU C 2 97  ? 89.273  33.692 -52.407 1.00 43.25  ? 497  GLU A O     1 
ATOM   6479  C CB    . GLU C 2 97  ? 92.268  34.646 -51.172 1.00 89.26  ? 497  GLU A CB    1 
ATOM   6480  C CG    . GLU C 2 97  ? 93.305  35.727 -51.287 1.00 91.75  ? 497  GLU A CG    1 
ATOM   6481  C CD    . GLU C 2 97  ? 94.689  35.189 -51.087 1.00 93.83  ? 497  GLU A CD    1 
ATOM   6482  O OE1   . GLU C 2 97  ? 94.909  34.043 -51.524 1.00 89.36  ? 497  GLU A OE1   1 
ATOM   6483  O OE2   . GLU C 2 97  ? 95.552  35.894 -50.511 1.00 94.43  ? 497  GLU A OE2   1 
ATOM   6484  N N     . ALA C 2 98  ? 89.566  33.570 -50.174 1.00 36.69  ? 498  ALA A N     1 
ATOM   6485  C CA    . ALA C 2 98  ? 88.584  32.517 -49.984 1.00 39.56  ? 498  ALA A CA    1 
ATOM   6486  C C     . ALA C 2 98  ? 87.292  32.919 -50.662 1.00 38.36  ? 498  ALA A C     1 
ATOM   6487  O O     . ALA C 2 98  ? 86.672  32.137 -51.355 1.00 35.16  ? 498  ALA A O     1 
ATOM   6488  C CB    . ALA C 2 98  ? 88.345  32.304 -48.536 1.00 7.89   ? 498  ALA A CB    1 
ATOM   6489  N N     . TYR C 2 99  ? 86.890  34.152 -50.430 1.00 29.61  ? 499  TYR A N     1 
ATOM   6490  C CA    . TYR C 2 99  ? 85.702  34.703 -51.019 1.00 27.98  ? 499  TYR A CA    1 
ATOM   6491  C C     . TYR C 2 99  ? 85.920  34.738 -52.510 1.00 30.94  ? 499  TYR A C     1 
ATOM   6492  O O     . TYR C 2 99  ? 85.247  34.037 -53.202 1.00 28.86  ? 499  TYR A O     1 
ATOM   6493  C CB    . TYR C 2 99  ? 85.429  36.121 -50.487 1.00 39.69  ? 499  TYR A CB    1 
ATOM   6494  C CG    . TYR C 2 99  ? 84.382  36.849 -51.289 1.00 38.77  ? 499  TYR A CG    1 
ATOM   6495  C CD1   . TYR C 2 99  ? 83.046  36.475 -51.232 1.00 38.63  ? 499  TYR A CD1   1 
ATOM   6496  C CD2   . TYR C 2 99  ? 84.738  37.860 -52.155 1.00 41.35  ? 499  TYR A CD2   1 
ATOM   6497  C CE1   . TYR C 2 99  ? 82.092  37.088 -52.021 1.00 40.42  ? 499  TYR A CE1   1 
ATOM   6498  C CE2   . TYR C 2 99  ? 83.813  38.478 -52.947 1.00 42.68  ? 499  TYR A CE2   1 
ATOM   6499  C CZ    . TYR C 2 99  ? 82.488  38.091 -52.881 1.00 39.99  ? 499  TYR A CZ    1 
ATOM   6500  O OH    . TYR C 2 99  ? 81.566  38.730 -53.692 1.00 39.01  ? 499  TYR A OH    1 
ATOM   6501  N N     . LEU C 2 100 ? 86.854  35.534 -53.013 1.00 36.05  ? 500  LEU A N     1 
ATOM   6502  C CA    . LEU C 2 100 ? 87.076  35.605 -54.450 1.00 35.45  ? 500  LEU A CA    1 
ATOM   6503  C C     . LEU C 2 100 ? 87.214  34.264 -55.149 1.00 35.34  ? 500  LEU A C     1 
ATOM   6504  O O     . LEU C 2 100 ? 86.658  34.074 -56.240 1.00 38.47  ? 500  LEU A O     1 
ATOM   6505  C CB    . LEU C 2 100 ? 88.308  36.424 -54.761 1.00 32.25  ? 500  LEU A CB    1 
ATOM   6506  C CG    . LEU C 2 100 ? 88.029  37.916 -54.791 1.00 35.49  ? 500  LEU A CG    1 
ATOM   6507  C CD1   . LEU C 2 100 ? 89.315  38.734 -54.943 1.00 36.11  ? 500  LEU A CD1   1 
ATOM   6508  C CD2   . LEU C 2 100 ? 87.111  38.166 -55.930 1.00 32.04  ? 500  LEU A CD2   1 
ATOM   6509  N N     . VAL C 2 101 ? 87.947  33.330 -54.539 1.00 32.20  ? 501  VAL A N     1 
ATOM   6510  C CA    . VAL C 2 101 ? 88.132  32.014 -55.160 1.00 34.20  ? 501  VAL A CA    1 
ATOM   6511  C C     . VAL C 2 101 ? 86.806  31.335 -55.532 1.00 33.25  ? 501  VAL A C     1 
ATOM   6512  O O     . VAL C 2 101 ? 86.593  30.898 -56.669 1.00 33.96  ? 501  VAL A O     1 
ATOM   6513  C CB    . VAL C 2 101 ? 88.958  31.073 -54.258 1.00 14.00  ? 501  VAL A CB    1 
ATOM   6514  C CG1   . VAL C 2 101 ? 88.903  29.666 -54.809 1.00 10.84  ? 501  VAL A CG1   1 
ATOM   6515  C CG2   . VAL C 2 101 ? 90.417  31.526 -54.232 1.00 14.03  ? 501  VAL A CG2   1 
ATOM   6516  N N     . ALA C 2 102 ? 85.924  31.270 -54.550 1.00 20.60  ? 502  ALA A N     1 
ATOM   6517  C CA    . ALA C 2 102 ? 84.617  30.687 -54.695 1.00 20.60  ? 502  ALA A CA    1 
ATOM   6518  C C     . ALA C 2 102 ? 83.757  31.425 -55.733 1.00 20.25  ? 502  ALA A C     1 
ATOM   6519  O O     . ALA C 2 102 ? 82.978  30.822 -56.467 1.00 19.96  ? 502  ALA A O     1 
ATOM   6520  C CB    . ALA C 2 102 ? 83.945  30.695 -53.343 1.00 8.88   ? 502  ALA A CB    1 
ATOM   6521  N N     . LEU C 2 103 ? 83.888  32.739 -55.771 1.00 24.53  ? 503  LEU A N     1 
ATOM   6522  C CA    . LEU C 2 103 ? 83.131  33.519 -56.721 1.00 25.19  ? 503  LEU A CA    1 
ATOM   6523  C C     . LEU C 2 103 ? 83.603  33.091 -58.103 1.00 27.00  ? 503  LEU A C     1 
ATOM   6524  O O     . LEU C 2 103 ? 82.833  33.103 -59.075 1.00 27.66  ? 503  LEU A O     1 
ATOM   6525  C CB    . LEU C 2 103 ? 83.349  35.027 -56.507 1.00 26.95  ? 503  LEU A CB    1 
ATOM   6526  C CG    . LEU C 2 103 ? 82.611  35.906 -57.518 1.00 31.60  ? 503  LEU A CG    1 
ATOM   6527  C CD1   . LEU C 2 103 ? 81.162  35.547 -57.473 1.00 28.14  ? 503  LEU A CD1   1 
ATOM   6528  C CD2   . LEU C 2 103 ? 82.777  37.360 -57.220 1.00 27.06  ? 503  LEU A CD2   1 
ATOM   6529  N N     . PHE C 2 104 ? 84.866  32.685 -58.191 1.00 33.91  ? 504  PHE A N     1 
ATOM   6530  C CA    . PHE C 2 104 ? 85.374  32.242 -59.473 1.00 34.51  ? 504  PHE A CA    1 
ATOM   6531  C C     . PHE C 2 104 ? 84.809  30.888 -59.881 1.00 34.20  ? 504  PHE A C     1 
ATOM   6532  O O     . PHE C 2 104 ? 84.533  30.677 -61.048 1.00 37.65  ? 504  PHE A O     1 
ATOM   6533  C CB    . PHE C 2 104 ? 86.909  32.237 -59.490 1.00 34.90  ? 504  PHE A CB    1 
ATOM   6534  C CG    . PHE C 2 104 ? 87.506  33.554 -59.945 1.00 34.85  ? 504  PHE A CG    1 
ATOM   6535  C CD1   . PHE C 2 104 ? 88.463  34.209 -59.173 1.00 35.70  ? 504  PHE A CD1   1 
ATOM   6536  C CD2   . PHE C 2 104 ? 87.032  34.187 -61.091 1.00 37.13  ? 504  PHE A CD2   1 
ATOM   6537  C CE1   . PHE C 2 104 ? 88.913  35.480 -59.518 1.00 38.53  ? 504  PHE A CE1   1 
ATOM   6538  C CE2   . PHE C 2 104 ? 87.478  35.460 -61.439 1.00 36.74  ? 504  PHE A CE2   1 
ATOM   6539  C CZ    . PHE C 2 104 ? 88.419  36.104 -60.652 1.00 38.14  ? 504  PHE A CZ    1 
ATOM   6540  N N     . GLU C 2 105 ? 84.594  29.980 -58.938 1.00 49.66  ? 505  GLU A N     1 
ATOM   6541  C CA    . GLU C 2 105 ? 84.038  28.689 -59.316 1.00 51.04  ? 505  GLU A CA    1 
ATOM   6542  C C     . GLU C 2 105 ? 82.629  28.892 -59.871 1.00 49.49  ? 505  GLU A C     1 
ATOM   6543  O O     . GLU C 2 105 ? 82.245  28.303 -60.884 1.00 51.46  ? 505  GLU A O     1 
ATOM   6544  C CB    . GLU C 2 105 ? 83.970  27.736 -58.125 1.00 72.86  ? 505  GLU A CB    1 
ATOM   6545  C CG    . GLU C 2 105 ? 85.061  27.923 -57.116 1.00 80.49  ? 505  GLU A CG    1 
ATOM   6546  C CD    . GLU C 2 105 ? 85.094  26.823 -56.070 1.00 84.37  ? 505  GLU A CD    1 
ATOM   6547  O OE1   . GLU C 2 105 ? 84.015  26.291 -55.705 1.00 84.20  ? 505  GLU A OE1   1 
ATOM   6548  O OE2   . GLU C 2 105 ? 86.210  26.502 -55.600 1.00 82.78  ? 505  GLU A OE2   1 
ATOM   6549  N N     . ASP C 2 106 ? 81.837  29.726 -59.221 1.00 41.33  ? 506  ASP A N     1 
ATOM   6550  C CA    . ASP C 2 106 ? 80.500  29.925 -59.736 1.00 41.36  ? 506  ASP A CA    1 
ATOM   6551  C C     . ASP C 2 106 ? 80.498  30.581 -61.109 1.00 40.65  ? 506  ASP A C     1 
ATOM   6552  O O     . ASP C 2 106 ? 79.636  30.294 -61.941 1.00 41.74  ? 506  ASP A O     1 
ATOM   6553  C CB    . ASP C 2 106 ? 79.668  30.770 -58.778 1.00 74.74  ? 506  ASP A CB    1 
ATOM   6554  C CG    . ASP C 2 106 ? 79.392  30.067 -57.482 1.00 75.32  ? 506  ASP A CG    1 
ATOM   6555  O OD1   . ASP C 2 106 ? 79.333  28.816 -57.476 1.00 78.72  ? 506  ASP A OD1   1 
ATOM   6556  O OD2   . ASP C 2 106 ? 79.215  30.775 -56.469 1.00 80.27  ? 506  ASP A OD2   1 
ATOM   6557  N N     . THR C 2 107 ? 81.448  31.480 -61.337 1.00 32.77  ? 507  THR A N     1 
ATOM   6558  C CA    . THR C 2 107 ? 81.520  32.168 -62.617 1.00 32.68  ? 507  THR A CA    1 
ATOM   6559  C C     . THR C 2 107 ? 81.854  31.166 -63.704 1.00 34.14  ? 507  THR A C     1 
ATOM   6560  O O     . THR C 2 107 ? 81.258  31.173 -64.775 1.00 34.72  ? 507  THR A O     1 
ATOM   6561  C CB    . THR C 2 107 ? 82.594  33.274 -62.601 1.00 49.05  ? 507  THR A CB    1 
ATOM   6562  O OG1   . THR C 2 107 ? 82.172  34.345 -61.752 1.00 43.93  ? 507  THR A OG1   1 
ATOM   6563  C CG2   . THR C 2 107 ? 82.813  33.809 -63.988 1.00 45.56  ? 507  THR A CG2   1 
ATOM   6564  N N     . ASN C 2 108 ? 82.816  30.301 -63.412 1.00 47.86  ? 508  ASN A N     1 
ATOM   6565  C CA    . ASN C 2 108 ? 83.228  29.298 -64.368 1.00 48.17  ? 508  ASN A CA    1 
ATOM   6566  C C     . ASN C 2 108 ? 81.997  28.513 -64.758 1.00 48.85  ? 508  ASN A C     1 
ATOM   6567  O O     . ASN C 2 108 ? 81.731  28.318 -65.936 1.00 45.56  ? 508  ASN A O     1 
ATOM   6568  C CB    . ASN C 2 108 ? 84.284  28.387 -63.757 1.00 44.89  ? 508  ASN A CB    1 
ATOM   6569  C CG    . ASN C 2 108 ? 84.981  27.549 -64.793 1.00 48.50  ? 508  ASN A CG    1 
ATOM   6570  O OD1   . ASN C 2 108 ? 85.151  27.982 -65.924 1.00 46.73  ? 508  ASN A OD1   1 
ATOM   6571  N ND2   . ASN C 2 108 ? 85.399  26.357 -64.416 1.00 49.01  ? 508  ASN A ND2   1 
ATOM   6572  N N     . LEU C 2 109 ? 81.244  28.060 -63.765 1.00 44.92  ? 509  LEU A N     1 
ATOM   6573  C CA    . LEU C 2 109 ? 80.003  27.352 -64.031 1.00 47.95  ? 509  LEU A CA    1 
ATOM   6574  C C     . LEU C 2 109 ? 79.012  28.133 -64.939 1.00 48.61  ? 509  LEU A C     1 
ATOM   6575  O O     . LEU C 2 109 ? 78.350  27.541 -65.780 1.00 48.96  ? 509  LEU A O     1 
ATOM   6576  C CB    . LEU C 2 109 ? 79.316  27.026 -62.710 1.00 38.02  ? 509  LEU A CB    1 
ATOM   6577  C CG    . LEU C 2 109 ? 79.951  25.857 -61.999 1.00 42.09  ? 509  LEU A CG    1 
ATOM   6578  C CD1   . LEU C 2 109 ? 79.171  25.505 -60.760 1.00 41.22  ? 509  LEU A CD1   1 
ATOM   6579  C CD2   . LEU C 2 109 ? 79.988  24.708 -62.960 1.00 39.17  ? 509  LEU A CD2   1 
ATOM   6580  N N     . CYS C 2 110 ? 78.902  29.446 -64.746 1.00 44.14  ? 510  CYS A N     1 
ATOM   6581  C CA    . CYS C 2 110 ? 78.007  30.286 -65.538 1.00 45.81  ? 510  CYS A CA    1 
ATOM   6582  C C     . CYS C 2 110 ? 78.486  30.436 -66.954 1.00 48.25  ? 510  CYS A C     1 
ATOM   6583  O O     . CYS C 2 110 ? 77.692  30.669 -67.855 1.00 46.88  ? 510  CYS A O     1 
ATOM   6584  C CB    . CYS C 2 110 ? 77.855  31.670 -64.912 1.00 54.86  ? 510  CYS A CB    1 
ATOM   6585  S SG    . CYS C 2 110 ? 77.018  31.600 -63.326 1.00 56.76  ? 510  CYS A SG    1 
ATOM   6586  N N     . ALA C 2 111 ? 79.796  30.307 -67.136 1.00 34.57  ? 511  ALA A N     1 
ATOM   6587  C CA    . ALA C 2 111 ? 80.431  30.393 -68.452 1.00 34.62  ? 511  ALA A CA    1 
ATOM   6588  C C     . ALA C 2 111 ? 80.092  29.103 -69.205 1.00 34.20  ? 511  ALA A C     1 
ATOM   6589  O O     . ALA C 2 111 ? 79.614  29.131 -70.336 1.00 35.20  ? 511  ALA A O     1 
ATOM   6590  C CB    . ALA C 2 111 ? 81.947  30.525 -68.289 1.00 32.36  ? 511  ALA A CB    1 
ATOM   6591  N N     . ILE C 2 112 ? 80.348  27.976 -68.541 1.00 37.31  ? 512  ILE A N     1 
ATOM   6592  C CA    . ILE C 2 112 ? 80.083  26.657 -69.077 1.00 38.59  ? 512  ILE A CA    1 
ATOM   6593  C C     . ILE C 2 112 ? 78.596  26.498 -69.336 1.00 39.50  ? 512  ILE A C     1 
ATOM   6594  O O     . ILE C 2 112 ? 78.190  25.852 -70.284 1.00 36.91  ? 512  ILE A O     1 
ATOM   6595  C CB    . ILE C 2 112 ? 80.538  25.585 -68.089 1.00 45.18  ? 512  ILE A CB    1 
ATOM   6596  C CG1   . ILE C 2 112 ? 81.977  25.868 -67.660 1.00 43.80  ? 512  ILE A CG1   1 
ATOM   6597  C CG2   . ILE C 2 112 ? 80.502  24.231 -68.726 1.00 47.11  ? 512  ILE A CG2   1 
ATOM   6598  C CD1   . ILE C 2 112 ? 82.642  24.751 -66.869 1.00 44.47  ? 512  ILE A CD1   1 
ATOM   6599  N N     . HIS C 2 113 ? 77.762  27.091 -68.504 1.00 63.15  ? 513  HIS A N     1 
ATOM   6600  C CA    . HIS C 2 113 ? 76.344  26.948 -68.742 1.00 62.86  ? 513  HIS A CA    1 
ATOM   6601  C C     . HIS C 2 113 ? 75.999  27.596 -70.061 1.00 64.28  ? 513  HIS A C     1 
ATOM   6602  O O     . HIS C 2 113 ? 75.036  27.209 -70.722 1.00 62.30  ? 513  HIS A O     1 
ATOM   6603  C CB    . HIS C 2 113 ? 75.529  27.604 -67.643 1.00 62.26  ? 513  HIS A CB    1 
ATOM   6604  C CG    . HIS C 2 113 ? 74.055  27.483 -67.855 1.00 61.21  ? 513  HIS A CG    1 
ATOM   6605  N ND1   . HIS C 2 113 ? 73.243  28.568 -68.123 1.00 62.36  ? 513  HIS A ND1   1 
ATOM   6606  C CD2   . HIS C 2 113 ? 73.246  26.399 -67.843 1.00 60.17  ? 513  HIS A CD2   1 
ATOM   6607  C CE1   . HIS C 2 113 ? 71.996  28.159 -68.261 1.00 60.66  ? 513  HIS A CE1   1 
ATOM   6608  N NE2   . HIS C 2 113 ? 71.971  26.848 -68.095 1.00 59.14  ? 513  HIS A NE2   1 
ATOM   6609  N N     . ALA C 2 114 ? 76.794  28.584 -70.444 1.00 47.03  ? 514  ALA A N     1 
ATOM   6610  C CA    . ALA C 2 114 ? 76.564  29.304 -71.688 1.00 48.33  ? 514  ALA A CA    1 
ATOM   6611  C C     . ALA C 2 114 ? 77.459  28.820 -72.845 1.00 48.80  ? 514  ALA A C     1 
ATOM   6612  O O     . ALA C 2 114 ? 77.802  29.593 -73.747 1.00 50.37  ? 514  ALA A O     1 
ATOM   6613  C CB    . ALA C 2 114 ? 76.745  30.800 -71.449 1.00 44.53  ? 514  ALA A CB    1 
ATOM   6614  N N     . LYS C 2 115 ? 77.796  27.528 -72.813 1.00 46.83  ? 515  LYS A N     1 
ATOM   6615  C CA    . LYS C 2 115 ? 78.638  26.876 -73.828 1.00 51.14  ? 515  LYS A CA    1 
ATOM   6616  C C     . LYS C 2 115 ? 79.917  27.674 -74.139 1.00 50.83  ? 515  LYS A C     1 
ATOM   6617  O O     . LYS C 2 115 ? 80.208  27.989 -75.292 1.00 50.99  ? 515  LYS A O     1 
ATOM   6618  C CB    . LYS C 2 115 ? 77.816  26.642 -75.104 1.00 76.13  ? 515  LYS A CB    1 
ATOM   6619  C CG    . LYS C 2 115 ? 76.605  25.733 -74.878 1.00 82.85  ? 515  LYS A CG    1 
ATOM   6620  C CD    . LYS C 2 115 ? 75.380  26.109 -75.729 1.00 87.81  ? 515  LYS A CD    1 
ATOM   6621  C CE    . LYS C 2 115 ? 74.171  25.240 -75.338 1.00 92.56  ? 515  LYS A CE    1 
ATOM   6622  N NZ    . LYS C 2 115 ? 72.836  25.738 -75.819 1.00 95.63  ? 515  LYS A NZ    1 
ATOM   6623  N N     . HIS C 2 116 ? 80.664  27.982 -73.078 1.00 60.23  ? 516  HIS A N     1 
ATOM   6624  C CA    . HIS C 2 116 ? 81.906  28.749 -73.124 1.00 59.27  ? 516  HIS A CA    1 
ATOM   6625  C C     . HIS C 2 116 ? 82.915  28.172 -72.164 1.00 59.62  ? 516  HIS A C     1 
ATOM   6626  O O     . HIS C 2 116 ? 82.603  27.309 -71.351 1.00 57.92  ? 516  HIS A O     1 
ATOM   6627  C CB    . HIS C 2 116 ? 81.675  30.171 -72.669 1.00 90.28  ? 516  HIS A CB    1 
ATOM   6628  C CG    . HIS C 2 116 ? 80.951  31.008 -73.654 1.00 90.11  ? 516  HIS A CG    1 
ATOM   6629  N ND1   . HIS C 2 116 ? 80.606  32.315 -73.393 1.00 67.54  ? 516  HIS A ND1   1 
ATOM   6630  C CD2   . HIS C 2 116 ? 80.549  30.751 -74.918 1.00 67.54  ? 516  HIS A CD2   1 
ATOM   6631  C CE1   . HIS C 2 116 ? 80.026  32.831 -74.460 1.00 67.54  ? 516  HIS A CE1   1 
ATOM   6632  N NE2   . HIS C 2 116 ? 79.978  31.902 -75.400 1.00 67.54  ? 516  HIS A NE2   1 
ATOM   6633  N N     . VAL C 2 117 ? 84.118  28.708 -72.218 1.00 55.91  ? 517  VAL A N     1 
ATOM   6634  C CA    . VAL C 2 117 ? 85.182  28.250 -71.352 1.00 55.20  ? 517  VAL A CA    1 
ATOM   6635  C C     . VAL C 2 117 ? 86.019  29.450 -70.901 1.00 54.41  ? 517  VAL A C     1 
ATOM   6636  O O     . VAL C 2 117 ? 86.998  29.333 -70.157 1.00 56.39  ? 517  VAL A O     1 
ATOM   6637  C CB    . VAL C 2 117 ? 86.036  27.244 -72.102 1.00 45.82  ? 517  VAL A CB    1 
ATOM   6638  C CG1   . VAL C 2 117 ? 85.298  25.941 -72.230 1.00 41.41  ? 517  VAL A CG1   1 
ATOM   6639  C CG2   . VAL C 2 117 ? 86.361  27.799 -73.484 1.00 42.96  ? 517  VAL A CG2   1 
ATOM   6640  N N     . THR C 2 118 ? 85.598  30.617 -71.339 1.00 37.44  ? 518  THR A N     1 
ATOM   6641  C CA    . THR C 2 118 ? 86.273  31.838 -70.998 1.00 37.80  ? 518  THR A CA    1 
ATOM   6642  C C     . THR C 2 118 ? 85.332  32.557 -70.057 1.00 37.54  ? 518  THR A C     1 
ATOM   6643  O O     . THR C 2 118 ? 84.259  32.984 -70.481 1.00 36.92  ? 518  THR A O     1 
ATOM   6644  C CB    . THR C 2 118 ? 86.488  32.738 -72.274 1.00 38.19  ? 518  THR A CB    1 
ATOM   6645  O OG1   . THR C 2 118 ? 87.253  32.030 -73.259 1.00 41.16  ? 518  THR A OG1   1 
ATOM   6646  C CG2   . THR C 2 118 ? 87.212  34.039 -71.920 1.00 38.40  ? 518  THR A CG2   1 
ATOM   6647  N N     . ILE C 2 119 ? 85.693  32.707 -68.788 1.00 33.31  ? 519  ILE A N     1 
ATOM   6648  C CA    . ILE C 2 119 ? 84.799  33.432 -67.882 1.00 32.78  ? 519  ILE A CA    1 
ATOM   6649  C C     . ILE C 2 119 ? 84.830  34.942 -68.231 1.00 33.66  ? 519  ILE A C     1 
ATOM   6650  O O     . ILE C 2 119 ? 85.902  35.578 -68.218 1.00 34.16  ? 519  ILE A O     1 
ATOM   6651  C CB    . ILE C 2 119 ? 85.221  33.264 -66.438 1.00 24.24  ? 519  ILE A CB    1 
ATOM   6652  C CG1   . ILE C 2 119 ? 86.614  33.846 -66.250 1.00 19.97  ? 519  ILE A CG1   1 
ATOM   6653  C CG2   . ILE C 2 119 ? 85.253  31.825 -66.073 1.00 20.62  ? 519  ILE A CG2   1 
ATOM   6654  C CD1   . ILE C 2 119 ? 86.869  34.318 -64.847 1.00 24.78  ? 519  ILE A CD1   1 
ATOM   6655  N N     . MET C 2 120 ? 83.660  35.510 -68.537 1.00 31.58  ? 520  MET A N     1 
ATOM   6656  C CA    . MET C 2 120 ? 83.551  36.921 -68.894 1.00 30.68  ? 520  MET A CA    1 
ATOM   6657  C C     . MET C 2 120 ? 82.828  37.773 -67.862 1.00 31.18  ? 520  MET A C     1 
ATOM   6658  O O     . MET C 2 120 ? 82.180  37.258 -67.007 1.00 28.68  ? 520  MET A O     1 
ATOM   6659  C CB    . MET C 2 120 ? 82.910  37.024 -70.257 1.00 75.72  ? 520  MET A CB    1 
ATOM   6660  C CG    . MET C 2 120 ? 83.708  36.227 -71.243 1.00 79.69  ? 520  MET A CG    1 
ATOM   6661  S SD    . MET C 2 120 ? 83.466  36.816 -72.872 1.00 84.03  ? 520  MET A SD    1 
ATOM   6662  C CE    . MET C 2 120 ? 82.735  35.331 -73.689 1.00 83.29  ? 520  MET A CE    1 
ATOM   6663  N N     . PRO C 2 121 ? 82.956  39.108 -67.931 1.00 59.78  ? 521  PRO A N     1 
ATOM   6664  C CA    . PRO C 2 121 ? 82.291  39.977 -66.950 1.00 61.77  ? 521  PRO A CA    1 
ATOM   6665  C C     . PRO C 2 121 ? 80.858  39.638 -66.628 1.00 62.90  ? 521  PRO A C     1 
ATOM   6666  O O     . PRO C 2 121 ? 80.477  39.550 -65.458 1.00 61.93  ? 521  PRO A O     1 
ATOM   6667  C CB    . PRO C 2 121 ? 82.423  41.360 -67.575 1.00 51.81  ? 521  PRO A CB    1 
ATOM   6668  C CG    . PRO C 2 121 ? 83.749  41.275 -68.231 1.00 52.89  ? 521  PRO A CG    1 
ATOM   6669  C CD    . PRO C 2 121 ? 83.671  39.926 -68.928 1.00 54.16  ? 521  PRO A CD    1 
ATOM   6670  N N     . LYS C 2 122 ? 80.064  39.455 -67.673 1.00 50.96  ? 522  LYS A N     1 
ATOM   6671  C CA    . LYS C 2 122 ? 78.666  39.152 -67.480 1.00 51.13  ? 522  LYS A CA    1 
ATOM   6672  C C     . LYS C 2 122 ? 78.536  37.837 -66.710 1.00 50.10  ? 522  LYS A C     1 
ATOM   6673  O O     . LYS C 2 122 ? 77.601  37.644 -65.959 1.00 49.98  ? 522  LYS A O     1 
ATOM   6674  C CB    . LYS C 2 122 ? 77.946  39.118 -68.835 1.00 64.01  ? 522  LYS A CB    1 
ATOM   6675  C CG    . LYS C 2 122 ? 77.909  37.782 -69.520 1.00 70.03  ? 522  LYS A CG    1 
ATOM   6676  C CD    . LYS C 2 122 ? 77.350  37.899 -70.938 1.00 75.20  ? 522  LYS A CD    1 
ATOM   6677  C CE    . LYS C 2 122 ? 78.473  38.178 -71.955 1.00 79.23  ? 522  LYS A CE    1 
ATOM   6678  N NZ    . LYS C 2 122 ? 78.286  37.524 -73.311 1.00 84.28  ? 522  LYS A NZ    1 
ATOM   6679  N N     . ASP C 2 123 ? 79.491  36.939 -66.877 1.00 36.63  ? 523  ASP A N     1 
ATOM   6680  C CA    . ASP C 2 123 ? 79.459  35.681 -66.145 1.00 37.35  ? 523  ASP A CA    1 
ATOM   6681  C C     . ASP C 2 123 ? 79.632  35.964 -64.649 1.00 34.92  ? 523  ASP A C     1 
ATOM   6682  O O     . ASP C 2 123 ? 79.079  35.277 -63.820 1.00 32.59  ? 523  ASP A O     1 
ATOM   6683  C CB    . ASP C 2 123 ? 80.556  34.717 -66.649 1.00 55.03  ? 523  ASP A CB    1 
ATOM   6684  C CG    . ASP C 2 123 ? 80.341  34.264 -68.116 1.00 57.85  ? 523  ASP A CG    1 
ATOM   6685  O OD1   . ASP C 2 123 ? 79.191  34.004 -68.506 1.00 56.98  ? 523  ASP A OD1   1 
ATOM   6686  O OD2   . ASP C 2 123 ? 81.317  34.142 -68.888 1.00 55.63  ? 523  ASP A OD2   1 
ATOM   6687  N N     . ILE C 2 124 ? 80.398  36.982 -64.286 1.00 27.89  ? 524  ILE A N     1 
ATOM   6688  C CA    . ILE C 2 124 ? 80.556  37.294 -62.878 1.00 29.42  ? 524  ILE A CA    1 
ATOM   6689  C C     . ILE C 2 124 ? 79.284  37.967 -62.436 1.00 28.21  ? 524  ILE A C     1 
ATOM   6690  O O     . ILE C 2 124 ? 78.726  37.632 -61.396 1.00 28.88  ? 524  ILE A O     1 
ATOM   6691  C CB    . ILE C 2 124 ? 81.725  38.258 -62.588 1.00 35.97  ? 524  ILE A CB    1 
ATOM   6692  C CG1   . ILE C 2 124 ? 83.027  37.502 -62.567 1.00 39.68  ? 524  ILE A CG1   1 
ATOM   6693  C CG2   . ILE C 2 124 ? 81.584  38.856 -61.184 1.00 36.87  ? 524  ILE A CG2   1 
ATOM   6694  C CD1   . ILE C 2 124 ? 84.165  38.392 -62.226 1.00 41.06  ? 524  ILE A CD1   1 
ATOM   6695  N N     . GLN C 2 125 ? 78.838  38.923 -63.249 1.00 29.64  ? 525  GLN A N     1 
ATOM   6696  C CA    . GLN C 2 125 ? 77.635  39.691 -62.983 1.00 33.68  ? 525  GLN A CA    1 
ATOM   6697  C C     . GLN C 2 125 ? 76.452  38.818 -62.568 1.00 31.27  ? 525  GLN A C     1 
ATOM   6698  O O     . GLN C 2 125 ? 75.830  39.052 -61.531 1.00 33.77  ? 525  GLN A O     1 
ATOM   6699  C CB    . GLN C 2 125 ? 77.317  40.519 -64.214 1.00 78.43  ? 525  GLN A CB    1 
ATOM   6700  C CG    . GLN C 2 125 ? 78.237  41.718 -64.340 1.00 85.76  ? 525  GLN A CG    1 
ATOM   6701  C CD    . GLN C 2 125 ? 78.051  42.457 -65.645 1.00 88.43  ? 525  GLN A CD    1 
ATOM   6702  O OE1   . GLN C 2 125 ? 76.935  42.543 -66.172 1.00 89.54  ? 525  GLN A OE1   1 
ATOM   6703  N NE2   . GLN C 2 125 ? 79.140  43.007 -66.172 1.00 94.34  ? 525  GLN A NE2   1 
ATOM   6704  N N     . LEU C 2 126 ? 76.176  37.797 -63.370 1.00 39.79  ? 526  LEU A N     1 
ATOM   6705  C CA    . LEU C 2 126 ? 75.091  36.865 -63.125 1.00 40.00  ? 526  LEU A CA    1 
ATOM   6706  C C     . LEU C 2 126 ? 75.255  36.139 -61.822 1.00 41.58  ? 526  LEU A C     1 
ATOM   6707  O O     . LEU C 2 126 ? 74.302  35.983 -61.059 1.00 40.49  ? 526  LEU A O     1 
ATOM   6708  C CB    . LEU C 2 126 ? 75.029  35.818 -64.235 1.00 40.13  ? 526  LEU A CB    1 
ATOM   6709  C CG    . LEU C 2 126 ? 74.141  34.588 -64.002 1.00 40.92  ? 526  LEU A CG    1 
ATOM   6710  C CD1   . LEU C 2 126 ? 72.678  34.978 -64.027 1.00 40.59  ? 526  LEU A CD1   1 
ATOM   6711  C CD2   . LEU C 2 126 ? 74.433  33.552 -65.075 1.00 37.63  ? 526  LEU A CD2   1 
ATOM   6712  N N     . ALA C 2 127 ? 76.466  35.662 -61.581 1.00 36.51  ? 527  ALA A N     1 
ATOM   6713  C CA    . ALA C 2 127 ? 76.719  34.912 -60.351 1.00 36.70  ? 527  ALA A CA    1 
ATOM   6714  C C     . ALA C 2 127 ? 76.370  35.764 -59.124 1.00 37.62  ? 527  ALA A C     1 
ATOM   6715  O O     . ALA C 2 127 ? 75.584  35.337 -58.267 1.00 36.40  ? 527  ALA A O     1 
ATOM   6716  C CB    . ALA C 2 127 ? 78.196  34.405 -60.303 1.00 30.36  ? 527  ALA A CB    1 
ATOM   6717  N N     . ARG C 2 128 ? 76.920  36.975 -59.062 1.00 28.58  ? 528  ARG A N     1 
ATOM   6718  C CA    . ARG C 2 128 ? 76.641  37.855 -57.937 1.00 27.59  ? 528  ARG A CA    1 
ATOM   6719  C C     . ARG C 2 128 ? 75.170  38.209 -57.752 1.00 29.88  ? 528  ARG A C     1 
ATOM   6720  O O     . ARG C 2 128 ? 74.705  38.347 -56.621 1.00 29.52  ? 528  ARG A O     1 
ATOM   6721  C CB    . ARG C 2 128 ? 77.500  39.098 -57.993 1.00 43.94  ? 528  ARG A CB    1 
ATOM   6722  C CG    . ARG C 2 128 ? 78.944  38.828 -57.669 1.00 45.16  ? 528  ARG A CG    1 
ATOM   6723  C CD    . ARG C 2 128 ? 79.686  40.146 -57.580 1.00 52.90  ? 528  ARG A CD    1 
ATOM   6724  N NE    . ARG C 2 128 ? 79.104  40.989 -56.542 1.00 53.42  ? 528  ARG A NE    1 
ATOM   6725  C CZ    . ARG C 2 128 ? 78.873  42.290 -56.675 1.00 55.94  ? 528  ARG A CZ    1 
ATOM   6726  N NH1   . ARG C 2 128 ? 79.181  42.909 -57.808 1.00 56.52  ? 528  ARG A NH1   1 
ATOM   6727  N NH2   . ARG C 2 128 ? 78.309  42.973 -55.684 1.00 58.39  ? 528  ARG A NH2   1 
ATOM   6728  N N     . ARG C 2 129 ? 74.442  38.305 -58.861 1.00 55.26  ? 529  ARG A N     1 
ATOM   6729  C CA    . ARG C 2 129 ? 73.010  38.599 -58.839 1.00 58.63  ? 529  ARG A CA    1 
ATOM   6730  C C     . ARG C 2 129 ? 72.274  37.406 -58.264 1.00 57.37  ? 529  ARG A C     1 
ATOM   6731  O O     . ARG C 2 129 ? 71.331  37.553 -57.497 1.00 55.74  ? 529  ARG A O     1 
ATOM   6732  C CB    . ARG C 2 129 ? 72.487  38.862 -60.249 1.00 54.24  ? 529  ARG A CB    1 
ATOM   6733  C CG    . ARG C 2 129 ? 71.062  39.353 -60.305 1.00 61.61  ? 529  ARG A CG    1 
ATOM   6734  C CD    . ARG C 2 129 ? 70.104  38.329 -59.719 1.00 66.48  ? 529  ARG A CD    1 
ATOM   6735  N NE    . ARG C 2 129 ? 68.691  38.720 -59.691 1.00 66.02  ? 529  ARG A NE    1 
ATOM   6736  C CZ    . ARG C 2 129 ? 67.726  37.945 -59.190 1.00 65.77  ? 529  ARG A CZ    1 
ATOM   6737  N NH1   . ARG C 2 129 ? 68.032  36.752 -58.671 1.00 58.12  ? 529  ARG A NH1   1 
ATOM   6738  N NH2   . ARG C 2 129 ? 66.454  38.341 -59.230 1.00 67.69  ? 529  ARG A NH2   1 
ATOM   6739  N N     . ILE C 2 130 ? 72.694  36.212 -58.645 1.00 67.13  ? 530  ILE A N     1 
ATOM   6740  C CA    . ILE C 2 130 ? 72.038  35.012 -58.152 1.00 68.92  ? 530  ILE A CA    1 
ATOM   6741  C C     . ILE C 2 130 ? 72.467  34.641 -56.736 1.00 69.95  ? 530  ILE A C     1 
ATOM   6742  O O     . ILE C 2 130 ? 71.928  33.709 -56.156 1.00 69.35  ? 530  ILE A O     1 
ATOM   6743  C CB    . ILE C 2 130 ? 72.270  33.844 -59.121 1.00 33.98  ? 530  ILE A CB    1 
ATOM   6744  C CG1   . ILE C 2 130 ? 71.571  34.149 -60.424 1.00 35.11  ? 530  ILE A CG1   1 
ATOM   6745  C CG2   . ILE C 2 130 ? 71.705  32.562 -58.586 1.00 31.68  ? 530  ILE A CG2   1 
ATOM   6746  C CD1   . ILE C 2 130 ? 71.677  33.038 -61.404 1.00 40.47  ? 530  ILE A CD1   1 
ATOM   6747  N N     . ARG C 2 131 ? 73.433  35.361 -56.172 1.00 52.17  ? 531  ARG A N     1 
ATOM   6748  C CA    . ARG C 2 131 ? 73.843  35.072 -54.798 1.00 53.68  ? 531  ARG A CA    1 
ATOM   6749  C C     . ARG C 2 131 ? 73.228  36.072 -53.845 1.00 56.24  ? 531  ARG A C     1 
ATOM   6750  O O     . ARG C 2 131 ? 73.404  35.969 -52.629 1.00 57.73  ? 531  ARG A O     1 
ATOM   6751  C CB    . ARG C 2 131 ? 75.349  35.121 -54.623 1.00 50.31  ? 531  ARG A CB    1 
ATOM   6752  C CG    . ARG C 2 131 ? 76.101  33.889 -55.058 1.00 48.80  ? 531  ARG A CG    1 
ATOM   6753  C CD    . ARG C 2 131 ? 77.552  34.229 -55.111 1.00 49.12  ? 531  ARG A CD    1 
ATOM   6754  N NE    . ARG C 2 131 ? 78.388  33.108 -54.752 1.00 51.94  ? 531  ARG A NE    1 
ATOM   6755  C CZ    . ARG C 2 131 ? 79.631  33.240 -54.306 1.00 50.56  ? 531  ARG A CZ    1 
ATOM   6756  N NH1   . ARG C 2 131 ? 80.169  34.457 -54.170 1.00 42.95  ? 531  ARG A NH1   1 
ATOM   6757  N NH2   . ARG C 2 131 ? 80.333  32.157 -53.997 1.00 48.76  ? 531  ARG A NH2   1 
ATOM   6758  N N     . GLY C 2 132 ? 72.513  37.040 -54.411 1.00 72.29  ? 532  GLY A N     1 
ATOM   6759  C CA    . GLY C 2 132 ? 71.859  38.050 -53.612 1.00 75.44  ? 532  GLY A CA    1 
ATOM   6760  C C     . GLY C 2 132 ? 72.797  39.187 -53.332 1.00 78.66  ? 532  GLY A C     1 
ATOM   6761  O O     . GLY C 2 132 ? 72.455  40.115 -52.615 1.00 78.43  ? 532  GLY A O     1 
ATOM   6762  N N     . GLU C 2 133 ? 73.995  39.123 -53.891 1.00 106.64 ? 533  GLU A N     1 
ATOM   6763  C CA    . GLU C 2 133 ? 74.955  40.191 -53.676 1.00 110.77 ? 533  GLU A CA    1 
ATOM   6764  C C     . GLU C 2 133 ? 74.486  41.472 -54.379 1.00 116.02 ? 533  GLU A C     1 
ATOM   6765  O O     . GLU C 2 133 ? 75.154  42.507 -54.328 1.00 116.90 ? 533  GLU A O     1 
ATOM   6766  C CB    . GLU C 2 133 ? 76.347  39.744 -54.157 1.00 83.14  ? 533  GLU A CB    1 
ATOM   6767  C CG    . GLU C 2 133 ? 77.010  38.736 -53.188 1.00 78.30  ? 533  GLU A CG    1 
ATOM   6768  C CD    . GLU C 2 133 ? 78.330  38.170 -53.691 1.00 78.12  ? 533  GLU A CD    1 
ATOM   6769  O OE1   . GLU C 2 133 ? 79.091  38.935 -54.312 1.00 74.82  ? 533  GLU A OE1   1 
ATOM   6770  O OE2   . GLU C 2 133 ? 78.611  36.971 -53.453 1.00 75.89  ? 533  GLU A OE2   1 
ATOM   6771  N N     . ARG C 2 134 ? 73.317  41.389 -55.017 1.00 110.51 ? 534  ARG A N     1 
ATOM   6772  C CA    . ARG C 2 134 ? 72.725  42.525 -55.719 1.00 117.75 ? 534  ARG A CA    1 
ATOM   6773  C C     . ARG C 2 134 ? 71.228  42.669 -55.434 1.00 120.88 ? 534  ARG A C     1 
ATOM   6774  O O     . ARG C 2 134 ? 70.764  43.734 -55.010 1.00 122.25 ? 534  ARG A O     1 
ATOM   6775  C CB    . ARG C 2 134 ? 72.935  42.400 -57.232 1.00 165.80 ? 534  ARG A CB    1 
ATOM   6776  C CG    . ARG C 2 134 ? 74.306  42.827 -57.718 1.00 167.77 ? 534  ARG A CG    1 
ATOM   6777  C CD    . ARG C 2 134 ? 74.319  42.918 -59.231 1.00 169.74 ? 534  ARG A CD    1 
ATOM   6778  N NE    . ARG C 2 134 ? 75.531  43.552 -59.739 1.00 174.00 ? 534  ARG A NE    1 
ATOM   6779  C CZ    . ARG C 2 134 ? 76.740  43.001 -59.702 1.00 174.53 ? 534  ARG A CZ    1 
ATOM   6780  N NH1   . ARG C 2 134 ? 76.905  41.793 -59.180 1.00 176.59 ? 534  ARG A NH1   1 
ATOM   6781  N NH2   . ARG C 2 134 ? 77.785  43.657 -60.188 1.00 175.74 ? 534  ARG A NH2   1 
ATOM   6782  N N     . ALA C 2 135 ? 70.480  41.592 -55.667 1.00 202.22 ? 535  ALA A N     1 
ATOM   6783  C CA    . ALA C 2 135 ? 69.032  41.586 -55.454 1.00 202.22 ? 535  ALA A CA    1 
ATOM   6784  C C     . ALA C 2 135 ? 68.627  41.860 -53.994 1.00 202.22 ? 535  ALA A C     1 
ATOM   6785  O O     . ALA C 2 135 ? 69.530  41.867 -53.125 1.00 174.91 ? 535  ALA A O     1 
ATOM   6786  C CB    . ALA C 2 135 ? 68.450  40.244 -55.928 1.00 130.34 ? 535  ALA A CB    1 
ATOM   6787  O OXT   . ALA C 2 135 ? 67.412  42.070 -53.733 1.00 94.00  ? 535  ALA A OXT   1 
ATOM   6788  N N     . ASP D 3 24  ? 98.244  53.643 -57.544 1.00 87.71  ? 24   ASP B N     1 
ATOM   6789  C CA    . ASP D 3 24  ? 96.872  53.328 -57.040 1.00 81.40  ? 24   ASP B CA    1 
ATOM   6790  C C     . ASP D 3 24  ? 96.881  51.945 -56.383 1.00 75.40  ? 24   ASP B C     1 
ATOM   6791  O O     . ASP D 3 24  ? 97.351  50.976 -56.977 1.00 74.54  ? 24   ASP B O     1 
ATOM   6792  C CB    . ASP D 3 24  ? 95.872  53.359 -58.196 1.00 142.37 ? 24   ASP B CB    1 
ATOM   6793  C CG    . ASP D 3 24  ? 94.635  54.174 -57.871 1.00 143.69 ? 24   ASP B CG    1 
ATOM   6794  O OD1   . ASP D 3 24  ? 93.903  53.808 -56.925 1.00 145.29 ? 24   ASP B OD1   1 
ATOM   6795  O OD2   . ASP D 3 24  ? 94.398  55.186 -58.563 1.00 144.04 ? 24   ASP B OD2   1 
ATOM   6796  N N     . ASN D 3 25  ? 96.352  51.850 -55.165 1.00 74.53  ? 25   ASN B N     1 
ATOM   6797  C CA    . ASN D 3 25  ? 96.357  50.585 -54.414 1.00 67.88  ? 25   ASN B CA    1 
ATOM   6798  C C     . ASN D 3 25  ? 95.517  49.405 -54.937 1.00 64.61  ? 25   ASN B C     1 
ATOM   6799  O O     . ASN D 3 25  ? 95.953  48.247 -54.901 1.00 63.27  ? 25   ASN B O     1 
ATOM   6800  C CB    . ASN D 3 25  ? 95.997  50.871 -52.951 1.00 68.35  ? 25   ASN B CB    1 
ATOM   6801  C CG    . ASN D 3 25  ? 97.105  51.605 -52.224 1.00 67.64  ? 25   ASN B CG    1 
ATOM   6802  O OD1   . ASN D 3 25  ? 98.240  51.123 -52.141 1.00 65.21  ? 25   ASN B OD1   1 
ATOM   6803  N ND2   . ASN D 3 25  ? 96.785  52.783 -51.700 1.00 66.06  ? 25   ASN B ND2   1 
ATOM   6804  N N     . ILE D 3 26  ? 94.315  49.696 -55.412 1.00 50.12  ? 26   ILE B N     1 
ATOM   6805  C CA    . ILE D 3 26  ? 93.466  48.647 -55.925 1.00 47.77  ? 26   ILE B CA    1 
ATOM   6806  C C     . ILE D 3 26  ? 94.151  48.026 -57.118 1.00 46.81  ? 26   ILE B C     1 
ATOM   6807  O O     . ILE D 3 26  ? 94.023  46.817 -57.354 1.00 45.66  ? 26   ILE B O     1 
ATOM   6808  C CB    . ILE D 3 26  ? 92.118  49.183 -56.357 1.00 26.77  ? 26   ILE B CB    1 
ATOM   6809  C CG1   . ILE D 3 26  ? 91.166  48.001 -56.603 1.00 26.02  ? 26   ILE B CG1   1 
ATOM   6810  C CG2   . ILE D 3 26  ? 92.291  50.019 -57.578 1.00 26.53  ? 26   ILE B CG2   1 
ATOM   6811  C CD1   . ILE D 3 26  ? 91.168  46.914 -55.514 1.00 21.87  ? 26   ILE B CD1   1 
ATOM   6812  N N     . GLN D 3 27  ? 94.872  48.865 -57.868 1.00 41.91  ? 27   GLN B N     1 
ATOM   6813  C CA    . GLN D 3 27  ? 95.632  48.420 -59.042 1.00 41.16  ? 27   GLN B CA    1 
ATOM   6814  C C     . GLN D 3 27  ? 96.841  47.636 -58.546 1.00 41.49  ? 27   GLN B C     1 
ATOM   6815  O O     . GLN D 3 27  ? 97.561  47.000 -59.317 1.00 42.35  ? 27   GLN B O     1 
ATOM   6816  C CB    . GLN D 3 27  ? 96.091  49.613 -59.853 1.00 61.53  ? 27   GLN B CB    1 
ATOM   6817  C CG    . GLN D 3 27  ? 94.963  50.444 -60.433 1.00 60.29  ? 27   GLN B CG    1 
ATOM   6818  C CD    . GLN D 3 27  ? 94.130  49.689 -61.450 1.00 59.95  ? 27   GLN B CD    1 
ATOM   6819  O OE1   . GLN D 3 27  ? 94.580  48.691 -62.039 1.00 61.12  ? 27   GLN B OE1   1 
ATOM   6820  N NE2   . GLN D 3 27  ? 92.907  50.175 -61.680 1.00 55.24  ? 27   GLN B NE2   1 
ATOM   6821  N N     . GLY D 3 28  ? 97.030  47.700 -57.230 1.00 71.40  ? 28   GLY B N     1 
ATOM   6822  C CA    . GLY D 3 28  ? 98.106  46.992 -56.577 1.00 70.35  ? 28   GLY B CA    1 
ATOM   6823  C C     . GLY D 3 28  ? 97.832  45.505 -56.622 1.00 69.67  ? 28   GLY B C     1 
ATOM   6824  O O     . GLY D 3 28  ? 98.761  44.704 -56.560 1.00 69.13  ? 28   GLY B O     1 
ATOM   6825  N N     . ILE D 3 29  ? 96.553  45.132 -56.706 1.00 64.16  ? 29   ILE B N     1 
ATOM   6826  C CA    . ILE D 3 29  ? 96.165  43.725 -56.800 1.00 61.93  ? 29   ILE B CA    1 
ATOM   6827  C C     . ILE D 3 29  ? 96.374  43.407 -58.268 1.00 61.47  ? 29   ILE B C     1 
ATOM   6828  O O     . ILE D 3 29  ? 95.588  43.796 -59.129 1.00 62.20  ? 29   ILE B O     1 
ATOM   6829  C CB    . ILE D 3 29  ? 94.707  43.524 -56.397 1.00 44.80  ? 29   ILE B CB    1 
ATOM   6830  C CG1   . ILE D 3 29  ? 94.464  44.186 -55.052 1.00 43.52  ? 29   ILE B CG1   1 
ATOM   6831  C CG2   . ILE D 3 29  ? 94.421  42.022 -56.230 1.00 42.89  ? 29   ILE B CG2   1 
ATOM   6832  C CD1   . ILE D 3 29  ? 95.305  43.592 -53.927 1.00 44.88  ? 29   ILE B CD1   1 
ATOM   6833  N N     . THR D 3 30  ? 97.453  42.699 -58.540 1.00 46.79  ? 30   THR B N     1 
ATOM   6834  C CA    . THR D 3 30  ? 97.848  42.408 -59.900 1.00 47.37  ? 30   THR B CA    1 
ATOM   6835  C C     . THR D 3 30  ? 97.149  41.310 -60.681 1.00 48.71  ? 30   THR B C     1 
ATOM   6836  O O     . THR D 3 30  ? 96.556  40.382 -60.120 1.00 49.06  ? 30   THR B O     1 
ATOM   6837  C CB    . THR D 3 30  ? 99.339  42.092 -59.941 1.00 41.78  ? 30   THR B CB    1 
ATOM   6838  O OG1   . THR D 3 30  ? 99.573  40.833 -59.287 1.00 41.88  ? 30   THR B OG1   1 
ATOM   6839  C CG2   . THR D 3 30  ? 100.131 43.195 -59.236 1.00 40.96  ? 30   THR B CG2   1 
ATOM   6840  N N     . LYS D 3 31  ? 97.262  41.427 -62.002 1.00 46.37  ? 31   LYS B N     1 
ATOM   6841  C CA    . LYS D 3 31  ? 96.726  40.455 -62.948 1.00 47.43  ? 31   LYS B CA    1 
ATOM   6842  C C     . LYS D 3 31  ? 97.265  39.058 -62.613 1.00 47.45  ? 31   LYS B C     1 
ATOM   6843  O O     . LYS D 3 31  ? 96.516  38.111 -62.516 1.00 48.12  ? 31   LYS B O     1 
ATOM   6844  C CB    . LYS D 3 31  ? 97.132  40.861 -64.367 1.00 64.18  ? 31   LYS B CB    1 
ATOM   6845  C CG    . LYS D 3 31  ? 96.861  39.830 -65.430 1.00 67.16  ? 31   LYS B CG    1 
ATOM   6846  C CD    . LYS D 3 31  ? 97.013  40.445 -66.789 1.00 71.74  ? 31   LYS B CD    1 
ATOM   6847  C CE    . LYS D 3 31  ? 96.915  39.412 -67.873 1.00 73.27  ? 31   LYS B CE    1 
ATOM   6848  N NZ    . LYS D 3 31  ? 96.589  40.109 -69.152 1.00 75.33  ? 31   LYS B NZ    1 
ATOM   6849  N N     . PRO D 3 32  ? 98.577  38.915 -62.427 1.00 49.96  ? 32   PRO B N     1 
ATOM   6850  C CA    . PRO D 3 32  ? 99.121  37.594 -62.092 1.00 50.01  ? 32   PRO B CA    1 
ATOM   6851  C C     . PRO D 3 32  ? 98.443  37.013 -60.845 1.00 47.90  ? 32   PRO B C     1 
ATOM   6852  O O     . PRO D 3 32  ? 98.092  35.826 -60.799 1.00 49.76  ? 32   PRO B O     1 
ATOM   6853  C CB    . PRO D 3 32  ? 100.576 37.892 -61.817 1.00 59.67  ? 32   PRO B CB    1 
ATOM   6854  C CG    . PRO D 3 32  ? 100.831 39.044 -62.681 1.00 59.77  ? 32   PRO B CG    1 
ATOM   6855  C CD    . PRO D 3 32  ? 99.645  39.914 -62.467 1.00 59.19  ? 32   PRO B CD    1 
ATOM   6856  N N     . ALA D 3 33  ? 98.269  37.865 -59.833 1.00 39.58  ? 33   ALA B N     1 
ATOM   6857  C CA    . ALA D 3 33  ? 97.630  37.456 -58.580 1.00 38.93  ? 33   ALA B CA    1 
ATOM   6858  C C     . ALA D 3 33  ? 96.162  37.052 -58.774 1.00 38.28  ? 33   ALA B C     1 
ATOM   6859  O O     . ALA D 3 33  ? 95.709  36.029 -58.239 1.00 38.18  ? 33   ALA B O     1 
ATOM   6860  C CB    . ALA D 3 33  ? 97.755  38.572 -57.543 1.00 50.63  ? 33   ALA B CB    1 
ATOM   6861  N N     . ILE D 3 34  ? 95.440  37.864 -59.550 1.00 39.79  ? 34   ILE B N     1 
ATOM   6862  C CA    . ILE D 3 34  ? 94.036  37.621 -59.869 1.00 41.10  ? 34   ILE B CA    1 
ATOM   6863  C C     . ILE D 3 34  ? 93.937  36.370 -60.738 1.00 43.14  ? 34   ILE B C     1 
ATOM   6864  O O     . ILE D 3 34  ? 93.124  35.488 -60.456 1.00 42.30  ? 34   ILE B O     1 
ATOM   6865  C CB    . ILE D 3 34  ? 93.410  38.834 -60.599 1.00 17.96  ? 34   ILE B CB    1 
ATOM   6866  C CG1   . ILE D 3 34  ? 93.206  39.994 -59.619 1.00 18.44  ? 34   ILE B CG1   1 
ATOM   6867  C CG2   . ILE D 3 34  ? 92.056  38.482 -61.181 1.00 17.70  ? 34   ILE B CG2   1 
ATOM   6868  C CD1   . ILE D 3 34  ? 92.702  41.285 -60.276 1.00 18.47  ? 34   ILE B CD1   1 
ATOM   6869  N N     . ARG D 3 35  ? 94.771  36.282 -61.773 1.00 42.78  ? 35   ARG B N     1 
ATOM   6870  C CA    . ARG D 3 35  ? 94.794  35.113 -62.637 1.00 43.82  ? 35   ARG B CA    1 
ATOM   6871  C C     . ARG D 3 35  ? 95.085  33.882 -61.793 1.00 43.60  ? 35   ARG B C     1 
ATOM   6872  O O     . ARG D 3 35  ? 94.564  32.796 -62.081 1.00 43.62  ? 35   ARG B O     1 
ATOM   6873  C CB    . ARG D 3 35  ? 95.859  35.247 -63.718 1.00 56.42  ? 35   ARG B CB    1 
ATOM   6874  C CG    . ARG D 3 35  ? 96.259  33.931 -64.344 1.00 62.61  ? 35   ARG B CG    1 
ATOM   6875  C CD    . ARG D 3 35  ? 96.926  34.149 -65.660 1.00 68.61  ? 35   ARG B CD    1 
ATOM   6876  N NE    . ARG D 3 35  ? 96.151  35.100 -66.445 1.00 74.67  ? 35   ARG B NE    1 
ATOM   6877  C CZ    . ARG D 3 35  ? 96.131  35.158 -67.777 1.00 77.47  ? 35   ARG B CZ    1 
ATOM   6878  N NH1   . ARG D 3 35  ? 96.850  34.312 -68.506 1.00 78.87  ? 35   ARG B NH1   1 
ATOM   6879  N NH2   . ARG D 3 35  ? 95.380  36.070 -68.387 1.00 81.02  ? 35   ARG B NH2   1 
ATOM   6880  N N     . ARG D 3 36  ? 95.917  34.029 -60.763 1.00 51.84  ? 36   ARG B N     1 
ATOM   6881  C CA    . ARG D 3 36  ? 96.204  32.890 -59.905 1.00 51.44  ? 36   ARG B CA    1 
ATOM   6882  C C     . ARG D 3 36  ? 94.930  32.498 -59.171 1.00 49.04  ? 36   ARG B C     1 
ATOM   6883  O O     . ARG D 3 36  ? 94.531  31.351 -59.226 1.00 48.94  ? 36   ARG B O     1 
ATOM   6884  C CB    . ARG D 3 36  ? 97.299  33.192 -58.879 1.00 40.23  ? 36   ARG B CB    1 
ATOM   6885  C CG    . ARG D 3 36  ? 98.724  33.058 -59.373 1.00 42.42  ? 36   ARG B CG    1 
ATOM   6886  C CD    . ARG D 3 36  ? 99.697  32.953 -58.213 1.00 41.47  ? 36   ARG B CD    1 
ATOM   6887  N NE    . ARG D 3 36  ? 99.807  34.185 -57.444 1.00 40.72  ? 36   ARG B NE    1 
ATOM   6888  C CZ    . ARG D 3 36  ? 100.420 35.282 -57.871 1.00 43.07  ? 36   ARG B CZ    1 
ATOM   6889  N NH1   . ARG D 3 36  ? 100.977 35.313 -59.060 1.00 41.75  ? 36   ARG B NH1   1 
ATOM   6890  N NH2   . ARG D 3 36  ? 100.485 36.345 -57.101 1.00 40.30  ? 36   ARG B NH2   1 
ATOM   6891  N N     . LEU D 3 37  ? 94.279  33.428 -58.482 1.00 34.27  ? 37   LEU B N     1 
ATOM   6892  C CA    . LEU D 3 37  ? 93.046  33.077 -57.778 1.00 34.83  ? 37   LEU B CA    1 
ATOM   6893  C C     . LEU D 3 37  ? 92.078  32.283 -58.654 1.00 33.19  ? 37   LEU B C     1 
ATOM   6894  O O     . LEU D 3 37  ? 91.592  31.213 -58.266 1.00 34.56  ? 37   LEU B O     1 
ATOM   6895  C CB    . LEU D 3 37  ? 92.337  34.332 -57.315 1.00 24.20  ? 37   LEU B CB    1 
ATOM   6896  C CG    . LEU D 3 37  ? 93.113  35.078 -56.254 1.00 27.69  ? 37   LEU B CG    1 
ATOM   6897  C CD1   . LEU D 3 37  ? 92.478  36.448 -56.085 1.00 29.85  ? 37   LEU B CD1   1 
ATOM   6898  C CD2   . LEU D 3 37  ? 93.145  34.269 -54.965 1.00 24.07  ? 37   LEU B CD2   1 
ATOM   6899  N N     . ALA D 3 38  ? 91.794  32.839 -59.829 1.00 35.13  ? 38   ALA B N     1 
ATOM   6900  C CA    . ALA D 3 38  ? 90.884  32.213 -60.762 1.00 35.70  ? 38   ALA B CA    1 
ATOM   6901  C C     . ALA D 3 38  ? 91.314  30.799 -61.061 1.00 35.53  ? 38   ALA B C     1 
ATOM   6902  O O     . ALA D 3 38  ? 90.490  29.908 -61.286 1.00 32.90  ? 38   ALA B O     1 
ATOM   6903  C CB    . ALA D 3 38  ? 90.805  33.010 -62.036 1.00 24.01  ? 38   ALA B CB    1 
ATOM   6904  N N     . ARG D 3 39  ? 92.607  30.557 -61.075 1.00 35.39  ? 39   ARG B N     1 
ATOM   6905  C CA    . ARG D 3 39  ? 93.026  29.202 -61.348 1.00 34.79  ? 39   ARG B CA    1 
ATOM   6906  C C     . ARG D 3 39  ? 92.659  28.272 -60.183 1.00 35.70  ? 39   ARG B C     1 
ATOM   6907  O O     . ARG D 3 39  ? 92.291  27.119 -60.385 1.00 36.40  ? 39   ARG B O     1 
ATOM   6908  C CB    . ARG D 3 39  ? 94.522  29.179 -61.667 1.00 40.70  ? 39   ARG B CB    1 
ATOM   6909  C CG    . ARG D 3 39  ? 94.801  29.984 -62.899 1.00 41.41  ? 39   ARG B CG    1 
ATOM   6910  C CD    . ARG D 3 39  ? 95.896  29.372 -63.790 1.00 43.60  ? 39   ARG B CD    1 
ATOM   6911  N NE    . ARG D 3 39  ? 95.971  30.081 -65.064 1.00 45.95  ? 39   ARG B NE    1 
ATOM   6912  C CZ    . ARG D 3 39  ? 94.969  30.077 -65.917 1.00 49.90  ? 39   ARG B CZ    1 
ATOM   6913  N NH1   . ARG D 3 39  ? 93.899  29.381 -65.603 1.00 47.40  ? 39   ARG B NH1   1 
ATOM   6914  N NH2   . ARG D 3 39  ? 94.980  30.835 -67.005 1.00 46.54  ? 39   ARG B NH2   1 
ATOM   6915  N N     . ARG D 3 40  ? 92.727  28.765 -58.957 1.00 39.22  ? 40   ARG B N     1 
ATOM   6916  C CA    . ARG D 3 40  ? 92.377  27.894 -57.854 1.00 37.74  ? 40   ARG B CA    1 
ATOM   6917  C C     . ARG D 3 40  ? 90.887  27.611 -57.959 1.00 38.07  ? 40   ARG B C     1 
ATOM   6918  O O     . ARG D 3 40  ? 90.382  26.634 -57.425 1.00 37.23  ? 40   ARG B O     1 
ATOM   6919  C CB    . ARG D 3 40  ? 92.732  28.553 -56.532 1.00 31.02  ? 40   ARG B CB    1 
ATOM   6920  C CG    . ARG D 3 40  ? 92.666  27.635 -55.347 1.00 34.67  ? 40   ARG B CG    1 
ATOM   6921  C CD    . ARG D 3 40  ? 93.288  28.291 -54.160 1.00 35.93  ? 40   ARG B CD    1 
ATOM   6922  N NE    . ARG D 3 40  ? 94.705  27.969 -54.039 1.00 37.91  ? 40   ARG B NE    1 
ATOM   6923  C CZ    . ARG D 3 40  ? 95.501  28.488 -53.110 1.00 39.10  ? 40   ARG B CZ    1 
ATOM   6924  N NH1   . ARG D 3 40  ? 95.026  29.362 -52.243 1.00 35.40  ? 40   ARG B NH1   1 
ATOM   6925  N NH2   . ARG D 3 40  ? 96.752  28.086 -53.002 1.00 39.18  ? 40   ARG B NH2   1 
ATOM   6926  N N     . GLY D 3 41  ? 90.190  28.469 -58.691 1.00 37.29  ? 41   GLY B N     1 
ATOM   6927  C CA    . GLY D 3 41  ? 88.764  28.300 -58.883 1.00 38.11  ? 41   GLY B CA    1 
ATOM   6928  C C     . GLY D 3 41  ? 88.477  27.394 -60.050 1.00 39.19  ? 41   GLY B C     1 
ATOM   6929  O O     . GLY D 3 41  ? 87.334  27.203 -60.450 1.00 40.57  ? 41   GLY B O     1 
ATOM   6930  N N     . GLY D 3 42  ? 89.540  26.846 -60.613 1.00 38.00  ? 42   GLY B N     1 
ATOM   6931  C CA    . GLY D 3 42  ? 89.405  25.945 -61.736 1.00 37.94  ? 42   GLY B CA    1 
ATOM   6932  C C     . GLY D 3 42  ? 89.066  26.636 -63.028 1.00 38.85  ? 42   GLY B C     1 
ATOM   6933  O O     . GLY D 3 42  ? 88.478  26.025 -63.900 1.00 40.08  ? 42   GLY B O     1 
ATOM   6934  N N     . VAL D 3 43  ? 89.450  27.901 -63.157 1.00 39.58  ? 43   VAL B N     1 
ATOM   6935  C CA    . VAL D 3 43  ? 89.183  28.702 -64.348 1.00 40.28  ? 43   VAL B CA    1 
ATOM   6936  C C     . VAL D 3 43  ? 90.305  28.551 -65.359 1.00 42.33  ? 43   VAL B C     1 
ATOM   6937  O O     . VAL D 3 43  ? 91.441  28.845 -65.037 1.00 39.69  ? 43   VAL B O     1 
ATOM   6938  C CB    . VAL D 3 43  ? 89.051  30.163 -63.928 1.00 24.99  ? 43   VAL B CB    1 
ATOM   6939  C CG1   . VAL D 3 43  ? 89.306  31.132 -65.098 1.00 23.66  ? 43   VAL B CG1   1 
ATOM   6940  C CG2   . VAL D 3 43  ? 87.704  30.359 -63.337 1.00 24.84  ? 43   VAL B CG2   1 
ATOM   6941  N N     . LYS D 3 44  ? 89.988  28.125 -66.580 1.00 70.35  ? 44   LYS B N     1 
ATOM   6942  C CA    . LYS D 3 44  ? 91.009  27.923 -67.623 1.00 71.76  ? 44   LYS B CA    1 
ATOM   6943  C C     . LYS D 3 44  ? 91.393  29.103 -68.519 1.00 72.55  ? 44   LYS B C     1 
ATOM   6944  O O     . LYS D 3 44  ? 92.571  29.328 -68.763 1.00 72.49  ? 44   LYS B O     1 
ATOM   6945  C CB    . LYS D 3 44  ? 90.595  26.761 -68.527 1.00 71.40  ? 44   LYS B CB    1 
ATOM   6946  C CG    . LYS D 3 44  ? 91.560  26.459 -69.669 1.00 75.49  ? 44   LYS B CG    1 
ATOM   6947  C CD    . LYS D 3 44  ? 91.174  25.152 -70.357 1.00 73.11  ? 44   LYS B CD    1 
ATOM   6948  C CE    . LYS D 3 44  ? 92.234  24.691 -71.338 1.00 74.09  ? 44   LYS B CE    1 
ATOM   6949  N NZ    . LYS D 3 44  ? 91.923  23.327 -71.844 1.00 71.37  ? 44   LYS B NZ    1 
ATOM   6950  N N     . ARG D 3 45  ? 90.404  29.829 -69.032 1.00 49.16  ? 45   ARG B N     1 
ATOM   6951  C CA    . ARG D 3 45  ? 90.640  30.962 -69.924 1.00 48.98  ? 45   ARG B CA    1 
ATOM   6952  C C     . ARG D 3 45  ? 89.961  32.230 -69.346 1.00 48.87  ? 45   ARG B C     1 
ATOM   6953  O O     . ARG D 3 45  ? 88.753  32.223 -69.028 1.00 45.03  ? 45   ARG B O     1 
ATOM   6954  C CB    . ARG D 3 45  ? 90.100  30.602 -71.301 1.00 56.55  ? 45   ARG B CB    1 
ATOM   6955  C CG    . ARG D 3 45  ? 90.622  31.445 -72.418 1.00 57.78  ? 45   ARG B CG    1 
ATOM   6956  C CD    . ARG D 3 45  ? 90.576  30.656 -73.720 1.00 56.49  ? 45   ARG B CD    1 
ATOM   6957  N NE    . ARG D 3 45  ? 91.176  31.371 -74.842 1.00 58.63  ? 45   ARG B NE    1 
ATOM   6958  C CZ    . ARG D 3 45  ? 90.555  32.330 -75.518 1.00 62.20  ? 45   ARG B CZ    1 
ATOM   6959  N NH1   . ARG D 3 45  ? 89.317  32.679 -75.183 1.00 58.93  ? 45   ARG B NH1   1 
ATOM   6960  N NH2   . ARG D 3 45  ? 91.167  32.937 -76.528 1.00 63.68  ? 45   ARG B NH2   1 
ATOM   6961  N N     . ILE D 3 46  ? 90.739  33.313 -69.218 1.00 38.59  ? 46   ILE B N     1 
ATOM   6962  C CA    . ILE D 3 46  ? 90.263  34.552 -68.614 1.00 38.83  ? 46   ILE B CA    1 
ATOM   6963  C C     . ILE D 3 46  ? 90.217  35.796 -69.470 1.00 39.62  ? 46   ILE B C     1 
ATOM   6964  O O     . ILE D 3 46  ? 91.240  36.403 -69.753 1.00 41.24  ? 46   ILE B O     1 
ATOM   6965  C CB    . ILE D 3 46  ? 91.107  34.912 -67.356 1.00 35.12  ? 46   ILE B CB    1 
ATOM   6966  C CG1   . ILE D 3 46  ? 90.958  33.847 -66.289 1.00 34.51  ? 46   ILE B CG1   1 
ATOM   6967  C CG2   . ILE D 3 46  ? 90.629  36.185 -66.736 1.00 33.29  ? 46   ILE B CG2   1 
ATOM   6968  C CD1   . ILE D 3 46  ? 91.708  34.194 -65.025 1.00 39.10  ? 46   ILE B CD1   1 
ATOM   6969  N N     . SER D 3 47  ? 89.013  36.192 -69.846 1.00 45.71  ? 47   SER B N     1 
ATOM   6970  C CA    . SER D 3 47  ? 88.794  37.405 -70.610 1.00 45.47  ? 47   SER B CA    1 
ATOM   6971  C C     . SER D 3 47  ? 89.551  38.612 -70.010 1.00 45.39  ? 47   SER B C     1 
ATOM   6972  O O     . SER D 3 47  ? 89.763  38.703 -68.795 1.00 45.40  ? 47   SER B O     1 
ATOM   6973  C CB    . SER D 3 47  ? 87.313  37.714 -70.647 1.00 52.78  ? 47   SER B CB    1 
ATOM   6974  O OG    . SER D 3 47  ? 87.126  39.071 -70.978 1.00 56.99  ? 47   SER B OG    1 
ATOM   6975  N N     . GLY D 3 48  ? 89.942  39.543 -70.878 1.00 48.56  ? 48   GLY B N     1 
ATOM   6976  C CA    . GLY D 3 48  ? 90.690  40.693 -70.433 1.00 47.33  ? 48   GLY B CA    1 
ATOM   6977  C C     . GLY D 3 48  ? 89.962  41.553 -69.434 1.00 49.26  ? 48   GLY B C     1 
ATOM   6978  O O     . GLY D 3 48  ? 90.548  42.021 -68.455 1.00 51.76  ? 48   GLY B O     1 
ATOM   6979  N N     . LEU D 3 49  ? 88.677  41.759 -69.674 1.00 39.17  ? 49   LEU B N     1 
ATOM   6980  C CA    . LEU D 3 49  ? 87.866  42.602 -68.825 1.00 39.39  ? 49   LEU B CA    1 
ATOM   6981  C C     . LEU D 3 49  ? 87.596  42.105 -67.393 1.00 39.24  ? 49   LEU B C     1 
ATOM   6982  O O     . LEU D 3 49  ? 87.065  42.838 -66.565 1.00 39.44  ? 49   LEU B O     1 
ATOM   6983  C CB    . LEU D 3 49  ? 86.559  42.867 -69.552 1.00 38.95  ? 49   LEU B CB    1 
ATOM   6984  C CG    . LEU D 3 49  ? 86.706  43.725 -70.800 1.00 41.37  ? 49   LEU B CG    1 
ATOM   6985  C CD1   . LEU D 3 49  ? 85.387  43.797 -71.527 1.00 41.05  ? 49   LEU B CD1   1 
ATOM   6986  C CD2   . LEU D 3 49  ? 87.204  45.110 -70.390 1.00 40.23  ? 49   LEU B CD2   1 
ATOM   6987  N N     . ILE D 3 50  ? 87.972  40.869 -67.093 1.00 43.91  ? 50   ILE B N     1 
ATOM   6988  C CA    . ILE D 3 50  ? 87.770  40.293 -65.765 1.00 42.44  ? 50   ILE B CA    1 
ATOM   6989  C C     . ILE D 3 50  ? 88.559  40.919 -64.627 1.00 43.03  ? 50   ILE B C     1 
ATOM   6990  O O     . ILE D 3 50  ? 88.112  40.917 -63.486 1.00 40.97  ? 50   ILE B O     1 
ATOM   6991  C CB    . ILE D 3 50  ? 88.092  38.790 -65.770 1.00 50.73  ? 50   ILE B CB    1 
ATOM   6992  C CG1   . ILE D 3 50  ? 87.024  38.040 -66.577 1.00 48.14  ? 50   ILE B CG1   1 
ATOM   6993  C CG2   . ILE D 3 50  ? 88.226  38.271 -64.340 1.00 45.10  ? 50   ILE B CG2   1 
ATOM   6994  C CD1   . ILE D 3 50  ? 85.623  38.090 -65.984 1.00 49.77  ? 50   ILE B CD1   1 
ATOM   6995  N N     . TYR D 3 51  ? 89.719  41.467 -64.922 1.00 56.53  ? 51   TYR B N     1 
ATOM   6996  C CA    . TYR D 3 51  ? 90.532  42.023 -63.856 1.00 55.72  ? 51   TYR B CA    1 
ATOM   6997  C C     . TYR D 3 51  ? 89.967  43.307 -63.219 1.00 54.67  ? 51   TYR B C     1 
ATOM   6998  O O     . TYR D 3 51  ? 89.836  43.376 -61.993 1.00 55.27  ? 51   TYR B O     1 
ATOM   6999  C CB    . TYR D 3 51  ? 91.972  42.224 -64.352 1.00 39.03  ? 51   TYR B CB    1 
ATOM   7000  C CG    . TYR D 3 51  ? 92.548  41.036 -65.103 1.00 37.46  ? 51   TYR B CG    1 
ATOM   7001  C CD1   . TYR D 3 51  ? 93.112  39.950 -64.424 1.00 36.36  ? 51   TYR B CD1   1 
ATOM   7002  C CD2   . TYR D 3 51  ? 92.474  40.978 -66.503 1.00 38.01  ? 51   TYR B CD2   1 
ATOM   7003  C CE1   . TYR D 3 51  ? 93.585  38.819 -65.132 1.00 38.24  ? 51   TYR B CE1   1 
ATOM   7004  C CE2   . TYR D 3 51  ? 92.933  39.874 -67.210 1.00 34.75  ? 51   TYR B CE2   1 
ATOM   7005  C CZ    . TYR D 3 51  ? 93.481  38.792 -66.525 1.00 38.26  ? 51   TYR B CZ    1 
ATOM   7006  O OH    . TYR D 3 51  ? 93.846  37.674 -67.247 1.00 40.24  ? 51   TYR B OH    1 
ATOM   7007  N N     . GLU D 3 52  ? 89.621  44.322 -64.006 1.00 66.89  ? 52   GLU B N     1 
ATOM   7008  C CA    . GLU D 3 52  ? 89.064  45.512 -63.363 1.00 66.91  ? 52   GLU B CA    1 
ATOM   7009  C C     . GLU D 3 52  ? 87.730  45.151 -62.744 1.00 65.80  ? 52   GLU B C     1 
ATOM   7010  O O     . GLU D 3 52  ? 87.292  45.785 -61.794 1.00 63.78  ? 52   GLU B O     1 
ATOM   7011  C CB    . GLU D 3 52  ? 88.850  46.681 -64.333 1.00 60.40  ? 52   GLU B CB    1 
ATOM   7012  C CG    . GLU D 3 52  ? 90.091  47.523 -64.640 1.00 65.02  ? 52   GLU B CG    1 
ATOM   7013  C CD    . GLU D 3 52  ? 90.827  48.034 -63.403 1.00 66.86  ? 52   GLU B CD    1 
ATOM   7014  O OE1   . GLU D 3 52  ? 90.196  48.711 -62.557 1.00 68.72  ? 52   GLU B OE1   1 
ATOM   7015  O OE2   . GLU D 3 52  ? 92.049  47.766 -63.288 1.00 68.71  ? 52   GLU B OE2   1 
ATOM   7016  N N     . GLU D 3 53  ? 87.077  44.138 -63.301 1.00 65.96  ? 53   GLU B N     1 
ATOM   7017  C CA    . GLU D 3 53  ? 85.791  43.692 -62.778 1.00 63.23  ? 53   GLU B CA    1 
ATOM   7018  C C     . GLU D 3 53  ? 86.059  43.082 -61.400 1.00 63.14  ? 53   GLU B C     1 
ATOM   7019  O O     . GLU D 3 53  ? 85.332  43.338 -60.439 1.00 61.14  ? 53   GLU B O     1 
ATOM   7020  C CB    . GLU D 3 53  ? 85.184  42.637 -63.711 1.00 83.97  ? 53   GLU B CB    1 
ATOM   7021  C CG    . GLU D 3 53  ? 83.718  42.278 -63.459 1.00 85.79  ? 53   GLU B CG    1 
ATOM   7022  C CD    . GLU D 3 53  ? 82.742  43.320 -64.017 1.00 91.26  ? 53   GLU B CD    1 
ATOM   7023  O OE1   . GLU D 3 53  ? 83.030  43.868 -65.102 1.00 92.93  ? 53   GLU B OE1   1 
ATOM   7024  O OE2   . GLU D 3 53  ? 81.684  43.586 -63.390 1.00 94.69  ? 53   GLU B OE2   1 
ATOM   7025  N N     . THR D 3 54  ? 87.139  42.309 -61.315 1.00 34.44  ? 54   THR B N     1 
ATOM   7026  C CA    . THR D 3 54  ? 87.504  41.631 -60.094 1.00 33.51  ? 54   THR B CA    1 
ATOM   7027  C C     . THR D 3 54  ? 87.841  42.516 -58.966 1.00 34.69  ? 54   THR B C     1 
ATOM   7028  O O     . THR D 3 54  ? 87.332  42.331 -57.872 1.00 33.06  ? 54   THR B O     1 
ATOM   7029  C CB    . THR D 3 54  ? 88.661  40.706 -60.336 1.00 39.56  ? 54   THR B CB    1 
ATOM   7030  O OG1   . THR D 3 54  ? 88.220  39.703 -61.257 1.00 41.86  ? 54   THR B OG1   1 
ATOM   7031  C CG2   . THR D 3 54  ? 89.152  40.052 -59.026 1.00 39.43  ? 54   THR B CG2   1 
ATOM   7032  N N     . ARG D 3 55  ? 88.711  43.479 -59.217 1.00 56.41  ? 55   ARG B N     1 
ATOM   7033  C CA    . ARG D 3 55  ? 89.114  44.397 -58.163 1.00 58.17  ? 55   ARG B CA    1 
ATOM   7034  C C     . ARG D 3 55  ? 87.892  45.084 -57.568 1.00 56.34  ? 55   ARG B C     1 
ATOM   7035  O O     . ARG D 3 55  ? 87.849  45.381 -56.383 1.00 58.98  ? 55   ARG B O     1 
ATOM   7036  C CB    . ARG D 3 55  ? 90.084  45.441 -58.714 1.00 48.68  ? 55   ARG B CB    1 
ATOM   7037  C CG    . ARG D 3 55  ? 91.282  44.844 -59.392 1.00 47.57  ? 55   ARG B CG    1 
ATOM   7038  C CD    . ARG D 3 55  ? 92.380  45.876 -59.623 1.00 52.92  ? 55   ARG B CD    1 
ATOM   7039  N NE    . ARG D 3 55  ? 93.514  45.252 -60.306 1.00 50.76  ? 55   ARG B NE    1 
ATOM   7040  C CZ    . ARG D 3 55  ? 93.654  45.186 -61.622 1.00 51.60  ? 55   ARG B CZ    1 
ATOM   7041  N NH1   . ARG D 3 55  ? 92.753  45.717 -62.430 1.00 51.56  ? 55   ARG B NH1   1 
ATOM   7042  N NH2   . ARG D 3 55  ? 94.679  44.534 -62.125 1.00 52.98  ? 55   ARG B NH2   1 
ATOM   7043  N N     . GLY D 3 56  ? 86.900  45.328 -58.412 1.00 38.65  ? 56   GLY B N     1 
ATOM   7044  C CA    . GLY D 3 56  ? 85.698  45.962 -57.964 1.00 40.41  ? 56   GLY B CA    1 
ATOM   7045  C C     . GLY D 3 56  ? 84.989  45.068 -56.978 1.00 40.12  ? 56   GLY B C     1 
ATOM   7046  O O     . GLY D 3 56  ? 84.468  45.539 -55.964 1.00 40.33  ? 56   GLY B O     1 
ATOM   7047  N N     . VAL D 3 57  ? 84.934  43.778 -57.259 1.00 44.59  ? 57   VAL B N     1 
ATOM   7048  C CA    . VAL D 3 57  ? 84.275  42.903 -56.320 1.00 43.51  ? 57   VAL B CA    1 
ATOM   7049  C C     . VAL D 3 57  ? 85.057  43.048 -55.017 1.00 41.56  ? 57   VAL B C     1 
ATOM   7050  O O     . VAL D 3 57  ? 84.511  43.469 -53.993 1.00 42.41  ? 57   VAL B O     1 
ATOM   7051  C CB    . VAL D 3 57  ? 84.301  41.406 -56.778 1.00 40.82  ? 57   VAL B CB    1 
ATOM   7052  C CG1   . VAL D 3 57  ? 83.697  40.504 -55.693 1.00 42.15  ? 57   VAL B CG1   1 
ATOM   7053  C CG2   . VAL D 3 57  ? 83.512  41.233 -58.043 1.00 39.26  ? 57   VAL B CG2   1 
ATOM   7054  N N     . LEU D 3 58  ? 86.352  42.748 -55.059 1.00 33.03  ? 58   LEU B N     1 
ATOM   7055  C CA    . LEU D 3 58  ? 87.146  42.802 -53.844 1.00 32.18  ? 58   LEU B CA    1 
ATOM   7056  C C     . LEU D 3 58  ? 87.009  44.105 -53.073 1.00 33.26  ? 58   LEU B C     1 
ATOM   7057  O O     . LEU D 3 58  ? 87.081  44.119 -51.842 1.00 32.60  ? 58   LEU B O     1 
ATOM   7058  C CB    . LEU D 3 58  ? 88.624  42.542 -54.166 1.00 34.62  ? 58   LEU B CB    1 
ATOM   7059  C CG    . LEU D 3 58  ? 89.589  42.478 -52.970 1.00 35.68  ? 58   LEU B CG    1 
ATOM   7060  C CD1   . LEU D 3 58  ? 89.242  41.291 -52.069 1.00 35.43  ? 58   LEU B CD1   1 
ATOM   7061  C CD2   . LEU D 3 58  ? 91.022  42.398 -53.502 1.00 37.51  ? 58   LEU B CD2   1 
ATOM   7062  N N     . LYS D 3 59  ? 86.813  45.199 -53.795 1.00 38.15  ? 59   LYS B N     1 
ATOM   7063  C CA    . LYS D 3 59  ? 86.704  46.479 -53.149 1.00 39.76  ? 59   LYS B CA    1 
ATOM   7064  C C     . LYS D 3 59  ? 85.425  46.531 -52.351 1.00 37.71  ? 59   LYS B C     1 
ATOM   7065  O O     . LYS D 3 59  ? 85.416  46.913 -51.185 1.00 34.97  ? 59   LYS B O     1 
ATOM   7066  C CB    . LYS D 3 59  ? 86.726  47.600 -54.171 1.00 44.99  ? 59   LYS B CB    1 
ATOM   7067  C CG    . LYS D 3 59  ? 87.174  48.925 -53.557 1.00 52.13  ? 59   LYS B CG    1 
ATOM   7068  C CD    . LYS D 3 59  ? 86.821  50.118 -54.435 1.00 59.97  ? 59   LYS B CD    1 
ATOM   7069  C CE    . LYS D 3 59  ? 86.446  51.342 -53.605 1.00 63.26  ? 59   LYS B CE    1 
ATOM   7070  N NZ    . LYS D 3 59  ? 85.808  52.403 -54.447 1.00 67.47  ? 59   LYS B NZ    1 
ATOM   7071  N N     . VAL D 3 60  ? 84.337  46.130 -52.983 1.00 28.06  ? 60   VAL B N     1 
ATOM   7072  C CA    . VAL D 3 60  ? 83.041  46.121 -52.328 1.00 26.29  ? 60   VAL B CA    1 
ATOM   7073  C C     . VAL D 3 60  ? 83.075  45.119 -51.205 1.00 26.41  ? 60   VAL B C     1 
ATOM   7074  O O     . VAL D 3 60  ? 82.397  45.284 -50.215 1.00 24.87  ? 60   VAL B O     1 
ATOM   7075  C CB    . VAL D 3 60  ? 81.900  45.776 -53.332 1.00 29.12  ? 60   VAL B CB    1 
ATOM   7076  C CG1   . VAL D 3 60  ? 80.694  45.296 -52.618 1.00 29.24  ? 60   VAL B CG1   1 
ATOM   7077  C CG2   . VAL D 3 60  ? 81.522  46.986 -54.100 1.00 29.31  ? 60   VAL B CG2   1 
ATOM   7078  N N     . PHE D 3 61  ? 83.888  44.088 -51.339 1.00 34.16  ? 61   PHE B N     1 
ATOM   7079  C CA    . PHE D 3 61  ? 83.963  43.103 -50.267 1.00 36.65  ? 61   PHE B CA    1 
ATOM   7080  C C     . PHE D 3 61  ? 84.566  43.725 -49.023 1.00 35.85  ? 61   PHE B C     1 
ATOM   7081  O O     . PHE D 3 61  ? 83.914  43.876 -48.004 1.00 35.11  ? 61   PHE B O     1 
ATOM   7082  C CB    . PHE D 3 61  ? 84.816  41.901 -50.657 1.00 24.87  ? 61   PHE B CB    1 
ATOM   7083  C CG    . PHE D 3 61  ? 84.772  40.793 -49.647 1.00 25.26  ? 61   PHE B CG    1 
ATOM   7084  C CD1   . PHE D 3 61  ? 83.649  39.996 -49.527 1.00 22.23  ? 61   PHE B CD1   1 
ATOM   7085  C CD2   . PHE D 3 61  ? 85.841  40.582 -48.760 1.00 24.34  ? 61   PHE B CD2   1 
ATOM   7086  C CE1   . PHE D 3 61  ? 83.600  38.993 -48.539 1.00 25.46  ? 61   PHE B CE1   1 
ATOM   7087  C CE2   . PHE D 3 61  ? 85.783  39.586 -47.785 1.00 26.11  ? 61   PHE B CE2   1 
ATOM   7088  C CZ    . PHE D 3 61  ? 84.664  38.802 -47.673 1.00 23.94  ? 61   PHE B CZ    1 
ATOM   7089  N N     . LEU D 3 62  ? 85.834  44.079 -49.123 1.00 39.39  ? 62   LEU B N     1 
ATOM   7090  C CA    . LEU D 3 62  ? 86.536  44.689 -48.019 1.00 37.63  ? 62   LEU B CA    1 
ATOM   7091  C C     . LEU D 3 62  ? 85.738  45.818 -47.328 1.00 38.50  ? 62   LEU B C     1 
ATOM   7092  O O     . LEU D 3 62  ? 85.613  45.841 -46.107 1.00 39.46  ? 62   LEU B O     1 
ATOM   7093  C CB    . LEU D 3 62  ? 87.888  45.171 -48.542 1.00 29.01  ? 62   LEU B CB    1 
ATOM   7094  C CG    . LEU D 3 62  ? 88.797  44.019 -49.021 1.00 30.67  ? 62   LEU B CG    1 
ATOM   7095  C CD1   . LEU D 3 62  ? 90.112  44.581 -49.510 1.00 29.67  ? 62   LEU B CD1   1 
ATOM   7096  C CD2   . LEU D 3 62  ? 89.077  43.044 -47.899 1.00 29.29  ? 62   LEU B CD2   1 
ATOM   7097  N N     . GLU D 3 63  ? 85.174  46.732 -48.111 1.00 34.55  ? 63   GLU B N     1 
ATOM   7098  C CA    . GLU D 3 63  ? 84.400  47.833 -47.564 1.00 36.62  ? 63   GLU B CA    1 
ATOM   7099  C C     . GLU D 3 63  ? 83.333  47.361 -46.594 1.00 36.67  ? 63   GLU B C     1 
ATOM   7100  O O     . GLU D 3 63  ? 83.134  47.959 -45.533 1.00 34.76  ? 63   GLU B O     1 
ATOM   7101  C CB    . GLU D 3 63  ? 83.740  48.630 -48.683 1.00 63.69  ? 63   GLU B CB    1 
ATOM   7102  C CG    . GLU D 3 63  ? 84.725  49.272 -49.612 1.00 68.62  ? 63   GLU B CG    1 
ATOM   7103  C CD    . GLU D 3 63  ? 84.075  50.072 -50.726 1.00 71.90  ? 63   GLU B CD    1 
ATOM   7104  O OE1   . GLU D 3 63  ? 83.205  49.521 -51.423 1.00 69.52  ? 63   GLU B OE1   1 
ATOM   7105  O OE2   . GLU D 3 63  ? 84.442  51.249 -50.921 1.00 72.96  ? 63   GLU B OE2   1 
ATOM   7106  N N     . ASN D 3 64  ? 82.639  46.290 -46.947 1.00 40.41  ? 64   ASN B N     1 
ATOM   7107  C CA    . ASN D 3 64  ? 81.586  45.803 -46.071 1.00 40.96  ? 64   ASN B CA    1 
ATOM   7108  C C     . ASN D 3 64  ? 82.140  45.263 -44.779 1.00 40.50  ? 64   ASN B C     1 
ATOM   7109  O O     . ASN D 3 64  ? 81.615  45.528 -43.701 1.00 39.83  ? 64   ASN B O     1 
ATOM   7110  C CB    . ASN D 3 64  ? 80.779  44.689 -46.722 1.00 45.58  ? 64   ASN B CB    1 
ATOM   7111  C CG    . ASN D 3 64  ? 79.983  45.151 -47.919 1.00 48.98  ? 64   ASN B CG    1 
ATOM   7112  O OD1   . ASN D 3 64  ? 79.683  46.337 -48.096 1.00 53.92  ? 64   ASN B OD1   1 
ATOM   7113  N ND2   . ASN D 3 64  ? 79.610  44.195 -48.748 1.00 52.07  ? 64   ASN B ND2   1 
ATOM   7114  N N     . VAL D 3 65  ? 83.216  44.506 -44.901 1.00 25.21  ? 65   VAL B N     1 
ATOM   7115  C CA    . VAL D 3 65  ? 83.838  43.861 -43.772 1.00 26.14  ? 65   VAL B CA    1 
ATOM   7116  C C     . VAL D 3 65  ? 84.551  44.842 -42.883 1.00 24.69  ? 65   VAL B C     1 
ATOM   7117  O O     . VAL D 3 65  ? 84.314  44.913 -41.681 1.00 22.95  ? 65   VAL B O     1 
ATOM   7118  C CB    . VAL D 3 65  ? 84.846  42.798 -44.253 1.00 28.27  ? 65   VAL B CB    1 
ATOM   7119  C CG1   . VAL D 3 65  ? 85.097  41.786 -43.154 1.00 25.22  ? 65   VAL B CG1   1 
ATOM   7120  C CG2   . VAL D 3 65  ? 84.327  42.100 -45.483 1.00 31.78  ? 65   VAL B CG2   1 
ATOM   7121  N N     . ILE D 3 66  ? 85.443  45.597 -43.495 1.00 32.92  ? 66   ILE B N     1 
ATOM   7122  C CA    . ILE D 3 66  ? 86.245  46.566 -42.775 1.00 34.04  ? 66   ILE B CA    1 
ATOM   7123  C C     . ILE D 3 66  ? 85.388  47.551 -42.000 1.00 35.01  ? 66   ILE B C     1 
ATOM   7124  O O     . ILE D 3 66  ? 85.693  47.860 -40.855 1.00 33.57  ? 66   ILE B O     1 
ATOM   7125  C CB    . ILE D 3 66  ? 87.199  47.281 -43.762 1.00 40.41  ? 66   ILE B CB    1 
ATOM   7126  C CG1   . ILE D 3 66  ? 88.345  46.336 -44.111 1.00 38.49  ? 66   ILE B CG1   1 
ATOM   7127  C CG2   . ILE D 3 66  ? 87.710  48.567 -43.184 1.00 39.29  ? 66   ILE B CG2   1 
ATOM   7128  C CD1   . ILE D 3 66  ? 89.222  46.812 -45.237 1.00 43.45  ? 66   ILE B CD1   1 
ATOM   7129  N N     . ARG D 3 67  ? 84.316  48.044 -42.616 1.00 43.70  ? 67   ARG B N     1 
ATOM   7130  C CA    . ARG D 3 67  ? 83.431  48.969 -41.924 1.00 46.42  ? 67   ARG B CA    1 
ATOM   7131  C C     . ARG D 3 67  ? 82.929  48.306 -40.631 1.00 45.81  ? 67   ARG B C     1 
ATOM   7132  O O     . ARG D 3 67  ? 83.109  48.834 -39.539 1.00 44.72  ? 67   ARG B O     1 
ATOM   7133  C CB    . ARG D 3 67  ? 82.261  49.334 -42.816 1.00 52.89  ? 67   ARG B CB    1 
ATOM   7134  C CG    . ARG D 3 67  ? 81.149  50.039 -42.107 1.00 59.53  ? 67   ARG B CG    1 
ATOM   7135  C CD    . ARG D 3 67  ? 79.970  50.155 -43.055 1.00 64.56  ? 67   ARG B CD    1 
ATOM   7136  N NE    . ARG D 3 67  ? 80.349  50.835 -44.299 1.00 71.27  ? 67   ARG B NE    1 
ATOM   7137  C CZ    . ARG D 3 67  ? 80.064  50.403 -45.533 1.00 72.83  ? 67   ARG B CZ    1 
ATOM   7138  N NH1   . ARG D 3 67  ? 79.386  49.270 -45.732 1.00 72.72  ? 67   ARG B NH1   1 
ATOM   7139  N NH2   . ARG D 3 67  ? 80.464  51.118 -46.580 1.00 72.82  ? 67   ARG B NH2   1 
ATOM   7140  N N     . ASP D 3 68  ? 82.311  47.135 -40.755 1.00 39.17  ? 68   ASP B N     1 
ATOM   7141  C CA    . ASP D 3 68  ? 81.824  46.442 -39.583 1.00 38.02  ? 68   ASP B CA    1 
ATOM   7142  C C     . ASP D 3 68  ? 82.931  46.213 -38.576 1.00 38.10  ? 68   ASP B C     1 
ATOM   7143  O O     . ASP D 3 68  ? 82.700  46.319 -37.401 1.00 39.22  ? 68   ASP B O     1 
ATOM   7144  C CB    . ASP D 3 68  ? 81.171  45.121 -39.976 1.00 79.44  ? 68   ASP B CB    1 
ATOM   7145  C CG    . ASP D 3 68  ? 79.748  45.305 -40.435 1.00 81.51  ? 68   ASP B CG    1 
ATOM   7146  O OD1   . ASP D 3 68  ? 79.257  46.454 -40.373 1.00 78.38  ? 68   ASP B OD1   1 
ATOM   7147  O OD2   . ASP D 3 68  ? 79.116  44.310 -40.847 1.00 82.14  ? 68   ASP B OD2   1 
ATOM   7148  N N     . ALA D 3 69  ? 84.131  45.900 -39.036 1.00 25.40  ? 69   ALA B N     1 
ATOM   7149  C CA    . ALA D 3 69  ? 85.260  45.669 -38.129 1.00 28.20  ? 69   ALA B CA    1 
ATOM   7150  C C     . ALA D 3 69  ? 85.672  46.981 -37.440 1.00 27.70  ? 69   ALA B C     1 
ATOM   7151  O O     . ALA D 3 69  ? 85.834  47.036 -36.223 1.00 25.44  ? 69   ALA B O     1 
ATOM   7152  C CB    . ALA D 3 69  ? 86.442  45.092 -38.904 1.00 25.55  ? 69   ALA B CB    1 
ATOM   7153  N N     . VAL D 3 70  ? 85.843  48.034 -38.233 1.00 34.26  ? 70   VAL B N     1 
ATOM   7154  C CA    . VAL D 3 70  ? 86.208  49.335 -37.711 1.00 34.56  ? 70   VAL B CA    1 
ATOM   7155  C C     . VAL D 3 70  ? 85.156  49.767 -36.687 1.00 37.73  ? 70   VAL B C     1 
ATOM   7156  O O     . VAL D 3 70  ? 85.467  50.409 -35.708 1.00 38.77  ? 70   VAL B O     1 
ATOM   7157  C CB    . VAL D 3 70  ? 86.309  50.339 -38.867 1.00 38.73  ? 70   VAL B CB    1 
ATOM   7158  C CG1   . VAL D 3 70  ? 86.343  51.732 -38.371 1.00 40.07  ? 70   VAL B CG1   1 
ATOM   7159  C CG2   . VAL D 3 70  ? 87.544  50.070 -39.642 1.00 37.29  ? 70   VAL B CG2   1 
ATOM   7160  N N     . THR D 3 71  ? 83.911  49.392 -36.915 1.00 31.63  ? 71   THR B N     1 
ATOM   7161  C CA    . THR D 3 71  ? 82.843  49.722 -35.994 1.00 31.63  ? 71   THR B CA    1 
ATOM   7162  C C     . THR D 3 71  ? 83.034  48.938 -34.724 1.00 31.90  ? 71   THR B C     1 
ATOM   7163  O O     . THR D 3 71  ? 82.940  49.483 -33.645 1.00 30.68  ? 71   THR B O     1 
ATOM   7164  C CB    . THR D 3 71  ? 81.493  49.351 -36.549 1.00 31.94  ? 71   THR B CB    1 
ATOM   7165  O OG1   . THR D 3 71  ? 81.196  50.206 -37.650 1.00 33.52  ? 71   THR B OG1   1 
ATOM   7166  C CG2   . THR D 3 71  ? 80.429  49.470 -35.487 1.00 29.84  ? 71   THR B CG2   1 
ATOM   7167  N N     . TYR D 3 72  ? 83.265  47.642 -34.827 1.00 35.90  ? 72   TYR B N     1 
ATOM   7168  C CA    . TYR D 3 72  ? 83.502  46.877 -33.619 1.00 36.09  ? 72   TYR B CA    1 
ATOM   7169  C C     . TYR D 3 72  ? 84.755  47.498 -32.937 1.00 39.51  ? 72   TYR B C     1 
ATOM   7170  O O     . TYR D 3 72  ? 84.847  47.541 -31.710 1.00 39.25  ? 72   TYR B O     1 
ATOM   7171  C CB    . TYR D 3 72  ? 83.752  45.394 -33.952 1.00 34.11  ? 72   TYR B CB    1 
ATOM   7172  C CG    . TYR D 3 72  ? 82.511  44.553 -34.109 1.00 34.89  ? 72   TYR B CG    1 
ATOM   7173  C CD1   . TYR D 3 72  ? 82.191  43.958 -35.348 1.00 34.87  ? 72   TYR B CD1   1 
ATOM   7174  C CD2   . TYR D 3 72  ? 81.652  44.341 -33.031 1.00 34.97  ? 72   TYR B CD2   1 
ATOM   7175  C CE1   . TYR D 3 72  ? 81.025  43.160 -35.523 1.00 33.84  ? 72   TYR B CE1   1 
ATOM   7176  C CE2   . TYR D 3 72  ? 80.498  43.554 -33.180 1.00 33.39  ? 72   TYR B CE2   1 
ATOM   7177  C CZ    . TYR D 3 72  ? 80.189  42.964 -34.440 1.00 33.09  ? 72   TYR B CZ    1 
ATOM   7178  O OH    . TYR D 3 72  ? 79.051  42.212 -34.577 1.00 36.52  ? 72   TYR B OH    1 
ATOM   7179  N N     . THR D 3 73  ? 85.702  47.990 -33.741 1.00 47.62  ? 73   THR B N     1 
ATOM   7180  C CA    . THR D 3 73  ? 86.916  48.601 -33.195 1.00 48.78  ? 73   THR B CA    1 
ATOM   7181  C C     . THR D 3 73  ? 86.569  49.780 -32.300 1.00 51.31  ? 73   THR B C     1 
ATOM   7182  O O     . THR D 3 73  ? 86.911  49.784 -31.119 1.00 50.50  ? 73   THR B O     1 
ATOM   7183  C CB    . THR D 3 73  ? 87.905  49.123 -34.292 1.00 31.06  ? 73   THR B CB    1 
ATOM   7184  O OG1   . THR D 3 73  ? 88.368  48.044 -35.114 1.00 29.85  ? 73   THR B OG1   1 
ATOM   7185  C CG2   . THR D 3 73  ? 89.125  49.719 -33.639 1.00 32.43  ? 73   THR B CG2   1 
ATOM   7186  N N     . GLU D 3 74  ? 85.899  50.776 -32.875 1.00 47.87  ? 74   GLU B N     1 
ATOM   7187  C CA    . GLU D 3 74  ? 85.486  51.969 -32.140 1.00 49.47  ? 74   GLU B CA    1 
ATOM   7188  C C     . GLU D 3 74  ? 84.620  51.689 -30.901 1.00 48.98  ? 74   GLU B C     1 
ATOM   7189  O O     . GLU D 3 74  ? 84.701  52.363 -29.878 1.00 47.34  ? 74   GLU B O     1 
ATOM   7190  C CB    . GLU D 3 74  ? 84.705  52.913 -33.050 1.00 58.45  ? 74   GLU B CB    1 
ATOM   7191  C CG    . GLU D 3 74  ? 85.486  53.537 -34.187 1.00 70.12  ? 74   GLU B CG    1 
ATOM   7192  C CD    . GLU D 3 74  ? 84.684  54.642 -34.873 1.00 76.37  ? 74   GLU B CD    1 
ATOM   7193  O OE1   . GLU D 3 74  ? 84.470  55.704 -34.236 1.00 81.72  ? 74   GLU B OE1   1 
ATOM   7194  O OE2   . GLU D 3 74  ? 84.252  54.446 -36.040 1.00 79.94  ? 74   GLU B OE2   1 
ATOM   7195  N N     . HIS D 3 75  ? 83.762  50.703 -30.974 1.00 42.69  ? 75   HIS B N     1 
ATOM   7196  C CA    . HIS D 3 75  ? 82.960  50.468 -29.811 1.00 44.29  ? 75   HIS B CA    1 
ATOM   7197  C C     . HIS D 3 75  ? 83.858  50.187 -28.594 1.00 45.41  ? 75   HIS B C     1 
ATOM   7198  O O     . HIS D 3 75  ? 83.531  50.569 -27.461 1.00 47.98  ? 75   HIS B O     1 
ATOM   7199  C CB    . HIS D 3 75  ? 82.014  49.310 -30.066 1.00 43.53  ? 75   HIS B CB    1 
ATOM   7200  C CG    . HIS D 3 75  ? 81.023  49.116 -28.976 1.00 41.24  ? 75   HIS B CG    1 
ATOM   7201  N ND1   . HIS D 3 75  ? 80.034  50.034 -28.710 1.00 42.15  ? 75   HIS B ND1   1 
ATOM   7202  C CD2   . HIS D 3 75  ? 80.897  48.138 -28.049 1.00 41.64  ? 75   HIS B CD2   1 
ATOM   7203  C CE1   . HIS D 3 75  ? 79.340  49.626 -27.662 1.00 40.13  ? 75   HIS B CE1   1 
ATOM   7204  N NE2   . HIS D 3 75  ? 79.843  48.478 -27.241 1.00 41.24  ? 75   HIS B NE2   1 
ATOM   7205  N N     . ALA D 3 76  ? 84.991  49.530 -28.844 1.00 50.71  ? 76   ALA B N     1 
ATOM   7206  C CA    . ALA D 3 76  ? 85.949  49.169 -27.804 1.00 51.98  ? 76   ALA B CA    1 
ATOM   7207  C C     . ALA D 3 76  ? 86.936  50.324 -27.483 1.00 53.43  ? 76   ALA B C     1 
ATOM   7208  O O     . ALA D 3 76  ? 87.838  50.218 -26.638 1.00 50.94  ? 76   ALA B O     1 
ATOM   7209  C CB    . ALA D 3 76  ? 86.693  47.923 -28.224 1.00 62.95  ? 76   ALA B CB    1 
ATOM   7210  N N     . LYS D 3 77  ? 86.760  51.435 -28.172 1.00 48.70  ? 77   LYS B N     1 
ATOM   7211  C CA    . LYS D 3 77  ? 87.591  52.574 -27.904 1.00 51.35  ? 77   LYS B CA    1 
ATOM   7212  C C     . LYS D 3 77  ? 89.042  52.282 -28.181 1.00 50.65  ? 77   LYS B C     1 
ATOM   7213  O O     . LYS D 3 77  ? 89.907  52.759 -27.462 1.00 50.11  ? 77   LYS B O     1 
ATOM   7214  C CB    . LYS D 3 77  ? 87.424  52.952 -26.442 1.00 70.77  ? 77   LYS B CB    1 
ATOM   7215  C CG    . LYS D 3 77  ? 85.989  52.932 -25.972 1.00 75.00  ? 77   LYS B CG    1 
ATOM   7216  C CD    . LYS D 3 77  ? 85.884  53.192 -24.485 1.00 79.67  ? 77   LYS B CD    1 
ATOM   7217  C CE    . LYS D 3 77  ? 84.433  53.322 -24.053 1.00 82.66  ? 77   LYS B CE    1 
ATOM   7218  N NZ    . LYS D 3 77  ? 84.317  53.677 -22.615 1.00 83.62  ? 77   LYS B NZ    1 
ATOM   7219  N N     . ARG D 3 78  ? 89.326  51.485 -29.199 1.00 44.86  ? 78   ARG B N     1 
ATOM   7220  C CA    . ARG D 3 78  ? 90.718  51.173 -29.547 1.00 42.20  ? 78   ARG B CA    1 
ATOM   7221  C C     . ARG D 3 78  ? 91.043  51.930 -30.810 1.00 42.23  ? 78   ARG B C     1 
ATOM   7222  O O     . ARG D 3 78  ? 90.149  52.368 -31.524 1.00 40.70  ? 78   ARG B O     1 
ATOM   7223  C CB    . ARG D 3 78  ? 90.914  49.679 -29.810 1.00 51.63  ? 78   ARG B CB    1 
ATOM   7224  C CG    . ARG D 3 78  ? 90.635  48.804 -28.642 1.00 52.03  ? 78   ARG B CG    1 
ATOM   7225  C CD    . ARG D 3 78  ? 91.088  47.386 -28.920 1.00 50.09  ? 78   ARG B CD    1 
ATOM   7226  N NE    . ARG D 3 78  ? 89.978  46.435 -28.838 1.00 51.61  ? 78   ARG B NE    1 
ATOM   7227  C CZ    . ARG D 3 78  ? 89.196  46.113 -29.868 1.00 51.64  ? 78   ARG B CZ    1 
ATOM   7228  N NH1   . ARG D 3 78  ? 89.410  46.644 -31.070 1.00 46.79  ? 78   ARG B NH1   1 
ATOM   7229  N NH2   . ARG D 3 78  ? 88.166  45.301 -29.677 1.00 47.88  ? 78   ARG B NH2   1 
ATOM   7230  N N     . LYS D 3 79  ? 92.315  52.119 -31.086 1.00 44.62  ? 79   LYS B N     1 
ATOM   7231  C CA    . LYS D 3 79  ? 92.670  52.829 -32.297 1.00 46.26  ? 79   LYS B CA    1 
ATOM   7232  C C     . LYS D 3 79  ? 93.327  51.744 -33.143 1.00 44.08  ? 79   LYS B C     1 
ATOM   7233  O O     . LYS D 3 79  ? 93.994  52.022 -34.143 1.00 46.55  ? 79   LYS B O     1 
ATOM   7234  C CB    . LYS D 3 79  ? 93.628  54.000 -31.963 1.00 74.31  ? 79   LYS B CB    1 
ATOM   7235  C CG    . LYS D 3 79  ? 93.206  54.756 -30.683 1.00 79.90  ? 79   LYS B CG    1 
ATOM   7236  C CD    . LYS D 3 79  ? 93.596  56.239 -30.621 1.00 85.26  ? 79   LYS B CD    1 
ATOM   7237  C CE    . LYS D 3 79  ? 93.050  56.914 -29.332 1.00 90.84  ? 79   LYS B CE    1 
ATOM   7238  N NZ    . LYS D 3 79  ? 93.400  58.371 -29.226 1.00 93.45  ? 79   LYS B NZ    1 
ATOM   7239  N N     . THR D 3 80  ? 93.088  50.496 -32.738 1.00 60.58  ? 80   THR B N     1 
ATOM   7240  C CA    . THR D 3 80  ? 93.666  49.304 -33.382 1.00 62.70  ? 80   THR B CA    1 
ATOM   7241  C C     . THR D 3 80  ? 92.656  48.241 -33.789 1.00 61.03  ? 80   THR B C     1 
ATOM   7242  O O     . THR D 3 80  ? 91.975  47.636 -32.949 1.00 60.28  ? 80   THR B O     1 
ATOM   7243  C CB    . THR D 3 80  ? 94.664  48.572 -32.442 1.00 50.37  ? 80   THR B CB    1 
ATOM   7244  O OG1   . THR D 3 80  ? 95.710  49.467 -32.057 1.00 54.96  ? 80   THR B OG1   1 
ATOM   7245  C CG2   . THR D 3 80  ? 95.258  47.347 -33.117 1.00 48.52  ? 80   THR B CG2   1 
ATOM   7246  N N     . VAL D 3 81  ? 92.564  47.979 -35.076 1.00 27.07  ? 81   VAL B N     1 
ATOM   7247  C CA    . VAL D 3 81  ? 91.652  46.947 -35.483 1.00 25.13  ? 81   VAL B CA    1 
ATOM   7248  C C     . VAL D 3 81  ? 92.292  45.595 -35.102 1.00 24.78  ? 81   VAL B C     1 
ATOM   7249  O O     . VAL D 3 81  ? 93.394  45.269 -35.536 1.00 27.45  ? 81   VAL B O     1 
ATOM   7250  C CB    . VAL D 3 81  ? 91.398  47.023 -37.000 1.00 36.78  ? 81   VAL B CB    1 
ATOM   7251  C CG1   . VAL D 3 81  ? 90.614  45.790 -37.463 1.00 36.28  ? 81   VAL B CG1   1 
ATOM   7252  C CG2   . VAL D 3 81  ? 90.631  48.265 -37.307 1.00 35.67  ? 81   VAL B CG2   1 
ATOM   7253  N N     . THR D 3 82  ? 91.602  44.817 -34.285 1.00 30.86  ? 82   THR B N     1 
ATOM   7254  C CA    . THR D 3 82  ? 92.119  43.519 -33.891 1.00 33.04  ? 82   THR B CA    1 
ATOM   7255  C C     . THR D 3 82  ? 91.534  42.409 -34.756 1.00 32.74  ? 82   THR B C     1 
ATOM   7256  O O     . THR D 3 82  ? 90.419  42.511 -35.233 1.00 30.45  ? 82   THR B O     1 
ATOM   7257  C CB    . THR D 3 82  ? 91.822  43.241 -32.402 1.00 38.45  ? 82   THR B CB    1 
ATOM   7258  O OG1   . THR D 3 82  ? 90.416  43.014 -32.192 1.00 38.04  ? 82   THR B OG1   1 
ATOM   7259  C CG2   . THR D 3 82  ? 92.266  44.439 -31.566 1.00 39.28  ? 82   THR B CG2   1 
ATOM   7260  N N     . ALA D 3 83  ? 92.282  41.337 -34.965 1.00 52.42  ? 83   ALA B N     1 
ATOM   7261  C CA    . ALA D 3 83  ? 91.775  40.252 -35.790 1.00 52.27  ? 83   ALA B CA    1 
ATOM   7262  C C     . ALA D 3 83  ? 90.393  39.752 -35.333 1.00 52.63  ? 83   ALA B C     1 
ATOM   7263  O O     . ALA D 3 83  ? 89.662  39.148 -36.113 1.00 54.41  ? 83   ALA B O     1 
ATOM   7264  C CB    . ALA D 3 83  ? 92.765  39.114 -35.805 1.00 25.65  ? 83   ALA B CB    1 
ATOM   7265  N N     . MET D 3 84  ? 90.044  39.995 -34.073 1.00 30.96  ? 84   MET B N     1 
ATOM   7266  C CA    . MET D 3 84  ? 88.756  39.579 -33.558 1.00 31.47  ? 84   MET B CA    1 
ATOM   7267  C C     . MET D 3 84  ? 87.692  40.500 -34.132 1.00 31.92  ? 84   MET B C     1 
ATOM   7268  O O     . MET D 3 84  ? 86.572  40.083 -34.384 1.00 30.27  ? 84   MET B O     1 
ATOM   7269  C CB    . MET D 3 84  ? 88.723  39.657 -32.034 1.00 48.14  ? 84   MET B CB    1 
ATOM   7270  C CG    . MET D 3 84  ? 89.238  38.428 -31.343 1.00 53.41  ? 84   MET B CG    1 
ATOM   7271  S SD    . MET D 3 84  ? 88.401  36.960 -31.952 1.00 58.54  ? 84   MET B SD    1 
ATOM   7272  C CE    . MET D 3 84  ? 87.498  36.425 -30.474 1.00 59.75  ? 84   MET B CE    1 
ATOM   7273  N N     . ASP D 3 85  ? 88.042  41.758 -34.347 1.00 32.75  ? 85   ASP B N     1 
ATOM   7274  C CA    . ASP D 3 85  ? 87.084  42.696 -34.883 1.00 34.87  ? 85   ASP B CA    1 
ATOM   7275  C C     . ASP D 3 85  ? 86.788  42.302 -36.307 1.00 34.13  ? 85   ASP B C     1 
ATOM   7276  O O     . ASP D 3 85  ? 85.746  42.647 -36.829 1.00 35.22  ? 85   ASP B O     1 
ATOM   7277  C CB    . ASP D 3 85  ? 87.619  44.140 -34.848 1.00 60.51  ? 85   ASP B CB    1 
ATOM   7278  C CG    . ASP D 3 85  ? 87.821  44.676 -33.426 1.00 62.41  ? 85   ASP B CG    1 
ATOM   7279  O OD1   . ASP D 3 85  ? 87.020  44.320 -32.536 1.00 62.78  ? 85   ASP B OD1   1 
ATOM   7280  O OD2   . ASP D 3 85  ? 88.773  45.468 -33.211 1.00 65.85  ? 85   ASP B OD2   1 
ATOM   7281  N N     . VAL D 3 86  ? 87.704  41.585 -36.948 1.00 31.35  ? 86   VAL B N     1 
ATOM   7282  C CA    . VAL D 3 86  ? 87.485  41.163 -38.327 1.00 34.04  ? 86   VAL B CA    1 
ATOM   7283  C C     . VAL D 3 86  ? 86.670  39.882 -38.319 1.00 34.58  ? 86   VAL B C     1 
ATOM   7284  O O     . VAL D 3 86  ? 85.786  39.686 -39.122 1.00 35.79  ? 86   VAL B O     1 
ATOM   7285  C CB    . VAL D 3 86  ? 88.805  40.912 -39.038 1.00 31.64  ? 86   VAL B CB    1 
ATOM   7286  C CG1   . VAL D 3 86  ? 88.545  40.448 -40.452 1.00 30.40  ? 86   VAL B CG1   1 
ATOM   7287  C CG2   . VAL D 3 86  ? 89.635  42.189 -39.051 1.00 32.32  ? 86   VAL B CG2   1 
ATOM   7288  N N     . VAL D 3 87  ? 86.995  39.002 -37.394 1.00 34.59  ? 87   VAL B N     1 
ATOM   7289  C CA    . VAL D 3 87  ? 86.301  37.745 -37.225 1.00 31.52  ? 87   VAL B CA    1 
ATOM   7290  C C     . VAL D 3 87  ? 84.842  37.998 -36.917 1.00 33.86  ? 87   VAL B C     1 
ATOM   7291  O O     . VAL D 3 87  ? 83.979  37.409 -37.516 1.00 32.06  ? 87   VAL B O     1 
ATOM   7292  C CB    . VAL D 3 87  ? 86.933  36.979 -36.096 1.00 22.60  ? 87   VAL B CB    1 
ATOM   7293  C CG1   . VAL D 3 87  ? 85.993  35.954 -35.576 1.00 21.23  ? 87   VAL B CG1   1 
ATOM   7294  C CG2   . VAL D 3 87  ? 88.239  36.374 -36.596 1.00 21.27  ? 87   VAL B CG2   1 
ATOM   7295  N N     . TYR D 3 88  ? 84.563  38.871 -35.973 1.00 30.38  ? 88   TYR B N     1 
ATOM   7296  C CA    . TYR D 3 88  ? 83.196  39.184 -35.666 1.00 29.97  ? 88   TYR B CA    1 
ATOM   7297  C C     . TYR D 3 88  ? 82.504  39.800 -36.880 1.00 28.85  ? 88   TYR B C     1 
ATOM   7298  O O     . TYR D 3 88  ? 81.324  39.549 -37.140 1.00 27.69  ? 88   TYR B O     1 
ATOM   7299  C CB    . TYR D 3 88  ? 83.153  40.158 -34.499 1.00 49.08  ? 88   TYR B CB    1 
ATOM   7300  C CG    . TYR D 3 88  ? 83.558  39.506 -33.231 1.00 52.92  ? 88   TYR B CG    1 
ATOM   7301  C CD1   . TYR D 3 88  ? 84.402  40.142 -32.335 1.00 53.29  ? 88   TYR B CD1   1 
ATOM   7302  C CD2   . TYR D 3 88  ? 83.116  38.236 -32.931 1.00 54.37  ? 88   TYR B CD2   1 
ATOM   7303  C CE1   . TYR D 3 88  ? 84.795  39.520 -31.169 1.00 55.66  ? 88   TYR B CE1   1 
ATOM   7304  C CE2   . TYR D 3 88  ? 83.498  37.616 -31.777 1.00 57.20  ? 88   TYR B CE2   1 
ATOM   7305  C CZ    . TYR D 3 88  ? 84.335  38.259 -30.900 1.00 58.04  ? 88   TYR B CZ    1 
ATOM   7306  O OH    . TYR D 3 88  ? 84.683  37.626 -29.737 1.00 60.89  ? 88   TYR B OH    1 
ATOM   7307  N N     . ALA D 3 89  ? 83.236  40.632 -37.610 1.00 28.86  ? 89   ALA B N     1 
ATOM   7308  C CA    . ALA D 3 89  ? 82.696  41.277 -38.804 1.00 30.52  ? 89   ALA B CA    1 
ATOM   7309  C C     . ALA D 3 89  ? 82.295  40.181 -39.777 1.00 30.57  ? 89   ALA B C     1 
ATOM   7310  O O     . ALA D 3 89  ? 81.141  40.085 -40.175 1.00 29.10  ? 89   ALA B O     1 
ATOM   7311  C CB    . ALA D 3 89  ? 83.747  42.185 -39.435 1.00 33.68  ? 89   ALA B CB    1 
ATOM   7312  N N     . LEU D 3 90  ? 83.255  39.350 -40.151 1.00 24.89  ? 90   LEU B N     1 
ATOM   7313  C CA    . LEU D 3 90  ? 82.988  38.267 -41.036 1.00 28.03  ? 90   LEU B CA    1 
ATOM   7314  C C     . LEU D 3 90  ? 81.771  37.447 -40.566 1.00 27.77  ? 90   LEU B C     1 
ATOM   7315  O O     . LEU D 3 90  ? 80.871  37.134 -41.366 1.00 29.54  ? 90   LEU B O     1 
ATOM   7316  C CB    . LEU D 3 90  ? 84.248  37.417 -41.157 1.00 24.28  ? 90   LEU B CB    1 
ATOM   7317  C CG    . LEU D 3 90  ? 85.271  38.086 -42.105 1.00 25.23  ? 90   LEU B CG    1 
ATOM   7318  C CD1   . LEU D 3 90  ? 86.649  37.457 -41.972 1.00 24.78  ? 90   LEU B CD1   1 
ATOM   7319  C CD2   . LEU D 3 90  ? 84.783  37.986 -43.554 1.00 25.91  ? 90   LEU B CD2   1 
ATOM   7320  N N     . LYS D 3 91  ? 81.694  37.121 -39.281 1.00 38.36  ? 91   LYS B N     1 
ATOM   7321  C CA    . LYS D 3 91  ? 80.558  36.336 -38.835 1.00 39.72  ? 91   LYS B CA    1 
ATOM   7322  C C     . LYS D 3 91  ? 79.221  36.980 -39.213 1.00 42.37  ? 91   LYS B C     1 
ATOM   7323  O O     . LYS D 3 91  ? 78.296  36.284 -39.638 1.00 40.05  ? 91   LYS B O     1 
ATOM   7324  C CB    . LYS D 3 91  ? 80.613  36.085 -37.343 1.00 30.44  ? 91   LYS B CB    1 
ATOM   7325  C CG    . LYS D 3 91  ? 79.423  35.309 -36.883 1.00 34.27  ? 91   LYS B CG    1 
ATOM   7326  C CD    . LYS D 3 91  ? 79.731  33.985 -36.214 1.00 43.02  ? 91   LYS B CD    1 
ATOM   7327  C CE    . LYS D 3 91  ? 80.419  34.164 -34.841 1.00 46.69  ? 91   LYS B CE    1 
ATOM   7328  N NZ    . LYS D 3 91  ? 80.733  32.831 -34.158 1.00 46.92  ? 91   LYS B NZ    1 
ATOM   7329  N N     . ARG D 3 92  ? 79.106  38.298 -39.091 1.00 40.62  ? 92   ARG B N     1 
ATOM   7330  C CA    . ARG D 3 92  ? 77.856  38.959 -39.443 1.00 44.50  ? 92   ARG B CA    1 
ATOM   7331  C C     . ARG D 3 92  ? 77.589  38.963 -40.928 1.00 44.81  ? 92   ARG B C     1 
ATOM   7332  O O     . ARG D 3 92  ? 76.441  38.971 -41.332 1.00 44.44  ? 92   ARG B O     1 
ATOM   7333  C CB    . ARG D 3 92  ? 77.834  40.407 -39.010 1.00 44.76  ? 92   ARG B CB    1 
ATOM   7334  C CG    . ARG D 3 92  ? 77.867  40.657 -37.557 1.00 46.61  ? 92   ARG B CG    1 
ATOM   7335  C CD    . ARG D 3 92  ? 77.690  42.135 -37.354 1.00 41.31  ? 92   ARG B CD    1 
ATOM   7336  N NE    . ARG D 3 92  ? 76.361  42.473 -37.811 1.00 39.80  ? 92   ARG B NE    1 
ATOM   7337  C CZ    . ARG D 3 92  ? 76.079  43.162 -38.916 1.00 41.86  ? 92   ARG B CZ    1 
ATOM   7338  N NH1   . ARG D 3 92  ? 77.058  43.621 -39.696 1.00 40.61  ? 92   ARG B NH1   1 
ATOM   7339  N NH2   . ARG D 3 92  ? 74.794  43.339 -39.260 1.00 43.07  ? 92   ARG B NH2   1 
ATOM   7340  N N     . GLN D 3 93  ? 78.637  39.005 -41.742 1.00 34.02  ? 93   GLN B N     1 
ATOM   7341  C CA    . GLN D 3 93  ? 78.477  39.011 -43.195 1.00 35.56  ? 93   GLN B CA    1 
ATOM   7342  C C     . GLN D 3 93  ? 78.070  37.615 -43.638 1.00 32.60  ? 93   GLN B C     1 
ATOM   7343  O O     . GLN D 3 93  ? 77.775  37.379 -44.810 1.00 33.69  ? 93   GLN B O     1 
ATOM   7344  C CB    . GLN D 3 93  ? 79.804  39.362 -43.866 1.00 52.85  ? 93   GLN B CB    1 
ATOM   7345  C CG    . GLN D 3 93  ? 80.442  40.643 -43.381 1.00 59.28  ? 93   GLN B CG    1 
ATOM   7346  C CD    . GLN D 3 93  ? 79.574  41.817 -43.687 1.00 62.70  ? 93   GLN B CD    1 
ATOM   7347  O OE1   . GLN D 3 93  ? 79.150  41.992 -44.827 1.00 63.41  ? 93   GLN B OE1   1 
ATOM   7348  N NE2   . GLN D 3 93  ? 79.288  42.629 -42.684 1.00 61.84  ? 93   GLN B NE2   1 
ATOM   7349  N N     . GLY D 3 94  ? 78.065  36.683 -42.693 1.00 28.38  ? 94   GLY B N     1 
ATOM   7350  C CA    . GLY D 3 94  ? 77.724  35.321 -43.020 1.00 26.48  ? 94   GLY B CA    1 
ATOM   7351  C C     . GLY D 3 94  ? 78.954  34.655 -43.598 1.00 28.37  ? 94   GLY B C     1 
ATOM   7352  O O     . GLY D 3 94  ? 78.817  33.663 -44.301 1.00 27.54  ? 94   GLY B O     1 
ATOM   7353  N N     . ARG D 3 95  ? 80.151  35.188 -43.310 1.00 31.95  ? 95   ARG B N     1 
ATOM   7354  C CA    . ARG D 3 95  ? 81.393  34.630 -43.823 1.00 31.44  ? 95   ARG B CA    1 
ATOM   7355  C C     . ARG D 3 95  ? 82.274  34.071 -42.693 1.00 32.54  ? 95   ARG B C     1 
ATOM   7356  O O     . ARG D 3 95  ? 83.481  34.311 -42.709 1.00 32.06  ? 95   ARG B O     1 
ATOM   7357  C CB    . ARG D 3 95  ? 82.197  35.685 -44.598 1.00 58.43  ? 95   ARG B CB    1 
ATOM   7358  C CG    . ARG D 3 95  ? 81.487  36.428 -45.737 1.00 63.32  ? 95   ARG B CG    1 
ATOM   7359  C CD    . ARG D 3 95  ? 81.018  35.568 -46.915 1.00 68.28  ? 95   ARG B CD    1 
ATOM   7360  N NE    . ARG D 3 95  ? 82.083  34.744 -47.508 1.00 73.04  ? 95   ARG B NE    1 
ATOM   7361  C CZ    . ARG D 3 95  ? 81.962  33.994 -48.618 1.00 74.43  ? 95   ARG B CZ    1 
ATOM   7362  N NH1   . ARG D 3 95  ? 80.813  33.958 -49.300 1.00 75.57  ? 95   ARG B NH1   1 
ATOM   7363  N NH2   . ARG D 3 95  ? 82.981  33.235 -49.029 1.00 74.60  ? 95   ARG B NH2   1 
ATOM   7364  N N     . THR D 3 96  ? 81.685  33.341 -41.732 1.00 23.76  ? 96   THR B N     1 
ATOM   7365  C CA    . THR D 3 96  ? 82.417  32.731 -40.594 1.00 23.69  ? 96   THR B CA    1 
ATOM   7366  C C     . THR D 3 96  ? 83.804  32.242 -40.992 1.00 26.19  ? 96   THR B C     1 
ATOM   7367  O O     . THR D 3 96  ? 83.898  31.444 -41.928 1.00 22.75  ? 96   THR B O     1 
ATOM   7368  C CB    . THR D 3 96  ? 81.713  31.453 -40.045 1.00 19.17  ? 96   THR B CB    1 
ATOM   7369  O OG1   . THR D 3 96  ? 80.766  31.793 -39.036 1.00 18.55  ? 96   THR B OG1   1 
ATOM   7370  C CG2   . THR D 3 96  ? 82.739  30.466 -39.441 1.00 21.65  ? 96   THR B CG2   1 
ATOM   7371  N N     . LEU D 3 97  ? 84.852  32.658 -40.260 1.00 34.27  ? 97   LEU B N     1 
ATOM   7372  C CA    . LEU D 3 97  ? 86.223  32.250 -40.572 1.00 33.39  ? 97   LEU B CA    1 
ATOM   7373  C C     . LEU D 3 97  ? 87.005  31.566 -39.426 1.00 35.17  ? 97   LEU B C     1 
ATOM   7374  O O     . LEU D 3 97  ? 87.413  32.204 -38.454 1.00 35.78  ? 97   LEU B O     1 
ATOM   7375  C CB    . LEU D 3 97  ? 86.994  33.459 -41.104 1.00 15.75  ? 97   LEU B CB    1 
ATOM   7376  C CG    . LEU D 3 97  ? 88.526  33.407 -41.249 1.00 17.85  ? 97   LEU B CG    1 
ATOM   7377  C CD1   . LEU D 3 97  ? 88.893  32.430 -42.284 1.00 13.69  ? 97   LEU B CD1   1 
ATOM   7378  C CD2   . LEU D 3 97  ? 89.127  34.713 -41.651 1.00 19.62  ? 97   LEU B CD2   1 
ATOM   7379  N N     . TYR D 3 98  ? 87.232  30.258 -39.534 1.00 41.69  ? 98   TYR B N     1 
ATOM   7380  C CA    . TYR D 3 98  ? 87.979  29.564 -38.493 1.00 40.56  ? 98   TYR B CA    1 
ATOM   7381  C C     . TYR D 3 98  ? 89.482  29.773 -38.662 1.00 40.58  ? 98   TYR B C     1 
ATOM   7382  O O     . TYR D 3 98  ? 89.999  29.679 -39.778 1.00 39.28  ? 98   TYR B O     1 
ATOM   7383  C CB    . TYR D 3 98  ? 87.719  28.063 -38.520 1.00 31.33  ? 98   TYR B CB    1 
ATOM   7384  C CG    . TYR D 3 98  ? 86.329  27.600 -38.148 1.00 31.74  ? 98   TYR B CG    1 
ATOM   7385  C CD1   . TYR D 3 98  ? 85.375  28.482 -37.683 1.00 34.99  ? 98   TYR B CD1   1 
ATOM   7386  C CD2   . TYR D 3 98  ? 85.982  26.253 -38.258 1.00 31.24  ? 98   TYR B CD2   1 
ATOM   7387  C CE1   . TYR D 3 98  ? 84.125  28.029 -37.340 1.00 32.69  ? 98   TYR B CE1   1 
ATOM   7388  C CE2   . TYR D 3 98  ? 84.743  25.805 -37.922 1.00 35.28  ? 98   TYR B CE2   1 
ATOM   7389  C CZ    . TYR D 3 98  ? 83.826  26.689 -37.467 1.00 34.58  ? 98   TYR B CZ    1 
ATOM   7390  O OH    . TYR D 3 98  ? 82.590  26.238 -37.134 1.00 38.29  ? 98   TYR B OH    1 
ATOM   7391  N N     . GLY D 3 99  ? 90.172  30.046 -37.549 1.00 32.68  ? 99   GLY B N     1 
ATOM   7392  C CA    . GLY D 3 99  ? 91.612  30.245 -37.576 1.00 36.10  ? 99   GLY B CA    1 
ATOM   7393  C C     . GLY D 3 99  ? 92.221  31.340 -36.725 1.00 38.92  ? 99   GLY B C     1 
ATOM   7394  O O     . GLY D 3 99  ? 93.390  31.298 -36.382 1.00 38.66  ? 99   GLY B O     1 
ATOM   7395  N N     . PHE D 3 100 ? 91.423  32.332 -36.379 1.00 45.60  ? 100  PHE B N     1 
ATOM   7396  C CA    . PHE D 3 100 ? 91.908  33.461 -35.610 1.00 45.68  ? 100  PHE B CA    1 
ATOM   7397  C C     . PHE D 3 100 ? 91.076  33.652 -34.343 1.00 47.36  ? 100  PHE B C     1 
ATOM   7398  O O     . PHE D 3 100 ? 90.755  34.769 -33.966 1.00 45.88  ? 100  PHE B O     1 
ATOM   7399  C CB    . PHE D 3 100 ? 91.855  34.699 -36.499 1.00 47.05  ? 100  PHE B CB    1 
ATOM   7400  C CG    . PHE D 3 100 ? 92.545  34.516 -37.808 1.00 46.06  ? 100  PHE B CG    1 
ATOM   7401  C CD1   . PHE D 3 100 ? 92.092  33.584 -38.728 1.00 46.06  ? 100  PHE B CD1   1 
ATOM   7402  C CD2   . PHE D 3 100 ? 93.727  35.200 -38.086 1.00 45.82  ? 100  PHE B CD2   1 
ATOM   7403  C CE1   . PHE D 3 100 ? 92.830  33.326 -39.912 1.00 47.09  ? 100  PHE B CE1   1 
ATOM   7404  C CE2   . PHE D 3 100 ? 94.479  34.952 -39.269 1.00 46.25  ? 100  PHE B CE2   1 
ATOM   7405  C CZ    . PHE D 3 100 ? 94.033  34.017 -40.173 1.00 47.85  ? 100  PHE B CZ    1 
ATOM   7406  N N     . GLY D 3 101 ? 90.723  32.551 -33.687 1.00 88.76  ? 101  GLY B N     1 
ATOM   7407  C CA    . GLY D 3 101 ? 89.937  32.652 -32.469 1.00 94.11  ? 101  GLY B CA    1 
ATOM   7408  C C     . GLY D 3 101 ? 88.449  32.726 -32.746 1.00 97.66  ? 101  GLY B C     1 
ATOM   7409  O O     . GLY D 3 101 ? 88.046  33.278 -33.768 1.00 97.59  ? 101  GLY B O     1 
ATOM   7410  N N     . GLY D 3 102 ? 87.634  32.150 -31.860 1.00 119.38 ? 102  GLY B N     1 
ATOM   7411  C CA    . GLY D 3 102 ? 86.184  32.178 -32.034 1.00 120.18 ? 102  GLY B CA    1 
ATOM   7412  C C     . GLY D 3 102 ? 85.577  31.328 -33.149 1.00 121.82 ? 102  GLY B C     1 
ATOM   7413  O O     . GLY D 3 102 ? 84.630  30.554 -32.875 1.00 103.04 ? 102  GLY B O     1 
ATOM   7414  O OXT   . GLY D 3 102 ? 86.023  31.449 -34.311 1.00 95.87  ? 102  GLY B OXT   1 
ATOM   7415  N N     . ALA E 4 14  ? 52.492  61.640 -12.863 1.00 113.10 ? 814  ALA C N     1 
ATOM   7416  C CA    . ALA E 4 14  ? 53.258  60.427 -13.283 1.00 112.94 ? 814  ALA C CA    1 
ATOM   7417  C C     . ALA E 4 14  ? 53.393  60.330 -14.796 1.00 111.80 ? 814  ALA C C     1 
ATOM   7418  O O     . ALA E 4 14  ? 52.649  59.598 -15.451 1.00 113.31 ? 814  ALA C O     1 
ATOM   7419  C CB    . ALA E 4 14  ? 52.587  59.159 -12.745 1.00 57.01  ? 814  ALA C CB    1 
ATOM   7420  N N     . LYS E 4 15  ? 54.353  61.068 -15.342 1.00 81.55  ? 815  LYS C N     1 
ATOM   7421  C CA    . LYS E 4 15  ? 54.607  61.069 -16.776 1.00 77.71  ? 815  LYS C CA    1 
ATOM   7422  C C     . LYS E 4 15  ? 55.212  59.754 -17.223 1.00 72.18  ? 815  LYS C C     1 
ATOM   7423  O O     . LYS E 4 15  ? 56.060  59.210 -16.535 1.00 71.16  ? 815  LYS C O     1 
ATOM   7424  C CB    . LYS E 4 15  ? 55.580  62.182 -17.142 1.00 79.95  ? 815  LYS C CB    1 
ATOM   7425  C CG    . LYS E 4 15  ? 55.017  63.559 -16.998 1.00 84.50  ? 815  LYS C CG    1 
ATOM   7426  C CD    . LYS E 4 15  ? 55.612  64.474 -18.042 1.00 87.51  ? 815  LYS C CD    1 
ATOM   7427  C CE    . LYS E 4 15  ? 55.142  64.078 -19.428 1.00 89.32  ? 815  LYS C CE    1 
ATOM   7428  N NZ    . LYS E 4 15  ? 55.698  64.957 -20.486 1.00 90.64  ? 815  LYS C NZ    1 
ATOM   7429  N N     . THR E 4 16  ? 54.790  59.248 -18.378 1.00 58.37  ? 816  THR C N     1 
ATOM   7430  C CA    . THR E 4 16  ? 55.348  57.999 -18.888 1.00 50.77  ? 816  THR C CA    1 
ATOM   7431  C C     . THR E 4 16  ? 56.754  58.321 -19.359 1.00 46.00  ? 816  THR C C     1 
ATOM   7432  O O     . THR E 4 16  ? 57.097  59.488 -19.508 1.00 42.10  ? 816  THR C O     1 
ATOM   7433  C CB    . THR E 4 16  ? 54.553  57.453 -20.087 1.00 64.58  ? 816  THR C CB    1 
ATOM   7434  O OG1   . THR E 4 16  ? 54.835  58.231 -21.258 1.00 62.73  ? 816  THR C OG1   1 
ATOM   7435  C CG2   . THR E 4 16  ? 53.083  57.501 -19.796 1.00 61.76  ? 816  THR C CG2   1 
ATOM   7436  N N     . ARG E 4 17  ? 57.574  57.298 -19.584 1.00 51.63  ? 817  ARG C N     1 
ATOM   7437  C CA    . ARG E 4 17  ? 58.938  57.546 -20.041 1.00 49.22  ? 817  ARG C CA    1 
ATOM   7438  C C     . ARG E 4 17  ? 58.936  57.840 -21.517 1.00 45.92  ? 817  ARG C C     1 
ATOM   7439  O O     . ARG E 4 17  ? 59.844  58.502 -22.036 1.00 43.79  ? 817  ARG C O     1 
ATOM   7440  C CB    . ARG E 4 17  ? 59.824  56.351 -19.773 1.00 57.65  ? 817  ARG C CB    1 
ATOM   7441  C CG    . ARG E 4 17  ? 60.140  56.175 -18.332 1.00 61.20  ? 817  ARG C CG    1 
ATOM   7442  C CD    . ARG E 4 17  ? 61.313  55.265 -18.185 1.00 60.39  ? 817  ARG C CD    1 
ATOM   7443  N NE    . ARG E 4 17  ? 60.927  53.870 -18.198 1.00 63.11  ? 817  ARG C NE    1 
ATOM   7444  C CZ    . ARG E 4 17  ? 61.813  52.897 -18.272 1.00 63.72  ? 817  ARG C CZ    1 
ATOM   7445  N NH1   . ARG E 4 17  ? 63.096  53.221 -18.350 1.00 61.53  ? 817  ARG C NH1   1 
ATOM   7446  N NH2   . ARG E 4 17  ? 61.435  51.624 -18.234 1.00 63.75  ? 817  ARG C NH2   1 
ATOM   7447  N N     . SER E 4 18  ? 57.899  57.337 -22.185 1.00 62.14  ? 818  SER C N     1 
ATOM   7448  C CA    . SER E 4 18  ? 57.739  57.538 -23.613 1.00 64.11  ? 818  SER C CA    1 
ATOM   7449  C C     . SER E 4 18  ? 57.555  59.020 -23.877 1.00 64.33  ? 818  SER C C     1 
ATOM   7450  O O     . SER E 4 18  ? 58.136  59.559 -24.817 1.00 63.25  ? 818  SER C O     1 
ATOM   7451  C CB    . SER E 4 18  ? 56.544  56.754 -24.119 1.00 33.71  ? 818  SER C CB    1 
ATOM   7452  O OG    . SER E 4 18  ? 56.672  55.406 -23.747 1.00 35.43  ? 818  SER C OG    1 
ATOM   7453  N N     . SER E 4 19  ? 56.750  59.684 -23.055 1.00 43.59  ? 819  SER C N     1 
ATOM   7454  C CA    . SER E 4 19  ? 56.574  61.122 -23.229 1.00 46.25  ? 819  SER C CA    1 
ATOM   7455  C C     . SER E 4 19  ? 57.822  61.867 -22.747 1.00 45.00  ? 819  SER C C     1 
ATOM   7456  O O     . SER E 4 19  ? 58.230  62.850 -23.364 1.00 45.89  ? 819  SER C O     1 
ATOM   7457  C CB    . SER E 4 19  ? 55.383  61.625 -22.445 1.00 39.67  ? 819  SER C CB    1 
ATOM   7458  O OG    . SER E 4 19  ? 55.641  61.429 -21.084 1.00 46.01  ? 819  SER C OG    1 
ATOM   7459  N N     . ARG E 4 20  ? 58.421  61.409 -21.649 1.00 37.66  ? 820  ARG C N     1 
ATOM   7460  C CA    . ARG E 4 20  ? 59.616  62.048 -21.145 1.00 37.28  ? 820  ARG C CA    1 
ATOM   7461  C C     . ARG E 4 20  ? 60.584  62.092 -22.291 1.00 35.86  ? 820  ARG C C     1 
ATOM   7462  O O     . ARG E 4 20  ? 61.350  63.037 -22.400 1.00 35.13  ? 820  ARG C O     1 
ATOM   7463  C CB    . ARG E 4 20  ? 60.260  61.270 -19.996 1.00 97.54  ? 820  ARG C CB    1 
ATOM   7464  C CG    . ARG E 4 20  ? 59.484  61.211 -18.696 1.00 104.02 ? 820  ARG C CG    1 
ATOM   7465  C CD    . ARG E 4 20  ? 60.313  60.471 -17.656 1.00 110.57 ? 820  ARG C CD    1 
ATOM   7466  N NE    . ARG E 4 20  ? 59.603  60.152 -16.415 1.00 115.70 ? 820  ARG C NE    1 
ATOM   7467  C CZ    . ARG E 4 20  ? 59.225  61.046 -15.504 1.00 118.74 ? 820  ARG C CZ    1 
ATOM   7468  N NH1   . ARG E 4 20  ? 59.476  62.340 -15.680 1.00 120.97 ? 820  ARG C NH1   1 
ATOM   7469  N NH2   . ARG E 4 20  ? 58.620  60.641 -14.396 1.00 119.51 ? 820  ARG C NH2   1 
ATOM   7470  N N     . ALA E 4 21  ? 60.548  61.084 -23.162 1.00 52.84  ? 821  ALA C N     1 
ATOM   7471  C CA    . ALA E 4 21  ? 61.486  61.029 -24.295 1.00 52.16  ? 821  ALA C CA    1 
ATOM   7472  C C     . ALA E 4 21  ? 60.959  61.654 -25.569 1.00 51.49  ? 821  ALA C C     1 
ATOM   7473  O O     . ALA E 4 21  ? 61.722  61.924 -26.498 1.00 53.72  ? 821  ALA C O     1 
ATOM   7474  C CB    . ALA E 4 21  ? 61.887  59.598 -24.570 1.00 78.55  ? 821  ALA C CB    1 
ATOM   7475  N N     . GLY E 4 22  ? 59.655  61.895 -25.597 1.00 57.18  ? 822  GLY C N     1 
ATOM   7476  C CA    . GLY E 4 22  ? 59.021  62.463 -26.767 1.00 54.31  ? 822  GLY C CA    1 
ATOM   7477  C C     . GLY E 4 22  ? 58.839  61.367 -27.795 1.00 52.88  ? 822  GLY C C     1 
ATOM   7478  O O     . GLY E 4 22  ? 59.357  61.501 -28.913 1.00 50.95  ? 822  GLY C O     1 
ATOM   7479  N N     . LEU E 4 23  ? 58.131  60.285 -27.425 1.00 27.93  ? 823  LEU C N     1 
ATOM   7480  C CA    . LEU E 4 23  ? 57.905  59.145 -28.333 1.00 26.99  ? 823  LEU C CA    1 
ATOM   7481  C C     . LEU E 4 23  ? 56.502  58.550 -28.285 1.00 28.09  ? 823  LEU C C     1 
ATOM   7482  O O     . LEU E 4 23  ? 55.778  58.723 -27.326 1.00 30.93  ? 823  LEU C O     1 
ATOM   7483  C CB    . LEU E 4 23  ? 58.936  58.038 -28.067 1.00 37.41  ? 823  LEU C CB    1 
ATOM   7484  C CG    . LEU E 4 23  ? 60.394  58.517 -28.048 1.00 35.78  ? 823  LEU C CG    1 
ATOM   7485  C CD1   . LEU E 4 23  ? 61.277  57.447 -27.452 1.00 33.13  ? 823  LEU C CD1   1 
ATOM   7486  C CD2   . LEU E 4 23  ? 60.861  58.909 -29.432 1.00 35.70  ? 823  LEU C CD2   1 
ATOM   7487  N N     . GLN E 4 24  ? 56.102  57.872 -29.345 1.00 40.09  ? 824  GLN C N     1 
ATOM   7488  C CA    . GLN E 4 24  ? 54.785  57.275 -29.361 1.00 40.49  ? 824  GLN C CA    1 
ATOM   7489  C C     . GLN E 4 24  ? 54.943  55.908 -28.735 1.00 40.16  ? 824  GLN C C     1 
ATOM   7490  O O     . GLN E 4 24  ? 54.144  55.520 -27.867 1.00 41.71  ? 824  GLN C O     1 
ATOM   7491  C CB    . GLN E 4 24  ? 54.258  57.138 -30.790 1.00 48.07  ? 824  GLN C CB    1 
ATOM   7492  C CG    . GLN E 4 24  ? 54.032  58.459 -31.487 1.00 51.14  ? 824  GLN C CG    1 
ATOM   7493  C CD    . GLN E 4 24  ? 53.482  59.494 -30.549 1.00 49.33  ? 824  GLN C CD    1 
ATOM   7494  O OE1   . GLN E 4 24  ? 52.375  59.367 -30.038 1.00 47.87  ? 824  GLN C OE1   1 
ATOM   7495  N NE2   . GLN E 4 24  ? 54.266  60.523 -30.300 1.00 54.00  ? 824  GLN C NE2   1 
ATOM   7496  N N     . PHE E 4 25  ? 56.002  55.212 -29.183 1.00 48.36  ? 825  PHE C N     1 
ATOM   7497  C CA    . PHE E 4 25  ? 56.399  53.875 -28.735 1.00 48.69  ? 825  PHE C CA    1 
ATOM   7498  C C     . PHE E 4 25  ? 56.662  53.766 -27.230 1.00 50.84  ? 825  PHE C C     1 
ATOM   7499  O O     . PHE E 4 25  ? 57.259  54.651 -26.613 1.00 49.16  ? 825  PHE C O     1 
ATOM   7500  C CB    . PHE E 4 25  ? 57.625  53.423 -29.517 1.00 49.75  ? 825  PHE C CB    1 
ATOM   7501  C CG    . PHE E 4 25  ? 57.295  52.864 -30.853 1.00 52.55  ? 825  PHE C CG    1 
ATOM   7502  C CD1   . PHE E 4 25  ? 56.592  53.617 -31.781 1.00 51.49  ? 825  PHE C CD1   1 
ATOM   7503  C CD2   . PHE E 4 25  ? 57.630  51.552 -31.172 1.00 54.72  ? 825  PHE C CD2   1 
ATOM   7504  C CE1   . PHE E 4 25  ? 56.212  53.061 -33.018 1.00 53.16  ? 825  PHE C CE1   1 
ATOM   7505  C CE2   . PHE E 4 25  ? 57.255  50.991 -32.410 1.00 55.07  ? 825  PHE C CE2   1 
ATOM   7506  C CZ    . PHE E 4 25  ? 56.546  51.749 -33.329 1.00 54.17  ? 825  PHE C CZ    1 
ATOM   7507  N N     . PRO E 4 26  ? 56.252  52.634 -26.635 1.00 50.58  ? 826  PRO C N     1 
ATOM   7508  C CA    . PRO E 4 26  ? 56.366  52.305 -25.216 1.00 49.75  ? 826  PRO C CA    1 
ATOM   7509  C C     . PRO E 4 26  ? 57.726  52.011 -24.634 1.00 51.77  ? 826  PRO C C     1 
ATOM   7510  O O     . PRO E 4 26  ? 58.171  50.883 -24.690 1.00 48.44  ? 826  PRO C O     1 
ATOM   7511  C CB    . PRO E 4 26  ? 55.426  51.124 -25.088 1.00 44.00  ? 826  PRO C CB    1 
ATOM   7512  C CG    . PRO E 4 26  ? 55.719  50.380 -26.346 1.00 44.79  ? 826  PRO C CG    1 
ATOM   7513  C CD    . PRO E 4 26  ? 55.821  51.446 -27.400 1.00 43.48  ? 826  PRO C CD    1 
ATOM   7514  N N     . VAL E 4 27  ? 58.367  53.018 -24.051 1.00 34.63  ? 827  VAL C N     1 
ATOM   7515  C CA    . VAL E 4 27  ? 59.677  52.824 -23.437 1.00 34.83  ? 827  VAL C CA    1 
ATOM   7516  C C     . VAL E 4 27  ? 59.616  51.774 -22.305 1.00 36.41  ? 827  VAL C C     1 
ATOM   7517  O O     . VAL E 4 27  ? 60.528  50.945 -22.179 1.00 33.42  ? 827  VAL C O     1 
ATOM   7518  C CB    . VAL E 4 27  ? 60.257  54.147 -22.865 1.00 26.39  ? 827  VAL C CB    1 
ATOM   7519  C CG1   . VAL E 4 27  ? 61.591  53.907 -22.230 1.00 28.13  ? 827  VAL C CG1   1 
ATOM   7520  C CG2   . VAL E 4 27  ? 60.437  55.157 -23.954 1.00 25.34  ? 827  VAL C CG2   1 
ATOM   7521  N N     . GLY E 4 28  ? 58.550  51.787 -21.500 1.00 37.49  ? 828  GLY C N     1 
ATOM   7522  C CA    . GLY E 4 28  ? 58.439  50.820 -20.422 1.00 37.46  ? 828  GLY C CA    1 
ATOM   7523  C C     . GLY E 4 28  ? 58.363  49.384 -20.924 1.00 39.16  ? 828  GLY C C     1 
ATOM   7524  O O     . GLY E 4 28  ? 58.916  48.458 -20.336 1.00 36.96  ? 828  GLY C O     1 
ATOM   7525  N N     . ARG E 4 29  ? 57.659  49.212 -22.036 1.00 58.01  ? 829  ARG C N     1 
ATOM   7526  C CA    . ARG E 4 29  ? 57.466  47.903 -22.658 1.00 58.50  ? 829  ARG C CA    1 
ATOM   7527  C C     . ARG E 4 29  ? 58.734  47.391 -23.303 1.00 58.09  ? 829  ARG C C     1 
ATOM   7528  O O     . ARG E 4 29  ? 59.104  46.248 -23.113 1.00 57.84  ? 829  ARG C O     1 
ATOM   7529  C CB    . ARG E 4 29  ? 56.375  47.997 -23.725 1.00 41.37  ? 829  ARG C CB    1 
ATOM   7530  C CG    . ARG E 4 29  ? 56.171  46.753 -24.540 1.00 41.87  ? 829  ARG C CG    1 
ATOM   7531  C CD    . ARG E 4 29  ? 54.784  46.263 -24.304 1.00 44.85  ? 829  ARG C CD    1 
ATOM   7532  N NE    . ARG E 4 29  ? 53.905  46.520 -25.426 1.00 48.09  ? 829  ARG C NE    1 
ATOM   7533  C CZ    . ARG E 4 29  ? 52.587  46.664 -25.308 1.00 47.25  ? 829  ARG C CZ    1 
ATOM   7534  N NH1   . ARG E 4 29  ? 52.000  46.591 -24.118 1.00 48.22  ? 829  ARG C NH1   1 
ATOM   7535  N NH2   . ARG E 4 29  ? 51.837  46.841 -26.383 1.00 52.12  ? 829  ARG C NH2   1 
ATOM   7536  N N     . VAL E 4 30  ? 59.373  48.248 -24.092 1.00 46.15  ? 830  VAL C N     1 
ATOM   7537  C CA    . VAL E 4 30  ? 60.600  47.902 -24.778 1.00 47.02  ? 830  VAL C CA    1 
ATOM   7538  C C     . VAL E 4 30  ? 61.678  47.606 -23.740 1.00 50.47  ? 830  VAL C C     1 
ATOM   7539  O O     . VAL E 4 30  ? 62.702  46.985 -24.042 1.00 50.43  ? 830  VAL C O     1 
ATOM   7540  C CB    . VAL E 4 30  ? 61.061  49.070 -25.709 1.00 44.12  ? 830  VAL C CB    1 
ATOM   7541  C CG1   . VAL E 4 30  ? 62.507  48.831 -26.198 1.00 41.78  ? 830  VAL C CG1   1 
ATOM   7542  C CG2   . VAL E 4 30  ? 60.134  49.181 -26.911 1.00 41.62  ? 830  VAL C CG2   1 
ATOM   7543  N N     . HIS E 4 31  ? 61.442  48.052 -22.510 1.00 36.25  ? 831  HIS C N     1 
ATOM   7544  C CA    . HIS E 4 31  ? 62.392  47.830 -21.422 1.00 39.19  ? 831  HIS C CA    1 
ATOM   7545  C C     . HIS E 4 31  ? 62.153  46.442 -20.815 1.00 40.37  ? 831  HIS C C     1 
ATOM   7546  O O     . HIS E 4 31  ? 63.074  45.756 -20.437 1.00 40.37  ? 831  HIS C O     1 
ATOM   7547  C CB    . HIS E 4 31  ? 62.216  48.909 -20.352 1.00 45.23  ? 831  HIS C CB    1 
ATOM   7548  C CG    . HIS E 4 31  ? 63.388  49.043 -19.445 1.00 46.31  ? 831  HIS C CG    1 
ATOM   7549  N ND1   . HIS E 4 31  ? 64.170  47.970 -19.084 1.00 50.00  ? 831  HIS C ND1   1 
ATOM   7550  C CD2   . HIS E 4 31  ? 63.932  50.124 -18.845 1.00 47.10  ? 831  HIS C CD2   1 
ATOM   7551  C CE1   . HIS E 4 31  ? 65.154  48.386 -18.308 1.00 48.60  ? 831  HIS C CE1   1 
ATOM   7552  N NE2   . HIS E 4 31  ? 65.033  49.690 -18.148 1.00 49.16  ? 831  HIS C NE2   1 
ATOM   7553  N N     . ARG E 4 32  ? 60.895  46.048 -20.709 1.00 39.08  ? 832  ARG C N     1 
ATOM   7554  C CA    . ARG E 4 32  ? 60.550  44.738 -20.171 1.00 40.58  ? 832  ARG C CA    1 
ATOM   7555  C C     . ARG E 4 32  ? 61.069  43.696 -21.111 1.00 40.34  ? 832  ARG C C     1 
ATOM   7556  O O     . ARG E 4 32  ? 61.756  42.802 -20.704 1.00 41.94  ? 832  ARG C O     1 
ATOM   7557  C CB    . ARG E 4 32  ? 59.052  44.543 -20.115 1.00 47.44  ? 832  ARG C CB    1 
ATOM   7558  C CG    . ARG E 4 32  ? 58.389  44.824 -18.830 1.00 49.52  ? 832  ARG C CG    1 
ATOM   7559  C CD    . ARG E 4 32  ? 56.928  44.701 -19.106 1.00 54.97  ? 832  ARG C CD    1 
ATOM   7560  N NE    . ARG E 4 32  ? 56.678  43.643 -20.093 1.00 56.54  ? 832  ARG C NE    1 
ATOM   7561  C CZ    . ARG E 4 32  ? 55.830  43.753 -21.119 1.00 58.13  ? 832  ARG C CZ    1 
ATOM   7562  N NH1   . ARG E 4 32  ? 55.144  44.869 -21.314 1.00 59.61  ? 832  ARG C NH1   1 
ATOM   7563  N NH2   . ARG E 4 32  ? 55.665  42.740 -21.952 1.00 61.19  ? 832  ARG C NH2   1 
ATOM   7564  N N     . LEU E 4 33  ? 60.687  43.803 -22.375 1.00 53.14  ? 833  LEU C N     1 
ATOM   7565  C CA    . LEU E 4 33  ? 61.117  42.873 -23.386 1.00 51.88  ? 833  LEU C CA    1 
ATOM   7566  C C     . LEU E 4 33  ? 62.624  42.798 -23.391 1.00 50.16  ? 833  LEU C C     1 
ATOM   7567  O O     . LEU E 4 33  ? 63.170  41.746 -23.672 1.00 51.12  ? 833  LEU C O     1 
ATOM   7568  C CB    . LEU E 4 33  ? 60.578  43.291 -24.750 1.00 47.58  ? 833  LEU C CB    1 
ATOM   7569  C CG    . LEU E 4 33  ? 59.066  43.489 -24.647 1.00 48.36  ? 833  LEU C CG    1 
ATOM   7570  C CD1   . LEU E 4 33  ? 58.422  43.892 -25.981 1.00 49.55  ? 833  LEU C CD1   1 
ATOM   7571  C CD2   . LEU E 4 33  ? 58.478  42.208 -24.133 1.00 49.18  ? 833  LEU C CD2   1 
ATOM   7572  N N     . LEU E 4 34  ? 63.326  43.879 -23.078 1.00 39.73  ? 834  LEU C N     1 
ATOM   7573  C CA    . LEU E 4 34  ? 64.774  43.743 -23.042 1.00 40.66  ? 834  LEU C CA    1 
ATOM   7574  C C     . LEU E 4 34  ? 65.242  42.904 -21.856 1.00 44.69  ? 834  LEU C C     1 
ATOM   7575  O O     . LEU E 4 34  ? 66.390  42.503 -21.799 1.00 44.90  ? 834  LEU C O     1 
ATOM   7576  C CB    . LEU E 4 34  ? 65.485  45.085 -22.997 1.00 27.28  ? 834  LEU C CB    1 
ATOM   7577  C CG    . LEU E 4 34  ? 65.871  45.693 -24.347 1.00 30.20  ? 834  LEU C CG    1 
ATOM   7578  C CD1   . LEU E 4 34  ? 66.747  46.901 -24.102 1.00 26.72  ? 834  LEU C CD1   1 
ATOM   7579  C CD2   . LEU E 4 34  ? 66.623  44.691 -25.208 1.00 25.53  ? 834  LEU C CD2   1 
ATOM   7580  N N     . ARG E 4 35  ? 64.361  42.626 -20.909 1.00 47.36  ? 835  ARG C N     1 
ATOM   7581  C CA    . ARG E 4 35  ? 64.739  41.828 -19.754 1.00 51.79  ? 835  ARG C CA    1 
ATOM   7582  C C     . ARG E 4 35  ? 64.339  40.395 -19.998 1.00 53.35  ? 835  ARG C C     1 
ATOM   7583  O O     . ARG E 4 35  ? 65.104  39.472 -19.729 1.00 56.12  ? 835  ARG C O     1 
ATOM   7584  C CB    . ARG E 4 35  ? 64.065  42.340 -18.478 1.00 54.36  ? 835  ARG C CB    1 
ATOM   7585  C CG    . ARG E 4 35  ? 64.513  43.714 -18.038 1.00 56.19  ? 835  ARG C CG    1 
ATOM   7586  C CD    . ARG E 4 35  ? 63.791  44.122 -16.774 1.00 62.14  ? 835  ARG C CD    1 
ATOM   7587  N NE    . ARG E 4 35  ? 63.950  45.544 -16.455 1.00 65.66  ? 835  ARG C NE    1 
ATOM   7588  C CZ    . ARG E 4 35  ? 65.066  46.111 -15.993 1.00 67.64  ? 835  ARG C CZ    1 
ATOM   7589  N NH1   . ARG E 4 35  ? 66.163  45.386 -15.781 1.00 69.54  ? 835  ARG C NH1   1 
ATOM   7590  N NH2   . ARG E 4 35  ? 65.081  47.411 -15.727 1.00 69.33  ? 835  ARG C NH2   1 
ATOM   7591  N N     . LYS E 4 36  ? 63.142  40.202 -20.520 1.00 48.63  ? 836  LYS C N     1 
ATOM   7592  C CA    . LYS E 4 36  ? 62.659  38.864 -20.791 1.00 51.16  ? 836  LYS C CA    1 
ATOM   7593  C C     . LYS E 4 36  ? 63.395  38.232 -21.987 1.00 50.04  ? 836  LYS C C     1 
ATOM   7594  O O     . LYS E 4 36  ? 63.316  37.022 -22.215 1.00 48.71  ? 836  LYS C O     1 
ATOM   7595  C CB    . LYS E 4 36  ? 61.152  38.899 -21.079 1.00 64.18  ? 836  LYS C CB    1 
ATOM   7596  C CG    . LYS E 4 36  ? 60.818  38.821 -22.574 1.00 70.41  ? 836  LYS C CG    1 
ATOM   7597  C CD    . LYS E 4 36  ? 59.340  39.066 -22.876 1.00 75.32  ? 836  LYS C CD    1 
ATOM   7598  C CE    . LYS E 4 36  ? 58.404  38.033 -22.272 1.00 76.92  ? 836  LYS C CE    1 
ATOM   7599  N NZ    . LYS E 4 36  ? 56.995  38.428 -22.561 1.00 80.94  ? 836  LYS C NZ    1 
ATOM   7600  N N     . GLY E 4 37  ? 64.092  39.048 -22.763 1.00 42.10  ? 837  GLY C N     1 
ATOM   7601  C CA    . GLY E 4 37  ? 64.781  38.511 -23.919 1.00 38.89  ? 837  GLY C CA    1 
ATOM   7602  C C     . GLY E 4 37  ? 66.122  37.963 -23.536 1.00 39.31  ? 837  GLY C C     1 
ATOM   7603  O O     . GLY E 4 37  ? 66.813  37.344 -24.351 1.00 38.44  ? 837  GLY C O     1 
ATOM   7604  N N     . ASN E 4 38  ? 66.468  38.182 -22.272 1.00 49.44  ? 838  ASN C N     1 
ATOM   7605  C CA    . ASN E 4 38  ? 67.728  37.749 -21.715 1.00 51.15  ? 838  ASN C CA    1 
ATOM   7606  C C     . ASN E 4 38  ? 68.841  38.071 -22.681 1.00 47.99  ? 838  ASN C C     1 
ATOM   7607  O O     . ASN E 4 38  ? 69.365  37.181 -23.344 1.00 49.93  ? 838  ASN C O     1 
ATOM   7608  C CB    . ASN E 4 38  ? 67.703  36.247 -21.422 1.00 103.72 ? 838  ASN C CB    1 
ATOM   7609  C CG    . ASN E 4 38  ? 68.022  35.941 -19.976 1.00 107.22 ? 838  ASN C CG    1 
ATOM   7610  O OD1   . ASN E 4 38  ? 67.288  36.345 -19.073 1.00 108.84 ? 838  ASN C OD1   1 
ATOM   7611  N ND2   . ASN E 4 38  ? 69.128  35.238 -19.743 1.00 109.88 ? 838  ASN C ND2   1 
ATOM   7612  N N     . TYR E 4 39  ? 69.192  39.347 -22.774 1.00 51.38  ? 839  TYR C N     1 
ATOM   7613  C CA    . TYR E 4 39  ? 70.256  39.760 -23.670 1.00 47.11  ? 839  TYR C CA    1 
ATOM   7614  C C     . TYR E 4 39  ? 71.522  40.122 -22.902 1.00 46.35  ? 839  TYR C C     1 
ATOM   7615  O O     . TYR E 4 39  ? 72.624  40.029 -23.445 1.00 46.13  ? 839  TYR C O     1 
ATOM   7616  C CB    . TYR E 4 39  ? 69.797  40.924 -24.525 1.00 43.50  ? 839  TYR C CB    1 
ATOM   7617  C CG    . TYR E 4 39  ? 68.588  40.604 -25.392 1.00 44.36  ? 839  TYR C CG    1 
ATOM   7618  C CD1   . TYR E 4 39  ? 67.304  40.988 -25.017 1.00 42.51  ? 839  TYR C CD1   1 
ATOM   7619  C CD2   . TYR E 4 39  ? 68.739  39.935 -26.605 1.00 43.28  ? 839  TYR C CD2   1 
ATOM   7620  C CE1   . TYR E 4 39  ? 66.222  40.719 -25.824 1.00 44.21  ? 839  TYR C CE1   1 
ATOM   7621  C CE2   . TYR E 4 39  ? 67.660  39.658 -27.418 1.00 45.20  ? 839  TYR C CE2   1 
ATOM   7622  C CZ    . TYR E 4 39  ? 66.406  40.045 -27.031 1.00 46.78  ? 839  TYR C CZ    1 
ATOM   7623  O OH    . TYR E 4 39  ? 65.321  39.721 -27.838 1.00 49.47  ? 839  TYR C OH    1 
ATOM   7624  N N     . ALA E 4 40  ? 71.377  40.553 -21.651 1.00 34.49  ? 840  ALA C N     1 
ATOM   7625  C CA    . ALA E 4 40  ? 72.535  40.854 -20.800 1.00 37.17  ? 840  ALA C CA    1 
ATOM   7626  C C     . ALA E 4 40  ? 72.148  40.884 -19.311 1.00 38.68  ? 840  ALA C C     1 
ATOM   7627  O O     . ALA E 4 40  ? 70.973  40.843 -18.974 1.00 38.52  ? 840  ALA C O     1 
ATOM   7628  C CB    . ALA E 4 40  ? 73.184  42.155 -21.210 1.00 23.88  ? 840  ALA C CB    1 
ATOM   7629  N N     . GLU E 4 41  ? 73.121  40.931 -18.409 1.00 42.55  ? 841  GLU C N     1 
ATOM   7630  C CA    . GLU E 4 41  ? 72.751  40.952 -17.008 1.00 45.44  ? 841  GLU C CA    1 
ATOM   7631  C C     . GLU E 4 41  ? 71.973  42.213 -16.650 1.00 44.20  ? 841  GLU C C     1 
ATOM   7632  O O     . GLU E 4 41  ? 70.966  42.155 -15.948 1.00 44.31  ? 841  GLU C O     1 
ATOM   7633  C CB    . GLU E 4 41  ? 73.992  40.810 -16.137 1.00 118.96 ? 841  GLU C CB    1 
ATOM   7634  C CG    . GLU E 4 41  ? 74.682  39.469 -16.320 1.00 127.15 ? 841  GLU C CG    1 
ATOM   7635  C CD    . GLU E 4 41  ? 73.753  38.294 -16.050 1.00 132.07 ? 841  GLU C CD    1 
ATOM   7636  O OE1   . GLU E 4 41  ? 73.249  38.184 -14.915 1.00 132.35 ? 841  GLU C OE1   1 
ATOM   7637  O OE2   . GLU E 4 41  ? 73.524  37.477 -16.969 1.00 134.30 ? 841  GLU C OE2   1 
ATOM   7638  N N     . ARG E 4 42  ? 72.414  43.361 -17.142 1.00 58.48  ? 842  ARG C N     1 
ATOM   7639  C CA    . ARG E 4 42  ? 71.702  44.586 -16.825 1.00 57.99  ? 842  ARG C CA    1 
ATOM   7640  C C     . ARG E 4 42  ? 71.289  45.380 -18.062 1.00 56.51  ? 842  ARG C C     1 
ATOM   7641  O O     . ARG E 4 42  ? 71.901  45.239 -19.132 1.00 54.90  ? 842  ARG C O     1 
ATOM   7642  C CB    . ARG E 4 42  ? 72.569  45.463 -15.931 1.00 73.28  ? 842  ARG C CB    1 
ATOM   7643  C CG    . ARG E 4 42  ? 73.600  44.695 -15.129 1.00 78.70  ? 842  ARG C CG    1 
ATOM   7644  C CD    . ARG E 4 42  ? 74.496  45.650 -14.352 1.00 81.37  ? 842  ARG C CD    1 
ATOM   7645  N NE    . ARG E 4 42  ? 74.064  45.830 -12.967 1.00 88.24  ? 842  ARG C NE    1 
ATOM   7646  C CZ    . ARG E 4 42  ? 74.493  46.807 -12.175 1.00 89.62  ? 842  ARG C CZ    1 
ATOM   7647  N NH1   . ARG E 4 42  ? 75.361  47.698 -12.642 1.00 89.83  ? 842  ARG C NH1   1 
ATOM   7648  N NH2   . ARG E 4 42  ? 74.068  46.881 -10.918 1.00 91.14  ? 842  ARG C NH2   1 
ATOM   7649  N N     . VAL E 4 43  ? 70.234  46.190 -17.901 1.00 37.11  ? 843  VAL C N     1 
ATOM   7650  C CA    . VAL E 4 43  ? 69.757  47.074 -18.961 1.00 35.90  ? 843  VAL C CA    1 
ATOM   7651  C C     . VAL E 4 43  ? 69.784  48.545 -18.542 1.00 35.85  ? 843  VAL C C     1 
ATOM   7652  O O     . VAL E 4 43  ? 69.086  48.965 -17.616 1.00 36.13  ? 843  VAL C O     1 
ATOM   7653  C CB    . VAL E 4 43  ? 68.342  46.761 -19.390 1.00 32.38  ? 843  VAL C CB    1 
ATOM   7654  C CG1   . VAL E 4 43  ? 67.975  47.634 -20.532 1.00 30.00  ? 843  VAL C CG1   1 
ATOM   7655  C CG2   . VAL E 4 43  ? 68.245  45.370 -19.844 1.00 34.48  ? 843  VAL C CG2   1 
ATOM   7656  N N     . GLY E 4 44  ? 70.608  49.320 -19.239 1.00 27.53  ? 844  GLY C N     1 
ATOM   7657  C CA    . GLY E 4 44  ? 70.706  50.759 -18.989 1.00 27.67  ? 844  GLY C CA    1 
ATOM   7658  C C     . GLY E 4 44  ? 69.387  51.505 -19.183 1.00 27.48  ? 844  GLY C C     1 
ATOM   7659  O O     . GLY E 4 44  ? 68.458  50.988 -19.824 1.00 26.08  ? 844  GLY C O     1 
ATOM   7660  N N     . ALA E 4 45  ? 69.295  52.712 -18.629 1.00 54.67  ? 845  ALA C N     1 
ATOM   7661  C CA    . ALA E 4 45  ? 68.079  53.520 -18.708 1.00 53.51  ? 845  ALA C CA    1 
ATOM   7662  C C     . ALA E 4 45  ? 67.812  54.070 -20.100 1.00 50.22  ? 845  ALA C C     1 
ATOM   7663  O O     . ALA E 4 45  ? 66.656  54.175 -20.537 1.00 52.36  ? 845  ALA C O     1 
ATOM   7664  C CB    . ALA E 4 45  ? 68.150  54.662 -17.713 1.00 118.48 ? 845  ALA C CB    1 
ATOM   7665  N N     . GLY E 4 46  ? 68.884  54.418 -20.794 1.00 55.94  ? 846  GLY C N     1 
ATOM   7666  C CA    . GLY E 4 46  ? 68.738  54.953 -22.124 1.00 57.86  ? 846  GLY C CA    1 
ATOM   7667  C C     . GLY E 4 46  ? 68.574  53.895 -23.186 1.00 56.83  ? 846  GLY C C     1 
ATOM   7668  O O     . GLY E 4 46  ? 68.160  54.202 -24.302 1.00 58.14  ? 846  GLY C O     1 
ATOM   7669  N N     . ALA E 4 47  ? 68.894  52.652 -22.849 1.00 39.74  ? 847  ALA C N     1 
ATOM   7670  C CA    . ALA E 4 47  ? 68.793  51.544 -23.796 1.00 39.24  ? 847  ALA C CA    1 
ATOM   7671  C C     . ALA E 4 47  ? 67.425  51.442 -24.402 1.00 37.11  ? 847  ALA C C     1 
ATOM   7672  O O     . ALA E 4 47  ? 67.266  51.513 -25.604 1.00 39.11  ? 847  ALA C O     1 
ATOM   7673  C CB    . ALA E 4 47  ? 69.134  50.239 -23.116 1.00 76.75  ? 847  ALA C CB    1 
ATOM   7674  N N     . PRO E 4 48  ? 66.403  51.301 -23.568 1.00 39.59  ? 848  PRO C N     1 
ATOM   7675  C CA    . PRO E 4 48  ? 65.054  51.187 -24.132 1.00 40.03  ? 848  PRO C CA    1 
ATOM   7676  C C     . PRO E 4 48  ? 64.562  52.448 -24.808 1.00 41.75  ? 848  PRO C C     1 
ATOM   7677  O O     . PRO E 4 48  ? 63.804  52.404 -25.757 1.00 40.46  ? 848  PRO C O     1 
ATOM   7678  C CB    . PRO E 4 48  ? 64.204  50.788 -22.919 1.00 31.28  ? 848  PRO C CB    1 
ATOM   7679  C CG    . PRO E 4 48  ? 64.899  51.514 -21.788 1.00 32.10  ? 848  PRO C CG    1 
ATOM   7680  C CD    . PRO E 4 48  ? 66.380  51.347 -22.092 1.00 31.17  ? 848  PRO C CD    1 
ATOM   7681  N N     . VAL E 4 49  ? 65.019  53.573 -24.309 1.00 21.06  ? 849  VAL C N     1 
ATOM   7682  C CA    . VAL E 4 49  ? 64.627  54.860 -24.816 1.00 20.65  ? 849  VAL C CA    1 
ATOM   7683  C C     . VAL E 4 49  ? 65.138  55.050 -26.227 1.00 20.24  ? 849  VAL C C     1 
ATOM   7684  O O     . VAL E 4 49  ? 64.390  55.446 -27.118 1.00 22.11  ? 849  VAL C O     1 
ATOM   7685  C CB    . VAL E 4 49  ? 65.156  55.996 -23.866 1.00 26.82  ? 849  VAL C CB    1 
ATOM   7686  C CG1   . VAL E 4 49  ? 65.159  57.330 -24.585 1.00 26.38  ? 849  VAL C CG1   1 
ATOM   7687  C CG2   . VAL E 4 49  ? 64.292  56.068 -22.591 1.00 27.21  ? 849  VAL C CG2   1 
ATOM   7688  N N     . TYR E 4 50  ? 66.414  54.765 -26.414 1.00 32.46  ? 850  TYR C N     1 
ATOM   7689  C CA    . TYR E 4 50  ? 67.079  54.873 -27.703 1.00 34.34  ? 850  TYR C CA    1 
ATOM   7690  C C     . TYR E 4 50  ? 66.489  53.870 -28.731 1.00 36.00  ? 850  TYR C C     1 
ATOM   7691  O O     . TYR E 4 50  ? 66.326  54.170 -29.912 1.00 36.79  ? 850  TYR C O     1 
ATOM   7692  C CB    . TYR E 4 50  ? 68.587  54.590 -27.479 1.00 26.01  ? 850  TYR C CB    1 
ATOM   7693  C CG    . TYR E 4 50  ? 69.501  54.883 -28.657 1.00 28.74  ? 850  TYR C CG    1 
ATOM   7694  C CD1   . TYR E 4 50  ? 70.638  55.681 -28.495 1.00 28.62  ? 850  TYR C CD1   1 
ATOM   7695  C CD2   . TYR E 4 50  ? 69.202  54.401 -29.942 1.00 29.71  ? 850  TYR C CD2   1 
ATOM   7696  C CE1   . TYR E 4 50  ? 71.453  56.009 -29.578 1.00 32.50  ? 850  TYR C CE1   1 
ATOM   7697  C CE2   . TYR E 4 50  ? 70.009  54.719 -31.038 1.00 27.88  ? 850  TYR C CE2   1 
ATOM   7698  C CZ    . TYR E 4 50  ? 71.135  55.534 -30.856 1.00 31.94  ? 850  TYR C CZ    1 
ATOM   7699  O OH    . TYR E 4 50  ? 71.867  55.924 -31.965 1.00 31.16  ? 850  TYR C OH    1 
ATOM   7700  N N     . LEU E 4 51  ? 66.175  52.671 -28.260 1.00 40.22  ? 851  LEU C N     1 
ATOM   7701  C CA    . LEU E 4 51  ? 65.677  51.626 -29.118 1.00 39.24  ? 851  LEU C CA    1 
ATOM   7702  C C     . LEU E 4 51  ? 64.249  51.845 -29.558 1.00 40.52  ? 851  LEU C C     1 
ATOM   7703  O O     . LEU E 4 51  ? 63.887  51.526 -30.688 1.00 40.01  ? 851  LEU C O     1 
ATOM   7704  C CB    . LEU E 4 51  ? 65.845  50.268 -28.421 1.00 37.24  ? 851  LEU C CB    1 
ATOM   7705  C CG    . LEU E 4 51  ? 65.214  49.034 -29.075 1.00 36.04  ? 851  LEU C CG    1 
ATOM   7706  C CD1   . LEU E 4 51  ? 65.850  48.655 -30.403 1.00 33.54  ? 851  LEU C CD1   1 
ATOM   7707  C CD2   . LEU E 4 51  ? 65.355  47.920 -28.075 1.00 33.93  ? 851  LEU C CD2   1 
ATOM   7708  N N     . ALA E 4 52  ? 63.417  52.372 -28.676 1.00 43.57  ? 852  ALA C N     1 
ATOM   7709  C CA    . ALA E 4 52  ? 62.044  52.628 -29.069 1.00 42.74  ? 852  ALA C CA    1 
ATOM   7710  C C     . ALA E 4 52  ? 62.091  53.820 -30.056 1.00 41.24  ? 852  ALA C C     1 
ATOM   7711  O O     . ALA E 4 52  ? 61.282  53.929 -30.977 1.00 40.56  ? 852  ALA C O     1 
ATOM   7712  C CB    . ALA E 4 52  ? 61.205  52.918 -27.846 1.00 12.91  ? 852  ALA C CB    1 
ATOM   7713  N N     . ALA E 4 53  ? 63.075  54.694 -29.877 1.00 38.02  ? 853  ALA C N     1 
ATOM   7714  C CA    . ALA E 4 53  ? 63.267  55.811 -30.782 1.00 37.58  ? 853  ALA C CA    1 
ATOM   7715  C C     . ALA E 4 53  ? 63.592  55.283 -32.161 1.00 37.79  ? 853  ALA C C     1 
ATOM   7716  O O     . ALA E 4 53  ? 63.077  55.771 -33.139 1.00 35.96  ? 853  ALA C O     1 
ATOM   7717  C CB    . ALA E 4 53  ? 64.391  56.655 -30.327 1.00 23.99  ? 853  ALA C CB    1 
ATOM   7718  N N     . VAL E 4 54  ? 64.475  54.302 -32.245 1.00 27.14  ? 854  VAL C N     1 
ATOM   7719  C CA    . VAL E 4 54  ? 64.834  53.739 -33.534 1.00 28.10  ? 854  VAL C CA    1 
ATOM   7720  C C     . VAL E 4 54  ? 63.618  52.994 -34.145 1.00 29.47  ? 854  VAL C C     1 
ATOM   7721  O O     . VAL E 4 54  ? 63.240  53.219 -35.302 1.00 29.25  ? 854  VAL C O     1 
ATOM   7722  C CB    . VAL E 4 54  ? 66.089  52.790 -33.398 1.00 30.00  ? 854  VAL C CB    1 
ATOM   7723  C CG1   . VAL E 4 54  ? 66.535  52.289 -34.751 1.00 30.74  ? 854  VAL C CG1   1 
ATOM   7724  C CG2   . VAL E 4 54  ? 67.240  53.548 -32.777 1.00 28.30  ? 854  VAL C CG2   1 
ATOM   7725  N N     . LEU E 4 55  ? 62.987  52.127 -33.366 1.00 34.62  ? 855  LEU C N     1 
ATOM   7726  C CA    . LEU E 4 55  ? 61.841  51.393 -33.870 1.00 35.47  ? 855  LEU C CA    1 
ATOM   7727  C C     . LEU E 4 55  ? 60.742  52.342 -34.337 1.00 37.82  ? 855  LEU C C     1 
ATOM   7728  O O     . LEU E 4 55  ? 60.051  52.060 -35.301 1.00 36.02  ? 855  LEU C O     1 
ATOM   7729  C CB    . LEU E 4 55  ? 61.289  50.465 -32.790 1.00 31.13  ? 855  LEU C CB    1 
ATOM   7730  C CG    . LEU E 4 55  ? 62.296  49.439 -32.271 1.00 28.92  ? 855  LEU C CG    1 
ATOM   7731  C CD1   . LEU E 4 55  ? 61.896  49.035 -30.870 1.00 30.63  ? 855  LEU C CD1   1 
ATOM   7732  C CD2   . LEU E 4 55  ? 62.441  48.235 -33.225 1.00 30.03  ? 855  LEU C CD2   1 
ATOM   7733  N N     . GLU E 4 56  ? 60.552  53.464 -33.656 1.00 45.68  ? 856  GLU C N     1 
ATOM   7734  C CA    . GLU E 4 56  ? 59.507  54.390 -34.075 1.00 46.26  ? 856  GLU C CA    1 
ATOM   7735  C C     . GLU E 4 56  ? 59.922  55.005 -35.399 1.00 43.50  ? 856  GLU C C     1 
ATOM   7736  O O     . GLU E 4 56  ? 59.141  55.118 -36.320 1.00 44.49  ? 856  GLU C O     1 
ATOM   7737  C CB    . GLU E 4 56  ? 59.314  55.480 -33.022 1.00 65.06  ? 856  GLU C CB    1 
ATOM   7738  C CG    . GLU E 4 56  ? 58.109  56.381 -33.260 1.00 65.64  ? 856  GLU C CG    1 
ATOM   7739  C CD    . GLU E 4 56  ? 57.912  57.388 -32.137 1.00 69.84  ? 856  GLU C CD    1 
ATOM   7740  O OE1   . GLU E 4 56  ? 57.774  56.938 -30.978 1.00 68.90  ? 856  GLU C OE1   1 
ATOM   7741  O OE2   . GLU E 4 56  ? 57.900  58.619 -32.408 1.00 64.39  ? 856  GLU C OE2   1 
ATOM   7742  N N     . TYR E 4 57  ? 61.182  55.383 -35.477 1.00 32.06  ? 857  TYR C N     1 
ATOM   7743  C CA    . TYR E 4 57  ? 61.728  55.985 -36.658 1.00 32.35  ? 857  TYR C CA    1 
ATOM   7744  C C     . TYR E 4 57  ? 61.608  55.071 -37.831 1.00 33.81  ? 857  TYR C C     1 
ATOM   7745  O O     . TYR E 4 57  ? 61.317  55.531 -38.942 1.00 32.83  ? 857  TYR C O     1 
ATOM   7746  C CB    . TYR E 4 57  ? 63.207  56.316 -36.457 1.00 26.97  ? 857  TYR C CB    1 
ATOM   7747  C CG    . TYR E 4 57  ? 63.940  56.613 -37.746 1.00 28.54  ? 857  TYR C CG    1 
ATOM   7748  C CD1   . TYR E 4 57  ? 63.755  57.801 -38.406 1.00 33.51  ? 857  TYR C CD1   1 
ATOM   7749  C CD2   . TYR E 4 57  ? 64.737  55.654 -38.344 1.00 32.03  ? 857  TYR C CD2   1 
ATOM   7750  C CE1   . TYR E 4 57  ? 64.334  58.018 -39.622 1.00 33.70  ? 857  TYR C CE1   1 
ATOM   7751  C CE2   . TYR E 4 57  ? 65.306  55.858 -39.559 1.00 32.16  ? 857  TYR C CE2   1 
ATOM   7752  C CZ    . TYR E 4 57  ? 65.103  57.039 -40.205 1.00 34.18  ? 857  TYR C CZ    1 
ATOM   7753  O OH    . TYR E 4 57  ? 65.624  57.235 -41.466 1.00 35.74  ? 857  TYR C OH    1 
ATOM   7754  N N     . LEU E 4 58  ? 61.879  53.790 -37.598 1.00 33.99  ? 858  LEU C N     1 
ATOM   7755  C CA    . LEU E 4 58  ? 61.816  52.796 -38.667 1.00 35.46  ? 858  LEU C CA    1 
ATOM   7756  C C     . LEU E 4 58  ? 60.407  52.538 -39.169 1.00 33.35  ? 858  LEU C C     1 
ATOM   7757  O O     . LEU E 4 58  ? 60.209  52.426 -40.374 1.00 36.97  ? 858  LEU C O     1 
ATOM   7758  C CB    . LEU E 4 58  ? 62.460  51.473 -38.241 1.00 24.05  ? 858  LEU C CB    1 
ATOM   7759  C CG    . LEU E 4 58  ? 63.987  51.492 -38.311 1.00 25.21  ? 858  LEU C CG    1 
ATOM   7760  C CD1   . LEU E 4 58  ? 64.557  50.124 -37.970 1.00 25.69  ? 858  LEU C CD1   1 
ATOM   7761  C CD2   . LEU E 4 58  ? 64.430  51.935 -39.713 1.00 25.34  ? 858  LEU C CD2   1 
ATOM   7762  N N     . THR E 4 59  ? 59.426  52.457 -38.271 1.00 19.05  ? 859  THR C N     1 
ATOM   7763  C CA    . THR E 4 59  ? 58.071  52.238 -38.725 1.00 22.36  ? 859  THR C CA    1 
ATOM   7764  C C     . THR E 4 59  ? 57.516  53.511 -39.392 1.00 22.50  ? 859  THR C C     1 
ATOM   7765  O O     . THR E 4 59  ? 56.735  53.446 -40.334 1.00 23.67  ? 859  THR C O     1 
ATOM   7766  C CB    . THR E 4 59  ? 57.116  51.754 -37.585 1.00 20.72  ? 859  THR C CB    1 
ATOM   7767  O OG1   . THR E 4 59  ? 56.466  52.878 -37.021 1.00 34.17  ? 859  THR C OG1   1 
ATOM   7768  C CG2   . THR E 4 59  ? 57.843  51.020 -36.509 1.00 13.31  ? 859  THR C CG2   1 
ATOM   7769  N N     . ALA E 4 60  ? 57.914  54.681 -38.941 1.00 33.64  ? 860  ALA C N     1 
ATOM   7770  C CA    . ALA E 4 60  ? 57.402  55.873 -39.626 1.00 32.86  ? 860  ALA C CA    1 
ATOM   7771  C C     . ALA E 4 60  ? 57.936  55.928 -41.062 1.00 31.37  ? 860  ALA C C     1 
ATOM   7772  O O     . ALA E 4 60  ? 57.262  56.416 -41.956 1.00 31.52  ? 860  ALA C O     1 
ATOM   7773  C CB    . ALA E 4 60  ? 57.782  57.157 -38.875 1.00 19.41  ? 860  ALA C CB    1 
ATOM   7774  N N     . GLU E 4 61  ? 59.136  55.403 -41.281 1.00 34.17  ? 861  GLU C N     1 
ATOM   7775  C CA    . GLU E 4 61  ? 59.725  55.437 -42.600 1.00 36.40  ? 861  GLU C CA    1 
ATOM   7776  C C     . GLU E 4 61  ? 59.021  54.544 -43.579 1.00 36.79  ? 861  GLU C C     1 
ATOM   7777  O O     . GLU E 4 61  ? 58.759  54.949 -44.703 1.00 32.58  ? 861  GLU C O     1 
ATOM   7778  C CB    . GLU E 4 61  ? 61.190  55.060 -42.543 1.00 44.87  ? 861  GLU C CB    1 
ATOM   7779  C CG    . GLU E 4 61  ? 61.917  55.370 -43.823 1.00 53.47  ? 861  GLU C CG    1 
ATOM   7780  C CD    . GLU E 4 61  ? 61.984  56.873 -44.147 1.00 60.60  ? 861  GLU C CD    1 
ATOM   7781  O OE1   . GLU E 4 61  ? 62.716  57.642 -43.475 1.00 65.84  ? 861  GLU C OE1   1 
ATOM   7782  O OE2   . GLU E 4 61  ? 61.291  57.288 -45.097 1.00 64.05  ? 861  GLU C OE2   1 
ATOM   7783  N N     . ILE E 4 62  ? 58.698  53.322 -43.184 1.00 38.31  ? 862  ILE C N     1 
ATOM   7784  C CA    . ILE E 4 62  ? 58.030  52.459 -44.135 1.00 37.05  ? 862  ILE C CA    1 
ATOM   7785  C C     . ILE E 4 62  ? 56.558  52.834 -44.343 1.00 35.30  ? 862  ILE C C     1 
ATOM   7786  O O     . ILE E 4 62  ? 56.048  52.771 -45.471 1.00 36.17  ? 862  ILE C O     1 
ATOM   7787  C CB    . ILE E 4 62  ? 58.193  50.980 -43.754 1.00 53.70  ? 862  ILE C CB    1 
ATOM   7788  C CG1   . ILE E 4 62  ? 56.997  50.175 -44.242 1.00 56.34  ? 862  ILE C CG1   1 
ATOM   7789  C CG2   . ILE E 4 62  ? 58.382  50.846 -42.289 1.00 54.70  ? 862  ILE C CG2   1 
ATOM   7790  C CD1   . ILE E 4 62  ? 57.125  48.701 -43.966 1.00 61.66  ? 862  ILE C CD1   1 
ATOM   7791  N N     . LEU E 4 63  ? 55.884  53.253 -43.270 1.00 26.48  ? 863  LEU C N     1 
ATOM   7792  C CA    . LEU E 4 63  ? 54.479  53.657 -43.340 1.00 29.02  ? 863  LEU C CA    1 
ATOM   7793  C C     . LEU E 4 63  ? 54.307  54.867 -44.287 1.00 29.86  ? 863  LEU C C     1 
ATOM   7794  O O     . LEU E 4 63  ? 53.297  55.003 -44.994 1.00 29.96  ? 863  LEU C O     1 
ATOM   7795  C CB    . LEU E 4 63  ? 54.001  54.003 -41.939 1.00 15.75  ? 863  LEU C CB    1 
ATOM   7796  C CG    . LEU E 4 63  ? 53.419  52.950 -41.004 1.00 16.86  ? 863  LEU C CG    1 
ATOM   7797  C CD1   . LEU E 4 63  ? 52.486  53.695 -40.089 1.00 16.47  ? 863  LEU C CD1   1 
ATOM   7798  C CD2   . LEU E 4 63  ? 52.619  51.913 -41.733 1.00 18.79  ? 863  LEU C CD2   1 
ATOM   7799  N N     . GLU E 4 64  ? 55.311  55.750 -44.271 1.00 34.02  ? 864  GLU C N     1 
ATOM   7800  C CA    . GLU E 4 64  ? 55.366  56.906 -45.141 1.00 34.59  ? 864  GLU C CA    1 
ATOM   7801  C C     . GLU E 4 64  ? 55.333  56.371 -46.561 1.00 35.23  ? 864  GLU C C     1 
ATOM   7802  O O     . GLU E 4 64  ? 54.596  56.840 -47.393 1.00 32.15  ? 864  GLU C O     1 
ATOM   7803  C CB    . GLU E 4 64  ? 56.667  57.634 -44.963 1.00 52.03  ? 864  GLU C CB    1 
ATOM   7804  C CG    . GLU E 4 64  ? 56.816  58.755 -45.934 1.00 59.34  ? 864  GLU C CG    1 
ATOM   7805  C CD    . GLU E 4 64  ? 55.819  59.852 -45.643 1.00 61.13  ? 864  GLU C CD    1 
ATOM   7806  O OE1   . GLU E 4 64  ? 55.759  60.884 -46.368 1.00 68.74  ? 864  GLU C OE1   1 
ATOM   7807  O OE2   . GLU E 4 64  ? 55.087  59.664 -44.650 1.00 64.81  ? 864  GLU C OE2   1 
ATOM   7808  N N     . LEU E 4 65  ? 56.140  55.358 -46.831 1.00 28.69  ? 865  LEU C N     1 
ATOM   7809  C CA    . LEU E 4 65  ? 56.193  54.754 -48.154 1.00 30.92  ? 865  LEU C CA    1 
ATOM   7810  C C     . LEU E 4 65  ? 54.968  53.916 -48.542 1.00 26.72  ? 865  LEU C C     1 
ATOM   7811  O O     . LEU E 4 65  ? 54.501  53.987 -49.663 1.00 28.22  ? 865  LEU C O     1 
ATOM   7812  C CB    . LEU E 4 65  ? 57.465  53.920 -48.255 1.00 22.14  ? 865  LEU C CB    1 
ATOM   7813  C CG    . LEU E 4 65  ? 58.751  54.734 -48.066 1.00 23.92  ? 865  LEU C CG    1 
ATOM   7814  C CD1   . LEU E 4 65  ? 59.979  53.856 -48.290 1.00 18.85  ? 865  LEU C CD1   1 
ATOM   7815  C CD2   . LEU E 4 65  ? 58.697  55.922 -49.019 1.00 26.33  ? 865  LEU C CD2   1 
ATOM   7816  N N     . ALA E 4 66  ? 54.462  53.113 -47.610 1.00 20.31  ? 866  ALA C N     1 
ATOM   7817  C CA    . ALA E 4 66  ? 53.283  52.280 -47.847 1.00 24.07  ? 866  ALA C CA    1 
ATOM   7818  C C     . ALA E 4 66  ? 52.121  53.191 -48.171 1.00 22.22  ? 866  ALA C C     1 
ATOM   7819  O O     . ALA E 4 66  ? 51.400  52.979 -49.146 1.00 23.02  ? 866  ALA C O     1 
ATOM   7820  C CB    . ALA E 4 66  ? 52.970  51.482 -46.616 1.00 81.25  ? 866  ALA C CB    1 
ATOM   7821  N N     . GLY E 4 67  ? 51.943  54.204 -47.330 1.00 35.29  ? 867  GLY C N     1 
ATOM   7822  C CA    . GLY E 4 67  ? 50.887  55.155 -47.542 1.00 31.39  ? 867  GLY C CA    1 
ATOM   7823  C C     . GLY E 4 67  ? 50.986  55.727 -48.935 1.00 32.21  ? 867  GLY C C     1 
ATOM   7824  O O     . GLY E 4 67  ? 49.987  55.836 -49.633 1.00 32.06  ? 867  GLY C O     1 
ATOM   7825  N N     . ASN E 4 68  ? 52.178  56.090 -49.380 1.00 36.55  ? 868  ASN C N     1 
ATOM   7826  C CA    . ASN E 4 68  ? 52.276  56.647 -50.724 1.00 37.49  ? 868  ASN C CA    1 
ATOM   7827  C C     . ASN E 4 68  ? 51.816  55.679 -51.818 1.00 41.59  ? 868  ASN C C     1 
ATOM   7828  O O     . ASN E 4 68  ? 51.040  56.047 -52.716 1.00 41.42  ? 868  ASN C O     1 
ATOM   7829  C CB    . ASN E 4 68  ? 53.695  57.068 -51.013 1.00 23.89  ? 868  ASN C CB    1 
ATOM   7830  C CG    . ASN E 4 68  ? 54.081  58.317 -50.287 1.00 25.66  ? 868  ASN C CG    1 
ATOM   7831  O OD1   . ASN E 4 68  ? 53.232  59.010 -49.710 1.00 26.51  ? 868  ASN C OD1   1 
ATOM   7832  N ND2   . ASN E 4 68  ? 55.375  58.623 -50.311 1.00 26.43  ? 868  ASN C ND2   1 
ATOM   7833  N N     . ALA E 4 69  ? 52.334  54.453 -51.732 1.00 21.26  ? 869  ALA C N     1 
ATOM   7834  C CA    . ALA E 4 69  ? 52.031  53.366 -52.626 1.00 24.22  ? 869  ALA C CA    1 
ATOM   7835  C C     . ALA E 4 69  ? 50.557  53.241 -52.748 1.00 24.65  ? 869  ALA C C     1 
ATOM   7836  O O     . ALA E 4 69  ? 50.055  52.986 -53.851 1.00 25.52  ? 869  ALA C O     1 
ATOM   7837  C CB    . ALA E 4 69  ? 52.578  52.100 -52.074 1.00 12.55  ? 869  ALA C CB    1 
ATOM   7838  N N     . ALA E 4 70  ? 49.863  53.383 -51.614 1.00 28.57  ? 870  ALA C N     1 
ATOM   7839  C CA    . ALA E 4 70  ? 48.410  53.303 -51.604 1.00 31.05  ? 870  ALA C CA    1 
ATOM   7840  C C     . ALA E 4 70  ? 47.821  54.490 -52.360 1.00 32.19  ? 870  ALA C C     1 
ATOM   7841  O O     . ALA E 4 70  ? 46.938  54.303 -53.194 1.00 31.41  ? 870  ALA C O     1 
ATOM   7842  C CB    . ALA E 4 70  ? 47.893  53.274 -50.210 1.00 8.55   ? 870  ALA C CB    1 
ATOM   7843  N N     . ARG E 4 71  ? 48.287  55.706 -52.090 1.00 40.63  ? 871  ARG C N     1 
ATOM   7844  C CA    . ARG E 4 71  ? 47.760  56.818 -52.852 1.00 42.61  ? 871  ARG C CA    1 
ATOM   7845  C C     . ARG E 4 71  ? 47.984  56.497 -54.332 1.00 40.46  ? 871  ARG C C     1 
ATOM   7846  O O     . ARG E 4 71  ? 47.066  56.578 -55.146 1.00 38.45  ? 871  ARG C O     1 
ATOM   7847  C CB    . ARG E 4 71  ? 48.461  58.108 -52.508 1.00 62.33  ? 871  ARG C CB    1 
ATOM   7848  C CG    . ARG E 4 71  ? 47.526  59.223 -52.123 1.00 73.29  ? 871  ARG C CG    1 
ATOM   7849  C CD    . ARG E 4 71  ? 48.342  60.429 -51.729 1.00 80.25  ? 871  ARG C CD    1 
ATOM   7850  N NE    . ARG E 4 71  ? 47.596  61.411 -50.948 1.00 88.85  ? 871  ARG C NE    1 
ATOM   7851  C CZ    . ARG E 4 71  ? 48.142  62.518 -50.442 1.00 92.76  ? 871  ARG C CZ    1 
ATOM   7852  N NH1   . ARG E 4 71  ? 49.432  62.781 -50.638 1.00 93.91  ? 871  ARG C NH1   1 
ATOM   7853  N NH2   . ARG E 4 71  ? 47.408  63.361 -49.730 1.00 95.85  ? 871  ARG C NH2   1 
ATOM   7854  N N     . ASP E 4 72  ? 49.188  56.115 -54.710 1.00 35.55  ? 872  ASP C N     1 
ATOM   7855  C CA    . ASP E 4 72  ? 49.391  55.786 -56.115 1.00 37.23  ? 872  ASP C CA    1 
ATOM   7856  C C     . ASP E 4 72  ? 48.448  54.685 -56.642 1.00 39.66  ? 872  ASP C C     1 
ATOM   7857  O O     . ASP E 4 72  ? 48.360  54.466 -57.853 1.00 39.93  ? 872  ASP C O     1 
ATOM   7858  C CB    . ASP E 4 72  ? 50.837  55.380 -56.343 1.00 106.25 ? 872  ASP C CB    1 
ATOM   7859  C CG    . ASP E 4 72  ? 51.791  56.424 -55.856 1.00 107.66 ? 872  ASP C CG    1 
ATOM   7860  O OD1   . ASP E 4 72  ? 51.566  57.604 -56.202 1.00 105.90 ? 872  ASP C OD1   1 
ATOM   7861  O OD2   . ASP E 4 72  ? 52.751  56.073 -55.132 1.00 110.83 ? 872  ASP C OD2   1 
ATOM   7862  N N     . ASN E 4 73  ? 47.757  53.998 -55.730 1.00 62.16  ? 873  ASN C N     1 
ATOM   7863  C CA    . ASN E 4 73  ? 46.833  52.922 -56.089 1.00 64.74  ? 873  ASN C CA    1 
ATOM   7864  C C     . ASN E 4 73  ? 45.408  53.300 -55.780 1.00 64.89  ? 873  ASN C C     1 
ATOM   7865  O O     . ASN E 4 73  ? 44.521  52.462 -55.659 1.00 63.22  ? 873  ASN C O     1 
ATOM   7866  C CB    . ASN E 4 73  ? 47.184  51.639 -55.352 1.00 98.73  ? 873  ASN C CB    1 
ATOM   7867  C CG    . ASN E 4 73  ? 48.403  50.981 -55.916 1.00 103.43 ? 873  ASN C CG    1 
ATOM   7868  O OD1   . ASN E 4 73  ? 48.418  50.581 -57.077 1.00 107.38 ? 873  ASN C OD1   1 
ATOM   7869  N ND2   . ASN E 4 73  ? 49.446  50.873 -55.106 1.00 102.74 ? 873  ASN C ND2   1 
ATOM   7870  N N     . LYS E 4 74  ? 45.198  54.586 -55.611 1.00 47.83  ? 874  LYS C N     1 
ATOM   7871  C CA    . LYS E 4 74  ? 43.866  55.095 -55.368 1.00 49.38  ? 874  LYS C CA    1 
ATOM   7872  C C     . LYS E 4 74  ? 43.154  54.412 -54.215 1.00 48.75  ? 874  LYS C C     1 
ATOM   7873  O O     . LYS E 4 74  ? 41.942  54.537 -54.060 1.00 49.63  ? 874  LYS C O     1 
ATOM   7874  C CB    . LYS E 4 74  ? 43.099  55.004 -56.689 1.00 65.38  ? 874  LYS C CB    1 
ATOM   7875  C CG    . LYS E 4 74  ? 44.041  55.390 -57.845 1.00 70.96  ? 874  LYS C CG    1 
ATOM   7876  C CD    . LYS E 4 74  ? 43.397  55.570 -59.204 1.00 75.40  ? 874  LYS C CD    1 
ATOM   7877  C CE    . LYS E 4 74  ? 44.463  55.984 -60.238 1.00 78.32  ? 874  LYS C CE    1 
ATOM   7878  N NZ    . LYS E 4 74  ? 43.889  56.257 -61.589 1.00 80.09  ? 874  LYS C NZ    1 
ATOM   7879  N N     . LYS E 4 75  ? 43.935  53.719 -53.391 1.00 50.89  ? 875  LYS C N     1 
ATOM   7880  C CA    . LYS E 4 75  ? 43.409  53.042 -52.198 1.00 47.96  ? 875  LYS C CA    1 
ATOM   7881  C C     . LYS E 4 75  ? 43.662  53.900 -50.957 1.00 46.54  ? 875  LYS C C     1 
ATOM   7882  O O     . LYS E 4 75  ? 44.701  54.534 -50.807 1.00 45.93  ? 875  LYS C O     1 
ATOM   7883  C CB    . LYS E 4 75  ? 44.066  51.677 -51.988 1.00 42.66  ? 875  LYS C CB    1 
ATOM   7884  C CG    . LYS E 4 75  ? 43.923  50.751 -53.138 1.00 44.81  ? 875  LYS C CG    1 
ATOM   7885  C CD    . LYS E 4 75  ? 42.541  50.169 -53.257 1.00 49.04  ? 875  LYS C CD    1 
ATOM   7886  C CE    . LYS E 4 75  ? 42.531  49.151 -54.394 1.00 53.55  ? 875  LYS C CE    1 
ATOM   7887  N NZ    . LYS E 4 75  ? 42.972  49.766 -55.688 1.00 56.69  ? 875  LYS C NZ    1 
ATOM   7888  N N     . THR E 4 76  ? 42.721  53.879 -50.043 1.00 39.08  ? 876  THR C N     1 
ATOM   7889  C CA    . THR E 4 76  ? 42.825  54.700 -48.877 1.00 41.67  ? 876  THR C CA    1 
ATOM   7890  C C     . THR E 4 76  ? 43.422  53.965 -47.727 1.00 39.52  ? 876  THR C C     1 
ATOM   7891  O O     . THR E 4 76  ? 44.049  54.585 -46.865 1.00 38.57  ? 876  THR C O     1 
ATOM   7892  C CB    . THR E 4 76  ? 41.436  55.197 -48.486 1.00 56.63  ? 876  THR C CB    1 
ATOM   7893  O OG1   . THR E 4 76  ? 40.859  55.874 -49.609 1.00 63.08  ? 876  THR C OG1   1 
ATOM   7894  C CG2   . THR E 4 76  ? 41.500  56.113 -47.282 1.00 60.49  ? 876  THR C CG2   1 
ATOM   7895  N N     . ARG E 4 77  ? 43.209  52.648 -47.713 1.00 48.09  ? 877  ARG C N     1 
ATOM   7896  C CA    . ARG E 4 77  ? 43.685  51.765 -46.650 1.00 48.13  ? 877  ARG C CA    1 
ATOM   7897  C C     . ARG E 4 77  ? 44.933  51.029 -47.067 1.00 45.90  ? 877  ARG C C     1 
ATOM   7898  O O     . ARG E 4 77  ? 44.980  50.434 -48.132 1.00 41.75  ? 877  ARG C O     1 
ATOM   7899  C CB    . ARG E 4 77  ? 42.607  50.751 -46.333 1.00 45.86  ? 877  ARG C CB    1 
ATOM   7900  C CG    . ARG E 4 77  ? 42.806  50.055 -45.025 1.00 50.27  ? 877  ARG C CG    1 
ATOM   7901  C CD    . ARG E 4 77  ? 41.681  49.069 -44.747 1.00 51.01  ? 877  ARG C CD    1 
ATOM   7902  N NE    . ARG E 4 77  ? 40.422  49.769 -44.524 1.00 51.76  ? 877  ARG C NE    1 
ATOM   7903  C CZ    . ARG E 4 77  ? 39.273  49.457 -45.116 1.00 54.32  ? 877  ARG C CZ    1 
ATOM   7904  N NH1   . ARG E 4 77  ? 39.216  48.434 -45.969 1.00 53.53  ? 877  ARG C NH1   1 
ATOM   7905  N NH2   . ARG E 4 77  ? 38.193  50.211 -44.891 1.00 55.13  ? 877  ARG C NH2   1 
ATOM   7906  N N     . ILE E 4 78  ? 45.961  51.049 -46.245 1.00 39.17  ? 878  ILE C N     1 
ATOM   7907  C CA    . ILE E 4 78  ? 47.182  50.324 -46.611 1.00 37.13  ? 878  ILE C CA    1 
ATOM   7908  C C     . ILE E 4 78  ? 47.008  48.788 -46.497 1.00 35.36  ? 878  ILE C C     1 
ATOM   7909  O O     . ILE E 4 78  ? 46.495  48.281 -45.484 1.00 33.77  ? 878  ILE C O     1 
ATOM   7910  C CB    . ILE E 4 78  ? 48.353  50.685 -45.687 1.00 26.47  ? 878  ILE C CB    1 
ATOM   7911  C CG1   . ILE E 4 78  ? 48.915  52.069 -45.999 1.00 26.07  ? 878  ILE C CG1   1 
ATOM   7912  C CG2   . ILE E 4 78  ? 49.399  49.650 -45.822 1.00 25.54  ? 878  ILE C CG2   1 
ATOM   7913  C CD1   . ILE E 4 78  ? 49.942  52.521 -45.002 1.00 21.73  ? 878  ILE C CD1   1 
ATOM   7914  N N     . ILE E 4 79  ? 47.426  48.051 -47.526 1.00 24.57  ? 879  ILE C N     1 
ATOM   7915  C CA    . ILE E 4 79  ? 47.342  46.605 -47.451 1.00 25.70  ? 879  ILE C CA    1 
ATOM   7916  C C     . ILE E 4 79  ? 48.708  45.995 -47.645 1.00 26.94  ? 879  ILE C C     1 
ATOM   7917  O O     . ILE E 4 79  ? 49.645  46.690 -47.992 1.00 23.87  ? 879  ILE C O     1 
ATOM   7918  C CB    . ILE E 4 79  ? 46.404  46.043 -48.468 1.00 16.23  ? 879  ILE C CB    1 
ATOM   7919  C CG1   . ILE E 4 79  ? 46.812  46.409 -49.859 1.00 16.27  ? 879  ILE C CG1   1 
ATOM   7920  C CG2   . ILE E 4 79  ? 45.057  46.552 -48.239 1.00 17.54  ? 879  ILE C CG2   1 
ATOM   7921  C CD1   . ILE E 4 79  ? 45.860  45.755 -50.822 1.00 14.51  ? 879  ILE C CD1   1 
ATOM   7922  N N     . PRO E 4 80  ? 48.858  44.684 -47.442 1.00 33.56  ? 880  PRO C N     1 
ATOM   7923  C CA    . PRO E 4 80  ? 50.203  44.133 -47.630 1.00 29.48  ? 880  PRO C CA    1 
ATOM   7924  C C     . PRO E 4 80  ? 50.965  44.471 -48.898 1.00 27.44  ? 880  PRO C C     1 
ATOM   7925  O O     . PRO E 4 80  ? 52.154  44.758 -48.830 1.00 29.46  ? 880  PRO C O     1 
ATOM   7926  C CB    . PRO E 4 80  ? 49.979  42.644 -47.472 1.00 30.76  ? 880  PRO C CB    1 
ATOM   7927  C CG    . PRO E 4 80  ? 48.971  42.615 -46.395 1.00 30.23  ? 880  PRO C CG    1 
ATOM   7928  C CD    . PRO E 4 80  ? 47.973  43.669 -46.869 1.00 29.93  ? 880  PRO C CD    1 
ATOM   7929  N N     . ARG E 4 81  ? 50.300  44.460 -50.052 1.00 28.74  ? 881  ARG C N     1 
ATOM   7930  C CA    . ARG E 4 81  ? 51.035  44.741 -51.288 1.00 32.12  ? 881  ARG C CA    1 
ATOM   7931  C C     . ARG E 4 81  ? 51.668  46.110 -51.242 1.00 31.60  ? 881  ARG C C     1 
ATOM   7932  O O     . ARG E 4 81  ? 52.694  46.342 -51.869 1.00 31.42  ? 881  ARG C O     1 
ATOM   7933  C CB    . ARG E 4 81  ? 50.151  44.626 -52.522 1.00 24.35  ? 881  ARG C CB    1 
ATOM   7934  C CG    . ARG E 4 81  ? 50.701  45.431 -53.650 1.00 28.51  ? 881  ARG C CG    1 
ATOM   7935  C CD    . ARG E 4 81  ? 50.530  44.826 -55.014 1.00 34.16  ? 881  ARG C CD    1 
ATOM   7936  N NE    . ARG E 4 81  ? 51.536  43.811 -55.245 1.00 36.04  ? 881  ARG C NE    1 
ATOM   7937  C CZ    . ARG E 4 81  ? 52.411  43.827 -56.242 1.00 33.74  ? 881  ARG C CZ    1 
ATOM   7938  N NH1   . ARG E 4 81  ? 52.419  44.802 -57.131 1.00 31.19  ? 881  ARG C NH1   1 
ATOM   7939  N NH2   . ARG E 4 81  ? 53.311  42.864 -56.327 1.00 29.95  ? 881  ARG C NH2   1 
ATOM   7940  N N     . HIS E 4 82  ? 51.041  47.011 -50.494 1.00 43.46  ? 882  HIS C N     1 
ATOM   7941  C CA    . HIS E 4 82  ? 51.543  48.363 -50.350 1.00 44.03  ? 882  HIS C CA    1 
ATOM   7942  C C     . HIS E 4 82  ? 52.836  48.309 -49.578 1.00 46.08  ? 882  HIS C C     1 
ATOM   7943  O O     . HIS E 4 82  ? 53.787  48.941 -49.983 1.00 43.86  ? 882  HIS C O     1 
ATOM   7944  C CB    . HIS E 4 82  ? 50.544  49.242 -49.611 1.00 29.93  ? 882  HIS C CB    1 
ATOM   7945  C CG    . HIS E 4 82  ? 49.261  49.446 -50.343 1.00 30.10  ? 882  HIS C CG    1 
ATOM   7946  N ND1   . HIS E 4 82  ? 48.036  49.444 -49.708 1.00 31.58  ? 882  HIS C ND1   1 
ATOM   7947  C CD2   . HIS E 4 82  ? 49.010  49.652 -51.656 1.00 30.18  ? 882  HIS C CD2   1 
ATOM   7948  C CE1   . HIS E 4 82  ? 47.084  49.637 -50.605 1.00 30.30  ? 882  HIS C CE1   1 
ATOM   7949  N NE2   . HIS E 4 82  ? 47.648  49.768 -51.794 1.00 33.08  ? 882  HIS C NE2   1 
ATOM   7950  N N     . LEU E 4 83  ? 52.878  47.577 -48.461 1.00 17.54  ? 883  LEU C N     1 
ATOM   7951  C CA    . LEU E 4 83  ? 54.122  47.459 -47.710 1.00 17.90  ? 883  LEU C CA    1 
ATOM   7952  C C     . LEU E 4 83  ? 55.163  46.866 -48.653 1.00 19.80  ? 883  LEU C C     1 
ATOM   7953  O O     . LEU E 4 83  ? 56.279  47.365 -48.761 1.00 18.55  ? 883  LEU C O     1 
ATOM   7954  C CB    . LEU E 4 83  ? 53.932  46.574 -46.489 1.00 36.33  ? 883  LEU C CB    1 
ATOM   7955  C CG    . LEU E 4 83  ? 53.028  47.167 -45.403 1.00 40.60  ? 883  LEU C CG    1 
ATOM   7956  C CD1   . LEU E 4 83  ? 52.607  46.083 -44.402 1.00 37.24  ? 883  LEU C CD1   1 
ATOM   7957  C CD2   . LEU E 4 83  ? 53.773  48.283 -44.674 1.00 36.60  ? 883  LEU C CD2   1 
ATOM   7958  N N     . GLN E 4 84  ? 54.776  45.828 -49.382 1.00 31.44  ? 884  GLN C N     1 
ATOM   7959  C CA    . GLN E 4 84  ? 55.695  45.187 -50.318 1.00 32.16  ? 884  GLN C CA    1 
ATOM   7960  C C     . GLN E 4 84  ? 56.289  46.140 -51.375 1.00 31.64  ? 884  GLN C C     1 
ATOM   7961  O O     . GLN E 4 84  ? 57.498  46.207 -51.558 1.00 32.23  ? 884  GLN C O     1 
ATOM   7962  C CB    . GLN E 4 84  ? 55.007  44.018 -51.004 1.00 49.99  ? 884  GLN C CB    1 
ATOM   7963  C CG    . GLN E 4 84  ? 55.764  43.518 -52.209 1.00 49.87  ? 884  GLN C CG    1 
ATOM   7964  C CD    . GLN E 4 84  ? 56.912  42.602 -51.865 1.00 50.68  ? 884  GLN C CD    1 
ATOM   7965  O OE1   . GLN E 4 84  ? 57.572  42.757 -50.831 1.00 44.38  ? 884  GLN C OE1   1 
ATOM   7966  N NE2   . GLN E 4 84  ? 57.175  41.644 -52.749 1.00 47.28  ? 884  GLN C NE2   1 
ATOM   7967  N N     . LEU E 4 85  ? 55.428  46.867 -52.063 1.00 29.64  ? 885  LEU C N     1 
ATOM   7968  C CA    . LEU E 4 85  ? 55.854  47.801 -53.083 1.00 30.81  ? 885  LEU C CA    1 
ATOM   7969  C C     . LEU E 4 85  ? 56.753  48.871 -52.516 1.00 29.45  ? 885  LEU C C     1 
ATOM   7970  O O     . LEU E 4 85  ? 57.722  49.286 -53.170 1.00 34.59  ? 885  LEU C O     1 
ATOM   7971  C CB    . LEU E 4 85  ? 54.652  48.479 -53.697 1.00 30.20  ? 885  LEU C CB    1 
ATOM   7972  C CG    . LEU E 4 85  ? 53.737  47.582 -54.504 1.00 32.05  ? 885  LEU C CG    1 
ATOM   7973  C CD1   . LEU E 4 85  ? 52.427  48.266 -54.731 1.00 35.70  ? 885  LEU C CD1   1 
ATOM   7974  C CD2   . LEU E 4 85  ? 54.466  47.241 -55.789 1.00 35.71  ? 885  LEU C CD2   1 
ATOM   7975  N N     . ALA E 4 86  ? 56.417  49.332 -51.310 1.00 22.69  ? 886  ALA C N     1 
ATOM   7976  C CA    . ALA E 4 86  ? 57.185  50.352 -50.599 1.00 27.93  ? 886  ALA C CA    1 
ATOM   7977  C C     . ALA E 4 86  ? 58.530  49.826 -50.173 1.00 27.42  ? 886  ALA C C     1 
ATOM   7978  O O     . ALA E 4 86  ? 59.521  50.532 -50.235 1.00 25.24  ? 886  ALA C O     1 
ATOM   7979  C CB    . ALA E 4 86  ? 56.437  50.815 -49.379 1.00 38.60  ? 886  ALA C CB    1 
ATOM   7980  N N     . VAL E 4 87  ? 58.574  48.591 -49.716 1.00 25.81  ? 887  VAL C N     1 
ATOM   7981  C CA    . VAL E 4 87  ? 59.835  48.039 -49.296 1.00 23.02  ? 887  VAL C CA    1 
ATOM   7982  C C     . VAL E 4 87  ? 60.739  47.717 -50.488 1.00 22.12  ? 887  VAL C C     1 
ATOM   7983  O O     . VAL E 4 87  ? 61.916  48.001 -50.465 1.00 24.99  ? 887  VAL C O     1 
ATOM   7984  C CB    . VAL E 4 87  ? 59.601  46.744 -48.463 1.00 24.81  ? 887  VAL C CB    1 
ATOM   7985  C CG1   . VAL E 4 87  ? 60.893  45.890 -48.386 1.00 22.90  ? 887  VAL C CG1   1 
ATOM   7986  C CG2   . VAL E 4 87  ? 59.123  47.116 -47.067 1.00 25.78  ? 887  VAL C CG2   1 
ATOM   7987  N N     . ARG E 4 88  ? 60.201  47.129 -51.544 1.00 23.23  ? 888  ARG C N     1 
ATOM   7988  C CA    . ARG E 4 88  ? 61.071  46.762 -52.627 1.00 27.60  ? 888  ARG C CA    1 
ATOM   7989  C C     . ARG E 4 88  ? 61.511  47.900 -53.455 1.00 28.44  ? 888  ARG C C     1 
ATOM   7990  O O     . ARG E 4 88  ? 62.491  47.773 -54.179 1.00 26.27  ? 888  ARG C O     1 
ATOM   7991  C CB    . ARG E 4 88  ? 60.459  45.674 -53.533 1.00 26.31  ? 888  ARG C CB    1 
ATOM   7992  C CG    . ARG E 4 88  ? 60.156  44.362 -52.836 1.00 23.57  ? 888  ARG C CG    1 
ATOM   7993  C CD    . ARG E 4 88  ? 61.264  43.894 -51.921 1.00 27.97  ? 888  ARG C CD    1 
ATOM   7994  N NE    . ARG E 4 88  ? 60.782  42.974 -50.878 1.00 26.26  ? 888  ARG C NE    1 
ATOM   7995  C CZ    . ARG E 4 88  ? 61.487  42.579 -49.802 1.00 26.55  ? 888  ARG C CZ    1 
ATOM   7996  N NH1   . ARG E 4 88  ? 62.744  43.008 -49.578 1.00 22.64  ? 888  ARG C NH1   1 
ATOM   7997  N NH2   . ARG E 4 88  ? 60.915  41.748 -48.933 1.00 25.30  ? 888  ARG C NH2   1 
ATOM   7998  N N     . ASN E 4 89  ? 60.811  49.014 -53.384 1.00 32.68  ? 889  ASN C N     1 
ATOM   7999  C CA    . ASN E 4 89  ? 61.245  50.148 -54.199 1.00 35.59  ? 889  ASN C CA    1 
ATOM   8000  C C     . ASN E 4 89  ? 62.286  51.031 -53.541 1.00 37.65  ? 889  ASN C C     1 
ATOM   8001  O O     . ASN E 4 89  ? 62.889  51.877 -54.183 1.00 37.88  ? 889  ASN C O     1 
ATOM   8002  C CB    . ASN E 4 89  ? 60.059  50.979 -54.634 1.00 25.64  ? 889  ASN C CB    1 
ATOM   8003  C CG    . ASN E 4 89  ? 59.295  50.323 -55.730 1.00 27.09  ? 889  ASN C CG    1 
ATOM   8004  O OD1   . ASN E 4 89  ? 59.869  49.938 -56.757 1.00 27.34  ? 889  ASN C OD1   1 
ATOM   8005  N ND2   . ASN E 4 89  ? 57.998  50.174 -55.535 1.00 28.25  ? 889  ASN C ND2   1 
ATOM   8006  N N     . ASP E 4 90  ? 62.499  50.789 -52.257 1.00 39.58  ? 890  ASP C N     1 
ATOM   8007  C CA    . ASP E 4 90  ? 63.456  51.506 -51.458 1.00 38.53  ? 890  ASP C CA    1 
ATOM   8008  C C     . ASP E 4 90  ? 64.773  50.706 -51.338 1.00 39.34  ? 890  ASP C C     1 
ATOM   8009  O O     . ASP E 4 90  ? 64.781  49.560 -50.848 1.00 39.02  ? 890  ASP C O     1 
ATOM   8010  C CB    . ASP E 4 90  ? 62.870  51.713 -50.078 1.00 66.67  ? 890  ASP C CB    1 
ATOM   8011  C CG    . ASP E 4 90  ? 63.738  52.565 -49.218 1.00 72.04  ? 890  ASP C CG    1 
ATOM   8012  O OD1   . ASP E 4 90  ? 63.638  53.803 -49.342 1.00 71.45  ? 890  ASP C OD1   1 
ATOM   8013  O OD2   . ASP E 4 90  ? 64.532  52.001 -48.439 1.00 68.38  ? 890  ASP C OD2   1 
ATOM   8014  N N     . GLU E 4 91  ? 65.895  51.303 -51.753 1.00 35.76  ? 891  GLU C N     1 
ATOM   8015  C CA    . GLU E 4 91  ? 67.165  50.592 -51.674 1.00 37.96  ? 891  GLU C CA    1 
ATOM   8016  C C     . GLU E 4 91  ? 67.455  50.118 -50.289 1.00 36.80  ? 891  GLU C C     1 
ATOM   8017  O O     . GLU E 4 91  ? 67.737  48.958 -50.102 1.00 34.64  ? 891  GLU C O     1 
ATOM   8018  C CB    . GLU E 4 91  ? 68.317  51.449 -52.163 1.00 72.09  ? 891  GLU C CB    1 
ATOM   8019  C CG    . GLU E 4 91  ? 68.850  51.008 -53.498 1.00 82.85  ? 891  GLU C CG    1 
ATOM   8020  C CD    . GLU E 4 91  ? 69.617  52.109 -54.205 1.00 89.80  ? 891  GLU C CD    1 
ATOM   8021  O OE1   . GLU E 4 91  ? 70.621  52.623 -53.642 1.00 90.32  ? 891  GLU C OE1   1 
ATOM   8022  O OE2   . GLU E 4 91  ? 69.210  52.468 -55.332 1.00 93.29  ? 891  GLU C OE2   1 
ATOM   8023  N N     . GLU E 4 92  ? 67.345  50.995 -49.300 1.00 36.00  ? 892  GLU C N     1 
ATOM   8024  C CA    . GLU E 4 92  ? 67.680  50.616 -47.920 1.00 37.36  ? 892  GLU C CA    1 
ATOM   8025  C C     . GLU E 4 92  ? 66.722  49.675 -47.181 1.00 33.80  ? 892  GLU C C     1 
ATOM   8026  O O     . GLU E 4 92  ? 67.146  48.817 -46.420 1.00 32.04  ? 892  GLU C O     1 
ATOM   8027  C CB    . GLU E 4 92  ? 67.980  51.886 -47.117 1.00 58.14  ? 892  GLU C CB    1 
ATOM   8028  C CG    . GLU E 4 92  ? 69.464  52.197 -47.125 1.00 67.57  ? 892  GLU C CG    1 
ATOM   8029  C CD    . GLU E 4 92  ? 69.813  53.664 -47.331 1.00 69.55  ? 892  GLU C CD    1 
ATOM   8030  O OE1   . GLU E 4 92  ? 69.237  54.534 -46.630 1.00 72.56  ? 892  GLU C OE1   1 
ATOM   8031  O OE2   . GLU E 4 92  ? 70.693  53.946 -48.189 1.00 72.51  ? 892  GLU C OE2   1 
ATOM   8032  N N     . LEU E 4 93  ? 65.428  49.824 -47.409 1.00 31.65  ? 893  LEU C N     1 
ATOM   8033  C CA    . LEU E 4 93  ? 64.494  48.936 -46.770 1.00 32.53  ? 893  LEU C CA    1 
ATOM   8034  C C     . LEU E 4 93  ? 64.664  47.618 -47.503 1.00 31.15  ? 893  LEU C C     1 
ATOM   8035  O O     . LEU E 4 93  ? 64.642  46.564 -46.892 1.00 29.67  ? 893  LEU C O     1 
ATOM   8036  C CB    . LEU E 4 93  ? 63.075  49.499 -46.890 1.00 30.40  ? 893  LEU C CB    1 
ATOM   8037  C CG    . LEU E 4 93  ? 62.945  50.699 -45.927 1.00 30.82  ? 893  LEU C CG    1 
ATOM   8038  C CD1   . LEU E 4 93  ? 61.620  51.411 -46.079 1.00 31.06  ? 893  LEU C CD1   1 
ATOM   8039  C CD2   . LEU E 4 93  ? 63.100  50.206 -44.498 1.00 28.67  ? 893  LEU C CD2   1 
ATOM   8040  N N     . ASN E 4 94  ? 64.879  47.662 -48.819 1.00 28.01  ? 894  ASN C N     1 
ATOM   8041  C CA    . ASN E 4 94  ? 65.069  46.420 -49.562 1.00 30.01  ? 894  ASN C CA    1 
ATOM   8042  C C     . ASN E 4 94  ? 66.250  45.631 -48.989 1.00 32.62  ? 894  ASN C C     1 
ATOM   8043  O O     . ASN E 4 94  ? 66.186  44.430 -48.841 1.00 30.64  ? 894  ASN C O     1 
ATOM   8044  C CB    . ASN E 4 94  ? 65.247  46.695 -51.052 1.00 44.17  ? 894  ASN C CB    1 
ATOM   8045  C CG    . ASN E 4 94  ? 65.104  45.442 -51.879 1.00 49.43  ? 894  ASN C CG    1 
ATOM   8046  O OD1   . ASN E 4 94  ? 64.302  44.583 -51.563 1.00 43.51  ? 894  ASN C OD1   1 
ATOM   8047  N ND2   . ASN E 4 94  ? 65.874  45.328 -52.939 1.00 46.56  ? 894  ASN C ND2   1 
ATOM   8048  N N     . LYS E 4 95  ? 67.323  46.314 -48.641 1.00 30.91  ? 895  LYS C N     1 
ATOM   8049  C CA    . LYS E 4 95  ? 68.466  45.648 -48.044 1.00 34.40  ? 895  LYS C CA    1 
ATOM   8050  C C     . LYS E 4 95  ? 68.140  45.184 -46.593 1.00 33.31  ? 895  LYS C C     1 
ATOM   8051  O O     . LYS E 4 95  ? 68.488  44.082 -46.190 1.00 33.88  ? 895  LYS C O     1 
ATOM   8052  C CB    . LYS E 4 95  ? 69.685  46.580 -48.044 1.00 38.17  ? 895  LYS C CB    1 
ATOM   8053  C CG    . LYS E 4 95  ? 70.962  45.895 -47.562 1.00 46.35  ? 895  LYS C CG    1 
ATOM   8054  C CD    . LYS E 4 95  ? 71.317  44.729 -48.528 1.00 56.28  ? 895  LYS C CD    1 
ATOM   8055  C CE    . LYS E 4 95  ? 72.255  43.611 -47.955 1.00 61.84  ? 895  LYS C CE    1 
ATOM   8056  N NZ    . LYS E 4 95  ? 72.331  42.383 -48.868 1.00 66.40  ? 895  LYS C NZ    1 
ATOM   8057  N N     . LEU E 4 96  ? 67.460  46.010 -45.809 1.00 27.46  ? 896  LEU C N     1 
ATOM   8058  C CA    . LEU E 4 96  ? 67.140  45.637 -44.452 1.00 25.52  ? 896  LEU C CA    1 
ATOM   8059  C C     . LEU E 4 96  ? 66.234  44.422 -44.399 1.00 25.18  ? 896  LEU C C     1 
ATOM   8060  O O     . LEU E 4 96  ? 66.221  43.694 -43.417 1.00 25.43  ? 896  LEU C O     1 
ATOM   8061  C CB    . LEU E 4 96  ? 66.473  46.814 -43.738 1.00 18.97  ? 896  LEU C CB    1 
ATOM   8062  C CG    . LEU E 4 96  ? 66.027  46.636 -42.279 1.00 22.02  ? 896  LEU C CG    1 
ATOM   8063  C CD1   . LEU E 4 96  ? 67.148  46.085 -41.409 1.00 19.33  ? 896  LEU C CD1   1 
ATOM   8064  C CD2   . LEU E 4 96  ? 65.622  47.974 -41.728 1.00 21.54  ? 896  LEU C CD2   1 
ATOM   8065  N N     . LEU E 4 97  ? 65.467  44.201 -45.456 1.00 35.69  ? 897  LEU C N     1 
ATOM   8066  C CA    . LEU E 4 97  ? 64.522  43.102 -45.466 1.00 37.52  ? 897  LEU C CA    1 
ATOM   8067  C C     . LEU E 4 97  ? 64.721  42.272 -46.668 1.00 37.11  ? 897  LEU C C     1 
ATOM   8068  O O     . LEU E 4 97  ? 63.756  41.795 -47.265 1.00 36.15  ? 897  LEU C O     1 
ATOM   8069  C CB    . LEU E 4 97  ? 63.119  43.628 -45.492 1.00 21.47  ? 897  LEU C CB    1 
ATOM   8070  C CG    . LEU E 4 97  ? 62.728  44.508 -44.315 1.00 28.14  ? 897  LEU C CG    1 
ATOM   8071  C CD1   . LEU E 4 97  ? 61.316  45.050 -44.577 1.00 27.64  ? 897  LEU C CD1   1 
ATOM   8072  C CD2   . LEU E 4 97  ? 62.873  43.699 -42.999 1.00 25.55  ? 897  LEU C CD2   1 
ATOM   8073  N N     . GLY E 4 98  ? 65.995  42.104 -47.008 1.00 29.79  ? 898  GLY C N     1 
ATOM   8074  C CA    . GLY E 4 98  ? 66.376  41.347 -48.168 1.00 32.88  ? 898  GLY C CA    1 
ATOM   8075  C C     . GLY E 4 98  ? 66.201  39.871 -47.971 1.00 35.46  ? 898  GLY C C     1 
ATOM   8076  O O     . GLY E 4 98  ? 66.512  39.094 -48.863 1.00 34.63  ? 898  GLY C O     1 
ATOM   8077  N N     . ARG E 4 99  ? 65.736  39.463 -46.801 1.00 35.58  ? 899  ARG C N     1 
ATOM   8078  C CA    . ARG E 4 99  ? 65.500  38.039 -46.548 1.00 39.28  ? 899  ARG C CA    1 
ATOM   8079  C C     . ARG E 4 99  ? 64.191  37.825 -45.809 1.00 38.71  ? 899  ARG C C     1 
ATOM   8080  O O     . ARG E 4 99  ? 64.006  36.818 -45.141 1.00 39.29  ? 899  ARG C O     1 
ATOM   8081  C CB    . ARG E 4 99  ? 66.643  37.447 -45.757 1.00 33.17  ? 899  ARG C CB    1 
ATOM   8082  C CG    . ARG E 4 99  ? 67.918  37.588 -46.454 1.00 40.55  ? 899  ARG C CG    1 
ATOM   8083  C CD    . ARG E 4 99  ? 68.795  36.413 -46.190 1.00 53.99  ? 899  ARG C CD    1 
ATOM   8084  N NE    . ARG E 4 99  ? 70.086  36.647 -46.821 1.00 62.24  ? 899  ARG C NE    1 
ATOM   8085  C CZ    . ARG E 4 99  ? 71.107  35.793 -46.814 1.00 66.77  ? 899  ARG C CZ    1 
ATOM   8086  N NH1   . ARG E 4 99  ? 70.989  34.605 -46.200 1.00 69.05  ? 899  ARG C NH1   1 
ATOM   8087  N NH2   . ARG E 4 99  ? 72.259  36.152 -47.396 1.00 68.92  ? 899  ARG C NH2   1 
ATOM   8088  N N     . VAL E 4 100 ? 63.301  38.802 -45.931 1.00 29.96  ? 900  VAL C N     1 
ATOM   8089  C CA    . VAL E 4 100 ? 62.006  38.761 -45.297 1.00 29.35  ? 900  VAL C CA    1 
ATOM   8090  C C     . VAL E 4 100 ? 61.006  38.600 -46.426 1.00 30.02  ? 900  VAL C C     1 
ATOM   8091  O O     . VAL E 4 100 ? 61.238  39.099 -47.524 1.00 28.47  ? 900  VAL C O     1 
ATOM   8092  C CB    . VAL E 4 100 ? 61.721  40.053 -44.531 1.00 21.85  ? 900  VAL C CB    1 
ATOM   8093  C CG1   . VAL E 4 100 ? 60.277  40.109 -44.082 1.00 18.34  ? 900  VAL C CG1   1 
ATOM   8094  C CG2   . VAL E 4 100 ? 62.576  40.113 -43.378 1.00 19.76  ? 900  VAL C CG2   1 
ATOM   8095  N N     . THR E 4 101 ? 59.918  37.880 -46.160 1.00 27.59  ? 901  THR C N     1 
ATOM   8096  C CA    . THR E 4 101 ? 58.891  37.650 -47.154 1.00 24.70  ? 901  THR C CA    1 
ATOM   8097  C C     . THR E 4 101 ? 57.613  38.225 -46.561 1.00 29.15  ? 901  THR C C     1 
ATOM   8098  O O     . THR E 4 101 ? 57.130  37.800 -45.520 1.00 30.27  ? 901  THR C O     1 
ATOM   8099  C CB    . THR E 4 101 ? 58.776  36.112 -47.485 1.00 36.79  ? 901  THR C CB    1 
ATOM   8100  O OG1   . THR E 4 101 ? 59.888  35.716 -48.310 1.00 35.93  ? 901  THR C OG1   1 
ATOM   8101  C CG2   . THR E 4 101 ? 57.488  35.780 -48.205 1.00 30.75  ? 901  THR C CG2   1 
ATOM   8102  N N     . ILE E 4 102 ? 57.094  39.247 -47.208 1.00 33.71  ? 902  ILE C N     1 
ATOM   8103  C CA    . ILE E 4 102 ? 55.905  39.886 -46.732 1.00 32.62  ? 902  ILE C CA    1 
ATOM   8104  C C     . ILE E 4 102 ? 54.794  39.073 -47.374 1.00 30.69  ? 902  ILE C C     1 
ATOM   8105  O O     . ILE E 4 102 ? 54.651  39.039 -48.591 1.00 30.75  ? 902  ILE C O     1 
ATOM   8106  C CB    . ILE E 4 102 ? 55.911  41.327 -47.210 1.00 16.96  ? 902  ILE C CB    1 
ATOM   8107  C CG1   . ILE E 4 102 ? 57.140  42.044 -46.657 1.00 15.92  ? 902  ILE C CG1   1 
ATOM   8108  C CG2   . ILE E 4 102 ? 54.775  42.051 -46.697 1.00 16.04  ? 902  ILE C CG2   1 
ATOM   8109  C CD1   . ILE E 4 102 ? 57.469  43.373 -47.383 1.00 18.04  ? 902  ILE C CD1   1 
ATOM   8110  N N     . ALA E 4 103 ? 54.022  38.370 -46.566 1.00 28.55  ? 903  ALA C N     1 
ATOM   8111  C CA    . ALA E 4 103 ? 52.957  37.552 -47.109 1.00 27.92  ? 903  ALA C CA    1 
ATOM   8112  C C     . ALA E 4 103 ? 51.969  38.428 -47.832 1.00 32.59  ? 903  ALA C C     1 
ATOM   8113  O O     . ALA E 4 103 ? 51.814  39.598 -47.478 1.00 30.93  ? 903  ALA C O     1 
ATOM   8114  C CB    . ALA E 4 103 ? 52.266  36.808 -45.999 1.00 19.12  ? 903  ALA C CB    1 
ATOM   8115  N N     . GLN E 4 104 ? 51.311  37.846 -48.845 1.00 20.97  ? 904  GLN C N     1 
ATOM   8116  C CA    . GLN E 4 104 ? 50.308  38.529 -49.654 1.00 23.86  ? 904  GLN C CA    1 
ATOM   8117  C C     . GLN E 4 104 ? 50.793  39.852 -50.282 1.00 22.87  ? 904  GLN C C     1 
ATOM   8118  O O     . GLN E 4 104 ? 49.983  40.749 -50.558 1.00 21.67  ? 904  GLN C O     1 
ATOM   8119  C CB    . GLN E 4 104 ? 49.051  38.758 -48.812 1.00 59.36  ? 904  GLN C CB    1 
ATOM   8120  C CG    . GLN E 4 104 ? 48.138  37.560 -48.781 1.00 64.19  ? 904  GLN C CG    1 
ATOM   8121  C CD    . GLN E 4 104 ? 47.827  37.069 -50.200 1.00 65.73  ? 904  GLN C CD    1 
ATOM   8122  O OE1   . GLN E 4 104 ? 47.376  37.855 -51.064 1.00 65.82  ? 904  GLN C OE1   1 
ATOM   8123  N NE2   . GLN E 4 104 ? 48.069  35.771 -50.455 1.00 58.56  ? 904  GLN C NE2   1 
ATOM   8124  N N     . GLY E 4 105 ? 52.105  39.937 -50.542 1.00 32.87  ? 905  GLY C N     1 
ATOM   8125  C CA    . GLY E 4 105 ? 52.680  41.132 -51.104 1.00 33.31  ? 905  GLY C CA    1 
ATOM   8126  C C     . GLY E 4 105 ? 52.966  41.176 -52.593 1.00 33.98  ? 905  GLY C C     1 
ATOM   8127  O O     . GLY E 4 105 ? 53.071  42.247 -53.189 1.00 32.04  ? 905  GLY C O     1 
ATOM   8128  N N     . GLY E 4 106 ? 53.111  40.019 -53.212 1.00 26.68  ? 906  GLY C N     1 
ATOM   8129  C CA    . GLY E 4 106 ? 53.384  39.984 -54.640 1.00 19.94  ? 906  GLY C CA    1 
ATOM   8130  C C     . GLY E 4 106 ? 54.833  40.246 -54.896 1.00 26.95  ? 906  GLY C C     1 
ATOM   8131  O O     . GLY E 4 106 ? 55.660  40.076 -54.022 1.00 27.46  ? 906  GLY C O     1 
ATOM   8132  N N     . VAL E 4 107 ? 55.142  40.665 -56.103 1.00 21.84  ? 907  VAL C N     1 
ATOM   8133  C CA    . VAL E 4 107 ? 56.520  40.942 -56.473 1.00 28.67  ? 907  VAL C CA    1 
ATOM   8134  C C     . VAL E 4 107 ? 56.480  42.302 -57.140 1.00 28.02  ? 907  VAL C C     1 
ATOM   8135  O O     . VAL E 4 107 ? 55.414  42.873 -57.201 1.00 26.66  ? 907  VAL C O     1 
ATOM   8136  C CB    . VAL E 4 107 ? 57.039  39.853 -57.451 1.00 22.72  ? 907  VAL C CB    1 
ATOM   8137  C CG1   . VAL E 4 107 ? 56.991  38.464 -56.753 1.00 23.88  ? 907  VAL C CG1   1 
ATOM   8138  C CG2   . VAL E 4 107 ? 56.217  39.889 -58.786 1.00 21.39  ? 907  VAL C CG2   1 
ATOM   8139  N N     . LEU E 4 108 ? 57.610  42.852 -57.592 1.00 39.85  ? 908  LEU C N     1 
ATOM   8140  C CA    . LEU E 4 108 ? 57.583  44.158 -58.276 1.00 42.03  ? 908  LEU C CA    1 
ATOM   8141  C C     . LEU E 4 108 ? 57.444  43.842 -59.735 1.00 42.17  ? 908  LEU C C     1 
ATOM   8142  O O     . LEU E 4 108 ? 58.080  42.913 -60.224 1.00 40.58  ? 908  LEU C O     1 
ATOM   8143  C CB    . LEU E 4 108 ? 58.875  44.949 -58.085 1.00 31.48  ? 908  LEU C CB    1 
ATOM   8144  C CG    . LEU E 4 108 ? 59.072  45.672 -56.747 1.00 33.08  ? 908  LEU C CG    1 
ATOM   8145  C CD1   . LEU E 4 108 ? 60.312  46.546 -56.795 1.00 36.60  ? 908  LEU C CD1   1 
ATOM   8146  C CD2   . LEU E 4 108 ? 57.803  46.510 -56.434 1.00 33.52  ? 908  LEU C CD2   1 
ATOM   8147  N N     . PRO E 4 109 ? 56.596  44.578 -60.456 1.00 40.58  ? 909  PRO C N     1 
ATOM   8148  C CA    . PRO E 4 109 ? 56.415  44.322 -61.881 1.00 41.89  ? 909  PRO C CA    1 
ATOM   8149  C C     . PRO E 4 109 ? 57.728  44.507 -62.556 1.00 45.24  ? 909  PRO C C     1 
ATOM   8150  O O     . PRO E 4 109 ? 58.280  45.575 -62.540 1.00 45.10  ? 909  PRO C O     1 
ATOM   8151  C CB    . PRO E 4 109 ? 55.409  45.369 -62.277 1.00 30.76  ? 909  PRO C CB    1 
ATOM   8152  C CG    . PRO E 4 109 ? 54.525  45.358 -61.107 1.00 29.68  ? 909  PRO C CG    1 
ATOM   8153  C CD    . PRO E 4 109 ? 55.538  45.466 -59.978 1.00 27.02  ? 909  PRO C CD    1 
ATOM   8154  N N     . ASN E 4 110 ? 58.246  43.450 -63.135 1.00 33.81  ? 910  ASN C N     1 
ATOM   8155  C CA    . ASN E 4 110 ? 59.519  43.556 -63.781 1.00 36.72  ? 910  ASN C CA    1 
ATOM   8156  C C     . ASN E 4 110 ? 59.673  42.508 -64.886 1.00 36.89  ? 910  ASN C C     1 
ATOM   8157  O O     . ASN E 4 110 ? 59.747  41.317 -64.612 1.00 37.22  ? 910  ASN C O     1 
ATOM   8158  C CB    . ASN E 4 110 ? 60.615  43.389 -62.737 1.00 65.94  ? 910  ASN C CB    1 
ATOM   8159  C CG    . ASN E 4 110 ? 61.973  43.602 -63.313 1.00 71.82  ? 910  ASN C CG    1 
ATOM   8160  O OD1   . ASN E 4 110 ? 62.335  44.728 -63.657 1.00 74.74  ? 910  ASN C OD1   1 
ATOM   8161  N ND2   . ASN E 4 110 ? 62.735  42.520 -63.457 1.00 71.28  ? 910  ASN C ND2   1 
ATOM   8162  N N     . ILE E 4 111 ? 59.712  42.960 -66.133 1.00 61.95  ? 911  ILE C N     1 
ATOM   8163  C CA    . ILE E 4 111 ? 59.871  42.055 -67.259 1.00 60.62  ? 911  ILE C CA    1 
ATOM   8164  C C     . ILE E 4 111 ? 61.184  42.339 -67.975 1.00 62.57  ? 911  ILE C C     1 
ATOM   8165  O O     . ILE E 4 111 ? 61.401  43.455 -68.434 1.00 62.74  ? 911  ILE C O     1 
ATOM   8166  C CB    . ILE E 4 111 ? 58.780  42.238 -68.308 1.00 27.34  ? 911  ILE C CB    1 
ATOM   8167  C CG1   . ILE E 4 111 ? 57.406  41.973 -67.724 1.00 26.22  ? 911  ILE C CG1   1 
ATOM   8168  C CG2   . ILE E 4 111 ? 59.029  41.299 -69.458 1.00 30.03  ? 911  ILE C CG2   1 
ATOM   8169  C CD1   . ILE E 4 111 ? 56.252  42.172 -68.735 1.00 26.57  ? 911  ILE C CD1   1 
ATOM   8170  N N     . GLN E 4 112 ? 62.042  41.332 -68.095 1.00 39.54  ? 912  GLN C N     1 
ATOM   8171  C CA    . GLN E 4 112 ? 63.317  41.481 -68.782 1.00 40.21  ? 912  GLN C CA    1 
ATOM   8172  C C     . GLN E 4 112 ? 63.004  41.974 -70.165 1.00 42.87  ? 912  GLN C C     1 
ATOM   8173  O O     . GLN E 4 112 ? 61.994  41.556 -70.746 1.00 41.91  ? 912  GLN C O     1 
ATOM   8174  C CB    . GLN E 4 112 ? 64.010  40.129 -68.894 1.00 51.10  ? 912  GLN C CB    1 
ATOM   8175  C CG    . GLN E 4 112 ? 64.238  39.454 -67.567 1.00 51.87  ? 912  GLN C CG    1 
ATOM   8176  C CD    . GLN E 4 112 ? 65.077  40.301 -66.662 1.00 55.12  ? 912  GLN C CD    1 
ATOM   8177  O OE1   . GLN E 4 112 ? 66.261  40.481 -66.907 1.00 50.61  ? 912  GLN C OE1   1 
ATOM   8178  N NE2   . GLN E 4 112 ? 64.464  40.851 -65.617 1.00 54.87  ? 912  GLN C NE2   1 
ATOM   8179  N N     . SER E 4 113 ? 63.880  42.845 -70.680 1.00 64.11  ? 913  SER C N     1 
ATOM   8180  C CA    . SER E 4 113 ? 63.774  43.442 -72.016 1.00 66.17  ? 913  SER C CA    1 
ATOM   8181  C C     . SER E 4 113 ? 63.742  42.478 -73.192 1.00 64.40  ? 913  SER C C     1 
ATOM   8182  O O     . SER E 4 113 ? 62.857  42.573 -74.041 1.00 65.83  ? 913  SER C O     1 
ATOM   8183  C CB    . SER E 4 113 ? 64.927  44.395 -72.248 1.00 62.77  ? 913  SER C CB    1 
ATOM   8184  O OG    . SER E 4 113 ? 64.703  45.579 -71.533 1.00 71.73  ? 913  SER C OG    1 
ATOM   8185  N N     . VAL E 4 114 ? 64.719  41.575 -73.250 1.00 54.75  ? 914  VAL C N     1 
ATOM   8186  C CA    . VAL E 4 114 ? 64.816  40.603 -74.330 1.00 55.30  ? 914  VAL C CA    1 
ATOM   8187  C C     . VAL E 4 114 ? 63.551  39.790 -74.520 1.00 54.47  ? 914  VAL C C     1 
ATOM   8188  O O     . VAL E 4 114 ? 63.465  38.997 -75.460 1.00 54.46  ? 914  VAL C O     1 
ATOM   8189  C CB    . VAL E 4 114 ? 65.960  39.599 -74.098 1.00 50.26  ? 914  VAL C CB    1 
ATOM   8190  C CG1   . VAL E 4 114 ? 67.247  40.339 -73.754 1.00 53.43  ? 914  VAL C CG1   1 
ATOM   8191  C CG2   . VAL E 4 114 ? 65.586  38.625 -73.004 1.00 48.79  ? 914  VAL C CG2   1 
ATOM   8192  N N     . LEU E 4 115 ? 62.584  39.969 -73.617 1.00 55.93  ? 915  LEU C N     1 
ATOM   8193  C CA    . LEU E 4 115 ? 61.310  39.251 -73.681 1.00 56.52  ? 915  LEU C CA    1 
ATOM   8194  C C     . LEU E 4 115 ? 60.282  40.017 -74.487 1.00 57.74  ? 915  LEU C C     1 
ATOM   8195  O O     . LEU E 4 115 ? 59.478  39.435 -75.205 1.00 57.02  ? 915  LEU C O     1 
ATOM   8196  C CB    . LEU E 4 115 ? 60.756  38.997 -72.279 1.00 52.30  ? 915  LEU C CB    1 
ATOM   8197  C CG    . LEU E 4 115 ? 61.556  38.080 -71.360 1.00 53.07  ? 915  LEU C CG    1 
ATOM   8198  C CD1   . LEU E 4 115 ? 60.759  37.798 -70.128 1.00 51.86  ? 915  LEU C CD1   1 
ATOM   8199  C CD2   . LEU E 4 115 ? 61.840  36.794 -72.051 1.00 51.23  ? 915  LEU C CD2   1 
ATOM   8200  N N     . LEU E 4 116 ? 60.305  41.329 -74.354 1.00 50.11  ? 916  LEU C N     1 
ATOM   8201  C CA    . LEU E 4 116 ? 59.381  42.173 -75.086 1.00 54.74  ? 916  LEU C CA    1 
ATOM   8202  C C     . LEU E 4 116 ? 59.611  41.918 -76.574 1.00 57.22  ? 916  LEU C C     1 
ATOM   8203  O O     . LEU E 4 116 ? 60.732  41.629 -77.008 1.00 56.95  ? 916  LEU C O     1 
ATOM   8204  C CB    . LEU E 4 116 ? 59.643  43.633 -74.744 1.00 50.03  ? 916  LEU C CB    1 
ATOM   8205  C CG    . LEU E 4 116 ? 59.792  43.944 -73.248 1.00 52.34  ? 916  LEU C CG    1 
ATOM   8206  C CD1   . LEU E 4 116 ? 60.273  45.372 -73.106 1.00 53.67  ? 916  LEU C CD1   1 
ATOM   8207  C CD2   . LEU E 4 116 ? 58.469  43.717 -72.495 1.00 50.01  ? 916  LEU C CD2   1 
ATOM   8208  N N     . PRO E 4 117 ? 58.551  42.025 -77.381 1.00 61.82  ? 917  PRO C N     1 
ATOM   8209  C CA    . PRO E 4 117 ? 58.640  41.791 -78.831 1.00 67.86  ? 917  PRO C CA    1 
ATOM   8210  C C     . PRO E 4 117 ? 59.175  42.953 -79.643 1.00 74.28  ? 917  PRO C C     1 
ATOM   8211  O O     . PRO E 4 117 ? 59.566  43.973 -79.082 1.00 73.53  ? 917  PRO C O     1 
ATOM   8212  C CB    . PRO E 4 117 ? 57.212  41.428 -79.204 1.00 51.51  ? 917  PRO C CB    1 
ATOM   8213  C CG    . PRO E 4 117 ? 56.394  42.316 -78.247 1.00 49.55  ? 917  PRO C CG    1 
ATOM   8214  C CD    . PRO E 4 117 ? 57.166  42.277 -76.943 1.00 48.76  ? 917  PRO C CD    1 
ATOM   8215  N N     . LYS E 4 118 ? 59.183  42.781 -80.965 1.00 134.49 ? 918  LYS C N     1 
ATOM   8216  C CA    . LYS E 4 118 ? 59.665  43.797 -81.895 1.00 141.62 ? 918  LYS C CA    1 
ATOM   8217  C C     . LYS E 4 118 ? 61.107  44.212 -81.630 1.00 145.16 ? 918  LYS C C     1 
ATOM   8218  O O     . LYS E 4 118 ? 61.942  43.391 -81.246 1.00 146.23 ? 918  LYS C O     1 
ATOM   8219  C CB    . LYS E 4 118 ? 58.776  45.041 -81.841 1.00 192.83 ? 918  LYS C CB    1 
ATOM   8220  C CG    . LYS E 4 118 ? 57.370  44.830 -82.352 1.00 197.10 ? 918  LYS C CG    1 
ATOM   8221  C CD    . LYS E 4 118 ? 56.592  46.133 -82.319 1.00 200.52 ? 918  LYS C CD    1 
ATOM   8222  C CE    . LYS E 4 118 ? 55.184  45.950 -82.856 1.00 202.22 ? 918  LYS C CE    1 
ATOM   8223  N NZ    . LYS E 4 118 ? 54.424  47.230 -82.849 1.00 202.22 ? 918  LYS C NZ    1 
ATOM   8224  N N     . LYS E 4 119 ? 61.380  45.500 -81.841 1.00 202.22 ? 919  LYS C N     1 
ATOM   8225  C CA    . LYS E 4 119 ? 62.712  46.079 -81.658 1.00 202.22 ? 919  LYS C CA    1 
ATOM   8226  C C     . LYS E 4 119 ? 62.671  47.611 -81.514 1.00 202.22 ? 919  LYS C C     1 
ATOM   8227  O O     . LYS E 4 119 ? 61.610  48.230 -81.657 1.00 202.22 ? 919  LYS C O     1 
ATOM   8228  C CB    . LYS E 4 119 ? 63.616  45.700 -82.843 1.00 103.58 ? 919  LYS C CB    1 
ATOM   8229  C CG    . LYS E 4 119 ? 62.977  45.891 -84.229 1.00 103.68 ? 919  LYS C CG    1 
ATOM   8230  C CD    . LYS E 4 119 ? 61.907  44.827 -84.499 1.00 103.78 ? 919  LYS C CD    1 
ATOM   8231  C CE    . LYS E 4 119 ? 61.110  45.119 -85.757 1.00 103.67 ? 919  LYS C CE    1 
ATOM   8232  N NZ    . LYS E 4 119 ? 59.914  44.234 -85.900 1.00 103.13 ? 919  LYS C NZ    1 
ATOM   8233  N N     . THR E 4 120 ? 63.836  48.203 -81.231 1.00 202.22 ? 920  THR C N     1 
ATOM   8234  C CA    . THR E 4 120 ? 64.013  49.655 -81.059 1.00 202.22 ? 920  THR C CA    1 
ATOM   8235  C C     . THR E 4 120 ? 63.443  50.220 -79.752 1.00 202.22 ? 920  THR C C     1 
ATOM   8236  O O     . THR E 4 120 ? 64.221  50.847 -79.001 1.00 149.91 ? 920  THR C O     1 
ATOM   8237  C CB    . THR E 4 120 ? 63.408  50.457 -82.247 1.00 188.19 ? 920  THR C CB    1 
ATOM   8238  O OG1   . THR E 4 120 ? 64.052  50.071 -83.468 1.00 188.44 ? 920  THR C OG1   1 
ATOM   8239  C CG2   . THR E 4 120 ? 63.612  51.955 -82.039 1.00 188.19 ? 920  THR C CG2   1 
ATOM   8240  N N     . GLU F 5 35  ? 49.951  40.986 -26.188 1.00 71.64  ? 1232 GLU D N     1 
ATOM   8241  C CA    . GLU F 5 35  ? 50.673  42.282 -26.471 1.00 67.11  ? 1232 GLU D CA    1 
ATOM   8242  C C     . GLU F 5 35  ? 51.043  42.483 -27.936 1.00 63.93  ? 1232 GLU D C     1 
ATOM   8243  O O     . GLU F 5 35  ? 51.544  41.569 -28.599 1.00 62.93  ? 1232 GLU D O     1 
ATOM   8244  C CB    . GLU F 5 35  ? 51.961  42.422 -25.657 1.00 120.13 ? 1232 GLU D CB    1 
ATOM   8245  C CG    . GLU F 5 35  ? 51.793  42.607 -24.173 1.00 121.42 ? 1232 GLU D CG    1 
ATOM   8246  C CD    . GLU F 5 35  ? 53.106  42.958 -23.525 1.00 123.12 ? 1232 GLU D CD    1 
ATOM   8247  O OE1   . GLU F 5 35  ? 54.118  42.307 -23.860 1.00 124.17 ? 1232 GLU D OE1   1 
ATOM   8248  O OE2   . GLU F 5 35  ? 53.133  43.879 -22.688 1.00 122.39 ? 1232 GLU D OE2   1 
ATOM   8249  N N     . SER F 5 36  ? 50.844  43.716 -28.402 1.00 53.28  ? 1233 SER D N     1 
ATOM   8250  C CA    . SER F 5 36  ? 51.083  44.098 -29.786 1.00 51.03  ? 1233 SER D CA    1 
ATOM   8251  C C     . SER F 5 36  ? 51.749  45.450 -29.855 1.00 47.19  ? 1233 SER D C     1 
ATOM   8252  O O     . SER F 5 36  ? 52.024  46.062 -28.848 1.00 44.56  ? 1233 SER D O     1 
ATOM   8253  C CB    . SER F 5 36  ? 49.740  44.161 -30.503 1.00 53.79  ? 1233 SER D CB    1 
ATOM   8254  O OG    . SER F 5 36  ? 49.870  44.302 -31.894 1.00 57.29  ? 1233 SER D OG    1 
ATOM   8255  N N     . TYR F 5 37  ? 52.020  45.909 -31.062 1.00 41.09  ? 1234 TYR D N     1 
ATOM   8256  C CA    . TYR F 5 37  ? 52.614  47.217 -31.277 1.00 39.17  ? 1234 TYR D CA    1 
ATOM   8257  C C     . TYR F 5 37  ? 51.599  48.028 -32.081 1.00 36.54  ? 1234 TYR D C     1 
ATOM   8258  O O     . TYR F 5 37  ? 51.783  49.215 -32.362 1.00 34.56  ? 1234 TYR D O     1 
ATOM   8259  C CB    . TYR F 5 37  ? 53.909  47.082 -32.054 1.00 33.98  ? 1234 TYR D CB    1 
ATOM   8260  C CG    . TYR F 5 37  ? 55.093  46.828 -31.181 1.00 36.02  ? 1234 TYR D CG    1 
ATOM   8261  C CD1   . TYR F 5 37  ? 55.823  45.664 -31.283 1.00 35.88  ? 1234 TYR D CD1   1 
ATOM   8262  C CD2   . TYR F 5 37  ? 55.501  47.771 -30.271 1.00 37.70  ? 1234 TYR D CD2   1 
ATOM   8263  C CE1   . TYR F 5 37  ? 56.937  45.453 -30.501 1.00 34.46  ? 1234 TYR D CE1   1 
ATOM   8264  C CE2   . TYR F 5 37  ? 56.609  47.575 -29.481 1.00 36.27  ? 1234 TYR D CE2   1 
ATOM   8265  C CZ    . TYR F 5 37  ? 57.325  46.424 -29.601 1.00 35.25  ? 1234 TYR D CZ    1 
ATOM   8266  O OH    . TYR F 5 37  ? 58.460  46.282 -28.832 1.00 35.09  ? 1234 TYR D OH    1 
ATOM   8267  N N     . ALA F 5 38  ? 50.493  47.367 -32.403 1.00 36.64  ? 1235 ALA D N     1 
ATOM   8268  C CA    . ALA F 5 38  ? 49.409  47.939 -33.195 1.00 40.51  ? 1235 ALA D CA    1 
ATOM   8269  C C     . ALA F 5 38  ? 48.956  49.362 -32.895 1.00 41.34  ? 1235 ALA D C     1 
ATOM   8270  O O     . ALA F 5 38  ? 48.926  50.176 -33.803 1.00 41.49  ? 1235 ALA D O     1 
ATOM   8271  C CB    . ALA F 5 38  ? 48.232  47.008 -33.179 1.00 31.61  ? 1235 ALA D CB    1 
ATOM   8272  N N     . ILE F 5 39  ? 48.594  49.668 -31.650 1.00 36.01  ? 1236 ILE D N     1 
ATOM   8273  C CA    . ILE F 5 39  ? 48.185  51.026 -31.321 1.00 37.16  ? 1236 ILE D CA    1 
ATOM   8274  C C     . ILE F 5 39  ? 49.374  51.979 -31.546 1.00 35.82  ? 1236 ILE D C     1 
ATOM   8275  O O     . ILE F 5 39  ? 49.224  53.110 -32.008 1.00 34.95  ? 1236 ILE D O     1 
ATOM   8276  C CB    . ILE F 5 39  ? 47.679  51.154 -29.861 1.00 22.57  ? 1236 ILE D CB    1 
ATOM   8277  C CG1   . ILE F 5 39  ? 48.799  50.913 -28.876 1.00 25.79  ? 1236 ILE D CG1   1 
ATOM   8278  C CG2   . ILE F 5 39  ? 46.608  50.169 -29.601 1.00 21.96  ? 1236 ILE D CG2   1 
ATOM   8279  C CD1   . ILE F 5 39  ? 48.324  50.917 -27.443 1.00 28.98  ? 1236 ILE D CD1   1 
ATOM   8280  N N     . TYR F 5 40  ? 50.573  51.531 -31.257 1.00 32.60  ? 1237 TYR D N     1 
ATOM   8281  C CA    . TYR F 5 40  ? 51.662  52.425 -31.502 1.00 34.44  ? 1237 TYR D CA    1 
ATOM   8282  C C     . TYR F 5 40  ? 51.882  52.640 -32.999 1.00 35.33  ? 1237 TYR D C     1 
ATOM   8283  O O     . TYR F 5 40  ? 52.197  53.761 -33.420 1.00 34.88  ? 1237 TYR D O     1 
ATOM   8284  C CB    . TYR F 5 40  ? 52.899  51.909 -30.804 1.00 50.59  ? 1237 TYR D CB    1 
ATOM   8285  C CG    . TYR F 5 40  ? 52.612  51.649 -29.347 1.00 53.71  ? 1237 TYR D CG    1 
ATOM   8286  C CD1   . TYR F 5 40  ? 52.211  50.388 -28.900 1.00 56.56  ? 1237 TYR D CD1   1 
ATOM   8287  C CD2   . TYR F 5 40  ? 52.685  52.672 -28.424 1.00 53.40  ? 1237 TYR D CD2   1 
ATOM   8288  C CE1   . TYR F 5 40  ? 51.898  50.174 -27.575 1.00 58.04  ? 1237 TYR D CE1   1 
ATOM   8289  C CE2   . TYR F 5 40  ? 52.368  52.467 -27.108 1.00 58.44  ? 1237 TYR D CE2   1 
ATOM   8290  C CZ    . TYR F 5 40  ? 51.979  51.227 -26.685 1.00 59.79  ? 1237 TYR D CZ    1 
ATOM   8291  O OH    . TYR F 5 40  ? 51.669  51.052 -25.359 1.00 61.38  ? 1237 TYR D OH    1 
ATOM   8292  N N     . VAL F 5 41  ? 51.706  51.590 -33.806 1.00 38.55  ? 1238 VAL D N     1 
ATOM   8293  C CA    . VAL F 5 41  ? 51.860  51.716 -35.256 1.00 38.15  ? 1238 VAL D CA    1 
ATOM   8294  C C     . VAL F 5 41  ? 50.774  52.638 -35.779 1.00 38.28  ? 1238 VAL D C     1 
ATOM   8295  O O     . VAL F 5 41  ? 50.975  53.434 -36.690 1.00 36.13  ? 1238 VAL D O     1 
ATOM   8296  C CB    . VAL F 5 41  ? 51.779  50.317 -35.951 1.00 20.33  ? 1238 VAL D CB    1 
ATOM   8297  C CG1   . VAL F 5 41  ? 51.622  50.435 -37.480 1.00 19.91  ? 1238 VAL D CG1   1 
ATOM   8298  C CG2   . VAL F 5 41  ? 53.070  49.555 -35.630 1.00 18.24  ? 1238 VAL D CG2   1 
ATOM   8299  N N     . TYR F 5 42  ? 49.612  52.566 -35.163 1.00 40.61  ? 1239 TYR D N     1 
ATOM   8300  C CA    . TYR F 5 42  ? 48.532  53.401 -35.611 1.00 41.77  ? 1239 TYR D CA    1 
ATOM   8301  C C     . TYR F 5 42  ? 48.802  54.898 -35.403 1.00 41.53  ? 1239 TYR D C     1 
ATOM   8302  O O     . TYR F 5 42  ? 48.556  55.707 -36.320 1.00 43.27  ? 1239 TYR D O     1 
ATOM   8303  C CB    . TYR F 5 42  ? 47.247  52.994 -34.939 1.00 40.22  ? 1239 TYR D CB    1 
ATOM   8304  C CG    . TYR F 5 42  ? 46.073  53.451 -35.737 1.00 46.64  ? 1239 TYR D CG    1 
ATOM   8305  C CD1   . TYR F 5 42  ? 45.670  52.774 -36.879 1.00 48.50  ? 1239 TYR D CD1   1 
ATOM   8306  C CD2   . TYR F 5 42  ? 45.374  54.610 -35.369 1.00 50.21  ? 1239 TYR D CD2   1 
ATOM   8307  C CE1   . TYR F 5 42  ? 44.575  53.248 -37.653 1.00 56.37  ? 1239 TYR D CE1   1 
ATOM   8308  C CE2   . TYR F 5 42  ? 44.286  55.093 -36.125 1.00 54.47  ? 1239 TYR D CE2   1 
ATOM   8309  C CZ    . TYR F 5 42  ? 43.880  54.417 -37.265 1.00 56.95  ? 1239 TYR D CZ    1 
ATOM   8310  O OH    . TYR F 5 42  ? 42.788  54.913 -37.975 1.00 61.66  ? 1239 TYR D OH    1 
ATOM   8311  N N     . LYS F 5 43  ? 49.308  55.275 -34.224 1.00 35.71  ? 1240 LYS D N     1 
ATOM   8312  C CA    . LYS F 5 43  ? 49.604  56.668 -33.953 1.00 37.22  ? 1240 LYS D CA    1 
ATOM   8313  C C     . LYS F 5 43  ? 50.499  57.202 -35.065 1.00 39.22  ? 1240 LYS D C     1 
ATOM   8314  O O     . LYS F 5 43  ? 50.089  58.059 -35.868 1.00 37.05  ? 1240 LYS D O     1 
ATOM   8315  C CB    . LYS F 5 43  ? 50.285  56.785 -32.604 1.00 53.00  ? 1240 LYS D CB    1 
ATOM   8316  C CG    . LYS F 5 43  ? 49.388  56.365 -31.451 1.00 52.41  ? 1240 LYS D CG    1 
ATOM   8317  C CD    . LYS F 5 43  ? 50.052  56.516 -30.077 1.00 58.92  ? 1240 LYS D CD    1 
ATOM   8318  C CE    . LYS F 5 43  ? 49.090  56.089 -28.967 1.00 60.94  ? 1240 LYS D CE    1 
ATOM   8319  N NZ    . LYS F 5 43  ? 49.693  56.119 -27.600 1.00 66.79  ? 1240 LYS D NZ    1 
ATOM   8320  N N     . VAL F 5 44  ? 51.720  56.671 -35.119 1.00 32.29  ? 1241 VAL D N     1 
ATOM   8321  C CA    . VAL F 5 44  ? 52.715  57.037 -36.134 1.00 28.63  ? 1241 VAL D CA    1 
ATOM   8322  C C     . VAL F 5 44  ? 52.048  57.116 -37.493 1.00 28.98  ? 1241 VAL D C     1 
ATOM   8323  O O     . VAL F 5 44  ? 52.303  58.027 -38.266 1.00 30.16  ? 1241 VAL D O     1 
ATOM   8324  C CB    . VAL F 5 44  ? 53.841  55.953 -36.249 1.00 18.88  ? 1241 VAL D CB    1 
ATOM   8325  C CG1   . VAL F 5 44  ? 54.880  56.362 -37.262 1.00 15.34  ? 1241 VAL D CG1   1 
ATOM   8326  C CG2   . VAL F 5 44  ? 54.485  55.729 -34.920 1.00 13.74  ? 1241 VAL D CG2   1 
ATOM   8327  N N     . LEU F 5 45  ? 51.215  56.118 -37.782 1.00 28.00  ? 1242 LEU D N     1 
ATOM   8328  C CA    . LEU F 5 45  ? 50.539  56.059 -39.057 1.00 30.52  ? 1242 LEU D CA    1 
ATOM   8329  C C     . LEU F 5 45  ? 49.784  57.340 -39.269 1.00 31.84  ? 1242 LEU D C     1 
ATOM   8330  O O     . LEU F 5 45  ? 49.951  58.036 -40.271 1.00 29.69  ? 1242 LEU D O     1 
ATOM   8331  C CB    . LEU F 5 45  ? 49.578  54.869 -39.125 1.00 23.69  ? 1242 LEU D CB    1 
ATOM   8332  C CG    . LEU F 5 45  ? 48.585  54.956 -40.319 1.00 27.57  ? 1242 LEU D CG    1 
ATOM   8333  C CD1   . LEU F 5 45  ? 49.383  55.166 -41.612 1.00 26.13  ? 1242 LEU D CD1   1 
ATOM   8334  C CD2   . LEU F 5 45  ? 47.687  53.718 -40.457 1.00 25.53  ? 1242 LEU D CD2   1 
ATOM   8335  N N     . LYS F 5 46  ? 48.949  57.658 -38.306 1.00 43.04  ? 1243 LYS D N     1 
ATOM   8336  C CA    . LYS F 5 46  ? 48.164  58.865 -38.429 1.00 47.68  ? 1243 LYS D CA    1 
ATOM   8337  C C     . LYS F 5 46  ? 49.051  60.095 -38.517 1.00 46.44  ? 1243 LYS D C     1 
ATOM   8338  O O     . LYS F 5 46  ? 48.684  61.087 -39.157 1.00 48.34  ? 1243 LYS D O     1 
ATOM   8339  C CB    . LYS F 5 46  ? 47.156  58.949 -37.278 1.00 35.63  ? 1243 LYS D CB    1 
ATOM   8340  C CG    . LYS F 5 46  ? 46.064  57.850 -37.388 1.00 37.95  ? 1243 LYS D CG    1 
ATOM   8341  C CD    . LYS F 5 46  ? 45.769  57.589 -38.870 1.00 43.04  ? 1243 LYS D CD    1 
ATOM   8342  C CE    . LYS F 5 46  ? 44.328  57.274 -39.129 1.00 43.95  ? 1243 LYS D CE    1 
ATOM   8343  N NZ    . LYS F 5 46  ? 43.944  57.701 -40.507 1.00 44.27  ? 1243 LYS D NZ    1 
ATOM   8344  N N     . GLN F 5 47  ? 50.237  60.011 -37.912 1.00 34.28  ? 1244 GLN D N     1 
ATOM   8345  C CA    . GLN F 5 47  ? 51.160  61.119 -37.971 1.00 32.60  ? 1244 GLN D CA    1 
ATOM   8346  C C     . GLN F 5 47  ? 51.669  61.378 -39.343 1.00 32.40  ? 1244 GLN D C     1 
ATOM   8347  O O     . GLN F 5 47  ? 51.765  62.523 -39.716 1.00 29.07  ? 1244 GLN D O     1 
ATOM   8348  C CB    . GLN F 5 47  ? 52.346  60.926 -37.041 1.00 35.76  ? 1244 GLN D CB    1 
ATOM   8349  C CG    . GLN F 5 47  ? 51.944  60.952 -35.599 1.00 36.83  ? 1244 GLN D CG    1 
ATOM   8350  C CD    . GLN F 5 47  ? 53.075  61.312 -34.658 1.00 39.24  ? 1244 GLN D CD    1 
ATOM   8351  O OE1   . GLN F 5 47  ? 54.209  60.829 -34.791 1.00 43.06  ? 1244 GLN D OE1   1 
ATOM   8352  N NE2   . GLN F 5 47  ? 52.762  62.147 -33.681 1.00 35.28  ? 1244 GLN D NE2   1 
ATOM   8353  N N     . VAL F 5 48  ? 51.989  60.358 -40.123 1.00 36.84  ? 1245 VAL D N     1 
ATOM   8354  C CA    . VAL F 5 48  ? 52.541  60.623 -41.461 1.00 35.62  ? 1245 VAL D CA    1 
ATOM   8355  C C     . VAL F 5 48  ? 51.463  60.839 -42.510 1.00 35.16  ? 1245 VAL D C     1 
ATOM   8356  O O     . VAL F 5 48  ? 51.524  61.795 -43.335 1.00 40.61  ? 1245 VAL D O     1 
ATOM   8357  C CB    . VAL F 5 48  ? 53.479  59.484 -41.911 1.00 27.00  ? 1245 VAL D CB    1 
ATOM   8358  C CG1   . VAL F 5 48  ? 54.364  59.118 -40.766 1.00 26.25  ? 1245 VAL D CG1   1 
ATOM   8359  C CG2   . VAL F 5 48  ? 52.697  58.272 -42.355 1.00 22.89  ? 1245 VAL D CG2   1 
ATOM   8360  N N     . HIS F 5 49  ? 50.468  59.961 -42.423 1.00 39.30  ? 1246 HIS D N     1 
ATOM   8361  C CA    . HIS F 5 49  ? 49.337  59.970 -43.327 1.00 40.76  ? 1246 HIS D CA    1 
ATOM   8362  C C     . HIS F 5 49  ? 48.003  60.001 -42.557 1.00 41.77  ? 1246 HIS D C     1 
ATOM   8363  O O     . HIS F 5 49  ? 47.358  58.966 -42.372 1.00 42.43  ? 1246 HIS D O     1 
ATOM   8364  C CB    . HIS F 5 49  ? 49.387  58.731 -44.241 1.00 20.04  ? 1246 HIS D CB    1 
ATOM   8365  C CG    . HIS F 5 49  ? 50.528  58.733 -45.209 1.00 20.89  ? 1246 HIS D CG    1 
ATOM   8366  N ND1   . HIS F 5 49  ? 50.723  59.744 -46.118 1.00 19.38  ? 1246 HIS D ND1   1 
ATOM   8367  C CD2   . HIS F 5 49  ? 51.548  57.863 -45.394 1.00 20.99  ? 1246 HIS D CD2   1 
ATOM   8368  C CE1   . HIS F 5 49  ? 51.819  59.492 -46.824 1.00 21.92  ? 1246 HIS D CE1   1 
ATOM   8369  N NE2   . HIS F 5 49  ? 52.337  58.357 -46.408 1.00 21.14  ? 1246 HIS D NE2   1 
ATOM   8370  N N     . PRO F 5 50  ? 47.573  61.215 -42.134 1.00 38.40  ? 1247 PRO D N     1 
ATOM   8371  C CA    . PRO F 5 50  ? 46.361  61.539 -41.387 1.00 39.06  ? 1247 PRO D CA    1 
ATOM   8372  C C     . PRO F 5 50  ? 45.064  60.923 -41.884 1.00 36.25  ? 1247 PRO D C     1 
ATOM   8373  O O     . PRO F 5 50  ? 44.174  60.687 -41.094 1.00 38.30  ? 1247 PRO D O     1 
ATOM   8374  C CB    . PRO F 5 50  ? 46.335  63.063 -41.463 1.00 35.16  ? 1247 PRO D CB    1 
ATOM   8375  C CG    . PRO F 5 50  ? 47.734  63.401 -41.444 1.00 37.37  ? 1247 PRO D CG    1 
ATOM   8376  C CD    . PRO F 5 50  ? 48.261  62.478 -42.478 1.00 31.59  ? 1247 PRO D CD    1 
ATOM   8377  N N     . ASP F 5 51  ? 44.951  60.675 -43.183 1.00 36.64  ? 1248 ASP D N     1 
ATOM   8378  C CA    . ASP F 5 51  ? 43.716  60.110 -43.743 1.00 39.78  ? 1248 ASP D CA    1 
ATOM   8379  C C     . ASP F 5 51  ? 43.799  58.673 -44.272 1.00 39.61  ? 1248 ASP D C     1 
ATOM   8380  O O     . ASP F 5 51  ? 42.899  58.213 -44.975 1.00 37.79  ? 1248 ASP D O     1 
ATOM   8381  C CB    . ASP F 5 51  ? 43.219  60.992 -44.891 1.00 57.16  ? 1248 ASP D CB    1 
ATOM   8382  C CG    . ASP F 5 51  ? 42.708  62.331 -44.422 1.00 62.73  ? 1248 ASP D CG    1 
ATOM   8383  O OD1   . ASP F 5 51  ? 42.052  62.388 -43.350 1.00 62.80  ? 1248 ASP D OD1   1 
ATOM   8384  O OD2   . ASP F 5 51  ? 42.944  63.324 -45.145 1.00 65.32  ? 1248 ASP D OD2   1 
ATOM   8385  N N     . THR F 5 52  ? 44.869  57.967 -43.923 1.00 39.46  ? 1249 THR D N     1 
ATOM   8386  C CA    . THR F 5 52  ? 45.084  56.621 -44.438 1.00 37.30  ? 1249 THR D CA    1 
ATOM   8387  C C     . THR F 5 52  ? 44.883  55.565 -43.367 1.00 35.94  ? 1249 THR D C     1 
ATOM   8388  O O     . THR F 5 52  ? 45.206  55.758 -42.212 1.00 36.28  ? 1249 THR D O     1 
ATOM   8389  C CB    . THR F 5 52  ? 46.542  56.512 -45.043 1.00 39.41  ? 1249 THR D CB    1 
ATOM   8390  O OG1   . THR F 5 52  ? 46.782  57.605 -45.960 1.00 36.39  ? 1249 THR D OG1   1 
ATOM   8391  C CG2   . THR F 5 52  ? 46.741  55.186 -45.754 1.00 35.38  ? 1249 THR D CG2   1 
ATOM   8392  N N     . GLY F 5 53  ? 44.327  54.444 -43.759 1.00 35.47  ? 1250 GLY D N     1 
ATOM   8393  C CA    . GLY F 5 53  ? 44.132  53.386 -42.799 1.00 35.55  ? 1250 GLY D CA    1 
ATOM   8394  C C     . GLY F 5 53  ? 45.015  52.180 -43.074 1.00 36.00  ? 1250 GLY D C     1 
ATOM   8395  O O     . GLY F 5 53  ? 45.841  52.159 -43.994 1.00 33.13  ? 1250 GLY D O     1 
ATOM   8396  N N     . ILE F 5 54  ? 44.844  51.147 -42.268 1.00 35.15  ? 1251 ILE D N     1 
ATOM   8397  C CA    . ILE F 5 54  ? 45.664  49.983 -42.461 1.00 35.47  ? 1251 ILE D CA    1 
ATOM   8398  C C     . ILE F 5 54  ? 44.788  48.785 -42.227 1.00 36.47  ? 1251 ILE D C     1 
ATOM   8399  O O     . ILE F 5 54  ? 43.931  48.802 -41.369 1.00 34.52  ? 1251 ILE D O     1 
ATOM   8400  C CB    . ILE F 5 54  ? 46.900  50.034 -41.514 1.00 30.88  ? 1251 ILE D CB    1 
ATOM   8401  C CG1   . ILE F 5 54  ? 47.983  49.064 -42.011 1.00 30.48  ? 1251 ILE D CG1   1 
ATOM   8402  C CG2   . ILE F 5 54  ? 46.475  49.828 -40.069 1.00 29.31  ? 1251 ILE D CG2   1 
ATOM   8403  C CD1   . ILE F 5 54  ? 49.264  49.168 -41.234 1.00 26.99  ? 1251 ILE D CD1   1 
ATOM   8404  N N     . SER F 5 55  ? 44.960  47.761 -43.047 1.00 31.46  ? 1252 SER D N     1 
ATOM   8405  C CA    . SER F 5 55  ? 44.177  46.556 -42.923 1.00 31.40  ? 1252 SER D CA    1 
ATOM   8406  C C     . SER F 5 55  ? 44.757  45.756 -41.760 1.00 33.09  ? 1252 SER D C     1 
ATOM   8407  O O     . SER F 5 55  ? 45.777  46.131 -41.196 1.00 31.70  ? 1252 SER D O     1 
ATOM   8408  C CB    . SER F 5 55  ? 44.287  45.768 -44.219 1.00 41.26  ? 1252 SER D CB    1 
ATOM   8409  O OG    . SER F 5 55  ? 45.559  45.156 -44.347 1.00 45.67  ? 1252 SER D OG    1 
ATOM   8410  N N     . SER F 5 56  ? 44.118  44.659 -41.381 1.00 28.95  ? 1253 SER D N     1 
ATOM   8411  C CA    . SER F 5 56  ? 44.657  43.872 -40.295 1.00 30.34  ? 1253 SER D CA    1 
ATOM   8412  C C     . SER F 5 56  ? 45.882  43.068 -40.773 1.00 29.18  ? 1253 SER D C     1 
ATOM   8413  O O     . SER F 5 56  ? 46.859  42.923 -40.041 1.00 27.55  ? 1253 SER D O     1 
ATOM   8414  C CB    . SER F 5 56  ? 43.601  42.935 -39.756 1.00 49.37  ? 1253 SER D CB    1 
ATOM   8415  O OG    . SER F 5 56  ? 43.375  41.920 -40.711 1.00 53.13  ? 1253 SER D OG    1 
ATOM   8416  N N     . LYS F 5 57  ? 45.854  42.532 -41.985 1.00 39.04  ? 1254 LYS D N     1 
ATOM   8417  C CA    . LYS F 5 57  ? 47.018  41.777 -42.400 1.00 39.87  ? 1254 LYS D CA    1 
ATOM   8418  C C     . LYS F 5 57  ? 48.188  42.745 -42.413 1.00 38.37  ? 1254 LYS D C     1 
ATOM   8419  O O     . LYS F 5 57  ? 49.264  42.438 -41.897 1.00 38.20  ? 1254 LYS D O     1 
ATOM   8420  C CB    . LYS F 5 57  ? 46.821  41.150 -43.782 1.00 54.66  ? 1254 LYS D CB    1 
ATOM   8421  C CG    . LYS F 5 57  ? 45.442  40.565 -44.002 1.00 63.39  ? 1254 LYS D CG    1 
ATOM   8422  C CD    . LYS F 5 57  ? 45.485  39.441 -45.023 1.00 69.96  ? 1254 LYS D CD    1 
ATOM   8423  C CE    . LYS F 5 57  ? 44.114  38.789 -45.199 1.00 72.83  ? 1254 LYS D CE    1 
ATOM   8424  N NZ    . LYS F 5 57  ? 44.224  37.490 -45.926 1.00 78.99  ? 1254 LYS D NZ    1 
ATOM   8425  N N     . ALA F 5 58  ? 47.977  43.926 -42.986 1.00 35.25  ? 1255 ALA D N     1 
ATOM   8426  C CA    . ALA F 5 58  ? 49.037  44.919 -43.032 1.00 35.19  ? 1255 ALA D CA    1 
ATOM   8427  C C     . ALA F 5 58  ? 49.546  45.225 -41.620 1.00 31.69  ? 1255 ALA D C     1 
ATOM   8428  O O     . ALA F 5 58  ? 50.742  45.246 -41.396 1.00 35.52  ? 1255 ALA D O     1 
ATOM   8429  C CB    . ALA F 5 58  ? 48.552  46.187 -43.730 1.00 22.20  ? 1255 ALA D CB    1 
ATOM   8430  N N     . MET F 5 59  ? 48.643  45.441 -40.668 1.00 31.24  ? 1256 MET D N     1 
ATOM   8431  C CA    . MET F 5 59  ? 49.056  45.709 -39.300 1.00 31.05  ? 1256 MET D CA    1 
ATOM   8432  C C     . MET F 5 59  ? 49.800  44.518 -38.771 1.00 33.58  ? 1256 MET D C     1 
ATOM   8433  O O     . MET F 5 59  ? 50.718  44.671 -37.987 1.00 34.91  ? 1256 MET D O     1 
ATOM   8434  C CB    . MET F 5 59  ? 47.884  45.954 -38.379 1.00 27.19  ? 1256 MET D CB    1 
ATOM   8435  C CG    . MET F 5 59  ? 48.321  46.305 -36.957 1.00 30.37  ? 1256 MET D CG    1 
ATOM   8436  S SD    . MET F 5 59  ? 49.290  47.860 -36.936 1.00 32.73  ? 1256 MET D SD    1 
ATOM   8437  C CE    . MET F 5 59  ? 48.010  49.069 -37.094 1.00 34.95  ? 1256 MET D CE    1 
ATOM   8438  N N     . SER F 5 60  ? 49.389  43.322 -39.193 1.00 25.20  ? 1257 SER D N     1 
ATOM   8439  C CA    . SER F 5 60  ? 50.042  42.091 -38.788 1.00 30.55  ? 1257 SER D CA    1 
ATOM   8440  C C     . SER F 5 60  ? 51.505  42.079 -39.262 1.00 28.19  ? 1257 SER D C     1 
ATOM   8441  O O     . SER F 5 60  ? 52.413  41.827 -38.474 1.00 30.65  ? 1257 SER D O     1 
ATOM   8442  C CB    . SER F 5 60  ? 49.305  40.931 -39.355 1.00 43.77  ? 1257 SER D CB    1 
ATOM   8443  O OG    . SER F 5 60  ? 49.792  39.782 -38.727 1.00 50.39  ? 1257 SER D OG    1 
ATOM   8444  N N     . ILE F 5 61  ? 51.735  42.343 -40.543 1.00 17.02  ? 1258 ILE D N     1 
ATOM   8445  C CA    . ILE F 5 61  ? 53.093  42.466 -41.081 1.00 20.20  ? 1258 ILE D CA    1 
ATOM   8446  C C     . ILE F 5 61  ? 53.909  43.595 -40.354 1.00 21.02  ? 1258 ILE D C     1 
ATOM   8447  O O     . ILE F 5 61  ? 55.139  43.501 -40.170 1.00 18.85  ? 1258 ILE D O     1 
ATOM   8448  C CB    . ILE F 5 61  ? 53.035  42.863 -42.564 1.00 19.43  ? 1258 ILE D CB    1 
ATOM   8449  C CG1   . ILE F 5 61  ? 52.591  41.701 -43.415 1.00 24.16  ? 1258 ILE D CG1   1 
ATOM   8450  C CG2   . ILE F 5 61  ? 54.401  43.408 -43.033 1.00 14.68  ? 1258 ILE D CG2   1 
ATOM   8451  C CD1   . ILE F 5 61  ? 52.184  42.201 -44.712 1.00 28.04  ? 1258 ILE D CD1   1 
ATOM   8452  N N     . MET F 5 62  ? 53.224  44.679 -39.972 1.00 23.81  ? 1259 MET D N     1 
ATOM   8453  C CA    . MET F 5 62  ? 53.905  45.781 -39.288 1.00 24.49  ? 1259 MET D CA    1 
ATOM   8454  C C     . MET F 5 62  ? 54.310  45.381 -37.902 1.00 24.03  ? 1259 MET D C     1 
ATOM   8455  O O     . MET F 5 62  ? 55.228  45.976 -37.316 1.00 20.61  ? 1259 MET D O     1 
ATOM   8456  C CB    . MET F 5 62  ? 53.038  47.024 -39.215 1.00 27.45  ? 1259 MET D CB    1 
ATOM   8457  C CG    . MET F 5 62  ? 53.013  47.810 -40.500 1.00 26.21  ? 1259 MET D CG    1 
ATOM   8458  S SD    . MET F 5 62  ? 54.627  47.963 -41.184 1.00 32.06  ? 1259 MET D SD    1 
ATOM   8459  C CE    . MET F 5 62  ? 55.271  49.355 -40.323 1.00 30.10  ? 1259 MET D CE    1 
ATOM   8460  N N     . ASN F 5 63  ? 53.629  44.360 -37.379 1.00 25.08  ? 1260 ASN D N     1 
ATOM   8461  C CA    . ASN F 5 63  ? 53.968  43.919 -36.063 1.00 26.89  ? 1260 ASN D CA    1 
ATOM   8462  C C     . ASN F 5 63  ? 55.158  43.001 -36.171 1.00 25.31  ? 1260 ASN D C     1 
ATOM   8463  O O     . ASN F 5 63  ? 56.113  43.105 -35.401 1.00 27.92  ? 1260 ASN D O     1 
ATOM   8464  C CB    . ASN F 5 63  ? 52.789  43.254 -35.363 1.00 26.92  ? 1260 ASN D CB    1 
ATOM   8465  C CG    . ASN F 5 63  ? 52.880  43.435 -33.848 1.00 35.46  ? 1260 ASN D CG    1 
ATOM   8466  O OD1   . ASN F 5 63  ? 52.799  44.550 -33.371 1.00 36.71  ? 1260 ASN D OD1   1 
ATOM   8467  N ND2   . ASN F 5 63  ? 53.099  42.359 -33.104 1.00 32.91  ? 1260 ASN D ND2   1 
ATOM   8468  N N     . SER F 5 64  ? 55.102  42.125 -37.161 1.00 42.30  ? 1261 SER D N     1 
ATOM   8469  C CA    . SER F 5 64  ? 56.181  41.190 -37.409 1.00 43.43  ? 1261 SER D CA    1 
ATOM   8470  C C     . SER F 5 64  ? 57.461  41.995 -37.651 1.00 43.52  ? 1261 SER D C     1 
ATOM   8471  O O     . SER F 5 64  ? 58.538  41.665 -37.121 1.00 44.42  ? 1261 SER D O     1 
ATOM   8472  C CB    . SER F 5 64  ? 55.856  40.319 -38.625 1.00 60.66  ? 1261 SER D CB    1 
ATOM   8473  O OG    . SER F 5 64  ? 54.636  39.619 -38.444 1.00 62.77  ? 1261 SER D OG    1 
ATOM   8474  N N     . PHE F 5 65  ? 57.321  43.065 -38.440 1.00 36.57  ? 1262 PHE D N     1 
ATOM   8475  C CA    . PHE F 5 65  ? 58.422  43.944 -38.764 1.00 36.42  ? 1262 PHE D CA    1 
ATOM   8476  C C     . PHE F 5 65  ? 59.097  44.466 -37.523 1.00 34.82  ? 1262 PHE D C     1 
ATOM   8477  O O     . PHE F 5 65  ? 60.277  44.280 -37.346 1.00 36.11  ? 1262 PHE D O     1 
ATOM   8478  C CB    . PHE F 5 65  ? 57.933  45.114 -39.582 1.00 27.61  ? 1262 PHE D CB    1 
ATOM   8479  C CG    . PHE F 5 65  ? 59.013  46.128 -39.877 1.00 27.65  ? 1262 PHE D CG    1 
ATOM   8480  C CD1   . PHE F 5 65  ? 60.209  45.733 -40.499 1.00 28.90  ? 1262 PHE D CD1   1 
ATOM   8481  C CD2   . PHE F 5 65  ? 58.866  47.468 -39.487 1.00 29.69  ? 1262 PHE D CD2   1 
ATOM   8482  C CE1   . PHE F 5 65  ? 61.226  46.651 -40.724 1.00 31.01  ? 1262 PHE D CE1   1 
ATOM   8483  C CE2   . PHE F 5 65  ? 59.890  48.408 -39.718 1.00 31.11  ? 1262 PHE D CE2   1 
ATOM   8484  C CZ    . PHE F 5 65  ? 61.069  47.998 -40.328 1.00 28.20  ? 1262 PHE D CZ    1 
ATOM   8485  N N     . VAL F 5 66  ? 58.339  45.134 -36.662 1.00 20.96  ? 1263 VAL D N     1 
ATOM   8486  C CA    . VAL F 5 66  ? 58.861  45.710 -35.401 1.00 19.90  ? 1263 VAL D CA    1 
ATOM   8487  C C     . VAL F 5 66  ? 59.559  44.701 -34.495 1.00 21.64  ? 1263 VAL D C     1 
ATOM   8488  O O     . VAL F 5 66  ? 60.681  44.912 -34.064 1.00 19.87  ? 1263 VAL D O     1 
ATOM   8489  C CB    . VAL F 5 66  ? 57.748  46.354 -34.574 1.00 26.61  ? 1263 VAL D CB    1 
ATOM   8490  C CG1   . VAL F 5 66  ? 58.339  46.869 -33.293 1.00 24.69  ? 1263 VAL D CG1   1 
ATOM   8491  C CG2   . VAL F 5 66  ? 57.065  47.466 -35.362 1.00 24.79  ? 1263 VAL D CG2   1 
ATOM   8492  N N     . ASN F 5 67  ? 58.887  43.592 -34.206 1.00 24.35  ? 1264 ASN D N     1 
ATOM   8493  C CA    . ASN F 5 67  ? 59.491  42.577 -33.366 1.00 24.67  ? 1264 ASN D CA    1 
ATOM   8494  C C     . ASN F 5 67  ? 60.739  42.001 -34.029 1.00 22.04  ? 1264 ASN D C     1 
ATOM   8495  O O     . ASN F 5 67  ? 61.662  41.590 -33.369 1.00 23.03  ? 1264 ASN D O     1 
ATOM   8496  C CB    . ASN F 5 67  ? 58.447  41.534 -32.978 1.00 41.62  ? 1264 ASN D CB    1 
ATOM   8497  C CG    . ASN F 5 67  ? 57.431  42.111 -31.998 1.00 46.23  ? 1264 ASN D CG    1 
ATOM   8498  O OD1   . ASN F 5 67  ? 57.819  42.629 -30.954 1.00 47.70  ? 1264 ASN D OD1   1 
ATOM   8499  N ND2   . ASN F 5 67  ? 56.139  42.058 -32.335 1.00 50.62  ? 1264 ASN D ND2   1 
ATOM   8500  N N     . ASP F 5 68  ? 60.798  42.032 -35.345 1.00 21.97  ? 1265 ASP D N     1 
ATOM   8501  C CA    . ASP F 5 68  ? 61.978  41.552 -36.038 1.00 24.20  ? 1265 ASP D CA    1 
ATOM   8502  C C     . ASP F 5 68  ? 63.161  42.497 -35.764 1.00 24.90  ? 1265 ASP D C     1 
ATOM   8503  O O     . ASP F 5 68  ? 64.106  42.137 -35.119 1.00 24.08  ? 1265 ASP D O     1 
ATOM   8504  C CB    . ASP F 5 68  ? 61.674  41.441 -37.542 1.00 45.79  ? 1265 ASP D CB    1 
ATOM   8505  C CG    . ASP F 5 68  ? 62.687  40.604 -38.288 1.00 48.16  ? 1265 ASP D CG    1 
ATOM   8506  O OD1   . ASP F 5 68  ? 63.108  39.535 -37.791 1.00 53.65  ? 1265 ASP D OD1   1 
ATOM   8507  O OD2   . ASP F 5 68  ? 63.055  41.014 -39.390 1.00 45.66  ? 1265 ASP D OD2   1 
ATOM   8508  N N     . VAL F 5 69  ? 63.087  43.722 -36.240 1.00 30.28  ? 1266 VAL D N     1 
ATOM   8509  C CA    . VAL F 5 69  ? 64.145  44.688 -36.008 1.00 27.33  ? 1266 VAL D CA    1 
ATOM   8510  C C     . VAL F 5 69  ? 64.525  44.711 -34.516 1.00 28.85  ? 1266 VAL D C     1 
ATOM   8511  O O     . VAL F 5 69  ? 65.695  44.834 -34.165 1.00 28.05  ? 1266 VAL D O     1 
ATOM   8512  C CB    . VAL F 5 69  ? 63.678  46.124 -36.438 1.00 30.42  ? 1266 VAL D CB    1 
ATOM   8513  C CG1   . VAL F 5 69  ? 64.894  47.044 -36.605 1.00 30.65  ? 1266 VAL D CG1   1 
ATOM   8514  C CG2   . VAL F 5 69  ? 62.840  46.055 -37.722 1.00 29.56  ? 1266 VAL D CG2   1 
ATOM   8515  N N     . PHE F 5 70  ? 63.520  44.605 -33.646 1.00 33.21  ? 1267 PHE D N     1 
ATOM   8516  C CA    . PHE F 5 70  ? 63.742  44.619 -32.214 1.00 35.17  ? 1267 PHE D CA    1 
ATOM   8517  C C     . PHE F 5 70  ? 64.680  43.520 -31.727 1.00 36.47  ? 1267 PHE D C     1 
ATOM   8518  O O     . PHE F 5 70  ? 65.473  43.733 -30.803 1.00 35.45  ? 1267 PHE D O     1 
ATOM   8519  C CB    . PHE F 5 70  ? 62.443  44.467 -31.457 1.00 38.60  ? 1267 PHE D CB    1 
ATOM   8520  C CG    . PHE F 5 70  ? 62.650  44.438 -29.968 1.00 42.46  ? 1267 PHE D CG    1 
ATOM   8521  C CD1   . PHE F 5 70  ? 62.515  45.585 -29.212 1.00 46.11  ? 1267 PHE D CD1   1 
ATOM   8522  C CD2   . PHE F 5 70  ? 63.067  43.269 -29.324 1.00 46.01  ? 1267 PHE D CD2   1 
ATOM   8523  C CE1   . PHE F 5 70  ? 62.797  45.573 -27.874 1.00 45.64  ? 1267 PHE D CE1   1 
ATOM   8524  C CE2   . PHE F 5 70  ? 63.351  43.263 -27.979 1.00 47.51  ? 1267 PHE D CE2   1 
ATOM   8525  C CZ    . PHE F 5 70  ? 63.211  44.415 -27.260 1.00 46.30  ? 1267 PHE D CZ    1 
ATOM   8526  N N     . GLU F 5 71  ? 64.541  42.329 -32.318 1.00 32.61  ? 1268 GLU D N     1 
ATOM   8527  C CA    . GLU F 5 71  ? 65.341  41.170 -31.976 1.00 34.76  ? 1268 GLU D CA    1 
ATOM   8528  C C     . GLU F 5 71  ? 66.713  41.256 -32.612 1.00 34.39  ? 1268 GLU D C     1 
ATOM   8529  O O     . GLU F 5 71  ? 67.672  40.751 -32.071 1.00 34.04  ? 1268 GLU D O     1 
ATOM   8530  C CB    . GLU F 5 71  ? 64.671  39.891 -32.465 1.00 73.08  ? 1268 GLU D CB    1 
ATOM   8531  C CG    . GLU F 5 71  ? 63.403  39.472 -31.746 1.00 84.51  ? 1268 GLU D CG    1 
ATOM   8532  C CD    . GLU F 5 71  ? 62.441  38.731 -32.676 1.00 91.37  ? 1268 GLU D CD    1 
ATOM   8533  O OE1   . GLU F 5 71  ? 62.920  37.970 -33.546 1.00 95.13  ? 1268 GLU D OE1   1 
ATOM   8534  O OE2   . GLU F 5 71  ? 61.209  38.912 -32.539 1.00 96.04  ? 1268 GLU D OE2   1 
ATOM   8535  N N     . ARG F 5 72  ? 66.849  41.892 -33.755 1.00 24.22  ? 1269 ARG D N     1 
ATOM   8536  C CA    . ARG F 5 72  ? 68.159  41.906 -34.340 1.00 23.20  ? 1269 ARG D CA    1 
ATOM   8537  C C     . ARG F 5 72  ? 69.030  42.847 -33.588 1.00 24.36  ? 1269 ARG D C     1 
ATOM   8538  O O     . ARG F 5 72  ? 70.170  42.509 -33.263 1.00 20.97  ? 1269 ARG D O     1 
ATOM   8539  C CB    . ARG F 5 72  ? 68.134  42.311 -35.800 1.00 38.00  ? 1269 ARG D CB    1 
ATOM   8540  C CG    . ARG F 5 72  ? 66.764  42.418 -36.358 1.00 39.27  ? 1269 ARG D CG    1 
ATOM   8541  C CD    . ARG F 5 72  ? 66.511  41.390 -37.480 1.00 41.63  ? 1269 ARG D CD    1 
ATOM   8542  N NE    . ARG F 5 72  ? 67.298  41.755 -38.653 1.00 40.26  ? 1269 ARG D NE    1 
ATOM   8543  C CZ    . ARG F 5 72  ? 66.811  41.994 -39.874 1.00 41.29  ? 1269 ARG D CZ    1 
ATOM   8544  N NH1   . ARG F 5 72  ? 65.522  41.891 -40.141 1.00 36.76  ? 1269 ARG D NH1   1 
ATOM   8545  N NH2   . ARG F 5 72  ? 67.632  42.416 -40.825 1.00 43.28  ? 1269 ARG D NH2   1 
ATOM   8546  N N     . ILE F 5 73  ? 68.496  44.032 -33.314 1.00 31.65  ? 1270 ILE D N     1 
ATOM   8547  C CA    . ILE F 5 73  ? 69.219  45.093 -32.614 1.00 30.37  ? 1270 ILE D CA    1 
ATOM   8548  C C     . ILE F 5 73  ? 69.541  44.572 -31.228 1.00 31.83  ? 1270 ILE D C     1 
ATOM   8549  O O     . ILE F 5 73  ? 70.659  44.703 -30.765 1.00 32.94  ? 1270 ILE D O     1 
ATOM   8550  C CB    . ILE F 5 73  ? 68.354  46.404 -32.574 1.00 18.46  ? 1270 ILE D CB    1 
ATOM   8551  C CG1   . ILE F 5 73  ? 68.167  46.938 -33.995 1.00 16.23  ? 1270 ILE D CG1   1 
ATOM   8552  C CG2   . ILE F 5 73  ? 69.033  47.475 -31.825 1.00 18.73  ? 1270 ILE D CG2   1 
ATOM   8553  C CD1   . ILE F 5 73  ? 67.213  48.049 -34.104 1.00 19.01  ? 1270 ILE D CD1   1 
ATOM   8554  N N     . ALA F 5 74  ? 68.574  43.935 -30.588 1.00 35.33  ? 1271 ALA D N     1 
ATOM   8555  C CA    . ALA F 5 74  ? 68.794  43.390 -29.258 1.00 35.32  ? 1271 ALA D CA    1 
ATOM   8556  C C     . ALA F 5 74  ? 69.949  42.439 -29.318 1.00 34.53  ? 1271 ALA D C     1 
ATOM   8557  O O     . ALA F 5 74  ? 70.928  42.644 -28.658 1.00 33.99  ? 1271 ALA D O     1 
ATOM   8558  C CB    . ALA F 5 74  ? 67.567  42.665 -28.768 1.00 34.84  ? 1271 ALA D CB    1 
ATOM   8559  N N     . GLY F 5 75  ? 69.825  41.388 -30.106 1.00 19.98  ? 1272 GLY D N     1 
ATOM   8560  C CA    . GLY F 5 75  ? 70.914  40.442 -30.219 1.00 21.60  ? 1272 GLY D CA    1 
ATOM   8561  C C     . GLY F 5 75  ? 72.285  41.033 -30.599 1.00 24.81  ? 1272 GLY D C     1 
ATOM   8562  O O     . GLY F 5 75  ? 73.305  40.663 -30.009 1.00 24.45  ? 1272 GLY D O     1 
ATOM   8563  N N     . GLU F 5 76  ? 72.322  41.922 -31.591 1.00 36.02  ? 1273 GLU D N     1 
ATOM   8564  C CA    . GLU F 5 76  ? 73.563  42.555 -31.986 1.00 37.58  ? 1273 GLU D CA    1 
ATOM   8565  C C     . GLU F 5 76  ? 74.141  43.210 -30.752 1.00 34.94  ? 1273 GLU D C     1 
ATOM   8566  O O     . GLU F 5 76  ? 75.352  43.154 -30.528 1.00 35.83  ? 1273 GLU D O     1 
ATOM   8567  C CB    . GLU F 5 76  ? 73.319  43.622 -33.051 1.00 61.50  ? 1273 GLU D CB    1 
ATOM   8568  C CG    . GLU F 5 76  ? 73.407  43.146 -34.503 1.00 66.91  ? 1273 GLU D CG    1 
ATOM   8569  C CD    . GLU F 5 76  ? 74.778  42.574 -34.861 1.00 68.59  ? 1273 GLU D CD    1 
ATOM   8570  O OE1   . GLU F 5 76  ? 75.789  43.056 -34.300 1.00 68.72  ? 1273 GLU D OE1   1 
ATOM   8571  O OE2   . GLU F 5 76  ? 74.848  41.650 -35.709 1.00 69.18  ? 1273 GLU D OE2   1 
ATOM   8572  N N     . ALA F 5 77  ? 73.273  43.838 -29.952 1.00 26.07  ? 1274 ALA D N     1 
ATOM   8573  C CA    . ALA F 5 77  ? 73.673  44.518 -28.689 1.00 26.93  ? 1274 ALA D CA    1 
ATOM   8574  C C     . ALA F 5 77  ? 74.172  43.525 -27.650 1.00 26.50  ? 1274 ALA D C     1 
ATOM   8575  O O     . ALA F 5 77  ? 75.272  43.644 -27.125 1.00 27.20  ? 1274 ALA D O     1 
ATOM   8576  C CB    . ALA F 5 77  ? 72.488  45.305 -28.100 1.00 34.15  ? 1274 ALA D CB    1 
ATOM   8577  N N     . SER F 5 78  ? 73.323  42.557 -27.347 1.00 40.03  ? 1275 SER D N     1 
ATOM   8578  C CA    . SER F 5 78  ? 73.655  41.510 -26.413 1.00 42.73  ? 1275 SER D CA    1 
ATOM   8579  C C     . SER F 5 78  ? 75.091  41.048 -26.649 1.00 43.23  ? 1275 SER D C     1 
ATOM   8580  O O     . SER F 5 78  ? 75.929  41.111 -25.745 1.00 41.77  ? 1275 SER D O     1 
ATOM   8581  C CB    . SER F 5 78  ? 72.701  40.346 -26.613 1.00 39.60  ? 1275 SER D CB    1 
ATOM   8582  O OG    . SER F 5 78  ? 73.069  39.284 -25.770 1.00 42.74  ? 1275 SER D OG    1 
ATOM   8583  N N     . ARG F 5 79  ? 75.343  40.607 -27.884 1.00 42.83  ? 1276 ARG D N     1 
ATOM   8584  C CA    . ARG F 5 79  ? 76.647  40.103 -28.375 1.00 45.48  ? 1276 ARG D CA    1 
ATOM   8585  C C     . ARG F 5 79  ? 77.801  41.091 -28.129 1.00 45.49  ? 1276 ARG D C     1 
ATOM   8586  O O     . ARG F 5 79  ? 78.806  40.778 -27.487 1.00 45.92  ? 1276 ARG D O     1 
ATOM   8587  C CB    . ARG F 5 79  ? 76.535  39.828 -29.880 1.00 26.92  ? 1276 ARG D CB    1 
ATOM   8588  C CG    . ARG F 5 79  ? 76.856  38.434 -30.344 1.00 29.47  ? 1276 ARG D CG    1 
ATOM   8589  C CD    . ARG F 5 79  ? 76.291  38.229 -31.715 1.00 32.75  ? 1276 ARG D CD    1 
ATOM   8590  N NE    . ARG F 5 79  ? 74.865  37.874 -31.633 1.00 38.78  ? 1276 ARG D NE    1 
ATOM   8591  C CZ    . ARG F 5 79  ? 73.909  38.349 -32.442 1.00 38.92  ? 1276 ARG D CZ    1 
ATOM   8592  N NH1   . ARG F 5 79  ? 74.216  39.210 -33.411 1.00 46.28  ? 1276 ARG D NH1   1 
ATOM   8593  N NH2   . ARG F 5 79  ? 72.647  37.964 -32.278 1.00 42.95  ? 1276 ARG D NH2   1 
ATOM   8594  N N     . LEU F 5 80  ? 77.639  42.278 -28.687 1.00 32.45  ? 1277 LEU D N     1 
ATOM   8595  C CA    . LEU F 5 80  ? 78.586  43.359 -28.530 1.00 33.47  ? 1277 LEU D CA    1 
ATOM   8596  C C     . LEU F 5 80  ? 79.111  43.440 -27.087 1.00 33.26  ? 1277 LEU D C     1 
ATOM   8597  O O     . LEU F 5 80  ? 80.309  43.546 -26.876 1.00 33.94  ? 1277 LEU D O     1 
ATOM   8598  C CB    . LEU F 5 80  ? 77.879  44.666 -28.892 1.00 30.94  ? 1277 LEU D CB    1 
ATOM   8599  C CG    . LEU F 5 80  ? 78.754  45.750 -29.496 1.00 35.31  ? 1277 LEU D CG    1 
ATOM   8600  C CD1   . LEU F 5 80  ? 79.713  45.133 -30.534 1.00 32.20  ? 1277 LEU D CD1   1 
ATOM   8601  C CD2   . LEU F 5 80  ? 77.857  46.772 -30.131 1.00 37.52  ? 1277 LEU D CD2   1 
ATOM   8602  N N     . ALA F 5 81  ? 78.197  43.404 -26.111 1.00 25.62  ? 1278 ALA D N     1 
ATOM   8603  C CA    . ALA F 5 81  ? 78.518  43.467 -24.679 1.00 27.35  ? 1278 ALA D CA    1 
ATOM   8604  C C     . ALA F 5 81  ? 79.400  42.311 -24.283 1.00 28.42  ? 1278 ALA D C     1 
ATOM   8605  O O     . ALA F 5 81  ? 80.438  42.517 -23.689 1.00 29.11  ? 1278 ALA D O     1 
ATOM   8606  C CB    . ALA F 5 81  ? 77.245  43.448 -23.843 1.00 40.60  ? 1278 ALA D CB    1 
ATOM   8607  N N     . HIS F 5 82  ? 78.988  41.090 -24.624 1.00 45.41  ? 1279 HIS D N     1 
ATOM   8608  C CA    . HIS F 5 82  ? 79.781  39.916 -24.302 1.00 47.35  ? 1279 HIS D CA    1 
ATOM   8609  C C     . HIS F 5 82  ? 81.120  40.066 -24.974 1.00 46.60  ? 1279 HIS D C     1 
ATOM   8610  O O     . HIS F 5 82  ? 82.117  39.797 -24.349 1.00 48.36  ? 1279 HIS D O     1 
ATOM   8611  C CB    . HIS F 5 82  ? 79.099  38.613 -24.732 1.00 74.34  ? 1279 HIS D CB    1 
ATOM   8612  C CG    . HIS F 5 82  ? 77.867  38.281 -23.933 1.00 79.58  ? 1279 HIS D CG    1 
ATOM   8613  N ND1   . HIS F 5 82  ? 77.755  38.547 -22.581 1.00 84.74  ? 1279 HIS D ND1   1 
ATOM   8614  C CD2   . HIS F 5 82  ? 76.691  37.707 -24.295 1.00 82.01  ? 1279 HIS D CD2   1 
ATOM   8615  C CE1   . HIS F 5 82  ? 76.567  38.156 -22.150 1.00 83.97  ? 1279 HIS D CE1   1 
ATOM   8616  N NE2   . HIS F 5 82  ? 75.901  37.643 -23.169 1.00 83.84  ? 1279 HIS D NE2   1 
ATOM   8617  N N     . TYR F 5 83  ? 81.176  40.528 -26.223 1.00 54.55  ? 1280 TYR D N     1 
ATOM   8618  C CA    . TYR F 5 83  ? 82.481  40.694 -26.871 1.00 55.96  ? 1280 TYR D CA    1 
ATOM   8619  C C     . TYR F 5 83  ? 83.312  41.677 -26.098 1.00 56.78  ? 1280 TYR D C     1 
ATOM   8620  O O     . TYR F 5 83  ? 84.510  41.730 -26.276 1.00 57.19  ? 1280 TYR D O     1 
ATOM   8621  C CB    . TYR F 5 83  ? 82.388  41.226 -28.306 1.00 66.15  ? 1280 TYR D CB    1 
ATOM   8622  C CG    . TYR F 5 83  ? 81.650  40.344 -29.306 1.00 68.90  ? 1280 TYR D CG    1 
ATOM   8623  C CD1   . TYR F 5 83  ? 81.276  40.849 -30.564 1.00 68.74  ? 1280 TYR D CD1   1 
ATOM   8624  C CD2   . TYR F 5 83  ? 81.285  39.030 -28.992 1.00 69.32  ? 1280 TYR D CD2   1 
ATOM   8625  C CE1   . TYR F 5 83  ? 80.567  40.082 -31.452 1.00 70.89  ? 1280 TYR D CE1   1 
ATOM   8626  C CE2   . TYR F 5 83  ? 80.569  38.261 -29.886 1.00 71.37  ? 1280 TYR D CE2   1 
ATOM   8627  C CZ    . TYR F 5 83  ? 80.213  38.797 -31.108 1.00 73.83  ? 1280 TYR D CZ    1 
ATOM   8628  O OH    . TYR F 5 83  ? 79.468  38.054 -31.983 1.00 75.15  ? 1280 TYR D OH    1 
ATOM   8629  N N     . ASN F 5 84  ? 82.708  42.462 -25.227 1.00 42.41  ? 1281 ASN D N     1 
ATOM   8630  C CA    . ASN F 5 84  ? 83.501  43.444 -24.510 1.00 42.84  ? 1281 ASN D CA    1 
ATOM   8631  C C     . ASN F 5 84  ? 83.567  43.242 -23.010 1.00 42.55  ? 1281 ASN D C     1 
ATOM   8632  O O     . ASN F 5 84  ? 83.983  44.139 -22.277 1.00 42.88  ? 1281 ASN D O     1 
ATOM   8633  C CB    . ASN F 5 84  ? 82.992  44.854 -24.826 1.00 48.33  ? 1281 ASN D CB    1 
ATOM   8634  C CG    . ASN F 5 84  ? 83.398  45.322 -26.205 1.00 49.85  ? 1281 ASN D CG    1 
ATOM   8635  O OD1   . ASN F 5 84  ? 84.516  45.795 -26.404 1.00 47.48  ? 1281 ASN D OD1   1 
ATOM   8636  N ND2   . ASN F 5 84  ? 82.496  45.180 -27.171 1.00 49.42  ? 1281 ASN D ND2   1 
ATOM   8637  N N     . LYS F 5 85  ? 83.189  42.050 -22.565 1.00 48.84  ? 1282 LYS D N     1 
ATOM   8638  C CA    . LYS F 5 85  ? 83.189  41.709 -21.155 1.00 51.56  ? 1282 LYS D CA    1 
ATOM   8639  C C     . LYS F 5 85  ? 82.436  42.798 -20.392 1.00 50.55  ? 1282 LYS D C     1 
ATOM   8640  O O     . LYS F 5 85  ? 82.919  43.352 -19.412 1.00 51.04  ? 1282 LYS D O     1 
ATOM   8641  C CB    . LYS F 5 85  ? 84.621  41.593 -20.632 1.00 55.04  ? 1282 LYS D CB    1 
ATOM   8642  C CG    . LYS F 5 85  ? 85.513  40.566 -21.290 1.00 59.99  ? 1282 LYS D CG    1 
ATOM   8643  C CD    . LYS F 5 85  ? 86.865  40.552 -20.523 1.00 66.21  ? 1282 LYS D CD    1 
ATOM   8644  C CE    . LYS F 5 85  ? 88.023  39.812 -21.247 1.00 68.09  ? 1282 LYS D CE    1 
ATOM   8645  N NZ    . LYS F 5 85  ? 89.399  40.120 -20.698 1.00 73.58  ? 1282 LYS D NZ    1 
ATOM   8646  N N     . ARG F 5 86  ? 81.253  43.122 -20.866 1.00 36.99  ? 1283 ARG D N     1 
ATOM   8647  C CA    . ARG F 5 86  ? 80.434  44.140 -20.242 1.00 37.68  ? 1283 ARG D CA    1 
ATOM   8648  C C     . ARG F 5 86  ? 79.153  43.403 -19.853 1.00 36.34  ? 1283 ARG D C     1 
ATOM   8649  O O     . ARG F 5 86  ? 78.591  42.684 -20.675 1.00 35.21  ? 1283 ARG D O     1 
ATOM   8650  C CB    . ARG F 5 86  ? 80.079  45.240 -21.252 1.00 86.94  ? 1283 ARG D CB    1 
ATOM   8651  C CG    . ARG F 5 86  ? 81.228  46.047 -21.776 1.00 94.42  ? 1283 ARG D CG    1 
ATOM   8652  C CD    . ARG F 5 86  ? 81.335  47.382 -21.067 1.00 100.29 ? 1283 ARG D CD    1 
ATOM   8653  N NE    . ARG F 5 86  ? 82.438  48.185 -21.598 1.00 107.35 ? 1283 ARG D NE    1 
ATOM   8654  C CZ    . ARG F 5 86  ? 83.730  47.881 -21.464 1.00 110.87 ? 1283 ARG D CZ    1 
ATOM   8655  N NH1   . ARG F 5 86  ? 84.100  46.788 -20.805 1.00 114.36 ? 1283 ARG D NH1   1 
ATOM   8656  N NH2   . ARG F 5 86  ? 84.658  48.662 -22.005 1.00 113.71 ? 1283 ARG D NH2   1 
ATOM   8657  N N     . SER F 5 87  ? 78.673  43.590 -18.630 1.00 31.47  ? 1284 SER D N     1 
ATOM   8658  C CA    . SER F 5 87  ? 77.464  42.915 -18.218 1.00 31.33  ? 1284 SER D CA    1 
ATOM   8659  C C     . SER F 5 87  ? 76.231  43.782 -18.403 1.00 28.76  ? 1284 SER D C     1 
ATOM   8660  O O     . SER F 5 87  ? 75.105  43.383 -18.069 1.00 27.51  ? 1284 SER D O     1 
ATOM   8661  C CB    . SER F 5 87  ? 77.591  42.462 -16.761 1.00 47.66  ? 1284 SER D CB    1 
ATOM   8662  O OG    . SER F 5 87  ? 77.938  43.543 -15.928 1.00 48.32  ? 1284 SER D OG    1 
ATOM   8663  N N     . THR F 5 88  ? 76.419  44.958 -18.975 1.00 48.54  ? 1285 THR D N     1 
ATOM   8664  C CA    . THR F 5 88  ? 75.280  45.843 -19.129 1.00 47.76  ? 1285 THR D CA    1 
ATOM   8665  C C     . THR F 5 88  ? 75.067  46.379 -20.534 1.00 46.11  ? 1285 THR D C     1 
ATOM   8666  O O     . THR F 5 88  ? 75.984  46.959 -21.111 1.00 45.81  ? 1285 THR D O     1 
ATOM   8667  C CB    . THR F 5 88  ? 75.405  47.068 -18.160 1.00 60.93  ? 1285 THR D CB    1 
ATOM   8668  O OG1   . THR F 5 88  ? 75.888  46.636 -16.880 1.00 62.39  ? 1285 THR D OG1   1 
ATOM   8669  C CG2   . THR F 5 88  ? 74.051  47.742 -17.967 1.00 60.64  ? 1285 THR D CG2   1 
ATOM   8670  N N     . ILE F 5 89  ? 73.868  46.171 -21.079 1.00 31.51  ? 1286 ILE D N     1 
ATOM   8671  C CA    . ILE F 5 89  ? 73.527  46.735 -22.379 1.00 30.12  ? 1286 ILE D CA    1 
ATOM   8672  C C     . ILE F 5 89  ? 73.089  48.183 -22.066 1.00 29.83  ? 1286 ILE D C     1 
ATOM   8673  O O     . ILE F 5 89  ? 72.361  48.430 -21.102 1.00 30.82  ? 1286 ILE D O     1 
ATOM   8674  C CB    . ILE F 5 89  ? 72.343  45.980 -23.059 1.00 34.71  ? 1286 ILE D CB    1 
ATOM   8675  C CG1   . ILE F 5 89  ? 72.818  44.606 -23.521 1.00 35.99  ? 1286 ILE D CG1   1 
ATOM   8676  C CG2   . ILE F 5 89  ? 71.777  46.787 -24.256 1.00 34.77  ? 1286 ILE D CG2   1 
ATOM   8677  C CD1   . ILE F 5 89  ? 71.668  43.671 -23.929 1.00 35.35  ? 1286 ILE D CD1   1 
ATOM   8678  N N     . THR F 5 90  ? 73.523  49.128 -22.885 1.00 33.90  ? 1287 THR D N     1 
ATOM   8679  C CA    . THR F 5 90  ? 73.208  50.524 -22.685 1.00 35.57  ? 1287 THR D CA    1 
ATOM   8680  C C     . THR F 5 90  ? 72.901  51.236 -24.001 1.00 36.29  ? 1287 THR D C     1 
ATOM   8681  O O     . THR F 5 90  ? 72.897  50.618 -25.066 1.00 36.70  ? 1287 THR D O     1 
ATOM   8682  C CB    . THR F 5 90  ? 74.400  51.231 -22.073 1.00 36.47  ? 1287 THR D CB    1 
ATOM   8683  O OG1   . THR F 5 90  ? 75.535  51.026 -22.918 1.00 31.57  ? 1287 THR D OG1   1 
ATOM   8684  C CG2   . THR F 5 90  ? 74.696  50.693 -20.703 1.00 38.29  ? 1287 THR D CG2   1 
ATOM   8685  N N     . SER F 5 91  ? 72.664  52.545 -23.925 1.00 40.46  ? 1288 SER D N     1 
ATOM   8686  C CA    . SER F 5 91  ? 72.391  53.320 -25.120 1.00 40.51  ? 1288 SER D CA    1 
ATOM   8687  C C     . SER F 5 91  ? 73.588  53.229 -26.067 1.00 41.34  ? 1288 SER D C     1 
ATOM   8688  O O     . SER F 5 91  ? 73.452  53.383 -27.283 1.00 43.43  ? 1288 SER D O     1 
ATOM   8689  C CB    . SER F 5 91  ? 72.055  54.788 -24.768 1.00 34.08  ? 1288 SER D CB    1 
ATOM   8690  O OG    . SER F 5 91  ? 72.868  55.301 -23.735 1.00 35.77  ? 1288 SER D OG    1 
ATOM   8691  N N     . ARG F 5 92  ? 74.759  52.930 -25.532 1.00 43.39  ? 1289 ARG D N     1 
ATOM   8692  C CA    . ARG F 5 92  ? 75.918  52.841 -26.403 1.00 43.72  ? 1289 ARG D CA    1 
ATOM   8693  C C     . ARG F 5 92  ? 76.011  51.512 -27.202 1.00 44.01  ? 1289 ARG D C     1 
ATOM   8694  O O     . ARG F 5 92  ? 76.532  51.482 -28.320 1.00 39.75  ? 1289 ARG D O     1 
ATOM   8695  C CB    . ARG F 5 92  ? 77.186  53.103 -25.595 1.00 39.97  ? 1289 ARG D CB    1 
ATOM   8696  C CG    . ARG F 5 92  ? 78.402  53.322 -26.445 1.00 45.35  ? 1289 ARG D CG    1 
ATOM   8697  C CD    . ARG F 5 92  ? 79.510  54.068 -25.716 1.00 51.65  ? 1289 ARG D CD    1 
ATOM   8698  N NE    . ARG F 5 92  ? 80.623  54.356 -26.620 1.00 51.34  ? 1289 ARG D NE    1 
ATOM   8699  C CZ    . ARG F 5 92  ? 81.446  53.424 -27.085 1.00 51.13  ? 1289 ARG D CZ    1 
ATOM   8700  N NH1   . ARG F 5 92  ? 81.278  52.161 -26.724 1.00 48.06  ? 1289 ARG D NH1   1 
ATOM   8701  N NH2   . ARG F 5 92  ? 82.428  53.749 -27.907 1.00 52.13  ? 1289 ARG D NH2   1 
ATOM   8702  N N     . GLU F 5 93  ? 75.502  50.416 -26.654 1.00 41.19  ? 1290 GLU D N     1 
ATOM   8703  C CA    . GLU F 5 93  ? 75.546  49.171 -27.398 1.00 42.24  ? 1290 GLU D CA    1 
ATOM   8704  C C     . GLU F 5 93  ? 74.465  49.301 -28.451 1.00 40.42  ? 1290 GLU D C     1 
ATOM   8705  O O     . GLU F 5 93  ? 74.668  48.966 -29.622 1.00 40.17  ? 1290 GLU D O     1 
ATOM   8706  C CB    . GLU F 5 93  ? 75.211  47.955 -26.528 1.00 55.10  ? 1290 GLU D CB    1 
ATOM   8707  C CG    . GLU F 5 93  ? 75.433  48.109 -25.053 1.00 64.11  ? 1290 GLU D CG    1 
ATOM   8708  C CD    . GLU F 5 93  ? 76.813  48.564 -24.740 1.00 62.34  ? 1290 GLU D CD    1 
ATOM   8709  O OE1   . GLU F 5 93  ? 77.740  47.733 -24.735 1.00 65.38  ? 1290 GLU D OE1   1 
ATOM   8710  O OE2   . GLU F 5 93  ? 76.975  49.775 -24.515 1.00 65.73  ? 1290 GLU D OE2   1 
ATOM   8711  N N     . ILE F 5 94  ? 73.310  49.800 -28.025 1.00 26.37  ? 1291 ILE D N     1 
ATOM   8712  C CA    . ILE F 5 94  ? 72.198  49.941 -28.939 1.00 23.62  ? 1291 ILE D CA    1 
ATOM   8713  C C     . ILE F 5 94  ? 72.612  50.753 -30.147 1.00 24.86  ? 1291 ILE D C     1 
ATOM   8714  O O     . ILE F 5 94  ? 72.249  50.406 -31.264 1.00 24.92  ? 1291 ILE D O     1 
ATOM   8715  C CB    . ILE F 5 94  ? 70.968  50.644 -28.301 1.00 31.04  ? 1291 ILE D CB    1 
ATOM   8716  C CG1   . ILE F 5 94  ? 70.611  50.009 -26.958 1.00 32.95  ? 1291 ILE D CG1   1 
ATOM   8717  C CG2   . ILE F 5 94  ? 69.759  50.557 -29.284 1.00 25.96  ? 1291 ILE D CG2   1 
ATOM   8718  C CD1   . ILE F 5 94  ? 69.929  48.696 -27.076 1.00 33.06  ? 1291 ILE D CD1   1 
ATOM   8719  N N     . GLN F 5 95  ? 73.362  51.837 -29.931 1.00 40.11  ? 1292 GLN D N     1 
ATOM   8720  C CA    . GLN F 5 95  ? 73.792  52.667 -31.050 1.00 39.90  ? 1292 GLN D CA    1 
ATOM   8721  C C     . GLN F 5 95  ? 74.659  51.913 -32.056 1.00 36.80  ? 1292 GLN D C     1 
ATOM   8722  O O     . GLN F 5 95  ? 74.474  52.044 -33.254 1.00 38.09  ? 1292 GLN D O     1 
ATOM   8723  C CB    . GLN F 5 95  ? 74.557  53.904 -30.564 1.00 51.82  ? 1292 GLN D CB    1 
ATOM   8724  C CG    . GLN F 5 95  ? 74.435  55.093 -31.550 1.00 52.50  ? 1292 GLN D CG    1 
ATOM   8725  C CD    . GLN F 5 95  ? 75.184  56.337 -31.130 1.00 53.08  ? 1292 GLN D CD    1 
ATOM   8726  O OE1   . GLN F 5 95  ? 76.393  56.395 -31.247 1.00 55.93  ? 1292 GLN D OE1   1 
ATOM   8727  N NE2   . GLN F 5 95  ? 74.466  57.337 -30.639 1.00 46.14  ? 1292 GLN D NE2   1 
ATOM   8728  N N     . THR F 5 96  ? 75.609  51.130 -31.557 1.00 39.51  ? 1293 THR D N     1 
ATOM   8729  C CA    . THR F 5 96  ? 76.500  50.376 -32.413 1.00 41.44  ? 1293 THR D CA    1 
ATOM   8730  C C     . THR F 5 96  ? 75.712  49.316 -33.157 1.00 39.06  ? 1293 THR D C     1 
ATOM   8731  O O     . THR F 5 96  ? 75.871  49.107 -34.368 1.00 39.66  ? 1293 THR D O     1 
ATOM   8732  C CB    . THR F 5 96  ? 77.620  49.706 -31.592 1.00 40.62  ? 1293 THR D CB    1 
ATOM   8733  O OG1   . THR F 5 96  ? 78.532  50.704 -31.130 1.00 42.42  ? 1293 THR D OG1   1 
ATOM   8734  C CG2   . THR F 5 96  ? 78.408  48.725 -32.444 1.00 39.20  ? 1293 THR D CG2   1 
ATOM   8735  N N     . ALA F 5 97  ? 74.844  48.645 -32.426 1.00 32.77  ? 1294 ALA D N     1 
ATOM   8736  C CA    . ALA F 5 97  ? 74.036  47.601 -33.035 1.00 33.40  ? 1294 ALA D CA    1 
ATOM   8737  C C     . ALA F 5 97  ? 73.332  48.167 -34.220 1.00 34.62  ? 1294 ALA D C     1 
ATOM   8738  O O     . ALA F 5 97  ? 73.249  47.525 -35.259 1.00 35.57  ? 1294 ALA D O     1 
ATOM   8739  C CB    . ALA F 5 97  ? 73.004  47.083 -32.041 1.00 38.02  ? 1294 ALA D CB    1 
ATOM   8740  N N     . VAL F 5 98  ? 72.811  49.376 -34.039 1.00 31.23  ? 1295 VAL D N     1 
ATOM   8741  C CA    . VAL F 5 98  ? 72.068  50.066 -35.069 1.00 30.75  ? 1295 VAL D CA    1 
ATOM   8742  C C     . VAL F 5 98  ? 72.924  50.423 -36.240 1.00 29.50  ? 1295 VAL D C     1 
ATOM   8743  O O     . VAL F 5 98  ? 72.448  50.479 -37.352 1.00 28.97  ? 1295 VAL D O     1 
ATOM   8744  C CB    . VAL F 5 98  ? 71.396  51.326 -34.526 1.00 42.18  ? 1295 VAL D CB    1 
ATOM   8745  C CG1   . VAL F 5 98  ? 70.682  52.028 -35.636 1.00 41.42  ? 1295 VAL D CG1   1 
ATOM   8746  C CG2   . VAL F 5 98  ? 70.404  50.954 -33.435 1.00 39.70  ? 1295 VAL D CG2   1 
ATOM   8747  N N     . ARG F 5 99  ? 74.200  50.653 -35.996 1.00 47.63  ? 1296 ARG D N     1 
ATOM   8748  C CA    . ARG F 5 99  ? 75.110  50.985 -37.079 1.00 49.25  ? 1296 ARG D CA    1 
ATOM   8749  C C     . ARG F 5 99  ? 75.512  49.733 -37.839 1.00 49.96  ? 1296 ARG D C     1 
ATOM   8750  O O     . ARG F 5 99  ? 75.618  49.753 -39.067 1.00 49.41  ? 1296 ARG D O     1 
ATOM   8751  C CB    . ARG F 5 99  ? 76.329  51.695 -36.529 1.00 37.48  ? 1296 ARG D CB    1 
ATOM   8752  C CG    . ARG F 5 99  ? 76.008  53.075 -36.156 1.00 44.70  ? 1296 ARG D CG    1 
ATOM   8753  C CD    . ARG F 5 99  ? 77.246  53.849 -35.959 1.00 51.15  ? 1296 ARG D CD    1 
ATOM   8754  N NE    . ARG F 5 99  ? 76.952  55.256 -36.131 1.00 55.10  ? 1296 ARG D NE    1 
ATOM   8755  C CZ    . ARG F 5 99  ? 77.357  56.189 -35.284 1.00 57.02  ? 1296 ARG D CZ    1 
ATOM   8756  N NH1   . ARG F 5 99  ? 78.084  55.815 -34.220 1.00 54.78  ? 1296 ARG D NH1   1 
ATOM   8757  N NH2   . ARG F 5 99  ? 77.009  57.471 -35.483 1.00 59.21  ? 1296 ARG D NH2   1 
ATOM   8758  N N     . LEU F 5 100 ? 75.720  48.643 -37.107 1.00 37.90  ? 1297 LEU D N     1 
ATOM   8759  C CA    . LEU F 5 100 ? 76.075  47.374 -37.723 1.00 39.90  ? 1297 LEU D CA    1 
ATOM   8760  C C     . LEU F 5 100 ? 74.934  46.763 -38.547 1.00 40.86  ? 1297 LEU D C     1 
ATOM   8761  O O     . LEU F 5 100 ? 75.173  46.180 -39.589 1.00 40.38  ? 1297 LEU D O     1 
ATOM   8762  C CB    . LEU F 5 100 ? 76.510  46.358 -36.653 1.00 29.16  ? 1297 LEU D CB    1 
ATOM   8763  C CG    . LEU F 5 100 ? 77.866  46.618 -35.990 1.00 30.99  ? 1297 LEU D CG    1 
ATOM   8764  C CD1   . LEU F 5 100 ? 78.089  45.713 -34.834 1.00 29.17  ? 1297 LEU D CD1   1 
ATOM   8765  C CD2   . LEU F 5 100 ? 78.958  46.443 -36.987 1.00 30.73  ? 1297 LEU D CD2   1 
ATOM   8766  N N     . LEU F 5 101 ? 73.701  46.935 -38.093 1.00 33.01  ? 1298 LEU D N     1 
ATOM   8767  C CA    . LEU F 5 101 ? 72.538  46.345 -38.730 1.00 32.83  ? 1298 LEU D CA    1 
ATOM   8768  C C     . LEU F 5 101 ? 71.779  47.092 -39.819 1.00 34.59  ? 1298 LEU D C     1 
ATOM   8769  O O     . LEU F 5 101 ? 71.224  46.471 -40.713 1.00 36.40  ? 1298 LEU D O     1 
ATOM   8770  C CB    . LEU F 5 101 ? 71.547  45.936 -37.642 1.00 56.31  ? 1298 LEU D CB    1 
ATOM   8771  C CG    . LEU F 5 101 ? 70.288  45.351 -38.271 1.00 61.33  ? 1298 LEU D CG    1 
ATOM   8772  C CD1   . LEU F 5 101 ? 70.571  43.924 -38.673 1.00 63.19  ? 1298 LEU D CD1   1 
ATOM   8773  C CD2   . LEU F 5 101 ? 69.120  45.415 -37.324 1.00 59.06  ? 1298 LEU D CD2   1 
ATOM   8774  N N     . LEU F 5 102 ? 71.717  48.409 -39.749 1.00 30.68  ? 1299 LEU D N     1 
ATOM   8775  C CA    . LEU F 5 102 ? 70.978  49.169 -40.749 1.00 32.08  ? 1299 LEU D CA    1 
ATOM   8776  C C     . LEU F 5 102 ? 71.803  49.725 -41.880 1.00 32.14  ? 1299 LEU D C     1 
ATOM   8777  O O     . LEU F 5 102 ? 72.916  50.167 -41.671 1.00 34.64  ? 1299 LEU D O     1 
ATOM   8778  C CB    . LEU F 5 102 ? 70.262  50.334 -40.098 1.00 21.39  ? 1299 LEU D CB    1 
ATOM   8779  C CG    . LEU F 5 102 ? 69.434  50.048 -38.861 1.00 24.70  ? 1299 LEU D CG    1 
ATOM   8780  C CD1   . LEU F 5 102 ? 68.534  51.225 -38.637 1.00 20.80  ? 1299 LEU D CD1   1 
ATOM   8781  C CD2   . LEU F 5 102 ? 68.632  48.784 -39.042 1.00 20.08  ? 1299 LEU D CD2   1 
ATOM   8782  N N     . PRO F 5 103 ? 71.248  49.740 -43.102 1.00 46.10  ? 1300 PRO D N     1 
ATOM   8783  C CA    . PRO F 5 103 ? 71.906  50.249 -44.310 1.00 48.77  ? 1300 PRO D CA    1 
ATOM   8784  C C     . PRO F 5 103 ? 72.278  51.732 -44.204 1.00 47.27  ? 1300 PRO D C     1 
ATOM   8785  O O     . PRO F 5 103 ? 72.006  52.374 -43.202 1.00 50.95  ? 1300 PRO D O     1 
ATOM   8786  C CB    . PRO F 5 103 ? 70.871  49.995 -45.391 1.00 48.29  ? 1300 PRO D CB    1 
ATOM   8787  C CG    . PRO F 5 103 ? 70.211  48.753 -44.926 1.00 48.88  ? 1300 PRO D CG    1 
ATOM   8788  C CD    . PRO F 5 103 ? 70.005  49.038 -43.461 1.00 46.38  ? 1300 PRO D CD    1 
ATOM   8789  N N     . GLY F 5 104 ? 72.894  52.252 -45.260 1.00 32.69  ? 1301 GLY D N     1 
ATOM   8790  C CA    . GLY F 5 104 ? 73.332  53.633 -45.310 1.00 31.80  ? 1301 GLY D CA    1 
ATOM   8791  C C     . GLY F 5 104 ? 72.592  54.769 -44.628 1.00 32.84  ? 1301 GLY D C     1 
ATOM   8792  O O     . GLY F 5 104 ? 72.750  55.016 -43.438 1.00 34.43  ? 1301 GLY D O     1 
ATOM   8793  N N     . GLU F 5 105 ? 71.791  55.487 -45.393 1.00 35.14  ? 1302 GLU D N     1 
ATOM   8794  C CA    . GLU F 5 105 ? 71.084  56.634 -44.865 1.00 35.09  ? 1302 GLU D CA    1 
ATOM   8795  C C     . GLU F 5 105 ? 70.133  56.345 -43.706 1.00 37.23  ? 1302 GLU D C     1 
ATOM   8796  O O     . GLU F 5 105 ? 69.858  57.233 -42.895 1.00 35.92  ? 1302 GLU D O     1 
ATOM   8797  C CB    . GLU F 5 105 ? 70.342  57.334 -46.002 1.00 59.86  ? 1302 GLU D CB    1 
ATOM   8798  C CG    . GLU F 5 105 ? 70.079  58.815 -45.753 1.00 69.43  ? 1302 GLU D CG    1 
ATOM   8799  C CD    . GLU F 5 105 ? 71.313  59.591 -45.232 1.00 71.31  ? 1302 GLU D CD    1 
ATOM   8800  O OE1   . GLU F 5 105 ? 72.453  59.369 -45.749 1.00 72.06  ? 1302 GLU D OE1   1 
ATOM   8801  O OE2   . GLU F 5 105 ? 71.122  60.443 -44.310 1.00 76.87  ? 1302 GLU D OE2   1 
ATOM   8802  N N     . LEU F 5 106 ? 69.619  55.115 -43.619 1.00 45.53  ? 1303 LEU D N     1 
ATOM   8803  C CA    . LEU F 5 106 ? 68.703  54.773 -42.536 1.00 42.15  ? 1303 LEU D CA    1 
ATOM   8804  C C     . LEU F 5 106 ? 69.416  54.825 -41.202 1.00 40.64  ? 1303 LEU D C     1 
ATOM   8805  O O     . LEU F 5 106 ? 68.913  55.392 -40.246 1.00 40.84  ? 1303 LEU D O     1 
ATOM   8806  C CB    . LEU F 5 106 ? 68.108  53.379 -42.717 1.00 10.27  ? 1303 LEU D CB    1 
ATOM   8807  C CG    . LEU F 5 106 ? 66.847  53.116 -43.572 1.00 10.61  ? 1303 LEU D CG    1 
ATOM   8808  C CD1   . LEU F 5 106 ? 66.358  51.635 -43.485 1.00 6.57   ? 1303 LEU D CD1   1 
ATOM   8809  C CD2   . LEU F 5 106 ? 65.796  54.059 -43.116 1.00 7.84   ? 1303 LEU D CD2   1 
ATOM   8810  N N     . ALA F 5 107 ? 70.609  54.251 -41.145 1.00 33.71  ? 1304 ALA D N     1 
ATOM   8811  C CA    . ALA F 5 107 ? 71.384  54.209 -39.916 1.00 34.94  ? 1304 ALA D CA    1 
ATOM   8812  C C     . ALA F 5 107 ? 71.728  55.597 -39.411 1.00 38.76  ? 1304 ALA D C     1 
ATOM   8813  O O     . ALA F 5 107 ? 71.573  55.912 -38.229 1.00 37.94  ? 1304 ALA D O     1 
ATOM   8814  C CB    . ALA F 5 107 ? 72.606  53.414 -40.149 1.00 11.04  ? 1304 ALA D CB    1 
ATOM   8815  N N     . LYS F 5 108 ? 72.194  56.440 -40.308 1.00 26.70  ? 1305 LYS D N     1 
ATOM   8816  C CA    . LYS F 5 108 ? 72.496  57.800 -39.918 1.00 28.82  ? 1305 LYS D CA    1 
ATOM   8817  C C     . LYS F 5 108 ? 71.241  58.384 -39.265 1.00 29.99  ? 1305 LYS D C     1 
ATOM   8818  O O     . LYS F 5 108 ? 71.240  58.706 -38.092 1.00 28.18  ? 1305 LYS D O     1 
ATOM   8819  C CB    . LYS F 5 108 ? 72.906  58.610 -41.136 1.00 62.03  ? 1305 LYS D CB    1 
ATOM   8820  C CG    . LYS F 5 108 ? 74.162  59.382 -40.909 1.00 72.02  ? 1305 LYS D CG    1 
ATOM   8821  C CD    . LYS F 5 108 ? 74.695  59.965 -42.200 1.00 76.28  ? 1305 LYS D CD    1 
ATOM   8822  C CE    . LYS F 5 108 ? 75.317  58.898 -43.116 1.00 79.80  ? 1305 LYS D CE    1 
ATOM   8823  N NZ    . LYS F 5 108 ? 76.097  59.530 -44.244 1.00 84.26  ? 1305 LYS D NZ    1 
ATOM   8824  N N     . HIS F 5 109 ? 70.149  58.486 -40.001 1.00 32.95  ? 1306 HIS D N     1 
ATOM   8825  C CA    . HIS F 5 109 ? 68.942  59.040 -39.409 1.00 34.67  ? 1306 HIS D CA    1 
ATOM   8826  C C     . HIS F 5 109 ? 68.499  58.324 -38.123 1.00 33.11  ? 1306 HIS D C     1 
ATOM   8827  O O     . HIS F 5 109 ? 68.096  58.978 -37.178 1.00 31.40  ? 1306 HIS D O     1 
ATOM   8828  C CB    . HIS F 5 109 ? 67.787  59.069 -40.433 1.00 56.62  ? 1306 HIS D CB    1 
ATOM   8829  C CG    . HIS F 5 109 ? 67.967  60.079 -41.529 1.00 63.29  ? 1306 HIS D CG    1 
ATOM   8830  N ND1   . HIS F 5 109 ? 67.164  60.110 -42.652 1.00 67.52  ? 1306 HIS D ND1   1 
ATOM   8831  C CD2   . HIS F 5 109 ? 68.890  61.055 -41.703 1.00 65.48  ? 1306 HIS D CD2   1 
ATOM   8832  C CE1   . HIS F 5 109 ? 67.588  61.053 -43.473 1.00 67.57  ? 1306 HIS D CE1   1 
ATOM   8833  N NE2   . HIS F 5 109 ? 68.636  61.641 -42.922 1.00 67.40  ? 1306 HIS D NE2   1 
ATOM   8834  N N     . ALA F 5 110 ? 68.562  57.001 -38.071 1.00 35.76  ? 1307 ALA D N     1 
ATOM   8835  C CA    . ALA F 5 110 ? 68.156  56.297 -36.847 1.00 33.54  ? 1307 ALA D CA    1 
ATOM   8836  C C     . ALA F 5 110 ? 69.029  56.672 -35.654 1.00 34.42  ? 1307 ALA D C     1 
ATOM   8837  O O     . ALA F 5 110 ? 68.540  56.702 -34.534 1.00 33.90  ? 1307 ALA D O     1 
ATOM   8838  C CB    . ALA F 5 110 ? 68.198  54.774 -37.039 1.00 22.92  ? 1307 ALA D CB    1 
ATOM   8839  N N     . VAL F 5 111 ? 70.318  56.934 -35.882 1.00 24.17  ? 1308 VAL D N     1 
ATOM   8840  C CA    . VAL F 5 111 ? 71.203  57.316 -34.774 1.00 27.70  ? 1308 VAL D CA    1 
ATOM   8841  C C     . VAL F 5 111 ? 70.754  58.649 -34.178 1.00 29.16  ? 1308 VAL D C     1 
ATOM   8842  O O     . VAL F 5 111 ? 70.744  58.824 -32.954 1.00 25.42  ? 1308 VAL D O     1 
ATOM   8843  C CB    . VAL F 5 111 ? 72.686  57.455 -35.213 1.00 30.63  ? 1308 VAL D CB    1 
ATOM   8844  C CG1   . VAL F 5 111 ? 73.561  57.676 -34.001 1.00 31.39  ? 1308 VAL D CG1   1 
ATOM   8845  C CG2   . VAL F 5 111 ? 73.130  56.215 -35.893 1.00 30.28  ? 1308 VAL D CG2   1 
ATOM   8846  N N     . SER F 5 112 ? 70.396  59.580 -35.055 1.00 33.80  ? 1309 SER D N     1 
ATOM   8847  C CA    . SER F 5 112 ? 69.926  60.869 -34.626 1.00 35.69  ? 1309 SER D CA    1 
ATOM   8848  C C     . SER F 5 112 ? 68.722  60.656 -33.736 1.00 35.62  ? 1309 SER D C     1 
ATOM   8849  O O     . SER F 5 112 ? 68.717  60.993 -32.564 1.00 35.16  ? 1309 SER D O     1 
ATOM   8850  C CB    . SER F 5 112 ? 69.486  61.692 -35.815 1.00 49.31  ? 1309 SER D CB    1 
ATOM   8851  O OG    . SER F 5 112 ? 70.575  62.312 -36.426 1.00 57.77  ? 1309 SER D OG    1 
ATOM   8852  N N     . GLU F 5 113 ? 67.679  60.100 -34.316 1.00 48.70  ? 1310 GLU D N     1 
ATOM   8853  C CA    . GLU F 5 113 ? 66.484  59.869 -33.570 1.00 50.26  ? 1310 GLU D CA    1 
ATOM   8854  C C     . GLU F 5 113 ? 66.790  59.236 -32.233 1.00 49.25  ? 1310 GLU D C     1 
ATOM   8855  O O     . GLU F 5 113 ? 66.262  59.653 -31.213 1.00 47.80  ? 1310 GLU D O     1 
ATOM   8856  C CB    . GLU F 5 113 ? 65.535  59.015 -34.393 1.00 81.71  ? 1310 GLU D CB    1 
ATOM   8857  C CG    . GLU F 5 113 ? 64.892  59.802 -35.526 1.00 86.15  ? 1310 GLU D CG    1 
ATOM   8858  C CD    . GLU F 5 113 ? 63.783  60.714 -35.040 1.00 92.64  ? 1310 GLU D CD    1 
ATOM   8859  O OE1   . GLU F 5 113 ? 64.046  61.582 -34.178 1.00 92.03  ? 1310 GLU D OE1   1 
ATOM   8860  O OE2   . GLU F 5 113 ? 62.641  60.557 -35.519 1.00 94.97  ? 1310 GLU D OE2   1 
ATOM   8861  N N     . GLY F 5 114 ? 67.661  58.249 -32.211 1.00 34.56  ? 1311 GLY D N     1 
ATOM   8862  C CA    . GLY F 5 114 ? 67.955  57.626 -30.940 1.00 34.06  ? 1311 GLY D CA    1 
ATOM   8863  C C     . GLY F 5 114 ? 68.620  58.596 -29.989 1.00 32.81  ? 1311 GLY D C     1 
ATOM   8864  O O     . GLY F 5 114 ? 68.228  58.756 -28.836 1.00 32.60  ? 1311 GLY D O     1 
ATOM   8865  N N     . THR F 5 115 ? 69.650  59.264 -30.469 1.00 38.18  ? 1312 THR D N     1 
ATOM   8866  C CA    . THR F 5 115 ? 70.318  60.183 -29.591 1.00 42.43  ? 1312 THR D CA    1 
ATOM   8867  C C     . THR F 5 115 ? 69.436  61.281 -29.075 1.00 43.35  ? 1312 THR D C     1 
ATOM   8868  O O     . THR F 5 115 ? 69.428  61.539 -27.891 1.00 44.29  ? 1312 THR D O     1 
ATOM   8869  C CB    . THR F 5 115 ? 71.481  60.835 -30.237 1.00 30.00  ? 1312 THR D CB    1 
ATOM   8870  O OG1   . THR F 5 115 ? 72.372  59.832 -30.721 1.00 31.08  ? 1312 THR D OG1   1 
ATOM   8871  C CG2   . THR F 5 115 ? 72.179  61.710 -29.191 1.00 29.44  ? 1312 THR D CG2   1 
ATOM   8872  N N     . LYS F 5 116 ? 68.739  61.948 -29.983 1.00 30.04  ? 1313 LYS D N     1 
ATOM   8873  C CA    . LYS F 5 116 ? 67.827  63.026 -29.644 1.00 33.50  ? 1313 LYS D CA    1 
ATOM   8874  C C     . LYS F 5 116 ? 66.935  62.576 -28.474 1.00 31.47  ? 1313 LYS D C     1 
ATOM   8875  O O     . LYS F 5 116 ? 66.812  63.258 -27.452 1.00 29.75  ? 1313 LYS D O     1 
ATOM   8876  C CB    . LYS F 5 116 ? 66.946  63.361 -30.858 1.00 36.06  ? 1313 LYS D CB    1 
ATOM   8877  C CG    . LYS F 5 116 ? 66.548  64.809 -30.992 1.00 43.43  ? 1313 LYS D CG    1 
ATOM   8878  C CD    . LYS F 5 116 ? 65.264  64.999 -31.800 1.00 51.14  ? 1313 LYS D CD    1 
ATOM   8879  C CE    . LYS F 5 116 ? 64.976  66.507 -32.071 1.00 56.28  ? 1313 LYS D CE    1 
ATOM   8880  N NZ    . LYS F 5 116 ? 64.872  67.419 -30.862 1.00 60.67  ? 1313 LYS D NZ    1 
ATOM   8881  N N     . ALA F 5 117 ? 66.319  61.415 -28.623 1.00 29.91  ? 1314 ALA D N     1 
ATOM   8882  C CA    . ALA F 5 117 ? 65.453  60.906 -27.592 1.00 29.16  ? 1314 ALA D CA    1 
ATOM   8883  C C     . ALA F 5 117 ? 66.198  60.633 -26.297 1.00 31.53  ? 1314 ALA D C     1 
ATOM   8884  O O     . ALA F 5 117 ? 65.702  60.899 -25.228 1.00 30.93  ? 1314 ALA D O     1 
ATOM   8885  C CB    . ALA F 5 117 ? 64.762  59.641 -28.078 1.00 48.88  ? 1314 ALA D CB    1 
ATOM   8886  N N     . VAL F 5 118 ? 67.390  60.095 -26.361 1.00 47.96  ? 1315 VAL D N     1 
ATOM   8887  C CA    . VAL F 5 118 ? 68.054  59.826 -25.102 1.00 47.90  ? 1315 VAL D CA    1 
ATOM   8888  C C     . VAL F 5 118 ? 68.377  61.095 -24.363 1.00 48.06  ? 1315 VAL D C     1 
ATOM   8889  O O     . VAL F 5 118 ? 68.163  61.167 -23.154 1.00 47.49  ? 1315 VAL D O     1 
ATOM   8890  C CB    . VAL F 5 118 ? 69.331  59.047 -25.299 1.00 48.45  ? 1315 VAL D CB    1 
ATOM   8891  C CG1   . VAL F 5 118 ? 70.067  58.917 -23.949 1.00 44.33  ? 1315 VAL D CG1   1 
ATOM   8892  C CG2   . VAL F 5 118 ? 68.987  57.699 -25.941 1.00 45.87  ? 1315 VAL D CG2   1 
ATOM   8893  N N     . THR F 5 119 ? 68.903  62.072 -25.103 1.00 30.74  ? 1316 THR D N     1 
ATOM   8894  C CA    . THR F 5 119 ? 69.261  63.384 -24.595 1.00 33.86  ? 1316 THR D CA    1 
ATOM   8895  C C     . THR F 5 119 ? 68.037  64.051 -23.941 1.00 34.94  ? 1316 THR D C     1 
ATOM   8896  O O     . THR F 5 119 ? 68.122  64.553 -22.820 1.00 37.32  ? 1316 THR D O     1 
ATOM   8897  C CB    . THR F 5 119 ? 69.790  64.259 -25.736 1.00 34.73  ? 1316 THR D CB    1 
ATOM   8898  O OG1   . THR F 5 119 ? 71.185  64.045 -25.891 1.00 36.08  ? 1316 THR D OG1   1 
ATOM   8899  C CG2   . THR F 5 119 ? 69.607  65.676 -25.458 1.00 36.92  ? 1316 THR D CG2   1 
ATOM   8900  N N     . LYS F 5 120 ? 66.903  64.048 -24.637 1.00 44.09  ? 1317 LYS D N     1 
ATOM   8901  C CA    . LYS F 5 120 ? 65.697  64.636 -24.097 1.00 44.66  ? 1317 LYS D CA    1 
ATOM   8902  C C     . LYS F 5 120 ? 65.311  63.966 -22.802 1.00 45.54  ? 1317 LYS D C     1 
ATOM   8903  O O     . LYS F 5 120 ? 65.281  64.613 -21.771 1.00 46.89  ? 1317 LYS D O     1 
ATOM   8904  C CB    . LYS F 5 120 ? 64.549  64.530 -25.093 1.00 32.98  ? 1317 LYS D CB    1 
ATOM   8905  C CG    . LYS F 5 120 ? 63.209  64.839 -24.488 1.00 36.29  ? 1317 LYS D CG    1 
ATOM   8906  C CD    . LYS F 5 120 ? 62.181  65.309 -25.485 1.00 39.43  ? 1317 LYS D CD    1 
ATOM   8907  C CE    . LYS F 5 120 ? 60.869  65.539 -24.732 1.00 42.76  ? 1317 LYS D CE    1 
ATOM   8908  N NZ    . LYS F 5 120 ? 59.796  66.160 -25.560 1.00 49.99  ? 1317 LYS D NZ    1 
ATOM   8909  N N     . TYR F 5 121 ? 64.996  62.679 -22.848 1.00 57.42  ? 1318 TYR D N     1 
ATOM   8910  C CA    . TYR F 5 121 ? 64.620  61.934 -21.639 1.00 57.94  ? 1318 TYR D CA    1 
ATOM   8911  C C     . TYR F 5 121 ? 65.641  62.159 -20.495 1.00 60.91  ? 1318 TYR D C     1 
ATOM   8912  O O     . TYR F 5 121 ? 65.296  62.132 -19.315 1.00 58.33  ? 1318 TYR D O     1 
ATOM   8913  C CB    . TYR F 5 121 ? 64.519  60.444 -21.994 1.00 47.07  ? 1318 TYR D CB    1 
ATOM   8914  C CG    . TYR F 5 121 ? 64.366  59.492 -20.837 1.00 45.53  ? 1318 TYR D CG    1 
ATOM   8915  C CD1   . TYR F 5 121 ? 63.127  58.988 -20.490 1.00 43.74  ? 1318 TYR D CD1   1 
ATOM   8916  C CD2   . TYR F 5 121 ? 65.474  59.058 -20.124 1.00 44.20  ? 1318 TYR D CD2   1 
ATOM   8917  C CE1   . TYR F 5 121 ? 62.986  58.059 -19.452 1.00 46.57  ? 1318 TYR D CE1   1 
ATOM   8918  C CE2   . TYR F 5 121 ? 65.358  58.134 -19.087 1.00 44.92  ? 1318 TYR D CE2   1 
ATOM   8919  C CZ    . TYR F 5 121 ? 64.113  57.633 -18.755 1.00 46.20  ? 1318 TYR D CZ    1 
ATOM   8920  O OH    . TYR F 5 121 ? 64.003  56.687 -17.752 1.00 52.48  ? 1318 TYR D OH    1 
ATOM   8921  N N     . THR F 5 122 ? 66.895  62.390 -20.865 1.00 52.70  ? 1319 THR D N     1 
ATOM   8922  C CA    . THR F 5 122 ? 67.972  62.615 -19.909 1.00 58.26  ? 1319 THR D CA    1 
ATOM   8923  C C     . THR F 5 122 ? 67.712  63.849 -19.032 1.00 61.24  ? 1319 THR D C     1 
ATOM   8924  O O     . THR F 5 122 ? 67.860  63.798 -17.815 1.00 62.39  ? 1319 THR D O     1 
ATOM   8925  C CB    . THR F 5 122 ? 69.346  62.762 -20.683 1.00 54.67  ? 1319 THR D CB    1 
ATOM   8926  O OG1   . THR F 5 122 ? 70.322  61.912 -20.078 1.00 55.75  ? 1319 THR D OG1   1 
ATOM   8927  C CG2   . THR F 5 122 ? 69.872  64.216 -20.687 1.00 56.52  ? 1319 THR D CG2   1 
ATOM   8928  N N     . SER F 5 123 ? 67.296  64.940 -19.668 1.00 68.89  ? 1320 SER D N     1 
ATOM   8929  C CA    . SER F 5 123 ? 67.041  66.215 -19.008 1.00 72.30  ? 1320 SER D CA    1 
ATOM   8930  C C     . SER F 5 123 ? 65.605  66.419 -18.595 1.00 75.11  ? 1320 SER D C     1 
ATOM   8931  O O     . SER F 5 123 ? 65.165  67.562 -18.494 1.00 75.67  ? 1320 SER D O     1 
ATOM   8932  C CB    . SER F 5 123 ? 67.393  67.364 -19.953 1.00 53.32  ? 1320 SER D CB    1 
ATOM   8933  O OG    . SER F 5 123 ? 66.350  67.562 -20.893 1.00 51.80  ? 1320 SER D OG    1 
ATOM   8934  N N     . ALA F 5 124 ? 64.872  65.343 -18.355 1.00 92.92  ? 1321 ALA D N     1 
ATOM   8935  C CA    . ALA F 5 124 ? 63.472  65.503 -18.009 1.00 96.89  ? 1321 ALA D CA    1 
ATOM   8936  C C     . ALA F 5 124 ? 63.028  64.855 -16.703 1.00 101.32 ? 1321 ALA D C     1 
ATOM   8937  O O     . ALA F 5 124 ? 62.169  63.965 -16.706 1.00 103.50 ? 1321 ALA D O     1 
ATOM   8938  C CB    . ALA F 5 124 ? 62.603  65.008 -19.173 1.00 70.50  ? 1321 ALA D CB    1 
ATOM   8939  N N     . LYS F 5 125 ? 63.598  65.316 -15.589 1.00 196.57 ? 1322 LYS D N     1 
ATOM   8940  C CA    . LYS F 5 125 ? 63.242  64.803 -14.266 1.00 199.53 ? 1322 LYS D CA    1 
ATOM   8941  C C     . LYS F 5 125 ? 64.121  65.395 -13.168 1.00 201.32 ? 1322 LYS D C     1 
ATOM   8942  O O     . LYS F 5 125 ? 64.892  64.612 -12.578 1.00 156.48 ? 1322 LYS D O     1 
ATOM   8943  C CB    . LYS F 5 125 ? 63.350  63.276 -14.237 1.00 118.08 ? 1322 LYS D CB    1 
ATOM   8944  C CG    . LYS F 5 125 ? 62.648  62.613 -13.053 1.00 117.40 ? 1322 LYS D CG    1 
ATOM   8945  C CD    . LYS F 5 125 ? 62.744  61.087 -13.135 1.00 118.12 ? 1322 LYS D CD    1 
ATOM   8946  C CE    . LYS F 5 125 ? 61.969  60.424 -12.019 1.00 117.77 ? 1322 LYS D CE    1 
ATOM   8947  N NZ    . LYS F 5 125 ? 62.185  58.960 -12.018 1.00 117.86 ? 1322 LYS D NZ    1 
ATOM   8948  O OXT   . LYS F 5 125 ? 64.038  66.619 -12.905 1.00 75.37  ? 1322 LYS D OXT   1 
ATOM   8949  N N     . PRO G 2 38  ? 39.947  33.317 -88.463 1.00 126.16 ? 638  PRO E N     1 
ATOM   8950  C CA    . PRO G 2 38  ? 39.820  33.443 -86.984 1.00 124.41 ? 638  PRO E CA    1 
ATOM   8951  C C     . PRO G 2 38  ? 40.964  34.225 -86.324 1.00 120.71 ? 638  PRO E C     1 
ATOM   8952  O O     . PRO G 2 38  ? 42.108  34.164 -86.776 1.00 120.14 ? 638  PRO E O     1 
ATOM   8953  C CB    . PRO G 2 38  ? 39.755  32.029 -86.435 1.00 74.01  ? 638  PRO E CB    1 
ATOM   8954  C CG    . PRO G 2 38  ? 39.094  31.281 -87.601 1.00 75.78  ? 638  PRO E CG    1 
ATOM   8955  C CD    . PRO G 2 38  ? 39.622  31.940 -88.893 1.00 75.96  ? 638  PRO E CD    1 
ATOM   8956  N N     . HIS G 2 39  ? 40.657  34.957 -85.253 1.00 117.84 ? 639  HIS E N     1 
ATOM   8957  C CA    . HIS G 2 39  ? 41.682  35.734 -84.551 1.00 112.13 ? 639  HIS E CA    1 
ATOM   8958  C C     . HIS G 2 39  ? 42.549  34.793 -83.705 1.00 106.23 ? 639  HIS E C     1 
ATOM   8959  O O     . HIS G 2 39  ? 42.047  33.863 -83.061 1.00 102.51 ? 639  HIS E O     1 
ATOM   8960  C CB    . HIS G 2 39  ? 41.034  36.818 -83.673 1.00 119.75 ? 639  HIS E CB    1 
ATOM   8961  C CG    . HIS G 2 39  ? 42.007  37.816 -83.119 1.00 122.70 ? 639  HIS E CG    1 
ATOM   8962  N ND1   . HIS G 2 39  ? 42.877  37.520 -82.091 1.00 123.60 ? 639  HIS E ND1   1 
ATOM   8963  C CD2   . HIS G 2 39  ? 42.249  39.107 -83.454 1.00 123.44 ? 639  HIS E CD2   1 
ATOM   8964  C CE1   . HIS G 2 39  ? 43.609  38.585 -81.815 1.00 124.23 ? 639  HIS E CE1   1 
ATOM   8965  N NE2   . HIS G 2 39  ? 43.249  39.562 -82.628 1.00 123.82 ? 639  HIS E NE2   1 
ATOM   8966  N N     . ARG G 2 40  ? 43.853  35.052 -83.712 1.00 70.34  ? 640  ARG E N     1 
ATOM   8967  C CA    . ARG G 2 40  ? 44.810  34.224 -82.994 1.00 66.20  ? 640  ARG E CA    1 
ATOM   8968  C C     . ARG G 2 40  ? 46.083  35.015 -82.658 1.00 62.66  ? 640  ARG E C     1 
ATOM   8969  O O     . ARG G 2 40  ? 46.764  35.463 -83.570 1.00 59.54  ? 640  ARG E O     1 
ATOM   8970  C CB    . ARG G 2 40  ? 45.132  33.013 -83.885 1.00 41.16  ? 640  ARG E CB    1 
ATOM   8971  C CG    . ARG G 2 40  ? 46.284  32.121 -83.429 1.00 45.19  ? 640  ARG E CG    1 
ATOM   8972  C CD    . ARG G 2 40  ? 46.289  30.776 -84.167 1.00 45.73  ? 640  ARG E CD    1 
ATOM   8973  N NE    . ARG G 2 40  ? 45.777  29.690 -83.328 1.00 50.17  ? 640  ARG E NE    1 
ATOM   8974  C CZ    . ARG G 2 40  ? 46.487  29.009 -82.420 1.00 48.79  ? 640  ARG E CZ    1 
ATOM   8975  N NH1   . ARG G 2 40  ? 47.777  29.267 -82.207 1.00 52.55  ? 640  ARG E NH1   1 
ATOM   8976  N NH2   . ARG G 2 40  ? 45.896  28.079 -81.693 1.00 50.42  ? 640  ARG E NH2   1 
ATOM   8977  N N     . TYR G 2 41  ? 46.411  35.184 -81.371 1.00 52.63  ? 641  TYR E N     1 
ATOM   8978  C CA    . TYR G 2 41  ? 47.628  35.934 -80.985 1.00 48.65  ? 641  TYR E CA    1 
ATOM   8979  C C     . TYR G 2 41  ? 48.902  35.164 -81.276 1.00 46.68  ? 641  TYR E C     1 
ATOM   8980  O O     . TYR G 2 41  ? 48.962  33.964 -81.054 1.00 46.14  ? 641  TYR E O     1 
ATOM   8981  C CB    . TYR G 2 41  ? 47.638  36.289 -79.492 1.00 25.02  ? 641  TYR E CB    1 
ATOM   8982  C CG    . TYR G 2 41  ? 46.572  37.267 -79.085 1.00 24.61  ? 641  TYR E CG    1 
ATOM   8983  C CD1   . TYR G 2 41  ? 45.397  36.816 -78.519 1.00 24.64  ? 641  TYR E CD1   1 
ATOM   8984  C CD2   . TYR G 2 41  ? 46.707  38.652 -79.359 1.00 24.85  ? 641  TYR E CD2   1 
ATOM   8985  C CE1   . TYR G 2 41  ? 44.376  37.671 -78.238 1.00 25.35  ? 641  TYR E CE1   1 
ATOM   8986  C CE2   . TYR G 2 41  ? 45.667  39.533 -79.069 1.00 23.46  ? 641  TYR E CE2   1 
ATOM   8987  C CZ    . TYR G 2 41  ? 44.502  39.011 -78.503 1.00 23.72  ? 641  TYR E CZ    1 
ATOM   8988  O OH    . TYR G 2 41  ? 43.460  39.819 -78.151 1.00 28.81  ? 641  TYR E OH    1 
ATOM   8989  N N     . ARG G 2 42  ? 49.931  35.840 -81.760 1.00 49.82  ? 642  ARG E N     1 
ATOM   8990  C CA    . ARG G 2 42  ? 51.169  35.133 -82.042 1.00 49.59  ? 642  ARG E CA    1 
ATOM   8991  C C     . ARG G 2 42  ? 51.699  34.583 -80.709 1.00 52.28  ? 642  ARG E C     1 
ATOM   8992  O O     . ARG G 2 42  ? 51.481  35.171 -79.660 1.00 49.37  ? 642  ARG E O     1 
ATOM   8993  C CB    . ARG G 2 42  ? 52.154  36.086 -82.708 1.00 65.16  ? 642  ARG E CB    1 
ATOM   8994  C CG    . ARG G 2 42  ? 51.550  36.817 -83.893 1.00 71.80  ? 642  ARG E CG    1 
ATOM   8995  C CD    . ARG G 2 42  ? 52.525  37.812 -84.468 1.00 80.09  ? 642  ARG E CD    1 
ATOM   8996  N NE    . ARG G 2 42  ? 53.705  37.149 -85.017 1.00 87.38  ? 642  ARG E NE    1 
ATOM   8997  C CZ    . ARG G 2 42  ? 54.888  37.738 -85.189 1.00 91.94  ? 642  ARG E CZ    1 
ATOM   8998  N NH1   . ARG G 2 42  ? 55.057  39.013 -84.851 1.00 94.12  ? 642  ARG E NH1   1 
ATOM   8999  N NH2   . ARG G 2 42  ? 55.905  37.054 -85.703 1.00 94.96  ? 642  ARG E NH2   1 
ATOM   9000  N N     . PRO G 2 43  ? 52.383  33.431 -80.730 1.00 48.45  ? 643  PRO E N     1 
ATOM   9001  C CA    . PRO G 2 43  ? 52.916  32.832 -79.501 1.00 47.41  ? 643  PRO E CA    1 
ATOM   9002  C C     . PRO G 2 43  ? 53.815  33.739 -78.670 1.00 46.26  ? 643  PRO E C     1 
ATOM   9003  O O     . PRO G 2 43  ? 54.797  34.288 -79.173 1.00 46.85  ? 643  PRO E O     1 
ATOM   9004  C CB    . PRO G 2 43  ? 53.659  31.602 -80.021 1.00 36.20  ? 643  PRO E CB    1 
ATOM   9005  C CG    . PRO G 2 43  ? 54.172  32.067 -81.325 1.00 39.31  ? 643  PRO E CG    1 
ATOM   9006  C CD    . PRO G 2 43  ? 52.916  32.721 -81.904 1.00 36.93  ? 643  PRO E CD    1 
ATOM   9007  N N     . GLY G 2 44  ? 53.455  33.883 -77.396 1.00 44.16  ? 644  GLY E N     1 
ATOM   9008  C CA    . GLY G 2 44  ? 54.221  34.706 -76.471 1.00 42.29  ? 644  GLY E CA    1 
ATOM   9009  C C     . GLY G 2 44  ? 53.536  35.987 -76.051 1.00 42.38  ? 644  GLY E C     1 
ATOM   9010  O O     . GLY G 2 44  ? 53.971  36.669 -75.130 1.00 44.06  ? 644  GLY E O     1 
ATOM   9011  N N     . THR G 2 45  ? 52.446  36.301 -76.730 1.00 39.91  ? 645  THR E N     1 
ATOM   9012  C CA    . THR G 2 45  ? 51.708  37.518 -76.489 1.00 39.40  ? 645  THR E CA    1 
ATOM   9013  C C     . THR G 2 45  ? 50.845  37.347 -75.260 1.00 38.52  ? 645  THR E C     1 
ATOM   9014  O O     . THR G 2 45  ? 50.739  38.243 -74.421 1.00 37.29  ? 645  THR E O     1 
ATOM   9015  C CB    . THR G 2 45  ? 50.848  37.827 -77.723 1.00 31.14  ? 645  THR E CB    1 
ATOM   9016  O OG1   . THR G 2 45  ? 51.705  37.960 -78.845 1.00 31.30  ? 645  THR E OG1   1 
ATOM   9017  C CG2   . THR G 2 45  ? 50.105  39.100 -77.591 1.00 30.16  ? 645  THR E CG2   1 
ATOM   9018  N N     . VAL G 2 46  ? 50.221  36.187 -75.151 1.00 42.28  ? 646  VAL E N     1 
ATOM   9019  C CA    . VAL G 2 46  ? 49.374  35.922 -74.014 1.00 42.98  ? 646  VAL E CA    1 
ATOM   9020  C C     . VAL G 2 46  ? 50.308  35.772 -72.837 1.00 43.01  ? 646  VAL E C     1 
ATOM   9021  O O     . VAL G 2 46  ? 50.004  36.206 -71.759 1.00 42.61  ? 646  VAL E O     1 
ATOM   9022  C CB    . VAL G 2 46  ? 48.559  34.628 -74.210 1.00 22.37  ? 646  VAL E CB    1 
ATOM   9023  C CG1   . VAL G 2 46  ? 47.550  34.476 -73.093 1.00 23.18  ? 646  VAL E CG1   1 
ATOM   9024  C CG2   . VAL G 2 46  ? 47.849  34.657 -75.547 1.00 24.19  ? 646  VAL E CG2   1 
ATOM   9025  N N     . ALA G 2 47  ? 51.467  35.173 -73.046 1.00 41.27  ? 647  ALA E N     1 
ATOM   9026  C CA    . ALA G 2 47  ? 52.436  34.992 -71.967 1.00 41.89  ? 647  ALA E CA    1 
ATOM   9027  C C     . ALA G 2 47  ? 52.874  36.313 -71.309 1.00 43.61  ? 647  ALA E C     1 
ATOM   9028  O O     . ALA G 2 47  ? 52.996  36.386 -70.089 1.00 39.77  ? 647  ALA E O     1 
ATOM   9029  C CB    . ALA G 2 47  ? 53.641  34.251 -72.501 1.00 21.72  ? 647  ALA E CB    1 
ATOM   9030  N N     . LEU G 2 48  ? 53.141  37.342 -72.122 1.00 35.66  ? 648  LEU E N     1 
ATOM   9031  C CA    . LEU G 2 48  ? 53.535  38.659 -71.625 1.00 34.46  ? 648  LEU E CA    1 
ATOM   9032  C C     . LEU G 2 48  ? 52.316  39.177 -70.923 1.00 34.09  ? 648  LEU E C     1 
ATOM   9033  O O     . LEU G 2 48  ? 52.385  39.696 -69.841 1.00 35.38  ? 648  LEU E O     1 
ATOM   9034  C CB    . LEU G 2 48  ? 53.915  39.568 -72.783 1.00 46.86  ? 648  LEU E CB    1 
ATOM   9035  C CG    . LEU G 2 48  ? 55.368  39.413 -73.213 1.00 49.28  ? 648  LEU E CG    1 
ATOM   9036  C CD1   . LEU G 2 48  ? 55.692  40.284 -74.390 1.00 49.75  ? 648  LEU E CD1   1 
ATOM   9037  C CD2   . LEU G 2 48  ? 56.239  39.812 -72.030 1.00 49.13  ? 648  LEU E CD2   1 
ATOM   9038  N N     . ARG G 2 49  ? 51.179  39.002 -71.557 1.00 27.95  ? 649  ARG E N     1 
ATOM   9039  C CA    . ARG G 2 49  ? 49.923  39.386 -70.978 1.00 30.31  ? 649  ARG E CA    1 
ATOM   9040  C C     . ARG G 2 49  ? 49.844  38.816 -69.545 1.00 29.34  ? 649  ARG E C     1 
ATOM   9041  O O     . ARG G 2 49  ? 49.550  39.554 -68.608 1.00 24.48  ? 649  ARG E O     1 
ATOM   9042  C CB    . ARG G 2 49  ? 48.769  38.830 -71.830 1.00 41.31  ? 649  ARG E CB    1 
ATOM   9043  C CG    . ARG G 2 49  ? 47.798  39.875 -72.339 1.00 47.10  ? 649  ARG E CG    1 
ATOM   9044  C CD    . ARG G 2 49  ? 46.319  39.481 -72.173 1.00 54.42  ? 649  ARG E CD    1 
ATOM   9045  N NE    . ARG G 2 49  ? 45.828  38.433 -73.086 1.00 58.78  ? 649  ARG E NE    1 
ATOM   9046  C CZ    . ARG G 2 49  ? 45.930  38.441 -74.419 1.00 59.93  ? 649  ARG E CZ    1 
ATOM   9047  N NH1   . ARG G 2 49  ? 46.514  39.445 -75.078 1.00 62.31  ? 649  ARG E NH1   1 
ATOM   9048  N NH2   . ARG G 2 49  ? 45.445  37.415 -75.096 1.00 59.34  ? 649  ARG E NH2   1 
ATOM   9049  N N     . GLU G 2 50  ? 50.115  37.513 -69.379 1.00 44.67  ? 650  GLU E N     1 
ATOM   9050  C CA    . GLU G 2 50  ? 50.061  36.833 -68.080 1.00 46.70  ? 650  GLU E CA    1 
ATOM   9051  C C     . GLU G 2 50  ? 51.185  37.237 -67.089 1.00 47.12  ? 650  GLU E C     1 
ATOM   9052  O O     . GLU G 2 50  ? 50.975  37.234 -65.857 1.00 48.34  ? 650  GLU E O     1 
ATOM   9053  C CB    . GLU G 2 50  ? 50.018  35.328 -68.321 1.00 62.54  ? 650  GLU E CB    1 
ATOM   9054  C CG    . GLU G 2 50  ? 48.798  34.945 -69.126 1.00 67.09  ? 650  GLU E CG    1 
ATOM   9055  C CD    . GLU G 2 50  ? 48.582  33.437 -69.295 1.00 70.39  ? 650  GLU E CD    1 
ATOM   9056  O OE1   . GLU G 2 50  ? 47.498  33.059 -69.807 1.00 72.66  ? 650  GLU E OE1   1 
ATOM   9057  O OE2   . GLU G 2 50  ? 49.472  32.630 -68.933 1.00 70.40  ? 650  GLU E OE2   1 
ATOM   9058  N N     . ILE G 2 51  ? 52.375  37.572 -67.599 1.00 20.28  ? 651  ILE E N     1 
ATOM   9059  C CA    . ILE G 2 51  ? 53.405  38.075 -66.699 1.00 21.97  ? 651  ILE E CA    1 
ATOM   9060  C C     . ILE G 2 51  ? 52.855  39.394 -66.112 1.00 23.77  ? 651  ILE E C     1 
ATOM   9061  O O     . ILE G 2 51  ? 52.761  39.559 -64.890 1.00 23.24  ? 651  ILE E O     1 
ATOM   9062  C CB    . ILE G 2 51  ? 54.729  38.416 -67.396 1.00 18.02  ? 651  ILE E CB    1 
ATOM   9063  C CG1   . ILE G 2 51  ? 55.331  37.153 -68.038 1.00 19.10  ? 651  ILE E CG1   1 
ATOM   9064  C CG2   . ILE G 2 51  ? 55.671  39.061 -66.384 1.00 18.07  ? 651  ILE E CG2   1 
ATOM   9065  C CD1   . ILE G 2 51  ? 56.602  37.385 -68.835 1.00 17.07  ? 651  ILE E CD1   1 
ATOM   9066  N N     . ARG G 2 52  ? 52.467  40.321 -66.981 1.00 29.78  ? 652  ARG E N     1 
ATOM   9067  C CA    . ARG G 2 52  ? 51.906  41.570 -66.512 1.00 32.57  ? 652  ARG E CA    1 
ATOM   9068  C C     . ARG G 2 52  ? 50.775  41.297 -65.534 1.00 30.85  ? 652  ARG E C     1 
ATOM   9069  O O     . ARG G 2 52  ? 50.738  41.842 -64.431 1.00 30.04  ? 652  ARG E O     1 
ATOM   9070  C CB    . ARG G 2 52  ? 51.433  42.399 -67.691 1.00 31.50  ? 652  ARG E CB    1 
ATOM   9071  C CG    . ARG G 2 52  ? 52.581  43.203 -68.322 1.00 38.74  ? 652  ARG E CG    1 
ATOM   9072  C CD    . ARG G 2 52  ? 52.160  44.074 -69.507 1.00 43.16  ? 652  ARG E CD    1 
ATOM   9073  N NE    . ARG G 2 52  ? 52.608  43.536 -70.801 1.00 47.22  ? 652  ARG E NE    1 
ATOM   9074  C CZ    . ARG G 2 52  ? 53.819  43.729 -71.340 1.00 48.58  ? 652  ARG E CZ    1 
ATOM   9075  N NH1   . ARG G 2 52  ? 54.761  44.468 -70.714 1.00 52.58  ? 652  ARG E NH1   1 
ATOM   9076  N NH2   . ARG G 2 52  ? 54.095  43.170 -72.523 1.00 45.93  ? 652  ARG E NH2   1 
ATOM   9077  N N     . ARG G 2 53  ? 49.865  40.427 -65.927 1.00 41.46  ? 653  ARG E N     1 
ATOM   9078  C CA    . ARG G 2 53  ? 48.749  40.057 -65.080 1.00 39.84  ? 653  ARG E CA    1 
ATOM   9079  C C     . ARG G 2 53  ? 49.148  39.580 -63.695 1.00 40.50  ? 653  ARG E C     1 
ATOM   9080  O O     . ARG G 2 53  ? 48.800  40.168 -62.688 1.00 38.77  ? 653  ARG E O     1 
ATOM   9081  C CB    . ARG G 2 53  ? 47.953  38.936 -65.718 1.00 31.19  ? 653  ARG E CB    1 
ATOM   9082  C CG    . ARG G 2 53  ? 46.801  38.531 -64.836 1.00 33.58  ? 653  ARG E CG    1 
ATOM   9083  C CD    . ARG G 2 53  ? 46.043  37.351 -65.405 1.00 40.38  ? 653  ARG E CD    1 
ATOM   9084  N NE    . ARG G 2 53  ? 44.878  37.024 -64.586 1.00 47.89  ? 653  ARG E NE    1 
ATOM   9085  C CZ    . ARG G 2 53  ? 44.180  35.898 -64.706 1.00 48.74  ? 653  ARG E CZ    1 
ATOM   9086  N NH1   . ARG G 2 53  ? 44.551  35.000 -65.616 1.00 48.02  ? 653  ARG E NH1   1 
ATOM   9087  N NH2   . ARG G 2 53  ? 43.116  35.676 -63.927 1.00 49.75  ? 653  ARG E NH2   1 
ATOM   9088  N N     . TYR G 2 54  ? 49.892  38.489 -63.647 1.00 34.13  ? 654  TYR E N     1 
ATOM   9089  C CA    . TYR G 2 54  ? 50.254  37.929 -62.366 1.00 35.23  ? 654  TYR E CA    1 
ATOM   9090  C C     . TYR G 2 54  ? 51.189  38.734 -61.475 1.00 34.04  ? 654  TYR E C     1 
ATOM   9091  O O     . TYR G 2 54  ? 51.210  38.516 -60.266 1.00 32.81  ? 654  TYR E O     1 
ATOM   9092  C CB    . TYR G 2 54  ? 50.751  36.486 -62.581 1.00 29.73  ? 654  TYR E CB    1 
ATOM   9093  C CG    . TYR G 2 54  ? 49.613  35.544 -62.946 1.00 31.43  ? 654  TYR E CG    1 
ATOM   9094  C CD1   . TYR G 2 54  ? 49.442  35.075 -64.266 1.00 28.97  ? 654  TYR E CD1   1 
ATOM   9095  C CD2   . TYR G 2 54  ? 48.625  35.244 -62.011 1.00 30.02  ? 654  TYR E CD2   1 
ATOM   9096  C CE1   . TYR G 2 54  ? 48.322  34.353 -64.637 1.00 28.23  ? 654  TYR E CE1   1 
ATOM   9097  C CE2   . TYR G 2 54  ? 47.511  34.535 -62.375 1.00 32.26  ? 654  TYR E CE2   1 
ATOM   9098  C CZ    . TYR G 2 54  ? 47.366  34.095 -63.681 1.00 29.67  ? 654  TYR E CZ    1 
ATOM   9099  O OH    . TYR G 2 54  ? 46.245  33.383 -63.981 1.00 32.43  ? 654  TYR E OH    1 
ATOM   9100  N N     . GLN G 2 55  ? 51.954  39.657 -62.063 1.00 35.10  ? 655  GLN E N     1 
ATOM   9101  C CA    . GLN G 2 55  ? 52.861  40.489 -61.281 1.00 36.21  ? 655  GLN E CA    1 
ATOM   9102  C C     . GLN G 2 55  ? 52.128  41.646 -60.603 1.00 38.85  ? 655  GLN E C     1 
ATOM   9103  O O     . GLN G 2 55  ? 52.712  42.362 -59.788 1.00 40.59  ? 655  GLN E O     1 
ATOM   9104  C CB    . GLN G 2 55  ? 54.001  41.029 -62.139 1.00 21.73  ? 655  GLN E CB    1 
ATOM   9105  C CG    . GLN G 2 55  ? 54.896  39.946 -62.731 1.00 21.20  ? 655  GLN E CG    1 
ATOM   9106  C CD    . GLN G 2 55  ? 56.288  40.434 -63.229 1.00 22.28  ? 655  GLN E CD    1 
ATOM   9107  O OE1   . GLN G 2 55  ? 56.476  41.568 -63.700 1.00 22.69  ? 655  GLN E OE1   1 
ATOM   9108  N NE2   . GLN G 2 55  ? 57.253  39.544 -63.149 1.00 23.89  ? 655  GLN E NE2   1 
ATOM   9109  N N     . LYS G 2 56  ? 50.852  41.825 -60.940 1.00 32.21  ? 656  LYS E N     1 
ATOM   9110  C CA    . LYS G 2 56  ? 50.028  42.872 -60.347 1.00 33.76  ? 656  LYS E CA    1 
ATOM   9111  C C     . LYS G 2 56  ? 49.294  42.268 -59.170 1.00 32.31  ? 656  LYS E C     1 
ATOM   9112  O O     . LYS G 2 56  ? 49.108  42.898 -58.155 1.00 29.56  ? 656  LYS E O     1 
ATOM   9113  C CB    . LYS G 2 56  ? 48.962  43.371 -61.312 1.00 55.94  ? 656  LYS E CB    1 
ATOM   9114  C CG    . LYS G 2 56  ? 49.399  44.231 -62.443 1.00 63.80  ? 656  LYS E CG    1 
ATOM   9115  C CD    . LYS G 2 56  ? 48.197  44.409 -63.381 1.00 68.80  ? 656  LYS E CD    1 
ATOM   9116  C CE    . LYS G 2 56  ? 48.462  45.433 -64.499 1.00 75.34  ? 656  LYS E CE    1 
ATOM   9117  N NZ    . LYS G 2 56  ? 47.354  45.547 -65.502 1.00 79.99  ? 656  LYS E NZ    1 
ATOM   9118  N N     . SER G 2 57  ? 48.839  41.037 -59.318 1.00 45.54  ? 657  SER E N     1 
ATOM   9119  C CA    . SER G 2 57  ? 48.119  40.424 -58.232 1.00 45.35  ? 657  SER E CA    1 
ATOM   9120  C C     . SER G 2 57  ? 49.060  39.867 -57.189 1.00 43.97  ? 657  SER E C     1 
ATOM   9121  O O     . SER G 2 57  ? 50.293  39.897 -57.357 1.00 43.05  ? 657  SER E O     1 
ATOM   9122  C CB    . SER G 2 57  ? 47.228  39.311 -58.748 1.00 48.42  ? 657  SER E CB    1 
ATOM   9123  O OG    . SER G 2 57  ? 47.998  38.291 -59.338 1.00 51.27  ? 657  SER E OG    1 
ATOM   9124  N N     . THR G 2 58  ? 48.447  39.339 -56.125 1.00 51.21  ? 658  THR E N     1 
ATOM   9125  C CA    . THR G 2 58  ? 49.160  38.757 -54.999 1.00 54.72  ? 658  THR E CA    1 
ATOM   9126  C C     . THR G 2 58  ? 48.486  37.527 -54.427 1.00 53.02  ? 658  THR E C     1 
ATOM   9127  O O     . THR G 2 58  ? 48.895  37.069 -53.372 1.00 53.67  ? 658  THR E O     1 
ATOM   9128  C CB    . THR G 2 58  ? 49.324  39.767 -53.839 1.00 20.72  ? 658  THR E CB    1 
ATOM   9129  O OG1   . THR G 2 58  ? 48.067  40.351 -53.555 1.00 22.93  ? 658  THR E OG1   1 
ATOM   9130  C CG2   . THR G 2 58  ? 50.224  40.886 -54.211 1.00 26.07  ? 658  THR E CG2   1 
ATOM   9131  N N     . GLU G 2 59  ? 47.461  36.990 -55.084 1.00 44.10  ? 659  GLU E N     1 
ATOM   9132  C CA    . GLU G 2 59  ? 46.814  35.791 -54.557 1.00 44.86  ? 659  GLU E CA    1 
ATOM   9133  C C     . GLU G 2 59  ? 47.683  34.577 -54.785 1.00 42.37  ? 659  GLU E C     1 
ATOM   9134  O O     . GLU G 2 59  ? 48.471  34.539 -55.750 1.00 39.10  ? 659  GLU E O     1 
ATOM   9135  C CB    . GLU G 2 59  ? 45.495  35.529 -55.225 1.00 35.45  ? 659  GLU E CB    1 
ATOM   9136  C CG    . GLU G 2 59  ? 45.248  36.379 -56.437 1.00 48.34  ? 659  GLU E CG    1 
ATOM   9137  C CD    . GLU G 2 59  ? 45.710  35.775 -57.752 1.00 49.46  ? 659  GLU E CD    1 
ATOM   9138  O OE1   . GLU G 2 59  ? 45.268  34.657 -58.074 1.00 58.40  ? 659  GLU E OE1   1 
ATOM   9139  O OE2   . GLU G 2 59  ? 46.493  36.431 -58.481 1.00 48.88  ? 659  GLU E OE2   1 
ATOM   9140  N N     . LEU G 2 60  ? 47.563  33.581 -53.902 1.00 33.39  ? 660  LEU E N     1 
ATOM   9141  C CA    . LEU G 2 60  ? 48.339  32.357 -54.078 1.00 36.26  ? 660  LEU E CA    1 
ATOM   9142  C C     . LEU G 2 60  ? 47.904  31.773 -55.428 1.00 36.20  ? 660  LEU E C     1 
ATOM   9143  O O     . LEU G 2 60  ? 46.737  31.810 -55.801 1.00 34.74  ? 660  LEU E O     1 
ATOM   9144  C CB    . LEU G 2 60  ? 48.053  31.366 -52.944 1.00 31.58  ? 660  LEU E CB    1 
ATOM   9145  C CG    . LEU G 2 60  ? 48.368  31.820 -51.503 1.00 33.48  ? 660  LEU E CG    1 
ATOM   9146  C CD1   . LEU G 2 60  ? 47.581  30.954 -50.511 1.00 35.00  ? 660  LEU E CD1   1 
ATOM   9147  C CD2   . LEU G 2 60  ? 49.873  31.767 -51.209 1.00 33.21  ? 660  LEU E CD2   1 
ATOM   9148  N N     . LEU G 2 61  ? 48.854  31.241 -56.160 1.00 30.58  ? 661  LEU E N     1 
ATOM   9149  C CA    . LEU G 2 61  ? 48.584  30.670 -57.457 1.00 28.48  ? 661  LEU E CA    1 
ATOM   9150  C C     . LEU G 2 61  ? 48.441  29.142 -57.436 1.00 28.41  ? 661  LEU E C     1 
ATOM   9151  O O     . LEU G 2 61  ? 48.360  28.523 -58.493 1.00 28.08  ? 661  LEU E O     1 
ATOM   9152  C CB    . LEU G 2 61  ? 49.712  31.065 -58.393 1.00 26.17  ? 661  LEU E CB    1 
ATOM   9153  C CG    . LEU G 2 61  ? 50.042  32.568 -58.369 1.00 27.65  ? 661  LEU E CG    1 
ATOM   9154  C CD1   . LEU G 2 61  ? 51.425  32.835 -58.991 1.00 26.44  ? 661  LEU E CD1   1 
ATOM   9155  C CD2   . LEU G 2 61  ? 48.914  33.315 -59.079 1.00 28.10  ? 661  LEU E CD2   1 
ATOM   9156  N N     . ILE G 2 62  ? 48.421  28.534 -56.251 1.00 39.49  ? 662  ILE E N     1 
ATOM   9157  C CA    . ILE G 2 62  ? 48.286  27.090 -56.136 1.00 41.27  ? 662  ILE E CA    1 
ATOM   9158  C C     . ILE G 2 62  ? 46.974  26.770 -55.448 1.00 41.77  ? 662  ILE E C     1 
ATOM   9159  O O     . ILE G 2 62  ? 46.675  27.357 -54.428 1.00 37.80  ? 662  ILE E O     1 
ATOM   9160  C CB    . ILE G 2 62  ? 49.405  26.498 -55.292 1.00 53.54  ? 662  ILE E CB    1 
ATOM   9161  C CG1   . ILE G 2 62  ? 50.739  26.675 -56.003 1.00 52.04  ? 662  ILE E CG1   1 
ATOM   9162  C CG2   . ILE G 2 62  ? 49.135  25.027 -55.012 1.00 54.12  ? 662  ILE E CG2   1 
ATOM   9163  C CD1   . ILE G 2 62  ? 51.925  26.330 -55.125 1.00 50.13  ? 662  ILE E CD1   1 
ATOM   9164  N N     . ARG G 2 63  ? 46.198  25.836 -56.002 1.00 21.36  ? 663  ARG E N     1 
ATOM   9165  C CA    . ARG G 2 63  ? 44.914  25.443 -55.433 1.00 22.76  ? 663  ARG E CA    1 
ATOM   9166  C C     . ARG G 2 63  ? 45.098  25.131 -53.944 1.00 22.95  ? 663  ARG E C     1 
ATOM   9167  O O     . ARG G 2 63  ? 46.010  24.440 -53.599 1.00 21.84  ? 663  ARG E O     1 
ATOM   9168  C CB    . ARG G 2 63  ? 44.420  24.236 -56.205 1.00 38.72  ? 663  ARG E CB    1 
ATOM   9169  C CG    . ARG G 2 63  ? 44.221  24.489 -57.682 1.00 46.01  ? 663  ARG E CG    1 
ATOM   9170  C CD    . ARG G 2 63  ? 42.991  25.342 -57.916 1.00 53.74  ? 663  ARG E CD    1 
ATOM   9171  N NE    . ARG G 2 63  ? 43.124  26.684 -57.361 1.00 64.18  ? 663  ARG E NE    1 
ATOM   9172  C CZ    . ARG G 2 63  ? 42.112  27.535 -57.221 1.00 69.28  ? 663  ARG E CZ    1 
ATOM   9173  N NH1   . ARG G 2 63  ? 40.899  27.171 -57.603 1.00 75.02  ? 663  ARG E NH1   1 
ATOM   9174  N NH2   . ARG G 2 63  ? 42.299  28.735 -56.684 1.00 69.77  ? 663  ARG E NH2   1 
ATOM   9175  N N     . LYS G 2 64  ? 44.241  25.638 -53.065 1.00 26.95  ? 664  LYS E N     1 
ATOM   9176  C CA    . LYS G 2 64  ? 44.402  25.430 -51.625 1.00 29.80  ? 664  LYS E CA    1 
ATOM   9177  C C     . LYS G 2 64  ? 44.338  24.005 -51.133 1.00 29.72  ? 664  LYS E C     1 
ATOM   9178  O O     . LYS G 2 64  ? 45.308  23.463 -50.591 1.00 26.14  ? 664  LYS E O     1 
ATOM   9179  C CB    . LYS G 2 64  ? 43.414  26.284 -50.841 1.00 40.65  ? 664  LYS E CB    1 
ATOM   9180  C CG    . LYS G 2 64  ? 43.709  27.735 -51.024 1.00 52.96  ? 664  LYS E CG    1 
ATOM   9181  C CD    . LYS G 2 64  ? 42.860  28.644 -50.128 1.00 59.47  ? 664  LYS E CD    1 
ATOM   9182  C CE    . LYS G 2 64  ? 43.202  30.156 -50.331 1.00 64.19  ? 664  LYS E CE    1 
ATOM   9183  N NZ    . LYS G 2 64  ? 44.621  30.429 -49.986 1.00 69.58  ? 664  LYS E NZ    1 
ATOM   9184  N N     . LEU G 2 65  ? 43.198  23.390 -51.311 1.00 23.62  ? 665  LEU E N     1 
ATOM   9185  C CA    . LEU G 2 65  ? 43.029  22.028 -50.863 1.00 23.03  ? 665  LEU E CA    1 
ATOM   9186  C C     . LEU G 2 65  ? 44.137  21.069 -51.373 1.00 22.29  ? 665  LEU E C     1 
ATOM   9187  O O     . LEU G 2 65  ? 44.671  20.252 -50.628 1.00 23.41  ? 665  LEU E O     1 
ATOM   9188  C CB    . LEU G 2 65  ? 41.651  21.573 -51.317 1.00 21.05  ? 665  LEU E CB    1 
ATOM   9189  C CG    . LEU G 2 65  ? 41.161  20.176 -51.042 1.00 22.78  ? 665  LEU E CG    1 
ATOM   9190  C CD1   . LEU G 2 65  ? 41.422  19.761 -49.635 1.00 23.90  ? 665  LEU E CD1   1 
ATOM   9191  C CD2   . LEU G 2 65  ? 39.708  20.202 -51.347 1.00 23.08  ? 665  LEU E CD2   1 
ATOM   9192  N N     . PRO G 2 66  ? 44.470  21.149 -52.666 1.00 32.53  ? 666  PRO E N     1 
ATOM   9193  C CA    . PRO G 2 66  ? 45.510  20.260 -53.145 1.00 33.03  ? 666  PRO E CA    1 
ATOM   9194  C C     . PRO G 2 66  ? 46.770  20.443 -52.357 1.00 35.03  ? 666  PRO E C     1 
ATOM   9195  O O     . PRO G 2 66  ? 47.400  19.453 -52.000 1.00 30.73  ? 666  PRO E O     1 
ATOM   9196  C CB    . PRO G 2 66  ? 45.684  20.672 -54.604 1.00 36.24  ? 666  PRO E CB    1 
ATOM   9197  C CG    . PRO G 2 66  ? 44.349  21.038 -54.968 1.00 38.33  ? 666  PRO E CG    1 
ATOM   9198  C CD    . PRO G 2 66  ? 43.852  21.860 -53.791 1.00 38.84  ? 666  PRO E CD    1 
ATOM   9199  N N     . PHE G 2 67  ? 47.126  21.702 -52.081 1.00 36.33  ? 667  PHE E N     1 
ATOM   9200  C CA    . PHE G 2 67  ? 48.356  22.035 -51.357 1.00 34.70  ? 667  PHE E CA    1 
ATOM   9201  C C     . PHE G 2 67  ? 48.357  21.545 -49.920 1.00 32.84  ? 667  PHE E C     1 
ATOM   9202  O O     . PHE G 2 67  ? 49.380  21.063 -49.424 1.00 28.95  ? 667  PHE E O     1 
ATOM   9203  C CB    . PHE G 2 67  ? 48.594  23.540 -51.358 1.00 27.84  ? 667  PHE E CB    1 
ATOM   9204  C CG    . PHE G 2 67  ? 49.875  23.955 -50.680 1.00 24.41  ? 667  PHE E CG    1 
ATOM   9205  C CD1   . PHE G 2 67  ? 51.052  24.016 -51.384 1.00 27.25  ? 667  PHE E CD1   1 
ATOM   9206  C CD2   . PHE G 2 67  ? 49.895  24.241 -49.333 1.00 25.26  ? 667  PHE E CD2   1 
ATOM   9207  C CE1   . PHE G 2 67  ? 52.243  24.333 -50.757 1.00 23.60  ? 667  PHE E CE1   1 
ATOM   9208  C CE2   . PHE G 2 67  ? 51.076  24.558 -48.698 1.00 20.35  ? 667  PHE E CE2   1 
ATOM   9209  C CZ    . PHE G 2 67  ? 52.258  24.614 -49.415 1.00 21.68  ? 667  PHE E CZ    1 
ATOM   9210  N N     . GLN G 2 68  ? 47.216  21.685 -49.253 1.00 34.73  ? 668  GLN E N     1 
ATOM   9211  C CA    . GLN G 2 68  ? 47.073  21.240 -47.892 1.00 39.92  ? 668  GLN E CA    1 
ATOM   9212  C C     . GLN G 2 68  ? 47.279  19.725 -47.828 1.00 38.49  ? 668  GLN E C     1 
ATOM   9213  O O     . GLN G 2 68  ? 47.918  19.196 -46.908 1.00 35.98  ? 668  GLN E O     1 
ATOM   9214  C CB    . GLN G 2 68  ? 45.698  21.617 -47.386 1.00 29.97  ? 668  GLN E CB    1 
ATOM   9215  C CG    . GLN G 2 68  ? 45.542  21.370 -45.917 1.00 39.21  ? 668  GLN E CG    1 
ATOM   9216  C CD    . GLN G 2 68  ? 44.221  21.828 -45.354 1.00 45.04  ? 668  GLN E CD    1 
ATOM   9217  O OE1   . GLN G 2 68  ? 43.176  21.347 -45.764 1.00 48.73  ? 668  GLN E OE1   1 
ATOM   9218  N NE2   . GLN G 2 68  ? 44.263  22.758 -44.390 1.00 48.70  ? 668  GLN E NE2   1 
ATOM   9219  N N     . ARG G 2 69  ? 46.761  19.006 -48.810 1.00 41.47  ? 669  ARG E N     1 
ATOM   9220  C CA    . ARG G 2 69  ? 46.947  17.576 -48.791 1.00 43.63  ? 669  ARG E CA    1 
ATOM   9221  C C     . ARG G 2 69  ? 48.403  17.273 -48.843 1.00 43.77  ? 669  ARG E C     1 
ATOM   9222  O O     . ARG G 2 69  ? 48.868  16.464 -48.059 1.00 44.61  ? 669  ARG E O     1 
ATOM   9223  C CB    . ARG G 2 69  ? 46.274  16.909 -49.965 1.00 28.39  ? 669  ARG E CB    1 
ATOM   9224  C CG    . ARG G 2 69  ? 44.818  16.727 -49.768 1.00 32.13  ? 669  ARG E CG    1 
ATOM   9225  C CD    . ARG G 2 69  ? 44.287  15.791 -50.780 1.00 36.27  ? 669  ARG E CD    1 
ATOM   9226  N NE    . ARG G 2 69  ? 43.265  16.439 -51.585 1.00 44.25  ? 669  ARG E NE    1 
ATOM   9227  C CZ    . ARG G 2 69  ? 43.446  16.774 -52.849 1.00 41.87  ? 669  ARG E CZ    1 
ATOM   9228  N NH1   . ARG G 2 69  ? 44.626  16.509 -53.437 1.00 36.40  ? 669  ARG E NH1   1 
ATOM   9229  N NH2   . ARG G 2 69  ? 42.453  17.360 -53.506 1.00 46.37  ? 669  ARG E NH2   1 
ATOM   9230  N N     . LEU G 2 70  ? 49.126  17.925 -49.759 1.00 32.82  ? 670  LEU E N     1 
ATOM   9231  C CA    . LEU G 2 70  ? 50.580  17.703 -49.897 1.00 33.17  ? 670  LEU E CA    1 
ATOM   9232  C C     . LEU G 2 70  ? 51.315  18.002 -48.569 1.00 32.66  ? 670  LEU E C     1 
ATOM   9233  O O     . LEU G 2 70  ? 52.335  17.391 -48.250 1.00 31.89  ? 670  LEU E O     1 
ATOM   9234  C CB    . LEU G 2 70  ? 51.166  18.563 -51.051 1.00 26.94  ? 670  LEU E CB    1 
ATOM   9235  C CG    . LEU G 2 70  ? 52.693  18.494 -51.336 1.00 26.46  ? 670  LEU E CG    1 
ATOM   9236  C CD1   . LEU G 2 70  ? 53.141  17.140 -51.852 1.00 22.27  ? 670  LEU E CD1   1 
ATOM   9237  C CD2   . LEU G 2 70  ? 53.061  19.525 -52.354 1.00 25.88  ? 670  LEU E CD2   1 
ATOM   9238  N N     . VAL G 2 71  ? 50.776  18.929 -47.789 1.00 31.55  ? 671  VAL E N     1 
ATOM   9239  C CA    . VAL G 2 71  ? 51.410  19.267 -46.534 1.00 31.47  ? 671  VAL E CA    1 
ATOM   9240  C C     . VAL G 2 71  ? 51.169  18.163 -45.554 1.00 33.51  ? 671  VAL E C     1 
ATOM   9241  O O     . VAL G 2 71  ? 52.111  17.675 -44.908 1.00 29.69  ? 671  VAL E O     1 
ATOM   9242  C CB    . VAL G 2 71  ? 50.888  20.610 -45.918 1.00 30.06  ? 671  VAL E CB    1 
ATOM   9243  C CG1   . VAL G 2 71  ? 51.367  20.752 -44.480 1.00 28.72  ? 671  VAL E CG1   1 
ATOM   9244  C CG2   . VAL G 2 71  ? 51.439  21.775 -46.713 1.00 31.99  ? 671  VAL E CG2   1 
ATOM   9245  N N     . ARG G 2 72  ? 49.904  17.768 -45.452 1.00 28.40  ? 672  ARG E N     1 
ATOM   9246  C CA    . ARG G 2 72  ? 49.531  16.732 -44.519 1.00 30.17  ? 672  ARG E CA    1 
ATOM   9247  C C     . ARG G 2 72  ? 50.272  15.415 -44.813 1.00 27.73  ? 672  ARG E C     1 
ATOM   9248  O O     . ARG G 2 72  ? 50.731  14.698 -43.905 1.00 32.02  ? 672  ARG E O     1 
ATOM   9249  C CB    . ARG G 2 72  ? 48.022  16.562 -44.568 1.00 33.06  ? 672  ARG E CB    1 
ATOM   9250  C CG    . ARG G 2 72  ? 47.316  17.568 -43.738 1.00 36.96  ? 672  ARG E CG    1 
ATOM   9251  C CD    . ARG G 2 72  ? 45.891  17.653 -44.117 1.00 39.23  ? 672  ARG E CD    1 
ATOM   9252  N NE    . ARG G 2 72  ? 45.308  18.896 -43.632 1.00 42.40  ? 672  ARG E NE    1 
ATOM   9253  C CZ    . ARG G 2 72  ? 45.116  19.181 -42.348 1.00 44.36  ? 672  ARG E CZ    1 
ATOM   9254  N NH1   . ARG G 2 72  ? 45.454  18.315 -41.397 1.00 38.51  ? 672  ARG E NH1   1 
ATOM   9255  N NH2   . ARG G 2 72  ? 44.584  20.344 -42.014 1.00 44.45  ? 672  ARG E NH2   1 
ATOM   9256  N N     . GLU G 2 73  ? 50.397  15.129 -46.100 1.00 44.31  ? 673  GLU E N     1 
ATOM   9257  C CA    . GLU G 2 73  ? 51.073  13.948 -46.550 1.00 42.97  ? 673  GLU E CA    1 
ATOM   9258  C C     . GLU G 2 73  ? 52.521  13.947 -46.091 1.00 44.75  ? 673  GLU E C     1 
ATOM   9259  O O     . GLU G 2 73  ? 52.947  13.026 -45.411 1.00 46.42  ? 673  GLU E O     1 
ATOM   9260  C CB    . GLU G 2 73  ? 51.013  13.857 -48.065 1.00 47.10  ? 673  GLU E CB    1 
ATOM   9261  C CG    . GLU G 2 73  ? 51.706  12.624 -48.564 1.00 45.05  ? 673  GLU E CG    1 
ATOM   9262  C CD    . GLU G 2 73  ? 51.857  12.604 -50.058 1.00 46.15  ? 673  GLU E CD    1 
ATOM   9263  O OE1   . GLU G 2 73  ? 50.820  12.560 -50.737 1.00 46.34  ? 673  GLU E OE1   1 
ATOM   9264  O OE2   . GLU G 2 73  ? 53.001  12.634 -50.562 1.00 46.95  ? 673  GLU E OE2   1 
ATOM   9265  N N     . ILE G 2 74  ? 53.275  14.964 -46.487 1.00 29.66  ? 674  ILE E N     1 
ATOM   9266  C CA    . ILE G 2 74  ? 54.667  15.092 -46.109 1.00 28.29  ? 674  ILE E CA    1 
ATOM   9267  C C     . ILE G 2 74  ? 54.819  15.127 -44.595 1.00 26.81  ? 674  ILE E C     1 
ATOM   9268  O O     . ILE G 2 74  ? 55.785  14.599 -44.063 1.00 29.41  ? 674  ILE E O     1 
ATOM   9269  C CB    . ILE G 2 74  ? 55.290  16.366 -46.664 1.00 22.68  ? 674  ILE E CB    1 
ATOM   9270  C CG1   . ILE G 2 74  ? 55.341  16.328 -48.190 1.00 21.35  ? 674  ILE E CG1   1 
ATOM   9271  C CG2   . ILE G 2 74  ? 56.662  16.542 -46.107 1.00 16.74  ? 674  ILE E CG2   1 
ATOM   9272  C CD1   . ILE G 2 74  ? 55.703  17.708 -48.797 1.00 23.31  ? 674  ILE E CD1   1 
ATOM   9273  N N     . ALA G 2 75  ? 53.880  15.745 -43.889 1.00 25.29  ? 675  ALA E N     1 
ATOM   9274  C CA    . ALA G 2 75  ? 53.990  15.768 -42.434 1.00 25.80  ? 675  ALA E CA    1 
ATOM   9275  C C     . ALA G 2 75  ? 53.792  14.412 -41.810 1.00 27.85  ? 675  ALA E C     1 
ATOM   9276  O O     . ALA G 2 75  ? 54.552  14.027 -40.955 1.00 26.81  ? 675  ALA E O     1 
ATOM   9277  C CB    . ALA G 2 75  ? 52.992  16.720 -41.810 1.00 20.08  ? 675  ALA E CB    1 
ATOM   9278  N N     . GLN G 2 76  ? 52.765  13.685 -42.228 1.00 38.14  ? 676  GLN E N     1 
ATOM   9279  C CA    . GLN G 2 76  ? 52.471  12.401 -41.602 1.00 40.78  ? 676  GLN E CA    1 
ATOM   9280  C C     . GLN G 2 76  ? 53.368  11.298 -42.025 1.00 41.21  ? 676  GLN E C     1 
ATOM   9281  O O     . GLN G 2 76  ? 53.334  10.214 -41.458 1.00 40.50  ? 676  GLN E O     1 
ATOM   9282  C CB    . GLN G 2 76  ? 50.965  12.076 -41.747 1.00 34.36  ? 676  GLN E CB    1 
ATOM   9283  C CG    . GLN G 2 76  ? 50.497  10.662 -41.958 1.00 36.78  ? 676  GLN E CG    1 
ATOM   9284  C CD    . GLN G 2 76  ? 50.068  10.461 -43.402 1.00 34.94  ? 676  GLN E CD    1 
ATOM   9285  O OE1   . GLN G 2 76  ? 50.907  10.412 -44.349 1.00 33.24  ? 676  GLN E OE1   1 
ATOM   9286  N NE2   . GLN G 2 76  ? 48.765  10.367 -43.593 1.00 35.64  ? 676  GLN E NE2   1 
ATOM   9287  N N     . ASP G 2 77  ? 54.204  11.563 -43.011 1.00 34.44  ? 677  ASP E N     1 
ATOM   9288  C CA    . ASP G 2 77  ? 55.155  10.552 -43.375 1.00 36.85  ? 677  ASP E CA    1 
ATOM   9289  C C     . ASP G 2 77  ? 56.506  11.098 -42.620 1.00 39.41  ? 677  ASP E C     1 
ATOM   9290  O O     . ASP G 2 77  ? 57.606  10.883 -43.080 1.00 37.63  ? 677  ASP E O     1 
ATOM   9291  C CB    . ASP G 2 77  ? 55.115  10.305 -44.989 1.00 9.93   ? 677  ASP E CB    1 
ATOM   9292  C CG    . ASP G 2 77  ? 53.741  9.187  -45.627 1.00 12.92  ? 677  ASP E CG    1 
ATOM   9293  O OD1   . ASP G 2 77  ? 53.056  8.348  -44.899 1.00 14.57  ? 677  ASP E OD1   1 
ATOM   9294  O OD2   . ASP G 2 77  ? 53.377  9.095  -46.900 1.00 7.97   ? 677  ASP E OD2   1 
ATOM   9295  N N     . PHE G 2 78  ? 56.355  11.781 -41.438 1.00 53.55  ? 678  PHE E N     1 
ATOM   9296  C CA    . PHE G 2 78  ? 57.421  12.336 -40.509 1.00 57.03  ? 678  PHE E CA    1 
ATOM   9297  C C     . PHE G 2 78  ? 56.971  12.151 -39.043 1.00 55.27  ? 678  PHE E C     1 
ATOM   9298  O O     . PHE G 2 78  ? 57.796  11.964 -38.157 1.00 52.52  ? 678  PHE E O     1 
ATOM   9299  C CB    . PHE G 2 78  ? 57.716  13.838 -40.690 1.00 78.31  ? 678  PHE E CB    1 
ATOM   9300  C CG    . PHE G 2 78  ? 58.815  14.384 -39.752 1.00 82.51  ? 678  PHE E CG    1 
ATOM   9301  C CD1   . PHE G 2 78  ? 60.154  14.304 -40.098 1.00 81.81  ? 678  PHE E CD1   1 
ATOM   9302  C CD2   . PHE G 2 78  ? 58.507  14.986 -38.529 1.00 84.15  ? 678  PHE E CD2   1 
ATOM   9303  C CE1   . PHE G 2 78  ? 61.170  14.816 -39.242 1.00 80.78  ? 678  PHE E CE1   1 
ATOM   9304  C CE2   . PHE G 2 78  ? 59.523  15.495 -37.674 1.00 85.56  ? 678  PHE E CE2   1 
ATOM   9305  C CZ    . PHE G 2 78  ? 60.843  15.406 -38.041 1.00 82.26  ? 678  PHE E CZ    1 
ATOM   9306  N N     . LYS G 2 79  ? 55.668  12.218 -38.786 1.00 59.36  ? 679  LYS E N     1 
ATOM   9307  C CA    . LYS G 2 79  ? 55.128  12.009 -37.444 1.00 61.58  ? 679  LYS E CA    1 
ATOM   9308  C C     . LYS G 2 79  ? 53.625  11.793 -37.632 1.00 61.25  ? 679  LYS E C     1 
ATOM   9309  O O     . LYS G 2 79  ? 53.119  12.076 -38.702 1.00 59.52  ? 679  LYS E O     1 
ATOM   9310  C CB    . LYS G 2 79  ? 55.429  13.215 -36.548 1.00 47.82  ? 679  LYS E CB    1 
ATOM   9311  C CG    . LYS G 2 79  ? 55.675  12.873 -35.075 1.00 55.75  ? 679  LYS E CG    1 
ATOM   9312  C CD    . LYS G 2 79  ? 54.389  12.572 -34.358 1.00 60.94  ? 679  LYS E CD    1 
ATOM   9313  C CE    . LYS G 2 79  ? 54.652  12.030 -32.977 1.00 61.86  ? 679  LYS E CE    1 
ATOM   9314  N NZ    . LYS G 2 79  ? 53.491  11.131 -32.645 1.00 65.64  ? 679  LYS E NZ    1 
ATOM   9315  N N     . THR G 2 80  ? 52.931  11.281 -36.610 1.00 53.38  ? 680  THR E N     1 
ATOM   9316  C CA    . THR G 2 80  ? 51.491  10.995 -36.657 1.00 53.35  ? 680  THR E CA    1 
ATOM   9317  C C     . THR G 2 80  ? 50.675  11.812 -35.660 1.00 53.59  ? 680  THR E C     1 
ATOM   9318  O O     . THR G 2 80  ? 51.233  12.595 -34.878 1.00 57.23  ? 680  THR E O     1 
ATOM   9319  C CB    . THR G 2 80  ? 51.240  9.533  -36.359 1.00 107.67 ? 680  THR E CB    1 
ATOM   9320  O OG1   . THR G 2 80  ? 51.758  9.217  -35.060 1.00 106.35 ? 680  THR E OG1   1 
ATOM   9321  C CG2   . THR G 2 80  ? 51.928  8.688  -37.381 1.00 109.22 ? 680  THR E CG2   1 
ATOM   9322  N N     . ASP G 2 81  ? 49.364  11.586 -35.655 1.00 57.97  ? 681  ASP E N     1 
ATOM   9323  C CA    . ASP G 2 81  ? 48.462  12.314 -34.771 1.00 61.73  ? 681  ASP E CA    1 
ATOM   9324  C C     . ASP G 2 81  ? 48.822  13.782 -34.810 1.00 62.25  ? 681  ASP E C     1 
ATOM   9325  O O     . ASP G 2 81  ? 48.905  14.447 -33.775 1.00 61.70  ? 681  ASP E O     1 
ATOM   9326  C CB    . ASP G 2 81  ? 48.537  11.810 -33.317 1.00 153.68 ? 681  ASP E CB    1 
ATOM   9327  C CG    . ASP G 2 81  ? 47.680  10.581 -33.076 1.00 159.78 ? 681  ASP E CG    1 
ATOM   9328  O OD1   . ASP G 2 81  ? 48.039  9.508  -33.606 1.00 163.79 ? 681  ASP E OD1   1 
ATOM   9329  O OD2   . ASP G 2 81  ? 46.652  10.690 -32.363 1.00 164.64 ? 681  ASP E OD2   1 
ATOM   9330  N N     . LEU G 2 82  ? 49.040  14.294 -36.013 1.00 61.83  ? 682  LEU E N     1 
ATOM   9331  C CA    . LEU G 2 82  ? 49.386  15.698 -36.148 1.00 60.38  ? 682  LEU E CA    1 
ATOM   9332  C C     . LEU G 2 82  ? 48.275  16.531 -36.736 1.00 57.78  ? 682  LEU E C     1 
ATOM   9333  O O     . LEU G 2 82  ? 47.786  16.276 -37.836 1.00 58.60  ? 682  LEU E O     1 
ATOM   9334  C CB    . LEU G 2 82  ? 50.649  15.898 -37.000 1.00 42.35  ? 682  LEU E CB    1 
ATOM   9335  C CG    . LEU G 2 82  ? 52.037  15.662 -36.387 1.00 40.51  ? 682  LEU E CG    1 
ATOM   9336  C CD1   . LEU G 2 82  ? 53.092  15.927 -37.450 1.00 40.40  ? 682  LEU E CD1   1 
ATOM   9337  C CD2   . LEU G 2 82  ? 52.246  16.553 -35.185 1.00 40.39  ? 682  LEU E CD2   1 
ATOM   9338  N N     . ARG G 2 83  ? 47.871  17.532 -35.974 1.00 40.40  ? 683  ARG E N     1 
ATOM   9339  C CA    . ARG G 2 83  ? 46.875  18.449 -36.438 1.00 39.94  ? 683  ARG E CA    1 
ATOM   9340  C C     . ARG G 2 83  ? 47.563  19.758 -36.927 1.00 39.22  ? 683  ARG E C     1 
ATOM   9341  O O     . ARG G 2 83  ? 48.703  20.095 -36.522 1.00 36.06  ? 683  ARG E O     1 
ATOM   9342  C CB    . ARG G 2 83  ? 45.895  18.716 -35.319 1.00 56.00  ? 683  ARG E CB    1 
ATOM   9343  C CG    . ARG G 2 83  ? 44.993  17.570 -35.084 1.00 60.89  ? 683  ARG E CG    1 
ATOM   9344  C CD    . ARG G 2 83  ? 44.408  17.625 -33.701 1.00 66.20  ? 683  ARG E CD    1 
ATOM   9345  N NE    . ARG G 2 83  ? 43.310  16.681 -33.549 1.00 75.60  ? 683  ARG E NE    1 
ATOM   9346  C CZ    . ARG G 2 83  ? 42.082  16.896 -34.013 1.00 76.77  ? 683  ARG E CZ    1 
ATOM   9347  N NH1   . ARG G 2 83  ? 41.797  18.027 -34.654 1.00 78.48  ? 683  ARG E NH1   1 
ATOM   9348  N NH2   . ARG G 2 83  ? 41.139  15.977 -33.842 1.00 81.89  ? 683  ARG E NH2   1 
ATOM   9349  N N     . PHE G 2 84  ? 46.870  20.471 -37.818 1.00 36.75  ? 684  PHE E N     1 
ATOM   9350  C CA    . PHE G 2 84  ? 47.369  21.714 -38.349 1.00 38.61  ? 684  PHE E CA    1 
ATOM   9351  C C     . PHE G 2 84  ? 46.414  22.900 -38.177 1.00 35.69  ? 684  PHE E C     1 
ATOM   9352  O O     . PHE G 2 84  ? 45.224  22.788 -38.490 1.00 38.97  ? 684  PHE E O     1 
ATOM   9353  C CB    . PHE G 2 84  ? 47.677  21.547 -39.833 1.00 50.93  ? 684  PHE E CB    1 
ATOM   9354  C CG    . PHE G 2 84  ? 48.998  20.903 -40.116 1.00 49.66  ? 684  PHE E CG    1 
ATOM   9355  C CD1   . PHE G 2 84  ? 49.128  19.520 -40.138 1.00 51.20  ? 684  PHE E CD1   1 
ATOM   9356  C CD2   . PHE G 2 84  ? 50.132  21.686 -40.349 1.00 49.85  ? 684  PHE E CD2   1 
ATOM   9357  C CE1   . PHE G 2 84  ? 50.379  18.939 -40.405 1.00 50.52  ? 684  PHE E CE1   1 
ATOM   9358  C CE2   . PHE G 2 84  ? 51.365  21.110 -40.612 1.00 50.30  ? 684  PHE E CE2   1 
ATOM   9359  C CZ    . PHE G 2 84  ? 51.493  19.745 -40.636 1.00 52.11  ? 684  PHE E CZ    1 
ATOM   9360  N N     . GLN G 2 85  ? 46.940  24.025 -37.670 1.00 36.79  ? 685  GLN E N     1 
ATOM   9361  C CA    . GLN G 2 85  ? 46.162  25.255 -37.554 1.00 36.34  ? 685  GLN E CA    1 
ATOM   9362  C C     . GLN G 2 85  ? 46.069  25.630 -39.027 1.00 36.25  ? 685  GLN E C     1 
ATOM   9363  O O     . GLN G 2 85  ? 46.942  25.309 -39.837 1.00 33.43  ? 685  GLN E O     1 
ATOM   9364  C CB    . GLN G 2 85  ? 46.899  26.359 -36.800 1.00 36.34  ? 685  GLN E CB    1 
ATOM   9365  C CG    . GLN G 2 85  ? 47.139  26.152 -35.321 1.00 37.40  ? 685  GLN E CG    1 
ATOM   9366  C CD    . GLN G 2 85  ? 47.708  27.429 -34.662 1.00 40.61  ? 685  GLN E CD    1 
ATOM   9367  O OE1   . GLN G 2 85  ? 48.251  28.291 -35.341 1.00 39.02  ? 685  GLN E OE1   1 
ATOM   9368  N NE2   . GLN G 2 85  ? 47.594  27.537 -33.342 1.00 41.06  ? 685  GLN E NE2   1 
ATOM   9369  N N     . SER G 2 86  ? 45.013  26.322 -39.378 1.00 42.35  ? 686  SER E N     1 
ATOM   9370  C CA    . SER G 2 86  ? 44.794  26.648 -40.754 1.00 42.53  ? 686  SER E CA    1 
ATOM   9371  C C     . SER G 2 86  ? 45.843  27.559 -41.228 1.00 40.79  ? 686  SER E C     1 
ATOM   9372  O O     . SER G 2 86  ? 46.425  27.381 -42.298 1.00 40.46  ? 686  SER E O     1 
ATOM   9373  C CB    . SER G 2 86  ? 43.468  27.355 -40.889 1.00 24.53  ? 686  SER E CB    1 
ATOM   9374  O OG    . SER G 2 86  ? 43.415  28.412 -39.952 1.00 35.13  ? 686  SER E OG    1 
ATOM   9375  N N     . SER G 2 87  ? 46.119  28.516 -40.364 1.00 31.89  ? 687  SER E N     1 
ATOM   9376  C CA    . SER G 2 87  ? 47.001  29.540 -40.798 1.00 33.37  ? 687  SER E CA    1 
ATOM   9377  C C     . SER G 2 87  ? 48.362  29.044 -40.935 1.00 32.36  ? 687  SER E C     1 
ATOM   9378  O O     . SER G 2 87  ? 49.190  29.614 -41.631 1.00 31.36  ? 687  SER E O     1 
ATOM   9379  C CB    . SER G 2 87  ? 46.900  30.817 -39.973 1.00 38.32  ? 687  SER E CB    1 
ATOM   9380  O OG    . SER G 2 87  ? 46.462  30.578 -38.660 1.00 49.72  ? 687  SER E OG    1 
ATOM   9381  N N     . ALA G 2 88  ? 48.572  27.885 -40.355 1.00 30.18  ? 688  ALA E N     1 
ATOM   9382  C CA    . ALA G 2 88  ? 49.863  27.219 -40.433 1.00 30.66  ? 688  ALA E CA    1 
ATOM   9383  C C     . ALA G 2 88  ? 50.137  26.668 -41.867 1.00 31.18  ? 688  ALA E C     1 
ATOM   9384  O O     . ALA G 2 88  ? 51.244  26.746 -42.414 1.00 27.68  ? 688  ALA E O     1 
ATOM   9385  C CB    . ALA G 2 88  ? 49.894  26.113 -39.411 1.00 21.51  ? 688  ALA E CB    1 
ATOM   9386  N N     . VAL G 2 89  ? 49.105  26.103 -42.461 1.00 30.85  ? 689  VAL E N     1 
ATOM   9387  C CA    . VAL G 2 89  ? 49.182  25.618 -43.810 1.00 33.88  ? 689  VAL E CA    1 
ATOM   9388  C C     . VAL G 2 89  ? 49.231  26.803 -44.758 1.00 32.81  ? 689  VAL E C     1 
ATOM   9389  O O     . VAL G 2 89  ? 49.639  26.662 -45.903 1.00 33.85  ? 689  VAL E O     1 
ATOM   9390  C CB    . VAL G 2 89  ? 47.945  24.875 -44.188 1.00 43.07  ? 689  VAL E CB    1 
ATOM   9391  C CG1   . VAL G 2 89  ? 48.233  24.067 -45.420 1.00 41.97  ? 689  VAL E CG1   1 
ATOM   9392  C CG2   . VAL G 2 89  ? 47.436  24.065 -43.004 1.00 45.28  ? 689  VAL E CG2   1 
ATOM   9393  N N     . MET G 2 90  ? 48.760  27.958 -44.310 1.00 30.33  ? 690  MET E N     1 
ATOM   9394  C CA    . MET G 2 90  ? 48.773  29.132 -45.169 1.00 32.01  ? 690  MET E CA    1 
ATOM   9395  C C     . MET G 2 90  ? 50.124  29.826 -45.173 1.00 28.97  ? 690  MET E C     1 
ATOM   9396  O O     . MET G 2 90  ? 50.525  30.433 -46.184 1.00 30.18  ? 690  MET E O     1 
ATOM   9397  C CB    . MET G 2 90  ? 47.685  30.101 -44.763 1.00 47.20  ? 690  MET E CB    1 
ATOM   9398  C CG    . MET G 2 90  ? 46.324  29.624 -45.183 1.00 55.54  ? 690  MET E CG    1 
ATOM   9399  S SD    . MET G 2 90  ? 46.181  29.472 -46.961 1.00 64.30  ? 690  MET E SD    1 
ATOM   9400  C CE    . MET G 2 90  ? 46.196  31.207 -47.373 1.00 59.80  ? 690  MET E CE    1 
ATOM   9401  N N     . ALA G 2 91  ? 50.823  29.738 -44.038 1.00 29.40  ? 691  ALA E N     1 
ATOM   9402  C CA    . ALA G 2 91  ? 52.160  30.296 -43.905 1.00 30.65  ? 691  ALA E CA    1 
ATOM   9403  C C     . ALA G 2 91  ? 53.091  29.514 -44.826 1.00 30.34  ? 691  ALA E C     1 
ATOM   9404  O O     . ALA G 2 91  ? 53.972  30.088 -45.473 1.00 29.83  ? 691  ALA E O     1 
ATOM   9405  C CB    . ALA G 2 91  ? 52.610  30.134 -42.517 1.00 7.13   ? 691  ALA E CB    1 
ATOM   9406  N N     . LEU G 2 92  ? 52.874  28.201 -44.862 1.00 33.27  ? 692  LEU E N     1 
ATOM   9407  C CA    . LEU G 2 92  ? 53.673  27.301 -45.662 1.00 33.99  ? 692  LEU E CA    1 
ATOM   9408  C C     . LEU G 2 92  ? 53.431  27.516 -47.131 1.00 33.12  ? 692  LEU E C     1 
ATOM   9409  O O     . LEU G 2 92  ? 54.329  27.295 -47.937 1.00 30.29  ? 692  LEU E O     1 
ATOM   9410  C CB    . LEU G 2 92  ? 53.365  25.846 -45.319 1.00 31.19  ? 692  LEU E CB    1 
ATOM   9411  C CG    . LEU G 2 92  ? 53.879  25.194 -44.039 1.00 33.30  ? 692  LEU E CG    1 
ATOM   9412  C CD1   . LEU G 2 92  ? 53.022  23.986 -43.743 1.00 33.57  ? 692  LEU E CD1   1 
ATOM   9413  C CD2   . LEU G 2 92  ? 55.335  24.800 -44.193 1.00 31.08  ? 692  LEU E CD2   1 
ATOM   9414  N N     . GLN G 2 93  ? 52.218  27.930 -47.490 1.00 32.14  ? 693  GLN E N     1 
ATOM   9415  C CA    . GLN G 2 93  ? 51.939  28.172 -48.897 1.00 36.45  ? 693  GLN E CA    1 
ATOM   9416  C C     . GLN G 2 93  ? 52.494  29.534 -49.291 1.00 36.64  ? 693  GLN E C     1 
ATOM   9417  O O     . GLN G 2 93  ? 52.984  29.714 -50.405 1.00 37.61  ? 693  GLN E O     1 
ATOM   9418  C CB    . GLN G 2 93  ? 50.450  28.109 -49.198 1.00 31.57  ? 693  GLN E CB    1 
ATOM   9419  C CG    . GLN G 2 93  ? 50.213  27.987 -50.684 1.00 32.31  ? 693  GLN E CG    1 
ATOM   9420  C CD    . GLN G 2 93  ? 48.764  27.815 -51.043 1.00 36.28  ? 693  GLN E CD    1 
ATOM   9421  O OE1   . GLN G 2 93  ? 48.007  27.184 -50.318 1.00 34.63  ? 693  GLN E OE1   1 
ATOM   9422  N NE2   . GLN G 2 93  ? 48.369  28.369 -52.172 1.00 34.59  ? 693  GLN E NE2   1 
ATOM   9423  N N     . GLU G 2 94  ? 52.417  30.490 -48.367 1.00 23.88  ? 694  GLU E N     1 
ATOM   9424  C CA    . GLU G 2 94  ? 52.952  31.814 -48.590 1.00 23.32  ? 694  GLU E CA    1 
ATOM   9425  C C     . GLU G 2 94  ? 54.449  31.692 -48.878 1.00 22.52  ? 694  GLU E C     1 
ATOM   9426  O O     . GLU G 2 94  ? 54.976  32.223 -49.855 1.00 21.23  ? 694  GLU E O     1 
ATOM   9427  C CB    . GLU G 2 94  ? 52.720  32.678 -47.357 1.00 63.94  ? 694  GLU E CB    1 
ATOM   9428  C CG    . GLU G 2 94  ? 51.333  33.307 -47.299 1.00 63.45  ? 694  GLU E CG    1 
ATOM   9429  C CD    . GLU G 2 94  ? 51.047  34.255 -48.469 1.00 68.65  ? 694  GLU E CD    1 
ATOM   9430  O OE1   . GLU G 2 94  ? 51.985  34.937 -48.925 1.00 67.94  ? 694  GLU E OE1   1 
ATOM   9431  O OE2   . GLU G 2 94  ? 49.884  34.336 -48.923 1.00 71.53  ? 694  GLU E OE2   1 
ATOM   9432  N N     . ALA G 2 95  ? 55.130  30.970 -48.016 1.00 20.12  ? 695  ALA E N     1 
ATOM   9433  C CA    . ALA G 2 95  ? 56.541  30.760 -48.145 1.00 19.31  ? 695  ALA E CA    1 
ATOM   9434  C C     . ALA G 2 95  ? 56.940  29.987 -49.391 1.00 19.91  ? 695  ALA E C     1 
ATOM   9435  O O     . ALA G 2 95  ? 57.956  30.274 -50.012 1.00 18.74  ? 695  ALA E O     1 
ATOM   9436  C CB    . ALA G 2 95  ? 57.008  30.003 -46.931 1.00 13.76  ? 695  ALA E CB    1 
ATOM   9437  N N     . SER G 2 96  ? 56.179  28.946 -49.723 1.00 30.04  ? 696  SER E N     1 
ATOM   9438  C CA    . SER G 2 96  ? 56.525  28.093 -50.853 1.00 29.44  ? 696  SER E CA    1 
ATOM   9439  C C     . SER G 2 96  ? 56.447  28.819 -52.148 1.00 26.98  ? 696  SER E C     1 
ATOM   9440  O O     . SER G 2 96  ? 57.348  28.704 -52.997 1.00 27.81  ? 696  SER E O     1 
ATOM   9441  C CB    . SER G 2 96  ? 55.621  26.884 -50.888 1.00 38.34  ? 696  SER E CB    1 
ATOM   9442  O OG    . SER G 2 96  ? 55.846  26.125 -49.720 1.00 44.14  ? 696  SER E OG    1 
ATOM   9443  N N     . GLU G 2 97  ? 55.359  29.569 -52.309 1.00 32.68  ? 697  GLU E N     1 
ATOM   9444  C CA    . GLU G 2 97  ? 55.197  30.344 -53.513 1.00 33.50  ? 697  GLU E CA    1 
ATOM   9445  C C     . GLU G 2 97  ? 56.299  31.436 -53.571 1.00 30.92  ? 697  GLU E C     1 
ATOM   9446  O O     . GLU G 2 97  ? 56.952  31.653 -54.587 1.00 32.57  ? 697  GLU E O     1 
ATOM   9447  C CB    . GLU G 2 97  ? 53.810  30.936 -53.521 1.00 50.09  ? 697  GLU E CB    1 
ATOM   9448  C CG    . GLU G 2 97  ? 52.757  29.892 -53.643 1.00 51.53  ? 697  GLU E CG    1 
ATOM   9449  C CD    . GLU G 2 97  ? 51.531  30.391 -54.409 1.00 56.03  ? 697  GLU E CD    1 
ATOM   9450  O OE1   . GLU G 2 97  ? 51.661  31.446 -55.093 1.00 52.29  ? 697  GLU E OE1   1 
ATOM   9451  O OE2   . GLU G 2 97  ? 50.457  29.727 -54.334 1.00 56.87  ? 697  GLU E OE2   1 
ATOM   9452  N N     . ALA G 2 98  ? 56.512  32.102 -52.455 1.00 20.21  ? 698  ALA E N     1 
ATOM   9453  C CA    . ALA G 2 98  ? 57.510  33.126 -52.399 1.00 22.26  ? 698  ALA E CA    1 
ATOM   9454  C C     . ALA G 2 98  ? 58.800  32.509 -52.902 1.00 23.59  ? 698  ALA E C     1 
ATOM   9455  O O     . ALA G 2 98  ? 59.430  33.050 -53.805 1.00 23.94  ? 698  ALA E O     1 
ATOM   9456  C CB    . ALA G 2 98  ? 57.654  33.624 -50.971 1.00 3.22   ? 698  ALA E CB    1 
ATOM   9457  N N     . TYR G 2 99  ? 59.157  31.361 -52.329 1.00 29.31  ? 699  TYR E N     1 
ATOM   9458  C CA    . TYR G 2 99  ? 60.347  30.613 -52.675 1.00 26.76  ? 699  TYR E CA    1 
ATOM   9459  C C     . TYR G 2 99  ? 60.419  30.227 -54.164 1.00 27.23  ? 699  TYR E C     1 
ATOM   9460  O O     . TYR G 2 99  ? 61.436  30.460 -54.822 1.00 28.13  ? 699  TYR E O     1 
ATOM   9461  C CB    . TYR G 2 99  ? 60.443  29.357 -51.810 1.00 28.35  ? 699  TYR E CB    1 
ATOM   9462  C CG    . TYR G 2 99  ? 61.648  28.511 -52.171 1.00 29.85  ? 699  TYR E CG    1 
ATOM   9463  C CD1   . TYR G 2 99  ? 62.947  28.925 -51.842 1.00 28.72  ? 699  TYR E CD1   1 
ATOM   9464  C CD2   . TYR G 2 99  ? 61.496  27.334 -52.921 1.00 32.52  ? 699  TYR E CD2   1 
ATOM   9465  C CE1   . TYR G 2 99  ? 64.065  28.184 -52.264 1.00 30.81  ? 699  TYR E CE1   1 
ATOM   9466  C CE2   . TYR G 2 99  ? 62.597  26.581 -53.351 1.00 31.26  ? 699  TYR E CE2   1 
ATOM   9467  C CZ    . TYR G 2 99  ? 63.885  27.003 -53.028 1.00 34.28  ? 699  TYR E CZ    1 
ATOM   9468  O OH    . TYR G 2 99  ? 64.983  26.273 -53.487 1.00 32.55  ? 699  TYR E OH    1 
ATOM   9469  N N     . LEU G 2 100 ? 59.349  29.636 -54.694 1.00 30.25  ? 700  LEU E N     1 
ATOM   9470  C CA    . LEU G 2 100 ? 59.310  29.235 -56.098 1.00 30.64  ? 700  LEU E CA    1 
ATOM   9471  C C     . LEU G 2 100 ? 59.355  30.415 -57.095 1.00 29.42  ? 700  LEU E C     1 
ATOM   9472  O O     . LEU G 2 100 ? 60.059  30.369 -58.088 1.00 31.04  ? 700  LEU E O     1 
ATOM   9473  C CB    . LEU G 2 100 ? 58.068  28.373 -56.349 1.00 18.68  ? 700  LEU E CB    1 
ATOM   9474  C CG    . LEU G 2 100 ? 58.110  26.902 -55.890 1.00 23.85  ? 700  LEU E CG    1 
ATOM   9475  C CD1   . LEU G 2 100 ? 56.760  26.223 -56.096 1.00 20.33  ? 700  LEU E CD1   1 
ATOM   9476  C CD2   . LEU G 2 100 ? 59.154  26.185 -56.662 1.00 19.79  ? 700  LEU E CD2   1 
ATOM   9477  N N     . VAL G 2 101 ? 58.597  31.470 -56.850 1.00 22.32  ? 701  VAL E N     1 
ATOM   9478  C CA    . VAL G 2 101 ? 58.615  32.638 -57.741 1.00 21.85  ? 701  VAL E CA    1 
ATOM   9479  C C     . VAL G 2 101 ? 60.048  33.192 -57.780 1.00 18.13  ? 701  VAL E C     1 
ATOM   9480  O O     . VAL G 2 101 ? 60.559  33.612 -58.829 1.00 21.16  ? 701  VAL E O     1 
ATOM   9481  C CB    . VAL G 2 101 ? 57.591  33.711 -57.229 1.00 7.33   ? 701  VAL E CB    1 
ATOM   9482  C CG1   . VAL G 2 101 ? 57.666  34.982 -58.011 1.00 6.62   ? 701  VAL E CG1   1 
ATOM   9483  C CG2   . VAL G 2 101 ? 56.193  33.158 -57.338 1.00 7.70   ? 701  VAL E CG2   1 
ATOM   9484  N N     . ALA G 2 102 ? 60.680  33.185 -56.615 1.00 29.18  ? 702  ALA E N     1 
ATOM   9485  C CA    . ALA G 2 102 ? 62.046  33.639 -56.477 1.00 29.72  ? 702  ALA E CA    1 
ATOM   9486  C C     . ALA G 2 102 ? 62.937  32.772 -57.357 1.00 30.74  ? 702  ALA E C     1 
ATOM   9487  O O     . ALA G 2 102 ? 63.690  33.250 -58.171 1.00 32.25  ? 702  ALA E O     1 
ATOM   9488  C CB    . ALA G 2 102 ? 62.472  33.482 -55.053 1.00 16.94  ? 702  ALA E CB    1 
ATOM   9489  N N     . LEU G 2 103 ? 62.867  31.467 -57.156 1.00 35.62  ? 703  LEU E N     1 
ATOM   9490  C CA    . LEU G 2 103 ? 63.666  30.549 -57.918 1.00 31.40  ? 703  LEU E CA    1 
ATOM   9491  C C     . LEU G 2 103 ? 63.465  30.810 -59.389 1.00 31.84  ? 703  LEU E C     1 
ATOM   9492  O O     . LEU G 2 103 ? 64.427  30.965 -60.110 1.00 30.77  ? 703  LEU E O     1 
ATOM   9493  C CB    . LEU G 2 103 ? 63.275  29.137 -57.548 1.00 18.58  ? 703  LEU E CB    1 
ATOM   9494  C CG    . LEU G 2 103 ? 64.156  28.099 -58.188 1.00 21.19  ? 703  LEU E CG    1 
ATOM   9495  C CD1   . LEU G 2 103 ? 65.625  28.366 -57.951 1.00 21.37  ? 703  LEU E CD1   1 
ATOM   9496  C CD2   . LEU G 2 103 ? 63.798  26.810 -57.589 1.00 19.92  ? 703  LEU E CD2   1 
ATOM   9497  N N     . PHE G 2 104 ? 62.214  30.887 -59.834 1.00 35.28  ? 704  PHE E N     1 
ATOM   9498  C CA    . PHE G 2 104 ? 61.918  31.144 -61.233 1.00 36.32  ? 704  PHE E CA    1 
ATOM   9499  C C     . PHE G 2 104 ? 62.560  32.399 -61.801 1.00 37.16  ? 704  PHE E C     1 
ATOM   9500  O O     . PHE G 2 104 ? 62.985  32.371 -62.940 1.00 40.09  ? 704  PHE E O     1 
ATOM   9501  C CB    . PHE G 2 104 ? 60.411  31.202 -61.483 1.00 29.84  ? 704  PHE E CB    1 
ATOM   9502  C CG    . PHE G 2 104 ? 59.752  29.861 -61.596 1.00 29.43  ? 704  PHE E CG    1 
ATOM   9503  C CD1   . PHE G 2 104 ? 58.663  29.553 -60.806 1.00 30.11  ? 704  PHE E CD1   1 
ATOM   9504  C CD2   . PHE G 2 104 ? 60.270  28.868 -62.438 1.00 30.32  ? 704  PHE E CD2   1 
ATOM   9505  C CE1   . PHE G 2 104 ? 58.107  28.275 -60.825 1.00 29.75  ? 704  PHE E CE1   1 
ATOM   9506  C CE2   . PHE G 2 104 ? 59.709  27.583 -62.460 1.00 29.80  ? 704  PHE E CE2   1 
ATOM   9507  C CZ    . PHE G 2 104 ? 58.625  27.298 -61.644 1.00 30.65  ? 704  PHE E CZ    1 
ATOM   9508  N N     . GLU G 2 105 ? 62.630  33.504 -61.068 1.00 39.32  ? 705  GLU E N     1 
ATOM   9509  C CA    . GLU G 2 105 ? 63.296  34.703 -61.625 1.00 41.47  ? 705  GLU E CA    1 
ATOM   9510  C C     . GLU G 2 105 ? 64.815  34.408 -61.895 1.00 39.70  ? 705  GLU E C     1 
ATOM   9511  O O     . GLU G 2 105 ? 65.364  34.721 -62.967 1.00 39.94  ? 705  GLU E O     1 
ATOM   9512  C CB    . GLU G 2 105 ? 63.172  35.897 -60.672 1.00 36.92  ? 705  GLU E CB    1 
ATOM   9513  C CG    . GLU G 2 105 ? 61.916  35.922 -59.850 1.00 44.11  ? 705  GLU E CG    1 
ATOM   9514  C CD    . GLU G 2 105 ? 61.783  37.216 -59.062 1.00 47.64  ? 705  GLU E CD    1 
ATOM   9515  O OE1   . GLU G 2 105 ? 62.868  37.763 -58.753 1.00 46.93  ? 705  GLU E OE1   1 
ATOM   9516  O OE2   . GLU G 2 105 ? 60.631  37.681 -58.752 1.00 47.31  ? 705  GLU E OE2   1 
ATOM   9517  N N     . ASP G 2 106 ? 65.489  33.803 -60.920 1.00 27.89  ? 706  ASP E N     1 
ATOM   9518  C CA    . ASP G 2 106 ? 66.890  33.442 -61.076 1.00 28.32  ? 706  ASP E CA    1 
ATOM   9519  C C     . ASP G 2 106 ? 67.047  32.491 -62.253 1.00 26.62  ? 706  ASP E C     1 
ATOM   9520  O O     . ASP G 2 106 ? 67.954  32.617 -63.040 1.00 26.90  ? 706  ASP E O     1 
ATOM   9521  C CB    . ASP G 2 106 ? 67.390  32.765 -59.814 1.00 66.00  ? 706  ASP E CB    1 
ATOM   9522  C CG    . ASP G 2 106 ? 67.361  33.684 -58.626 1.00 69.87  ? 706  ASP E CG    1 
ATOM   9523  O OD1   . ASP G 2 106 ? 66.631  34.707 -58.684 1.00 70.78  ? 706  ASP E OD1   1 
ATOM   9524  O OD2   . ASP G 2 106 ? 68.061  33.371 -57.633 1.00 70.44  ? 706  ASP E OD2   1 
ATOM   9525  N N     . THR G 2 107 ? 66.145  31.528 -62.354 1.00 32.85  ? 707  THR E N     1 
ATOM   9526  C CA    . THR G 2 107 ? 66.175  30.554 -63.434 1.00 29.16  ? 707  THR E CA    1 
ATOM   9527  C C     . THR G 2 107 ? 66.006  31.263 -64.753 1.00 29.97  ? 707  THR E C     1 
ATOM   9528  O O     . THR G 2 107 ? 66.663  30.946 -65.734 1.00 31.70  ? 707  THR E O     1 
ATOM   9529  C CB    . THR G 2 107 ? 65.050  29.571 -63.286 1.00 54.89  ? 707  THR E CB    1 
ATOM   9530  O OG1   . THR G 2 107 ? 65.307  28.753 -62.145 1.00 52.09  ? 707  THR E OG1   1 
ATOM   9531  C CG2   . THR G 2 107 ? 64.925  28.715 -64.528 1.00 57.07  ? 707  THR E CG2   1 
ATOM   9532  N N     . ASN G 2 108 ? 65.110  32.236 -64.762 1.00 40.62  ? 708  ASN E N     1 
ATOM   9533  C CA    . ASN G 2 108 ? 64.842  33.010 -65.953 1.00 39.05  ? 708  ASN E CA    1 
ATOM   9534  C C     . ASN G 2 108 ? 66.095  33.816 -66.358 1.00 43.99  ? 708  ASN E C     1 
ATOM   9535  O O     . ASN G 2 108 ? 66.379  34.032 -67.542 1.00 43.11  ? 708  ASN E O     1 
ATOM   9536  C CB    . ASN G 2 108 ? 63.661  33.902 -65.652 1.00 26.93  ? 708  ASN E CB    1 
ATOM   9537  C CG    . ASN G 2 108 ? 63.208  34.692 -66.838 1.00 28.39  ? 708  ASN E CG    1 
ATOM   9538  O OD1   . ASN G 2 108 ? 63.268  34.221 -67.969 1.00 31.11  ? 708  ASN E OD1   1 
ATOM   9539  N ND2   . ASN G 2 108 ? 62.727  35.906 -66.581 1.00 30.22  ? 708  ASN E ND2   1 
ATOM   9540  N N     . LEU G 2 109 ? 66.841  34.269 -65.363 1.00 38.79  ? 709  LEU E N     1 
ATOM   9541  C CA    . LEU G 2 109 ? 68.072  34.971 -65.632 1.00 38.64  ? 709  LEU E CA    1 
ATOM   9542  C C     . LEU G 2 109 ? 69.132  34.047 -66.276 1.00 39.59  ? 709  LEU E C     1 
ATOM   9543  O O     . LEU G 2 109 ? 69.752  34.421 -67.254 1.00 37.75  ? 709  LEU E O     1 
ATOM   9544  C CB    . LEU G 2 109 ? 68.630  35.508 -64.342 1.00 28.64  ? 709  LEU E CB    1 
ATOM   9545  C CG    . LEU G 2 109 ? 68.057  36.802 -63.838 1.00 30.00  ? 709  LEU E CG    1 
ATOM   9546  C CD1   . LEU G 2 109 ? 68.843  37.198 -62.624 1.00 31.86  ? 709  LEU E CD1   1 
ATOM   9547  C CD2   . LEU G 2 109 ? 68.155  37.845 -64.912 1.00 30.04  ? 709  LEU E CD2   1 
ATOM   9548  N N     . CYS G 2 110 ? 69.357  32.855 -65.720 1.00 53.34  ? 710  CYS E N     1 
ATOM   9549  C CA    . CYS G 2 110 ? 70.343  31.935 -66.289 1.00 57.35  ? 710  CYS E CA    1 
ATOM   9550  C C     . CYS G 2 110 ? 70.020  31.658 -67.746 1.00 56.66  ? 710  CYS E C     1 
ATOM   9551  O O     . CYS G 2 110 ? 70.915  31.583 -68.582 1.00 55.07  ? 710  CYS E O     1 
ATOM   9552  C CB    . CYS G 2 110 ? 70.394  30.612 -65.518 1.00 54.35  ? 710  CYS E CB    1 
ATOM   9553  S SG    . CYS G 2 110 ? 70.971  30.757 -63.810 1.00 61.57  ? 710  CYS E SG    1 
ATOM   9554  N N     . ALA G 2 111 ? 68.741  31.502 -68.051 1.00 34.95  ? 711  ALA E N     1 
ATOM   9555  C CA    . ALA G 2 111 ? 68.319  31.260 -69.426 1.00 33.98  ? 711  ALA E CA    1 
ATOM   9556  C C     . ALA G 2 111 ? 68.727  32.416 -70.360 1.00 33.59  ? 711  ALA E C     1 
ATOM   9557  O O     . ALA G 2 111 ? 69.240  32.189 -71.446 1.00 34.13  ? 711  ALA E O     1 
ATOM   9558  C CB    . ALA G 2 111 ? 66.796  31.063 -69.490 1.00 52.59  ? 711  ALA E CB    1 
ATOM   9559  N N     . ILE G 2 112 ? 68.494  33.654 -69.942 1.00 36.72  ? 712  ILE E N     1 
ATOM   9560  C CA    . ILE G 2 112 ? 68.822  34.790 -70.786 1.00 37.79  ? 712  ILE E CA    1 
ATOM   9561  C C     . ILE G 2 112 ? 70.325  34.921 -70.999 1.00 40.18  ? 712  ILE E C     1 
ATOM   9562  O O     . ILE G 2 112 ? 70.777  35.459 -71.995 1.00 41.52  ? 712  ILE E O     1 
ATOM   9563  C CB    . ILE G 2 112 ? 68.279  36.061 -70.165 1.00 29.66  ? 712  ILE E CB    1 
ATOM   9564  C CG1   . ILE G 2 112 ? 66.763  35.942 -70.018 1.00 25.71  ? 712  ILE E CG1   1 
ATOM   9565  C CG2   . ILE G 2 112 ? 68.623  37.226 -70.999 1.00 28.45  ? 712  ILE E CG2   1 
ATOM   9566  C CD1   . ILE G 2 112 ? 66.101  37.071 -69.203 1.00 28.32  ? 712  ILE E CD1   1 
ATOM   9567  N N     . HIS G 2 113 ? 71.090  34.410 -70.042 1.00 40.41  ? 713  HIS E N     1 
ATOM   9568  C CA    . HIS G 2 113 ? 72.540  34.435 -70.051 1.00 42.39  ? 713  HIS E CA    1 
ATOM   9569  C C     . HIS G 2 113 ? 72.977  33.470 -71.104 1.00 44.71  ? 713  HIS E C     1 
ATOM   9570  O O     . HIS G 2 113 ? 73.996  33.637 -71.762 1.00 46.75  ? 713  HIS E O     1 
ATOM   9571  C CB    . HIS G 2 113 ? 73.026  33.973 -68.705 1.00 49.65  ? 713  HIS E CB    1 
ATOM   9572  C CG    . HIS G 2 113 ? 74.504  33.973 -68.574 1.00 48.20  ? 713  HIS E CG    1 
ATOM   9573  N ND1   . HIS G 2 113 ? 75.250  32.816 -68.605 1.00 46.98  ? 713  HIS E ND1   1 
ATOM   9574  C CD2   . HIS G 2 113 ? 75.384  34.989 -68.418 1.00 49.03  ? 713  HIS E CD2   1 
ATOM   9575  C CE1   . HIS G 2 113 ? 76.529  33.117 -68.473 1.00 47.93  ? 713  HIS E CE1   1 
ATOM   9576  N NE2   . HIS G 2 113 ? 76.637  34.429 -68.359 1.00 47.89  ? 713  HIS E NE2   1 
ATOM   9577  N N     . ALA G 2 114 ? 72.172  32.437 -71.247 1.00 60.49  ? 714  ALA E N     1 
ATOM   9578  C CA    . ALA G 2 114 ? 72.398  31.391 -72.222 1.00 63.29  ? 714  ALA E CA    1 
ATOM   9579  C C     . ALA G 2 114 ? 71.905  31.840 -73.585 1.00 63.11  ? 714  ALA E C     1 
ATOM   9580  O O     . ALA G 2 114 ? 72.143  31.169 -74.579 1.00 62.58  ? 714  ALA E O     1 
ATOM   9581  C CB    . ALA G 2 114 ? 71.643  30.146 -71.803 1.00 23.04  ? 714  ALA E CB    1 
ATOM   9582  N N     . LYS G 2 115 ? 71.197  32.963 -73.621 1.00 56.00  ? 715  LYS E N     1 
ATOM   9583  C CA    . LYS G 2 115 ? 70.644  33.474 -74.871 1.00 58.41  ? 715  LYS E CA    1 
ATOM   9584  C C     . LYS G 2 115 ? 69.401  32.664 -75.307 1.00 57.52  ? 715  LYS E C     1 
ATOM   9585  O O     . LYS G 2 115 ? 69.104  32.521 -76.500 1.00 57.27  ? 715  LYS E O     1 
ATOM   9586  C CB    . LYS G 2 115 ? 71.719  33.471 -75.978 1.00 75.91  ? 715  LYS E CB    1 
ATOM   9587  C CG    . LYS G 2 115 ? 72.860  34.470 -75.752 1.00 83.41  ? 715  LYS E CG    1 
ATOM   9588  C CD    . LYS G 2 115 ? 73.886  34.427 -76.868 1.00 88.99  ? 715  LYS E CD    1 
ATOM   9589  C CE    . LYS G 2 115 ? 74.931  35.513 -76.678 1.00 93.28  ? 715  LYS E CE    1 
ATOM   9590  N NZ    . LYS G 2 115 ? 75.806  35.665 -77.873 1.00 97.70  ? 715  LYS E NZ    1 
ATOM   9591  N N     . HIS G 2 116 ? 68.692  32.148 -74.304 1.00 54.41  ? 716  HIS E N     1 
ATOM   9592  C CA    . HIS G 2 116 ? 67.464  31.371 -74.453 1.00 53.05  ? 716  HIS E CA    1 
ATOM   9593  C C     . HIS G 2 116 ? 66.366  32.168 -73.767 1.00 53.47  ? 716  HIS E C     1 
ATOM   9594  O O     . HIS G 2 116 ? 66.625  33.084 -72.992 1.00 53.47  ? 716  HIS E O     1 
ATOM   9595  C CB    . HIS G 2 116 ? 67.596  30.042 -73.735 1.00 82.41  ? 716  HIS E CB    1 
ATOM   9596  C CG    . HIS G 2 116 ? 68.658  29.166 -74.296 1.00 84.26  ? 716  HIS E CG    1 
ATOM   9597  N ND1   . HIS G 2 116 ? 69.571  29.612 -75.221 1.00 63.79  ? 716  HIS E ND1   1 
ATOM   9598  C CD2   . HIS G 2 116 ? 68.939  27.861 -74.083 1.00 63.79  ? 716  HIS E CD2   1 
ATOM   9599  C CE1   . HIS G 2 116 ? 70.369  28.615 -75.560 1.00 63.79  ? 716  HIS E CE1   1 
ATOM   9600  N NE2   . HIS G 2 116 ? 70.006  27.539 -74.884 1.00 63.79  ? 716  HIS E NE2   1 
ATOM   9601  N N     . VAL G 2 117 ? 65.127  31.821 -74.024 1.00 51.40  ? 717  VAL E N     1 
ATOM   9602  C CA    . VAL G 2 117 ? 64.055  32.550 -73.378 1.00 50.13  ? 717  VAL E CA    1 
ATOM   9603  C C     . VAL G 2 117 ? 63.184  31.539 -72.682 1.00 48.12  ? 717  VAL E C     1 
ATOM   9604  O O     . VAL G 2 117 ? 62.229  31.870 -72.003 1.00 50.66  ? 717  VAL E O     1 
ATOM   9605  C CB    . VAL G 2 117 ? 63.253  33.348 -74.416 1.00 37.23  ? 717  VAL E CB    1 
ATOM   9606  C CG1   . VAL G 2 117 ? 63.964  34.652 -74.683 1.00 37.93  ? 717  VAL E CG1   1 
ATOM   9607  C CG2   . VAL G 2 117 ? 63.116  32.549 -75.719 1.00 35.13  ? 717  VAL E CG2   1 
ATOM   9608  N N     . THR G 2 118 ? 63.571  30.290 -72.837 1.00 39.98  ? 718  THR E N     1 
ATOM   9609  C CA    . THR G 2 118 ? 62.845  29.187 -72.280 1.00 41.61  ? 718  THR E CA    1 
ATOM   9610  C C     . THR G 2 118 ? 63.611  28.618 -71.113 1.00 39.56  ? 718  THR E C     1 
ATOM   9611  O O     . THR G 2 118 ? 64.690  28.061 -71.314 1.00 42.04  ? 718  THR E O     1 
ATOM   9612  C CB    . THR G 2 118 ? 62.686  28.071 -73.356 1.00 45.19  ? 718  THR E CB    1 
ATOM   9613  O OG1   . THR G 2 118 ? 62.247  28.650 -74.594 1.00 46.27  ? 718  THR E OG1   1 
ATOM   9614  C CG2   . THR G 2 118 ? 61.670  27.020 -72.913 1.00 43.90  ? 718  THR E CG2   1 
ATOM   9615  N N     . ILE G 2 119 ? 63.089  28.742 -69.896 1.00 28.97  ? 719  ILE E N     1 
ATOM   9616  C CA    . ILE G 2 119 ? 63.789  28.152 -68.755 1.00 28.61  ? 719  ILE E CA    1 
ATOM   9617  C C     . ILE G 2 119 ? 63.804  26.615 -68.909 1.00 30.44  ? 719  ILE E C     1 
ATOM   9618  O O     . ILE G 2 119 ? 62.759  25.988 -69.088 1.00 28.74  ? 719  ILE E O     1 
ATOM   9619  C CB    . ILE G 2 119 ? 63.108  28.516 -67.436 1.00 35.56  ? 719  ILE E CB    1 
ATOM   9620  C CG1   . ILE G 2 119 ? 61.674  27.964 -67.398 1.00 36.08  ? 719  ILE E CG1   1 
ATOM   9621  C CG2   . ILE G 2 119 ? 63.080  29.998 -67.294 1.00 34.09  ? 719  ILE E CG2   1 
ATOM   9622  C CD1   . ILE G 2 119 ? 60.982  28.087 -66.052 1.00 36.24  ? 719  ILE E CD1   1 
ATOM   9623  N N     . MET G 2 120 ? 64.988  26.007 -68.870 1.00 30.26  ? 720  MET E N     1 
ATOM   9624  C CA    . MET G 2 120 ? 65.107  24.548 -68.981 1.00 33.70  ? 720  MET E CA    1 
ATOM   9625  C C     . MET G 2 120 ? 65.579  24.008 -67.639 1.00 34.14  ? 720  MET E C     1 
ATOM   9626  O O     . MET G 2 120 ? 65.985  24.785 -66.778 1.00 32.45  ? 720  MET E O     1 
ATOM   9627  C CB    . MET G 2 120 ? 66.056  24.209 -70.117 1.00 68.19  ? 720  MET E CB    1 
ATOM   9628  C CG    . MET G 2 120 ? 65.665  25.043 -71.325 1.00 67.94  ? 720  MET E CG    1 
ATOM   9629  S SD    . MET G 2 120 ? 65.924  24.365 -72.953 1.00 74.61  ? 720  MET E SD    1 
ATOM   9630  C CE    . MET G 2 120 ? 66.890  25.591 -73.646 1.00 79.30  ? 720  MET E CE    1 
ATOM   9631  N N     . PRO G 2 121 ? 65.482  22.684 -67.407 1.00 50.05  ? 721  PRO E N     1 
ATOM   9632  C CA    . PRO G 2 121 ? 65.906  22.091 -66.134 1.00 50.24  ? 721  PRO E CA    1 
ATOM   9633  C C     . PRO G 2 121 ? 67.294  22.450 -65.687 1.00 48.62  ? 721  PRO E C     1 
ATOM   9634  O O     . PRO G 2 121 ? 67.537  22.681 -64.503 1.00 51.12  ? 721  PRO E O     1 
ATOM   9635  C CB    . PRO G 2 121 ? 65.749  20.608 -66.389 1.00 55.40  ? 721  PRO E CB    1 
ATOM   9636  C CG    . PRO G 2 121 ? 64.520  20.573 -67.185 1.00 55.89  ? 721  PRO E CG    1 
ATOM   9637  C CD    . PRO G 2 121 ? 64.770  21.674 -68.207 1.00 55.71  ? 721  PRO E CD    1 
ATOM   9638  N N     . LYS G 2 122 ? 68.208  22.509 -66.632 1.00 43.54  ? 722  LYS E N     1 
ATOM   9639  C CA    . LYS G 2 122 ? 69.567  22.831 -66.261 1.00 46.69  ? 722  LYS E CA    1 
ATOM   9640  C C     . LYS G 2 122 ? 69.641  24.244 -65.750 1.00 43.38  ? 722  LYS E C     1 
ATOM   9641  O O     . LYS G 2 122 ? 70.522  24.574 -64.983 1.00 43.49  ? 722  LYS E O     1 
ATOM   9642  C CB    . LYS G 2 122 ? 70.535  22.616 -67.433 1.00 67.04  ? 722  LYS E CB    1 
ATOM   9643  C CG    . LYS G 2 122 ? 70.492  23.662 -68.519 1.00 71.79  ? 722  LYS E CG    1 
ATOM   9644  C CD    . LYS G 2 122 ? 71.006  23.067 -69.822 1.00 77.14  ? 722  LYS E CD    1 
ATOM   9645  C CE    . LYS G 2 122 ? 72.346  22.409 -69.657 1.00 83.56  ? 722  LYS E CE    1 
ATOM   9646  N NZ    . LYS G 2 122 ? 72.747  21.752 -70.927 1.00 84.69  ? 722  LYS E NZ    1 
ATOM   9647  N N     . ASP G 2 123 ? 68.723  25.091 -66.174 1.00 40.12  ? 723  ASP E N     1 
ATOM   9648  C CA    . ASP G 2 123 ? 68.704  26.457 -65.665 1.00 39.23  ? 723  ASP E CA    1 
ATOM   9649  C C     . ASP G 2 123 ? 68.407  26.441 -64.175 1.00 40.14  ? 723  ASP E C     1 
ATOM   9650  O O     . ASP G 2 123 ? 69.059  27.106 -63.419 1.00 38.32  ? 723  ASP E O     1 
ATOM   9651  C CB    . ASP G 2 123 ? 67.635  27.280 -66.370 1.00 78.99  ? 723  ASP E CB    1 
ATOM   9652  C CG    . ASP G 2 123 ? 67.986  27.562 -67.802 1.00 77.41  ? 723  ASP E CG    1 
ATOM   9653  O OD1   . ASP G 2 123 ? 69.163  27.885 -68.056 1.00 77.42  ? 723  ASP E OD1   1 
ATOM   9654  O OD2   . ASP G 2 123 ? 67.090  27.475 -68.668 1.00 79.00  ? 723  ASP E OD2   1 
ATOM   9655  N N     . ILE G 2 124 ? 67.408  25.675 -63.764 1.00 43.95  ? 724  ILE E N     1 
ATOM   9656  C CA    . ILE G 2 124 ? 67.025  25.577 -62.360 1.00 44.91  ? 724  ILE E CA    1 
ATOM   9657  C C     . ILE G 2 124 ? 68.181  24.991 -61.592 1.00 45.92  ? 724  ILE E C     1 
ATOM   9658  O O     . ILE G 2 124 ? 68.475  25.395 -60.478 1.00 46.68  ? 724  ILE E O     1 
ATOM   9659  C CB    . ILE G 2 124 ? 65.801  24.639 -62.158 1.00 48.39  ? 724  ILE E CB    1 
ATOM   9660  C CG1   . ILE G 2 124 ? 64.658  25.084 -63.065 1.00 49.69  ? 724  ILE E CG1   1 
ATOM   9661  C CG2   . ILE G 2 124 ? 65.351  24.649 -60.695 1.00 47.43  ? 724  ILE E CG2   1 
ATOM   9662  C CD1   . ILE G 2 124 ? 63.293  24.525 -62.661 1.00 45.89  ? 724  ILE E CD1   1 
ATOM   9663  N N     . GLN G 2 125 ? 68.848  24.022 -62.193 1.00 49.75  ? 725  GLN E N     1 
ATOM   9664  C CA    . GLN G 2 125 ? 69.950  23.395 -61.504 1.00 50.26  ? 725  GLN E CA    1 
ATOM   9665  C C     . GLN G 2 125 ? 71.087  24.377 -61.261 1.00 47.07  ? 725  GLN E C     1 
ATOM   9666  O O     . GLN G 2 125 ? 71.622  24.436 -60.158 1.00 48.14  ? 725  GLN E O     1 
ATOM   9667  C CB    . GLN G 2 125 ? 70.392  22.166 -62.283 1.00 74.03  ? 725  GLN E CB    1 
ATOM   9668  C CG    . GLN G 2 125 ? 69.297  21.124 -62.323 1.00 76.16  ? 725  GLN E CG    1 
ATOM   9669  C CD    . GLN G 2 125 ? 69.778  19.778 -62.823 1.00 81.62  ? 725  GLN E CD    1 
ATOM   9670  O OE1   . GLN G 2 125 ? 70.603  19.118 -62.179 1.00 83.47  ? 725  GLN E OE1   1 
ATOM   9671  N NE2   . GLN G 2 125 ? 69.263  19.354 -63.979 1.00 80.79  ? 725  GLN E NE2   1 
ATOM   9672  N N     . LEU G 2 126 ? 71.426  25.172 -62.275 1.00 38.47  ? 726  LEU E N     1 
ATOM   9673  C CA    . LEU G 2 126 ? 72.512  26.152 -62.168 1.00 38.99  ? 726  LEU E CA    1 
ATOM   9674  C C     . LEU G 2 126 ? 72.162  27.159 -61.111 1.00 39.79  ? 726  LEU E C     1 
ATOM   9675  O O     . LEU G 2 126 ? 72.951  27.455 -60.213 1.00 39.25  ? 726  LEU E O     1 
ATOM   9676  C CB    . LEU G 2 126 ? 72.752  26.889 -63.502 1.00 49.12  ? 726  LEU E CB    1 
ATOM   9677  C CG    . LEU G 2 126 ? 73.786  28.021 -63.419 1.00 52.56  ? 726  LEU E CG    1 
ATOM   9678  C CD1   . LEU G 2 126 ? 75.036  27.428 -62.911 1.00 52.30  ? 726  LEU E CD1   1 
ATOM   9679  C CD2   . LEU G 2 126 ? 74.094  28.660 -64.739 1.00 51.74  ? 726  LEU E CD2   1 
ATOM   9680  N N     . ALA G 2 127 ? 70.953  27.677 -61.228 1.00 37.73  ? 727  ALA E N     1 
ATOM   9681  C CA    . ALA G 2 127 ? 70.466  28.664 -60.287 1.00 40.20  ? 727  ALA E CA    1 
ATOM   9682  C C     . ALA G 2 127 ? 70.564  28.116 -58.859 1.00 41.20  ? 727  ALA E C     1 
ATOM   9683  O O     . ALA G 2 127 ? 71.233  28.710 -58.008 1.00 42.52  ? 727  ALA E O     1 
ATOM   9684  C CB    . ALA G 2 127 ? 69.018  29.066 -60.626 1.00 26.81  ? 727  ALA E CB    1 
ATOM   9685  N N     . ARG G 2 128 ? 69.900  26.986 -58.623 1.00 44.95  ? 728  ARG E N     1 
ATOM   9686  C CA    . ARG G 2 128 ? 69.873  26.311 -57.328 1.00 47.50  ? 728  ARG E CA    1 
ATOM   9687  C C     . ARG G 2 128 ? 71.246  26.067 -56.725 1.00 48.61  ? 728  ARG E C     1 
ATOM   9688  O O     . ARG G 2 128 ? 71.427  26.173 -55.513 1.00 44.71  ? 728  ARG E O     1 
ATOM   9689  C CB    . ARG G 2 128 ? 69.170  24.982 -57.486 1.00 46.72  ? 728  ARG E CB    1 
ATOM   9690  C CG    . ARG G 2 128 ? 67.707  25.126 -57.610 1.00 48.31  ? 728  ARG E CG    1 
ATOM   9691  C CD    . ARG G 2 128 ? 67.114  24.588 -56.369 1.00 55.43  ? 728  ARG E CD    1 
ATOM   9692  N NE    . ARG G 2 128 ? 67.177  23.141 -56.371 1.00 65.92  ? 728  ARG E NE    1 
ATOM   9693  C CZ    . ARG G 2 128 ? 66.825  22.425 -55.325 1.00 64.87  ? 728  ARG E CZ    1 
ATOM   9694  N NH1   . ARG G 2 128 ? 66.418  23.054 -54.230 1.00 63.37  ? 728  ARG E NH1   1 
ATOM   9695  N NH2   . ARG G 2 128 ? 66.821  21.104 -55.386 1.00 66.32  ? 728  ARG E NH2   1 
ATOM   9696  N N     . ARG G 2 129 ? 72.193  25.708 -57.588 1.00 36.73  ? 729  ARG E N     1 
ATOM   9697  C CA    . ARG G 2 129 ? 73.579  25.455 -57.213 1.00 41.97  ? 729  ARG E CA    1 
ATOM   9698  C C     . ARG G 2 129 ? 74.216  26.766 -56.767 1.00 41.63  ? 729  ARG E C     1 
ATOM   9699  O O     . ARG G 2 129 ? 74.619  26.927 -55.629 1.00 40.76  ? 729  ARG E O     1 
ATOM   9700  C CB    . ARG G 2 129 ? 74.337  24.882 -58.427 1.00 59.55  ? 729  ARG E CB    1 
ATOM   9701  C CG    . ARG G 2 129 ? 75.815  24.659 -58.221 1.00 67.21  ? 729  ARG E CG    1 
ATOM   9702  C CD    . ARG G 2 129 ? 76.340  23.640 -59.202 1.00 75.37  ? 729  ARG E CD    1 
ATOM   9703  N NE    . ARG G 2 129 ? 77.788  23.433 -59.101 1.00 80.85  ? 729  ARG E NE    1 
ATOM   9704  C CZ    . ARG G 2 129 ? 78.465  22.531 -59.820 1.00 82.23  ? 729  ARG E CZ    1 
ATOM   9705  N NH1   . ARG G 2 129 ? 77.821  21.750 -60.683 1.00 82.21  ? 729  ARG E NH1   1 
ATOM   9706  N NH2   . ARG G 2 129 ? 79.787  22.420 -59.701 1.00 81.14  ? 729  ARG E NH2   1 
ATOM   9707  N N     . ILE G 2 130 ? 74.292  27.716 -57.675 1.00 53.35  ? 730  ILE E N     1 
ATOM   9708  C CA    . ILE G 2 130 ? 74.893  28.962 -57.314 1.00 55.04  ? 730  ILE E CA    1 
ATOM   9709  C C     . ILE G 2 130 ? 74.250  29.532 -56.075 1.00 56.34  ? 730  ILE E C     1 
ATOM   9710  O O     . ILE G 2 130 ? 74.939  30.089 -55.228 1.00 55.15  ? 730  ILE E O     1 
ATOM   9711  C CB    . ILE G 2 130 ? 74.813  29.939 -58.469 1.00 45.36  ? 730  ILE E CB    1 
ATOM   9712  C CG1   . ILE G 2 130 ? 75.788  29.463 -59.552 1.00 48.32  ? 730  ILE E CG1   1 
ATOM   9713  C CG2   . ILE G 2 130 ? 75.110  31.363 -57.992 1.00 42.92  ? 730  ILE E CG2   1 
ATOM   9714  C CD1   . ILE G 2 130 ? 75.768  30.299 -60.787 1.00 51.19  ? 730  ILE E CD1   1 
ATOM   9715  N N     . ARG G 2 131 ? 72.933  29.369 -55.967 1.00 67.69  ? 731  ARG E N     1 
ATOM   9716  C CA    . ARG G 2 131 ? 72.132  29.852 -54.835 1.00 70.14  ? 731  ARG E CA    1 
ATOM   9717  C C     . ARG G 2 131 ? 72.644  29.268 -53.533 1.00 71.47  ? 731  ARG E C     1 
ATOM   9718  O O     . ARG G 2 131 ? 72.453  29.837 -52.467 1.00 74.60  ? 731  ARG E O     1 
ATOM   9719  C CB    . ARG G 2 131 ? 70.673  29.441 -55.032 1.00 66.62  ? 731  ARG E CB    1 
ATOM   9720  C CG    . ARG G 2 131 ? 69.715  30.572 -55.312 1.00 63.43  ? 731  ARG E CG    1 
ATOM   9721  C CD    . ARG G 2 131 ? 68.553  30.081 -56.162 1.00 64.24  ? 731  ARG E CD    1 
ATOM   9722  N NE    . ARG G 2 131 ? 67.323  30.825 -55.904 1.00 62.10  ? 731  ARG E NE    1 
ATOM   9723  C CZ    . ARG G 2 131 ? 66.537  30.597 -54.857 1.00 61.98  ? 731  ARG E CZ    1 
ATOM   9724  N NH1   . ARG G 2 131 ? 66.882  29.643 -53.987 1.00 61.27  ? 731  ARG E NH1   1 
ATOM   9725  N NH2   . ARG G 2 131 ? 65.409  31.295 -54.686 1.00 57.81  ? 731  ARG E NH2   1 
ATOM   9726  N N     . GLY G 2 132 ? 73.276  28.111 -53.634 1.00 50.08  ? 732  GLY E N     1 
ATOM   9727  C CA    . GLY G 2 132 ? 73.831  27.455 -52.466 1.00 52.28  ? 732  GLY E CA    1 
ATOM   9728  C C     . GLY G 2 132 ? 72.970  26.331 -51.921 1.00 54.86  ? 732  GLY E C     1 
ATOM   9729  O O     . GLY G 2 132 ? 72.804  26.213 -50.717 1.00 52.41  ? 732  GLY E O     1 
ATOM   9730  N N     . GLU G 2 133 ? 72.445  25.488 -52.806 1.00 68.49  ? 733  GLU E N     1 
ATOM   9731  C CA    . GLU G 2 133 ? 71.572  24.365 -52.444 1.00 72.61  ? 733  GLU E CA    1 
ATOM   9732  C C     . GLU G 2 133 ? 72.129  23.054 -53.052 1.00 78.36  ? 733  GLU E C     1 
ATOM   9733  O O     . GLU G 2 133 ? 71.500  21.995 -53.089 1.00 80.01  ? 733  GLU E O     1 
ATOM   9734  C CB    . GLU G 2 133 ? 70.169  24.698 -52.968 1.00 54.38  ? 733  GLU E CB    1 
ATOM   9735  C CG    . GLU G 2 133 ? 69.628  26.022 -52.407 1.00 53.72  ? 733  GLU E CG    1 
ATOM   9736  C CD    . GLU G 2 133 ? 68.200  26.338 -52.861 1.00 48.66  ? 733  GLU E CD    1 
ATOM   9737  O OE1   . GLU G 2 133 ? 67.420  25.383 -53.100 1.00 49.04  ? 733  GLU E OE1   1 
ATOM   9738  O OE2   . GLU G 2 133 ? 67.844  27.543 -52.963 1.00 49.25  ? 733  GLU E OE2   1 
ATOM   9739  N N     . ARG G 2 134 ? 73.358  23.195 -53.510 1.00 132.02 ? 734  ARG E N     1 
ATOM   9740  C CA    . ARG G 2 134 ? 74.212  22.203 -54.150 1.00 139.67 ? 734  ARG E CA    1 
ATOM   9741  C C     . ARG G 2 134 ? 75.217  23.337 -54.385 1.00 142.17 ? 734  ARG E C     1 
ATOM   9742  O O     . ARG G 2 134 ? 75.027  24.399 -53.794 1.00 144.42 ? 734  ARG E O     1 
ATOM   9743  C CB    . ARG G 2 134 ? 73.577  21.686 -55.463 1.00 159.92 ? 734  ARG E CB    1 
ATOM   9744  C CG    . ARG G 2 134 ? 74.011  20.265 -55.919 1.00 163.36 ? 734  ARG E CG    1 
ATOM   9745  C CD    . ARG G 2 134 ? 73.037  19.657 -56.973 1.00 167.32 ? 734  ARG E CD    1 
ATOM   9746  N NE    . ARG G 2 134 ? 73.575  18.467 -57.653 1.00 173.44 ? 734  ARG E NE    1 
ATOM   9747  C CZ    . ARG G 2 134 ? 72.934  17.756 -58.585 1.00 173.80 ? 734  ARG E CZ    1 
ATOM   9748  N NH1   . ARG G 2 134 ? 71.709  18.095 -58.969 1.00 174.16 ? 734  ARG E NH1   1 
ATOM   9749  N NH2   . ARG G 2 134 ? 73.528  16.707 -59.150 1.00 174.56 ? 734  ARG E NH2   1 
ATOM   9750  N N     . ALA G 2 135 ? 76.244  23.170 -55.209 1.00 116.59 ? 735  ALA E N     1 
ATOM   9751  C CA    . ALA G 2 135 ? 77.223  24.248 -55.442 1.00 119.52 ? 735  ALA E CA    1 
ATOM   9752  C C     . ALA G 2 135 ? 78.572  23.837 -54.907 1.00 122.21 ? 735  ALA E C     1 
ATOM   9753  O O     . ALA G 2 135 ? 79.433  23.466 -55.730 1.00 80.81  ? 735  ALA E O     1 
ATOM   9754  C CB    . ALA G 2 135 ? 76.805  25.558 -54.761 1.00 158.17 ? 735  ALA E CB    1 
ATOM   9755  O OXT   . ALA G 2 135 ? 78.738  23.892 -53.668 1.00 119.65 ? 735  ALA E OXT   1 
ATOM   9756  N N     . VAL H 3 21  ? 43.808  7.262  -47.582 1.00 51.85  ? 221  VAL F N     1 
ATOM   9757  C CA    . VAL H 3 21  ? 45.248  7.575  -47.299 1.00 51.71  ? 221  VAL F CA    1 
ATOM   9758  C C     . VAL H 3 21  ? 45.803  8.452  -48.380 1.00 49.73  ? 221  VAL F C     1 
ATOM   9759  O O     . VAL H 3 21  ? 45.562  8.230  -49.569 1.00 51.70  ? 221  VAL F O     1 
ATOM   9760  C CB    . VAL H 3 21  ? 46.262  6.368  -47.294 1.00 101.35 ? 221  VAL F CB    1 
ATOM   9761  C CG1   . VAL H 3 21  ? 47.419  6.725  -46.331 1.00 96.50  ? 221  VAL F CG1   1 
ATOM   9762  C CG2   . VAL H 3 21  ? 45.621  5.048  -46.942 1.00 95.87  ? 221  VAL F CG2   1 
ATOM   9763  N N     . LEU H 3 22  ? 46.623  9.404  -47.950 1.00 68.17  ? 222  LEU F N     1 
ATOM   9764  C CA    . LEU H 3 22  ? 47.215  10.342 -48.865 1.00 67.19  ? 222  LEU F CA    1 
ATOM   9765  C C     . LEU H 3 22  ? 48.435  9.795  -49.525 1.00 68.63  ? 222  LEU F C     1 
ATOM   9766  O O     . LEU H 3 22  ? 49.412  9.449  -48.881 1.00 65.59  ? 222  LEU F O     1 
ATOM   9767  C CB    . LEU H 3 22  ? 47.628  11.605 -48.151 1.00 31.96  ? 222  LEU F CB    1 
ATOM   9768  C CG    . LEU H 3 22  ? 47.052  11.982 -46.795 1.00 31.70  ? 222  LEU F CG    1 
ATOM   9769  C CD1   . LEU H 3 22  ? 48.072  12.768 -45.926 1.00 32.06  ? 222  LEU F CD1   1 
ATOM   9770  C CD2   . LEU H 3 22  ? 45.848  12.849 -47.038 1.00 33.49  ? 222  LEU F CD2   1 
ATOM   9771  N N     . ARG H 3 23  ? 48.381  9.732  -50.833 1.00 26.45  ? 223  ARG F N     1 
ATOM   9772  C CA    . ARG H 3 23  ? 49.525  9.265  -51.559 1.00 26.41  ? 223  ARG F CA    1 
ATOM   9773  C C     . ARG H 3 23  ? 49.500  10.035 -52.891 1.00 25.68  ? 223  ARG F C     1 
ATOM   9774  O O     . ARG H 3 23  ? 48.434  10.467 -53.341 1.00 26.26  ? 223  ARG F O     1 
ATOM   9775  C CB    . ARG H 3 23  ? 49.446  7.735  -51.693 1.00 17.94  ? 223  ARG F CB    1 
ATOM   9776  C CG    . ARG H 3 23  ? 49.194  7.172  -53.034 1.00 27.29  ? 223  ARG F CG    1 
ATOM   9777  C CD    . ARG H 3 23  ? 48.856  5.726  -52.823 1.00 34.27  ? 223  ARG F CD    1 
ATOM   9778  N NE    . ARG H 3 23  ? 47.487  5.456  -53.253 1.00 45.54  ? 223  ARG F NE    1 
ATOM   9779  C CZ    . ARG H 3 23  ? 47.129  5.184  -54.499 1.00 51.72  ? 223  ARG F CZ    1 
ATOM   9780  N NH1   . ARG H 3 23  ? 48.024  5.126  -55.475 1.00 56.82  ? 223  ARG F NH1   1 
ATOM   9781  N NH2   . ARG H 3 23  ? 45.856  4.987  -54.766 1.00 57.78  ? 223  ARG F NH2   1 
ATOM   9782  N N     . ASP H 3 24  ? 50.691  10.282 -53.450 1.00 42.80  ? 224  ASP F N     1 
ATOM   9783  C CA    . ASP H 3 24  ? 50.888  11.031 -54.700 1.00 43.65  ? 224  ASP F CA    1 
ATOM   9784  C C     . ASP H 3 24  ? 50.328  12.463 -54.777 1.00 40.27  ? 224  ASP F C     1 
ATOM   9785  O O     . ASP H 3 24  ? 50.115  12.999 -55.850 1.00 41.76  ? 224  ASP F O     1 
ATOM   9786  C CB    . ASP H 3 24  ? 50.380  10.223 -55.885 1.00 91.19  ? 224  ASP F CB    1 
ATOM   9787  C CG    . ASP H 3 24  ? 51.197  10.466 -57.133 1.00 93.75  ? 224  ASP F CG    1 
ATOM   9788  O OD1   . ASP H 3 24  ? 52.446  10.476 -57.015 1.00 95.15  ? 224  ASP F OD1   1 
ATOM   9789  O OD2   . ASP H 3 24  ? 50.599  10.633 -58.223 1.00 93.94  ? 224  ASP F OD2   1 
ATOM   9790  N N     . ASN H 3 25  ? 50.098  13.094 -53.638 1.00 39.38  ? 225  ASN F N     1 
ATOM   9791  C CA    . ASN H 3 25  ? 49.616  14.468 -53.630 1.00 44.41  ? 225  ASN F CA    1 
ATOM   9792  C C     . ASN H 3 25  ? 50.580  15.470 -54.261 1.00 42.57  ? 225  ASN F C     1 
ATOM   9793  O O     . ASN H 3 25  ? 50.303  16.649 -54.242 1.00 44.95  ? 225  ASN F O     1 
ATOM   9794  C CB    . ASN H 3 25  ? 49.333  14.913 -52.205 1.00 47.98  ? 225  ASN F CB    1 
ATOM   9795  C CG    . ASN H 3 25  ? 48.068  14.335 -51.684 1.00 51.94  ? 225  ASN F CG    1 
ATOM   9796  O OD1   . ASN H 3 25  ? 46.971  14.814 -52.008 1.00 49.90  ? 225  ASN F OD1   1 
ATOM   9797  N ND2   . ASN H 3 25  ? 48.185  13.276 -50.898 1.00 50.51  ? 225  ASN F ND2   1 
ATOM   9798  N N     . ILE H 3 26  ? 51.715  15.034 -54.798 1.00 36.79  ? 226  ILE F N     1 
ATOM   9799  C CA    . ILE H 3 26  ? 52.641  15.996 -55.387 1.00 40.11  ? 226  ILE F CA    1 
ATOM   9800  C C     . ILE H 3 26  ? 52.059  16.396 -56.707 1.00 43.02  ? 226  ILE F C     1 
ATOM   9801  O O     . ILE H 3 26  ? 52.378  17.430 -57.229 1.00 41.70  ? 226  ILE F O     1 
ATOM   9802  C CB    . ILE H 3 26  ? 54.070  15.389 -55.637 1.00 34.80  ? 226  ILE F CB    1 
ATOM   9803  C CG1   . ILE H 3 26  ? 55.063  16.482 -56.080 1.00 37.26  ? 226  ILE F CG1   1 
ATOM   9804  C CG2   . ILE H 3 26  ? 53.989  14.294 -56.744 1.00 31.67  ? 226  ILE F CG2   1 
ATOM   9805  C CD1   . ILE H 3 26  ? 55.180  17.637 -55.134 1.00 34.15  ? 226  ILE F CD1   1 
ATOM   9806  N N     . GLN H 3 27  ? 51.202  15.554 -57.254 1.00 39.30  ? 227  GLN F N     1 
ATOM   9807  C CA    . GLN H 3 27  ? 50.577  15.841 -58.536 1.00 44.81  ? 227  GLN F CA    1 
ATOM   9808  C C     . GLN H 3 27  ? 49.462  16.853 -58.359 1.00 45.84  ? 227  GLN F C     1 
ATOM   9809  O O     . GLN H 3 27  ? 48.815  17.253 -59.310 1.00 48.91  ? 227  GLN F O     1 
ATOM   9810  C CB    . GLN H 3 27  ? 50.026  14.548 -59.154 1.00 43.38  ? 227  GLN F CB    1 
ATOM   9811  C CG    . GLN H 3 27  ? 51.109  13.635 -59.698 1.00 44.54  ? 227  GLN F CG    1 
ATOM   9812  C CD    . GLN H 3 27  ? 52.064  14.387 -60.618 1.00 47.16  ? 227  GLN F CD    1 
ATOM   9813  O OE1   . GLN H 3 27  ? 51.614  15.148 -61.484 1.00 51.88  ? 227  GLN F OE1   1 
ATOM   9814  N NE2   . GLN H 3 27  ? 53.379  14.187 -60.444 1.00 46.63  ? 227  GLN F NE2   1 
ATOM   9815  N N     . GLY H 3 28  ? 49.255  17.274 -57.126 1.00 37.47  ? 228  GLY F N     1 
ATOM   9816  C CA    . GLY H 3 28  ? 48.202  18.216 -56.824 1.00 39.57  ? 228  GLY F CA    1 
ATOM   9817  C C     . GLY H 3 28  ? 48.650  19.608 -57.118 1.00 39.58  ? 228  GLY F C     1 
ATOM   9818  O O     . GLY H 3 28  ? 47.956  20.564 -56.830 1.00 42.67  ? 228  GLY F O     1 
ATOM   9819  N N     . ILE H 3 29  ? 49.840  19.723 -57.667 1.00 33.22  ? 229  ILE F N     1 
ATOM   9820  C CA    . ILE H 3 29  ? 50.409  21.011 -58.032 1.00 32.30  ? 229  ILE F CA    1 
ATOM   9821  C C     . ILE H 3 29  ? 50.430  20.864 -59.538 1.00 28.13  ? 229  ILE F C     1 
ATOM   9822  O O     . ILE H 3 29  ? 51.371  20.306 -60.129 1.00 29.20  ? 229  ILE F O     1 
ATOM   9823  C CB    . ILE H 3 29  ? 51.841  21.152 -57.455 1.00 35.95  ? 229  ILE F CB    1 
ATOM   9824  C CG1   . ILE H 3 29  ? 51.837  20.673 -56.005 1.00 37.57  ? 229  ILE F CG1   1 
ATOM   9825  C CG2   . ILE H 3 29  ? 52.323  22.600 -57.524 1.00 35.95  ? 229  ILE F CG2   1 
ATOM   9826  C CD1   . ILE H 3 29  ? 50.652  21.148 -55.189 1.00 35.79  ? 229  ILE F CD1   1 
ATOM   9827  N N     . THR H 3 30  ? 49.338  21.318 -60.133 1.00 27.13  ? 230  THR F N     1 
ATOM   9828  C CA    . THR H 3 30  ? 49.093  21.230 -61.570 1.00 26.90  ? 230  THR F CA    1 
ATOM   9829  C C     . THR H 3 30  ? 50.024  22.032 -62.447 1.00 28.69  ? 230  THR F C     1 
ATOM   9830  O O     . THR H 3 30  ? 50.533  23.066 -62.031 1.00 26.80  ? 230  THR F O     1 
ATOM   9831  C CB    . THR H 3 30  ? 47.628  21.644 -61.864 1.00 35.24  ? 230  THR F CB    1 
ATOM   9832  O OG1   . THR H 3 30  ? 47.474  23.074 -61.738 1.00 36.73  ? 230  THR F OG1   1 
ATOM   9833  C CG2   . THR H 3 30  ? 46.678  20.935 -60.872 1.00 33.42  ? 230  THR F CG2   1 
ATOM   9834  N N     . LYS H 3 31  ? 50.265  21.526 -63.651 1.00 30.56  ? 231  LYS F N     1 
ATOM   9835  C CA    . LYS H 3 31  ? 51.092  22.210 -64.651 1.00 34.34  ? 231  LYS F CA    1 
ATOM   9836  C C     . LYS H 3 31  ? 50.650  23.702 -64.674 1.00 32.99  ? 231  LYS F C     1 
ATOM   9837  O O     . LYS H 3 31  ? 51.478  24.605 -64.651 1.00 32.00  ? 231  LYS F O     1 
ATOM   9838  C CB    . LYS H 3 31  ? 50.873  21.543 -66.016 1.00 33.76  ? 231  LYS F CB    1 
ATOM   9839  C CG    . LYS H 3 31  ? 51.754  22.019 -67.106 1.00 39.43  ? 231  LYS F CG    1 
ATOM   9840  C CD    . LYS H 3 31  ? 51.280  21.520 -68.446 1.00 41.72  ? 231  LYS F CD    1 
ATOM   9841  C CE    . LYS H 3 31  ? 51.800  22.466 -69.540 1.00 45.88  ? 231  LYS F CE    1 
ATOM   9842  N NZ    . LYS H 3 31  ? 51.604  22.007 -70.934 1.00 48.60  ? 231  LYS F NZ    1 
ATOM   9843  N N     . PRO H 3 32  ? 49.326  23.969 -64.733 1.00 44.06  ? 232  PRO F N     1 
ATOM   9844  C CA    . PRO H 3 32  ? 48.738  25.307 -64.734 1.00 45.60  ? 232  PRO F CA    1 
ATOM   9845  C C     . PRO H 3 32  ? 49.262  26.170 -63.566 1.00 45.60  ? 232  PRO F C     1 
ATOM   9846  O O     . PRO H 3 32  ? 49.691  27.295 -63.782 1.00 44.77  ? 232  PRO F O     1 
ATOM   9847  C CB    . PRO H 3 32  ? 47.258  24.999 -64.577 1.00 42.96  ? 232  PRO F CB    1 
ATOM   9848  C CG    . PRO H 3 32  ? 47.108  23.842 -65.420 1.00 44.73  ? 232  PRO F CG    1 
ATOM   9849  C CD    . PRO H 3 32  ? 48.286  22.986 -65.085 1.00 41.86  ? 232  PRO F CD    1 
ATOM   9850  N N     . ALA H 3 33  ? 49.218  25.645 -62.336 1.00 30.75  ? 233  ALA F N     1 
ATOM   9851  C CA    . ALA H 3 33  ? 49.713  26.395 -61.168 1.00 28.97  ? 233  ALA F CA    1 
ATOM   9852  C C     . ALA H 3 33  ? 51.205  26.705 -61.238 1.00 31.71  ? 233  ALA F C     1 
ATOM   9853  O O     . ALA H 3 33  ? 51.634  27.775 -60.803 1.00 29.63  ? 233  ALA F O     1 
ATOM   9854  C CB    . ALA H 3 33  ? 49.398  25.668 -59.854 1.00 29.42  ? 233  ALA F CB    1 
ATOM   9855  N N     . ILE H 3 34  ? 51.987  25.774 -61.785 1.00 38.17  ? 234  ILE F N     1 
ATOM   9856  C CA    . ILE H 3 34  ? 53.425  25.983 -61.948 1.00 39.68  ? 234  ILE F CA    1 
ATOM   9857  C C     . ILE H 3 34  ? 53.665  26.974 -63.083 1.00 41.38  ? 234  ILE F C     1 
ATOM   9858  O O     . ILE H 3 34  ? 54.667  27.678 -63.063 1.00 38.64  ? 234  ILE F O     1 
ATOM   9859  C CB    . ILE H 3 34  ? 54.178  24.662 -62.271 1.00 26.29  ? 234  ILE F CB    1 
ATOM   9860  C CG1   . ILE H 3 34  ? 54.111  23.735 -61.044 1.00 27.30  ? 234  ILE F CG1   1 
ATOM   9861  C CG2   . ILE H 3 34  ? 55.632  24.956 -62.733 1.00 26.15  ? 234  ILE F CG2   1 
ATOM   9862  C CD1   . ILE H 3 34  ? 54.413  22.286 -61.337 1.00 26.44  ? 234  ILE F CD1   1 
ATOM   9863  N N     . ARG H 3 35  ? 52.755  27.032 -64.067 1.00 27.14  ? 235  ARG F N     1 
ATOM   9864  C CA    . ARG H 3 35  ? 52.891  27.968 -65.182 1.00 27.10  ? 235  ARG F CA    1 
ATOM   9865  C C     . ARG H 3 35  ? 52.647  29.388 -64.654 1.00 26.37  ? 235  ARG F C     1 
ATOM   9866  O O     . ARG H 3 35  ? 53.382  30.314 -64.995 1.00 26.95  ? 235  ARG F O     1 
ATOM   9867  C CB    . ARG H 3 35  ? 51.897  27.632 -66.288 1.00 53.49  ? 235  ARG F CB    1 
ATOM   9868  C CG    . ARG H 3 35  ? 52.082  28.466 -67.544 1.00 62.84  ? 235  ARG F CG    1 
ATOM   9869  C CD    . ARG H 3 35  ? 50.835  28.522 -68.423 1.00 69.82  ? 235  ARG F CD    1 
ATOM   9870  N NE    . ARG H 3 35  ? 50.508  27.229 -69.017 1.00 81.09  ? 235  ARG F NE    1 
ATOM   9871  C CZ    . ARG H 3 35  ? 51.382  26.463 -69.665 1.00 87.27  ? 235  ARG F CZ    1 
ATOM   9872  N NH1   . ARG H 3 35  ? 52.641  26.861 -69.800 1.00 92.37  ? 235  ARG F NH1   1 
ATOM   9873  N NH2   . ARG H 3 35  ? 50.998  25.299 -70.174 1.00 93.33  ? 235  ARG F NH2   1 
ATOM   9874  N N     . ARG H 3 36  ? 51.624  29.546 -63.813 1.00 23.82  ? 236  ARG F N     1 
ATOM   9875  C CA    . ARG H 3 36  ? 51.298  30.825 -63.193 1.00 26.77  ? 236  ARG F CA    1 
ATOM   9876  C C     . ARG H 3 36  ? 52.405  31.362 -62.295 1.00 26.88  ? 236  ARG F C     1 
ATOM   9877  O O     . ARG H 3 36  ? 52.587  32.574 -62.222 1.00 27.37  ? 236  ARG F O     1 
ATOM   9878  C CB    . ARG H 3 36  ? 50.065  30.719 -62.299 1.00 30.49  ? 236  ARG F CB    1 
ATOM   9879  C CG    . ARG H 3 36  ? 48.759  30.568 -62.976 1.00 30.15  ? 236  ARG F CG    1 
ATOM   9880  C CD    . ARG H 3 36  ? 47.635  30.769 -61.998 1.00 32.74  ? 236  ARG F CD    1 
ATOM   9881  N NE    . ARG H 3 36  ? 47.371  29.640 -61.101 1.00 31.67  ? 236  ARG F NE    1 
ATOM   9882  C CZ    . ARG H 3 36  ? 46.760  28.490 -61.423 1.00 35.75  ? 236  ARG F CZ    1 
ATOM   9883  N NH1   . ARG H 3 36  ? 46.321  28.241 -62.652 1.00 29.70  ? 236  ARG F NH1   1 
ATOM   9884  N NH2   . ARG H 3 36  ? 46.552  27.590 -60.479 1.00 32.72  ? 236  ARG F NH2   1 
ATOM   9885  N N     . LEU H 3 37  ? 53.094  30.479 -61.565 1.00 32.28  ? 237  LEU F N     1 
ATOM   9886  C CA    . LEU H 3 37  ? 54.161  30.896 -60.647 1.00 31.30  ? 237  LEU F CA    1 
ATOM   9887  C C     . LEU H 3 37  ? 55.317  31.438 -61.412 1.00 32.74  ? 237  LEU F C     1 
ATOM   9888  O O     . LEU H 3 37  ? 56.063  32.280 -60.920 1.00 29.70  ? 237  LEU F O     1 
ATOM   9889  C CB    . LEU H 3 37  ? 54.713  29.735 -59.847 1.00 25.74  ? 237  LEU F CB    1 
ATOM   9890  C CG    . LEU H 3 37  ? 53.821  29.229 -58.760 1.00 25.48  ? 237  LEU F CG    1 
ATOM   9891  C CD1   . LEU H 3 37  ? 54.303  27.862 -58.273 1.00 25.84  ? 237  LEU F CD1   1 
ATOM   9892  C CD2   . LEU H 3 37  ? 53.786  30.231 -57.700 1.00 27.27  ? 237  LEU F CD2   1 
ATOM   9893  N N     . ALA H 3 38  ? 55.485  30.913 -62.614 1.00 25.65  ? 238  ALA F N     1 
ATOM   9894  C CA    . ALA H 3 38  ? 56.592  31.304 -63.456 1.00 28.35  ? 238  ALA F CA    1 
ATOM   9895  C C     . ALA H 3 38  ? 56.267  32.667 -64.114 1.00 31.13  ? 238  ALA F C     1 
ATOM   9896  O O     . ALA H 3 38  ? 57.145  33.510 -64.333 1.00 29.25  ? 238  ALA F O     1 
ATOM   9897  C CB    . ALA H 3 38  ? 56.857  30.174 -64.497 1.00 16.77  ? 238  ALA F CB    1 
ATOM   9898  N N     . ARG H 3 39  ? 55.000  32.899 -64.405 1.00 34.35  ? 239  ARG F N     1 
ATOM   9899  C CA    . ARG H 3 39  ? 54.650  34.178 -64.987 1.00 37.95  ? 239  ARG F CA    1 
ATOM   9900  C C     . ARG H 3 39  ? 55.008  35.285 -63.987 1.00 38.34  ? 239  ARG F C     1 
ATOM   9901  O O     . ARG H 3 39  ? 55.583  36.302 -64.386 1.00 39.76  ? 239  ARG F O     1 
ATOM   9902  C CB    . ARG H 3 39  ? 53.158  34.250 -65.302 1.00 30.23  ? 239  ARG F CB    1 
ATOM   9903  C CG    . ARG H 3 39  ? 52.706  33.304 -66.306 1.00 29.08  ? 239  ARG F CG    1 
ATOM   9904  C CD    . ARG H 3 39  ? 53.562  33.386 -67.519 1.00 32.52  ? 239  ARG F CD    1 
ATOM   9905  N NE    . ARG H 3 39  ? 52.875  32.631 -68.549 1.00 31.78  ? 239  ARG F NE    1 
ATOM   9906  C CZ    . ARG H 3 39  ? 53.462  31.960 -69.513 1.00 35.09  ? 239  ARG F CZ    1 
ATOM   9907  N NH1   . ARG H 3 39  ? 54.777  31.932 -69.620 1.00 34.22  ? 239  ARG F NH1   1 
ATOM   9908  N NH2   . ARG H 3 39  ? 52.703  31.293 -70.347 1.00 36.09  ? 239  ARG F NH2   1 
ATOM   9909  N N     . ARG H 3 40  ? 54.637  35.097 -62.710 1.00 20.49  ? 240  ARG F N     1 
ATOM   9910  C CA    . ARG H 3 40  ? 54.964  36.057 -61.663 1.00 21.42  ? 240  ARG F CA    1 
ATOM   9911  C C     . ARG H 3 40  ? 56.500  36.160 -61.627 1.00 21.66  ? 240  ARG F C     1 
ATOM   9912  O O     . ARG H 3 40  ? 57.096  37.234 -61.503 1.00 20.86  ? 240  ARG F O     1 
ATOM   9913  C CB    . ARG H 3 40  ? 54.414  35.563 -60.337 1.00 21.26  ? 240  ARG F CB    1 
ATOM   9914  C CG    . ARG H 3 40  ? 54.544  36.532 -59.184 1.00 16.21  ? 240  ARG F CG    1 
ATOM   9915  C CD    . ARG H 3 40  ? 53.631  36.134 -58.053 1.00 21.25  ? 240  ARG F CD    1 
ATOM   9916  N NE    . ARG H 3 40  ? 52.251  36.571 -58.313 1.00 20.00  ? 240  ARG F NE    1 
ATOM   9917  C CZ    . ARG H 3 40  ? 51.197  36.214 -57.575 1.00 21.15  ? 240  ARG F CZ    1 
ATOM   9918  N NH1   . ARG H 3 40  ? 51.372  35.401 -56.546 1.00 17.24  ? 240  ARG F NH1   1 
ATOM   9919  N NH2   . ARG H 3 40  ? 49.985  36.693 -57.831 1.00 18.61  ? 240  ARG F NH2   1 
ATOM   9920  N N     . GLY H 3 41  ? 57.154  35.026 -61.779 1.00 17.18  ? 241  GLY F N     1 
ATOM   9921  C CA    . GLY H 3 41  ? 58.586  35.052 -61.795 1.00 17.78  ? 241  GLY F CA    1 
ATOM   9922  C C     . GLY H 3 41  ? 59.086  35.714 -63.053 1.00 18.77  ? 241  GLY F C     1 
ATOM   9923  O O     . GLY H 3 41  ? 60.304  35.788 -63.280 1.00 18.85  ? 241  GLY F O     1 
ATOM   9924  N N     . GLY H 3 42  ? 58.159  36.182 -63.878 1.00 33.71  ? 242  GLY F N     1 
ATOM   9925  C CA    . GLY H 3 42  ? 58.522  36.842 -65.114 1.00 31.27  ? 242  GLY F CA    1 
ATOM   9926  C C     . GLY H 3 42  ? 59.068  35.946 -66.220 1.00 35.24  ? 242  GLY F C     1 
ATOM   9927  O O     . GLY H 3 42  ? 59.733  36.422 -67.120 1.00 34.20  ? 242  GLY F O     1 
ATOM   9928  N N     . VAL H 3 43  ? 58.786  34.652 -66.157 1.00 43.97  ? 243  VAL F N     1 
ATOM   9929  C CA    . VAL H 3 43  ? 59.234  33.705 -67.165 1.00 43.83  ? 243  VAL F CA    1 
ATOM   9930  C C     . VAL H 3 43  ? 58.250  33.629 -68.339 1.00 41.85  ? 243  VAL F C     1 
ATOM   9931  O O     . VAL H 3 43  ? 57.070  33.309 -68.153 1.00 43.82  ? 243  VAL F O     1 
ATOM   9932  C CB    . VAL H 3 43  ? 59.353  32.320 -66.563 1.00 35.18  ? 243  VAL F CB    1 
ATOM   9933  C CG1   . VAL H 3 43  ? 59.797  31.329 -67.628 1.00 30.33  ? 243  VAL F CG1   1 
ATOM   9934  C CG2   . VAL H 3 43  ? 60.296  32.357 -65.396 1.00 29.70  ? 243  VAL F CG2   1 
ATOM   9935  N N     . LYS H 3 44  ? 58.754  33.890 -69.544 1.00 41.77  ? 244  LYS F N     1 
ATOM   9936  C CA    . LYS H 3 44  ? 57.942  33.873 -70.764 1.00 44.67  ? 244  LYS F CA    1 
ATOM   9937  C C     . LYS H 3 44  ? 57.650  32.498 -71.379 1.00 45.58  ? 244  LYS F C     1 
ATOM   9938  O O     . LYS H 3 44  ? 56.494  32.142 -71.576 1.00 46.46  ? 244  LYS F O     1 
ATOM   9939  C CB    . LYS H 3 44  ? 58.604  34.754 -71.815 1.00 60.49  ? 244  LYS F CB    1 
ATOM   9940  C CG    . LYS H 3 44  ? 57.754  35.053 -73.015 1.00 62.54  ? 244  LYS F CG    1 
ATOM   9941  C CD    . LYS H 3 44  ? 58.538  35.900 -73.981 1.00 65.20  ? 244  LYS F CD    1 
ATOM   9942  C CE    . LYS H 3 44  ? 57.765  36.205 -75.247 1.00 66.72  ? 244  LYS F CE    1 
ATOM   9943  N NZ    . LYS H 3 44  ? 58.572  37.105 -76.125 1.00 66.52  ? 244  LYS F NZ    1 
ATOM   9944  N N     . ARG H 3 45  ? 58.693  31.736 -71.690 1.00 28.34  ? 245  ARG F N     1 
ATOM   9945  C CA    . ARG H 3 45  ? 58.563  30.418 -72.292 1.00 30.15  ? 245  ARG F CA    1 
ATOM   9946  C C     . ARG H 3 45  ? 59.061  29.298 -71.374 1.00 30.98  ? 245  ARG F C     1 
ATOM   9947  O O     . ARG H 3 45  ? 60.164  29.384 -70.851 1.00 27.92  ? 245  ARG F O     1 
ATOM   9948  C CB    . ARG H 3 45  ? 59.351  30.430 -73.595 1.00 46.25  ? 245  ARG F CB    1 
ATOM   9949  C CG    . ARG H 3 45  ? 58.840  29.486 -74.665 1.00 47.95  ? 245  ARG F CG    1 
ATOM   9950  C CD    . ARG H 3 45  ? 59.485  29.786 -76.018 1.00 49.18  ? 245  ARG F CD    1 
ATOM   9951  N NE    . ARG H 3 45  ? 59.063  28.778 -76.976 1.00 50.14  ? 245  ARG F NE    1 
ATOM   9952  C CZ    . ARG H 3 45  ? 59.712  27.641 -77.199 1.00 52.17  ? 245  ARG F CZ    1 
ATOM   9953  N NH1   . ARG H 3 45  ? 60.830  27.396 -76.543 1.00 45.80  ? 245  ARG F NH1   1 
ATOM   9954  N NH2   . ARG H 3 45  ? 59.203  26.721 -78.025 1.00 51.33  ? 245  ARG F NH2   1 
ATOM   9955  N N     . ILE H 3 46  ? 58.275  28.238 -71.184 1.00 51.98  ? 246  ILE F N     1 
ATOM   9956  C CA    . ILE H 3 46  ? 58.653  27.102 -70.297 1.00 54.51  ? 246  ILE F CA    1 
ATOM   9957  C C     . ILE H 3 46  ? 58.826  25.732 -71.014 1.00 55.71  ? 246  ILE F C     1 
ATOM   9958  O O     . ILE H 3 46  ? 58.040  25.369 -71.902 1.00 55.56  ? 246  ILE F O     1 
ATOM   9959  C CB    . ILE H 3 46  ? 57.560  26.878 -69.224 1.00 20.50  ? 246  ILE F CB    1 
ATOM   9960  C CG1   . ILE H 3 46  ? 57.263  28.165 -68.505 1.00 20.52  ? 246  ILE F CG1   1 
ATOM   9961  C CG2   . ILE H 3 46  ? 57.957  25.828 -68.265 1.00 18.95  ? 246  ILE F CG2   1 
ATOM   9962  C CD1   . ILE H 3 46  ? 56.171  28.037 -67.503 1.00 19.55  ? 246  ILE F CD1   1 
ATOM   9963  N N     . SER H 3 47  ? 59.830  24.956 -70.605 1.00 62.56  ? 247  SER F N     1 
ATOM   9964  C CA    . SER H 3 47  ? 60.067  23.612 -71.164 1.00 62.22  ? 247  SER F CA    1 
ATOM   9965  C C     . SER H 3 47  ? 59.237  22.522 -70.440 1.00 62.93  ? 247  SER F C     1 
ATOM   9966  O O     . SER H 3 47  ? 58.923  22.640 -69.252 1.00 60.03  ? 247  SER F O     1 
ATOM   9967  C CB    . SER H 3 47  ? 61.545  23.260 -71.074 1.00 50.85  ? 247  SER F CB    1 
ATOM   9968  O OG    . SER H 3 47  ? 61.706  21.857 -71.135 1.00 59.30  ? 247  SER F OG    1 
ATOM   9969  N N     . GLY H 3 48  ? 58.894  21.454 -71.151 1.00 41.32  ? 248  GLY F N     1 
ATOM   9970  C CA    . GLY H 3 48  ? 58.082  20.394 -70.562 1.00 38.17  ? 248  GLY F CA    1 
ATOM   9971  C C     . GLY H 3 48  ? 58.637  19.706 -69.324 1.00 38.15  ? 248  GLY F C     1 
ATOM   9972  O O     . GLY H 3 48  ? 57.892  19.172 -68.461 1.00 39.23  ? 248  GLY F O     1 
ATOM   9973  N N     . LEU H 3 49  ? 59.966  19.737 -69.237 1.00 34.38  ? 249  LEU F N     1 
ATOM   9974  C CA    . LEU H 3 49  ? 60.680  19.127 -68.145 1.00 36.53  ? 249  LEU F CA    1 
ATOM   9975  C C     . LEU H 3 49  ? 60.664  19.993 -66.893 1.00 35.76  ? 249  LEU F C     1 
ATOM   9976  O O     . LEU H 3 49  ? 60.937  19.534 -65.790 1.00 33.25  ? 249  LEU F O     1 
ATOM   9977  C CB    . LEU H 3 49  ? 62.094  18.863 -68.606 1.00 32.55  ? 249  LEU F CB    1 
ATOM   9978  C CG    . LEU H 3 49  ? 62.115  17.905 -69.783 1.00 38.42  ? 249  LEU F CG    1 
ATOM   9979  C CD1   . LEU H 3 49  ? 63.514  17.778 -70.269 1.00 40.01  ? 249  LEU F CD1   1 
ATOM   9980  C CD2   . LEU H 3 49  ? 61.567  16.560 -69.345 1.00 37.97  ? 249  LEU F CD2   1 
ATOM   9981  N N     . ILE H 3 50  ? 60.321  21.255 -67.060 1.00 39.69  ? 250  ILE F N     1 
ATOM   9982  C CA    . ILE H 3 50  ? 60.278  22.133 -65.924 1.00 36.40  ? 250  ILE F CA    1 
ATOM   9983  C C     . ILE H 3 50  ? 59.272  21.720 -64.869 1.00 37.12  ? 250  ILE F C     1 
ATOM   9984  O O     . ILE H 3 50  ? 59.553  21.762 -63.687 1.00 37.35  ? 250  ILE F O     1 
ATOM   9985  C CB    . ILE H 3 50  ? 59.984  23.592 -66.357 1.00 47.18  ? 250  ILE F CB    1 
ATOM   9986  C CG1   . ILE H 3 50  ? 61.212  24.195 -67.040 1.00 45.64  ? 250  ILE F CG1   1 
ATOM   9987  C CG2   . ILE H 3 50  ? 59.710  24.459 -65.157 1.00 43.65  ? 250  ILE F CG2   1 
ATOM   9988  C CD1   . ILE H 3 50  ? 62.416  24.181 -66.184 1.00 44.64  ? 250  ILE F CD1   1 
ATOM   9989  N N     . TYR H 3 51  ? 58.096  21.296 -65.276 1.00 44.79  ? 251  TYR F N     1 
ATOM   9990  C CA    . TYR H 3 51  ? 57.098  20.989 -64.272 1.00 45.01  ? 251  TYR F CA    1 
ATOM   9991  C C     . TYR H 3 51  ? 57.506  19.933 -63.275 1.00 46.32  ? 251  TYR F C     1 
ATOM   9992  O O     . TYR H 3 51  ? 57.264  20.094 -62.087 1.00 45.66  ? 251  TYR F O     1 
ATOM   9993  C CB    . TYR H 3 51  ? 55.772  20.667 -64.941 1.00 31.40  ? 251  TYR F CB    1 
ATOM   9994  C CG    . TYR H 3 51  ? 55.389  21.669 -65.994 1.00 34.58  ? 251  TYR F CG    1 
ATOM   9995  C CD1   . TYR H 3 51  ? 55.619  21.387 -67.351 1.00 34.13  ? 251  TYR F CD1   1 
ATOM   9996  C CD2   . TYR H 3 51  ? 54.840  22.906 -65.650 1.00 34.78  ? 251  TYR F CD2   1 
ATOM   9997  C CE1   . TYR H 3 51  ? 55.313  22.305 -68.356 1.00 36.44  ? 251  TYR F CE1   1 
ATOM   9998  C CE2   . TYR H 3 51  ? 54.523  23.861 -66.652 1.00 37.22  ? 251  TYR F CE2   1 
ATOM   9999  C CZ    . TYR H 3 51  ? 54.764  23.549 -68.013 1.00 36.88  ? 251  TYR F CZ    1 
ATOM   10000 O OH    . TYR H 3 51  ? 54.481  24.448 -69.037 1.00 36.61  ? 251  TYR F OH    1 
ATOM   10001 N N     . GLU H 3 52  ? 58.145  18.869 -63.739 1.00 36.75  ? 252  GLU F N     1 
ATOM   10002 C CA    . GLU H 3 52  ? 58.606  17.828 -62.815 1.00 38.10  ? 252  GLU F CA    1 
ATOM   10003 C C     . GLU H 3 52  ? 59.813  18.250 -61.987 1.00 33.89  ? 252  GLU F C     1 
ATOM   10004 O O     . GLU H 3 52  ? 59.936  17.868 -60.842 1.00 37.14  ? 252  GLU F O     1 
ATOM   10005 C CB    . GLU H 3 52  ? 58.915  16.526 -63.554 1.00 62.93  ? 252  GLU F CB    1 
ATOM   10006 C CG    . GLU H 3 52  ? 57.695  15.622 -63.669 1.00 74.58  ? 252  GLU F CG    1 
ATOM   10007 C CD    . GLU H 3 52  ? 56.922  15.492 -62.341 1.00 75.10  ? 252  GLU F CD    1 
ATOM   10008 O OE1   . GLU H 3 52  ? 57.584  15.415 -61.278 1.00 81.81  ? 252  GLU F OE1   1 
ATOM   10009 O OE2   . GLU H 3 52  ? 55.662  15.454 -62.356 1.00 77.63  ? 252  GLU F OE2   1 
ATOM   10010 N N     . GLU H 3 53  ? 60.707  19.043 -62.560 1.00 35.01  ? 253  GLU F N     1 
ATOM   10011 C CA    . GLU H 3 53  ? 61.856  19.496 -61.804 1.00 38.55  ? 253  GLU F CA    1 
ATOM   10012 C C     . GLU H 3 53  ? 61.376  20.379 -60.662 1.00 35.40  ? 253  GLU F C     1 
ATOM   10013 O O     . GLU H 3 53  ? 61.959  20.401 -59.594 1.00 33.87  ? 253  GLU F O     1 
ATOM   10014 C CB    . GLU H 3 53  ? 62.828  20.274 -62.689 1.00 79.63  ? 253  GLU F CB    1 
ATOM   10015 C CG    . GLU H 3 53  ? 64.117  20.655 -61.967 1.00 83.77  ? 253  GLU F CG    1 
ATOM   10016 C CD    . GLU H 3 53  ? 64.911  19.445 -61.453 1.00 90.06  ? 253  GLU F CD    1 
ATOM   10017 O OE1   . GLU H 3 53  ? 65.387  18.655 -62.297 1.00 90.01  ? 253  GLU F OE1   1 
ATOM   10018 O OE2   . GLU H 3 53  ? 65.058  19.281 -60.214 1.00 90.07  ? 253  GLU F OE2   1 
ATOM   10019 N N     . THR H 3 54  ? 60.274  21.074 -60.882 1.00 34.00  ? 254  THR F N     1 
ATOM   10020 C CA    . THR H 3 54  ? 59.713  21.984 -59.895 1.00 33.66  ? 254  THR F CA    1 
ATOM   10021 C C     . THR H 3 54  ? 59.008  21.277 -58.762 1.00 36.77  ? 254  THR F C     1 
ATOM   10022 O O     . THR H 3 54  ? 59.073  21.715 -57.620 1.00 36.27  ? 254  THR F O     1 
ATOM   10023 C CB    . THR H 3 54  ? 58.741  22.954 -60.576 1.00 27.58  ? 254  THR F CB    1 
ATOM   10024 O OG1   . THR H 3 54  ? 59.439  23.602 -61.628 1.00 29.56  ? 254  THR F OG1   1 
ATOM   10025 C CG2   . THR H 3 54  ? 58.205  24.009 -59.608 1.00 25.81  ? 254  THR F CG2   1 
ATOM   10026 N N     . ARG H 3 55  ? 58.315  20.195 -59.068 1.00 39.58  ? 255  ARG F N     1 
ATOM   10027 C CA    . ARG H 3 55  ? 57.629  19.460 -58.010 1.00 35.55  ? 255  ARG F CA    1 
ATOM   10028 C C     . ARG H 3 55  ? 58.741  18.971 -57.083 1.00 36.60  ? 255  ARG F C     1 
ATOM   10029 O O     . ARG H 3 55  ? 58.632  19.043 -55.857 1.00 37.07  ? 255  ARG F O     1 
ATOM   10030 C CB    . ARG H 3 55  ? 56.800  18.287 -58.594 1.00 31.49  ? 255  ARG F CB    1 
ATOM   10031 C CG    . ARG H 3 55  ? 55.816  18.730 -59.664 1.00 32.04  ? 255  ARG F CG    1 
ATOM   10032 C CD    . ARG H 3 55  ? 54.710  17.737 -59.969 1.00 36.94  ? 255  ARG F CD    1 
ATOM   10033 N NE    . ARG H 3 55  ? 53.685  18.376 -60.800 1.00 35.54  ? 255  ARG F NE    1 
ATOM   10034 C CZ    . ARG H 3 55  ? 53.612  18.263 -62.125 1.00 35.78  ? 255  ARG F CZ    1 
ATOM   10035 N NH1   . ARG H 3 55  ? 54.475  17.520 -62.796 1.00 32.03  ? 255  ARG F NH1   1 
ATOM   10036 N NH2   . ARG H 3 55  ? 52.719  18.968 -62.793 1.00 36.58  ? 255  ARG F NH2   1 
ATOM   10037 N N     . GLY H 3 56  ? 59.827  18.515 -57.681 1.00 26.01  ? 256  GLY F N     1 
ATOM   10038 C CA    . GLY H 3 56  ? 60.926  18.060 -56.888 1.00 28.00  ? 256  GLY F CA    1 
ATOM   10039 C C     . GLY H 3 56  ? 61.448  19.139 -55.954 1.00 28.68  ? 256  GLY F C     1 
ATOM   10040 O O     . GLY H 3 56  ? 61.605  18.924 -54.747 1.00 27.22  ? 256  GLY F O     1 
ATOM   10041 N N     . VAL H 3 57  ? 61.741  20.300 -56.517 1.00 28.30  ? 257  VAL F N     1 
ATOM   10042 C CA    . VAL H 3 57  ? 62.236  21.418 -55.760 1.00 27.48  ? 257  VAL F CA    1 
ATOM   10043 C C     . VAL H 3 57  ? 61.247  21.839 -54.651 1.00 26.13  ? 257  VAL F C     1 
ATOM   10044 O O     . VAL H 3 57  ? 61.658  22.179 -53.521 1.00 25.25  ? 257  VAL F O     1 
ATOM   10045 C CB    . VAL H 3 57  ? 62.506  22.561 -56.744 1.00 31.38  ? 257  VAL F CB    1 
ATOM   10046 C CG1   . VAL H 3 57  ? 62.472  23.928 -56.066 1.00 30.87  ? 257  VAL F CG1   1 
ATOM   10047 C CG2   . VAL H 3 57  ? 63.826  22.309 -57.384 1.00 28.54  ? 257  VAL F CG2   1 
ATOM   10048 N N     . LEU H 3 58  ? 59.952  21.827 -54.958 1.00 26.36  ? 258  LEU F N     1 
ATOM   10049 C CA    . LEU H 3 58  ? 58.970  22.218 -53.961 1.00 27.36  ? 258  LEU F CA    1 
ATOM   10050 C C     . LEU H 3 58  ? 58.868  21.146 -52.911 1.00 28.67  ? 258  LEU F C     1 
ATOM   10051 O O     . LEU H 3 58  ? 58.612  21.418 -51.741 1.00 27.50  ? 258  LEU F O     1 
ATOM   10052 C CB    . LEU H 3 58  ? 57.586  22.434 -54.586 1.00 26.61  ? 258  LEU F CB    1 
ATOM   10053 C CG    . LEU H 3 58  ? 56.421  22.698 -53.603 1.00 27.28  ? 258  LEU F CG    1 
ATOM   10054 C CD1   . LEU H 3 58  ? 56.680  24.019 -52.954 1.00 29.13  ? 258  LEU F CD1   1 
ATOM   10055 C CD2   . LEU H 3 58  ? 55.038  22.682 -54.279 1.00 31.85  ? 258  LEU F CD2   1 
ATOM   10056 N N     . LYS H 3 59  ? 59.054  19.908 -53.334 1.00 33.63  ? 259  LYS F N     1 
ATOM   10057 C CA    . LYS H 3 59  ? 58.969  18.806 -52.390 1.00 33.48  ? 259  LYS F CA    1 
ATOM   10058 C C     . LYS H 3 59  ? 60.062  18.912 -51.338 1.00 28.38  ? 259  LYS F C     1 
ATOM   10059 O O     . LYS H 3 59  ? 59.798  18.842 -50.146 1.00 30.74  ? 259  LYS F O     1 
ATOM   10060 C CB    . LYS H 3 59  ? 59.078  17.481 -53.118 1.00 41.23  ? 259  LYS F CB    1 
ATOM   10061 C CG    . LYS H 3 59  ? 58.906  16.328 -52.213 1.00 45.62  ? 259  LYS F CG    1 
ATOM   10062 C CD    . LYS H 3 59  ? 57.632  15.608 -52.493 1.00 49.02  ? 259  LYS F CD    1 
ATOM   10063 C CE    . LYS H 3 59  ? 57.622  14.243 -51.781 1.00 53.46  ? 259  LYS F CE    1 
ATOM   10064 N NZ    . LYS H 3 59  ? 58.967  13.476 -51.826 1.00 52.30  ? 259  LYS F NZ    1 
ATOM   10065 N N     . VAL H 3 60  ? 61.288  19.087 -51.797 1.00 26.81  ? 260  VAL F N     1 
ATOM   10066 C CA    . VAL H 3 60  ? 62.408  19.207 -50.900 1.00 27.73  ? 260  VAL F CA    1 
ATOM   10067 C C     . VAL H 3 60  ? 62.259  20.422 -50.005 1.00 26.60  ? 260  VAL F C     1 
ATOM   10068 O O     . VAL H 3 60  ? 62.543  20.361 -48.808 1.00 28.14  ? 260  VAL F O     1 
ATOM   10069 C CB    . VAL H 3 60  ? 63.678  19.336 -51.679 1.00 21.44  ? 260  VAL F CB    1 
ATOM   10070 C CG1   . VAL H 3 60  ? 64.827  19.668 -50.763 1.00 22.53  ? 260  VAL F CG1   1 
ATOM   10071 C CG2   . VAL H 3 60  ? 63.914  18.059 -52.395 1.00 24.00  ? 260  VAL F CG2   1 
ATOM   10072 N N     . PHE H 3 61  ? 61.835  21.536 -50.591 1.00 26.74  ? 261  PHE F N     1 
ATOM   10073 C CA    . PHE H 3 61  ? 61.635  22.721 -49.816 1.00 24.21  ? 261  PHE F CA    1 
ATOM   10074 C C     . PHE H 3 61  ? 60.678  22.419 -48.628 1.00 24.62  ? 261  PHE F C     1 
ATOM   10075 O O     . PHE H 3 61  ? 60.982  22.705 -47.468 1.00 23.65  ? 261  PHE F O     1 
ATOM   10076 C CB    . PHE H 3 61  ? 61.059  23.828 -50.713 1.00 20.02  ? 261  PHE F CB    1 
ATOM   10077 C CG    . PHE H 3 61  ? 60.824  25.142 -49.982 1.00 21.37  ? 261  PHE F CG    1 
ATOM   10078 C CD1   . PHE H 3 61  ? 61.894  25.990 -49.697 1.00 20.30  ? 261  PHE F CD1   1 
ATOM   10079 C CD2   . PHE H 3 61  ? 59.537  25.453 -49.475 1.00 19.99  ? 261  PHE F CD2   1 
ATOM   10080 C CE1   . PHE H 3 61  ? 61.689  27.120 -48.916 1.00 19.52  ? 261  PHE F CE1   1 
ATOM   10081 C CE2   . PHE H 3 61  ? 59.315  26.580 -48.691 1.00 20.13  ? 261  PHE F CE2   1 
ATOM   10082 C CZ    . PHE H 3 61  ? 60.378  27.421 -48.398 1.00 22.49  ? 261  PHE F CZ    1 
ATOM   10083 N N     . LEU H 3 62  ? 59.525  21.836 -48.913 1.00 29.43  ? 262  LEU F N     1 
ATOM   10084 C CA    . LEU H 3 62  ? 58.586  21.539 -47.863 1.00 30.23  ? 262  LEU F CA    1 
ATOM   10085 C C     . LEU H 3 62  ? 59.049  20.510 -46.846 1.00 27.80  ? 262  LEU F C     1 
ATOM   10086 O O     . LEU H 3 62  ? 58.763  20.662 -45.658 1.00 31.89  ? 262  LEU F O     1 
ATOM   10087 C CB    . LEU H 3 62  ? 57.248  21.117 -48.475 1.00 36.24  ? 262  LEU F CB    1 
ATOM   10088 C CG    . LEU H 3 62  ? 56.386  22.307 -48.894 1.00 38.07  ? 262  LEU F CG    1 
ATOM   10089 C CD1   . LEU H 3 62  ? 55.403  21.848 -49.922 1.00 36.68  ? 262  LEU F CD1   1 
ATOM   10090 C CD2   . LEU H 3 62  ? 55.678  22.916 -47.684 1.00 31.95  ? 262  LEU F CD2   1 
ATOM   10091 N N     . GLU H 3 63  ? 59.737  19.459 -47.293 1.00 31.05  ? 263  GLU F N     1 
ATOM   10092 C CA    . GLU H 3 63  ? 60.221  18.419 -46.378 1.00 31.32  ? 263  GLU F CA    1 
ATOM   10093 C C     . GLU H 3 63  ? 61.101  19.070 -45.316 1.00 30.68  ? 263  GLU F C     1 
ATOM   10094 O O     . GLU H 3 63  ? 61.099  18.667 -44.155 1.00 29.05  ? 263  GLU F O     1 
ATOM   10095 C CB    . GLU H 3 63  ? 61.061  17.379 -47.111 1.00 84.00  ? 263  GLU F CB    1 
ATOM   10096 C CG    . GLU H 3 63  ? 60.411  16.757 -48.323 1.00 90.04  ? 263  GLU F CG    1 
ATOM   10097 C CD    . GLU H 3 63  ? 61.295  15.695 -48.975 1.00 89.63  ? 263  GLU F CD    1 
ATOM   10098 O OE1   . GLU H 3 63  ? 62.524  15.911 -49.041 1.00 90.33  ? 263  GLU F OE1   1 
ATOM   10099 O OE2   . GLU H 3 63  ? 60.767  14.654 -49.429 1.00 95.89  ? 263  GLU F OE2   1 
ATOM   10100 N N     . ASN H 3 64  ? 61.847  20.091 -45.734 1.00 36.88  ? 264  ASN F N     1 
ATOM   10101 C CA    . ASN H 3 64  ? 62.740  20.807 -44.850 1.00 36.43  ? 264  ASN F CA    1 
ATOM   10102 C C     . ASN H 3 64  ? 62.056  21.723 -43.865 1.00 36.59  ? 264  ASN F C     1 
ATOM   10103 O O     . ASN H 3 64  ? 62.455  21.784 -42.721 1.00 35.00  ? 264  ASN F O     1 
ATOM   10104 C CB    . ASN H 3 64  ? 63.730  21.622 -45.649 1.00 39.86  ? 264  ASN F CB    1 
ATOM   10105 C CG    . ASN H 3 64  ? 64.677  20.764 -46.458 1.00 46.82  ? 264  ASN F CG    1 
ATOM   10106 O OD1   . ASN H 3 64  ? 64.726  19.543 -46.308 1.00 51.49  ? 264  ASN F OD1   1 
ATOM   10107 N ND2   . ASN H 3 64  ? 65.452  21.408 -47.319 1.00 47.85  ? 264  ASN F ND2   1 
ATOM   10108 N N     . VAL H 3 65  ? 61.023  22.436 -44.276 1.00 32.58  ? 265  VAL F N     1 
ATOM   10109 C CA    . VAL H 3 65  ? 60.374  23.351 -43.342 1.00 31.96  ? 265  VAL F CA    1 
ATOM   10110 C C     . VAL H 3 65  ? 59.499  22.590 -42.353 1.00 29.21  ? 265  VAL F C     1 
ATOM   10111 O O     . VAL H 3 65  ? 59.494  22.902 -41.146 1.00 27.63  ? 265  VAL F O     1 
ATOM   10112 C CB    . VAL H 3 65  ? 59.507  24.459 -44.098 1.00 29.00  ? 265  VAL F CB    1 
ATOM   10113 C CG1   . VAL H 3 65  ? 58.975  25.511 -43.109 1.00 32.61  ? 265  VAL F CG1   1 
ATOM   10114 C CG2   . VAL H 3 65  ? 60.356  25.148 -45.157 1.00 34.02  ? 265  VAL F CG2   1 
ATOM   10115 N N     . ILE H 3 66  ? 58.770  21.591 -42.859 1.00 32.42  ? 266  ILE F N     1 
ATOM   10116 C CA    . ILE H 3 66  ? 57.862  20.795 -42.036 1.00 30.46  ? 266  ILE F CA    1 
ATOM   10117 C C     . ILE H 3 66  ? 58.635  19.960 -41.039 1.00 33.15  ? 266  ILE F C     1 
ATOM   10118 O O     . ILE H 3 66  ? 58.180  19.787 -39.931 1.00 30.73  ? 266  ILE F O     1 
ATOM   10119 C CB    . ILE H 3 66  ? 56.958  19.879 -42.907 1.00 42.42  ? 266  ILE F CB    1 
ATOM   10120 C CG1   . ILE H 3 66  ? 56.076  20.716 -43.824 1.00 41.47  ? 266  ILE F CG1   1 
ATOM   10121 C CG2   . ILE H 3 66  ? 56.015  19.113 -42.047 1.00 40.32  ? 266  ILE F CG2   1 
ATOM   10122 C CD1   . ILE H 3 66  ? 55.384  19.946 -44.899 1.00 39.91  ? 266  ILE F CD1   1 
ATOM   10123 N N     . ARG H 3 67  ? 59.797  19.434 -41.427 1.00 32.58  ? 267  ARG F N     1 
ATOM   10124 C CA    . ARG H 3 67  ? 60.611  18.669 -40.488 1.00 33.98  ? 267  ARG F CA    1 
ATOM   10125 C C     . ARG H 3 67  ? 60.854  19.563 -39.276 1.00 34.41  ? 267  ARG F C     1 
ATOM   10126 O O     . ARG H 3 67  ? 60.524  19.218 -38.144 1.00 32.54  ? 267  ARG F O     1 
ATOM   10127 C CB    . ARG H 3 67  ? 61.945  18.313 -41.120 1.00 38.80  ? 267  ARG F CB    1 
ATOM   10128 C CG    . ARG H 3 67  ? 62.880  17.522 -40.218 1.00 46.00  ? 267  ARG F CG    1 
ATOM   10129 C CD    . ARG H 3 67  ? 64.108  17.159 -41.000 1.00 51.83  ? 267  ARG F CD    1 
ATOM   10130 N NE    . ARG H 3 67  ? 63.769  16.360 -42.191 1.00 61.69  ? 267  ARG F NE    1 
ATOM   10131 C CZ    . ARG H 3 67  ? 64.170  16.624 -43.442 1.00 63.43  ? 267  ARG F CZ    1 
ATOM   10132 N NH1   . ARG H 3 67  ? 64.938  17.684 -43.698 1.00 63.83  ? 267  ARG F NH1   1 
ATOM   10133 N NH2   . ARG H 3 67  ? 63.807  15.822 -44.441 1.00 63.39  ? 267  ARG F NH2   1 
ATOM   10134 N N     . ASP H 3 68  ? 61.456  20.720 -39.527 1.00 29.65  ? 268  ASP F N     1 
ATOM   10135 C CA    . ASP H 3 68  ? 61.701  21.711 -38.485 1.00 27.43  ? 268  ASP F CA    1 
ATOM   10136 C C     . ASP H 3 68  ? 60.426  22.132 -37.750 1.00 24.57  ? 268  ASP F C     1 
ATOM   10137 O O     . ASP H 3 68  ? 60.395  22.168 -36.522 1.00 26.31  ? 268  ASP F O     1 
ATOM   10138 C CB    . ASP H 3 68  ? 62.325  22.952 -39.096 1.00 73.26  ? 268  ASP F CB    1 
ATOM   10139 C CG    . ASP H 3 68  ? 63.752  22.736 -39.490 1.00 80.95  ? 268  ASP F CG    1 
ATOM   10140 O OD1   . ASP H 3 68  ? 64.093  21.593 -39.844 1.00 75.64  ? 268  ASP F OD1   1 
ATOM   10141 O OD2   . ASP H 3 68  ? 64.529  23.712 -39.455 1.00 76.84  ? 268  ASP F OD2   1 
ATOM   10142 N N     . ALA H 3 69  ? 59.386  22.476 -38.506 1.00 36.24  ? 269  ALA F N     1 
ATOM   10143 C CA    . ALA H 3 69  ? 58.137  22.908 -37.897 1.00 38.84  ? 269  ALA F CA    1 
ATOM   10144 C C     . ALA H 3 69  ? 57.717  21.860 -36.893 1.00 38.74  ? 269  ALA F C     1 
ATOM   10145 O O     . ALA H 3 69  ? 57.555  22.152 -35.713 1.00 38.53  ? 269  ALA F O     1 
ATOM   10146 C CB    . ALA H 3 69  ? 57.073  23.093 -38.951 1.00 62.23  ? 269  ALA F CB    1 
ATOM   10147 N N     . VAL H 3 70  ? 57.577  20.635 -37.385 1.00 34.84  ? 270  VAL F N     1 
ATOM   10148 C CA    . VAL H 3 70  ? 57.204  19.462 -36.583 1.00 36.14  ? 270  VAL F CA    1 
ATOM   10149 C C     . VAL H 3 70  ? 58.202  19.202 -35.422 1.00 36.35  ? 270  VAL F C     1 
ATOM   10150 O O     . VAL H 3 70  ? 57.813  18.875 -34.303 1.00 39.55  ? 270  VAL F O     1 
ATOM   10151 C CB    . VAL H 3 70  ? 57.012  18.188 -37.532 1.00 23.28  ? 270  VAL F CB    1 
ATOM   10152 C CG1   . VAL H 3 70  ? 56.848  16.921 -36.716 1.00 20.74  ? 270  VAL F CG1   1 
ATOM   10153 C CG2   . VAL H 3 70  ? 55.746  18.411 -38.429 1.00 19.67  ? 270  VAL F CG2   1 
ATOM   10154 N N     . THR H 3 71  ? 59.484  19.369 -35.669 1.00 35.15  ? 271  THR F N     1 
ATOM   10155 C CA    . THR H 3 71  ? 60.420  19.217 -34.575 1.00 34.46  ? 271  THR F CA    1 
ATOM   10156 C C     . THR H 3 71  ? 60.066  20.208 -33.448 1.00 37.26  ? 271  THR F C     1 
ATOM   10157 O O     . THR H 3 71  ? 60.199  19.879 -32.281 1.00 35.31  ? 271  THR F O     1 
ATOM   10158 C CB    . THR H 3 71  ? 61.863  19.490 -35.039 1.00 29.32  ? 271  THR F CB    1 
ATOM   10159 O OG1   . THR H 3 71  ? 62.198  18.558 -36.073 1.00 26.26  ? 271  THR F OG1   1 
ATOM   10160 C CG2   . THR H 3 71  ? 62.856  19.376 -33.867 1.00 27.70  ? 271  THR F CG2   1 
ATOM   10161 N N     . TYR H 3 72  ? 59.624  21.418 -33.799 1.00 35.77  ? 272  TYR F N     1 
ATOM   10162 C CA    . TYR H 3 72  ? 59.268  22.421 -32.792 1.00 33.91  ? 272  TYR F CA    1 
ATOM   10163 C C     . TYR H 3 72  ? 58.007  22.042 -32.056 1.00 36.97  ? 272  TYR F C     1 
ATOM   10164 O O     . TYR H 3 72  ? 57.879  22.258 -30.863 1.00 35.57  ? 272  TYR F O     1 
ATOM   10165 C CB    . TYR H 3 72  ? 59.053  23.808 -33.412 1.00 27.64  ? 272  TYR F CB    1 
ATOM   10166 C CG    . TYR H 3 72  ? 60.331  24.580 -33.655 1.00 27.39  ? 272  TYR F CG    1 
ATOM   10167 C CD1   . TYR H 3 72  ? 60.828  24.765 -34.964 1.00 27.89  ? 272  TYR F CD1   1 
ATOM   10168 C CD2   . TYR H 3 72  ? 61.055  25.119 -32.607 1.00 29.09  ? 272  TYR F CD2   1 
ATOM   10169 C CE1   . TYR H 3 72  ? 62.007  25.476 -35.211 1.00 29.32  ? 272  TYR F CE1   1 
ATOM   10170 C CE2   . TYR H 3 72  ? 62.239  25.822 -32.856 1.00 29.48  ? 272  TYR F CE2   1 
ATOM   10171 C CZ    . TYR H 3 72  ? 62.697  25.994 -34.162 1.00 29.80  ? 272  TYR F CZ    1 
ATOM   10172 O OH    . TYR H 3 72  ? 63.832  26.693 -34.409 1.00 32.54  ? 272  TYR F OH    1 
ATOM   10173 N N     . THR H 3 73  ? 57.060  21.500 -32.795 1.00 32.69  ? 273  THR F N     1 
ATOM   10174 C CA    . THR H 3 73  ? 55.805  21.089 -32.237 1.00 37.44  ? 273  THR F CA    1 
ATOM   10175 C C     . THR H 3 73  ? 56.076  20.033 -31.198 1.00 39.09  ? 273  THR F C     1 
ATOM   10176 O O     . THR H 3 73  ? 55.619  20.161 -30.093 1.00 37.12  ? 273  THR F O     1 
ATOM   10177 C CB    . THR H 3 73  ? 54.919  20.463 -33.299 1.00 30.40  ? 273  THR F CB    1 
ATOM   10178 O OG1   . THR H 3 73  ? 54.904  21.282 -34.480 1.00 32.12  ? 273  THR F OG1   1 
ATOM   10179 C CG2   . THR H 3 73  ? 53.522  20.288 -32.754 1.00 27.15  ? 273  THR F CG2   1 
ATOM   10180 N N     . GLU H 3 74  ? 56.816  18.981 -31.562 1.00 47.47  ? 274  GLU F N     1 
ATOM   10181 C CA    . GLU H 3 74  ? 57.122  17.890 -30.634 1.00 50.39  ? 274  GLU F CA    1 
ATOM   10182 C C     . GLU H 3 74  ? 57.767  18.394 -29.364 1.00 51.16  ? 274  GLU F C     1 
ATOM   10183 O O     . GLU H 3 74  ? 57.428  17.960 -28.278 1.00 49.76  ? 274  GLU F O     1 
ATOM   10184 C CB    . GLU H 3 74  ? 58.057  16.836 -31.264 1.00 62.20  ? 274  GLU F CB    1 
ATOM   10185 C CG    . GLU H 3 74  ? 57.507  16.084 -32.497 1.00 74.29  ? 274  GLU F CG    1 
ATOM   10186 C CD    . GLU H 3 74  ? 58.495  15.065 -33.140 1.00 78.83  ? 274  GLU F CD    1 
ATOM   10187 O OE1   . GLU H 3 74  ? 59.675  15.397 -33.410 1.00 83.83  ? 274  GLU F OE1   1 
ATOM   10188 O OE2   . GLU H 3 74  ? 58.071  13.919 -33.402 1.00 82.74  ? 274  GLU F OE2   1 
ATOM   10189 N N     . HIS H 3 75  ? 58.694  19.322 -29.480 1.00 38.37  ? 275  HIS F N     1 
ATOM   10190 C CA    . HIS H 3 75  ? 59.364  19.795 -28.296 1.00 37.18  ? 275  HIS F CA    1 
ATOM   10191 C C     . HIS H 3 75  ? 58.465  20.505 -27.292 1.00 40.87  ? 275  HIS F C     1 
ATOM   10192 O O     . HIS H 3 75  ? 58.816  20.686 -26.115 1.00 38.90  ? 275  HIS F O     1 
ATOM   10193 C CB    . HIS H 3 75  ? 60.476  20.726 -28.665 1.00 34.40  ? 275  HIS F CB    1 
ATOM   10194 C CG    . HIS H 3 75  ? 61.164  21.308 -27.478 1.00 34.65  ? 275  HIS F CG    1 
ATOM   10195 N ND1   . HIS H 3 75  ? 62.191  20.660 -26.824 1.00 33.57  ? 275  HIS F ND1   1 
ATOM   10196 C CD2   . HIS H 3 75  ? 60.978  22.483 -26.828 1.00 35.95  ? 275  HIS F CD2   1 
ATOM   10197 C CE1   . HIS H 3 75  ? 62.614  21.417 -25.828 1.00 37.61  ? 275  HIS F CE1   1 
ATOM   10198 N NE2   . HIS H 3 75  ? 61.896  22.529 -25.808 1.00 36.60  ? 275  HIS F NE2   1 
ATOM   10199 N N     . ALA H 3 76  ? 57.308  20.929 -27.758 1.00 37.65  ? 276  ALA F N     1 
ATOM   10200 C CA    . ALA H 3 76  ? 56.376  21.629 -26.914 1.00 39.81  ? 276  ALA F CA    1 
ATOM   10201 C C     . ALA H 3 76  ? 55.311  20.618 -26.547 1.00 40.49  ? 276  ALA F C     1 
ATOM   10202 O O     . ALA H 3 76  ? 54.203  20.973 -26.181 1.00 41.05  ? 276  ALA F O     1 
ATOM   10203 C CB    . ALA H 3 76  ? 55.778  22.782 -27.691 1.00 33.01  ? 276  ALA F CB    1 
ATOM   10204 N N     . LYS H 3 77  ? 55.658  19.346 -26.674 1.00 55.83  ? 277  LYS F N     1 
ATOM   10205 C CA    . LYS H 3 77  ? 54.731  18.266 -26.395 1.00 57.03  ? 277  LYS F CA    1 
ATOM   10206 C C     . LYS H 3 77  ? 53.302  18.525 -26.907 1.00 57.14  ? 277  LYS F C     1 
ATOM   10207 O O     . LYS H 3 77  ? 52.321  18.124 -26.287 1.00 57.63  ? 277  LYS F O     1 
ATOM   10208 C CB    . LYS H 3 77  ? 54.737  17.979 -24.895 1.00 62.31  ? 277  LYS F CB    1 
ATOM   10209 C CG    . LYS H 3 77  ? 56.042  17.369 -24.385 1.00 66.32  ? 277  LYS F CG    1 
ATOM   10210 C CD    . LYS H 3 77  ? 56.018  17.232 -22.879 1.00 71.18  ? 277  LYS F CD    1 
ATOM   10211 C CE    . LYS H 3 77  ? 57.373  16.880 -22.329 1.00 75.82  ? 277  LYS F CE    1 
ATOM   10212 N NZ    . LYS H 3 77  ? 57.489  17.436 -20.950 1.00 77.83  ? 277  LYS F NZ    1 
ATOM   10213 N N     . ARG H 3 78  ? 53.184  19.206 -28.039 1.00 40.57  ? 278  ARG F N     1 
ATOM   10214 C CA    . ARG H 3 78  ? 51.875  19.486 -28.625 1.00 36.81  ? 278  ARG F CA    1 
ATOM   10215 C C     . ARG H 3 78  ? 51.633  18.459 -29.722 1.00 36.74  ? 278  ARG F C     1 
ATOM   10216 O O     . ARG H 3 78  ? 52.508  17.655 -30.010 1.00 34.84  ? 278  ARG F O     1 
ATOM   10217 C CB    . ARG H 3 78  ? 51.810  20.910 -29.209 1.00 39.31  ? 278  ARG F CB    1 
ATOM   10218 C CG    . ARG H 3 78  ? 51.369  21.969 -28.219 1.00 39.47  ? 278  ARG F CG    1 
ATOM   10219 C CD    . ARG H 3 78  ? 51.151  23.357 -28.838 1.00 40.95  ? 278  ARG F CD    1 
ATOM   10220 N NE    . ARG H 3 78  ? 52.433  24.025 -29.062 1.00 39.83  ? 278  ARG F NE    1 
ATOM   10221 C CZ    . ARG H 3 78  ? 53.049  24.139 -30.243 1.00 38.54  ? 278  ARG F CZ    1 
ATOM   10222 N NH1   . ARG H 3 78  ? 52.511  23.647 -31.374 1.00 34.43  ? 278  ARG F NH1   1 
ATOM   10223 N NH2   . ARG H 3 78  ? 54.240  24.716 -30.267 1.00 37.91  ? 278  ARG F NH2   1 
ATOM   10224 N N     . LYS H 3 79  ? 50.449  18.469 -30.319 1.00 45.18  ? 279  LYS F N     1 
ATOM   10225 C CA    . LYS H 3 79  ? 50.134  17.533 -31.376 1.00 48.45  ? 279  LYS F CA    1 
ATOM   10226 C C     . LYS H 3 79  ? 49.671  18.337 -32.562 1.00 45.71  ? 279  LYS F C     1 
ATOM   10227 O O     . LYS H 3 79  ? 49.363  17.792 -33.610 1.00 46.78  ? 279  LYS F O     1 
ATOM   10228 C CB    . LYS H 3 79  ? 49.023  16.586 -30.950 1.00 59.93  ? 279  LYS F CB    1 
ATOM   10229 C CG    . LYS H 3 79  ? 49.441  15.429 -30.086 1.00 66.85  ? 279  LYS F CG    1 
ATOM   10230 C CD    . LYS H 3 79  ? 48.246  14.504 -29.942 1.00 75.17  ? 279  LYS F CD    1 
ATOM   10231 C CE    . LYS H 3 79  ? 48.642  13.037 -29.741 1.00 78.60  ? 279  LYS F CE    1 
ATOM   10232 N NZ    . LYS H 3 79  ? 47.458  12.113 -29.869 1.00 79.11  ? 279  LYS F NZ    1 
ATOM   10233 N N     . THR H 3 80  ? 49.604  19.647 -32.383 1.00 48.99  ? 280  THR F N     1 
ATOM   10234 C CA    . THR H 3 80  ? 49.197  20.551 -33.455 1.00 48.98  ? 280  THR F CA    1 
ATOM   10235 C C     . THR H 3 80  ? 50.330  21.466 -33.950 1.00 46.91  ? 280  THR F C     1 
ATOM   10236 O O     . THR H 3 80  ? 51.035  22.134 -33.166 1.00 45.76  ? 280  THR F O     1 
ATOM   10237 C CB    . THR H 3 80  ? 48.044  21.449 -33.008 1.00 44.71  ? 280  THR F CB    1 
ATOM   10238 O OG1   . THR H 3 80  ? 46.974  20.636 -32.518 1.00 47.71  ? 280  THR F OG1   1 
ATOM   10239 C CG2   . THR H 3 80  ? 47.546  22.291 -34.163 1.00 47.23  ? 280  THR F CG2   1 
ATOM   10240 N N     . VAL H 3 81  ? 50.519  21.503 -35.259 1.00 35.68  ? 281  VAL F N     1 
ATOM   10241 C CA    . VAL H 3 81  ? 51.535  22.390 -35.783 1.00 34.63  ? 281  VAL F CA    1 
ATOM   10242 C C     . VAL H 3 81  ? 50.890  23.766 -35.850 1.00 34.06  ? 281  VAL F C     1 
ATOM   10243 O O     . VAL H 3 81  ? 49.882  23.949 -36.530 1.00 33.35  ? 281  VAL F O     1 
ATOM   10244 C CB    . VAL H 3 81  ? 51.927  22.001 -37.175 1.00 29.38  ? 281  VAL F CB    1 
ATOM   10245 C CG1   . VAL H 3 81  ? 53.077  22.858 -37.622 1.00 29.57  ? 281  VAL F CG1   1 
ATOM   10246 C CG2   . VAL H 3 81  ? 52.260  20.543 -37.222 1.00 29.86  ? 281  VAL F CG2   1 
ATOM   10247 N N     . THR H 3 82  ? 51.455  24.725 -35.134 1.00 31.88  ? 282  THR F N     1 
ATOM   10248 C CA    . THR H 3 82  ? 50.927  26.082 -35.125 1.00 32.62  ? 282  THR F CA    1 
ATOM   10249 C C     . THR H 3 82  ? 51.606  26.976 -36.201 1.00 32.31  ? 282  THR F C     1 
ATOM   10250 O O     . THR H 3 82  ? 52.676  26.629 -36.725 1.00 28.17  ? 282  THR F O     1 
ATOM   10251 C CB    . THR H 3 82  ? 51.134  26.697 -33.719 1.00 23.69  ? 282  THR F CB    1 
ATOM   10252 O OG1   . THR H 3 82  ? 52.527  26.806 -33.429 1.00 24.59  ? 282  THR F OG1   1 
ATOM   10253 C CG2   . THR H 3 82  ? 50.557  25.809 -32.690 1.00 23.45  ? 282  THR F CG2   1 
ATOM   10254 N N     . ALA H 3 83  ? 51.031  28.113 -36.574 1.00 30.79  ? 283  ALA F N     1 
ATOM   10255 C CA    . ALA H 3 83  ? 51.800  28.888 -37.536 1.00 30.27  ? 283  ALA F CA    1 
ATOM   10256 C C     . ALA H 3 83  ? 53.098  29.300 -36.933 1.00 29.36  ? 283  ALA F C     1 
ATOM   10257 O O     . ALA H 3 83  ? 54.061  29.580 -37.658 1.00 30.42  ? 283  ALA F O     1 
ATOM   10258 C CB    . ALA H 3 83  ? 51.208  30.050 -37.851 1.00 12.26  ? 283  ALA F CB    1 
ATOM   10259 N N     . MET H 3 84  ? 53.125  29.478 -35.617 1.00 37.86  ? 284  MET F N     1 
ATOM   10260 C CA    . MET H 3 84  ? 54.395  29.864 -35.041 1.00 40.15  ? 284  MET F CA    1 
ATOM   10261 C C     . MET H 3 84  ? 55.433  28.812 -35.384 1.00 40.00  ? 284  MET F C     1 
ATOM   10262 O O     . MET H 3 84  ? 56.548  29.132 -35.766 1.00 37.70  ? 284  MET F O     1 
ATOM   10263 C CB    . MET H 3 84  ? 54.291  30.036 -33.538 1.00 40.30  ? 284  MET F CB    1 
ATOM   10264 C CG    . MET H 3 84  ? 53.684  31.359 -33.161 1.00 52.05  ? 284  MET F CG    1 
ATOM   10265 S SD    . MET H 3 84  ? 54.336  32.705 -34.205 1.00 57.95  ? 284  MET F SD    1 
ATOM   10266 C CE    . MET H 3 84  ? 55.940  33.035 -33.508 1.00 56.50  ? 284  MET F CE    1 
ATOM   10267 N N     . ASP H 3 85  ? 55.051  27.548 -35.284 1.00 25.87  ? 285  ASP F N     1 
ATOM   10268 C CA    . ASP H 3 85  ? 55.981  26.498 -35.587 1.00 25.88  ? 285  ASP F CA    1 
ATOM   10269 C C     . ASP H 3 85  ? 56.575  26.656 -36.974 1.00 22.05  ? 285  ASP F C     1 
ATOM   10270 O O     . ASP H 3 85  ? 57.786  26.500 -37.153 1.00 23.36  ? 285  ASP F O     1 
ATOM   10271 C CB    . ASP H 3 85  ? 55.304  25.139 -35.442 1.00 49.25  ? 285  ASP F CB    1 
ATOM   10272 C CG    . ASP H 3 85  ? 54.890  24.850 -34.021 1.00 50.57  ? 285  ASP F CG    1 
ATOM   10273 O OD1   . ASP H 3 85  ? 55.634  25.269 -33.119 1.00 47.34  ? 285  ASP F OD1   1 
ATOM   10274 O OD2   . ASP H 3 85  ? 53.839  24.200 -33.808 1.00 51.53  ? 285  ASP F OD2   1 
ATOM   10275 N N     . VAL H 3 86  ? 55.719  26.958 -37.950 1.00 21.18  ? 286  VAL F N     1 
ATOM   10276 C CA    . VAL H 3 86  ? 56.155  27.180 -39.342 1.00 20.81  ? 286  VAL F CA    1 
ATOM   10277 C C     . VAL H 3 86  ? 57.028  28.457 -39.402 1.00 21.87  ? 286  VAL F C     1 
ATOM   10278 O O     . VAL H 3 86  ? 58.062  28.497 -40.064 1.00 24.62  ? 286  VAL F O     1 
ATOM   10279 C CB    . VAL H 3 86  ? 54.928  27.329 -40.303 1.00 13.63  ? 286  VAL F CB    1 
ATOM   10280 C CG1   . VAL H 3 86  ? 55.392  27.628 -41.693 1.00 13.14  ? 286  VAL F CG1   1 
ATOM   10281 C CG2   . VAL H 3 86  ? 54.113  26.083 -40.295 1.00 14.92  ? 286  VAL F CG2   1 
ATOM   10282 N N     . VAL H 3 87  ? 56.598  29.492 -38.689 1.00 21.06  ? 287  VAL F N     1 
ATOM   10283 C CA    . VAL H 3 87  ? 57.346  30.749 -38.627 1.00 19.50  ? 287  VAL F CA    1 
ATOM   10284 C C     . VAL H 3 87  ? 58.739  30.567 -37.977 1.00 20.23  ? 287  VAL F C     1 
ATOM   10285 O O     . VAL H 3 87  ? 59.718  31.077 -38.477 1.00 19.26  ? 287  VAL F O     1 
ATOM   10286 C CB    . VAL H 3 87  ? 56.529  31.842 -37.894 1.00 15.94  ? 287  VAL F CB    1 
ATOM   10287 C CG1   . VAL H 3 87  ? 57.405  33.011 -37.533 1.00 16.71  ? 287  VAL F CG1   1 
ATOM   10288 C CG2   . VAL H 3 87  ? 55.448  32.309 -38.789 1.00 15.17  ? 287  VAL F CG2   1 
ATOM   10289 N N     . TYR H 3 88  ? 58.830  29.850 -36.874 1.00 29.34  ? 288  TYR F N     1 
ATOM   10290 C CA    . TYR H 3 88  ? 60.140  29.639 -36.318 1.00 29.32  ? 288  TYR F CA    1 
ATOM   10291 C C     . TYR H 3 88  ? 60.963  28.827 -37.308 1.00 27.12  ? 288  TYR F C     1 
ATOM   10292 O O     . TYR H 3 88  ? 62.160  29.133 -37.532 1.00 29.47  ? 288  TYR F O     1 
ATOM   10293 C CB    . TYR H 3 88  ? 60.085  28.916 -34.964 1.00 37.69  ? 288  TYR F CB    1 
ATOM   10294 C CG    . TYR H 3 88  ? 59.458  29.761 -33.886 1.00 41.08  ? 288  TYR F CG    1 
ATOM   10295 C CD1   . TYR H 3 88  ? 58.488  29.229 -33.030 1.00 45.32  ? 288  TYR F CD1   1 
ATOM   10296 C CD2   . TYR H 3 88  ? 59.727  31.111 -33.798 1.00 45.33  ? 288  TYR F CD2   1 
ATOM   10297 C CE1   . TYR H 3 88  ? 57.793  30.036 -32.136 1.00 46.23  ? 288  TYR F CE1   1 
ATOM   10298 C CE2   . TYR H 3 88  ? 59.059  31.906 -32.925 1.00 48.81  ? 288  TYR F CE2   1 
ATOM   10299 C CZ    . TYR H 3 88  ? 58.088  31.379 -32.104 1.00 47.41  ? 288  TYR F CZ    1 
ATOM   10300 O OH    . TYR H 3 88  ? 57.346  32.216 -31.308 1.00 49.87  ? 288  TYR F OH    1 
ATOM   10301 N N     . ALA H 3 89  ? 60.343  27.815 -37.921 1.00 29.96  ? 289  ALA F N     1 
ATOM   10302 C CA    . ALA H 3 89  ? 61.074  26.964 -38.875 1.00 29.18  ? 289  ALA F CA    1 
ATOM   10303 C C     . ALA H 3 89  ? 61.625  27.760 -40.015 1.00 30.87  ? 289  ALA F C     1 
ATOM   10304 O O     . ALA H 3 89  ? 62.777  27.627 -40.364 1.00 28.29  ? 289  ALA F O     1 
ATOM   10305 C CB    . ALA H 3 89  ? 60.197  25.863 -39.417 1.00 27.54  ? 289  ALA F CB    1 
ATOM   10306 N N     . LEU H 3 90  ? 60.796  28.591 -40.608 1.00 27.35  ? 290  LEU F N     1 
ATOM   10307 C CA    . LEU H 3 90  ? 61.277  29.390 -41.698 1.00 29.26  ? 290  LEU F CA    1 
ATOM   10308 C C     . LEU H 3 90  ? 62.427  30.290 -41.292 1.00 29.18  ? 290  LEU F C     1 
ATOM   10309 O O     . LEU H 3 90  ? 63.360  30.463 -42.045 1.00 28.26  ? 290  LEU F O     1 
ATOM   10310 C CB    . LEU H 3 90  ? 60.142  30.216 -42.249 1.00 20.02  ? 290  LEU F CB    1 
ATOM   10311 C CG    . LEU H 3 90  ? 59.185  29.324 -43.014 1.00 20.39  ? 290  LEU F CG    1 
ATOM   10312 C CD1   . LEU H 3 90  ?