data_1P3F
# 
_entry.id   1P3F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P3F         
NDB   PD0416       
RCSB  RCSB018958   
WWPDB D_1000018958 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'X-ray structure of the Nucleosome Core Particle at 2.8 A' unspecified 
PDB 1F66 '2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2A.Z' unspecified 
PDB 1ID3 
;Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental 
Differences In Inter-Nucleosome Interactions
;
unspecified 
PDB 1KX3 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution' unspecified 
PDB 1KX4 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146B, At 2.6 A Resolution' unspecified 
PDB 1KX5 'X-Ray Structure Of The Nucleosome Core Particle, Ncp147, At 1.9 A Resolution' unspecified 
PDB 1P34 . unspecified 
PDB 1P3A . unspecified 
PDB 1P3B . unspecified 
PDB 1P3G . unspecified 
PDB 1P3I . unspecified 
PDB 1P3K . unspecified 
PDB 1P3L . unspecified 
PDB 1P3M . unspecified 
PDB 1P3O . unspecified 
PDB 1P3P . unspecified 
# 
_pdbx_database_status.entry_id                        1P3F 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muthurajan, U.M.'       1 
'Bao, Y.'                2 
'Forsberg, L.J.'         3 
'Edayathumangalam, R.S.' 4 
'Dyer, P.N.'             5 
'White, C.L.'            6 
'Luger, K.'              7 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            23 
_citation.page_first                260 
_citation.page_last                 271 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14739929 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muthurajan, U.M.'       1 
primary 'Bao, Y.'                2 
primary 'Forsberg, L.J.'         3 
primary 'Edayathumangalam, R.S.' 4 
primary 'Dyer, P.N.'             5 
primary 'White, C.L.'            6 
primary 'Luger, K.'              7 
# 
_cell.entry_id           1P3F 
_cell.length_a           105.739 
_cell.length_b           109.499 
_cell.length_c           181.649 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P3F 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Palindromic 146bp Human Alpha-Satellite DNA fragment' 45054.844 2   ? ? ? ? 
2 polymer man 'Histone H3'                                           15363.939 2   ? ? ? ? 
3 polymer man 'Histone H4'                                           11209.181 2   ? ? ? ? 
4 polymer man 'Histone H2A'                                          13962.241 2   ? ? ? ? 
5 polymer man 'Histone H2B'                                          13834.070 2   ? ? ? ? 
6 water   nat water                                                  18.015    171 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKCISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKCISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLU n 
2 35  SER n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  CYS n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 ALA n 
4 124 LYS n 
4 125 SER n 
4 126 ALA n 
4 127 LYS n 
4 128 SER n 
4 129 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'HB 101'         ? ? ? ? ? ? Plasmid ? ? ? pUC ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q7ZT64_9ZZZZ Q7ZT64 2 2 ? ? 
2 UNP H4_XENLA     P62799 3 1 ? ? 
3 UNP Q7ZT66_9ZZZZ Q7ZT66 4 2 ? ? 
4 UNP H2B1_XENLA   P02281 5 1 ? ? 
5 PDB 1P3F         1P3F   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1P3F A 1 ? 135 ? Q7ZT64 2   ? 136 ? 401  535  
2  2 1P3F B 1 ? 102 ? P62799 1   ? 102 ? 1    102  
3  3 1P3F C 1 ? 129 ? Q7ZT66 2   ? 130 ? 801  929  
4  4 1P3F D 1 ? 125 ? P02281 1   ? 125 ? 1198 1322 
5  1 1P3F E 1 ? 135 ? Q7ZT64 2   ? 136 ? 601  735  
6  2 1P3F F 1 ? 102 ? P62799 1   ? 102 ? 201  302  
7  3 1P3F G 1 ? 129 ? Q7ZT66 2   ? 130 ? 1001 1129 
8  4 1P3F H 1 ? 125 ? P02281 1   ? 125 ? 1398 1522 
9  5 1P3F I 1 ? 146 ? 1P3F   1   ? 146 ? 1    146  
10 5 1P3F J 1 ? 146 ? 1P3F   147 ? 292 ? 147  292  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P3F GLU A 34  ? UNP Q7ZT64 GLY 35  CONFLICT 434  1  
1 1P3F SER A 35  ? UNP Q7ZT64 VAL 36  CONFLICT 435  2  
1 1P3F ALA A 102 ? UNP Q7ZT64 GLY 103 CONFLICT 502  3  
5 1P3F GLU E 34  ? UNP Q7ZT64 GLY 35  CONFLICT 634  4  
5 1P3F SER E 35  ? UNP Q7ZT64 VAL 36  CONFLICT 635  5  
5 1P3F ALA E 102 ? UNP Q7ZT64 GLY 103 CONFLICT 702  6  
2 1P3F CYS B 45  ? UNP P62799 ARG 46  CONFLICT 45   7  
6 1P3F CYS F 45  ? UNP P62799 ARG 46  CONFLICT 245  8  
3 1P3F ALA C 14  ? UNP Q7ZT66 SER 15  CONFLICT 814  9  
3 1P3F GLY C 67  ? UNP Q7ZT66 TRP 68  CONFLICT 867  10 
3 1P3F ASN C 68  ? UNP Q7ZT66 GLU 69  CONFLICT 868  11 
3 1P3F ALA C 69  ? UNP Q7ZT66 ARG 70  CONFLICT 869  12 
3 1P3F ALA C 70  ? UNP Q7ZT66 LEU 71  CONFLICT 870  13 
3 1P3F ARG C 71  ? UNP Q7ZT66 PRO 72  CONFLICT 871  14 
3 1P3F ASP C 72  ? UNP Q7ZT66 GLU 73  CONFLICT 872  15 
3 1P3F ASN C 73  ? UNP Q7ZT66 ILE 74  CONFLICT 873  16 
3 1P3F LYS C 74  ? UNP Q7ZT66 TRP 75  CONFLICT 874  17 
3 1P3F THR C 76  ? UNP Q7ZT66 ARG 77  CONFLICT 876  18 
3 1P3F ARG C 77  ? UNP Q7ZT66 PRO 78  CONFLICT 877  19 
3 1P3F ILE C 78  ? UNP Q7ZT66 VAL 79  CONFLICT 878  20 
3 1P3F ILE C 79  ? UNP Q7ZT66 LEU 80  CONFLICT 879  21 
3 1P3F PRO C 80  ? UNP Q7ZT66 SER 81  CONFLICT 880  22 
3 1P3F ARG C 81  ? UNP Q7ZT66 PRO 82  CONFLICT 881  23 
3 1P3F HIS C 82  ? UNP Q7ZT66 GLY 83  CONFLICT 882  24 
3 1P3F LEU C 83  ? UNP Q7ZT66 TRP 84  CONFLICT 883  25 
3 1P3F GLN C 84  ? UNP Q7ZT66 CYS 85  CONFLICT 884  26 
3 1P3F LEU C 85  ? UNP Q7ZT66 ASN 86  CONFLICT 885  27 
3 1P3F ALA C 86  ? UNP Q7ZT66 SER 87  CONFLICT 886  28 
3 1P3F VAL C 87  ? UNP Q7ZT66 LEU 88  CONFLICT 887  29 
3 1P3F ARG C 88  ? UNP Q7ZT66 CYS 89  CONFLICT 888  30 
3 1P3F ALA C 123 ? UNP Q7ZT66 SER 124 CONFLICT 923  31 
3 1P3F ALA C 126 ? UNP Q7ZT66 THR 127 CONFLICT 926  32 
7 1P3F ALA G 14  ? UNP Q7ZT66 SER 15  CONFLICT 1014 33 
7 1P3F GLY G 67  ? UNP Q7ZT66 TRP 68  CONFLICT 1067 34 
7 1P3F ASN G 68  ? UNP Q7ZT66 GLU 69  CONFLICT 1068 35 
7 1P3F ALA G 69  ? UNP Q7ZT66 ARG 70  CONFLICT 1069 36 
7 1P3F ALA G 70  ? UNP Q7ZT66 LEU 71  CONFLICT 1070 37 
7 1P3F ARG G 71  ? UNP Q7ZT66 PRO 72  CONFLICT 1071 38 
7 1P3F ASP G 72  ? UNP Q7ZT66 GLU 73  CONFLICT 1072 39 
7 1P3F ASN G 73  ? UNP Q7ZT66 ILE 74  CONFLICT 1073 40 
7 1P3F LYS G 74  ? UNP Q7ZT66 TRP 75  CONFLICT 1074 41 
7 1P3F THR G 76  ? UNP Q7ZT66 ARG 77  CONFLICT 1076 42 
7 1P3F ARG G 77  ? UNP Q7ZT66 PRO 78  CONFLICT 1077 43 
7 1P3F ILE G 78  ? UNP Q7ZT66 VAL 79  CONFLICT 1078 44 
7 1P3F ILE G 79  ? UNP Q7ZT66 LEU 80  CONFLICT 1079 45 
7 1P3F PRO G 80  ? UNP Q7ZT66 SER 81  CONFLICT 1080 46 
7 1P3F ARG G 81  ? UNP Q7ZT66 PRO 82  CONFLICT 1081 47 
7 1P3F HIS G 82  ? UNP Q7ZT66 GLY 83  CONFLICT 1082 48 
7 1P3F LEU G 83  ? UNP Q7ZT66 TRP 84  CONFLICT 1083 49 
7 1P3F GLN G 84  ? UNP Q7ZT66 CYS 85  CONFLICT 1084 50 
7 1P3F LEU G 85  ? UNP Q7ZT66 ASN 86  CONFLICT 1085 51 
7 1P3F ALA G 86  ? UNP Q7ZT66 SER 87  CONFLICT 1086 52 
7 1P3F VAL G 87  ? UNP Q7ZT66 LEU 88  CONFLICT 1087 53 
7 1P3F ARG G 88  ? UNP Q7ZT66 CYS 89  CONFLICT 1088 54 
7 1P3F ALA G 123 ? UNP Q7ZT66 SER 124 CONFLICT 1123 55 
7 1P3F ALA G 126 ? UNP Q7ZT66 THR 127 CONFLICT 1126 56 
4 1P3F GLN D 22  ? UNP P02281 PRO 23  CONFLICT 1219 57 
4 1P3F LEU D 45  ? UNP P02281 MET 46  CONFLICT 1242 58 
4 1P3F SER D 60  ? UNP P02281 GLY 61  CONFLICT 1257 59 
4 1P3F VAL D 69  ? UNP P02281 ILE 70  CONFLICT 1266 60 
8 1P3F GLN H 22  ? UNP P02281 PRO 23  CONFLICT 1419 61 
8 1P3F LEU H 45  ? UNP P02281 MET 46  CONFLICT 1442 62 
8 1P3F SER H 60  ? UNP P02281 GLY 61  CONFLICT 1457 63 
8 1P3F VAL H 69  ? UNP P02281 ILE 70  CONFLICT 1466 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1P3F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.70 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'MnCl2, KCl, Potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'Potassium cacodylate' ? ? ? 
1 4 2 MnCl2                  ? ? ? 
1 5 2 KCl                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-09-29 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Cu 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1P3F 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.90 
_reflns.d_resolution_low             40. 
_reflns.number_all                   ? 
_reflns.number_obs                   46650 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   94.7 
_reflns_shell.Rmerge_I_obs           0.324 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P3F 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             40. 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     44678 
_refine.ls_number_reflns_obs                     43347 
_refine.ls_number_reflns_R_free                  1331 
_refine.ls_percent_reflns_obs                    94.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 3.1 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5999 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             171 
_refine_hist.number_atoms_total               12150 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        40. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.025 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d   2.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 2.4   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P3F 
_struct.title                     
;Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
;
_struct.pdbx_descriptor           'Nucleosome Core Particle/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P3F 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
'Sin mutants, Nucleosome Core Particle, chromatin, protein/DNA interaction, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? GLN C 76  ? ARG A 463  GLN A 476  1 ? 14 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? GLY C 132 ? MET A 520  GLY A 532  1 ? 13 
HELX_P HELX_P5  5  ASP D 24  ? ILE D 29  ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLY D 94  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9  9  THR E 16  ? GLY E 22  ? THR C 816  GLY C 822  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 845  ASN C 873  1 ? 29 
HELX_P HELX_P12 12 ILE E 79  ? ASN E 89  ? ILE C 879  ASN C 889  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? SER F 123 ? PRO D 1300 SER D 1320 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? ASP G 77  ? ARG E 663  ASP E 677  1 ? 15 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? GLY G 132 ? MET E 720  GLY E 732  1 ? 13 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? ALA I 21  ? THR G 1016 ALA G 1021 1 ? 6  
HELX_P HELX_P28 28 PRO I 26  ? GLY I 37  ? PRO G 1026 GLY G 1037 1 ? 12 
HELX_P HELX_P29 29 ALA I 45  ? ASP I 72  ? ALA G 1045 ASP G 1072 1 ? 28 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P36 36 PRO J 103 ? SER J 123 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog4   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B DT 142 O4 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B DA 139 N1 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B DA 139 N6 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? A DC 9   N3 ? ? ? 1_555 B DG 138 N1 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? A DC 9   N4 ? ? ? 1_555 B DG 138 O6 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog21  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT 136 N3 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DC 12  N3 ? ? ? 1_555 B DG 135 N1 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DC 12  O2 ? ? ? 1_555 B DG 135 N2 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog27  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog30  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DT 130 N3 ? ? I DC 16  J DT 276 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog31  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DT 130 O4 ? ? I DC 16  J DT 276 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog32  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DG 131 N1 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B DG 131 N2 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog38  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? A DT 20  N3 ? ? ? 1_555 B DA 127 N1 ? ? I DT 20  J DA 273 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? A DT 20  O4 ? ? ? 1_555 B DA 127 N6 ? ? I DT 20  J DA 273 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 21  J DA 272 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog43  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog44  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B DA 124 N1 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA 124 N6 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? A DA 24  N6 ? ? ? 1_555 B DT 123 O4 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 25  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog49  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog50  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 27  J DT 265 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog51  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT 120 N3 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 120 O4 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DA 28  N1 ? ? ? 1_555 B DT 119 N3 ? ? I DA 28  J DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 28  J DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog60  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B DA 115 N1 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B DA 115 N6 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DG 33  N2 ? ? ? 1_555 B DC 114 O2 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog63  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 108 N4 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? A DA 41  N6 ? ? ? 1_555 B DT 106 O4 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog86  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DA 102 N6 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B DC 101 O2 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B DC 101 N4 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DG 100 N1 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DC 47  N4 ? ? ? 1_555 B DG 100 O6 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog95  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog96  hydrog ? ? A DC 50  N3 ? ? ? 1_555 B DG 97  N1 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DC 50  N4 ? ? ? 1_555 B DG 97  O6 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DC 53  N3 ? ? ? 1_555 B DG 94  N1 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DC 53  O2 ? ? ? 1_555 B DG 94  N2 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DA 56  N1 ? ? ? 1_555 B DT 91  N3 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DG 58  N1 ? ? ? 1_555 B DC 89  N3 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DG 58  N2 ? ? ? 1_555 B DC 89  O2 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DG 58  O6 ? ? ? 1_555 B DC 89  N4 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog121 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DA 61  N6 ? ? ? 1_555 B DT 86  O4 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog124 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog140 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog141 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG 71  N1 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N2 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 70  N1 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 70  N2 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog177 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 58  N1 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 58  O6 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B DA 55  N6 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 45  O4 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog220 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog224 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N2 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog227 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DT 38  O4 ? ? I DC 108 J DT 184 1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog228 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 109 J DT 183 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog232 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog243 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog249 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 28  N6 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DC 26  N4 ? ? I DT 120 J DC 172 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog254 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DG 121 N1 ? ? ? 1_555 B DC 26  N3 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog257 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog258 hydrog ? ? A DT 123 N3 ? ? ? 1_555 B DA 24  N1 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DT 123 O4 ? ? ? 1_555 B DA 24  N6 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog261 hydrog ? ? A DG 125 N1 ? ? ? 1_555 B DC 22  N3 ? ? I DG 125 J DC 168 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog262 hydrog ? ? A DA 126 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? A DT 128 N3 ? ? ? 1_555 B DA 19  N1 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DT 128 O4 ? ? ? 1_555 B DA 19  N6 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B DG 18  N1 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? A DC 129 N4 ? ? ? 1_555 B DG 18  O6 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog270 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog271 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog282 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog283 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 9   O2 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog292 hydrog ? ? A DG 138 O6 ? ? ? 1_555 B DC 9   N4 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog293 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog294 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog295 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog296 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog297 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog298 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog299 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog300 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog301 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog302 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog303 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog304 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog305 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog306 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog307 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 80  ? VAL D 81  ? THR B 80   VAL B 81   
B 1 THR C 118 ? ILE C 119 ? THR A 518  ILE A 519  
B 2 CYS D 45  ? ILE D 46  ? CYS B 45   ILE B 46   
C 1 THR D 96  ? TYR D 98  ? THR B 96   TYR B 98   
C 2 VAL I 100 ? ILE I 102 ? VAL G 1100 ILE G 1102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 842  VAL C 843  
D 2 THR F 88  ? ILE F 89  ? THR D 1285 ILE D 1286 
E 1 ARG E 77  ? ILE E 78  ? ARG C 877  ILE C 878  
E 2 GLY F 53  ? ILE F 54  ? GLY D 1250 ILE D 1251 
F 1 THR E 101 ? ILE E 102 ? THR C 901  ILE C 902  
F 2 LEU H 97  ? TYR H 98  ? LEU F 297  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 80  ? VAL H 81  ? THR F 280  VAL F 281  
H 1 THR G 118 ? ILE G 119 ? THR E 718  ILE E 719  
H 2 CYS H 45  ? ILE H 46  ? CYS F 245  ILE F 246  
I 1 ARG I 42  ? VAL I 43  ? ARG G 1042 VAL G 1043 
I 2 THR J 88  ? ILE J 89  ? THR H 1485 ILE H 1486 
J 1 ARG I 77  ? ILE I 78  ? ARG G 1077 ILE G 1078 
J 2 GLY J 53  ? ILE J 54  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 81  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O CYS D 45  ? O CYS B 45   
C 1 2 N TYR D 98  ? N TYR B 98   O THR I 101 ? O THR G 1101 
D 1 2 N ARG E 42  ? N ARG C 842  O ILE F 89  ? O ILE D 1286 
E 1 2 N ILE E 78  ? N ILE C 878  O GLY F 53  ? O GLY D 1250 
F 1 2 N THR E 101 ? N THR C 901  O TYR H 98  ? O TYR F 298  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 81  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O CYS H 45  ? O CYS F 245  
I 1 2 N ARG I 42  ? N ARG G 1042 O ILE J 89  ? O ILE H 1486 
J 1 2 N ILE I 78  ? N ILE G 1078 O GLY J 53  ? O GLY H 1450 
# 
_atom_sites.entry_id                    1P3F 
_atom_sites.fract_transf_matrix[1][1]   0.009457 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009133 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005505 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? 1.938   -0.136  -91.872 1.00 92.13  ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? 1.841   0.005   -93.310 1.00 92.13  ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? 2.985   0.725   -93.998 1.00 92.13  ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? 2.597   2.098   -94.286 1.00 92.13  ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? 4.260   0.813   -93.150 1.00 92.13  ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? 5.476   0.463   -93.796 1.00 92.13  ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? 4.389   2.270   -92.771 1.00 92.13  ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? 3.616   3.000   -93.843 1.00 92.13  ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? 2.981   4.168   -93.241 1.00 119.11 ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? 1.835   4.249   -92.490 1.00 119.11 ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? 1.580   5.456   -92.044 1.00 119.11 ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? 2.619   6.218   -92.549 1.00 119.11 ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? 2.925   7.573   -92.447 1.00 119.11 ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? 2.180   8.444   -91.779 1.00 119.11 ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? 4.034   8.014   -93.063 1.00 119.11 ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? 4.781   7.139   -93.744 1.00 119.11 ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? 4.597   5.838   -93.920 1.00 119.11 ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? 3.486   5.439   -93.290 1.00 119.11 ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? 6.637   -0.188  -92.890 1.00 108.34 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? 6.830   -1.631  -93.288 1.00 99.88  ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? 6.233   0.137   -91.484 1.00 99.88  ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? 7.930   0.671   -93.215 1.00 108.34 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? 8.242   0.998   -94.545 1.00 108.34 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? 9.126   2.209   -94.540 1.00 108.34 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? 8.351   3.327   -94.058 1.00 108.34 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? 10.274  2.054   -93.554 1.00 108.34 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? 11.374  2.773   -94.080 1.00 108.34 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? 9.750   2.730   -92.299 1.00 108.34 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? 8.996   3.892   -92.927 1.00 108.34 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? 7.957   4.558   -92.096 1.00 99.88  ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? 7.938   5.949   -92.024 1.00 99.88  ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? 8.795   6.649   -92.535 1.00 99.88  ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? 6.877   6.480   -91.304 1.00 99.88  ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? 5.892   5.774   -90.622 1.00 99.88  ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? 4.987   6.388   -90.027 1.00 99.88  ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? 6.029   4.314   -90.685 1.00 99.88  ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? 5.091   3.453   -89.911 1.00 99.88  ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? 7.020   3.797   -91.425 1.00 99.88  ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? 12.464  3.352   -93.079 1.00 102.02 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? 13.702  3.737   -93.823 1.00 71.28  ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? 12.535  2.373   -91.938 1.00 71.28  ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? 11.809  4.703   -92.572 1.00 102.02 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? 11.980  5.888   -93.332 1.00 102.02 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? 12.438  7.022   -92.448 1.00 102.02 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? 11.356  7.497   -91.616 1.00 102.02 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? 13.558  6.672   -91.486 1.00 102.02 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? 14.199  7.880   -91.207 1.00 102.02 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? 12.826  6.271   -90.226 1.00 102.02 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? 11.686  7.284   -90.237 1.00 102.02 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? 10.448  6.897   -89.525 1.00 71.28  ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? 9.482   7.880   -89.338 1.00 71.28  ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? 9.714   9.017   -89.782 1.00 71.28  ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? 8.329   7.576   -88.682 1.00 71.28  ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? 8.137   6.334   -88.218 1.00 71.28  ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? 6.974   6.066   -87.571 1.00 71.28  ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? 9.124   5.304   -88.399 1.00 71.28  ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? 10.247  5.626   -89.057 1.00 71.28  ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? 15.757  7.869   -91.007 1.00 93.71  ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? 16.396  8.258   -92.307 1.00 66.18  ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? 15.876  6.471   -90.427 1.00 66.18  ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? 16.103  9.107   -90.066 1.00 93.71  ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? 16.102  10.415  -90.633 1.00 93.71  ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? 15.503  11.417  -89.671 1.00 93.71  ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? 14.230  10.986  -89.107 1.00 93.71  ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? 16.395  11.755  -88.488 1.00 93.71  ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? 16.273  13.151  -88.303 1.00 93.71  ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? 15.774  10.994  -87.332 1.00 93.71  ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? 14.290  11.018  -87.682 1.00 93.71  ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? 13.511  9.879   -87.163 1.00 66.18  ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? 13.833  8.539   -87.263 1.00 66.18  ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? 12.911  7.731   -86.768 1.00 66.18  ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? 11.912  8.593   -86.305 1.00 66.18  ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? 10.630  8.363   -85.710 1.00 66.18  ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? 10.115  7.156   -85.457 1.00 66.18  ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? 9.894   9.443   -85.383 1.00 66.18  ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? 10.410  10.659  -85.594 1.00 66.18  ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? 11.583  11.007  -86.131 1.00 66.18  ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? 12.289  9.919   -86.497 1.00 66.18  ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? 16.906  13.839  -87.013 1.00 104.55 ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? 17.345  15.185  -87.461 1.00 52.04  ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? 17.825  12.913  -86.293 1.00 52.04  ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? 15.680  14.016  -86.028 1.00 104.55 ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? 14.664  14.962  -86.323 1.00 104.55 ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? 13.916  15.315  -85.063 1.00 104.55 ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? 13.139  14.181  -84.624 1.00 104.55 ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? 14.827  15.691  -83.898 1.00 104.55 ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? 14.186  16.738  -83.175 1.00 104.55 ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? 14.939  14.397  -83.116 1.00 104.55 ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? 13.573  13.765  -83.350 1.00 104.55 ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? 13.620  12.320  -83.390 1.00 52.04  ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? 14.645  11.549  -83.862 1.00 52.04  ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? 14.441  10.247  -83.733 1.00 52.04  ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? 13.187  10.161  -83.162 1.00 52.04  ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? 12.386  9.048   -82.800 1.00 52.04  ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? 12.756  7.792   -82.961 1.00 52.04  ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? 11.162  9.296   -82.268 1.00 52.04  ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? 10.770  10.610  -82.135 1.00 52.04  ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? 11.448  11.745  -82.451 1.00 52.04  ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? 12.658  11.442  -82.955 1.00 52.04  ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? 14.944  17.482  -81.967 1.00 70.03  ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? 14.774  18.956  -82.227 1.00 50.64  ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? 16.297  16.876  -81.709 1.00 50.64  ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? 14.055  17.026  -80.738 1.00 70.03  ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? 13.626  15.706  -80.740 1.00 70.03  ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? 12.678  15.461  -79.625 1.00 70.03  ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? 12.449  14.062  -79.818 1.00 70.03  ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? 13.328  15.619  -78.263 1.00 70.03  ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? 12.329  16.141  -77.369 1.00 70.03  ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? 13.844  14.217  -77.958 1.00 70.03  ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? 12.882  13.326  -78.714 1.00 70.03  ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? 13.378  12.044  -79.216 1.00 50.64  ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? 12.533  10.939  -79.174 1.00 50.64  ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? 11.359  10.986  -78.844 1.00 50.64  ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? 13.099  9.768   -79.563 1.00 50.64  ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? 14.352  9.579   -80.028 1.00 50.64  ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? 14.705  8.475   -80.344 1.00 50.64  ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? 15.173  10.757  -80.105 1.00 50.64  ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? 16.572  10.614  -80.628 1.00 50.64  ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? 14.651  11.933  -79.698 1.00 50.64  ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? 12.678  16.403  -75.821 1.00 59.62  ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? 12.532  17.836  -75.525 1.00 66.00  ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? 13.953  15.711  -75.556 1.00 66.00  ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? 11.599  15.564  -75.020 1.00 59.62  ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? 10.280  15.467  -75.530 1.00 59.62  ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? 9.647   14.159  -75.116 1.00 59.62  ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? 10.339  13.018  -75.675 1.00 59.62  ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? 9.739   13.986  -73.615 1.00 59.62  ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? 8.624   13.224  -73.139 1.00 59.62  ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? 11.039  13.226  -73.462 1.00 59.62  ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? 10.879  12.250  -74.604 1.00 59.62  ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? 12.114  11.606  -75.051 1.00 66.00  ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? 13.389  12.126  -75.229 1.00 66.00  ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? 14.260  11.247  -75.673 1.00 66.00  ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? 13.520  10.074  -75.796 1.00 66.00  ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? 13.850  8.758   -76.221 1.00 66.00  ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? 15.060  8.398   -76.653 1.00 66.00  ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? 12.892  7.820   -76.192 1.00 66.00  ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? 11.686  8.173   -75.778 1.00 66.00  ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? 11.235  9.365   -75.375 1.00 66.00  ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? 12.212  10.272  -75.407 1.00 66.00  ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? 8.513   12.939  -71.562 1.00 78.08  ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? 7.093   13.032  -71.174 1.00 53.58  ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? 9.561   13.856  -70.875 1.00 53.58  ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? 8.794   11.389  -71.537 1.00 78.08  ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? 8.050   10.580  -72.422 1.00 78.08  ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? 8.176   9.141   -72.012 1.00 78.08  ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? 9.417   8.596   -72.512 1.00 78.08  ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? 8.256   9.047   -70.498 1.00 78.08  ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? 7.467   7.922   -70.072 1.00 78.08  ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? 9.761   8.976   -70.229 1.00 78.08  ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? 10.252  8.204   -71.436 1.00 78.08  ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? 11.653  8.393   -71.854 1.00 53.58  ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? 12.344  7.266   -72.314 1.00 53.58  ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? 11.852  6.123   -72.354 1.00 53.58  ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? 13.633  7.517   -72.729 1.00 53.58  ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? 14.298  8.734   -72.735 1.00 53.58  ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? 15.463  8.806   -73.170 1.00 53.58  ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? 13.528  9.864   -72.218 1.00 53.58  ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? 14.189  11.221  -72.168 1.00 53.58  ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? 12.250  9.632   -71.810 1.00 53.58  ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? 7.717   7.264   -68.634 1.00 101.55 ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? 6.446   6.523   -68.380 1.00 44.44  ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? 8.268   8.222   -67.616 1.00 44.44  ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? 8.831   6.194   -68.962 1.00 101.55 ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? 8.582   5.250   -69.990 1.00 101.55 ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? 9.437   4.035   -69.767 1.00 101.55 ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? 10.798  4.335   -70.144 1.00 101.55 ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? 9.472   3.666   -68.291 1.00 101.55 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? 9.494   2.247   -68.171 1.00 101.55 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? 10.743  4.327   -67.796 1.00 101.55 ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? 11.632  4.270   -69.017 1.00 101.55 ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? 12.593  5.356   -69.134 1.00 44.44  ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? 13.874  5.040   -69.614 1.00 44.44  ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? 14.098  3.829   -69.961 1.00 44.44  ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? 14.832  6.039   -69.718 1.00 44.44  ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? 14.496  7.305   -69.433 1.00 44.44  ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? 15.418  8.279   -69.666 1.00 44.44  ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? 13.177  7.642   -68.930 1.00 44.44  ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? 12.277  6.642   -68.798 1.00 44.44  ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? 9.185   1.561   -66.755 1.00 90.78  ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? 8.242   0.427   -67.021 1.00 71.86  ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? 8.796   2.644   -65.768 1.00 71.86  ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? 10.619  0.970   -66.434 1.00 90.78  ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? 11.393  0.449   -67.495 1.00 90.78  ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? 12.759  0.149   -66.968 1.00 90.78  ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? 13.674  1.239   -67.237 1.00 90.78  ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? 12.636  0.046   -65.450 1.00 90.78  ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? 13.483  -1.028  -65.001 1.00 90.78  ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? 13.136  1.411   -65.003 1.00 90.78  ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? 14.230  1.666   -66.021 1.00 90.78  ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? 14.648  3.061   -66.174 1.00 71.86  ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? 15.886  3.359   -66.828 1.00 71.86  ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? 16.561  2.421   -67.279 1.00 71.86  ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? 16.288  4.668   -66.964 1.00 71.86  ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? 15.495  5.647   -66.506 1.00 71.86  ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? 15.891  6.920   -66.677 1.00 71.86  ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? 14.242  5.366   -65.849 1.00 71.86  ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? 13.867  4.073   -65.706 1.00 71.86  ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? 13.107  -1.913  -63.689 1.00 84.61  ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? 12.092  -2.954  -64.120 1.00 69.58  ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? 12.783  -1.027  -62.505 1.00 69.58  ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? 14.540  -2.590  -63.458 1.00 84.61  ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? 15.266  -3.093  -64.567 1.00 84.61  ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? 16.707  -2.687  -64.471 1.00 84.61  ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? 16.865  -1.297  -64.751 1.00 84.61  ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? 17.335  -2.899  -63.100 1.00 84.61  ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? 18.660  -3.343  -63.354 1.00 84.61  ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? 17.359  -1.504  -62.529 1.00 84.61  ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? 17.720  -0.743  -63.771 1.00 84.61  ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? 17.521  0.715   -63.708 1.00 69.58  ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? 16.355  1.368   -63.341 1.00 69.58  ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? 16.432  2.686   -63.421 1.00 69.58  ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? 17.731  2.918   -63.850 1.00 69.58  ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? 18.397  4.089   -64.150 1.00 69.58  ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? 17.828  5.278   -64.009 1.00 69.58  ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? 19.677  4.003   -64.591 1.00 69.58  ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? 20.235  2.800   -64.677 1.00 69.58  ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? 19.711  1.608   -64.403 1.00 69.58  ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? 18.431  1.725   -64.006 1.00 69.58  ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? 19.562  -3.874  -62.126 1.00 89.57  ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? 19.900  -5.303  -62.551 1.00 57.08  ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? 18.594  -3.715  -60.911 1.00 57.08  ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? 20.874  -2.911  -62.070 1.00 89.57  ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? 21.809  -2.935  -63.176 1.00 89.57  ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? 22.948  -1.954  -62.978 1.00 89.57  ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? 22.509  -0.566  -63.110 1.00 89.57  ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? 23.552  -2.061  -61.575 1.00 89.57  ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? 24.983  -1.896  -61.569 1.00 89.57  ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? 22.815  -0.982  -60.797 1.00 89.57  ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? 22.718  0.129   -61.848 1.00 89.57  ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? 21.674  1.222   -61.650 1.00 57.08  ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? 22.053  2.601   -61.758 1.00 57.08  ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? 23.227  2.873   -62.055 1.00 57.08  ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? 21.105  3.578   -61.527 1.00 57.08  ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? 19.849  3.228   -61.197 1.00 57.08  ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? 18.973  4.186   -60.925 1.00 57.08  ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? 19.438  1.868   -61.115 1.00 57.08  ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? 20.363  0.906   -61.347 1.00 57.08  ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? 25.735  -1.567  -60.186 1.00 89.20  ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? 27.198  -1.677  -60.417 1.00 78.56  ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? 25.067  -2.363  -59.083 1.00 78.56  ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? 25.588  0.006   -60.047 1.00 89.20  ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? 26.457  0.832   -60.784 1.00 89.20  ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? 26.751  2.082   -59.999 1.00 89.20  ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? 25.573  2.933   -59.884 1.00 89.20  ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? 27.224  1.836   -58.569 1.00 89.20  ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? 28.276  2.773   -58.270 1.00 89.20  ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? 25.985  2.124   -57.728 1.00 89.20  ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? 25.319  3.257   -58.506 1.00 89.20  ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? 23.838  3.395   -58.298 1.00 78.56  ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? 23.237  4.696   -58.185 1.00 78.56  ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? 23.951  5.722   -58.249 1.00 78.56  ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? 21.891  4.775   -58.013 1.00 78.56  ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? 21.149  3.656   -57.942 1.00 78.56  ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? 19.831  3.774   -57.785 1.00 78.56  ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? 21.724  2.362   -58.039 1.00 78.56  ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? 23.052  2.275   -58.215 1.00 78.56  ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? 29.099  2.626   -56.902 1.00 144.42 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? 30.540  2.813   -57.164 1.00 82.64  ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? 28.624  1.361   -56.271 1.00 82.64  ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? 28.634  3.902   -56.069 1.00 144.42 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? 28.838  5.223   -56.586 1.00 144.42 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? 28.357  6.256   -55.590 1.00 144.42 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? 26.909  6.370   -55.619 1.00 144.42 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? 28.720  5.929   -54.137 1.00 144.42 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? 28.978  7.139   -53.415 1.00 144.42 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? 27.447  5.298   -53.604 1.00 144.42 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? 26.407  6.159   -54.296 1.00 144.42 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? 25.059  5.557   -54.370 1.00 82.64  ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? 23.955  6.404   -54.328 1.00 82.64  ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? 24.066  7.626   -54.301 1.00 82.64  ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? 22.725  5.764   -54.341 1.00 82.64  ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? 22.505  4.393   -54.439 1.00 82.64  ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? 21.347  3.943   -54.464 1.00 82.64  ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? 23.718  3.574   -54.525 1.00 82.64  ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? 23.585  2.095   -54.705 1.00 82.64  ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? 24.909  4.189   -54.462 1.00 82.64  ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? 30.074  7.157   -52.234 1.00 153.40 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? 31.346  6.904   -52.948 1.00 82.27  ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? 29.700  6.262   -51.085 1.00 82.27  ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? 30.029  8.688   -51.775 1.00 153.40 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? 29.990  9.757   -52.744 1.00 153.40 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? 28.940  10.779  -52.364 1.00 153.40 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? 27.643  10.130  -52.379 1.00 153.40 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? 29.069  11.397  -50.963 1.00 153.40 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? 28.562  12.750  -50.972 1.00 153.40 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? 28.178  10.502  -50.115 1.00 153.40 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? 27.037  10.236  -51.086 1.00 153.40 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? 26.190  9.055   -50.853 1.00 82.27  ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? 26.565  7.776   -50.428 1.00 82.27  ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? 25.558  6.931   -50.361 1.00 82.27  ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? 24.445  7.688   -50.765 1.00 82.27  ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? 23.082  7.312   -50.917 1.00 82.27  ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? 22.600  6.162   -50.833 1.00 82.27  ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? 22.272  8.435   -51.249 1.00 82.27  ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? 22.746  9.759   -51.485 1.00 82.27  ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? 21.855  10.788  -51.777 1.00 82.27  ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? 24.030  10.074  -51.428 1.00 82.27  ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? 24.815  9.011   -51.046 1.00 82.27  ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? 28.110  13.454  -49.588 1.00 116.55 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? 28.121  14.934  -49.794 1.00 89.18  ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? 28.912  12.838  -48.478 1.00 89.18  ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? 26.589  12.993  -49.353 1.00 116.55 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? 25.471  13.543  -50.098 1.00 116.55 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? 24.201  13.507  -49.264 1.00 116.55 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? 23.631  12.180  -49.114 1.00 116.55 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? 24.381  14.036  -47.844 1.00 116.55 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? 23.225  14.740  -47.467 1.00 116.55 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? 24.465  12.789  -46.988 1.00 116.55 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? 23.524  11.852  -47.714 1.00 116.55 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? 23.859  10.424  -47.531 1.00 89.18  ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? 22.828  9.525   -47.321 1.00 89.18  ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? 21.684  9.964   -47.222 1.00 89.18  ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? 23.096  8.201   -47.215 1.00 89.18  ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? 24.357  7.771   -47.274 1.00 89.18  ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? 24.583  6.450   -47.171 1.00 89.18  ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? 25.444  8.676   -47.447 1.00 89.18  ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? 25.151  9.982   -47.574 1.00 89.18  ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? 23.323  15.837  -46.314 1.00 72.03  ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? 23.929  17.050  -46.887 1.00 80.89  ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? 23.905  15.214  -45.090 1.00 80.89  ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? 21.816  16.278  -46.088 1.00 72.03  ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? 20.864  16.202  -47.158 1.00 72.03  ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? 19.691  15.331  -46.749 1.00 72.03  ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? 20.126  13.974  -46.468 1.00 72.03  ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? 18.964  15.782  -45.492 1.00 72.03  ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? 17.590  15.452  -45.606 1.00 72.03  ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? 19.612  14.955  -44.398 1.00 72.03  ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? 19.871  13.655  -45.113 1.00 72.03  ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? 21.033  12.940  -44.626 1.00 80.89  ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? 22.234  13.454  -44.216 1.00 80.89  ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? 23.086  12.537  -43.821 1.00 80.89  ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? 22.388  11.340  -43.975 1.00 80.89  ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? 22.710  10.013  -43.689 1.00 80.89  ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? 23.870  9.646   -43.172 1.00 80.89  ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? 21.788  9.064   -43.942 1.00 80.89  ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? 20.635  9.431   -44.451 1.00 80.89  ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? 20.200  10.645  -44.757 1.00 80.89  ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? 21.134  11.572  -44.484 1.00 80.89  ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? 16.517  16.233  -44.706 1.00 73.22  ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? 15.922  17.306  -45.583 1.00 80.46  ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? 17.127  16.597  -43.384 1.00 80.46  ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? 15.463  15.108  -44.337 1.00 73.22  ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? 15.231  14.032  -45.177 1.00 73.22  ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? 15.285  12.769  -44.372 1.00 73.22  ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? 16.640  12.510  -43.981 1.00 73.22  ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? 14.470  12.711  -43.085 1.00 73.22  ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? 13.804  11.470  -43.102 1.00 73.22  ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? 15.523  12.653  -41.991 1.00 73.22  ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? 16.634  11.930  -42.693 1.00 73.22  ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? 17.978  12.076  -42.131 1.00 80.46  ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? 18.647  13.248  -41.874 1.00 80.46  ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? 19.864  13.060  -41.439 1.00 80.46  ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? 20.001  11.680  -41.392 1.00 80.46  ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? 21.123  10.876  -41.026 1.00 80.46  ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? 22.255  11.253  -40.639 1.00 80.46  ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? 20.838  9.510   -41.157 1.00 80.46  ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? 19.630  8.994   -41.588 1.00 80.46  ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? 19.540  7.667   -41.706 1.00 80.46  ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? 18.584  9.736   -41.904 1.00 80.46  ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? 18.841  11.058  -41.797 1.00 80.46  ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? 12.640  11.170  -42.063 1.00 47.15  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? 11.429  11.116  -42.946 1.00 66.41  ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? 12.698  12.125  -40.936 1.00 66.41  ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? 13.044  9.738   -41.492 1.00 47.15  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? 13.127  8.625   -42.383 1.00 47.15  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? 13.723  7.403   -41.704 1.00 47.15  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? 15.099  7.665   -41.374 1.00 47.15  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? 13.087  6.874   -40.413 1.00 47.15  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? 13.191  5.468   -40.393 1.00 47.15  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? 13.998  7.418   -39.339 1.00 47.15  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? 15.349  7.390   -40.007 1.00 47.15  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? 16.314  8.386   -39.543 1.00 66.41  ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? 16.177  9.756   -39.545 1.00 66.41  ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? 17.255  10.400  -39.152 1.00 66.41  ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? 18.156  9.385   -38.857 1.00 66.41  ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? 19.519  9.412   -38.420 1.00 66.41  ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? 20.203  10.547  -38.220 1.00 66.41  ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? 20.149  8.214   -38.214 1.00 66.41  ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? 19.445  7.077   -38.451 1.00 66.41  ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? 18.159  6.933   -38.881 1.00 66.41  ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? 17.578  8.137   -39.069 1.00 66.41  ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? 12.100  4.597   -39.615 1.00 94.58  ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? 11.324  3.729   -40.530 1.00 98.46  ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? 11.375  5.493   -38.719 1.00 98.46  ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? 13.094  3.659   -38.809 1.00 94.58  ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? 14.258  3.147   -39.464 1.00 94.58  ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? 15.417  2.961   -38.501 1.00 94.58  ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? 16.189  4.172   -38.274 1.00 94.58  ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? 15.158  2.345   -37.109 1.00 94.58  ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? 16.112  1.270   -36.855 1.00 94.58  ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? 15.439  3.511   -36.171 1.00 94.58  ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? 16.599  4.143   -36.912 1.00 94.58  ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? 17.013  5.497   -36.488 1.00 98.46  ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? 18.291  5.626   -35.979 1.00 98.46  ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? 19.055  4.673   -35.838 1.00 98.46  ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? 18.648  6.917   -35.635 1.00 98.46  ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? 17.877  8.057   -35.747 1.00 98.46  ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? 18.347  9.147   -35.439 1.00 98.46  ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? 16.542  7.845   -36.252 1.00 98.46  ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? 15.631  9.020   -36.373 1.00 98.46  ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? 16.177  6.592   -36.595 1.00 98.46  ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? 16.152  0.546   -35.414 1.00 113.89 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? 16.689  -0.802  -35.651 1.00 96.70  ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? 14.819  0.700   -34.746 1.00 96.70  ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? 17.299  1.351   -34.659 1.00 113.89 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? 18.652  1.252   -35.115 1.00 113.89 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? 19.598  1.327   -33.940 1.00 113.89 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? 19.849  2.721   -33.630 1.00 113.89 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? 18.990  0.703   -32.677 1.00 113.89 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? 19.997  0.037   -31.854 1.00 113.89 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? 18.345  1.909   -32.001 1.00 113.89 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? 19.339  3.022   -32.326 1.00 113.89 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? 18.794  4.419   -32.322 1.00 96.70  ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? 19.675  5.463   -31.993 1.00 96.70  ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? 20.833  5.287   -31.644 1.00 96.70  ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? 19.131  6.725   -32.081 1.00 96.70  ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? 17.834  7.049   -32.439 1.00 96.70  ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? 17.504  8.229   -32.502 1.00 96.70  ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? 16.957  5.917   -32.729 1.00 96.70  ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? 15.543  6.189   -33.113 1.00 96.70  ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? 17.467  4.675   -32.648 1.00 96.70  ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? 19.561  -1.071  -30.734 1.00 117.75 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? 20.797  -1.302  -29.925 1.00 132.62 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? 18.892  -2.229  -31.379 1.00 132.62 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? 18.414  -0.353  -29.871 1.00 117.75 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? 18.488  -0.256  -28.447 1.00 117.75 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? 19.837  0.287   -28.022 1.00 117.75 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? 20.113  1.556   -28.667 1.00 117.75 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? 19.986  0.526   -26.515 1.00 117.75 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? 21.248  0.061   -26.024 1.00 117.75 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? 19.886  2.029   -26.379 1.00 117.75 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? 20.404  2.553   -27.708 1.00 117.75 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? 19.695  3.783   -28.097 1.00 132.62 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? 20.383  4.994   -28.024 1.00 132.62 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? 21.567  4.978   -27.668 1.00 132.62 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? 19.736  6.149   -28.335 1.00 132.62 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? 18.448  6.118   -28.705 1.00 132.62 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? 17.844  7.289   -28.984 1.00 132.62 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? 17.722  4.887   -28.801 1.00 132.62 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? 18.383  3.753   -28.497 1.00 132.62 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? 21.759  0.528   -24.584 1.00 116.63 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? 22.930  -0.313  -24.255 1.00 125.06 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? 20.595  0.575   -23.655 1.00 125.06 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? 22.284  1.999   -24.873 1.00 116.63 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? 23.633  2.368   -24.592 1.00 116.63 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? 23.653  3.379   -23.469 1.00 116.63 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? 22.869  4.541   -23.875 1.00 116.63 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? 23.004  2.873   -22.170 1.00 116.63 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? 23.696  3.390   -21.009 1.00 116.63 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? 21.582  3.409   -22.260 1.00 116.63 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? 21.798  4.751   -22.953 1.00 116.63 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? 20.614  5.274   -23.687 1.00 125.06 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? 20.540  6.639   -23.937 1.00 125.06 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? 21.434  7.430   -23.650 1.00 125.06 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? 19.370  7.042   -24.551 1.00 125.06 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? 18.308  6.234   -24.959 1.00 125.06 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? 17.307  6.737   -25.485 1.00 125.06 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? 18.479  4.818   -24.714 1.00 125.06 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? 17.416  3.874   -25.185 1.00 125.06 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? 19.599  4.415   -24.087 1.00 125.06 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? 22.992  3.330   -19.555 1.00 133.67 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? 24.112  3.314   -18.573 1.00 157.61 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? 21.973  2.218   -19.551 1.00 157.61 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? 22.247  4.740   -19.421 1.00 133.67 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? 22.976  5.972   -19.540 1.00 133.67 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? 22.132  7.141   -19.083 1.00 133.67 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? 21.120  7.475   -20.066 1.00 133.67 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? 21.377  6.901   -17.774 1.00 133.67 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? 21.400  8.080   -16.947 1.00 133.67 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? 19.963  6.592   -18.236 1.00 133.67 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? 19.829  7.487   -19.452 1.00 133.67 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? 18.823  7.033   -20.430 1.00 157.61 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? 18.520  5.731   -20.781 1.00 157.61 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? 17.560  5.628   -21.677 1.00 157.61 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? 17.201  6.946   -21.938 1.00 157.61 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? 16.235  7.517   -22.803 1.00 157.61 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? 15.428  6.799   -23.598 1.00 157.61 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? 16.130  8.864   -22.823 1.00 157.61 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? 16.945  9.585   -22.032 1.00 157.61 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? 17.892  9.170   -21.183 1.00 157.61 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? 17.972  7.825   -21.179 1.00 157.61 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? 20.700  8.062   -15.481 1.00 129.20 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? 21.642  8.690   -14.516 1.00 108.44 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? 20.065  6.740   -15.161 1.00 108.44 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? 19.533  9.111   -15.650 1.00 129.20 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? 19.838  10.375  -16.184 1.00 129.20 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? 18.573  11.169  -16.329 1.00 129.20 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? 17.767  10.564  -17.363 1.00 129.20 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? 17.717  11.185  -15.064 1.00 129.20 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? 17.190  12.515  -14.949 1.00 129.20 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? 16.659  10.119  -15.344 1.00 129.20 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? 16.477  10.281  -16.849 1.00 129.20 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? 15.914  9.162   -17.632 1.00 108.44 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? 14.935  9.459   -18.596 1.00 108.44 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? 14.582  10.642  -18.750 1.00 108.44 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? 14.404  8.462   -19.332 1.00 108.44 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? 14.804  7.208   -19.145 1.00 108.44 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? 14.222  6.248   -19.891 1.00 108.44 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? 15.808  6.873   -18.182 1.00 108.44 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? 16.330  7.872   -17.449 1.00 108.44 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? 16.667  13.063  -13.531 1.00 107.48 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? 17.450  14.284  -13.129 1.00 113.52 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? 16.622  11.869  -12.624 1.00 113.52 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? 15.146  13.444  -13.867 1.00 107.48 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? 14.437  12.672  -14.841 1.00 107.48 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? 12.949  12.835  -14.690 1.00 107.48 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? 12.309  11.869  -15.553 1.00 107.48 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? 12.458  12.509  -13.296 1.00 107.48 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? 11.279  13.270  -13.076 1.00 107.48 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? 12.169  11.023  -13.370 1.00 107.48 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? 11.659  10.859  -14.791 1.00 107.48 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? 11.941  9.555   -15.435 1.00 113.52 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? 11.324  9.269   -16.652 1.00 113.52 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? 10.555  10.119  -17.134 1.00 113.52 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? 11.586  8.084   -17.272 1.00 113.52 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? 12.436  7.214   -16.723 1.00 113.52 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? 12.682  6.089   -17.381 1.00 113.52 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? 13.073  7.473   -15.475 1.00 113.52 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? 12.799  8.646   -14.869 1.00 113.52 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? 11.417  14.794  -12.593 1.00 85.97  ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? 12.477  15.373  -13.472 1.00 126.05 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? 11.599  14.747  -11.116 1.00 126.05 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? 9.999   15.477  -12.906 1.00 85.97  ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? 9.765   16.175  -14.139 1.00 85.97  ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? 8.473   15.718  -14.774 1.00 85.97  ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? 8.543   14.342  -15.211 1.00 85.97  ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? 7.231   15.826  -13.912 1.00 85.97  ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? 6.287   16.380  -14.815 1.00 85.97  ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? 6.961   14.381  -13.495 1.00 85.97  ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? 7.479   13.573  -14.674 1.00 85.97  ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? 7.999   12.220  -14.396 1.00 126.05 ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? 8.707   11.843  -13.290 1.00 126.05 ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? 9.091   10.582  -13.301 1.00 126.05 ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? 8.598   10.082  -14.490 1.00 126.05 ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? 8.685   8.803   -15.086 1.00 126.05 ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? 9.323   7.770   -14.550 1.00 126.05 ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? 8.092   8.627   -16.276 1.00 126.05 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? 7.462   9.673   -16.836 1.00 126.05 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? 7.314   10.930  -16.378 1.00 126.05 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? 7.912   11.074  -15.182 1.00 126.05 ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? 4.823   16.809  -14.324 1.00 112.55 ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? 4.739   18.303  -14.276 1.00 91.20  ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? 4.456   15.992  -13.124 1.00 91.20  ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? 3.953   16.307  -15.559 1.00 112.55 ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? 4.597   15.729  -16.692 1.00 112.55 ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? 4.093   14.328  -16.931 1.00 112.55 ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? 4.746   13.292  -16.152 1.00 112.55 ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? 2.599   14.113  -16.739 1.00 112.55 ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? 2.173   13.325  -17.837 1.00 112.55 ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? 2.534   13.267  -15.479 1.00 112.55 ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? 3.758   12.389  -15.671 1.00 112.55 ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? 4.269   11.744  -14.459 1.00 91.20  ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? 4.429   12.354  -13.256 1.00 91.20  ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? 4.937   11.579  -12.328 1.00 91.20  ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? 5.120   10.366  -12.964 1.00 91.20  ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? 5.644   9.129   -12.523 1.00 91.20  ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? 6.068   8.899   -11.283 1.00 91.20  ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? 5.709   8.124   -13.401 1.00 91.20  ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? 5.253   8.332   -14.621 1.00 91.20  ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? 4.727   9.437   -15.156 1.00 91.20  ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? 4.700   10.438  -14.270 1.00 91.20  ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? 0.671   13.440  -18.364 1.00 66.41  ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? 0.679   13.170  -19.853 1.00 91.63  ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? 0.241   14.747  -17.838 1.00 91.63  ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? -0.081  12.277  -17.598 1.00 66.41  ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? 0.698   11.233  -17.100 1.00 66.41  ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? 0.686   10.076  -18.051 1.00 66.41  ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? 1.543   9.085   -17.472 1.00 66.41  ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? -0.689  9.460   -18.066 1.00 66.41  ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? -0.881  8.786   -19.272 1.00 66.41  ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? -0.667  8.507   -16.889 1.00 66.41  ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? 0.809   8.239   -16.604 1.00 66.41  ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? 1.241   8.527   -15.214 1.00 91.63  ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? 1.041   9.673   -14.481 1.00 91.63  ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? 1.544   9.625   -13.279 1.00 91.63  ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? 2.110   8.372   -13.209 1.00 91.63  ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? 2.801   7.736   -12.211 1.00 91.63  ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? 3.040   8.288   -11.040 1.00 91.63  ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? 3.257   6.494   -12.449 1.00 91.63  ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? 3.015   5.946   -13.622 1.00 91.63  ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? 2.367   6.446   -14.653 1.00 91.63  ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? 1.935   7.683   -14.383 1.00 91.63  ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? -2.065  7.711   -19.395 1.00 54.34  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? -1.868  7.189   -20.809 1.00 69.90  ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? -3.405  8.273   -18.916 1.00 69.90  ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? -1.646  6.501   -18.475 1.00 54.34  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? -0.963  5.456   -19.051 1.00 54.34  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? -1.070  4.273   -18.153 1.00 54.34  ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? -0.562  4.711   -16.864 1.00 54.34  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? -2.498  3.782   -17.925 1.00 54.34  ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? -2.467  2.354   -18.018 1.00 54.34  ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? -2.843  4.289   -16.530 1.00 54.34  ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? -1.478  4.396   -15.821 1.00 54.34  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? -1.311  5.413   -14.744 1.00 69.90  ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? -1.753  6.716   -14.756 1.00 69.90  ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? -1.454  7.393   -13.668 1.00 69.90  ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? -0.780  6.479   -12.870 1.00 69.90  ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? -0.229  6.572   -11.567 1.00 69.90  ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? -0.251  7.668   -10.833 1.00 69.90  ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? 0.354   5.480   -11.047 1.00 69.90  ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? 0.406   4.371   -11.781 1.00 69.90  ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? -0.063  4.147   -13.017 1.00 69.90  ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? -0.667  5.254   -13.516 1.00 69.90  ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? -3.717  1.502   -17.530 1.00 62.16  ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? -3.807  0.252   -18.322 1.00 79.72  ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? -4.881  2.426   -17.471 1.00 79.72  ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? -3.255  1.109   -16.067 1.00 62.16  ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? -2.051  0.357   -15.900 1.00 62.16  ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? -1.936  -0.208  -14.499 1.00 62.16  ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? -1.588  0.861   -13.603 1.00 62.16  ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? -3.178  -0.892  -13.927 1.00 62.16  ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? -2.828  -2.093  -13.273 1.00 62.16  ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? -3.704  0.091   -12.911 1.00 62.16  ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? -2.474  0.886   -12.514 1.00 62.16  ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? -2.741  2.285   -12.223 1.00 79.72  ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? -3.326  3.220   -13.038 1.00 79.72  ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? -3.468  4.388   -12.464 1.00 79.72  ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? -2.925  4.213   -11.200 1.00 79.72  ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? -2.786  5.126   -10.117 1.00 79.72  ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? -3.122  6.313   -10.058 1.00 79.72  ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? -2.184  4.518   -9.020  1.00 79.72  ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? -1.762  3.193   -8.968  1.00 79.72  ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? -1.216  2.739   -7.807  1.00 79.72  ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? -1.874  2.351   -9.976  1.00 79.72  ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? -2.463  2.921   -11.047 1.00 79.72  ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? -3.979  -3.075  -12.740 1.00 75.88  ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? -3.563  -4.455  -13.064 1.00 79.44  ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? -5.333  -2.631  -13.137 1.00 79.44  ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? -3.859  -2.798  -11.183 1.00 75.88  ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? -2.598  -2.932  -10.528 1.00 75.88  ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? -2.780  -2.905  -9.027  1.00 75.88  ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? -2.708  -1.547  -8.559  1.00 75.88  ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? -4.118  -3.460  -8.529  1.00 75.88  ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? -3.959  -4.216  -7.334  1.00 75.88  ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? -4.920  -2.223  -8.209  1.00 75.88  ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? -3.850  -1.253  -7.791  1.00 75.88  ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? -4.229  0.088   -8.119  1.00 79.44  ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? -4.103  1.041   -7.151  1.00 79.44  ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? -3.691  0.803   -6.039  1.00 79.44  ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? -4.486  2.291   -7.522  1.00 79.44  ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? -4.982  2.676   -8.753  1.00 79.44  ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? -5.248  3.871   -8.967  1.00 79.44  ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? -5.121  1.596   -9.720  1.00 79.44  ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? -5.728  1.899   -11.052 1.00 79.44  ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? -4.716  0.374   -9.364  1.00 79.44  ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? -5.250  -4.875  -6.639  1.00 99.37  ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? -4.769  -6.024  -5.830  1.00 88.60  ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? -6.340  -5.086  -7.652  1.00 88.60  ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? -5.659  -3.723  -5.632  1.00 99.37  ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? -4.681  -3.176  -4.760  1.00 99.37  ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? -5.351  -2.291  -3.741  1.00 99.37  ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? -5.531  -0.960  -4.281  1.00 99.37  ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? -6.744  -2.797  -3.363  1.00 99.37  ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? -6.990  -2.624  -1.964  1.00 99.37  ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? -7.663  -1.899  -4.168  1.00 99.37  ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? -6.889  -0.593  -4.164  1.00 99.37  ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? -7.210  0.258   -5.295  1.00 88.60  ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? -7.383  -0.146  -6.593  1.00 88.60  ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? -7.664  0.842   -7.400  1.00 88.60  ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? -7.669  1.972   -6.581  1.00 88.60  ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? -7.909  3.361   -6.888  1.00 88.60  ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? -8.116  3.892   -7.971  1.00 88.60  ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? -7.874  4.151   -5.758  1.00 88.60  ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? -7.631  3.709   -4.501  1.00 88.60  ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? -7.708  4.658   -3.565  1.00 88.60  ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? -7.355  2.437   -4.190  1.00 88.60  ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? -7.402  1.627   -5.278  1.00 88.60  ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? -8.007  -3.615  -1.206  1.00 129.02 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? -7.817  -3.290  0.234   1.00 129.35 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? -7.802  -5.016  -1.681  1.00 129.35 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? -9.443  -3.164  -1.733  1.00 129.02 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? -10.520 -2.932  -0.836  1.00 129.02 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? -10.229 -1.725  0.027   1.00 129.02 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? -9.638  -0.649  -0.752  1.00 129.02 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? -11.498 -1.156  0.647   1.00 129.02 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? -11.266 -0.632  1.955   1.00 129.02 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? -11.869 -0.040  -0.309  1.00 129.02 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? -10.517 0.475   -0.789  1.00 129.02 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? -10.560 1.001   -2.188  1.00 129.35 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? -10.521 2.372   -2.410  1.00 129.35 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? -10.433 3.204   -1.527  1.00 129.35 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? -10.592 2.737   -3.720  1.00 129.35 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? -10.690 1.915   -4.813  1.00 129.35 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? -10.740 2.403   -5.925  1.00 129.35 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? -10.722 0.500   -4.526  1.00 129.35 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? -10.826 -0.473  -5.662  1.00 129.35 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? -10.654 0.119   -3.244  1.00 129.35 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? -12.517 -0.117  2.823   1.00 114.12 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? -12.026 0.218   4.172   1.00 88.85  ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? -13.589 -1.161  2.667   1.00 88.85  ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? -12.922 1.279   2.147   1.00 114.12 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? -12.293 2.504   2.550   1.00 114.12 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? -13.131 3.698   2.143   1.00 114.12 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? -12.956 3.964   0.721   1.00 114.12 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? -14.652 3.570   2.387   1.00 114.12 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? -15.248 4.827   2.835   1.00 114.12 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? -15.171 3.214   1.009   1.00 114.12 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? -14.239 4.019   0.102   1.00 114.12 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? -14.163 3.474   -1.257  1.00 88.85  ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? -13.791 2.211   -1.674  1.00 88.85  ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? -13.926 2.019   -2.964  1.00 88.85  ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? -14.398 3.238   -3.424  1.00 88.85  ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? -14.757 3.669   -4.677  1.00 88.85  ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? -14.716 2.891   -5.747  1.00 88.85  ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? -15.184 4.932   -4.811  1.00 88.85  ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? -15.258 5.693   -3.735  1.00 88.85  ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? -14.965 5.403   -2.487  1.00 88.85  ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? -14.531 4.143   -2.394  1.00 88.85  ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? -16.866 4.981   3.007   1.00 123.94 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? -17.091 5.900   4.159   1.00 89.83  ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? -17.556 3.659   2.977   1.00 89.83  ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? -17.294 5.824   1.721   1.00 123.94 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? -16.726 7.127   1.491   1.00 123.94 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? -17.562 7.908   0.499   1.00 123.94 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? -17.374 7.370   -0.830  1.00 123.94 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? -19.073 7.874   0.760   1.00 123.94 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? -19.665 9.156   0.461   1.00 123.94 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? -19.557 6.796   -0.190  1.00 123.94 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? -18.640 7.024   -1.385  1.00 123.94 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? -18.460 5.831   -2.248  1.00 89.83  ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? -18.628 5.921   -3.648  1.00 89.83  ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? -18.966 6.953   -4.255  1.00 89.83  ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? -18.396 4.742   -4.312  1.00 89.83  ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? -18.053 3.530   -3.757  1.00 89.83  ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? -17.868 2.577   -4.483  1.00 89.83  ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? -17.940 3.505   -2.310  1.00 89.83  ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? -17.639 2.215   -1.621  1.00 89.83  ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? -18.126 4.639   -1.643  1.00 89.83  ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? -21.273 9.293   0.296   1.00 101.65 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? -21.675 10.626  0.840   1.00 85.69  ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? -21.982 8.057   0.772   1.00 85.69  ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? -21.458 9.331   -1.293  1.00 101.65 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? -20.459 9.929   -2.138  1.00 101.65 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? -20.967 10.042  -3.560  1.00 101.65 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? -20.835 8.814   -4.308  1.00 101.65 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? -22.433 10.439  -3.664  1.00 101.65 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? -22.516 11.333  -4.742  1.00 101.65 ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? -23.152 9.138   -3.971  1.00 101.65 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? -22.112 8.392   -4.787  1.00 101.65 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? -22.152 6.914   -4.702  1.00 85.69  ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? -22.119 6.212   -5.889  1.00 85.69  ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? -22.165 6.750   -7.000  1.00 85.69  ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? -22.046 4.842   -5.732  1.00 85.69  ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? -22.041 4.127   -4.544  1.00 85.69  ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? -21.946 2.898   -4.560  1.00 85.69  ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? -22.147 4.925   -3.356  1.00 85.69  ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? -22.218 4.233   -2.037  1.00 85.69  ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? -22.187 6.260   -3.487  1.00 85.69  ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? -23.935 11.787  -5.265  1.00 72.98  ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? -23.741 13.159  -5.917  1.00 75.08  ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? -24.812 11.646  -4.084  1.00 75.08  ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? -24.287 10.658  -6.366  1.00 72.98  ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? -23.663 10.657  -7.689  1.00 72.98  ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? -24.391 9.732   -8.642  1.00 72.98  ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? -24.179 8.368   -8.193  1.00 72.98  ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? -25.917 9.926   -8.737  1.00 72.98  ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? -26.474 9.876   -10.072 1.00 72.98  ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? -26.454 8.738   -7.968  1.00 72.98  ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? -25.413 7.680   -8.233  1.00 72.98  ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? -25.392 6.569   -7.241  1.00 75.08  ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? -25.259 5.290   -7.712  1.00 75.08  ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? -25.080 5.035   -8.877  1.00 75.08  ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? -25.335 4.307   -6.764  1.00 75.08  ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? -25.508 4.462   -5.406  1.00 75.08  ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? -25.591 3.473   -4.681  1.00 75.08  ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? -25.588 5.839   -4.955  1.00 75.08  ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? -25.718 6.133   -3.491  1.00 75.08  ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? -25.532 6.806   -5.887  1.00 75.08  ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? -26.377 11.156  -11.046 1.00 62.51  ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? -25.032 11.700  -10.869 1.00 86.82  ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? -27.550 12.036  -10.927 1.00 86.82  ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? -26.305 10.467  -12.472 1.00 62.51  ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? -25.084 9.889   -12.892 1.00 62.51  ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? -25.336 8.638   -13.678 1.00 62.51  ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? -25.645 7.587   -12.778 1.00 62.51  ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? -26.545 8.776   -14.552 1.00 62.51  ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? -26.306 9.212   -15.886 1.00 62.51  ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? -27.676 8.021   -13.903 1.00 62.51  ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? -26.949 7.089   -12.982 1.00 62.51  ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? -27.570 6.900   -11.673 1.00 86.82  ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? -28.105 7.833   -10.808 1.00 86.82  ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? -28.470 7.300   -9.675  1.00 86.82  ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? -28.193 5.939   -9.814  1.00 86.82  ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? -28.323 4.840   -8.913  1.00 86.82  ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? -28.714 4.847   -7.703  1.00 86.82  ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? -27.917 3.651   -9.497  1.00 86.82  ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? -27.428 3.523   -10.745 1.00 86.82  ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? -27.082 2.287   -11.138 1.00 86.82  ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? -27.280 4.510   -11.565 1.00 86.82  ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? -27.671 5.679   -11.053 1.00 86.82  ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? -26.681 8.401   -17.204 1.00 41.12  ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? -25.394 8.184   -17.982 1.00 56.87  ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? -27.647 9.381   -17.795 1.00 56.87  ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? -27.478 7.045   -16.835 1.00 41.12  ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? -26.998 5.756   -17.213 1.00 41.12  ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? -28.070 4.718   -17.004 1.00 41.12  ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? -28.614 4.672   -15.647 1.00 41.12  ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? -29.281 4.921   -17.894 1.00 41.12  ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? -29.857 3.661   -18.173 1.00 41.12  ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? -30.262 5.624   -17.001 1.00 41.12  ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? -30.044 4.910   -15.682 1.00 41.12  ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? -30.492 5.691   -14.501 1.00 56.87  ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? -30.749 7.064   -14.404 1.00 56.87  ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? -31.143 7.444   -13.213 1.00 56.87  ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? -31.134 6.277   -12.464 1.00 56.87  ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? -31.373 6.030   -11.018 1.00 56.87  ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? -31.701 6.868   -10.086 1.00 56.87  ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? -31.193 4.661   -10.708 1.00 56.87  ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? -30.869 3.653   -11.637 1.00 56.87  ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? -30.828 2.394   -11.194 1.00 56.87  ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? -30.626 3.875   -12.924 1.00 56.87  ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? -30.758 5.176   -13.261 1.00 56.87  ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? -29.776 3.087   -19.652 1.00 60.35  ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? -28.340 3.225   -20.117 1.00 54.40  ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? -30.870 3.864   -20.337 1.00 54.40  ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? -30.154 1.568   -19.419 1.00 60.35  ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? -29.216 0.676   -18.829 1.00 60.35  ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? -29.939 -0.296  -17.935 1.00 60.35  ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? -30.500 0.439   -16.819 1.00 60.35  ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? -31.109 -1.037  -18.588 1.00 60.35  ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? -30.939 -2.448  -18.313 1.00 60.35  ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? -32.337 -0.280  -18.068 1.00 60.35  ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? -31.892 0.140   -16.688 1.00 60.35  ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? -32.542 1.345   -16.171 1.00 54.40  ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? -32.674 2.582   -16.799 1.00 54.40  ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? -33.086 3.539   -15.993 1.00 54.40  ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? -33.297 2.878   -14.778 1.00 54.40  ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? -33.676 3.344   -13.521 1.00 54.40  ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? -33.912 4.622   -13.300 1.00 54.40  ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? -33.777 2.465   -12.505 1.00 54.40  ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? -33.510 1.197   -12.750 1.00 54.40  ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? -33.134 0.619   -13.893 1.00 54.40  ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? -33.028 1.526   -14.887 1.00 54.40  ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? -32.179 -3.436  -18.379 1.00 73.24  ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? -31.835 -4.796  -17.883 1.00 67.28  ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? -32.768 -3.260  -19.758 1.00 67.28  ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? -33.092 -2.850  -17.221 1.00 73.24  ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? -33.030 -3.399  -15.917 1.00 73.24  ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? -34.413 -3.456  -15.338 1.00 73.24  ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? -34.822 -2.139  -14.910 1.00 73.24  ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? -35.458 -3.918  -16.348 1.00 73.24  ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? -36.439 -4.631  -15.607 1.00 73.24  ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? -36.036 -2.607  -16.840 1.00 73.24  ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? -36.040 -1.823  -15.546 1.00 73.24  ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? -36.116 -0.373  -15.649 1.00 67.28  ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? -35.779 0.478   -16.678 1.00 67.28  ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? -35.942 1.744   -16.374 1.00 67.28  ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? -36.425 1.722   -15.067 1.00 67.28  ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? -36.777 2.732   -14.171 1.00 67.28  ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? -36.764 4.011   -14.467 1.00 67.28  ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? -37.168 2.372   -12.948 1.00 67.28  ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? -37.245 1.081   -12.666 1.00 67.28  ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? -36.978 0.032   -13.425 1.00 67.28  ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? -36.551 0.427   -14.622 1.00 67.28  ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? -37.265 -5.827  -16.296 1.00 96.15  ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? -36.584 -7.133  -15.940 1.00 71.07  ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? -37.571 -5.481  -17.744 1.00 71.07  ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? -38.641 -5.745  -15.509 1.00 96.15  ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? -38.631 -5.481  -14.114 1.00 96.15  ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? -39.758 -4.549  -13.741 1.00 96.15  ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? -39.444 -3.157  -14.028 1.00 96.15  ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? -41.097 -4.852  -14.422 1.00 96.15  ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? -42.120 -4.925  -13.415 1.00 96.15  ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? -41.298 -3.659  -15.349 1.00 96.15  ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? -40.611 -2.552  -14.578 1.00 96.15  ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? -40.246 -1.309  -15.292 1.00 71.07  ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? -39.550 -1.113  -16.482 1.00 71.07  ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? -39.352 0.159   -16.780 1.00 71.07  ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? -39.960 0.849   -15.728 1.00 71.07  ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? -40.078 2.241   -15.416 1.00 71.07  ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? -39.515 3.219   -16.133 1.00 71.07  ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? -40.786 2.588   -14.313 1.00 71.07  ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? -41.309 1.621   -13.565 1.00 71.07  ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? -41.240 0.292   -13.719 1.00 71.07  ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? -40.544 -0.034  -14.826 1.00 71.07  ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? -43.585 -5.491  -13.775 1.00 101.91 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? -44.035 -6.404  -12.672 1.00 62.50  ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? -43.572 -6.004  -15.175 1.00 62.50  ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? -44.455 -4.171  -13.647 1.00 101.91 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? -44.578 -3.553  -12.374 1.00 101.91 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? -45.440 -2.318  -12.465 1.00 101.91 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? -44.699 -1.213  -13.039 1.00 101.91 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? -46.684 -2.490  -13.340 1.00 101.91 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? -47.805 -1.802  -12.750 1.00 101.91 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? -46.268 -1.825  -14.641 1.00 101.91 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? -45.456 -0.672  -14.094 1.00 101.91 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? -44.548 -0.070  -15.052 1.00 62.50  ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? -44.352 1.312   -14.998 1.00 62.50  ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? -44.842 1.936   -14.030 1.00 62.50  ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? -43.628 1.919   -15.980 1.00 62.50  ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? -43.076 1.179   -16.953 1.00 62.50  ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? -42.438 1.803   -17.931 1.00 62.50  ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? -43.183 -0.253  -16.968 1.00 62.50  ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? -43.933 -0.827  -16.012 1.00 62.50  ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? -49.080 -1.455  -13.661 1.00 104.88 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? -50.287 -1.339  -12.803 1.00 85.55  ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? -49.058 -2.429  -14.809 1.00 85.55  ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? -48.760 0.015   -14.177 1.00 104.88 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? -48.533 1.073   -13.249 1.00 104.88 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? -48.906 2.386   -13.888 1.00 104.88 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? -47.923 2.746   -14.893 1.00 104.88 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? -50.242 2.270   -14.624 1.00 104.88 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? -50.939 3.517   -14.545 1.00 104.88 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? -49.813 1.972   -16.054 1.00 104.88 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? -48.552 2.807   -16.169 1.00 104.88 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? -47.580 2.380   -17.202 1.00 85.55  ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? -46.952 3.405   -17.880 1.00 85.55  ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? -47.225 4.598   -17.675 1.00 85.55  ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? -46.000 2.986   -18.808 1.00 85.55  ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? -45.643 1.664   -19.111 1.00 85.55  ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? -44.756 1.430   -19.947 1.00 85.55  ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? -46.370 0.646   -18.379 1.00 85.55  ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? -46.056 -0.787  -18.655 1.00 85.55  ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? -47.293 1.045   -17.478 1.00 85.55  ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? -52.541 3.554   -14.644 1.00 88.43  ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? -52.966 3.586   -13.222 1.00 84.82  ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? -53.070 2.496   -15.570 1.00 84.82  ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? -52.800 4.987   -15.298 1.00 88.43  ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? -51.993 6.128   -14.969 1.00 88.43  ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? -51.840 6.993   -16.200 1.00 88.43  ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? -50.834 6.481   -17.107 1.00 88.43  ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? -53.115 7.065   -17.025 1.00 88.43  ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? -53.043 8.272   -17.724 1.00 88.43  ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? -52.884 6.002   -18.073 1.00 88.43  ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? -51.427 6.290   -18.386 1.00 88.43  ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? -50.748 5.193   -19.051 1.00 84.82  ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? -50.986 3.863   -18.805 1.00 84.82  ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? -50.248 3.061   -19.525 1.00 84.82  ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? -49.470 3.906   -20.313 1.00 84.82  ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? -48.469 3.599   -21.321 1.00 84.82  ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? -48.066 2.465   -21.733 1.00 84.82  ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? -47.932 4.762   -21.864 1.00 84.82  ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? -48.292 6.043   -21.516 1.00 84.82  ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? -47.658 7.015   -22.172 1.00 84.82  ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? -49.211 6.344   -20.596 1.00 84.82  ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? -49.756 5.233   -20.038 1.00 84.82  ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? -54.209 9.339   -17.582 1.00 105.33 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? -53.970 10.089  -16.291 1.00 57.56  ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? -55.507 8.593   -17.862 1.00 57.56  ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? -53.871 10.362  -18.750 1.00 105.33 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? -52.538 10.826  -18.899 1.00 105.33 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? -52.123 10.698  -20.339 1.00 105.33 ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? -51.816 9.325   -20.655 1.00 105.33 ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? -53.240 11.105  -21.293 1.00 105.33 ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? -52.693 11.959  -22.287 1.00 105.33 ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? -53.744 9.789   -21.870 1.00 105.33 ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? -52.470 8.975   -21.860 1.00 105.33 ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? -52.591 7.506   -21.917 1.00 57.56  ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? -51.797 6.807   -22.832 1.00 57.56  ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? -50.924 7.440   -23.486 1.00 57.56  ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? -51.964 5.465   -22.976 1.00 57.56  ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? -52.842 4.822   -22.221 1.00 57.56  ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? -53.007 3.505   -22.439 1.00 57.56  ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? -53.605 5.499   -21.224 1.00 57.56  ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? -53.456 6.833   -21.119 1.00 57.56  ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? -53.191 13.483  -22.390 1.00 72.26  ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? -52.965 14.291  -21.151 1.00 76.69  ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? -54.542 13.349  -23.009 1.00 76.69  ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? -52.226 14.081  -23.470 1.00 72.26  ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? -52.365 13.638  -24.807 1.00 72.26  ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? -51.107 12.949  -25.266 1.00 72.26  ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? -51.183 11.526  -25.034 1.00 72.26  ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? -50.933 13.115  -26.758 1.00 72.26  ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? -49.563 13.362  -27.004 1.00 72.26  ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? -51.457 11.812  -27.325 1.00 72.26  ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? -51.090 10.824  -26.254 1.00 72.26  ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? -51.970 9.671   -26.148 1.00 76.69  ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? -51.464 8.445   -26.463 1.00 76.69  ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? -50.347 8.285   -26.900 1.00 76.69  ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? -52.301 7.402   -26.223 1.00 76.69  ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? -53.550 7.459   -25.684 1.00 76.69  ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? -54.123 6.433   -25.404 1.00 76.69  ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? -54.056 8.785   -25.449 1.00 76.69  ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? -55.452 8.952   -24.948 1.00 76.69  ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? -53.250 9.818   -25.695 1.00 76.69  ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? -49.161 14.375  -28.172 1.00 56.14  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? -47.849 15.047  -27.888 1.00 64.86  ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? -50.405 15.198  -28.227 1.00 64.86  ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? -49.021 13.396  -29.445 1.00 56.14  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? -48.283 12.162  -29.371 1.00 56.14  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? -48.741 11.233  -30.456 1.00 56.14  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? -49.841 10.378  -30.073 1.00 56.14  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? -49.225 12.012  -31.675 1.00 56.14  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? -49.065 11.211  -32.874 1.00 56.14  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? -50.737 11.991  -31.514 1.00 56.14  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? -50.908 10.563  -31.027 1.00 56.14  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? -52.217 10.353  -30.355 1.00 64.86  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? -52.663 9.036   -30.063 1.00 64.86  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? -52.037 8.067   -30.550 1.00 64.86  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? -53.794 8.884   -29.282 1.00 64.86  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? -54.494 9.975   -28.880 1.00 64.86  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? -55.556 9.819   -28.102 1.00 64.86  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? -54.119 11.293  -29.254 1.00 64.86  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? -52.983 11.442  -29.976 1.00 64.86  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? -47.618 11.278  -33.631 1.00 43.44  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? -46.640 11.124  -32.427 1.00 47.16  ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? -47.575 12.597  -34.371 1.00 47.16  ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? -47.418 9.934   -34.519 1.00 43.44  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? -47.053 8.825   -33.792 1.00 43.44  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? -47.920 7.679   -34.257 1.00 43.44  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? -49.192 7.627   -33.551 1.00 43.44  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? -48.255 7.620   -35.744 1.00 43.44  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? -47.987 6.317   -36.245 1.00 43.44  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? -49.755 7.887   -35.809 1.00 43.44  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? -50.258 7.328   -34.480 1.00 43.44  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? -51.520 7.958   -33.969 1.00 47.16  ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? -52.509 7.184   -33.344 1.00 47.16  ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? -52.340 5.984   -33.234 1.00 47.16  ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? -53.593 7.798   -32.850 1.00 47.16  ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? -53.699 9.127   -32.906 1.00 47.16  ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? -54.730 9.703   -32.313 1.00 47.16  ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? -52.739 9.927   -33.549 1.00 47.16  ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? -51.680 9.309   -34.080 1.00 47.16  ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? -47.668 6.134   -37.794 1.00 31.23  ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? -46.223 5.826   -37.990 1.00 61.80  ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? -48.289 7.326   -38.401 1.00 61.80  ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? -48.522 4.874   -38.186 1.00 31.23  ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? -48.569 3.756   -37.271 1.00 31.23  ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? -49.787 2.892   -37.539 1.00 31.23  ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? -51.008 3.457   -36.957 1.00 31.23  ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? -50.063 2.630   -39.030 1.00 31.23  ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? -50.498 1.304   -39.134 1.00 31.23  ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? -51.182 3.586   -39.373 1.00 31.23  ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? -51.930 3.710   -38.033 1.00 31.23  ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? -52.418 5.048   -37.832 1.00 61.80  ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? -51.877 6.216   -38.268 1.00 61.80  ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? -52.467 7.270   -37.782 1.00 61.80  ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? -53.474 6.746   -36.985 1.00 61.80  ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? -54.432 7.344   -36.148 1.00 61.80  ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? -54.477 8.658   -35.904 1.00 61.80  ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? -55.335 6.540   -35.550 1.00 61.80  ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? -55.254 5.220   -35.776 1.00 61.80  ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? -54.365 4.539   -36.508 1.00 61.80  ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? -53.493 5.379   -37.075 1.00 61.80  ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? -51.061 0.725   -40.537 1.00 71.23  ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? -50.824 -0.774  -40.475 1.00 71.80  ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? -50.632 1.495   -41.735 1.00 71.80  ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? -52.626 0.950   -40.372 1.00 71.23  ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? -53.357 0.271   -39.354 1.00 71.23  ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? -54.823 0.591   -39.489 1.00 71.23  ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? -55.159 1.919   -38.989 1.00 71.23  ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? -55.348 0.542   -40.923 1.00 71.23  ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? -56.648 -0.025  -40.871 1.00 71.23  ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? -55.493 2.010   -41.281 1.00 71.23  ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? -55.977 2.567   -39.952 1.00 71.23  ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? -55.880 4.022   -39.754 1.00 71.80  ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? -56.827 4.672   -38.983 1.00 71.80  ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? -57.767 4.113   -38.470 1.00 71.80  ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? -56.633 6.025   -38.846 1.00 71.80  ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? -55.609 6.792   -39.413 1.00 71.80  ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? -55.555 8.025   -39.218 1.00 71.80  ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? -54.659 6.038   -40.215 1.00 71.80  ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? -53.522 6.764   -40.857 1.00 71.80  ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? -54.846 4.710   -40.340 1.00 71.80  ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? -57.182 -0.959  -42.075 1.00 109.84 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? -57.113 -2.404  -41.610 1.00 77.39  ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? -56.522 -0.588  -43.354 1.00 77.39  ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? -58.688 -0.456  -42.204 1.00 109.84 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? -59.637 -0.661  -41.159 1.00 109.84 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? -60.937 -0.003  -41.555 1.00 109.84 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? -60.854 1.421   -41.277 1.00 109.84 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? -61.216 -0.088  -43.069 1.00 109.84 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? -62.636 -0.167  -43.327 1.00 109.84 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? -60.647 1.218   -43.617 1.00 109.84 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? -60.955 2.181   -42.487 1.00 109.84 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? -60.082 3.365   -42.347 1.00 77.39  ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? -60.650 4.516   -41.791 1.00 77.39  ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? -61.848 4.479   -41.436 1.00 77.39  ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? -59.893 5.623   -41.654 1.00 77.39  ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? -58.617 5.611   -42.033 1.00 77.39  ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? -57.932 6.723   -41.861 1.00 77.39  ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? -58.000 4.452   -42.600 1.00 77.39  ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? -58.762 3.360   -42.741 1.00 77.39  ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? -63.263 0.460   -44.684 1.00 72.40  ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? -64.522 -0.262  -44.980 1.00 115.19 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? -62.193 0.512   -45.724 1.00 115.19 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? -63.646 1.947   -44.259 1.00 72.40  ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? -64.688 2.191   -43.327 1.00 72.40  ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? -65.384 3.490   -43.659 1.00 72.40  ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? -64.456 4.599   -43.527 1.00 72.40  ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? -66.013 3.643   -45.055 1.00 72.40  ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? -67.198 4.474   -44.944 1.00 72.40  ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? -64.916 4.341   -45.833 1.00 72.40  ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? -64.350 5.286   -44.770 1.00 72.40  ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? -62.947 5.659   -44.948 1.00 115.19 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? -61.879 4.865   -45.323 1.00 115.19 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? -60.741 5.507   -45.375 1.00 115.19 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? -61.080 6.805   -45.016 1.00 115.19 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? -60.325 7.953   -44.890 1.00 115.19 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? -59.003 7.969   -45.087 1.00 115.19 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? -60.966 9.102   -44.545 1.00 115.19 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? -62.287 9.062   -44.325 1.00 115.19 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? -63.108 8.027   -44.396 1.00 115.19 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? -62.433 6.916   -44.756 1.00 115.19 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? -68.173 4.660   -46.208 1.00 129.77 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? -69.560 4.525   -45.705 1.00 105.05 ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? -67.707 3.748   -47.288 1.00 105.05 ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? -67.905 6.173   -46.660 1.00 129.77 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? -68.275 7.265   -45.801 1.00 129.77 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? -67.781 8.592   -46.344 1.00 129.77 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? -66.328 8.610   -46.317 1.00 129.77 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? -68.171 8.940   -47.794 1.00 129.77 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? -68.169 10.373  -47.995 1.00 129.77 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? -66.981 8.423   -48.579 1.00 129.77 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? -65.834 8.822   -47.651 1.00 129.77 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? -64.599 8.036   -47.856 1.00 105.05 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? -64.506 6.679   -48.102 1.00 105.05 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? -63.274 6.257   -48.330 1.00 105.05 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? -62.498 7.404   -48.200 1.00 105.05 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? -61.120 7.629   -48.333 1.00 105.05 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? -60.235 6.662   -48.629 1.00 105.05 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? -60.675 8.895   -48.154 1.00 105.05 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? -61.554 9.854   -47.854 1.00 105.05 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? -62.866 9.771   -47.699 1.00 105.05 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? -63.292 8.506   -47.891 1.00 105.05 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? -69.530 11.166  -48.367 1.00 158.14 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? -70.261 11.423  -47.091 1.00 105.58 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? -70.211 10.457  -49.482 1.00 105.58 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? -69.016 12.572  -48.923 1.00 158.14 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? -68.466 13.538  -48.024 1.00 158.14 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? -67.345 14.320  -48.672 1.00 158.14 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? -66.106 13.565  -48.705 1.00 158.14 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? -67.600 14.832  -50.094 1.00 158.14 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? -67.320 16.239  -50.094 1.00 158.14 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? -66.692 13.980  -50.969 1.00 158.14 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? -65.580 13.509  -50.026 1.00 158.14 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? -65.106 12.135  -50.257 1.00 105.58 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? -65.873 10.991  -50.285 1.00 105.58 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? -65.188 9.892   -50.521 1.00 105.58 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? -63.876 10.337  -50.664 1.00 105.58 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? -62.663 9.661   -50.958 1.00 105.58 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? -62.585 8.338   -51.154 1.00 105.58 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? -61.531 10.406  -51.048 1.00 105.58 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? -61.616 11.729  -50.853 1.00 105.58 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? -62.692 12.477  -50.571 1.00 105.58 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? -63.805 11.717  -50.492 1.00 105.58 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? -66.759 16.996  -51.407 1.00 144.92 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? -66.808 18.462  -51.046 1.00 111.34 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? -67.420 16.505  -52.661 1.00 111.34 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? -65.207 16.612  -51.452 1.00 144.92 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? -64.218 17.393  -50.754 1.00 144.92 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? -62.930 17.421  -51.542 1.00 144.92 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? -62.481 16.072  -51.813 1.00 144.92 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? -63.012 18.092  -52.904 1.00 144.92 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? -61.717 18.545  -53.152 1.00 144.92 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? -63.233 16.930  -53.848 1.00 144.92 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? -62.350 15.874  -53.211 1.00 144.92 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? -62.769 14.509  -53.497 1.00 111.34 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? -64.061 14.058  -53.541 1.00 111.34 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? -64.171 12.779  -53.795 1.00 111.34 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? -62.859 12.353  -53.931 1.00 111.34 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? -62.297 11.086  -54.194 1.00 111.34 ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? -63.019 9.970   -54.378 1.00 111.34 ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? -60.951 11.004  -54.262 1.00 111.34 ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? -60.228 12.117  -54.085 1.00 111.34 ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? -60.639 13.360  -53.833 1.00 111.34 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? -61.981 13.412  -53.762 1.00 111.34 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? -61.416 20.099  -53.238 1.00 109.71 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? -61.277 20.658  -51.876 1.00 85.61  ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? -62.360 20.721  -54.217 1.00 85.61  ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? -59.976 20.053  -53.907 1.00 109.71 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? -59.108 18.946  -53.661 1.00 109.71 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? -58.649 18.334  -54.963 1.00 109.71 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? -59.365 17.154  -55.378 1.00 109.71 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? -58.595 19.239  -56.183 1.00 109.71 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? -57.364 18.958  -56.782 1.00 109.71 ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? -59.698 18.709  -57.077 1.00 109.71 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? -59.653 17.226  -56.769 1.00 109.71 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? -60.897 16.492  -56.969 1.00 85.61  ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? -62.196 16.970  -56.893 1.00 85.61  ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? -63.089 16.021  -56.968 1.00 85.61  ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? -62.344 14.864  -57.146 1.00 85.61  ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? -62.751 13.538  -57.283 1.00 85.61  ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? -63.894 13.098  -57.290 1.00 85.61  ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? -61.670 12.679  -57.428 1.00 85.61  ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? -60.353 13.068  -57.463 1.00 85.61  ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? -59.449 12.109  -57.635 1.00 85.61  ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? -59.957 14.309  -57.345 1.00 85.61  ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? -60.992 15.145  -57.182 1.00 85.61  ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? -56.204 20.033  -56.704 1.00 58.42  ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? -55.032 19.548  -55.912 1.00 111.60 ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? -56.815 21.347  -56.390 1.00 111.60 ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? -55.805 20.041  -58.218 1.00 58.42  ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? -54.565 19.495  -58.629 1.00 58.42  ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? -54.325 18.100  -58.094 1.00 58.42  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? -55.479 17.243  -58.077 1.00 58.42  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? -53.372 17.454  -59.078 1.00 58.42  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? -52.420 16.668  -58.436 1.00 58.42  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? -54.264 16.669  -60.021 1.00 58.42  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? -55.438 16.308  -59.168 1.00 58.42  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? -56.697 16.407  -59.886 1.00 111.60 ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? -57.365 17.554  -60.219 1.00 111.60 ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? -58.543 17.326  -60.720 1.00 111.60 ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? -58.645 15.949  -60.752 1.00 111.60 ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? -59.710 15.112  -61.142 1.00 111.60 ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? -60.840 15.444  -61.535 1.00 111.60 ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? -59.382 13.770  -61.030 1.00 111.60 ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? -58.173 13.294  -60.603 1.00 111.60 ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? -58.024 11.961  -60.631 1.00 111.60 ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? -57.183 14.064  -60.200 1.00 111.60 ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? -57.487 15.366  -60.295 1.00 111.60 ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? -50.966 16.573  -59.061 1.00 46.03  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? -50.021 16.221  -57.974 1.00 70.29  ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? -50.735 17.785  -59.864 1.00 70.29  ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? -51.070 15.344  -60.061 1.00 46.03  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? -50.788 14.018  -59.588 1.00 46.03  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? -51.336 12.999  -60.563 1.00 46.03  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? -52.648 13.445  -61.020 1.00 46.03  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? -50.527 12.815  -61.857 1.00 46.03  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? -50.601 11.476  -62.188 1.00 46.03  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? -51.293 13.555  -62.947 1.00 46.03  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? -52.713 13.366  -62.468 1.00 46.03  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? -53.701 14.351  -62.930 1.00 70.29  ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? -55.018 13.922  -63.171 1.00 70.29  ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? -55.284 12.702  -63.098 1.00 70.29  ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? -55.966 14.838  -63.504 1.00 70.29  ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? -55.622 16.119  -63.658 1.00 70.29  ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? -56.583 16.989  -64.020 1.00 70.29  ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? -54.279 16.567  -63.460 1.00 70.29  ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? -53.363 15.656  -63.095 1.00 70.29  ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? -49.378 10.801  -62.902 1.00 54.49  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? -48.896 9.690   -61.987 1.00 59.00  ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? -48.417 11.770  -63.449 1.00 59.00  ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? -50.119 10.162  -64.146 1.00 54.49  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? -51.048 9.119   -63.909 1.00 54.49  ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? -51.758 8.752   -65.171 1.00 54.49  ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? -52.670 9.797   -65.514 1.00 54.49  ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? -50.861 8.549   -66.372 1.00 54.49  ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? -51.331 7.365   -67.002 1.00 54.49  ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? -51.060 9.807   -67.196 1.00 54.49  ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? -52.441 10.256  -66.813 1.00 54.49  ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? -52.581 11.675  -66.712 1.00 59.00  ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? -51.791 12.581  -66.088 1.00 59.00  ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? -52.277 13.805  -66.089 1.00 59.00  ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? -53.459 13.679  -66.773 1.00 59.00  ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? -54.471 14.591  -67.094 1.00 59.00  ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? -54.475 15.868  -66.703 1.00 59.00  ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? -55.514 14.144  -67.820 1.00 59.00  ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? -55.547 12.846  -68.166 1.00 59.00  ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? -54.666 11.876  -67.893 1.00 59.00  ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? -53.643 12.376  -67.190 1.00 59.00  ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? -50.664 6.849   -68.356 1.00 75.71  ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? -51.041 5.421   -68.426 1.00 75.18  ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? -49.223 7.247   -68.492 1.00 75.18  ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? -51.546 7.636   -69.402 1.00 75.71  ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? -52.952 7.494   -69.394 1.00 75.71  ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? -53.520 8.185   -70.606 1.00 75.71  ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? -53.756 9.584   -70.289 1.00 75.71  ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? -52.558 8.162   -71.794 1.00 75.71  ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? -53.206 7.733   -73.004 1.00 75.71  ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? -52.029 9.587   -71.840 1.00 75.71  ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? -53.193 10.382  -71.295 1.00 75.71  ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? -52.853 11.682  -70.707 1.00 75.18  ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? -53.807 12.679  -70.775 1.00 75.18  ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? -54.897 12.499  -71.239 1.00 75.18  ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? -53.438 13.890  -70.258 1.00 75.18  ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? -52.235 14.197  -69.673 1.00 75.18  ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? -52.019 15.335  -69.275 1.00 75.18  ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? -51.287 13.096  -69.598 1.00 75.18  ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? -49.968 13.317  -68.939 1.00 75.18  ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? -51.638 11.910  -70.121 1.00 75.18  ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? -52.353 6.914   -74.102 1.00 85.54  ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? -52.737 5.477   -74.084 1.00 77.40  ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? -50.915 7.317   -73.974 1.00 77.40  ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? -52.837 7.549   -75.464 1.00 85.54  ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? -54.132 8.060   -75.567 1.00 85.54  ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? -54.144 9.174   -76.575 1.00 85.54  ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? -53.789 10.395  -75.905 1.00 85.54  ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? -53.143 9.003   -77.721 1.00 85.54  ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? -53.764 9.373   -78.970 1.00 85.54  ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? -52.016 9.940   -77.340 1.00 85.54  ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? -52.757 11.045  -76.630 1.00 85.54  ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? -51.904 11.746  -75.681 1.00 77.40  ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? -50.846 11.179  -74.999 1.00 77.40  ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? -50.291 11.993  -74.152 1.00 77.40  ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? -51.000 13.176  -74.285 1.00 77.40  ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? -50.848 14.395  -73.589 1.00 77.40  ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? -50.064 14.670  -72.690 1.00 77.40  ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? -51.742 15.348  -74.022 1.00 77.40  ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? -52.693 15.159  -75.004 1.00 77.40  ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? -53.451 16.218  -75.284 1.00 77.40  ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? -52.873 14.011  -75.663 1.00 77.40  ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? -51.989 13.061  -75.249 1.00 77.40  ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? -52.874 9.704   -80.281 1.00 89.38  ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? -53.609 9.087   -81.416 1.00 73.24  ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? -51.440 9.331   -80.064 1.00 73.24  ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? -53.006 11.300  -80.363 1.00 89.38  ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? -54.266 11.949  -80.139 1.00 89.38  ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? -54.210 13.359  -80.674 1.00 89.38  ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? -53.601 14.266  -79.721 1.00 89.38  ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? -53.358 13.450  -81.932 1.00 89.38  ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? -53.947 14.345  -82.881 1.00 89.38  ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? -52.015 13.958  -81.422 1.00 89.38  ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? -52.412 14.840  -80.266 1.00 89.38  ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? -51.402 14.881  -79.206 1.00 73.24  ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? -51.264 16.059  -78.511 1.00 73.24  ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? -51.957 17.060  -78.727 1.00 73.24  ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? -50.296 16.027  -77.530 1.00 73.24  ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? -49.504 14.955  -77.163 1.00 73.24  ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? -48.701 15.076  -76.238 1.00 73.24  ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? -49.712 13.751  -77.919 1.00 73.24  ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? -48.919 12.537  -77.563 1.00 73.24  ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? -50.625 13.775  -78.907 1.00 73.24  ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? -53.175 14.670  -84.261 1.00 71.83  ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? -54.305 14.989  -85.241 1.00 53.50  ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? -52.152 13.588  -84.620 1.00 53.50  ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? -52.396 16.000  -83.850 1.00 71.83  ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? -53.114 17.063  -83.236 1.00 71.83  ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? -52.236 18.286  -83.115 1.00 71.83  ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? -51.353 18.160  -81.977 1.00 71.83  ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? -51.324 18.493  -84.317 1.00 71.83  ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? -51.069 19.892  -84.484 1.00 71.83  ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? -50.047 17.808  -83.879 1.00 71.83  ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? -50.029 18.233  -82.421 1.00 71.83  ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? -49.226 17.411  -81.542 1.00 53.50  ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? -48.646 18.029  -80.465 1.00 53.50  ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? -48.878 19.209  -80.174 1.00 53.50  ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? -47.799 17.212  -79.717 1.00 53.50  ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? -47.530 15.857  -79.929 1.00 53.50  ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? -46.730 15.226  -79.171 1.00 53.50  ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? -48.248 15.276  -81.061 1.00 53.50  ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? -48.093 13.817  -81.347 1.00 53.50  ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? -49.036 16.079  -81.798 1.00 53.50  ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? -50.768 20.475  -85.959 1.00 73.07  ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? -52.044 21.130  -86.387 1.00 45.34  ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? -50.094 19.410  -86.808 1.00 45.34  ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? -49.689 21.624  -85.719 1.00 73.07  ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? -49.777 22.467  -84.561 1.00 73.07  ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? -48.399 22.726  -83.993 1.00 73.07  ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? -47.913 21.608  -83.201 1.00 73.07  ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? -47.332 22.961  -85.061 1.00 73.07  ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? -46.487 24.003  -84.646 1.00 73.07  ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? -46.516 21.679  -85.037 1.00 73.07  ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? -46.557 21.410  -83.568 1.00 73.07  ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? -46.119 20.073  -83.167 1.00 45.34  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? -45.565 19.879  -81.859 1.00 45.34  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? -45.463 20.857  -81.092 1.00 45.34  ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? -45.143 18.646  -81.496 1.00 45.34  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? -45.219 17.633  -82.372 1.00 45.34  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? -44.772 16.441  -81.978 1.00 45.34  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? -45.753 17.800  -83.691 1.00 45.34  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? -46.205 19.027  -84.037 1.00 45.34  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? -46.856 25.510  -85.012 1.00 65.18  ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? -48.310 25.796  -84.794 1.00 55.91  ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? -46.237 25.706  -86.323 1.00 55.91  ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? -46.000 26.358  -83.964 1.00 65.18  ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? -46.227 26.227  -82.531 1.00 65.18  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? -44.920 26.282  -81.772 1.00 65.18  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? -44.260 25.016  -81.845 1.00 65.18  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? -43.885 27.272  -82.287 1.00 65.18  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? -43.129 27.610  -81.149 1.00 65.18  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? -43.031 26.427  -83.224 1.00 65.18  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? -42.984 25.147  -82.449 1.00 65.18  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? -42.763 23.916  -83.172 1.00 55.91  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? -42.980 23.641  -84.479 1.00 55.91  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? -42.891 22.371  -84.778 1.00 55.91  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? -42.543 21.779  -83.576 1.00 55.91  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? -42.358 20.441  -83.196 1.00 55.91  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? -42.471 19.408  -84.034 1.00 55.91  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? -42.051 20.192  -81.897 1.00 55.91  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? -41.912 21.227  -81.058 1.00 55.91  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? -42.053 22.525  -81.303 1.00 55.91  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? -42.395 22.732  -82.592 1.00 55.91  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? -42.659 29.132  -80.895 1.00 60.27  ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? -43.552 29.816  -79.979 1.00 54.21  ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? -42.408 29.767  -82.186 1.00 54.21  ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? -41.285 28.851  -80.123 1.00 60.27  ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? -41.237 27.779  -79.169 1.00 60.27  ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? -39.980 26.956  -79.317 1.00 60.27  ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? -40.126 25.822  -80.197 1.00 60.27  ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? -38.796 27.743  -79.855 1.00 60.27  ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? -37.595 27.304  -79.185 1.00 60.27  ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? -38.711 27.276  -81.291 1.00 60.27  ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? -38.998 25.826  -81.048 1.00 60.27  ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? -39.295 25.070  -82.251 1.00 54.21  ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? -39.851 25.573  -83.398 1.00 54.21  ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? -39.981 24.684  -84.341 1.00 54.21  ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? -39.478 23.521  -83.776 1.00 54.21  ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? -39.341 22.235  -84.329 1.00 54.21  ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? -39.649 21.849  -85.492 1.00 54.21  ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? -38.779 21.342  -83.411 1.00 54.21  ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? -38.398 21.664  -82.128 1.00 54.21  ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? -37.906 20.654  -81.379 1.00 54.21  ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? -38.506 22.876  -81.615 1.00 54.21  ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? -39.057 23.744  -82.484 1.00 54.21  ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? -36.945 28.196  -77.977 1.00 42.22  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? -38.103 28.589  -77.059 1.00 52.73  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? -36.074 29.262  -78.574 1.00 52.73  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? -36.033 27.079  -77.328 1.00 42.22  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? -36.645 25.876  -76.928 1.00 42.22  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? -35.808 24.699  -77.352 1.00 42.22  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? -36.086 24.437  -78.730 1.00 42.22  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? -34.306 24.925  -77.257 1.00 42.22  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? -33.627 23.871  -76.573 1.00 42.22  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? -33.849 25.021  -78.699 1.00 42.22  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? -34.880 24.157  -79.388 1.00 42.22  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? -35.114 24.430  -80.805 1.00 52.73  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? -35.275 23.352  -81.675 1.00 52.73  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? -35.118 22.207  -81.258 1.00 52.73  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? -35.584 23.593  -82.936 1.00 52.73  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? -35.708 24.855  -83.359 1.00 52.73  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? -36.053 25.034  -84.622 1.00 52.73  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? -35.496 25.975  -82.503 1.00 52.73  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? -35.209 25.716  -81.254 1.00 52.73  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? -32.146 24.147  -75.988 1.00 36.75  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? -32.217 24.048  -74.509 1.00 54.03  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? -31.583 25.382  -76.582 1.00 54.03  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? -31.375 22.911  -76.581 1.00 36.75  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? -32.017 21.674  -76.593 1.00 36.75  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? -31.310 20.716  -77.519 1.00 36.75  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? -31.614 21.038  -78.894 1.00 36.75  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? -29.778 20.700  -77.458 1.00 36.75  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? -29.393 19.370  -77.840 1.00 36.75  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? -29.358 21.710  -78.533 1.00 36.75  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? -30.440 21.511  -79.590 1.00 36.75  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? -30.845 22.705  -80.313 1.00 54.03  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? -30.815 24.022  -79.879 1.00 54.03  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? -31.246 24.875  -80.776 1.00 54.03  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? -31.597 24.070  -81.858 1.00 54.03  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? -32.102 24.414  -83.099 1.00 54.03  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? -32.415 25.533  -83.475 1.00 54.03  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? -32.240 23.297  -83.939 1.00 54.03  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? -31.935 21.990  -83.586 1.00 54.03  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? -32.021 21.045  -84.528 1.00 54.03  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? -31.531 21.638  -82.385 1.00 54.03  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? -31.356 22.725  -81.583 1.00 54.03  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? -28.052 18.701  -77.257 1.00 62.08  ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? -28.560 17.539  -76.417 1.00 41.76  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? -27.170 19.792  -76.727 1.00 41.76  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? -27.270 18.134  -78.523 1.00 62.08  ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? -27.962 17.494  -79.581 1.00 62.08  ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? -27.465 18.006  -80.912 1.00 62.08  ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? -28.068 19.274  -81.250 1.00 62.08  ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? -25.953 18.244  -81.029 1.00 62.08  ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? -25.496 17.739  -82.284 1.00 62.08  ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? -25.837 19.755  -81.075 1.00 62.08  ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? -27.066 20.036  -81.871 1.00 62.08  ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? -27.465 21.424  -81.905 1.00 41.76  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? -27.382 22.361  -80.902 1.00 41.76  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? -27.783 23.551  -81.266 1.00 41.76  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? -28.162 23.370  -82.575 1.00 41.76  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? -28.724 24.277  -83.459 1.00 41.76  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? -28.994 25.466  -83.220 1.00 41.76  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? -28.999 23.678  -84.716 1.00 41.76  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? -28.746 22.341  -85.018 1.00 41.76  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? -29.027 21.909  -86.216 1.00 41.76  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? -28.237 21.484  -84.169 1.00 41.76  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? -27.970 22.057  -82.975 1.00 41.76  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? -24.442 16.563  -82.304 1.00 62.55  ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? -24.953 15.404  -81.498 1.00 49.88  ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? -23.170 17.245  -82.003 1.00 49.88  ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? -24.326 16.190  -83.834 1.00 62.55  ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? -25.476 15.948  -84.630 1.00 62.55  ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? -25.277 16.597  -85.974 1.00 62.55  ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? -25.707 17.962  -85.909 1.00 62.55  ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? -23.817 16.651  -86.431 1.00 62.55  ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? -23.756 16.348  -87.829 1.00 62.55  ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? -23.409 18.093  -86.187 1.00 62.55  ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? -24.701 18.806  -86.422 1.00 62.55  ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? -24.835 20.041  -85.692 1.00 49.88  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? -24.661 20.218  -84.349 1.00 49.88  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? -24.965 21.437  -83.929 1.00 49.88  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? -25.324 22.107  -85.081 1.00 49.88  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? -25.761 23.424  -85.300 1.00 49.88  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? -25.799 24.334  -84.352 1.00 49.88  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? -26.137 23.782  -86.543 1.00 49.88  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? -26.009 22.873  -87.516 1.00 49.88  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? -25.556 21.578  -87.446 1.00 49.88  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? -25.243 21.264  -86.180 1.00 49.88  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? -22.339 16.227  -88.557 1.00 62.55  ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? -22.521 15.191  -89.589 1.00 70.41  ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? -21.252 16.089  -87.540 1.00 70.41  ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? -22.286 17.668  -89.204 1.00 62.55  ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? -23.435 18.193  -89.805 1.00 62.55  ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? -23.020 19.211  -90.833 1.00 62.55  ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? -23.307 20.518  -90.334 1.00 62.55  ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? -21.547 19.228  -91.248 1.00 62.55  ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? -21.494 19.648  -92.646 1.00 62.55  ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? -20.957 20.236  -90.283 1.00 62.55  ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? -22.119 21.229  -90.092 1.00 62.55  ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? -22.238 21.767  -88.736 1.00 70.41  ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? -21.952 21.122  -87.555 1.00 70.41  ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? -22.135 21.863  -86.490 1.00 70.41  ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? -22.579 23.069  -87.000 1.00 70.41  ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? -22.934 24.270  -86.379 1.00 70.41  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? -22.878 24.448  -85.075 1.00 70.41  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? -23.346 25.297  -87.162 1.00 70.41  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? -23.384 25.107  -88.497 1.00 70.41  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? -23.057 24.011  -89.202 1.00 70.41  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? -22.659 23.022  -88.382 1.00 70.41  ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 74  ? -20.094 20.048  -93.354 1.00 83.50  ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 74  ? -20.333 19.800  -94.801 1.00 61.39  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 74  ? -18.919 19.421  -92.653 1.00 61.39  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 74  ? -20.022 21.613  -93.125 1.00 83.50  ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 74  ? -21.126 22.422  -93.448 1.00 83.50  ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 74  ? -20.683 23.855  -93.419 1.00 83.50  ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 74  ? -20.736 24.410  -92.081 1.00 83.50  ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 74  ? -19.219 23.913  -93.827 1.00 83.50  ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 74  ? -18.998 25.109  -94.579 1.00 83.50  ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 74  ? -18.494 23.931  -92.493 1.00 83.50  ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 74  ? -19.430 24.822  -91.698 1.00 83.50  ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 74  ? -19.333 24.715  -90.240 1.00 61.39  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 74  ? -19.577 25.847  -89.493 1.00 61.39  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 74  ? -19.730 26.955  -89.999 1.00 61.39  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 74  ? -19.604 25.641  -88.125 1.00 61.39  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 74  ? -19.346 24.434  -87.452 1.00 61.39  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 74  ? -19.428 24.371  -86.197 1.00 61.39  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 74  ? -19.005 23.304  -88.316 1.00 61.39  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 74  ? -18.631 21.996  -87.686 1.00 61.39  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 74  ? -19.036 23.505  -89.646 1.00 61.39  ? 74   DT  I C6    1 
ATOM   1512  P P     . DT  A 1 75  ? -17.552 25.391  -95.214 1.00 74.86  ? 75   DT  I P     1 
ATOM   1513  O OP1   . DT  A 1 75  ? -17.735 25.714  -96.649 1.00 51.67  ? 75   DT  I OP1   1 
ATOM   1514  O OP2   . DT  A 1 75  ? -16.638 24.240  -94.824 1.00 51.67  ? 75   DT  I OP2   1 
ATOM   1515  O "O5'" . DT  A 1 75  ? -17.185 26.747  -94.477 1.00 74.86  ? 75   DT  I "O5'" 1 
ATOM   1516  C "C5'" . DT  A 1 75  ? -18.166 27.771  -94.398 1.00 74.86  ? 75   DT  I "C5'" 1 
ATOM   1517  C "C4'" . DT  A 1 75  ? -17.646 28.885  -93.535 1.00 74.86  ? 75   DT  I "C4'" 1 
ATOM   1518  O "O4'" . DT  A 1 75  ? -17.776 28.519  -92.140 1.00 74.86  ? 75   DT  I "O4'" 1 
ATOM   1519  C "C3'" . DT  A 1 75  ? -16.160 29.107  -93.779 1.00 74.86  ? 75   DT  I "C3'" 1 
ATOM   1520  O "O3'" . DT  A 1 75  ? -15.930 30.494  -93.706 1.00 74.86  ? 75   DT  I "O3'" 1 
ATOM   1521  C "C2'" . DT  A 1 75  ? -15.501 28.428  -92.590 1.00 74.86  ? 75   DT  I "C2'" 1 
ATOM   1522  C "C1'" . DT  A 1 75  ? -16.524 28.716  -91.510 1.00 74.86  ? 75   DT  I "C1'" 1 
ATOM   1523  N N1    . DT  A 1 75  ? -16.464 27.878  -90.277 1.00 51.67  ? 75   DT  I N1    1 
ATOM   1524  C C2    . DT  A 1 75  ? -16.778 28.497  -89.037 1.00 51.67  ? 75   DT  I C2    1 
ATOM   1525  O O2    . DT  A 1 75  ? -17.088 29.692  -88.909 1.00 51.67  ? 75   DT  I O2    1 
ATOM   1526  N N3    . DT  A 1 75  ? -16.712 27.657  -87.955 1.00 51.67  ? 75   DT  I N3    1 
ATOM   1527  C C4    . DT  A 1 75  ? -16.367 26.315  -87.958 1.00 51.67  ? 75   DT  I C4    1 
ATOM   1528  O O4    . DT  A 1 75  ? -16.402 25.668  -86.913 1.00 51.67  ? 75   DT  I O4    1 
ATOM   1529  C C5    . DT  A 1 75  ? -15.992 25.755  -89.240 1.00 51.67  ? 75   DT  I C5    1 
ATOM   1530  C C7    . DT  A 1 75  ? -15.469 24.342  -89.259 1.00 51.67  ? 75   DT  I C7    1 
ATOM   1531  C C6    . DT  A 1 75  ? -16.093 26.544  -90.336 1.00 51.67  ? 75   DT  I C6    1 
ATOM   1532  P P     . DC  A 1 76  ? -14.878 31.197  -94.704 1.00 87.52  ? 76   DC  I P     1 
ATOM   1533  O OP1   . DC  A 1 76  ? -15.637 31.811  -95.813 1.00 55.49  ? 76   DC  I OP1   1 
ATOM   1534  O OP2   . DC  A 1 76  ? -13.731 30.291  -95.005 1.00 55.49  ? 76   DC  I OP2   1 
ATOM   1535  O "O5'" . DC  A 1 76  ? -14.476 32.451  -93.829 1.00 87.52  ? 76   DC  I "O5'" 1 
ATOM   1536  C "C5'" . DC  A 1 76  ? -15.532 33.257  -93.290 1.00 87.52  ? 76   DC  I "C5'" 1 
ATOM   1537  C "C4'" . DC  A 1 76  ? -15.160 33.752  -91.915 1.00 87.52  ? 76   DC  I "C4'" 1 
ATOM   1538  O "O4'" . DC  A 1 76  ? -15.102 32.678  -90.930 1.00 87.52  ? 76   DC  I "O4'" 1 
ATOM   1539  C "C3'" . DC  A 1 76  ? -13.778 34.387  -91.912 1.00 87.52  ? 76   DC  I "C3'" 1 
ATOM   1540  O "O3'" . DC  A 1 76  ? -13.852 35.558  -91.133 1.00 87.52  ? 76   DC  I "O3'" 1 
ATOM   1541  C "C2'" . DC  A 1 76  ? -12.883 33.328  -91.276 1.00 87.52  ? 76   DC  I "C2'" 1 
ATOM   1542  C "C1'" . DC  A 1 76  ? -13.834 32.739  -90.256 1.00 87.52  ? 76   DC  I "C1'" 1 
ATOM   1543  N N1    . DC  A 1 76  ? -13.510 31.404  -89.690 1.00 55.49  ? 76   DC  I N1    1 
ATOM   1544  C C2    . DC  A 1 76  ? -13.545 31.250  -88.272 1.00 55.49  ? 76   DC  I C2    1 
ATOM   1545  O O2    . DC  A 1 76  ? -13.861 32.243  -87.584 1.00 55.49  ? 76   DC  I O2    1 
ATOM   1546  N N3    . DC  A 1 76  ? -13.260 30.034  -87.704 1.00 55.49  ? 76   DC  I N3    1 
ATOM   1547  C C4    . DC  A 1 76  ? -12.983 28.985  -88.497 1.00 55.49  ? 76   DC  I C4    1 
ATOM   1548  N N4    . DC  A 1 76  ? -12.745 27.768  -87.918 1.00 55.49  ? 76   DC  I N4    1 
ATOM   1549  C C5    . DC  A 1 76  ? -12.946 29.121  -89.948 1.00 55.49  ? 76   DC  I C5    1 
ATOM   1550  C C6    . DC  A 1 76  ? -13.200 30.340  -90.488 1.00 55.49  ? 76   DC  I C6    1 
ATOM   1551  P P     . DC  A 1 77  ? -12.555 36.463  -90.989 1.00 74.23  ? 77   DC  I P     1 
ATOM   1552  O OP1   . DC  A 1 77  ? -12.933 37.917  -90.967 1.00 63.04  ? 77   DC  I OP1   1 
ATOM   1553  O OP2   . DC  A 1 77  ? -11.508 35.948  -91.941 1.00 63.04  ? 77   DC  I OP2   1 
ATOM   1554  O "O5'" . DC  A 1 77  ? -12.009 36.063  -89.548 1.00 74.23  ? 77   DC  I "O5'" 1 
ATOM   1555  C "C5'" . DC  A 1 77  ? -12.374 36.770  -88.370 1.00 74.23  ? 77   DC  I "C5'" 1 
ATOM   1556  C "C4'" . DC  A 1 77  ? -11.385 36.400  -87.306 1.00 74.23  ? 77   DC  I "C4'" 1 
ATOM   1557  O "O4'" . DC  A 1 77  ? -11.379 34.947  -87.210 1.00 74.23  ? 77   DC  I "O4'" 1 
ATOM   1558  C "C3'" . DC  A 1 77  ? -9.968  36.784  -87.718 1.00 74.23  ? 77   DC  I "C3'" 1 
ATOM   1559  O "O3'" . DC  A 1 77  ? -9.297  37.203  -86.544 1.00 74.23  ? 77   DC  I "O3'" 1 
ATOM   1560  C "C2'" . DC  A 1 77  ? -9.385  35.475  -88.231 1.00 74.23  ? 77   DC  I "C2'" 1 
ATOM   1561  C "C1'" . DC  A 1 77  ? -10.050 34.498  -87.297 1.00 74.23  ? 77   DC  I "C1'" 1 
ATOM   1562  N N1    . DC  A 1 77  ? -10.040 33.060  -87.633 1.00 63.04  ? 77   DC  I N1    1 
ATOM   1563  C C2    . DC  A 1 77  ? -10.282 32.118  -86.601 1.00 63.04  ? 77   DC  I C2    1 
ATOM   1564  O O2    . DC  A 1 77  ? -10.593 32.536  -85.466 1.00 63.04  ? 77   DC  I O2    1 
ATOM   1565  N N3    . DC  A 1 77  ? -10.179 30.786  -86.884 1.00 63.04  ? 77   DC  I N3    1 
ATOM   1566  C C4    . DC  A 1 77  ? -9.872  30.392  -88.130 1.00 63.04  ? 77   DC  I C4    1 
ATOM   1567  N N4    . DC  A 1 77  ? -9.706  29.105  -88.362 1.00 63.04  ? 77   DC  I N4    1 
ATOM   1568  C C5    . DC  A 1 77  ? -9.698  31.319  -89.190 1.00 63.04  ? 77   DC  I C5    1 
ATOM   1569  C C6    . DC  A 1 77  ? -9.781  32.628  -88.900 1.00 63.04  ? 77   DC  I C6    1 
ATOM   1570  P P     . DG  A 1 78  ? -9.601  38.659  -85.924 1.00 81.69  ? 78   DG  I P     1 
ATOM   1571  O OP1   . DG  A 1 78  ? -10.977 39.220  -86.191 1.00 59.46  ? 78   DG  I OP1   1 
ATOM   1572  O OP2   . DG  A 1 78  ? -8.342  39.389  -86.317 1.00 59.46  ? 78   DG  I OP2   1 
ATOM   1573  O "O5'" . DG  A 1 78  ? -9.594  38.499  -84.344 1.00 81.69  ? 78   DG  I "O5'" 1 
ATOM   1574  C "C5'" . DG  A 1 78  ? -10.645 37.823  -83.665 1.00 81.69  ? 78   DG  I "C5'" 1 
ATOM   1575  C "C4'" . DG  A 1 78  ? -10.018 36.848  -82.709 1.00 81.69  ? 78   DG  I "C4'" 1 
ATOM   1576  O "O4'" . DG  A 1 78  ? -9.534  35.682  -83.432 1.00 81.69  ? 78   DG  I "O4'" 1 
ATOM   1577  C "C3'" . DG  A 1 78  ? -8.781  37.479  -82.077 1.00 81.69  ? 78   DG  I "C3'" 1 
ATOM   1578  O "O3'" . DG  A 1 78  ? -8.723  37.050  -80.732 1.00 81.69  ? 78   DG  I "O3'" 1 
ATOM   1579  C "C2'" . DG  A 1 78  ? -7.624  36.912  -82.889 1.00 81.69  ? 78   DG  I "C2'" 1 
ATOM   1580  C "C1'" . DG  A 1 78  ? -8.142  35.524  -83.186 1.00 81.69  ? 78   DG  I "C1'" 1 
ATOM   1581  N N9    . DG  A 1 78  ? -7.542  34.769  -84.291 1.00 59.46  ? 78   DG  I N9    1 
ATOM   1582  C C8    . DG  A 1 78  ? -7.033  35.244  -85.479 1.00 59.46  ? 78   DG  I C8    1 
ATOM   1583  N N7    . DG  A 1 78  ? -6.605  34.288  -86.277 1.00 59.46  ? 78   DG  I N7    1 
ATOM   1584  C C5    . DG  A 1 78  ? -6.846  33.112  -85.568 1.00 59.46  ? 78   DG  I C5    1 
ATOM   1585  C C6    . DG  A 1 78  ? -6.607  31.732  -85.927 1.00 59.46  ? 78   DG  I C6    1 
ATOM   1586  O O6    . DG  A 1 78  ? -6.230  31.253  -87.026 1.00 59.46  ? 78   DG  I O6    1 
ATOM   1587  N N1    . DG  A 1 78  ? -6.891  30.879  -84.868 1.00 59.46  ? 78   DG  I N1    1 
ATOM   1588  C C2    . DG  A 1 78  ? -7.401  31.277  -83.634 1.00 59.46  ? 78   DG  I C2    1 
ATOM   1589  N N2    . DG  A 1 78  ? -7.554  30.300  -82.678 1.00 59.46  ? 78   DG  I N2    1 
ATOM   1590  N N3    . DG  A 1 78  ? -7.718  32.535  -83.335 1.00 59.46  ? 78   DG  I N3    1 
ATOM   1591  C C4    . DG  A 1 78  ? -7.395  33.393  -84.331 1.00 59.46  ? 78   DG  I C4    1 
ATOM   1592  P P     . DC  A 1 79  ? -7.702  37.758  -79.694 1.00 59.96  ? 79   DC  I P     1 
ATOM   1593  O OP1   . DC  A 1 79  ? -8.206  39.097  -79.202 1.00 59.29  ? 79   DC  I OP1   1 
ATOM   1594  O OP2   . DC  A 1 79  ? -6.297  37.651  -80.237 1.00 59.29  ? 79   DC  I OP2   1 
ATOM   1595  O "O5'" . DC  A 1 79  ? -7.904  36.792  -78.449 1.00 59.96  ? 79   DC  I "O5'" 1 
ATOM   1596  C "C5'" . DC  A 1 79  ? -8.673  35.631  -78.587 1.00 59.96  ? 79   DC  I "C5'" 1 
ATOM   1597  C "C4'" . DC  A 1 79  ? -7.774  34.441  -78.446 1.00 59.96  ? 79   DC  I "C4'" 1 
ATOM   1598  O "O4'" . DC  A 1 79  ? -7.129  34.098  -79.669 1.00 59.96  ? 79   DC  I "O4'" 1 
ATOM   1599  C "C3'" . DC  A 1 79  ? -6.653  34.651  -77.455 1.00 59.96  ? 79   DC  I "C3'" 1 
ATOM   1600  O "O3'" . DC  A 1 79  ? -6.533  33.426  -76.790 1.00 59.96  ? 79   DC  I "O3'" 1 
ATOM   1601  C "C2'" . DC  A 1 79  ? -5.443  34.847  -78.341 1.00 59.96  ? 79   DC  I "C2'" 1 
ATOM   1602  C "C1'" . DC  A 1 79  ? -5.790  33.833  -79.363 1.00 59.96  ? 79   DC  I "C1'" 1 
ATOM   1603  N N1    . DC  A 1 79  ? -5.051  33.789  -80.616 1.00 59.29  ? 79   DC  I N1    1 
ATOM   1604  C C2    . DC  A 1 79  ? -4.815  32.551  -81.143 1.00 59.29  ? 79   DC  I C2    1 
ATOM   1605  O O2    . DC  A 1 79  ? -5.184  31.565  -80.508 1.00 59.29  ? 79   DC  I O2    1 
ATOM   1606  N N3    . DC  A 1 79  ? -4.222  32.446  -82.326 1.00 59.29  ? 79   DC  I N3    1 
ATOM   1607  C C4    . DC  A 1 79  ? -3.884  33.541  -83.002 1.00 59.29  ? 79   DC  I C4    1 
ATOM   1608  N N4    . DC  A 1 79  ? -3.360  33.368  -84.212 1.00 59.29  ? 79   DC  I N4    1 
ATOM   1609  C C5    . DC  A 1 79  ? -4.082  34.846  -82.472 1.00 59.29  ? 79   DC  I C5    1 
ATOM   1610  C C6    . DC  A 1 79  ? -4.647  34.923  -81.279 1.00 59.29  ? 79   DC  I C6    1 
ATOM   1611  P P     . DT  A 1 80  ? -6.588  33.376  -75.204 1.00 37.48  ? 80   DT  I P     1 
ATOM   1612  O OP1   . DT  A 1 80  ? -8.037  33.193  -74.839 1.00 32.44  ? 80   DT  I OP1   1 
ATOM   1613  O OP2   . DT  A 1 80  ? -5.730  34.465  -74.617 1.00 32.44  ? 80   DT  I OP2   1 
ATOM   1614  O "O5'" . DT  A 1 80  ? -5.832  32.012  -74.977 1.00 37.48  ? 80   DT  I "O5'" 1 
ATOM   1615  C "C5'" . DT  A 1 80  ? -6.321  30.834  -75.609 1.00 37.48  ? 80   DT  I "C5'" 1 
ATOM   1616  C "C4'" . DT  A 1 80  ? -5.177  29.919  -75.987 1.00 37.48  ? 80   DT  I "C4'" 1 
ATOM   1617  O "O4'" . DT  A 1 80  ? -4.566  30.434  -77.194 1.00 37.48  ? 80   DT  I "O4'" 1 
ATOM   1618  C "C3'" . DT  A 1 80  ? -4.050  29.680  -74.965 1.00 37.48  ? 80   DT  I "C3'" 1 
ATOM   1619  O "O3'" . DT  A 1 80  ? -3.785  28.285  -74.813 1.00 37.48  ? 80   DT  I "O3'" 1 
ATOM   1620  C "C2'" . DT  A 1 80  ? -2.852  30.348  -75.611 1.00 37.48  ? 80   DT  I "C2'" 1 
ATOM   1621  C "C1'" . DT  A 1 80  ? -3.153  30.284  -77.096 1.00 37.48  ? 80   DT  I "C1'" 1 
ATOM   1622  N N1    . DT  A 1 80  ? -2.501  31.312  -77.984 1.00 32.44  ? 80   DT  I N1    1 
ATOM   1623  C C2    . DT  A 1 80  ? -2.012  30.906  -79.220 1.00 32.44  ? 80   DT  I C2    1 
ATOM   1624  O O2    . DT  A 1 80  ? -2.074  29.735  -79.606 1.00 32.44  ? 80   DT  I O2    1 
ATOM   1625  N N3    . DT  A 1 80  ? -1.476  31.918  -80.000 1.00 32.44  ? 80   DT  I N3    1 
ATOM   1626  C C4    . DT  A 1 80  ? -1.423  33.286  -79.668 1.00 32.44  ? 80   DT  I C4    1 
ATOM   1627  O O4    . DT  A 1 80  ? -0.990  34.173  -80.497 1.00 32.44  ? 80   DT  I O4    1 
ATOM   1628  C C5    . DT  A 1 80  ? -1.923  33.597  -78.354 1.00 32.44  ? 80   DT  I C5    1 
ATOM   1629  C C7    . DT  A 1 80  ? -1.858  35.024  -77.902 1.00 32.44  ? 80   DT  I C7    1 
ATOM   1630  C C6    . DT  A 1 80  ? -2.421  32.609  -77.599 1.00 32.44  ? 80   DT  I C6    1 
ATOM   1631  P P     . DG  A 1 81  ? -2.728  27.757  -73.703 1.00 31.36  ? 81   DG  I P     1 
ATOM   1632  O OP1   . DG  A 1 81  ? -3.248  26.628  -72.790 1.00 38.54  ? 81   DG  I OP1   1 
ATOM   1633  O OP2   . DG  A 1 81  ? -1.968  28.888  -73.116 1.00 38.54  ? 81   DG  I OP2   1 
ATOM   1634  O "O5'" . DG  A 1 81  ? -1.789  26.887  -74.622 1.00 31.36  ? 81   DG  I "O5'" 1 
ATOM   1635  C "C5'" . DG  A 1 81  ? -2.355  25.969  -75.581 1.00 31.36  ? 81   DG  I "C5'" 1 
ATOM   1636  C "C4'" . DG  A 1 81  ? -1.256  25.448  -76.475 1.00 31.36  ? 81   DG  I "C4'" 1 
ATOM   1637  O "O4'" . DG  A 1 81  ? -0.795  26.482  -77.363 1.00 31.36  ? 81   DG  I "O4'" 1 
ATOM   1638  C "C3'" . DG  A 1 81  ? -0.016  24.994  -75.712 1.00 31.36  ? 81   DG  I "C3'" 1 
ATOM   1639  O "O3'" . DG  A 1 81  ? 0.537   23.938  -76.436 1.00 31.36  ? 81   DG  I "O3'" 1 
ATOM   1640  C "C2'" . DG  A 1 81  ? 0.912   26.186  -75.759 1.00 31.36  ? 81   DG  I "C2'" 1 
ATOM   1641  C "C1'" . DG  A 1 81  ? 0.558   26.824  -77.073 1.00 31.36  ? 81   DG  I "C1'" 1 
ATOM   1642  N N9    . DG  A 1 81  ? 0.617   28.272  -77.084 1.00 38.54  ? 81   DG  I N9    1 
ATOM   1643  C C8    . DG  A 1 81  ? 0.095   29.135  -76.173 1.00 38.54  ? 81   DG  I C8    1 
ATOM   1644  N N7    . DG  A 1 81  ? 0.205   30.385  -76.523 1.00 38.54  ? 81   DG  I N7    1 
ATOM   1645  C C5    . DG  A 1 81  ? 0.875   30.330  -77.713 1.00 38.54  ? 81   DG  I C5    1 
ATOM   1646  C C6    . DG  A 1 81  ? 1.273   31.353  -78.559 1.00 38.54  ? 81   DG  I C6    1 
ATOM   1647  O O6    . DG  A 1 81  ? 1.147   32.555  -78.401 1.00 38.54  ? 81   DG  I O6    1 
ATOM   1648  N N1    . DG  A 1 81  ? 1.885   30.870  -79.691 1.00 38.54  ? 81   DG  I N1    1 
ATOM   1649  C C2    . DG  A 1 81  ? 2.074   29.558  -79.964 1.00 38.54  ? 81   DG  I C2    1 
ATOM   1650  N N2    . DG  A 1 81  ? 2.622   29.269  -81.148 1.00 38.54  ? 81   DG  I N2    1 
ATOM   1651  N N3    . DG  A 1 81  ? 1.738   28.577  -79.157 1.00 38.54  ? 81   DG  I N3    1 
ATOM   1652  C C4    . DG  A 1 81  ? 1.144   29.033  -78.061 1.00 38.54  ? 81   DG  I C4    1 
ATOM   1653  P P     . DA  A 1 82  ? 1.639   23.038  -75.779 1.00 28.54  ? 82   DA  I P     1 
ATOM   1654  O OP1   . DA  A 1 82  ? 1.241   21.626  -75.742 1.00 38.97  ? 82   DA  I OP1   1 
ATOM   1655  O OP2   . DA  A 1 82  ? 2.167   23.751  -74.595 1.00 38.97  ? 82   DA  I OP2   1 
ATOM   1656  O "O5'" . DA  A 1 82  ? 2.902   23.220  -76.685 1.00 28.54  ? 82   DA  I "O5'" 1 
ATOM   1657  C "C5'" . DA  A 1 82  ? 2.861   23.065  -78.070 1.00 28.54  ? 82   DA  I "C5'" 1 
ATOM   1658  C "C4'" . DA  A 1 82  ? 4.130   23.640  -78.645 1.00 28.54  ? 82   DA  I "C4'" 1 
ATOM   1659  O "O4'" . DA  A 1 82  ? 4.092   25.079  -78.750 1.00 28.54  ? 82   DA  I "O4'" 1 
ATOM   1660  C "C3'" . DA  A 1 82  ? 5.436   23.301  -77.941 1.00 28.54  ? 82   DA  I "C3'" 1 
ATOM   1661  O "O3'" . DA  A 1 82  ? 6.274   22.971  -79.005 1.00 28.54  ? 82   DA  I "O3'" 1 
ATOM   1662  C "C2'" . DA  A 1 82  ? 5.913   24.640  -77.433 1.00 28.54  ? 82   DA  I "C2'" 1 
ATOM   1663  C "C1'" . DA  A 1 82  ? 5.338   25.610  -78.439 1.00 28.54  ? 82   DA  I "C1'" 1 
ATOM   1664  N N9    . DA  A 1 82  ? 5.080   26.930  -77.911 1.00 38.97  ? 82   DA  I N9    1 
ATOM   1665  C C8    . DA  A 1 82  ? 4.601   27.224  -76.687 1.00 38.97  ? 82   DA  I C8    1 
ATOM   1666  N N7    . DA  A 1 82  ? 4.362   28.503  -76.493 1.00 38.97  ? 82   DA  I N7    1 
ATOM   1667  C C5    . DA  A 1 82  ? 4.728   29.088  -77.675 1.00 38.97  ? 82   DA  I C5    1 
ATOM   1668  C C6    . DA  A 1 82  ? 4.692   30.415  -78.118 1.00 38.97  ? 82   DA  I C6    1 
ATOM   1669  N N6    . DA  A 1 82  ? 4.313   31.424  -77.370 1.00 38.97  ? 82   DA  I N6    1 
ATOM   1670  N N1    . DA  A 1 82  ? 5.087   30.678  -79.371 1.00 38.97  ? 82   DA  I N1    1 
ATOM   1671  C C2    . DA  A 1 82  ? 5.569   29.672  -80.113 1.00 38.97  ? 82   DA  I C2    1 
ATOM   1672  N N3    . DA  A 1 82  ? 5.688   28.367  -79.801 1.00 38.97  ? 82   DA  I N3    1 
ATOM   1673  C C4    . DA  A 1 82  ? 5.213   28.136  -78.555 1.00 38.97  ? 82   DA  I C4    1 
ATOM   1674  P P     . DA  A 1 83  ? 7.696   22.335  -78.761 1.00 40.58  ? 83   DA  I P     1 
ATOM   1675  O OP1   . DA  A 1 83  ? 7.794   21.215  -79.787 1.00 40.95  ? 83   DA  I OP1   1 
ATOM   1676  O OP2   . DA  A 1 83  ? 7.836   22.092  -77.302 1.00 40.95  ? 83   DA  I OP2   1 
ATOM   1677  O "O5'" . DA  A 1 83  ? 8.626   23.574  -79.060 1.00 40.58  ? 83   DA  I "O5'" 1 
ATOM   1678  C "C5'" . DA  A 1 83  ? 8.561   24.221  -80.309 1.00 40.58  ? 83   DA  I "C5'" 1 
ATOM   1679  C "C4'" . DA  A 1 83  ? 9.700   25.201  -80.423 1.00 40.58  ? 83   DA  I "C4'" 1 
ATOM   1680  O "O4'" . DA  A 1 83  ? 9.194   26.448  -79.920 1.00 40.58  ? 83   DA  I "O4'" 1 
ATOM   1681  C "C3'" . DA  A 1 83  ? 11.027  24.924  -79.673 1.00 40.58  ? 83   DA  I "C3'" 1 
ATOM   1682  O "O3'" . DA  A 1 83  ? 12.122  25.297  -80.522 1.00 40.58  ? 83   DA  I "O3'" 1 
ATOM   1683  C "C2'" . DA  A 1 83  ? 10.953  25.840  -78.459 1.00 40.58  ? 83   DA  I "C2'" 1 
ATOM   1684  C "C1'" . DA  A 1 83  ? 10.105  26.991  -78.965 1.00 40.58  ? 83   DA  I "C1'" 1 
ATOM   1685  N N9    . DA  A 1 83  ? 9.276   27.621  -77.959 1.00 40.95  ? 83   DA  I N9    1 
ATOM   1686  C C8    . DA  A 1 83  ? 8.665   27.050  -76.885 1.00 40.95  ? 83   DA  I C8    1 
ATOM   1687  N N7    . DA  A 1 83  ? 7.965   27.895  -76.163 1.00 40.95  ? 83   DA  I N7    1 
ATOM   1688  C C5    . DA  A 1 83  ? 8.141   29.102  -76.820 1.00 40.95  ? 83   DA  I C5    1 
ATOM   1689  C C6    . DA  A 1 83  ? 7.681   30.389  -76.555 1.00 40.95  ? 83   DA  I C6    1 
ATOM   1690  N N6    . DA  A 1 83  ? 6.928   30.707  -75.518 1.00 40.95  ? 83   DA  I N6    1 
ATOM   1691  N N1    . DA  A 1 83  ? 8.032   31.357  -77.408 1.00 40.95  ? 83   DA  I N1    1 
ATOM   1692  C C2    . DA  A 1 83  ? 8.802   31.033  -78.439 1.00 40.95  ? 83   DA  I C2    1 
ATOM   1693  N N3    . DA  A 1 83  ? 9.305   29.861  -78.785 1.00 40.95  ? 83   DA  I N3    1 
ATOM   1694  C C4    . DA  A 1 83  ? 8.934   28.937  -77.930 1.00 40.95  ? 83   DA  I C4    1 
ATOM   1695  P P     . DC  A 1 84  ? 13.652  25.318  -79.964 1.00 56.47  ? 84   DC  I P     1 
ATOM   1696  O OP1   . DC  A 1 84  ? 14.510  25.087  -81.154 1.00 40.98  ? 84   DC  I OP1   1 
ATOM   1697  O OP2   . DC  A 1 84  ? 13.841  24.441  -78.775 1.00 40.98  ? 84   DC  I OP2   1 
ATOM   1698  O "O5'" . DC  A 1 84  ? 13.901  26.864  -79.641 1.00 56.47  ? 84   DC  I "O5'" 1 
ATOM   1699  C "C5'" . DC  A 1 84  ? 13.713  27.848  -80.678 1.00 56.47  ? 84   DC  I "C5'" 1 
ATOM   1700  C "C4'" . DC  A 1 84  ? 14.150  29.214  -80.194 1.00 56.47  ? 84   DC  I "C4'" 1 
ATOM   1701  O "O4'" . DC  A 1 84  ? 13.133  29.898  -79.400 1.00 56.47  ? 84   DC  I "O4'" 1 
ATOM   1702  C "C3'" . DC  A 1 84  ? 15.360  29.098  -79.274 1.00 56.47  ? 84   DC  I "C3'" 1 
ATOM   1703  O "O3'" . DC  A 1 84  ? 16.233  30.226  -79.409 1.00 56.47  ? 84   DC  I "O3'" 1 
ATOM   1704  C "C2'" . DC  A 1 84  ? 14.747  29.194  -77.897 1.00 56.47  ? 84   DC  I "C2'" 1 
ATOM   1705  C "C1'" . DC  A 1 84  ? 13.678  30.227  -78.124 1.00 56.47  ? 84   DC  I "C1'" 1 
ATOM   1706  N N1    . DC  A 1 84  ? 12.641  30.147  -77.076 1.00 40.98  ? 84   DC  I N1    1 
ATOM   1707  C C2    . DC  A 1 84  ? 11.954  31.316  -76.666 1.00 40.98  ? 84   DC  I C2    1 
ATOM   1708  O O2    . DC  A 1 84  ? 12.197  32.380  -77.247 1.00 40.98  ? 84   DC  I O2    1 
ATOM   1709  N N3    . DC  A 1 84  ? 11.058  31.242  -75.623 1.00 40.98  ? 84   DC  I N3    1 
ATOM   1710  C C4    . DC  A 1 84  ? 10.877  30.076  -74.980 1.00 40.98  ? 84   DC  I C4    1 
ATOM   1711  N N4    . DC  A 1 84  ? 10.033  30.054  -73.950 1.00 40.98  ? 84   DC  I N4    1 
ATOM   1712  C C5    . DC  A 1 84  ? 11.558  28.884  -75.377 1.00 40.98  ? 84   DC  I C5    1 
ATOM   1713  C C6    . DC  A 1 84  ? 12.393  28.957  -76.444 1.00 40.98  ? 84   DC  I C6    1 
ATOM   1714  P P     . DA  A 1 85  ? 17.799  30.055  -79.123 1.00 79.10  ? 85   DA  I P     1 
ATOM   1715  O OP1   . DA  A 1 85  ? 18.401  30.186  -80.473 1.00 61.69  ? 85   DA  I OP1   1 
ATOM   1716  O OP2   . DA  A 1 85  ? 18.142  28.931  -78.253 1.00 61.69  ? 85   DA  I OP2   1 
ATOM   1717  O "O5'" . DA  A 1 85  ? 18.170  31.412  -78.442 1.00 79.10  ? 85   DA  I "O5'" 1 
ATOM   1718  C "C5'" . DA  A 1 85  ? 17.972  32.557  -79.205 1.00 79.10  ? 85   DA  I "C5'" 1 
ATOM   1719  C "C4'" . DA  A 1 85  ? 17.582  33.694  -78.310 1.00 79.10  ? 85   DA  I "C4'" 1 
ATOM   1720  O "O4'" . DA  A 1 85  ? 16.288  33.463  -77.700 1.00 79.10  ? 85   DA  I "O4'" 1 
ATOM   1721  C "C3'" . DA  A 1 85  ? 18.579  33.842  -77.153 1.00 79.10  ? 85   DA  I "C3'" 1 
ATOM   1722  O "O3'" . DA  A 1 85  ? 18.864  35.220  -76.960 1.00 79.10  ? 85   DA  I "O3'" 1 
ATOM   1723  C "C2'" . DA  A 1 85  ? 17.823  33.438  -75.901 1.00 79.10  ? 85   DA  I "C2'" 1 
ATOM   1724  C "C1'" . DA  A 1 85  ? 16.384  33.692  -76.265 1.00 79.10  ? 85   DA  I "C1'" 1 
ATOM   1725  N N9    . DA  A 1 85  ? 15.702  32.636  -75.529 1.00 61.69  ? 85   DA  I N9    1 
ATOM   1726  C C8    . DA  A 1 85  ? 15.937  31.276  -75.661 1.00 61.69  ? 85   DA  I C8    1 
ATOM   1727  N N7    . DA  A 1 85  ? 15.366  30.551  -74.750 1.00 61.69  ? 85   DA  I N7    1 
ATOM   1728  C C5    . DA  A 1 85  ? 14.672  31.478  -73.977 1.00 61.69  ? 85   DA  I C5    1 
ATOM   1729  C C6    . DA  A 1 85  ? 13.891  31.338  -72.826 1.00 61.69  ? 85   DA  I C6    1 
ATOM   1730  N N6    . DA  A 1 85  ? 13.645  30.157  -72.237 1.00 61.69  ? 85   DA  I N6    1 
ATOM   1731  N N1    . DA  A 1 85  ? 13.356  32.461  -72.286 1.00 61.69  ? 85   DA  I N1    1 
ATOM   1732  C C2    . DA  A 1 85  ? 13.574  33.645  -72.884 1.00 61.69  ? 85   DA  I C2    1 
ATOM   1733  N N3    . DA  A 1 85  ? 14.274  33.910  -73.976 1.00 61.69  ? 85   DA  I N3    1 
ATOM   1734  C C4    . DA  A 1 85  ? 14.822  32.767  -74.478 1.00 61.69  ? 85   DA  I C4    1 
ATOM   1735  P P     . DT  A 1 86  ? 20.395  35.719  -76.730 1.00 68.70  ? 86   DT  I P     1 
ATOM   1736  O OP1   . DT  A 1 86  ? 20.724  36.307  -78.073 1.00 52.47  ? 86   DT  I OP1   1 
ATOM   1737  O OP2   . DT  A 1 86  ? 21.220  34.583  -76.189 1.00 52.47  ? 86   DT  I OP2   1 
ATOM   1738  O "O5'" . DT  A 1 86  ? 20.144  36.844  -75.620 1.00 68.70  ? 86   DT  I "O5'" 1 
ATOM   1739  C "C5'" . DT  A 1 86  ? 18.836  37.416  -75.486 1.00 68.70  ? 86   DT  I "C5'" 1 
ATOM   1740  C "C4'" . DT  A 1 86  ? 18.510  37.674  -74.036 1.00 68.70  ? 86   DT  I "C4'" 1 
ATOM   1741  O "O4'" . DT  A 1 86  ? 17.643  36.679  -73.437 1.00 68.70  ? 86   DT  I "O4'" 1 
ATOM   1742  C "C3'" . DT  A 1 86  ? 19.697  37.848  -73.075 1.00 68.70  ? 86   DT  I "C3'" 1 
ATOM   1743  O "O3'" . DT  A 1 86  ? 19.564  39.162  -72.467 1.00 68.70  ? 86   DT  I "O3'" 1 
ATOM   1744  C "C2'" . DT  A 1 86  ? 19.575  36.646  -72.127 1.00 68.70  ? 86   DT  I "C2'" 1 
ATOM   1745  C "C1'" . DT  A 1 86  ? 18.072  36.456  -72.102 1.00 68.70  ? 86   DT  I "C1'" 1 
ATOM   1746  N N1    . DT  A 1 86  ? 17.538  35.152  -71.678 1.00 52.47  ? 86   DT  I N1    1 
ATOM   1747  C C2    . DT  A 1 86  ? 16.366  35.159  -70.922 1.00 52.47  ? 86   DT  I C2    1 
ATOM   1748  O O2    . DT  A 1 86  ? 15.804  36.196  -70.582 1.00 52.47  ? 86   DT  I O2    1 
ATOM   1749  N N3    . DT  A 1 86  ? 15.884  33.924  -70.585 1.00 52.47  ? 86   DT  I N3    1 
ATOM   1750  C C4    . DT  A 1 86  ? 16.422  32.718  -70.923 1.00 52.47  ? 86   DT  I C4    1 
ATOM   1751  O O4    . DT  A 1 86  ? 15.880  31.697  -70.541 1.00 52.47  ? 86   DT  I O4    1 
ATOM   1752  C C5    . DT  A 1 86  ? 17.643  32.757  -71.724 1.00 52.47  ? 86   DT  I C5    1 
ATOM   1753  C C7    . DT  A 1 86  ? 18.265  31.470  -72.164 1.00 52.47  ? 86   DT  I C7    1 
ATOM   1754  C C6    . DT  A 1 86  ? 18.149  33.966  -72.036 1.00 52.47  ? 86   DT  I C6    1 
ATOM   1755  P P     . DG  A 1 87  ? 20.716  39.733  -71.540 1.00 43.55  ? 87   DG  I P     1 
ATOM   1756  O OP1   . DG  A 1 87  ? 20.755  41.214  -71.612 1.00 67.08  ? 87   DG  I OP1   1 
ATOM   1757  O OP2   . DG  A 1 87  ? 21.938  38.897  -71.620 1.00 67.08  ? 87   DG  I OP2   1 
ATOM   1758  O "O5'" . DG  A 1 87  ? 20.156  39.367  -70.110 1.00 43.55  ? 87   DG  I "O5'" 1 
ATOM   1759  C "C5'" . DG  A 1 87  ? 18.846  39.771  -69.698 1.00 43.55  ? 87   DG  I "C5'" 1 
ATOM   1760  C "C4'" . DG  A 1 87  ? 18.604  39.263  -68.296 1.00 43.55  ? 87   DG  I "C4'" 1 
ATOM   1761  O "O4'" . DG  A 1 87  ? 18.304  37.842  -68.356 1.00 43.55  ? 87   DG  I "O4'" 1 
ATOM   1762  C "C3'" . DG  A 1 87  ? 19.851  39.382  -67.415 1.00 43.55  ? 87   DG  I "C3'" 1 
ATOM   1763  O "O3'" . DG  A 1 87  ? 19.486  39.701  -66.061 1.00 43.55  ? 87   DG  I "O3'" 1 
ATOM   1764  C "C2'" . DG  A 1 87  ? 20.469  37.988  -67.510 1.00 43.55  ? 87   DG  I "C2'" 1 
ATOM   1765  C "C1'" . DG  A 1 87  ? 19.204  37.172  -67.489 1.00 43.55  ? 87   DG  I "C1'" 1 
ATOM   1766  N N9    . DG  A 1 87  ? 19.282  35.801  -67.934 1.00 67.08  ? 87   DG  I N9    1 
ATOM   1767  C C8    . DG  A 1 87  ? 20.215  35.210  -68.739 1.00 67.08  ? 87   DG  I C8    1 
ATOM   1768  N N7    . DG  A 1 87  ? 19.959  33.954  -68.962 1.00 67.08  ? 87   DG  I N7    1 
ATOM   1769  C C5    . DG  A 1 87  ? 18.791  33.712  -68.255 1.00 67.08  ? 87   DG  I C5    1 
ATOM   1770  C C6    . DG  A 1 87  ? 18.046  32.546  -68.108 1.00 67.08  ? 87   DG  I C6    1 
ATOM   1771  O O6    . DG  A 1 87  ? 18.266  31.454  -68.610 1.00 67.08  ? 87   DG  I O6    1 
ATOM   1772  N N1    . DG  A 1 87  ? 16.934  32.721  -67.275 1.00 67.08  ? 87   DG  I N1    1 
ATOM   1773  C C2    . DG  A 1 87  ? 16.579  33.887  -66.661 1.00 67.08  ? 87   DG  I C2    1 
ATOM   1774  N N2    . DG  A 1 87  ? 15.490  33.847  -65.861 1.00 67.08  ? 87   DG  I N2    1 
ATOM   1775  N N3    . DG  A 1 87  ? 17.266  35.015  -66.817 1.00 67.08  ? 87   DG  I N3    1 
ATOM   1776  C C4    . DG  A 1 87  ? 18.364  34.841  -67.616 1.00 67.08  ? 87   DG  I C4    1 
ATOM   1777  P P     . DC  A 1 88  ? 19.140  41.213  -65.667 1.00 55.45  ? 88   DC  I P     1 
ATOM   1778  O OP1   . DC  A 1 88  ? 18.379  41.811  -66.835 1.00 58.82  ? 88   DC  I OP1   1 
ATOM   1779  O OP2   . DC  A 1 88  ? 20.314  41.917  -65.054 1.00 58.82  ? 88   DC  I OP2   1 
ATOM   1780  O "O5'" . DC  A 1 88  ? 18.013  40.995  -64.576 1.00 55.45  ? 88   DC  I "O5'" 1 
ATOM   1781  C "C5'" . DC  A 1 88  ? 16.657  40.857  -65.057 1.00 55.45  ? 88   DC  I "C5'" 1 
ATOM   1782  C "C4'" . DC  A 1 88  ? 15.837  39.980  -64.142 1.00 55.45  ? 88   DC  I "C4'" 1 
ATOM   1783  O "O4'" . DC  A 1 88  ? 16.232  38.608  -64.224 1.00 55.45  ? 88   DC  I "O4'" 1 
ATOM   1784  C "C3'" . DC  A 1 88  ? 15.960  40.320  -62.676 1.00 55.45  ? 88   DC  I "C3'" 1 
ATOM   1785  O "O3'" . DC  A 1 88  ? 14.752  39.864  -62.113 1.00 55.45  ? 88   DC  I "O3'" 1 
ATOM   1786  C "C2'" . DC  A 1 88  ? 17.111  39.449  -62.240 1.00 55.45  ? 88   DC  I "C2'" 1 
ATOM   1787  C "C1'" . DC  A 1 88  ? 16.694  38.202  -62.960 1.00 55.45  ? 88   DC  I "C1'" 1 
ATOM   1788  N N1    . DC  A 1 88  ? 17.698  37.197  -63.178 1.00 58.82  ? 88   DC  I N1    1 
ATOM   1789  C C2    . DC  A 1 88  ? 17.298  35.852  -63.172 1.00 58.82  ? 88   DC  I C2    1 
ATOM   1790  O O2    . DC  A 1 88  ? 16.081  35.574  -63.076 1.00 58.82  ? 88   DC  I O2    1 
ATOM   1791  N N3    . DC  A 1 88  ? 18.235  34.903  -63.323 1.00 58.82  ? 88   DC  I N3    1 
ATOM   1792  C C4    . DC  A 1 88  ? 19.514  35.259  -63.544 1.00 58.82  ? 88   DC  I C4    1 
ATOM   1793  N N4    . DC  A 1 88  ? 20.409  34.278  -63.753 1.00 58.82  ? 88   DC  I N4    1 
ATOM   1794  C C5    . DC  A 1 88  ? 19.925  36.631  -63.578 1.00 58.82  ? 88   DC  I C5    1 
ATOM   1795  C C6    . DC  A 1 88  ? 18.991  37.548  -63.390 1.00 58.82  ? 88   DC  I C6    1 
ATOM   1796  P P     . DC  A 1 89  ? 14.191  40.539  -60.776 1.00 44.40  ? 89   DC  I P     1 
ATOM   1797  O OP1   . DC  A 1 89  ? 12.770  41.084  -61.092 1.00 41.02  ? 89   DC  I OP1   1 
ATOM   1798  O OP2   . DC  A 1 89  ? 15.254  41.459  -60.254 1.00 41.02  ? 89   DC  I OP2   1 
ATOM   1799  O "O5'" . DC  A 1 89  ? 14.112  39.272  -59.805 1.00 44.40  ? 89   DC  I "O5'" 1 
ATOM   1800  C "C5'" . DC  A 1 89  ? 13.139  38.314  -60.040 1.00 44.40  ? 89   DC  I "C5'" 1 
ATOM   1801  C "C4'" . DC  A 1 89  ? 13.445  37.090  -59.246 1.00 44.40  ? 89   DC  I "C4'" 1 
ATOM   1802  O "O4'" . DC  A 1 89  ? 14.710  36.570  -59.656 1.00 44.40  ? 89   DC  I "O4'" 1 
ATOM   1803  C "C3'" . DC  A 1 89  ? 13.576  37.417  -57.776 1.00 44.40  ? 89   DC  I "C3'" 1 
ATOM   1804  O "O3'" . DC  A 1 89  ? 13.076  36.288  -57.099 1.00 44.40  ? 89   DC  I "O3'" 1 
ATOM   1805  C "C2'" . DC  A 1 89  ? 15.070  37.452  -57.552 1.00 44.40  ? 89   DC  I "C2'" 1 
ATOM   1806  C "C1'" . DC  A 1 89  ? 15.494  36.361  -58.501 1.00 44.40  ? 89   DC  I "C1'" 1 
ATOM   1807  N N1    . DC  A 1 89  ? 16.934  36.329  -58.877 1.00 41.02  ? 89   DC  I N1    1 
ATOM   1808  C C2    . DC  A 1 89  ? 17.559  35.061  -59.004 1.00 41.02  ? 89   DC  I C2    1 
ATOM   1809  O O2    . DC  A 1 89  ? 16.879  34.024  -58.844 1.00 41.02  ? 89   DC  I O2    1 
ATOM   1810  N N3    . DC  A 1 89  ? 18.886  35.013  -59.289 1.00 41.02  ? 89   DC  I N3    1 
ATOM   1811  C C4    . DC  A 1 89  ? 19.580  36.142  -59.457 1.00 41.02  ? 89   DC  I C4    1 
ATOM   1812  N N4    . DC  A 1 89  ? 20.881  36.016  -59.747 1.00 41.02  ? 89   DC  I N4    1 
ATOM   1813  C C5    . DC  A 1 89  ? 18.964  37.432  -59.347 1.00 41.02  ? 89   DC  I C5    1 
ATOM   1814  C C6    . DC  A 1 89  ? 17.665  37.479  -59.072 1.00 41.02  ? 89   DC  I C6    1 
ATOM   1815  P P     . DT  A 1 90  ? 11.836  36.425  -56.101 1.00 33.05  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 90  ? 10.651  36.818  -56.924 1.00 53.48  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 90  ? 12.266  37.207  -54.875 1.00 53.48  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 90  ? 11.654  34.896  -55.797 1.00 33.05  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 90  ? 11.380  34.068  -56.883 1.00 33.05  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 90  ? 12.313  32.902  -56.858 1.00 33.05  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 90  ? 13.646  33.433  -57.005 1.00 33.05  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 90  ? 12.286  32.167  -55.524 1.00 33.05  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 90  ? 11.966  30.802  -55.690 1.00 33.05  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 90  ? 13.710  32.287  -55.018 1.00 33.05  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 90  ? 14.490  32.621  -56.246 1.00 33.05  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 90  ? 15.732  33.344  -55.988 1.00 53.48  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 90  ? 16.929  32.674  -56.205 1.00 53.48  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 90  ? 17.000  31.495  -56.518 1.00 53.48  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 90  ? 18.044  33.420  -56.031 1.00 53.48  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 90  ? 18.123  34.723  -55.639 1.00 53.48  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 90  ? 19.222  35.257  -55.611 1.00 53.48  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 90  ? 16.823  35.362  -55.314 1.00 53.48  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 90  ? 16.789  36.740  -54.720 1.00 53.48  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 90  ? 15.706  34.643  -55.545 1.00 53.48  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 91  ? 11.714  29.894  -54.423 1.00 34.01  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 91  ? 10.651  28.897  -54.626 1.00 43.27  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 91  ? 11.786  30.657  -53.188 1.00 43.27  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 91  ? 13.071  29.118  -54.314 1.00 34.01  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 91  ? 13.643  28.486  -55.408 1.00 34.01  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 91  ? 14.994  27.967  -55.010 1.00 34.01  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 91  ? 15.919  29.076  -54.955 1.00 34.01  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 91  ? 15.083  27.276  -53.643 1.00 34.01  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 91  ? 15.942  26.139  -53.780 1.00 34.01  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 91  ? 15.819  28.290  -52.771 1.00 34.01  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 91  ? 16.743  28.948  -53.776 1.00 34.01  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 91  ? 17.183  30.304  -53.422 1.00 43.27  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 91  ? 18.467  30.776  -53.813 1.00 43.27  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 91  ? 19.294  30.086  -54.408 1.00 43.27  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 91  ? 18.710  32.101  -53.503 1.00 43.27  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 91  ? 17.828  32.988  -52.869 1.00 43.27  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 91  ? 18.167  34.170  -52.668 1.00 43.27  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 91  ? 16.515  32.418  -52.481 1.00 43.27  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 91  ? 15.492  33.300  -51.812 1.00 43.27  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 91  ? 16.285  31.115  -52.756 1.00 43.27  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 92  ? 16.141  25.127  -52.545 1.00 45.83  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 92  ? 16.060  23.834  -53.271 1.00 45.07  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 92  ? 15.152  25.422  -51.441 1.00 45.07  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 92  ? 17.631  25.465  -52.073 1.00 45.83  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 92  ? 18.685  25.570  -53.027 1.00 45.83  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 92  ? 19.998  25.731  -52.305 1.00 45.83  ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 92  ? 20.295  27.122  -52.097 1.00 45.83  ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 92  ? 20.015  25.090  -50.922 1.00 45.83  ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 92  ? 21.327  24.547  -50.679 1.00 45.83  ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 92  ? 19.713  26.257  -49.999 1.00 45.83  ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 92  ? 20.420  27.384  -50.721 1.00 45.83  ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 92  ? 19.900  28.737  -50.481 1.00 45.07  ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 92  ? 20.778  29.784  -50.683 1.00 45.07  ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 92  ? 21.950  29.612  -50.997 1.00 45.07  ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 92  ? 20.228  31.061  -50.480 1.00 45.07  ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 92  ? 18.914  31.361  -50.077 1.00 45.07  ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 92  ? 18.518  32.553  -49.989 1.00 45.07  ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 92  ? 18.094  30.218  -49.807 1.00 45.07  ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 92  ? 16.746  30.464  -49.230 1.00 45.07  ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 92  ? 18.596  28.977  -50.058 1.00 45.07  ? 92   DT  I C6    1 
ATOM   1875  P P     . DT  A 1 93  ? 21.559  23.475  -49.484 1.00 69.99  ? 93   DT  I P     1 
ATOM   1876  O OP1   . DT  A 1 93  ? 21.991  22.192  -50.095 1.00 60.60  ? 93   DT  I OP1   1 
ATOM   1877  O OP2   . DT  A 1 93  ? 20.426  23.475  -48.505 1.00 60.60  ? 93   DT  I OP2   1 
ATOM   1878  O "O5'" . DT  A 1 93  ? 22.800  24.114  -48.737 1.00 69.99  ? 93   DT  I "O5'" 1 
ATOM   1879  C "C5'" . DT  A 1 93  ? 23.657  25.036  -49.430 1.00 69.99  ? 93   DT  I "C5'" 1 
ATOM   1880  C "C4'" . DT  A 1 93  ? 24.481  25.809  -48.424 1.00 69.99  ? 93   DT  I "C4'" 1 
ATOM   1881  O "O4'" . DT  A 1 93  ? 24.084  27.213  -48.382 1.00 69.99  ? 93   DT  I "O4'" 1 
ATOM   1882  C "C3'" . DT  A 1 93  ? 24.260  25.271  -46.998 1.00 69.99  ? 93   DT  I "C3'" 1 
ATOM   1883  O "O3'" . DT  A 1 93  ? 25.476  25.434  -46.244 1.00 69.99  ? 93   DT  I "O3'" 1 
ATOM   1884  C "C2'" . DT  A 1 93  ? 23.156  26.174  -46.469 1.00 69.99  ? 93   DT  I "C2'" 1 
ATOM   1885  C "C1'" . DT  A 1 93  ? 23.604  27.509  -47.058 1.00 69.99  ? 93   DT  I "C1'" 1 
ATOM   1886  N N1    . DT  A 1 93  ? 22.550  28.564  -47.126 1.00 60.60  ? 93   DT  I N1    1 
ATOM   1887  C C2    . DT  A 1 93  ? 22.885  29.895  -47.467 1.00 60.60  ? 93   DT  I C2    1 
ATOM   1888  O O2    . DT  A 1 93  ? 23.979  30.233  -47.840 1.00 60.60  ? 93   DT  I O2    1 
ATOM   1889  N N3    . DT  A 1 93  ? 21.844  30.805  -47.382 1.00 60.60  ? 93   DT  I N3    1 
ATOM   1890  C C4    . DT  A 1 93  ? 20.516  30.521  -47.059 1.00 60.60  ? 93   DT  I C4    1 
ATOM   1891  O O4    . DT  A 1 93  ? 19.686  31.417  -47.010 1.00 60.60  ? 93   DT  I O4    1 
ATOM   1892  C C5    . DT  A 1 93  ? 20.222  29.132  -46.791 1.00 60.60  ? 93   DT  I C5    1 
ATOM   1893  C C7    . DT  A 1 93  ? 18.811  28.760  -46.501 1.00 60.60  ? 93   DT  I C7    1 
ATOM   1894  C C6    . DT  A 1 93  ? 21.237  28.230  -46.821 1.00 60.60  ? 93   DT  I C6    1 
ATOM   1895  P P     . DG  A 1 94  ? 25.637  24.800  -44.756 1.00 97.35  ? 94   DG  I P     1 
ATOM   1896  O OP1   . DG  A 1 94  ? 27.126  24.618  -44.650 1.00 80.90  ? 94   DG  I OP1   1 
ATOM   1897  O OP2   . DG  A 1 94  ? 24.713  23.654  -44.462 1.00 80.90  ? 94   DG  I OP2   1 
ATOM   1898  O "O5'" . DG  A 1 94  ? 25.229  25.986  -43.777 1.00 97.35  ? 94   DG  I "O5'" 1 
ATOM   1899  C "C5'" . DG  A 1 94  ? 25.101  27.311  -44.275 1.00 97.35  ? 94   DG  I "C5'" 1 
ATOM   1900  C "C4'" . DG  A 1 94  ? 26.186  28.184  -43.700 1.00 97.35  ? 94   DG  I "C4'" 1 
ATOM   1901  O "O4'" . DG  A 1 94  ? 25.828  29.538  -44.041 1.00 97.35  ? 94   DG  I "O4'" 1 
ATOM   1902  C "C3'" . DG  A 1 94  ? 26.195  28.115  -42.175 1.00 97.35  ? 94   DG  I "C3'" 1 
ATOM   1903  O "O3'" . DG  A 1 94  ? 27.501  28.297  -41.603 1.00 97.35  ? 94   DG  I "O3'" 1 
ATOM   1904  C "C2'" . DG  A 1 94  ? 25.261  29.222  -41.754 1.00 97.35  ? 94   DG  I "C2'" 1 
ATOM   1905  C "C1'" . DG  A 1 94  ? 25.201  30.170  -42.938 1.00 97.35  ? 94   DG  I "C1'" 1 
ATOM   1906  N N9    . DG  A 1 94  ? 23.800  30.399  -43.272 1.00 80.90  ? 94   DG  I N9    1 
ATOM   1907  C C8    . DG  A 1 94  ? 22.805  29.462  -43.488 1.00 80.90  ? 94   DG  I C8    1 
ATOM   1908  N N7    . DG  A 1 94  ? 21.643  29.999  -43.689 1.00 80.90  ? 94   DG  I N7    1 
ATOM   1909  C C5    . DG  A 1 94  ? 21.894  31.356  -43.625 1.00 80.90  ? 94   DG  I C5    1 
ATOM   1910  C C6    . DG  A 1 94  ? 21.040  32.417  -43.776 1.00 80.90  ? 94   DG  I C6    1 
ATOM   1911  O O6    . DG  A 1 94  ? 19.845  32.385  -44.023 1.00 80.90  ? 94   DG  I O6    1 
ATOM   1912  N N1    . DG  A 1 94  ? 21.693  33.635  -43.615 1.00 80.90  ? 94   DG  I N1    1 
ATOM   1913  C C2    . DG  A 1 94  ? 23.028  33.785  -43.339 1.00 80.90  ? 94   DG  I C2    1 
ATOM   1914  N N2    . DG  A 1 94  ? 23.478  35.042  -43.173 1.00 80.90  ? 94   DG  I N2    1 
ATOM   1915  N N3    . DG  A 1 94  ? 23.853  32.775  -43.221 1.00 80.90  ? 94   DG  I N3    1 
ATOM   1916  C C4    . DG  A 1 94  ? 23.220  31.605  -43.373 1.00 80.90  ? 94   DG  I C4    1 
ATOM   1917  P P     . DA  A 1 95  ? 27.690  28.302  -39.981 1.00 99.35  ? 95   DA  I P     1 
ATOM   1918  O OP1   . DA  A 1 95  ? 29.129  28.025  -39.756 1.00 85.19  ? 95   DA  I OP1   1 
ATOM   1919  O OP2   . DA  A 1 95  ? 26.663  27.428  -39.309 1.00 85.19  ? 95   DA  I OP2   1 
ATOM   1920  O "O5'" . DA  A 1 95  ? 27.461  29.833  -39.629 1.00 99.35  ? 95   DA  I "O5'" 1 
ATOM   1921  C "C5'" . DA  A 1 95  ? 28.095  30.815  -40.420 1.00 99.35  ? 95   DA  I "C5'" 1 
ATOM   1922  C "C4'" . DA  A 1 95  ? 27.638  32.172  -39.971 1.00 99.35  ? 95   DA  I "C4'" 1 
ATOM   1923  O "O4'" . DA  A 1 95  ? 26.311  32.456  -40.492 1.00 99.35  ? 95   DA  I "O4'" 1 
ATOM   1924  C "C3'" . DA  A 1 95  ? 27.508  32.149  -38.462 1.00 99.35  ? 95   DA  I "C3'" 1 
ATOM   1925  O "O3'" . DA  A 1 95  ? 27.971  33.359  -37.904 1.00 99.35  ? 95   DA  I "O3'" 1 
ATOM   1926  C "C2'" . DA  A 1 95  ? 26.019  31.956  -38.228 1.00 99.35  ? 95   DA  I "C2'" 1 
ATOM   1927  C "C1'" . DA  A 1 95  ? 25.406  32.678  -39.420 1.00 99.35  ? 95   DA  I "C1'" 1 
ATOM   1928  N N9    . DA  A 1 95  ? 24.058  32.233  -39.827 1.00 85.19  ? 95   DA  I N9    1 
ATOM   1929  C C8    . DA  A 1 95  ? 23.585  30.972  -40.158 1.00 85.19  ? 95   DA  I C8    1 
ATOM   1930  N N7    . DA  A 1 95  ? 22.301  30.931  -40.418 1.00 85.19  ? 95   DA  I N7    1 
ATOM   1931  C C5    . DA  A 1 95  ? 21.898  32.246  -40.250 1.00 85.19  ? 95   DA  I C5    1 
ATOM   1932  C C6    . DA  A 1 95  ? 20.645  32.870  -40.359 1.00 85.19  ? 95   DA  I C6    1 
ATOM   1933  N N6    . DA  A 1 95  ? 19.527  32.221  -40.658 1.00 85.19  ? 95   DA  I N6    1 
ATOM   1934  N N1    . DA  A 1 95  ? 20.581  34.205  -40.147 1.00 85.19  ? 95   DA  I N1    1 
ATOM   1935  C C2    . DA  A 1 95  ? 21.717  34.868  -39.841 1.00 85.19  ? 95   DA  I C2    1 
ATOM   1936  N N3    . DA  A 1 95  ? 22.954  34.394  -39.697 1.00 85.19  ? 95   DA  I N3    1 
ATOM   1937  C C4    . DA  A 1 95  ? 22.973  33.064  -39.912 1.00 85.19  ? 95   DA  I C4    1 
ATOM   1938  P P     . DT  A 1 96  ? 28.175  33.440  -36.319 1.00 104.85 ? 96   DT  I P     1 
ATOM   1939  O OP1   . DT  A 1 96  ? 29.633  33.748  -36.113 1.00 59.86  ? 96   DT  I OP1   1 
ATOM   1940  O OP2   . DT  A 1 96  ? 27.589  32.168  -35.735 1.00 59.86  ? 96   DT  I OP2   1 
ATOM   1941  O "O5'" . DT  A 1 96  ? 27.234  34.665  -35.912 1.00 104.85 ? 96   DT  I "O5'" 1 
ATOM   1942  C "C5'" . DT  A 1 96  ? 27.176  35.838  -36.730 1.00 104.85 ? 96   DT  I "C5'" 1 
ATOM   1943  C "C4'" . DT  A 1 96  ? 26.044  36.737  -36.282 1.00 104.85 ? 96   DT  I "C4'" 1 
ATOM   1944  O "O4'" . DT  A 1 96  ? 24.764  36.347  -36.873 1.00 104.85 ? 96   DT  I "O4'" 1 
ATOM   1945  C "C3'" . DT  A 1 96  ? 25.839  36.706  -34.765 1.00 104.85 ? 96   DT  I "C3'" 1 
ATOM   1946  O "O3'" . DT  A 1 96  ? 25.526  38.014  -34.259 1.00 104.85 ? 96   DT  I "O3'" 1 
ATOM   1947  C "C2'" . DT  A 1 96  ? 24.653  35.775  -34.595 1.00 104.85 ? 96   DT  I "C2'" 1 
ATOM   1948  C "C1'" . DT  A 1 96  ? 23.821  36.122  -35.827 1.00 104.85 ? 96   DT  I "C1'" 1 
ATOM   1949  N N1    . DT  A 1 96  ? 22.835  35.064  -36.223 1.00 59.86  ? 96   DT  I N1    1 
ATOM   1950  C C2    . DT  A 1 96  ? 21.551  35.473  -36.531 1.00 59.86  ? 96   DT  I C2    1 
ATOM   1951  O O2    . DT  A 1 96  ? 21.256  36.666  -36.591 1.00 59.86  ? 96   DT  I O2    1 
ATOM   1952  N N3    . DT  A 1 96  ? 20.635  34.441  -36.760 1.00 59.86  ? 96   DT  I N3    1 
ATOM   1953  C C4    . DT  A 1 96  ? 20.898  33.072  -36.714 1.00 59.86  ? 96   DT  I C4    1 
ATOM   1954  O O4    . DT  A 1 96  ? 19.994  32.247  -36.955 1.00 59.86  ? 96   DT  I O4    1 
ATOM   1955  C C5    . DT  A 1 96  ? 22.286  32.720  -36.386 1.00 59.86  ? 96   DT  I C5    1 
ATOM   1956  C C7    . DT  A 1 96  ? 22.651  31.274  -36.223 1.00 59.86  ? 96   DT  I C7    1 
ATOM   1957  C C6    . DT  A 1 96  ? 23.170  33.719  -36.206 1.00 59.86  ? 96   DT  I C6    1 
ATOM   1958  P P     . DG  A 1 97  ? 25.731  38.333  -32.691 1.00 86.34  ? 97   DG  I P     1 
ATOM   1959  O OP1   . DG  A 1 97  ? 27.113  38.906  -32.531 1.00 76.69  ? 97   DG  I OP1   1 
ATOM   1960  O OP2   . DG  A 1 97  ? 25.335  37.070  -31.942 1.00 76.69  ? 97   DG  I OP2   1 
ATOM   1961  O "O5'" . DG  A 1 97  ? 24.708  39.536  -32.401 1.00 86.34  ? 97   DG  I "O5'" 1 
ATOM   1962  C "C5'" . DG  A 1 97  ? 24.206  40.376  -33.451 1.00 86.34  ? 97   DG  I "C5'" 1 
ATOM   1963  C "C4'" . DG  A 1 97  ? 22.697  40.467  -33.358 1.00 86.34  ? 97   DG  I "C4'" 1 
ATOM   1964  O "O4'" . DG  A 1 97  ? 22.084  39.197  -33.721 1.00 86.34  ? 97   DG  I "O4'" 1 
ATOM   1965  C "C3'" . DG  A 1 97  ? 22.179  40.777  -31.950 1.00 86.34  ? 97   DG  I "C3'" 1 
ATOM   1966  O "O3'" . DG  A 1 97  ? 21.020  41.613  -32.037 1.00 86.34  ? 97   DG  I "O3'" 1 
ATOM   1967  C "C2'" . DG  A 1 97  ? 21.798  39.407  -31.405 1.00 86.34  ? 97   DG  I "C2'" 1 
ATOM   1968  C "C1'" . DG  A 1 97  ? 21.224  38.792  -32.664 1.00 86.34  ? 97   DG  I "C1'" 1 
ATOM   1969  N N9    . DG  A 1 97  ? 21.047  37.353  -32.735 1.00 76.69  ? 97   DG  I N9    1 
ATOM   1970  C C8    . DG  A 1 97  ? 21.944  36.350  -32.425 1.00 76.69  ? 97   DG  I C8    1 
ATOM   1971  N N7    . DG  A 1 97  ? 21.490  35.154  -32.706 1.00 76.69  ? 97   DG  I N7    1 
ATOM   1972  C C5    . DG  A 1 97  ? 20.208  35.378  -33.210 1.00 76.69  ? 97   DG  I C5    1 
ATOM   1973  C C6    . DG  A 1 97  ? 19.206  34.480  -33.722 1.00 76.69  ? 97   DG  I C6    1 
ATOM   1974  O O6    . DG  A 1 97  ? 19.236  33.250  -33.821 1.00 76.69  ? 97   DG  I O6    1 
ATOM   1975  N N1    . DG  A 1 97  ? 18.083  35.157  -34.132 1.00 76.69  ? 97   DG  I N1    1 
ATOM   1976  C C2    . DG  A 1 97  ? 17.897  36.507  -34.049 1.00 76.69  ? 97   DG  I C2    1 
ATOM   1977  N N2    . DG  A 1 97  ? 16.745  36.992  -34.502 1.00 76.69  ? 97   DG  I N2    1 
ATOM   1978  N N3    . DG  A 1 97  ? 18.776  37.340  -33.569 1.00 76.69  ? 97   DG  I N3    1 
ATOM   1979  C C4    . DG  A 1 97  ? 19.910  36.724  -33.192 1.00 76.69  ? 97   DG  I C4    1 
ATOM   1980  P P     . DG  A 1 98  ? 20.689  42.634  -30.830 1.00 59.24  ? 98   DG  I P     1 
ATOM   1981  O OP1   . DG  A 1 98  ? 20.717  44.064  -31.344 1.00 62.13  ? 98   DG  I OP1   1 
ATOM   1982  O OP2   . DG  A 1 98  ? 21.513  42.218  -29.602 1.00 62.13  ? 98   DG  I OP2   1 
ATOM   1983  O "O5'" . DG  A 1 98  ? 19.192  42.290  -30.359 1.00 59.24  ? 98   DG  I "O5'" 1 
ATOM   1984  C "C5'" . DG  A 1 98  ? 18.097  42.248  -31.256 1.00 59.24  ? 98   DG  I "C5'" 1 
ATOM   1985  C "C4'" . DG  A 1 98  ? 17.069  41.267  -30.751 1.00 59.24  ? 98   DG  I "C4'" 1 
ATOM   1986  O "O4'" . DG  A 1 98  ? 17.447  39.908  -31.040 1.00 59.24  ? 98   DG  I "O4'" 1 
ATOM   1987  C "C3'" . DG  A 1 98  ? 16.846  41.300  -29.247 1.00 59.24  ? 98   DG  I "C3'" 1 
ATOM   1988  O "O3'" . DG  A 1 98  ? 15.469  41.318  -29.039 1.00 59.24  ? 98   DG  I "O3'" 1 
ATOM   1989  C "C2'" . DG  A 1 98  ? 17.358  39.961  -28.741 1.00 59.24  ? 98   DG  I "C2'" 1 
ATOM   1990  C "C1'" . DG  A 1 98  ? 17.119  39.084  -29.931 1.00 59.24  ? 98   DG  I "C1'" 1 
ATOM   1991  N N9    . DG  A 1 98  ? 17.961  37.894  -29.961 1.00 62.13  ? 98   DG  I N9    1 
ATOM   1992  C C8    . DG  A 1 98  ? 19.259  37.814  -29.493 1.00 62.13  ? 98   DG  I C8    1 
ATOM   1993  N N7    . DG  A 1 98  ? 19.807  36.630  -29.632 1.00 62.13  ? 98   DG  I N7    1 
ATOM   1994  C C5    . DG  A 1 98  ? 18.811  35.867  -30.231 1.00 62.13  ? 98   DG  I C5    1 
ATOM   1995  C C6    . DG  A 1 98  ? 18.831  34.490  -30.640 1.00 62.13  ? 98   DG  I C6    1 
ATOM   1996  O O6    . DG  A 1 98  ? 19.789  33.666  -30.534 1.00 62.13  ? 98   DG  I O6    1 
ATOM   1997  N N1    . DG  A 1 98  ? 17.601  34.111  -31.217 1.00 62.13  ? 98   DG  I N1    1 
ATOM   1998  C C2    . DG  A 1 98  ? 16.512  34.953  -31.373 1.00 62.13  ? 98   DG  I C2    1 
ATOM   1999  N N2    . DG  A 1 98  ? 15.448  34.372  -31.899 1.00 62.13  ? 98   DG  I N2    1 
ATOM   2000  N N3    . DG  A 1 98  ? 16.484  36.254  -31.021 1.00 62.13  ? 98   DG  I N3    1 
ATOM   2001  C C4    . DG  A 1 98  ? 17.654  36.635  -30.451 1.00 62.13  ? 98   DG  I C4    1 
ATOM   2002  P P     . DA  A 1 99  ? 14.650  42.607  -29.473 1.00 93.81  ? 99   DA  I P     1 
ATOM   2003  O OP1   . DA  A 1 99  ? 15.220  43.151  -30.740 1.00 69.60  ? 99   DA  I OP1   1 
ATOM   2004  O OP2   . DA  A 1 99  ? 14.547  43.485  -28.308 1.00 69.60  ? 99   DA  I OP2   1 
ATOM   2005  O "O5'" . DA  A 1 99  ? 13.219  41.987  -29.763 1.00 93.81  ? 99   DA  I "O5'" 1 
ATOM   2006  C "C5'" . DA  A 1 99  ? 12.825  41.723  -31.096 1.00 93.81  ? 99   DA  I "C5'" 1 
ATOM   2007  C "C4'" . DA  A 1 99  ? 11.841  40.590  -31.102 1.00 93.81  ? 99   DA  I "C4'" 1 
ATOM   2008  O "O4'" . DA  A 1 99  ? 12.529  39.372  -30.754 1.00 93.81  ? 99   DA  I "O4'" 1 
ATOM   2009  C "C3'" . DA  A 1 99  ? 10.746  40.737  -30.053 1.00 93.81  ? 99   DA  I "C3'" 1 
ATOM   2010  O "O3'" . DA  A 1 99  ? 9.642   40.010  -30.554 1.00 93.81  ? 99   DA  I "O3'" 1 
ATOM   2011  C "C2'" . DA  A 1 99  ? 11.294  39.964  -28.859 1.00 93.81  ? 99   DA  I "C2'" 1 
ATOM   2012  C "C1'" . DA  A 1 99  ? 11.966  38.805  -29.567 1.00 93.81  ? 99   DA  I "C1'" 1 
ATOM   2013  N N9    . DA  A 1 99  ? 13.070  38.201  -28.829 1.00 69.60  ? 99   DA  I N9    1 
ATOM   2014  C C8    . DA  A 1 99  ? 13.973  38.869  -28.045 1.00 69.60  ? 99   DA  I C8    1 
ATOM   2015  N N7    . DA  A 1 99  ? 14.953  38.107  -27.599 1.00 69.60  ? 99   DA  I N7    1 
ATOM   2016  C C5    . DA  A 1 99  ? 14.667  36.854  -28.130 1.00 69.60  ? 99   DA  I C5    1 
ATOM   2017  C C6    . DA  A 1 99  ? 15.367  35.638  -28.087 1.00 69.60  ? 99   DA  I C6    1 
ATOM   2018  N N6    . DA  A 1 99  ? 16.581  35.548  -27.520 1.00 69.60  ? 99   DA  I N6    1 
ATOM   2019  N N1    . DA  A 1 99  ? 14.791  34.550  -28.666 1.00 69.60  ? 99   DA  I N1    1 
ATOM   2020  C C2    . DA  A 1 99  ? 13.613  34.721  -29.265 1.00 69.60  ? 99   DA  I C2    1 
ATOM   2021  N N3    . DA  A 1 99  ? 12.888  35.836  -29.416 1.00 69.60  ? 99   DA  I N3    1 
ATOM   2022  C C4    . DA  A 1 99  ? 13.479  36.880  -28.828 1.00 69.60  ? 99   DA  I C4    1 
ATOM   2023  P P     . DG  A 1 100 ? 8.186   40.701  -30.713 1.00 52.83  ? 100  DG  I P     1 
ATOM   2024  O OP1   . DG  A 1 100 ? 7.932   41.192  -32.148 1.00 58.98  ? 100  DG  I OP1   1 
ATOM   2025  O OP2   . DG  A 1 100 ? 8.001   41.636  -29.568 1.00 58.98  ? 100  DG  I OP2   1 
ATOM   2026  O "O5'" . DG  A 1 100 ? 7.299   39.378  -30.523 1.00 52.83  ? 100  DG  I "O5'" 1 
ATOM   2027  C "C5'" . DG  A 1 100 ? 7.807   38.158  -31.066 1.00 52.83  ? 100  DG  I "C5'" 1 
ATOM   2028  C "C4'" . DG  A 1 100 ? 7.869   37.075  -30.013 1.00 52.83  ? 100  DG  I "C4'" 1 
ATOM   2029  O "O4'" . DG  A 1 100 ? 9.109   37.022  -29.283 1.00 52.83  ? 100  DG  I "O4'" 1 
ATOM   2030  C "C3'" . DG  A 1 100 ? 6.787   37.085  -28.955 1.00 52.83  ? 100  DG  I "C3'" 1 
ATOM   2031  O "O3'" . DG  A 1 100 ? 6.355   35.775  -28.843 1.00 52.83  ? 100  DG  I "O3'" 1 
ATOM   2032  C "C2'" . DG  A 1 100 ? 7.543   37.270  -27.651 1.00 52.83  ? 100  DG  I "C2'" 1 
ATOM   2033  C "C1'" . DG  A 1 100 ? 8.831   36.536  -27.968 1.00 52.83  ? 100  DG  I "C1'" 1 
ATOM   2034  N N9    . DG  A 1 100 ? 9.992   36.787  -27.076 1.00 58.98  ? 100  DG  I N9    1 
ATOM   2035  C C8    . DG  A 1 100 ? 10.295  37.989  -26.488 1.00 58.98  ? 100  DG  I C8    1 
ATOM   2036  N N7    . DG  A 1 100 ? 11.335  37.948  -25.697 1.00 58.98  ? 100  DG  I N7    1 
ATOM   2037  C C5    . DG  A 1 100 ? 11.773  36.638  -25.770 1.00 58.98  ? 100  DG  I C5    1 
ATOM   2038  C C6    . DG  A 1 100 ? 12.856  36.002  -25.108 1.00 58.98  ? 100  DG  I C6    1 
ATOM   2039  O O6    . DG  A 1 100 ? 13.642  36.498  -24.273 1.00 58.98  ? 100  DG  I O6    1 
ATOM   2040  N N1    . DG  A 1 100 ? 12.963  34.662  -25.484 1.00 58.98  ? 100  DG  I N1    1 
ATOM   2041  C C2    . DG  A 1 100 ? 12.113  34.027  -26.374 1.00 58.98  ? 100  DG  I C2    1 
ATOM   2042  N N2    . DG  A 1 100 ? 12.383  32.730  -26.636 1.00 58.98  ? 100  DG  I N2    1 
ATOM   2043  N N3    . DG  A 1 100 ? 11.079  34.619  -26.970 1.00 58.98  ? 100  DG  I N3    1 
ATOM   2044  C C4    . DG  A 1 100 ? 10.970  35.903  -26.630 1.00 58.98  ? 100  DG  I C4    1 
ATOM   2045  P P     . DC  A 1 101 ? 4.854   35.423  -29.112 1.00 42.18  ? 101  DC  I P     1 
ATOM   2046  O OP1   . DC  A 1 101 ? 4.635   35.561  -30.565 1.00 49.30  ? 101  DC  I OP1   1 
ATOM   2047  O OP2   . DC  A 1 101 ? 3.969   36.072  -28.169 1.00 49.30  ? 101  DC  I OP2   1 
ATOM   2048  O "O5'" . DC  A 1 101 ? 4.846   33.921  -28.692 1.00 42.18  ? 101  DC  I "O5'" 1 
ATOM   2049  C "C5'" . DC  A 1 101 ? 5.286   32.993  -29.644 1.00 42.18  ? 101  DC  I "C5'" 1 
ATOM   2050  C "C4'" . DC  A 1 101 ? 6.030   31.883  -28.968 1.00 42.18  ? 101  DC  I "C4'" 1 
ATOM   2051  O "O4'" . DC  A 1 101 ? 7.065   32.489  -28.181 1.00 42.18  ? 101  DC  I "O4'" 1 
ATOM   2052  C "C3'" . DC  A 1 101 ? 5.215   31.022  -28.002 1.00 42.18  ? 101  DC  I "C3'" 1 
ATOM   2053  O "O3'" . DC  A 1 101 ? 5.490   29.683  -28.384 1.00 42.18  ? 101  DC  I "O3'" 1 
ATOM   2054  C "C2'" . DC  A 1 101 ? 5.738   31.365  -26.604 1.00 42.18  ? 101  DC  I "C2'" 1 
ATOM   2055  C "C1'" . DC  A 1 101 ? 7.128   31.849  -26.911 1.00 42.18  ? 101  DC  I "C1'" 1 
ATOM   2056  N N1    . DC  A 1 101 ? 7.703   32.815  -25.990 1.00 49.30  ? 101  DC  I N1    1 
ATOM   2057  C C2    . DC  A 1 101 ? 8.713   32.391  -25.114 1.00 49.30  ? 101  DC  I C2    1 
ATOM   2058  O O2    . DC  A 1 101 ? 9.098   31.207  -25.177 1.00 49.30  ? 101  DC  I O2    1 
ATOM   2059  N N3    . DC  A 1 101 ? 9.256   33.274  -24.244 1.00 49.30  ? 101  DC  I N3    1 
ATOM   2060  C C4    . DC  A 1 101 ? 8.852   34.557  -24.261 1.00 49.30  ? 101  DC  I C4    1 
ATOM   2061  N N4    . DC  A 1 101 ? 9.421   35.429  -23.372 1.00 49.30  ? 101  DC  I N4    1 
ATOM   2062  C C5    . DC  A 1 101 ? 7.841   35.015  -25.179 1.00 49.30  ? 101  DC  I C5    1 
ATOM   2063  C C6    . DC  A 1 101 ? 7.289   34.108  -25.998 1.00 49.30  ? 101  DC  I C6    1 
ATOM   2064  P P     . DA  A 1 102 ? 4.698   28.453  -27.710 1.00 72.49  ? 102  DA  I P     1 
ATOM   2065  O OP1   . DA  A 1 102 ? 5.155   27.310  -28.583 1.00 60.31  ? 102  DA  I OP1   1 
ATOM   2066  O OP2   . DA  A 1 102 ? 3.219   28.694  -27.516 1.00 60.31  ? 102  DA  I OP2   1 
ATOM   2067  O "O5'" . DA  A 1 102 ? 5.438   28.347  -26.308 1.00 72.49  ? 102  DA  I "O5'" 1 
ATOM   2068  C "C5'" . DA  A 1 102 ? 6.766   27.867  -26.307 1.00 72.49  ? 102  DA  I "C5'" 1 
ATOM   2069  C "C4'" . DA  A 1 102 ? 7.260   27.705  -24.902 1.00 72.49  ? 102  DA  I "C4'" 1 
ATOM   2070  O "O4'" . DA  A 1 102 ? 7.469   29.015  -24.360 1.00 72.49  ? 102  DA  I "O4'" 1 
ATOM   2071  C "C3'" . DA  A 1 102 ? 6.299   26.982  -23.978 1.00 72.49  ? 102  DA  I "C3'" 1 
ATOM   2072  O "O3'" . DA  A 1 102 ? 7.054   25.969  -23.310 1.00 72.49  ? 102  DA  I "O3'" 1 
ATOM   2073  C "C2'" . DA  A 1 102 ? 5.772   28.098  -23.085 1.00 72.49  ? 102  DA  I "C2'" 1 
ATOM   2074  C "C1'" . DA  A 1 102 ? 6.943   29.054  -23.069 1.00 72.49  ? 102  DA  I "C1'" 1 
ATOM   2075  N N9    . DA  A 1 102 ? 6.676   30.461  -22.758 1.00 60.31  ? 102  DA  I N9    1 
ATOM   2076  C C8    . DA  A 1 102 ? 5.679   31.339  -23.159 1.00 60.31  ? 102  DA  I C8    1 
ATOM   2077  N N7    . DA  A 1 102 ? 5.863   32.571  -22.738 1.00 60.31  ? 102  DA  I N7    1 
ATOM   2078  C C5    . DA  A 1 102 ? 7.046   32.494  -22.010 1.00 60.31  ? 102  DA  I C5    1 
ATOM   2079  C C6    . DA  A 1 102 ? 7.808   33.446  -21.349 1.00 60.31  ? 102  DA  I C6    1 
ATOM   2080  N N6    . DA  A 1 102 ? 7.508   34.731  -21.328 1.00 60.31  ? 102  DA  I N6    1 
ATOM   2081  N N1    . DA  A 1 102 ? 8.917   33.035  -20.707 1.00 60.31  ? 102  DA  I N1    1 
ATOM   2082  C C2    . DA  A 1 102 ? 9.244   31.755  -20.750 1.00 60.31  ? 102  DA  I C2    1 
ATOM   2083  N N3    . DA  A 1 102 ? 8.635   30.763  -21.359 1.00 60.31  ? 102  DA  I N3    1 
ATOM   2084  C C4    . DA  A 1 102 ? 7.527   31.202  -21.980 1.00 60.31  ? 102  DA  I C4    1 
ATOM   2085  P P     . DG  A 1 103 ? 6.342   25.024  -22.227 1.00 66.91  ? 103  DG  I P     1 
ATOM   2086  O OP1   . DG  A 1 103 ? 6.606   23.635  -22.721 1.00 69.35  ? 103  DG  I OP1   1 
ATOM   2087  O OP2   . DG  A 1 103 ? 4.951   25.472  -21.925 1.00 69.35  ? 103  DG  I OP2   1 
ATOM   2088  O "O5'" . DG  A 1 103 ? 7.196   25.331  -20.923 1.00 66.91  ? 103  DG  I "O5'" 1 
ATOM   2089  C "C5'" . DG  A 1 103 ? 8.484   24.743  -20.790 1.00 66.91  ? 103  DG  I "C5'" 1 
ATOM   2090  C "C4'" . DG  A 1 103 ? 9.118   25.190  -19.505 1.00 66.91  ? 103  DG  I "C4'" 1 
ATOM   2091  O "O4'" . DG  A 1 103 ? 8.999   26.633  -19.517 1.00 66.91  ? 103  DG  I "O4'" 1 
ATOM   2092  C "C3'" . DG  A 1 103 ? 8.397   24.716  -18.244 1.00 66.91  ? 103  DG  I "C3'" 1 
ATOM   2093  O "O3'" . DG  A 1 103 ? 9.327   24.194  -17.279 1.00 66.91  ? 103  DG  I "O3'" 1 
ATOM   2094  C "C2'" . DG  A 1 103 ? 7.594   25.930  -17.779 1.00 66.91  ? 103  DG  I "C2'" 1 
ATOM   2095  C "C1'" . DG  A 1 103 ? 8.384   27.091  -18.342 1.00 66.91  ? 103  DG  I "C1'" 1 
ATOM   2096  N N9    . DG  A 1 103 ? 7.645   28.284  -18.702 1.00 69.35  ? 103  DG  I N9    1 
ATOM   2097  C C8    . DG  A 1 103 ? 6.683   28.431  -19.661 1.00 69.35  ? 103  DG  I C8    1 
ATOM   2098  N N7    . DG  A 1 103 ? 6.256   29.665  -19.773 1.00 69.35  ? 103  DG  I N7    1 
ATOM   2099  C C5    . DG  A 1 103 ? 6.989   30.357  -18.824 1.00 69.35  ? 103  DG  I C5    1 
ATOM   2100  C C6    . DG  A 1 103 ? 7.004   31.763  -18.474 1.00 69.35  ? 103  DG  I C6    1 
ATOM   2101  O O6    . DG  A 1 103 ? 6.355   32.714  -18.986 1.00 69.35  ? 103  DG  I O6    1 
ATOM   2102  N N1    . DG  A 1 103 ? 7.898   32.008  -17.419 1.00 69.35  ? 103  DG  I N1    1 
ATOM   2103  C C2    . DG  A 1 103 ? 8.674   31.041  -16.803 1.00 69.35  ? 103  DG  I C2    1 
ATOM   2104  N N2    . DG  A 1 103 ? 9.425   31.454  -15.784 1.00 69.35  ? 103  DG  I N2    1 
ATOM   2105  N N3    . DG  A 1 103 ? 8.692   29.767  -17.153 1.00 69.35  ? 103  DG  I N3    1 
ATOM   2106  C C4    . DG  A 1 103 ? 7.831   29.502  -18.149 1.00 69.35  ? 103  DG  I C4    1 
ATOM   2107  P P     . DT  A 1 104 ? 8.780   23.597  -15.887 1.00 81.20  ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 104 ? 9.871   22.773  -15.333 1.00 69.14  ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 104 ? 7.441   22.976  -16.083 1.00 69.14  ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 104 ? 8.611   24.907  -14.996 1.00 81.20  ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 104 ? 9.776   25.580  -14.530 1.00 81.20  ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 104 ? 9.470   26.464  -13.339 1.00 81.20  ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 104 ? 8.984   27.767  -13.745 1.00 81.20  ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 104 ? 8.459   25.933  -12.322 1.00 81.20  ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 104 ? 8.911   26.268  -10.990 1.00 81.20  ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 104 ? 7.195   26.707  -12.673 1.00 81.20  ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 104 ? 7.772   28.061  -13.087 1.00 81.20  ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 104 ? 6.954   28.889  -14.010 1.00 69.14  ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 104 ? 6.886   30.239  -13.763 1.00 69.14  ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 104 ? 7.543   30.776  -12.915 1.00 69.14  ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 104 ? 6.037   30.952  -14.587 1.00 69.14  ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 104 ? 5.311   30.468  -15.666 1.00 69.14  ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 104 ? 4.562   31.233  -16.284 1.00 69.14  ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 104 ? 5.510   29.042  -15.949 1.00 69.14  ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 104 ? 4.888   28.438  -17.170 1.00 69.14  ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 104 ? 6.283   28.333  -15.090 1.00 69.14  ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 105 ? 8.645   25.256  -9.756  1.00 98.57  ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 105 ? 9.784   24.278  -9.673  1.00 75.70  ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 105 ? 7.228   24.749  -9.842  1.00 75.70  ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 105 ? 8.757   26.277  -8.549  1.00 98.57  ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 105 ? 9.587   27.421  -8.690  1.00 98.57  ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 105 ? 8.854   28.671  -8.255  1.00 98.57  ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 105 ? 8.039   29.230  -9.321  1.00 98.57  ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 105 ? 7.929   28.529  -7.034  1.00 98.57  ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 105 ? 8.125   29.630  -6.119  1.00 98.57  ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 105 ? 6.541   28.613  -7.654  1.00 98.57  ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 105 ? 6.785   29.620  -8.759  1.00 98.57  ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 105 ? 5.758   29.703  -9.843  1.00 75.70  ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 105 ? 5.176   30.951  -10.134 1.00 75.70  ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 105 ? 5.356   31.954  -9.464  1.00 75.70  ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 105 ? 4.343   30.961  -11.244 1.00 75.70  ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 105 ? 4.006   29.888  -12.032 1.00 75.70  ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 105 ? 3.301   30.055  -12.989 1.00 75.70  ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 105 ? 4.564   28.608  -11.632 1.00 75.70  ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 105 ? 4.174   27.384  -12.400 1.00 75.70  ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 105 ? 5.407   28.576  -10.576 1.00 75.70  ? 105  DT  I C6    1 
ATOM   2147  P P     . DT  A 1 106 ? 7.150   29.794  -4.853  1.00 161.92 ? 106  DT  I P     1 
ATOM   2148  O OP1   . DT  A 1 106 ? 7.916   30.473  -3.804  1.00 79.54  ? 106  DT  I OP1   1 
ATOM   2149  O OP2   . DT  A 1 106 ? 6.477   28.492  -4.558  1.00 79.54  ? 106  DT  I OP2   1 
ATOM   2150  O "O5'" . DT  A 1 106 ? 6.118   30.880  -5.366  1.00 161.92 ? 106  DT  I "O5'" 1 
ATOM   2151  C "C5'" . DT  A 1 106 ? 6.611   32.116  -5.860  1.00 161.92 ? 106  DT  I "C5'" 1 
ATOM   2152  C "C4'" . DT  A 1 106 ? 5.505   33.137  -5.871  1.00 161.92 ? 106  DT  I "C4'" 1 
ATOM   2153  O "O4'" . DT  A 1 106 ? 4.655   32.956  -7.032  1.00 161.92 ? 106  DT  I "O4'" 1 
ATOM   2154  C "C3'" . DT  A 1 106 ? 4.594   33.023  -4.653  1.00 161.92 ? 106  DT  I "C3'" 1 
ATOM   2155  O "O3'" . DT  A 1 106 ? 4.189   34.335  -4.267  1.00 161.92 ? 106  DT  I "O3'" 1 
ATOM   2156  C "C2'" . DT  A 1 106 ? 3.414   32.231  -5.190  1.00 161.92 ? 106  DT  I "C2'" 1 
ATOM   2157  C "C1'" . DT  A 1 106 ? 3.313   32.756  -6.613  1.00 161.92 ? 106  DT  I "C1'" 1 
ATOM   2158  N N1    . DT  A 1 106 ? 2.635   31.866  -7.602  1.00 79.54  ? 106  DT  I N1    1 
ATOM   2159  C C2    . DT  A 1 106 ? 1.778   32.478  -8.526  1.00 79.54  ? 106  DT  I C2    1 
ATOM   2160  O O2    . DT  A 1 106 ? 1.552   33.708  -8.532  1.00 79.54  ? 106  DT  I O2    1 
ATOM   2161  N N3    . DT  A 1 106 ? 1.192   31.596  -9.440  1.00 79.54  ? 106  DT  I N3    1 
ATOM   2162  C C4    . DT  A 1 106 ? 1.362   30.203  -9.503  1.00 79.54  ? 106  DT  I C4    1 
ATOM   2163  O O4    . DT  A 1 106 ? 0.767   29.540  -10.365 1.00 79.54  ? 106  DT  I O4    1 
ATOM   2164  C C5    . DT  A 1 106 ? 2.262   29.636  -8.492  1.00 79.54  ? 106  DT  I C5    1 
ATOM   2165  C C7    . DT  A 1 106 ? 2.496   28.154  -8.483  1.00 79.54  ? 106  DT  I C7    1 
ATOM   2166  C C6    . DT  A 1 106 ? 2.843   30.485  -7.611  1.00 79.54  ? 106  DT  I C6    1 
ATOM   2167  P P     . DC  A 1 107 ? 3.685   34.617  -2.767  1.00 100.25 ? 107  DC  I P     1 
ATOM   2168  O OP1   . DC  A 1 107 ? 4.432   35.826  -2.300  1.00 84.09  ? 107  DC  I OP1   1 
ATOM   2169  O OP2   . DC  A 1 107 ? 3.699   33.344  -1.944  1.00 84.09  ? 107  DC  I OP2   1 
ATOM   2170  O "O5'" . DC  A 1 107 ? 2.215   35.158  -3.005  1.00 100.25 ? 107  DC  I "O5'" 1 
ATOM   2171  C "C5'" . DC  A 1 107 ? 2.003   36.218  -3.916  1.00 100.25 ? 107  DC  I "C5'" 1 
ATOM   2172  C "C4'" . DC  A 1 107 ? 0.589   36.162  -4.436  1.00 100.25 ? 107  DC  I "C4'" 1 
ATOM   2173  O "O4'" . DC  A 1 107 ? 0.390   35.033  -5.324  1.00 100.25 ? 107  DC  I "O4'" 1 
ATOM   2174  C "C3'" . DC  A 1 107 ? -0.460  36.023  -3.337  1.00 100.25 ? 107  DC  I "C3'" 1 
ATOM   2175  O "O3'" . DC  A 1 107 ? -1.566  36.820  -3.704  1.00 100.25 ? 107  DC  I "O3'" 1 
ATOM   2176  C "C2'" . DC  A 1 107 ? -0.865  34.565  -3.405  1.00 100.25 ? 107  DC  I "C2'" 1 
ATOM   2177  C "C1'" . DC  A 1 107 ? -0.783  34.337  -4.906  1.00 100.25 ? 107  DC  I "C1'" 1 
ATOM   2178  N N1    . DC  A 1 107 ? -0.716  32.939  -5.405  1.00 84.09  ? 107  DC  I N1    1 
ATOM   2179  C C2    . DC  A 1 107 ? -1.577  32.577  -6.437  1.00 84.09  ? 107  DC  I C2    1 
ATOM   2180  O O2    . DC  A 1 107 ? -2.372  33.438  -6.859  1.00 84.09  ? 107  DC  I O2    1 
ATOM   2181  N N3    . DC  A 1 107 ? -1.522  31.292  -6.947  1.00 84.09  ? 107  DC  I N3    1 
ATOM   2182  C C4    . DC  A 1 107 ? -0.660  30.398  -6.436  1.00 84.09  ? 107  DC  I C4    1 
ATOM   2183  N N4    . DC  A 1 107 ? -0.644  29.154  -6.948  1.00 84.09  ? 107  DC  I N4    1 
ATOM   2184  C C5    . DC  A 1 107 ? 0.224   30.743  -5.368  1.00 84.09  ? 107  DC  I C5    1 
ATOM   2185  C C6    . DC  A 1 107 ? 0.163   32.016  -4.886  1.00 84.09  ? 107  DC  I C6    1 
ATOM   2186  P P     . DC  A 1 108 ? -2.193  37.820  -2.629  1.00 81.81  ? 108  DC  I P     1 
ATOM   2187  O OP1   . DC  A 1 108 ? -1.414  39.111  -2.645  1.00 79.38  ? 108  DC  I OP1   1 
ATOM   2188  O OP2   . DC  A 1 108 ? -2.291  36.984  -1.377  1.00 79.38  ? 108  DC  I OP2   1 
ATOM   2189  O "O5'" . DC  A 1 108 ? -3.671  38.115  -3.165  1.00 81.81  ? 108  DC  I "O5'" 1 
ATOM   2190  C "C5'" . DC  A 1 108 ? -3.879  38.901  -4.352  1.00 81.81  ? 108  DC  I "C5'" 1 
ATOM   2191  C "C4'" . DC  A 1 108 ? -5.124  38.443  -5.070  1.00 81.81  ? 108  DC  I "C4'" 1 
ATOM   2192  O "O4'" . DC  A 1 108 ? -4.911  37.106  -5.551  1.00 81.81  ? 108  DC  I "O4'" 1 
ATOM   2193  C "C3'" . DC  A 1 108 ? -6.364  38.364  -4.189  1.00 81.81  ? 108  DC  I "C3'" 1 
ATOM   2194  O "O3'" . DC  A 1 108 ? -7.472  38.766  -4.945  1.00 81.81  ? 108  DC  I "O3'" 1 
ATOM   2195  C "C2'" . DC  A 1 108 ? -6.481  36.900  -3.839  1.00 81.81  ? 108  DC  I "C2'" 1 
ATOM   2196  C "C1'" . DC  A 1 108 ? -5.957  36.278  -5.099  1.00 81.81  ? 108  DC  I "C1'" 1 
ATOM   2197  N N1    . DC  A 1 108 ? -5.435  34.926  -4.977  1.00 79.38  ? 108  DC  I N1    1 
ATOM   2198  C C2    . DC  A 1 108 ? -5.761  34.044  -5.964  1.00 79.38  ? 108  DC  I C2    1 
ATOM   2199  O O2    . DC  A 1 108 ? -6.388  34.482  -6.932  1.00 79.38  ? 108  DC  I O2    1 
ATOM   2200  N N3    . DC  A 1 108 ? -5.368  32.749  -5.871  1.00 79.38  ? 108  DC  I N3    1 
ATOM   2201  C C4    . DC  A 1 108 ? -4.615  32.364  -4.842  1.00 79.38  ? 108  DC  I C4    1 
ATOM   2202  N N4    . DC  A 1 108 ? -4.228  31.097  -4.802  1.00 79.38  ? 108  DC  I N4    1 
ATOM   2203  C C5    . DC  A 1 108 ? -4.225  33.273  -3.820  1.00 79.38  ? 108  DC  I C5    1 
ATOM   2204  C C6    . DC  A 1 108 ? -4.658  34.537  -3.924  1.00 79.38  ? 108  DC  I C6    1 
ATOM   2205  P P     . DA  A 1 109 ? -7.897  40.291  -4.903  1.00 74.95  ? 109  DA  I P     1 
ATOM   2206  O OP1   . DA  A 1 109 ? -6.688  41.100  -5.278  1.00 59.53  ? 109  DA  I OP1   1 
ATOM   2207  O OP2   . DA  A 1 109 ? -8.552  40.541  -3.592  1.00 59.53  ? 109  DA  I OP2   1 
ATOM   2208  O "O5'" . DA  A 1 109 ? -9.002  40.376  -6.040  1.00 74.95  ? 109  DA  I "O5'" 1 
ATOM   2209  C "C5'" . DA  A 1 109 ? -8.621  40.711  -7.351  1.00 74.95  ? 109  DA  I "C5'" 1 
ATOM   2210  C "C4'" . DA  A 1 109 ? -9.240  39.751  -8.330  1.00 74.95  ? 109  DA  I "C4'" 1 
ATOM   2211  O "O4'" . DA  A 1 109 ? -8.896  38.411  -7.916  1.00 74.95  ? 109  DA  I "O4'" 1 
ATOM   2212  C "C3'" . DA  A 1 109 ? -10.765 39.803  -8.413  1.00 74.95  ? 109  DA  I "C3'" 1 
ATOM   2213  O "O3'" . DA  A 1 109 ? -11.164 39.753  -9.788  1.00 74.95  ? 109  DA  I "O3'" 1 
ATOM   2214  C "C2'" . DA  A 1 109 ? -11.210 38.565  -7.661  1.00 74.95  ? 109  DA  I "C2'" 1 
ATOM   2215  C "C1'" . DA  A 1 109 ? -10.056 37.617  -7.863  1.00 74.95  ? 109  DA  I "C1'" 1 
ATOM   2216  N N9    . DA  A 1 109 ? -9.881  36.679  -6.768  1.00 59.53  ? 109  DA  I N9    1 
ATOM   2217  C C8    . DA  A 1 109 ? -9.938  36.921  -5.432  1.00 59.53  ? 109  DA  I C8    1 
ATOM   2218  N N7    . DA  A 1 109 ? -9.704  35.860  -4.696  1.00 59.53  ? 109  DA  I N7    1 
ATOM   2219  C C5    . DA  A 1 109 ? -9.468  34.853  -5.623  1.00 59.53  ? 109  DA  I C5    1 
ATOM   2220  C C6    . DA  A 1 109 ? -9.107  33.473  -5.494  1.00 59.53  ? 109  DA  I C6    1 
ATOM   2221  N N6    . DA  A 1 109 ? -8.837  32.857  -4.332  1.00 59.53  ? 109  DA  I N6    1 
ATOM   2222  N N1    . DA  A 1 109 ? -8.998  32.749  -6.622  1.00 59.53  ? 109  DA  I N1    1 
ATOM   2223  C C2    . DA  A 1 109 ? -9.179  33.366  -7.785  1.00 59.53  ? 109  DA  I C2    1 
ATOM   2224  N N3    . DA  A 1 109 ? -9.469  34.656  -8.038  1.00 59.53  ? 109  DA  I N3    1 
ATOM   2225  C C4    . DA  A 1 109 ? -9.602  35.344  -6.900  1.00 59.53  ? 109  DA  I C4    1 
ATOM   2226  P P     . DA  A 1 110 ? -12.715 39.551  -10.172 1.00 66.92  ? 110  DA  I P     1 
ATOM   2227  O OP1   . DA  A 1 110 ? -12.978 40.039  -11.560 1.00 63.20  ? 110  DA  I OP1   1 
ATOM   2228  O OP2   . DA  A 1 110 ? -13.506 40.085  -9.049  1.00 63.20  ? 110  DA  I OP2   1 
ATOM   2229  O "O5'" . DA  A 1 110 ? -12.867 37.961  -10.211 1.00 66.92  ? 110  DA  I "O5'" 1 
ATOM   2230  C "C5'" . DA  A 1 110 ? -12.051 37.180  -11.091 1.00 66.92  ? 110  DA  I "C5'" 1 
ATOM   2231  C "C4'" . DA  A 1 110 ? -12.607 35.783  -11.212 1.00 66.92  ? 110  DA  I "C4'" 1 
ATOM   2232  O "O4'" . DA  A 1 110 ? -12.225 34.929  -10.120 1.00 66.92  ? 110  DA  I "O4'" 1 
ATOM   2233  C "C3'" . DA  A 1 110 ? -14.122 35.731  -11.267 1.00 66.92  ? 110  DA  I "C3'" 1 
ATOM   2234  O "O3'" . DA  A 1 110 ? -14.413 34.631  -12.092 1.00 66.92  ? 110  DA  I "O3'" 1 
ATOM   2235  C "C2'" . DA  A 1 110 ? -14.501 35.418  -9.842  1.00 66.92  ? 110  DA  I "C2'" 1 
ATOM   2236  C "C1'" . DA  A 1 110 ? -13.384 34.489  -9.439  1.00 66.92  ? 110  DA  I "C1'" 1 
ATOM   2237  N N9    . DA  A 1 110 ? -13.121 34.555  -8.009  1.00 63.20  ? 110  DA  I N9    1 
ATOM   2238  C C8    . DA  A 1 110 ? -13.228 35.621  -7.158  1.00 63.20  ? 110  DA  I C8    1 
ATOM   2239  N N7    . DA  A 1 110 ? -12.974 35.317  -5.910  1.00 63.20  ? 110  DA  I N7    1 
ATOM   2240  C C5    . DA  A 1 110 ? -12.657 33.966  -5.951  1.00 63.20  ? 110  DA  I C5    1 
ATOM   2241  C C6    . DA  A 1 110 ? -12.271 33.031  -4.956  1.00 63.20  ? 110  DA  I C6    1 
ATOM   2242  N N6    . DA  A 1 110 ? -12.079 33.331  -3.663  1.00 63.20  ? 110  DA  I N6    1 
ATOM   2243  N N1    . DA  A 1 110 ? -12.055 31.752  -5.345  1.00 63.20  ? 110  DA  I N1    1 
ATOM   2244  C C2    . DA  A 1 110 ? -12.169 31.453  -6.634  1.00 63.20  ? 110  DA  I C2    1 
ATOM   2245  N N3    . DA  A 1 110 ? -12.494 32.240  -7.654  1.00 63.20  ? 110  DA  I N3    1 
ATOM   2246  C C4    . DA  A 1 110 ? -12.735 33.494  -7.237  1.00 63.20  ? 110  DA  I C4    1 
ATOM   2247  P P     . DA  A 1 111 ? -15.928 34.228  -12.424 1.00 52.81  ? 111  DA  I P     1 
ATOM   2248  O OP1   . DA  A 1 111 ? -15.888 34.258  -13.931 1.00 69.97  ? 111  DA  I OP1   1 
ATOM   2249  O OP2   . DA  A 1 111 ? -16.962 35.033  -11.687 1.00 69.97  ? 111  DA  I OP2   1 
ATOM   2250  O "O5'" . DA  A 1 111 ? -15.891 32.700  -11.932 1.00 52.81  ? 111  DA  I "O5'" 1 
ATOM   2251  C "C5'" . DA  A 1 111 ? -14.803 31.917  -12.330 1.00 52.81  ? 111  DA  I "C5'" 1 
ATOM   2252  C "C4'" . DA  A 1 111 ? -14.946 30.531  -11.793 1.00 52.81  ? 111  DA  I "C4'" 1 
ATOM   2253  O "O4'" . DA  A 1 111 ? -14.366 30.531  -10.472 1.00 52.81  ? 111  DA  I "O4'" 1 
ATOM   2254  C "C3'" . DA  A 1 111 ? -16.385 30.024  -11.697 1.00 52.81  ? 111  DA  I "C3'" 1 
ATOM   2255  O "O3'" . DA  A 1 111 ? -16.491 28.731  -12.260 1.00 52.81  ? 111  DA  I "O3'" 1 
ATOM   2256  C "C2'" . DA  A 1 111 ? -16.635 29.895  -10.213 1.00 52.81  ? 111  DA  I "C2'" 1 
ATOM   2257  C "C1'" . DA  A 1 111 ? -15.258 29.977  -9.515  1.00 52.81  ? 111  DA  I "C1'" 1 
ATOM   2258  N N9    . DA  A 1 111 ? -15.306 30.904  -8.355  1.00 69.97  ? 111  DA  I N9    1 
ATOM   2259  C C8    . DA  A 1 111 ? -15.601 32.265  -8.370  1.00 69.97  ? 111  DA  I C8    1 
ATOM   2260  N N7    . DA  A 1 111 ? -15.686 32.810  -7.170  1.00 69.97  ? 111  DA  I N7    1 
ATOM   2261  C C5    . DA  A 1 111 ? -15.398 31.761  -6.319  1.00 69.97  ? 111  DA  I C5    1 
ATOM   2262  C C6    . DA  A 1 111 ? -15.321 31.696  -4.949  1.00 69.97  ? 111  DA  I C6    1 
ATOM   2263  N N6    . DA  A 1 111 ? -15.573 32.734  -4.179  1.00 69.97  ? 111  DA  I N6    1 
ATOM   2264  N N1    . DA  A 1 111 ? -14.980 30.526  -4.381  1.00 69.97  ? 111  DA  I N1    1 
ATOM   2265  C C2    . DA  A 1 111 ? -14.744 29.485  -5.175  1.00 69.97  ? 111  DA  I C2    1 
ATOM   2266  N N3    . DA  A 1 111 ? -14.801 29.413  -6.502  1.00 69.97  ? 111  DA  I N3    1 
ATOM   2267  C C4    . DA  A 1 111 ? -15.135 30.594  -7.020  1.00 69.97  ? 111  DA  I C4    1 
ATOM   2268  P P     . DT  A 1 112 ? -17.861 27.933  -12.156 1.00 57.34  ? 112  DT  I P     1 
ATOM   2269  O OP1   . DT  A 1 112 ? -18.052 26.928  -13.218 1.00 61.45  ? 112  DT  I OP1   1 
ATOM   2270  O OP2   . DT  A 1 112 ? -18.859 28.948  -11.938 1.00 61.45  ? 112  DT  I OP2   1 
ATOM   2271  O "O5'" . DT  A 1 112 ? -17.618 27.107  -10.856 1.00 57.34  ? 112  DT  I "O5'" 1 
ATOM   2272  C "C5'" . DT  A 1 112 ? -16.607 26.139  -10.869 1.00 57.34  ? 112  DT  I "C5'" 1 
ATOM   2273  C "C4'" . DT  A 1 112 ? -16.569 25.424  -9.545  1.00 57.34  ? 112  DT  I "C4'" 1 
ATOM   2274  O "O4'" . DT  A 1 112 ? -16.417 26.378  -8.460  1.00 57.34  ? 112  DT  I "O4'" 1 
ATOM   2275  C "C3'" . DT  A 1 112 ? -17.813 24.599  -9.217  1.00 57.34  ? 112  DT  I "C3'" 1 
ATOM   2276  O "O3'" . DT  A 1 112 ? -17.373 23.421  -8.586  1.00 57.34  ? 112  DT  I "O3'" 1 
ATOM   2277  C "C2'" . DT  A 1 112 ? -18.539 25.432  -8.181  1.00 57.34  ? 112  DT  I "C2'" 1 
ATOM   2278  C "C1'" . DT  A 1 112 ? -17.364 26.057  -7.451  1.00 57.34  ? 112  DT  I "C1'" 1 
ATOM   2279  N N1    . DT  A 1 112 ? -17.705 27.309  -6.807  1.00 61.45  ? 112  DT  I N1    1 
ATOM   2280  C C2    . DT  A 1 112 ? -17.686 27.371  -5.426  1.00 61.45  ? 112  DT  I C2    1 
ATOM   2281  O O2    . DT  A 1 112 ? -17.484 26.380  -4.717  1.00 61.45  ? 112  DT  I O2    1 
ATOM   2282  N N3    . DT  A 1 112 ? -17.929 28.635  -4.919  1.00 61.45  ? 112  DT  I N3    1 
ATOM   2283  C C4    . DT  A 1 112 ? -18.206 29.788  -5.648  1.00 61.45  ? 112  DT  I C4    1 
ATOM   2284  O O4    . DT  A 1 112 ? -18.333 30.857  -5.074  1.00 61.45  ? 112  DT  I O4    1 
ATOM   2285  C C5    . DT  A 1 112 ? -18.295 29.615  -7.081  1.00 61.45  ? 112  DT  I C5    1 
ATOM   2286  C C7    . DT  A 1 112 ? -18.710 30.772  -7.934  1.00 61.45  ? 112  DT  I C7    1 
ATOM   2287  C C6    . DT  A 1 112 ? -18.018 28.408  -7.584  1.00 61.45  ? 112  DT  I C6    1 
ATOM   2288  P P     . DA  A 1 113 ? -18.407 22.270  -8.324  1.00 92.88  ? 113  DA  I P     1 
ATOM   2289  O OP1   . DA  A 1 113 ? -17.581 21.033  -8.278  1.00 69.74  ? 113  DA  I OP1   1 
ATOM   2290  O OP2   . DA  A 1 113 ? -19.540 22.385  -9.296  1.00 69.74  ? 113  DA  I OP2   1 
ATOM   2291  O "O5'" . DA  A 1 113 ? -18.866 22.662  -6.861  1.00 92.88  ? 113  DA  I "O5'" 1 
ATOM   2292  C "C5'" . DA  A 1 113 ? -17.983 22.444  -5.770  1.00 92.88  ? 113  DA  I "C5'" 1 
ATOM   2293  C "C4'" . DA  A 1 113 ? -18.779 22.344  -4.496  1.00 92.88  ? 113  DA  I "C4'" 1 
ATOM   2294  O "O4'" . DA  A 1 113 ? -19.024 23.687  -4.043  1.00 92.88  ? 113  DA  I "O4'" 1 
ATOM   2295  C "C3'" . DA  A 1 113 ? -20.156 21.678  -4.664  1.00 92.88  ? 113  DA  I "C3'" 1 
ATOM   2296  O "O3'" . DA  A 1 113 ? -20.520 21.007  -3.433  1.00 92.88  ? 113  DA  I "O3'" 1 
ATOM   2297  C "C2'" . DA  A 1 113 ? -21.061 22.870  -4.903  1.00 92.88  ? 113  DA  I "C2'" 1 
ATOM   2298  C "C1'" . DA  A 1 113 ? -20.423 23.894  -3.974  1.00 92.88  ? 113  DA  I "C1'" 1 
ATOM   2299  N N9    . DA  A 1 113 ? -20.668 25.281  -4.328  1.00 69.74  ? 113  DA  I N9    1 
ATOM   2300  C C8    . DA  A 1 113 ? -20.782 25.850  -5.585  1.00 69.74  ? 113  DA  I C8    1 
ATOM   2301  N N7    . DA  A 1 113 ? -20.970 27.158  -5.562  1.00 69.74  ? 113  DA  I N7    1 
ATOM   2302  C C5    . DA  A 1 113 ? -20.982 27.463  -4.210  1.00 69.74  ? 113  DA  I C5    1 
ATOM   2303  C C6    . DA  A 1 113 ? -21.136 28.667  -3.537  1.00 69.74  ? 113  DA  I C6    1 
ATOM   2304  N N6    . DA  A 1 113 ? -21.261 29.824  -4.155  1.00 69.74  ? 113  DA  I N6    1 
ATOM   2305  N N1    . DA  A 1 113 ? -21.142 28.641  -2.188  1.00 69.74  ? 113  DA  I N1    1 
ATOM   2306  C C2    . DA  A 1 113 ? -20.976 27.447  -1.564  1.00 69.74  ? 113  DA  I C2    1 
ATOM   2307  N N3    . DA  A 1 113 ? -20.795 26.230  -2.098  1.00 69.74  ? 113  DA  I N3    1 
ATOM   2308  C C4    . DA  A 1 113 ? -20.812 26.312  -3.437  1.00 69.74  ? 113  DA  I C4    1 
ATOM   2309  P P     . DC  A 1 114 ? -21.595 19.790  -3.428  1.00 103.91 ? 114  DC  I P     1 
ATOM   2310  O OP1   . DC  A 1 114 ? -21.589 19.285  -2.018  1.00 75.71  ? 114  DC  I OP1   1 
ATOM   2311  O OP2   . DC  A 1 114 ? -21.319 18.843  -4.562  1.00 75.71  ? 114  DC  I OP2   1 
ATOM   2312  O "O5'" . DC  A 1 114 ? -22.994 20.511  -3.673  1.00 103.91 ? 114  DC  I "O5'" 1 
ATOM   2313  C "C5'" . DC  A 1 114 ? -24.043 20.396  -2.725  1.00 103.91 ? 114  DC  I "C5'" 1 
ATOM   2314  C "C4'" . DC  A 1 114 ? -23.634 20.950  -1.377  1.00 103.91 ? 114  DC  I "C4'" 1 
ATOM   2315  O "O4'" . DC  A 1 114 ? -23.044 22.278  -1.433  1.00 103.91 ? 114  DC  I "O4'" 1 
ATOM   2316  C "C3'" . DC  A 1 114 ? -24.884 21.094  -0.533  1.00 103.91 ? 114  DC  I "C3'" 1 
ATOM   2317  O "O3'" . DC  A 1 114 ? -24.679 20.702  0.798   1.00 103.91 ? 114  DC  I "O3'" 1 
ATOM   2318  C "C2'" . DC  A 1 114 ? -25.195 22.572  -0.587  1.00 103.91 ? 114  DC  I "C2'" 1 
ATOM   2319  C "C1'" . DC  A 1 114 ? -23.827 23.192  -0.675  1.00 103.91 ? 114  DC  I "C1'" 1 
ATOM   2320  N N1    . DC  A 1 114 ? -23.871 24.490  -1.380  1.00 75.71  ? 114  DC  I N1    1 
ATOM   2321  C C2    . DC  A 1 114 ? -23.966 25.695  -0.604  1.00 75.71  ? 114  DC  I C2    1 
ATOM   2322  O O2    . DC  A 1 114 ? -24.088 25.605  0.622   1.00 75.71  ? 114  DC  I O2    1 
ATOM   2323  N N3    . DC  A 1 114 ? -23.960 26.914  -1.237  1.00 75.71  ? 114  DC  I N3    1 
ATOM   2324  C C4    . DC  A 1 114 ? -23.926 26.965  -2.579  1.00 75.71  ? 114  DC  I C4    1 
ATOM   2325  N N4    . DC  A 1 114 ? -23.947 28.161  -3.153  1.00 75.71  ? 114  DC  I N4    1 
ATOM   2326  C C5    . DC  A 1 114 ? -23.872 25.769  -3.389  1.00 75.71  ? 114  DC  I C5    1 
ATOM   2327  C C6    . DC  A 1 114 ? -23.837 24.564  -2.753  1.00 75.71  ? 114  DC  I C6    1 
ATOM   2328  P P     . DA  A 1 115 ? -25.947 20.568  1.737   1.00 138.77 ? 115  DA  I P     1 
ATOM   2329  O OP1   . DA  A 1 115 ? -25.496 20.022  3.045   1.00 104.72 ? 115  DA  I OP1   1 
ATOM   2330  O OP2   . DA  A 1 115 ? -26.944 19.832  0.936   1.00 104.72 ? 115  DA  I OP2   1 
ATOM   2331  O "O5'" . DA  A 1 115 ? -26.467 22.070  1.871   1.00 138.77 ? 115  DA  I "O5'" 1 
ATOM   2332  C "C5'" . DA  A 1 115 ? -26.068 22.890  2.966   1.00 138.77 ? 115  DA  I "C5'" 1 
ATOM   2333  C "C4'" . DA  A 1 115 ? -27.065 24.007  3.176   1.00 138.77 ? 115  DA  I "C4'" 1 
ATOM   2334  O "O4'" . DA  A 1 115 ? -26.916 24.992  2.132   1.00 138.77 ? 115  DA  I "O4'" 1 
ATOM   2335  C "C3'" . DA  A 1 115 ? -28.539 23.593  3.148   1.00 138.77 ? 115  DA  I "C3'" 1 
ATOM   2336  O "O3'" . DA  A 1 115 ? -29.276 24.479  4.003   1.00 138.77 ? 115  DA  I "O3'" 1 
ATOM   2337  C "C2'" . DA  A 1 115 ? -28.920 23.843  1.702   1.00 138.77 ? 115  DA  I "C2'" 1 
ATOM   2338  C "C1'" . DA  A 1 115 ? -28.145 25.125  1.430   1.00 138.77 ? 115  DA  I "C1'" 1 
ATOM   2339  N N9    . DA  A 1 115 ? -27.830 25.388  0.028   1.00 104.72 ? 115  DA  I N9    1 
ATOM   2340  C C8    . DA  A 1 115 ? -27.499 24.480  -0.954  1.00 104.72 ? 115  DA  I C8    1 
ATOM   2341  N N7    . DA  A 1 115 ? -27.246 25.032  -2.116  1.00 104.72 ? 115  DA  I N7    1 
ATOM   2342  C C5    . DA  A 1 115 ? -27.430 26.392  -1.886  1.00 104.72 ? 115  DA  I C5    1 
ATOM   2343  C C6    . DA  A 1 115 ? -27.314 27.511  -2.720  1.00 104.72 ? 115  DA  I C6    1 
ATOM   2344  N N6    . DA  A 1 115 ? -26.950 27.429  -4.007  1.00 104.72 ? 115  DA  I N6    1 
ATOM   2345  N N1    . DA  A 1 115 ? -27.583 28.729  -2.181  1.00 104.72 ? 115  DA  I N1    1 
ATOM   2346  C C2    . DA  A 1 115 ? -27.935 28.799  -0.889  1.00 104.72 ? 115  DA  I C2    1 
ATOM   2347  N N3    . DA  A 1 115 ? -28.066 27.819  -0.005  1.00 104.72 ? 115  DA  I N3    1 
ATOM   2348  C C4    . DA  A 1 115 ? -27.797 26.627  -0.571  1.00 104.72 ? 115  DA  I C4    1 
ATOM   2349  P P     . DC  A 1 116 ? -30.735 24.066  4.541   1.00 123.21 ? 116  DC  I P     1 
ATOM   2350  O OP1   . DC  A 1 116 ? -30.601 23.508  5.919   1.00 107.21 ? 116  DC  I OP1   1 
ATOM   2351  O OP2   . DC  A 1 116 ? -31.458 23.286  3.486   1.00 107.21 ? 116  DC  I OP2   1 
ATOM   2352  O "O5'" . DC  A 1 116 ? -31.436 25.483  4.676   1.00 123.21 ? 116  DC  I "O5'" 1 
ATOM   2353  C "C5'" . DC  A 1 116 ? -30.701 26.624  5.111   1.00 123.21 ? 116  DC  I "C5'" 1 
ATOM   2354  C "C4'" . DC  A 1 116 ? -31.325 27.872  4.535   1.00 123.21 ? 116  DC  I "C4'" 1 
ATOM   2355  O "O4'" . DC  A 1 116 ? -30.830 28.148  3.194   1.00 123.21 ? 116  DC  I "O4'" 1 
ATOM   2356  C "C3'" . DC  A 1 116 ? -32.838 27.737  4.397   1.00 123.21 ? 116  DC  I "C3'" 1 
ATOM   2357  O "O3'" . DC  A 1 116 ? -33.494 28.936  4.747   1.00 123.21 ? 116  DC  I "O3'" 1 
ATOM   2358  C "C2'" . DC  A 1 116 ? -33.045 27.493  2.914   1.00 123.21 ? 116  DC  I "C2'" 1 
ATOM   2359  C "C1'" . DC  A 1 116 ? -31.932 28.328  2.308   1.00 123.21 ? 116  DC  I "C1'" 1 
ATOM   2360  N N1    . DC  A 1 116 ? -31.541 27.898  0.939   1.00 107.21 ? 116  DC  I N1    1 
ATOM   2361  C C2    . DC  A 1 116 ? -31.378 28.883  -0.090  1.00 107.21 ? 116  DC  I C2    1 
ATOM   2362  O O2    . DC  A 1 116 ? -31.439 30.106  0.213   1.00 107.21 ? 116  DC  I O2    1 
ATOM   2363  N N3    . DC  A 1 116 ? -31.153 28.458  -1.375  1.00 107.21 ? 116  DC  I N3    1 
ATOM   2364  C C4    . DC  A 1 116 ? -31.066 27.139  -1.647  1.00 107.21 ? 116  DC  I C4    1 
ATOM   2365  N N4    . DC  A 1 116 ? -30.912 26.757  -2.918  1.00 107.21 ? 116  DC  I N4    1 
ATOM   2366  C C5    . DC  A 1 116 ? -31.151 26.147  -0.620  1.00 107.21 ? 116  DC  I C5    1 
ATOM   2367  C C6    . DC  A 1 116 ? -31.386 26.564  0.644   1.00 107.21 ? 116  DC  I C6    1 
ATOM   2368  P P     . DT  A 1 117 ? -35.050 29.082  4.416   1.00 109.81 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 117 ? -35.637 29.942  5.471   1.00 80.26  ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 117 ? -35.607 27.730  4.185   1.00 80.26  ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 117 ? -35.041 29.857  3.030   1.00 109.81 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 117 ? -34.336 31.095  2.901   1.00 109.81 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 117 ? -34.922 31.922  1.778   1.00 109.81 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 117 ? -34.579 31.321  0.498   1.00 109.81 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 117 ? -36.449 32.026  1.792   1.00 109.81 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 117 ? -36.866 33.328  1.351   1.00 109.81 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 117 ? -36.885 30.911  0.850   1.00 109.81 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 117 ? -35.759 30.869  -0.182  1.00 109.81 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 117 ? -35.472 29.523  -0.787  1.00 80.26  ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 117 ? -35.117 29.458  -2.145  1.00 80.26  ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 117 ? -35.072 30.434  -2.871  1.00 80.26  ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 117 ? -34.813 28.188  -2.610  1.00 80.26  ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 117 ? -34.819 26.996  -1.878  1.00 80.26  ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 117 ? -34.486 25.923  -2.432  1.00 80.26  ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 117 ? -35.232 27.138  -0.459  1.00 80.26  ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 117 ? -35.287 25.921  0.415   1.00 80.26  ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 117 ? -35.539 28.375  -0.007  1.00 80.26  ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? -38.436 33.739  1.368   1.00 82.21  ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? -38.651 34.840  2.373   1.00 70.54  ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? -39.406 32.571  1.266   1.00 70.54  ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? -38.599 34.452  -0.028  1.00 82.21  ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? -37.502 35.114  -0.598  1.00 82.21  ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? -37.610 35.037  -2.093  1.00 82.21  ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? -37.338 33.688  -2.513  1.00 82.21  ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? -38.998 35.381  -2.612  1.00 82.21  ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? -38.820 36.348  -3.610  1.00 82.21  ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? -39.513 34.072  -3.177  1.00 82.21  ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? -38.235 33.340  -3.525  1.00 82.21  ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? -38.310 31.877  -3.529  1.00 70.54  ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? -38.050 31.171  -4.704  1.00 70.54  ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? -37.860 31.710  -5.792  1.00 70.54  ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? -38.059 29.795  -4.563  1.00 70.54  ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? -38.341 29.074  -3.429  1.00 70.54  ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? -38.261 27.851  -3.456  1.00 70.54  ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? -38.700 29.886  -2.256  1.00 70.54  ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? -39.167 29.212  -1.000  1.00 70.54  ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? -38.626 31.227  -2.362  1.00 70.54  ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 119 ? -40.059 36.835  -4.457  1.00 69.59  ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 119 ? -39.792 38.258  -4.844  1.00 86.12  ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 119 ? -41.323 36.452  -3.776  1.00 86.12  ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 119 ? -39.975 35.890  -5.743  1.00 69.59  ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 119 ? -38.894 35.985  -6.714  1.00 69.59  ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 119 ? -39.247 35.225  -7.977  1.00 69.59  ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 119 ? -39.163 33.796  -7.726  1.00 69.59  ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 119 ? -40.683 35.490  -8.454  1.00 69.59  ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 119 ? -40.766 35.504  -9.865  1.00 69.59  ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 119 ? -41.445 34.271  -7.970  1.00 69.59  ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 119 ? -40.390 33.194  -8.124  1.00 69.59  ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 119 ? -40.611 32.003  -7.311  1.00 86.12  ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 119 ? -40.491 30.746  -7.901  1.00 86.12  ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 119 ? -40.188 30.557  -9.083  1.00 86.12  ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 119 ? -40.733 29.699  -7.037  1.00 86.12  ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 119 ? -41.034 29.779  -5.685  1.00 86.12  ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 119 ? -41.168 28.758  -5.024  1.00 86.12  ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 119 ? -41.137 31.115  -5.154  1.00 86.12  ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 119 ? -41.448 31.287  -3.704  1.00 86.12  ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 119 ? -40.934 32.146  -5.982  1.00 86.12  ? 119  DT  I C6    1 
ATOM   2428  P P     . DT  A 1 120 ? -40.155 36.729  -10.684 1.00 74.77  ? 120  DT  I P     1 
ATOM   2429  O OP1   . DT  A 1 120 ? -38.886 37.196  -10.063 1.00 67.76  ? 120  DT  I OP1   1 
ATOM   2430  O OP2   . DT  A 1 120 ? -41.195 37.695  -11.028 1.00 67.76  ? 120  DT  I OP2   1 
ATOM   2431  O "O5'" . DT  A 1 120 ? -39.801 36.021  -12.051 1.00 74.77  ? 120  DT  I "O5'" 1 
ATOM   2432  C "C5'" . DT  A 1 120 ? -38.810 34.993  -12.092 1.00 74.77  ? 120  DT  I "C5'" 1 
ATOM   2433  C "C4'" . DT  A 1 120 ? -39.267 33.845  -12.964 1.00 74.77  ? 120  DT  I "C4'" 1 
ATOM   2434  O "O4'" . DT  A 1 120 ? -39.876 32.812  -12.171 1.00 74.77  ? 120  DT  I "O4'" 1 
ATOM   2435  C "C3'" . DT  A 1 120 ? -40.288 34.174  -14.060 1.00 74.77  ? 120  DT  I "C3'" 1 
ATOM   2436  O "O3'" . DT  A 1 120 ? -39.926 33.440  -15.238 1.00 74.77  ? 120  DT  I "O3'" 1 
ATOM   2437  C "C2'" . DT  A 1 120 ? -41.595 33.636  -13.491 1.00 74.77  ? 120  DT  I "C2'" 1 
ATOM   2438  C "C1'" . DT  A 1 120 ? -41.065 32.393  -12.812 1.00 74.77  ? 120  DT  I "C1'" 1 
ATOM   2439  N N1    . DT  A 1 120 ? -41.887 31.697  -11.811 1.00 67.76  ? 120  DT  I N1    1 
ATOM   2440  C C2    . DT  A 1 120 ? -41.938 30.321  -11.882 1.00 67.76  ? 120  DT  I C2    1 
ATOM   2441  O O2    . DT  A 1 120 ? -41.509 29.708  -12.816 1.00 67.76  ? 120  DT  I O2    1 
ATOM   2442  N N3    . DT  A 1 120 ? -42.543 29.697  -10.850 1.00 67.76  ? 120  DT  I N3    1 
ATOM   2443  C C4    . DT  A 1 120 ? -43.179 30.294  -9.795  1.00 67.76  ? 120  DT  I C4    1 
ATOM   2444  O O4    . DT  A 1 120 ? -43.685 29.576  -8.907  1.00 67.76  ? 120  DT  I O4    1 
ATOM   2445  C C5    . DT  A 1 120 ? -43.194 31.781  -9.833  1.00 67.76  ? 120  DT  I C5    1 
ATOM   2446  C C7    . DT  A 1 120 ? -43.950 32.547  -8.799  1.00 67.76  ? 120  DT  I C7    1 
ATOM   2447  C C6    . DT  A 1 120 ? -42.535 32.385  -10.823 1.00 67.76  ? 120  DT  I C6    1 
ATOM   2448  P P     . DG  A 1 121 ? -40.237 34.038  -16.692 1.00 56.94  ? 121  DG  I P     1 
ATOM   2449  O OP1   . DG  A 1 121 ? -39.244 35.103  -17.071 1.00 74.60  ? 121  DG  I OP1   1 
ATOM   2450  O OP2   . DG  A 1 121 ? -41.703 34.319  -16.727 1.00 74.60  ? 121  DG  I OP2   1 
ATOM   2451  O "O5'" . DG  A 1 121 ? -39.987 32.800  -17.636 1.00 56.94  ? 121  DG  I "O5'" 1 
ATOM   2452  C "C5'" . DG  A 1 121 ? -38.984 31.862  -17.341 1.00 56.94  ? 121  DG  I "C5'" 1 
ATOM   2453  C "C4'" . DG  A 1 121 ? -39.520 30.484  -17.614 1.00 56.94  ? 121  DG  I "C4'" 1 
ATOM   2454  O "O4'" . DG  A 1 121 ? -40.476 30.163  -16.589 1.00 56.94  ? 121  DG  I "O4'" 1 
ATOM   2455  C "C3'" . DG  A 1 121 ? -40.295 30.371  -18.931 1.00 56.94  ? 121  DG  I "C3'" 1 
ATOM   2456  O "O3'" . DG  A 1 121 ? -40.132 29.071  -19.416 1.00 56.94  ? 121  DG  I "O3'" 1 
ATOM   2457  C "C2'" . DG  A 1 121 ? -41.759 30.524  -18.553 1.00 56.94  ? 121  DG  I "C2'" 1 
ATOM   2458  C "C1'" . DG  A 1 121 ? -41.803 29.983  -17.145 1.00 56.94  ? 121  DG  I "C1'" 1 
ATOM   2459  N N9    . DG  A 1 121 ? -42.765 30.646  -16.260 1.00 74.60  ? 121  DG  I N9    1 
ATOM   2460  C C8    . DG  A 1 121 ? -43.112 31.981  -16.227 1.00 74.60  ? 121  DG  I C8    1 
ATOM   2461  N N7    . DG  A 1 121 ? -44.000 32.257  -15.309 1.00 74.60  ? 121  DG  I N7    1 
ATOM   2462  C C5    . DG  A 1 121 ? -44.251 31.033  -14.705 1.00 74.60  ? 121  DG  I C5    1 
ATOM   2463  C C6    . DG  A 1 121 ? -45.128 30.694  -13.673 1.00 74.60  ? 121  DG  I C6    1 
ATOM   2464  O O6    . DG  A 1 121 ? -45.884 31.435  -13.054 1.00 74.60  ? 121  DG  I O6    1 
ATOM   2465  N N1    . DG  A 1 121 ? -45.089 29.325  -13.387 1.00 74.60  ? 121  DG  I N1    1 
ATOM   2466  C C2    . DG  A 1 121 ? -44.303 28.405  -14.030 1.00 74.60  ? 121  DG  I C2    1 
ATOM   2467  N N2    . DG  A 1 121 ? -44.424 27.133  -13.683 1.00 74.60  ? 121  DG  I N2    1 
ATOM   2468  N N3    . DG  A 1 121 ? -43.463 28.712  -14.978 1.00 74.60  ? 121  DG  I N3    1 
ATOM   2469  C C4    . DG  A 1 121 ? -43.495 30.033  -15.277 1.00 74.60  ? 121  DG  I C4    1 
ATOM   2470  P P     . DG  A 1 122 ? -40.546 28.715  -20.905 1.00 36.47  ? 122  DG  I P     1 
ATOM   2471  O OP1   . DG  A 1 122 ? -39.324 28.176  -21.550 1.00 60.12  ? 122  DG  I OP1   1 
ATOM   2472  O OP2   . DG  A 1 122 ? -41.302 29.773  -21.574 1.00 60.12  ? 122  DG  I OP2   1 
ATOM   2473  O "O5'" . DG  A 1 122 ? -41.544 27.509  -20.620 1.00 36.47  ? 122  DG  I "O5'" 1 
ATOM   2474  C "C5'" . DG  A 1 122 ? -41.123 26.360  -19.862 1.00 36.47  ? 122  DG  I "C5'" 1 
ATOM   2475  C "C4'" . DG  A 1 122 ? -42.298 25.458  -19.547 1.00 36.47  ? 122  DG  I "C4'" 1 
ATOM   2476  O "O4'" . DG  A 1 122 ? -43.095 26.040  -18.484 1.00 36.47  ? 122  DG  I "O4'" 1 
ATOM   2477  C "C3'" . DG  A 1 122 ? -43.284 25.168  -20.685 1.00 36.47  ? 122  DG  I "C3'" 1 
ATOM   2478  O "O3'" . DG  A 1 122 ? -43.662 23.782  -20.687 1.00 36.47  ? 122  DG  I "O3'" 1 
ATOM   2479  C "C2'" . DG  A 1 122 ? -44.494 26.017  -20.336 1.00 36.47  ? 122  DG  I "C2'" 1 
ATOM   2480  C "C1'" . DG  A 1 122 ? -44.477 25.995  -18.829 1.00 36.47  ? 122  DG  I "C1'" 1 
ATOM   2481  N N9    . DG  A 1 122 ? -45.139 27.102  -18.153 1.00 60.12  ? 122  DG  I N9    1 
ATOM   2482  C C8    . DG  A 1 122 ? -45.141 28.428  -18.499 1.00 60.12  ? 122  DG  I C8    1 
ATOM   2483  N N7    . DG  A 1 122 ? -45.807 29.178  -17.667 1.00 60.12  ? 122  DG  I N7    1 
ATOM   2484  C C5    . DG  A 1 122 ? -46.274 28.287  -16.713 1.00 60.12  ? 122  DG  I C5    1 
ATOM   2485  C C6    . DG  A 1 122 ? -47.064 28.502  -15.544 1.00 60.12  ? 122  DG  I C6    1 
ATOM   2486  O O6    . DG  A 1 122 ? -47.569 29.589  -15.120 1.00 60.12  ? 122  DG  I O6    1 
ATOM   2487  N N1    . DG  A 1 122 ? -47.274 27.305  -14.839 1.00 60.12  ? 122  DG  I N1    1 
ATOM   2488  C C2    . DG  A 1 122 ? -46.816 26.072  -15.216 1.00 60.12  ? 122  DG  I C2    1 
ATOM   2489  N N2    . DG  A 1 122 ? -47.082 25.057  -14.381 1.00 60.12  ? 122  DG  I N2    1 
ATOM   2490  N N3    . DG  A 1 122 ? -46.125 25.854  -16.322 1.00 60.12  ? 122  DG  I N3    1 
ATOM   2491  C C4    . DG  A 1 122 ? -45.876 27.000  -17.008 1.00 60.12  ? 122  DG  I C4    1 
ATOM   2492  P P     . DT  A 1 123 ? -44.588 23.220  -21.866 1.00 59.01  ? 123  DT  I P     1 
ATOM   2493  O OP1   . DT  A 1 123 ? -44.033 21.954  -22.424 1.00 71.66  ? 123  DT  I OP1   1 
ATOM   2494  O OP2   . DT  A 1 123 ? -44.945 24.340  -22.773 1.00 71.66  ? 123  DT  I OP2   1 
ATOM   2495  O "O5'" . DT  A 1 123 ? -45.884 22.873  -21.028 1.00 59.01  ? 123  DT  I "O5'" 1 
ATOM   2496  C "C5'" . DT  A 1 123 ? -45.777 21.982  -19.920 1.00 59.01  ? 123  DT  I "C5'" 1 
ATOM   2497  C "C4'" . DT  A 1 123 ? -47.126 21.775  -19.280 1.00 59.01  ? 123  DT  I "C4'" 1 
ATOM   2498  O "O4'" . DT  A 1 123 ? -47.505 22.964  -18.539 1.00 59.01  ? 123  DT  I "O4'" 1 
ATOM   2499  C "C3'" . DT  A 1 123 ? -48.242 21.488  -20.285 1.00 59.01  ? 123  DT  I "C3'" 1 
ATOM   2500  O "O3'" . DT  A 1 123 ? -48.893 20.220  -19.957 1.00 59.01  ? 123  DT  I "O3'" 1 
ATOM   2501  C "C2'" . DT  A 1 123 ? -49.098 22.757  -20.253 1.00 59.01  ? 123  DT  I "C2'" 1 
ATOM   2502  C "C1'" . DT  A 1 123 ? -48.799 23.357  -18.881 1.00 59.01  ? 123  DT  I "C1'" 1 
ATOM   2503  N N1    . DT  A 1 123 ? -48.871 24.828  -18.742 1.00 71.66  ? 123  DT  I N1    1 
ATOM   2504  C C2    . DT  A 1 123 ? -49.524 25.304  -17.621 1.00 71.66  ? 123  DT  I C2    1 
ATOM   2505  O O2    . DT  A 1 123 ? -49.935 24.554  -16.738 1.00 71.66  ? 123  DT  I O2    1 
ATOM   2506  N N3    . DT  A 1 123 ? -49.681 26.698  -17.579 1.00 71.66  ? 123  DT  I N3    1 
ATOM   2507  C C4    . DT  A 1 123 ? -49.256 27.613  -18.532 1.00 71.66  ? 123  DT  I C4    1 
ATOM   2508  O O4    . DT  A 1 123 ? -49.523 28.796  -18.431 1.00 71.66  ? 123  DT  I O4    1 
ATOM   2509  C C5    . DT  A 1 123 ? -48.533 27.055  -19.627 1.00 71.66  ? 123  DT  I C5    1 
ATOM   2510  C C7    . DT  A 1 123 ? -48.025 28.003  -20.661 1.00 71.66  ? 123  DT  I C7    1 
ATOM   2511  C C6    . DT  A 1 123 ? -48.359 25.704  -19.685 1.00 71.66  ? 123  DT  I C6    1 
ATOM   2512  P P     . DA  A 1 124 ? -50.083 19.642  -20.887 1.00 107.49 ? 124  DA  I P     1 
ATOM   2513  O OP1   . DA  A 1 124 ? -50.105 18.161  -20.800 1.00 78.75  ? 124  DA  I OP1   1 
ATOM   2514  O OP2   . DA  A 1 124 ? -50.231 20.305  -22.212 1.00 78.75  ? 124  DA  I OP2   1 
ATOM   2515  O "O5'" . DA  A 1 124 ? -51.331 20.231  -20.137 1.00 107.49 ? 124  DA  I "O5'" 1 
ATOM   2516  C "C5'" . DA  A 1 124 ? -51.517 20.090  -18.743 1.00 107.49 ? 124  DA  I "C5'" 1 
ATOM   2517  C "C4'" . DA  A 1 124 ? -52.838 20.733  -18.425 1.00 107.49 ? 124  DA  I "C4'" 1 
ATOM   2518  O "O4'" . DA  A 1 124 ? -52.619 22.160  -18.191 1.00 107.49 ? 124  DA  I "O4'" 1 
ATOM   2519  C "C3'" . DA  A 1 124 ? -53.715 20.645  -19.703 1.00 107.49 ? 124  DA  I "C3'" 1 
ATOM   2520  O "O3'" . DA  A 1 124 ? -55.043 20.130  -19.532 1.00 107.49 ? 124  DA  I "O3'" 1 
ATOM   2521  C "C2'" . DA  A 1 124 ? -53.794 22.067  -20.205 1.00 107.49 ? 124  DA  I "C2'" 1 
ATOM   2522  C "C1'" . DA  A 1 124 ? -53.601 22.866  -18.935 1.00 107.49 ? 124  DA  I "C1'" 1 
ATOM   2523  N N9    . DA  A 1 124 ? -53.116 24.174  -19.321 1.00 78.75  ? 124  DA  I N9    1 
ATOM   2524  C C8    . DA  A 1 124 ? -52.443 24.384  -20.499 1.00 78.75  ? 124  DA  I C8    1 
ATOM   2525  N N7    . DA  A 1 124 ? -52.265 25.647  -20.788 1.00 78.75  ? 124  DA  I N7    1 
ATOM   2526  C C5    . DA  A 1 124 ? -52.803 26.317  -19.694 1.00 78.75  ? 124  DA  I C5    1 
ATOM   2527  C C6    . DA  A 1 124 ? -52.914 27.676  -19.406 1.00 78.75  ? 124  DA  I C6    1 
ATOM   2528  N N6    . DA  A 1 124 ? -52.497 28.615  -20.255 1.00 78.75  ? 124  DA  I N6    1 
ATOM   2529  N N1    . DA  A 1 124 ? -53.480 28.040  -18.227 1.00 78.75  ? 124  DA  I N1    1 
ATOM   2530  C C2    . DA  A 1 124 ? -53.909 27.082  -17.414 1.00 78.75  ? 124  DA  I C2    1 
ATOM   2531  N N3    . DA  A 1 124 ? -53.866 25.747  -17.579 1.00 78.75  ? 124  DA  I N3    1 
ATOM   2532  C C4    . DA  A 1 124 ? -53.296 25.424  -18.759 1.00 78.75  ? 124  DA  I C4    1 
ATOM   2533  P P     . DG  A 1 125 ? -55.889 20.605  -18.272 1.00 166.58 ? 125  DG  I P     1 
ATOM   2534  O OP1   . DG  A 1 125 ? -55.151 21.726  -17.642 1.00 108.16 ? 125  DG  I OP1   1 
ATOM   2535  O OP2   . DG  A 1 125 ? -56.227 19.398  -17.468 1.00 108.16 ? 125  DG  I OP2   1 
ATOM   2536  O "O5'" . DG  A 1 125 ? -57.238 21.259  -18.762 1.00 166.58 ? 125  DG  I "O5'" 1 
ATOM   2537  C "C5'" . DG  A 1 125 ? -57.965 21.932  -17.764 1.00 166.58 ? 125  DG  I "C5'" 1 
ATOM   2538  C "C4'" . DG  A 1 125 ? -58.819 22.988  -18.376 1.00 166.58 ? 125  DG  I "C4'" 1 
ATOM   2539  O "O4'" . DG  A 1 125 ? -58.033 24.101  -18.829 1.00 166.58 ? 125  DG  I "O4'" 1 
ATOM   2540  C "C3'" . DG  A 1 125 ? -59.542 22.406  -19.565 1.00 166.58 ? 125  DG  I "C3'" 1 
ATOM   2541  O "O3'" . DG  A 1 125 ? -60.863 22.276  -19.085 1.00 166.58 ? 125  DG  I "O3'" 1 
ATOM   2542  C "C2'" . DG  A 1 125 ? -59.233 23.353  -20.726 1.00 166.58 ? 125  DG  I "C2'" 1 
ATOM   2543  C "C1'" . DG  A 1 125 ? -58.486 24.534  -20.087 1.00 166.58 ? 125  DG  I "C1'" 1 
ATOM   2544  N N9    . DG  A 1 125 ? -57.311 25.015  -20.802 1.00 108.16 ? 125  DG  I N9    1 
ATOM   2545  C C8    . DG  A 1 125 ? -56.522 24.322  -21.693 1.00 108.16 ? 125  DG  I C8    1 
ATOM   2546  N N7    . DG  A 1 125 ? -55.540 25.042  -22.184 1.00 108.16 ? 125  DG  I N7    1 
ATOM   2547  C C5    . DG  A 1 125 ? -55.688 26.290  -21.576 1.00 108.16 ? 125  DG  I C5    1 
ATOM   2548  C C6    . DG  A 1 125 ? -54.922 27.510  -21.720 1.00 108.16 ? 125  DG  I C6    1 
ATOM   2549  O O6    . DG  A 1 125 ? -53.911 27.719  -22.441 1.00 108.16 ? 125  DG  I O6    1 
ATOM   2550  N N1    . DG  A 1 125 ? -55.443 28.536  -20.906 1.00 108.16 ? 125  DG  I N1    1 
ATOM   2551  C C2    . DG  A 1 125 ? -56.543 28.404  -20.062 1.00 108.16 ? 125  DG  I C2    1 
ATOM   2552  N N2    . DG  A 1 125 ? -56.909 29.482  -19.367 1.00 108.16 ? 125  DG  I N2    1 
ATOM   2553  N N3    . DG  A 1 125 ? -57.242 27.284  -19.921 1.00 108.16 ? 125  DG  I N3    1 
ATOM   2554  C C4    . DG  A 1 125 ? -56.772 26.282  -20.705 1.00 108.16 ? 125  DG  I C4    1 
ATOM   2555  P P     . DA  A 1 126 ? -62.071 22.444  -20.069 1.00 128.18 ? 126  DA  I P     1 
ATOM   2556  O OP1   . DA  A 1 126 ? -63.263 21.913  -19.354 1.00 134.41 ? 126  DA  I OP1   1 
ATOM   2557  O OP2   . DA  A 1 126 ? -61.609 21.815  -21.350 1.00 134.41 ? 126  DA  I OP2   1 
ATOM   2558  O "O5'" . DA  A 1 126 ? -62.155 24.032  -20.131 1.00 128.18 ? 126  DA  I "O5'" 1 
ATOM   2559  C "C5'" . DA  A 1 126 ? -61.737 24.795  -18.989 1.00 128.18 ? 126  DA  I "C5'" 1 
ATOM   2560  C "C4'" . DA  A 1 126 ? -62.204 26.222  -19.111 1.00 128.18 ? 126  DA  I "C4'" 1 
ATOM   2561  O "O4'" . DA  A 1 126 ? -61.146 27.138  -19.490 1.00 128.18 ? 126  DA  I "O4'" 1 
ATOM   2562  C "C3'" . DA  A 1 126 ? -63.279 26.359  -20.181 1.00 128.18 ? 126  DA  I "C3'" 1 
ATOM   2563  O "O3'" . DA  A 1 126 ? -64.275 27.256  -19.714 1.00 128.18 ? 126  DA  I "O3'" 1 
ATOM   2564  C "C2'" . DA  A 1 126 ? -62.532 26.920  -21.378 1.00 128.18 ? 126  DA  I "C2'" 1 
ATOM   2565  C "C1'" . DA  A 1 126 ? -61.507 27.813  -20.692 1.00 128.18 ? 126  DA  I "C1'" 1 
ATOM   2566  N N9    . DA  A 1 126 ? -60.292 28.022  -21.485 1.00 134.41 ? 126  DA  I N9    1 
ATOM   2567  C C8    . DA  A 1 126 ? -59.623 27.097  -22.258 1.00 134.41 ? 126  DA  I C8    1 
ATOM   2568  N N7    . DA  A 1 126 ? -58.592 27.596  -22.907 1.00 134.41 ? 126  DA  I N7    1 
ATOM   2569  C C5    . DA  A 1 126 ? -58.567 28.935  -22.523 1.00 134.41 ? 126  DA  I C5    1 
ATOM   2570  C C6    . DA  A 1 126 ? -57.711 30.018  -22.863 1.00 134.41 ? 126  DA  I C6    1 
ATOM   2571  N N6    . DA  A 1 126 ? -56.669 29.919  -23.696 1.00 134.41 ? 126  DA  I N6    1 
ATOM   2572  N N1    . DA  A 1 126 ? -57.976 31.221  -22.306 1.00 134.41 ? 126  DA  I N1    1 
ATOM   2573  C C2    . DA  A 1 126 ? -59.010 31.324  -21.455 1.00 134.41 ? 126  DA  I C2    1 
ATOM   2574  N N3    . DA  A 1 126 ? -59.871 30.390  -21.053 1.00 134.41 ? 126  DA  I N3    1 
ATOM   2575  C C4    . DA  A 1 126 ? -59.599 29.207  -21.634 1.00 134.41 ? 126  DA  I C4    1 
ATOM   2576  P P     . DA  A 1 127 ? -65.473 27.687  -20.684 1.00 132.66 ? 127  DA  I P     1 
ATOM   2577  O OP1   . DA  A 1 127 ? -66.639 27.958  -19.795 1.00 102.11 ? 127  DA  I OP1   1 
ATOM   2578  O OP2   . DA  A 1 127 ? -65.594 26.657  -21.771 1.00 102.11 ? 127  DA  I OP2   1 
ATOM   2579  O "O5'" . DA  A 1 127 ? -64.926 29.077  -21.234 1.00 132.66 ? 127  DA  I "O5'" 1 
ATOM   2580  C "C5'" . DA  A 1 127 ? -64.542 30.095  -20.314 1.00 132.66 ? 127  DA  I "C5'" 1 
ATOM   2581  C "C4'" . DA  A 1 127 ? -64.522 31.426  -21.014 1.00 132.66 ? 127  DA  I "C4'" 1 
ATOM   2582  O "O4'" . DA  A 1 127 ? -63.245 31.624  -21.680 1.00 132.66 ? 127  DA  I "O4'" 1 
ATOM   2583  C "C3'" . DA  A 1 127 ? -65.594 31.503  -22.094 1.00 132.66 ? 127  DA  I "C3'" 1 
ATOM   2584  O "O3'" . DA  A 1 127 ? -66.258 32.769  -21.986 1.00 132.66 ? 127  DA  I "O3'" 1 
ATOM   2585  C "C2'" . DA  A 1 127 ? -64.832 31.229  -23.387 1.00 132.66 ? 127  DA  I "C2'" 1 
ATOM   2586  C "C1'" . DA  A 1 127 ? -63.427 31.764  -23.096 1.00 132.66 ? 127  DA  I "C1'" 1 
ATOM   2587  N N9    . DA  A 1 127 ? -62.300 31.110  -23.813 1.00 102.11 ? 127  DA  I N9    1 
ATOM   2588  C C8    . DA  A 1 127 ? -62.221 29.798  -24.266 1.00 102.11 ? 127  DA  I C8    1 
ATOM   2589  N N7    . DA  A 1 127 ? -61.101 29.524  -24.905 1.00 102.11 ? 127  DA  I N7    1 
ATOM   2590  C C5    . DA  A 1 127 ? -60.384 30.722  -24.870 1.00 102.11 ? 127  DA  I C5    1 
ATOM   2591  C C6    . DA  A 1 127 ? -59.107 31.095  -25.385 1.00 102.11 ? 127  DA  I C6    1 
ATOM   2592  N N6    . DA  A 1 127 ? -58.307 30.278  -26.077 1.00 102.11 ? 127  DA  I N6    1 
ATOM   2593  N N1    . DA  A 1 127 ? -58.689 32.356  -25.159 1.00 102.11 ? 127  DA  I N1    1 
ATOM   2594  C C2    . DA  A 1 127 ? -59.490 33.190  -24.481 1.00 102.11 ? 127  DA  I C2    1 
ATOM   2595  N N3    . DA  A 1 127 ? -60.705 32.972  -23.967 1.00 102.11 ? 127  DA  I N3    1 
ATOM   2596  C C4    . DA  A 1 127 ? -61.103 31.704  -24.192 1.00 102.11 ? 127  DA  I C4    1 
ATOM   2597  P P     . DT  A 1 128 ? -66.959 33.438  -23.269 1.00 141.37 ? 128  DT  I P     1 
ATOM   2598  O OP1   . DT  A 1 128 ? -68.028 34.350  -22.705 1.00 90.62  ? 128  DT  I OP1   1 
ATOM   2599  O OP2   . DT  A 1 128 ? -67.363 32.301  -24.147 1.00 90.62  ? 128  DT  I OP2   1 
ATOM   2600  O "O5'" . DT  A 1 128 ? -65.745 34.285  -23.914 1.00 141.37 ? 128  DT  I "O5'" 1 
ATOM   2601  C "C5'" . DT  A 1 128 ? -64.850 35.048  -23.047 1.00 141.37 ? 128  DT  I "C5'" 1 
ATOM   2602  C "C4'" . DT  A 1 128 ? -63.974 35.980  -23.851 1.00 141.37 ? 128  DT  I "C4'" 1 
ATOM   2603  O "O4'" . DT  A 1 128 ? -62.859 35.291  -24.464 1.00 141.37 ? 128  DT  I "O4'" 1 
ATOM   2604  C "C3'" . DT  A 1 128 ? -64.788 36.558  -24.990 1.00 141.37 ? 128  DT  I "C3'" 1 
ATOM   2605  O "O3'" . DT  A 1 128 ? -64.374 37.884  -25.147 1.00 141.37 ? 128  DT  I "O3'" 1 
ATOM   2606  C "C2'" . DT  A 1 128 ? -64.336 35.766  -26.213 1.00 141.37 ? 128  DT  I "C2'" 1 
ATOM   2607  C "C1'" . DT  A 1 128 ? -62.906 35.418  -25.882 1.00 141.37 ? 128  DT  I "C1'" 1 
ATOM   2608  N N1    . DT  A 1 128 ? -62.380 34.155  -26.497 1.00 90.62  ? 128  DT  I N1    1 
ATOM   2609  C C2    . DT  A 1 128 ? -61.034 34.116  -26.920 1.00 90.62  ? 128  DT  I C2    1 
ATOM   2610  O O2    . DT  A 1 128 ? -60.271 35.082  -26.851 1.00 90.62  ? 128  DT  I O2    1 
ATOM   2611  N N3    . DT  A 1 128 ? -60.622 32.895  -27.441 1.00 90.62  ? 128  DT  I N3    1 
ATOM   2612  C C4    . DT  A 1 128 ? -61.399 31.748  -27.614 1.00 90.62  ? 128  DT  I C4    1 
ATOM   2613  O O4    . DT  A 1 128 ? -60.888 30.728  -28.089 1.00 90.62  ? 128  DT  I O4    1 
ATOM   2614  C C5    . DT  A 1 128 ? -62.802 31.870  -27.189 1.00 90.62  ? 128  DT  I C5    1 
ATOM   2615  C C7    . DT  A 1 128 ? -63.725 30.705  -27.379 1.00 90.62  ? 128  DT  I C7    1 
ATOM   2616  C C6    . DT  A 1 128 ? -63.206 33.042  -26.649 1.00 90.62  ? 128  DT  I C6    1 
ATOM   2617  P P     . DC  A 1 129 ? -64.374 38.579  -26.599 1.00 128.82 ? 129  DC  I P     1 
ATOM   2618  O OP1   . DC  A 1 129 ? -63.956 40.036  -26.403 1.00 82.36  ? 129  DC  I OP1   1 
ATOM   2619  O OP2   . DC  A 1 129 ? -65.629 38.254  -27.391 1.00 82.36  ? 129  DC  I OP2   1 
ATOM   2620  O "O5'" . DC  A 1 129 ? -63.128 37.971  -27.389 1.00 128.82 ? 129  DC  I "O5'" 1 
ATOM   2621  C "C5'" . DC  A 1 129 ? -61.829 38.168  -26.873 1.00 128.82 ? 129  DC  I "C5'" 1 
ATOM   2622  C "C4'" . DC  A 1 129 ? -60.857 38.432  -28.004 1.00 128.82 ? 129  DC  I "C4'" 1 
ATOM   2623  O "O4'" . DC  A 1 129 ? -60.499 37.287  -28.796 1.00 128.82 ? 129  DC  I "O4'" 1 
ATOM   2624  C "C3'" . DC  A 1 129 ? -61.301 39.442  -29.034 1.00 128.82 ? 129  DC  I "C3'" 1 
ATOM   2625  O "O3'" . DC  A 1 129 ? -60.083 39.948  -29.514 1.00 128.82 ? 129  DC  I "O3'" 1 
ATOM   2626  C "C2'" . DC  A 1 129 ? -61.901 38.590  -30.146 1.00 128.82 ? 129  DC  I "C2'" 1 
ATOM   2627  C "C1'" . DC  A 1 129 ? -60.914 37.443  -30.159 1.00 128.82 ? 129  DC  I "C1'" 1 
ATOM   2628  N N1    . DC  A 1 129 ? -61.323 36.107  -30.576 1.00 82.36  ? 129  DC  I N1    1 
ATOM   2629  C C2    . DC  A 1 129 ? -60.384 35.321  -31.257 1.00 82.36  ? 129  DC  I C2    1 
ATOM   2630  O O2    . DC  A 1 129 ? -59.363 35.854  -31.728 1.00 82.36  ? 129  DC  I O2    1 
ATOM   2631  N N3    . DC  A 1 129 ? -60.613 34.015  -31.382 1.00 82.36  ? 129  DC  I N3    1 
ATOM   2632  C C4    . DC  A 1 129 ? -61.746 33.494  -30.908 1.00 82.36  ? 129  DC  I C4    1 
ATOM   2633  N N4    . DC  A 1 129 ? -61.894 32.179  -30.972 1.00 82.36  ? 129  DC  I N4    1 
ATOM   2634  C C5    . DC  A 1 129 ? -62.771 34.299  -30.328 1.00 82.36  ? 129  DC  I C5    1 
ATOM   2635  C C6    . DC  A 1 129 ? -62.524 35.590  -30.200 1.00 82.36  ? 129  DC  I C6    1 
ATOM   2636  P P     . DT  A 1 130 ? -60.091 41.124  -30.589 1.00 68.21  ? 130  DT  I P     1 
ATOM   2637  O OP1   . DT  A 1 130 ? -59.146 42.230  -30.142 1.00 66.87  ? 130  DT  I OP1   1 
ATOM   2638  O OP2   . DT  A 1 130 ? -61.493 41.417  -31.023 1.00 66.87  ? 130  DT  I OP2   1 
ATOM   2639  O "O5'" . DT  A 1 130 ? -59.435 40.455  -31.870 1.00 68.21  ? 130  DT  I "O5'" 1 
ATOM   2640  C "C5'" . DT  A 1 130 ? -58.043 40.611  -32.084 1.00 68.21  ? 130  DT  I "C5'" 1 
ATOM   2641  C "C4'" . DT  A 1 130 ? -57.638 39.956  -33.378 1.00 68.21  ? 130  DT  I "C4'" 1 
ATOM   2642  O "O4'" . DT  A 1 130 ? -58.253 38.647  -33.501 1.00 68.21  ? 130  DT  I "O4'" 1 
ATOM   2643  C "C3'" . DT  A 1 130 ? -58.017 40.697  -34.651 1.00 68.21  ? 130  DT  I "C3'" 1 
ATOM   2644  O "O3'" . DT  A 1 130 ? -56.987 40.491  -35.584 1.00 68.21  ? 130  DT  I "O3'" 1 
ATOM   2645  C "C2'" . DT  A 1 130 ? -59.223 39.943  -35.169 1.00 68.21  ? 130  DT  I "C2'" 1 
ATOM   2646  C "C1'" . DT  A 1 130 ? -58.856 38.518  -34.794 1.00 68.21  ? 130  DT  I "C1'" 1 
ATOM   2647  N N1    . DT  A 1 130 ? -59.950 37.539  -34.681 1.00 66.87  ? 130  DT  I N1    1 
ATOM   2648  C C2    . DT  A 1 130 ? -59.840 36.304  -35.287 1.00 66.87  ? 130  DT  I C2    1 
ATOM   2649  O O2    . DT  A 1 130 ? -58.907 35.986  -36.002 1.00 66.87  ? 130  DT  I O2    1 
ATOM   2650  N N3    . DT  A 1 130 ? -60.873 35.450  -35.023 1.00 66.87  ? 130  DT  I N3    1 
ATOM   2651  C C4    . DT  A 1 130 ? -61.985 35.705  -34.240 1.00 66.87  ? 130  DT  I C4    1 
ATOM   2652  O O4    . DT  A 1 130 ? -62.812 34.819  -34.064 1.00 66.87  ? 130  DT  I O4    1 
ATOM   2653  C C5    . DT  A 1 130 ? -62.048 37.044  -33.672 1.00 66.87  ? 130  DT  I C5    1 
ATOM   2654  C C7    . DT  A 1 130 ? -63.215 37.451  -32.830 1.00 66.87  ? 130  DT  I C7    1 
ATOM   2655  C C6    . DT  A 1 130 ? -61.042 37.868  -33.930 1.00 66.87  ? 130  DT  I C6    1 
ATOM   2656  P P     . DG  A 1 131 ? -56.151 41.739  -36.096 1.00 51.64  ? 131  DG  I P     1 
ATOM   2657  O OP1   . DG  A 1 131 ? -55.493 42.383  -34.898 1.00 42.56  ? 131  DG  I OP1   1 
ATOM   2658  O OP2   . DG  A 1 131 ? -57.049 42.553  -37.004 1.00 42.56  ? 131  DG  I OP2   1 
ATOM   2659  O "O5'" . DG  A 1 131 ? -55.045 41.044  -37.016 1.00 51.64  ? 131  DG  I "O5'" 1 
ATOM   2660  C "C5'" . DG  A 1 131 ? -54.313 39.926  -36.564 1.00 51.64  ? 131  DG  I "C5'" 1 
ATOM   2661  C "C4'" . DG  A 1 131 ? -53.989 39.029  -37.727 1.00 51.64  ? 131  DG  I "C4'" 1 
ATOM   2662  O "O4'" . DG  A 1 131 ? -55.120 38.196  -37.949 1.00 51.64  ? 131  DG  I "O4'" 1 
ATOM   2663  C "C3'" . DG  A 1 131 ? -53.671 39.698  -39.052 1.00 51.64  ? 131  DG  I "C3'" 1 
ATOM   2664  O "O3'" . DG  A 1 131 ? -52.560 39.033  -39.630 1.00 51.64  ? 131  DG  I "O3'" 1 
ATOM   2665  C "C2'" . DG  A 1 131 ? -54.924 39.500  -39.888 1.00 51.64  ? 131  DG  I "C2'" 1 
ATOM   2666  C "C1'" . DG  A 1 131 ? -55.667 38.353  -39.243 1.00 51.64  ? 131  DG  I "C1'" 1 
ATOM   2667  N N9    . DG  A 1 131 ? -57.098 38.537  -39.012 1.00 42.56  ? 131  DG  I N9    1 
ATOM   2668  C C8    . DG  A 1 131 ? -57.733 39.677  -38.558 1.00 42.56  ? 131  DG  I C8    1 
ATOM   2669  N N7    . DG  A 1 131 ? -58.952 39.452  -38.155 1.00 42.56  ? 131  DG  I N7    1 
ATOM   2670  C C5    . DG  A 1 131 ? -59.154 38.097  -38.418 1.00 42.56  ? 131  DG  I C5    1 
ATOM   2671  C C6    . DG  A 1 131 ? -60.249 37.224  -38.094 1.00 42.56  ? 131  DG  I C6    1 
ATOM   2672  O O6    . DG  A 1 131 ? -61.275 37.455  -37.421 1.00 42.56  ? 131  DG  I O6    1 
ATOM   2673  N N1    . DG  A 1 131 ? -60.034 35.945  -38.558 1.00 42.56  ? 131  DG  I N1    1 
ATOM   2674  C C2    . DG  A 1 131 ? -58.920 35.520  -39.165 1.00 42.56  ? 131  DG  I C2    1 
ATOM   2675  N N2    . DG  A 1 131 ? -58.942 34.257  -39.528 1.00 42.56  ? 131  DG  I N2    1 
ATOM   2676  N N3    . DG  A 1 131 ? -57.866 36.273  -39.408 1.00 42.56  ? 131  DG  I N3    1 
ATOM   2677  C C4    . DG  A 1 131 ? -58.052 37.547  -39.020 1.00 42.56  ? 131  DG  I C4    1 
ATOM   2678  P P     . DC  A 1 132 ? -52.162 39.290  -41.163 1.00 38.48  ? 132  DC  I P     1 
ATOM   2679  O OP1   . DC  A 1 132 ? -50.768 38.746  -41.218 1.00 50.63  ? 132  DC  I OP1   1 
ATOM   2680  O OP2   . DC  A 1 132 ? -52.416 40.736  -41.370 1.00 50.63  ? 132  DC  I OP2   1 
ATOM   2681  O "O5'" . DC  A 1 132 ? -53.161 38.340  -41.962 1.00 38.48  ? 132  DC  I "O5'" 1 
ATOM   2682  C "C5'" . DC  A 1 132 ? -53.385 37.067  -41.451 1.00 38.48  ? 132  DC  I "C5'" 1 
ATOM   2683  C "C4'" . DC  A 1 132 ? -54.203 36.225  -42.393 1.00 38.48  ? 132  DC  I "C4'" 1 
ATOM   2684  O "O4'" . DC  A 1 132 ? -55.591 36.290  -42.054 1.00 38.48  ? 132  DC  I "O4'" 1 
ATOM   2685  C "C3'" . DC  A 1 132 ? -54.139 36.504  -43.898 1.00 38.48  ? 132  DC  I "C3'" 1 
ATOM   2686  O "O3'" . DC  A 1 132 ? -54.455 35.255  -44.535 1.00 38.48  ? 132  DC  I "O3'" 1 
ATOM   2687  C "C2'" . DC  A 1 132 ? -55.333 37.434  -44.112 1.00 38.48  ? 132  DC  I "C2'" 1 
ATOM   2688  C "C1'" . DC  A 1 132 ? -56.343 36.777  -43.185 1.00 38.48  ? 132  DC  I "C1'" 1 
ATOM   2689  N N1    . DC  A 1 132 ? -57.444 37.591  -42.661 1.00 50.63  ? 132  DC  I N1    1 
ATOM   2690  C C2    . DC  A 1 132 ? -58.620 36.951  -42.421 1.00 50.63  ? 132  DC  I C2    1 
ATOM   2691  O O2    . DC  A 1 132 ? -58.717 35.770  -42.729 1.00 50.63  ? 132  DC  I O2    1 
ATOM   2692  N N3    . DC  A 1 132 ? -59.650 37.619  -41.879 1.00 50.63  ? 132  DC  I N3    1 
ATOM   2693  C C4    . DC  A 1 132 ? -59.550 38.920  -41.635 1.00 50.63  ? 132  DC  I C4    1 
ATOM   2694  N N4    . DC  A 1 132 ? -60.647 39.537  -41.151 1.00 50.63  ? 132  DC  I N4    1 
ATOM   2695  C C5    . DC  A 1 132 ? -58.342 39.630  -41.891 1.00 50.63  ? 132  DC  I C5    1 
ATOM   2696  C C6    . DC  A 1 132 ? -57.315 38.922  -42.397 1.00 50.63  ? 132  DC  I C6    1 
ATOM   2697  P P     . DA  A 1 133 ? -53.501 34.658  -45.682 1.00 51.14  ? 133  DA  I P     1 
ATOM   2698  O OP1   . DA  A 1 133 ? -52.316 34.119  -45.005 1.00 50.22  ? 133  DA  I OP1   1 
ATOM   2699  O OP2   . DA  A 1 133 ? -53.293 35.722  -46.700 1.00 50.22  ? 133  DA  I OP2   1 
ATOM   2700  O "O5'" . DA  A 1 133 ? -54.420 33.436  -46.224 1.00 51.14  ? 133  DA  I "O5'" 1 
ATOM   2701  C "C5'" . DA  A 1 133 ? -54.989 32.383  -45.384 1.00 51.14  ? 133  DA  I "C5'" 1 
ATOM   2702  C "C4'" . DA  A 1 133 ? -56.092 31.687  -46.151 1.00 51.14  ? 133  DA  I "C4'" 1 
ATOM   2703  O "O4'" . DA  A 1 133 ? -57.278 32.502  -45.979 1.00 51.14  ? 133  DA  I "O4'" 1 
ATOM   2704  C "C3'" . DA  A 1 133 ? -55.743 31.744  -47.652 1.00 51.14  ? 133  DA  I "C3'" 1 
ATOM   2705  O "O3'" . DA  A 1 133 ? -56.504 30.921  -48.568 1.00 51.14  ? 133  DA  I "O3'" 1 
ATOM   2706  C "C2'" . DA  A 1 133 ? -56.254 33.127  -48.027 1.00 51.14  ? 133  DA  I "C2'" 1 
ATOM   2707  C "C1'" . DA  A 1 133 ? -57.522 33.277  -47.167 1.00 51.14  ? 133  DA  I "C1'" 1 
ATOM   2708  N N9    . DA  A 1 133 ? -57.718 34.667  -46.770 1.00 50.22  ? 133  DA  I N9    1 
ATOM   2709  C C8    . DA  A 1 133 ? -56.828 35.731  -46.918 1.00 50.22  ? 133  DA  I C8    1 
ATOM   2710  N N7    . DA  A 1 133 ? -57.266 36.850  -46.418 1.00 50.22  ? 133  DA  I N7    1 
ATOM   2711  C C5    . DA  A 1 133 ? -58.535 36.508  -45.919 1.00 50.22  ? 133  DA  I C5    1 
ATOM   2712  C C6    . DA  A 1 133 ? -59.508 37.235  -45.257 1.00 50.22  ? 133  DA  I C6    1 
ATOM   2713  N N6    . DA  A 1 133 ? -59.380 38.513  -44.929 1.00 50.22  ? 133  DA  I N6    1 
ATOM   2714  N N1    . DA  A 1 133 ? -60.638 36.595  -44.918 1.00 50.22  ? 133  DA  I N1    1 
ATOM   2715  C C2    . DA  A 1 133 ? -60.781 35.314  -45.227 1.00 50.22  ? 133  DA  I C2    1 
ATOM   2716  N N3    . DA  A 1 133 ? -59.947 34.517  -45.831 1.00 50.22  ? 133  DA  I N3    1 
ATOM   2717  C C4    . DA  A 1 133 ? -58.824 35.175  -46.153 1.00 50.22  ? 133  DA  I C4    1 
ATOM   2718  P P     . DG  A 1 134 ? -56.754 29.380  -48.313 1.00 69.10  ? 134  DG  I P     1 
ATOM   2719  O OP1   . DG  A 1 134 ? -56.315 29.104  -46.951 1.00 58.99  ? 134  DG  I OP1   1 
ATOM   2720  O OP2   . DG  A 1 134 ? -56.139 28.694  -49.523 1.00 58.99  ? 134  DG  I OP2   1 
ATOM   2721  O "O5'" . DG  A 1 134 ? -58.347 29.288  -48.293 1.00 69.10  ? 134  DG  I "O5'" 1 
ATOM   2722  C "C5'" . DG  A 1 134 ? -59.033 29.328  -49.513 1.00 69.10  ? 134  DG  I "C5'" 1 
ATOM   2723  C "C4'" . DG  A 1 134 ? -60.065 30.419  -49.536 1.00 69.10  ? 134  DG  I "C4'" 1 
ATOM   2724  O "O4'" . DG  A 1 134 ? -59.565 31.748  -49.214 1.00 69.10  ? 134  DG  I "O4'" 1 
ATOM   2725  C "C3'" . DG  A 1 134 ? -60.474 30.487  -50.989 1.00 69.10  ? 134  DG  I "C3'" 1 
ATOM   2726  O "O3'" . DG  A 1 134 ? -61.858 30.424  -51.099 1.00 69.10  ? 134  DG  I "O3'" 1 
ATOM   2727  C "C2'" . DG  A 1 134 ? -59.972 31.819  -51.487 1.00 69.10  ? 134  DG  I "C2'" 1 
ATOM   2728  C "C1'" . DG  A 1 134 ? -59.967 32.670  -50.235 1.00 69.10  ? 134  DG  I "C1'" 1 
ATOM   2729  N N9    . DG  A 1 134 ? -58.974 33.747  -50.382 1.00 58.99  ? 134  DG  I N9    1 
ATOM   2730  C C8    . DG  A 1 134 ? -57.769 33.648  -51.076 1.00 58.99  ? 134  DG  I C8    1 
ATOM   2731  N N7    . DG  A 1 134 ? -57.036 34.741  -51.041 1.00 58.99  ? 134  DG  I N7    1 
ATOM   2732  C C5    . DG  A 1 134 ? -57.779 35.606  -50.286 1.00 58.99  ? 134  DG  I C5    1 
ATOM   2733  C C6    . DG  A 1 134 ? -57.467 36.861  -49.917 1.00 58.99  ? 134  DG  I C6    1 
ATOM   2734  O O6    . DG  A 1 134 ? -56.380 37.457  -50.118 1.00 58.99  ? 134  DG  I O6    1 
ATOM   2735  N N1    . DG  A 1 134 ? -58.544 37.448  -49.225 1.00 58.99  ? 134  DG  I N1    1 
ATOM   2736  C C2    . DG  A 1 134 ? -59.761 36.801  -48.926 1.00 58.99  ? 134  DG  I C2    1 
ATOM   2737  N N2    . DG  A 1 134 ? -60.673 37.497  -48.297 1.00 58.99  ? 134  DG  I N2    1 
ATOM   2738  N N3    . DG  A 1 134 ? -60.030 35.559  -49.240 1.00 58.99  ? 134  DG  I N3    1 
ATOM   2739  C C4    . DG  A 1 134 ? -59.014 35.022  -49.907 1.00 58.99  ? 134  DG  I C4    1 
ATOM   2740  P P     . DG  A 1 135 ? -62.511 29.435  -52.196 1.00 84.78  ? 135  DG  I P     1 
ATOM   2741  O OP1   . DG  A 1 135 ? -62.438 28.001  -51.695 1.00 60.16  ? 135  DG  I OP1   1 
ATOM   2742  O OP2   . DG  A 1 135 ? -61.940 29.786  -53.550 1.00 60.16  ? 135  DG  I OP2   1 
ATOM   2743  O "O5'" . DG  A 1 135 ? -64.033 29.905  -52.173 1.00 84.78  ? 135  DG  I "O5'" 1 
ATOM   2744  C "C5'" . DG  A 1 135 ? -64.478 30.798  -51.151 1.00 84.78  ? 135  DG  I "C5'" 1 
ATOM   2745  C "C4'" . DG  A 1 135 ? -65.292 31.897  -51.776 1.00 84.78  ? 135  DG  I "C4'" 1 
ATOM   2746  O "O4'" . DG  A 1 135 ? -64.794 33.203  -51.397 1.00 84.78  ? 135  DG  I "O4'" 1 
ATOM   2747  C "C3'" . DG  A 1 135 ? -65.186 31.845  -53.292 1.00 84.78  ? 135  DG  I "C3'" 1 
ATOM   2748  O "O3'" . DG  A 1 135 ? -66.412 32.278  -53.844 1.00 84.78  ? 135  DG  I "O3'" 1 
ATOM   2749  C "C2'" . DG  A 1 135 ? -64.092 32.840  -53.605 1.00 84.78  ? 135  DG  I "C2'" 1 
ATOM   2750  C "C1'" . DG  A 1 135 ? -64.400 33.906  -52.571 1.00 84.78  ? 135  DG  I "C1'" 1 
ATOM   2751  N N9    . DG  A 1 135 ? -63.244 34.729  -52.256 1.00 60.16  ? 135  DG  I N9    1 
ATOM   2752  C C8    . DG  A 1 135 ? -61.943 34.319  -52.302 1.00 60.16  ? 135  DG  I C8    1 
ATOM   2753  N N7    . DG  A 1 135 ? -61.094 35.273  -52.055 1.00 60.16  ? 135  DG  I N7    1 
ATOM   2754  C C5    . DG  A 1 135 ? -61.885 36.388  -51.808 1.00 60.16  ? 135  DG  I C5    1 
ATOM   2755  C C6    . DG  A 1 135 ? -61.513 37.720  -51.474 1.00 60.16  ? 135  DG  I C6    1 
ATOM   2756  O O6    . DG  A 1 135 ? -60.364 38.203  -51.370 1.00 60.16  ? 135  DG  I O6    1 
ATOM   2757  N N1    . DG  A 1 135 ? -62.638 38.521  -51.243 1.00 60.16  ? 135  DG  I N1    1 
ATOM   2758  C C2    . DG  A 1 135 ? -63.931 38.099  -51.313 1.00 60.16  ? 135  DG  I C2    1 
ATOM   2759  N N2    . DG  A 1 135 ? -64.813 39.005  -50.922 1.00 60.16  ? 135  DG  I N2    1 
ATOM   2760  N N3    . DG  A 1 135 ? -64.301 36.876  -51.693 1.00 60.16  ? 135  DG  I N3    1 
ATOM   2761  C C4    . DG  A 1 135 ? -63.223 36.070  -51.905 1.00 60.16  ? 135  DG  I C4    1 
ATOM   2762  P P     . DT  A 1 136 ? -66.500 32.526  -55.412 1.00 88.33  ? 136  DT  I P     1 
ATOM   2763  O OP1   . DT  A 1 136 ? -67.461 31.512  -55.950 1.00 56.33  ? 136  DT  I OP1   1 
ATOM   2764  O OP2   . DT  A 1 136 ? -65.072 32.632  -55.941 1.00 56.33  ? 136  DT  I OP2   1 
ATOM   2765  O "O5'" . DT  A 1 136 ? -67.148 33.960  -55.571 1.00 88.33  ? 136  DT  I "O5'" 1 
ATOM   2766  C "C5'" . DT  A 1 136 ? -68.153 34.400  -54.711 1.00 88.33  ? 136  DT  I "C5'" 1 
ATOM   2767  C "C4'" . DT  A 1 136 ? -68.487 35.816  -55.084 1.00 88.33  ? 136  DT  I "C4'" 1 
ATOM   2768  O "O4'" . DT  A 1 136 ? -67.481 36.703  -54.520 1.00 88.33  ? 136  DT  I "O4'" 1 
ATOM   2769  C "C3'" . DT  A 1 136 ? -68.441 35.990  -56.603 1.00 88.33  ? 136  DT  I "C3'" 1 
ATOM   2770  O "O3'" . DT  A 1 136 ? -69.583 36.709  -57.122 1.00 88.33  ? 136  DT  I "O3'" 1 
ATOM   2771  C "C2'" . DT  A 1 136 ? -67.117 36.688  -56.829 1.00 88.33  ? 136  DT  I "C2'" 1 
ATOM   2772  C "C1'" . DT  A 1 136 ? -66.931 37.490  -55.557 1.00 88.33  ? 136  DT  I "C1'" 1 
ATOM   2773  N N1    . DT  A 1 136 ? -65.502 37.705  -55.278 1.00 56.33  ? 136  DT  I N1    1 
ATOM   2774  C C2    . DT  A 1 136 ? -65.091 38.950  -54.845 1.00 56.33  ? 136  DT  I C2    1 
ATOM   2775  O O2    . DT  A 1 136 ? -65.861 39.859  -54.613 1.00 56.33  ? 136  DT  I O2    1 
ATOM   2776  N N3    . DT  A 1 136 ? -63.743 39.087  -54.668 1.00 56.33  ? 136  DT  I N3    1 
ATOM   2777  C C4    . DT  A 1 136 ? -62.782 38.112  -54.840 1.00 56.33  ? 136  DT  I C4    1 
ATOM   2778  O O4    . DT  A 1 136 ? -61.622 38.378  -54.606 1.00 56.33  ? 136  DT  I O4    1 
ATOM   2779  C C5    . DT  A 1 136 ? -63.275 36.812  -55.287 1.00 56.33  ? 136  DT  I C5    1 
ATOM   2780  C C7    . DT  A 1 136 ? -62.312 35.697  -55.525 1.00 56.33  ? 136  DT  I C7    1 
ATOM   2781  C C6    . DT  A 1 136 ? -64.593 36.680  -55.472 1.00 56.33  ? 136  DT  I C6    1 
ATOM   2782  P P     . DG  A 1 137 ? -69.515 37.382  -58.598 1.00 92.71  ? 137  DG  I P     1 
ATOM   2783  O OP1   . DG  A 1 137 ? -70.904 37.820  -58.945 1.00 69.36  ? 137  DG  I OP1   1 
ATOM   2784  O OP2   . DG  A 1 137 ? -68.739 36.532  -59.585 1.00 69.36  ? 137  DG  I OP2   1 
ATOM   2785  O "O5'" . DG  A 1 137 ? -68.632 38.667  -58.291 1.00 92.71  ? 137  DG  I "O5'" 1 
ATOM   2786  C "C5'" . DG  A 1 137 ? -69.091 39.632  -57.355 1.00 92.71  ? 137  DG  I "C5'" 1 
ATOM   2787  C "C4'" . DG  A 1 137 ? -68.895 40.997  -57.949 1.00 92.71  ? 137  DG  I "C4'" 1 
ATOM   2788  O "O4'" . DG  A 1 137 ? -67.490 41.303  -57.876 1.00 92.71  ? 137  DG  I "O4'" 1 
ATOM   2789  C "C3'" . DG  A 1 137 ? -69.229 41.006  -59.436 1.00 92.71  ? 137  DG  I "C3'" 1 
ATOM   2790  O "O3'" . DG  A 1 137 ? -69.689 42.325  -59.716 1.00 92.71  ? 137  DG  I "O3'" 1 
ATOM   2791  C "C2'" . DG  A 1 137 ? -67.916 40.619  -60.106 1.00 92.71  ? 137  DG  I "C2'" 1 
ATOM   2792  C "C1'" . DG  A 1 137 ? -66.878 41.246  -59.175 1.00 92.71  ? 137  DG  I "C1'" 1 
ATOM   2793  N N9    . DG  A 1 137 ? -65.562 40.594  -59.020 1.00 69.36  ? 137  DG  I N9    1 
ATOM   2794  C C8    . DG  A 1 137 ? -65.226 39.243  -59.161 1.00 69.36  ? 137  DG  I C8    1 
ATOM   2795  N N7    . DG  A 1 137 ? -63.980 38.974  -58.813 1.00 69.36  ? 137  DG  I N7    1 
ATOM   2796  C C5    . DG  A 1 137 ? -63.455 40.214  -58.439 1.00 69.36  ? 137  DG  I C5    1 
ATOM   2797  C C6    . DG  A 1 137 ? -62.206 40.545  -57.939 1.00 69.36  ? 137  DG  I C6    1 
ATOM   2798  O O6    . DG  A 1 137 ? -61.303 39.794  -57.675 1.00 69.36  ? 137  DG  I O6    1 
ATOM   2799  N N1    . DG  A 1 137 ? -62.073 41.924  -57.722 1.00 69.36  ? 137  DG  I N1    1 
ATOM   2800  C C2    . DG  A 1 137 ? -63.059 42.874  -57.937 1.00 69.36  ? 137  DG  I C2    1 
ATOM   2801  N N2    . DG  A 1 137 ? -62.756 44.173  -57.660 1.00 69.36  ? 137  DG  I N2    1 
ATOM   2802  N N3    . DG  A 1 137 ? -64.255 42.569  -58.387 1.00 69.36  ? 137  DG  I N3    1 
ATOM   2803  C C4    . DG  A 1 137 ? -64.393 41.232  -58.612 1.00 69.36  ? 137  DG  I C4    1 
ATOM   2804  P P     . DG  A 1 138 ? -69.627 42.931  -61.211 1.00 99.72  ? 138  DG  I P     1 
ATOM   2805  O OP1   . DG  A 1 138 ? -70.538 44.143  -61.145 1.00 46.22  ? 138  DG  I OP1   1 
ATOM   2806  O OP2   . DG  A 1 138 ? -69.779 41.902  -62.301 1.00 46.22  ? 138  DG  I OP2   1 
ATOM   2807  O "O5'" . DG  A 1 138 ? -68.159 43.515  -61.304 1.00 99.72  ? 138  DG  I "O5'" 1 
ATOM   2808  C "C5'" . DG  A 1 138 ? -67.780 44.622  -60.506 1.00 99.72  ? 138  DG  I "C5'" 1 
ATOM   2809  C "C4'" . DG  A 1 138 ? -66.605 45.287  -61.157 1.00 99.72  ? 138  DG  I "C4'" 1 
ATOM   2810  O "O4'" . DG  A 1 138 ? -65.429 44.426  -61.145 1.00 99.72  ? 138  DG  I "O4'" 1 
ATOM   2811  C "C3'" . DG  A 1 138 ? -66.903 45.511  -62.616 1.00 99.72  ? 138  DG  I "C3'" 1 
ATOM   2812  O "O3'" . DG  A 1 138 ? -66.078 46.589  -62.934 1.00 99.72  ? 138  DG  I "O3'" 1 
ATOM   2813  C "C2'" . DG  A 1 138 ? -66.420 44.220  -63.263 1.00 99.72  ? 138  DG  I "C2'" 1 
ATOM   2814  C "C1'" . DG  A 1 138 ? -65.146 43.956  -62.459 1.00 99.72  ? 138  DG  I "C1'" 1 
ATOM   2815  N N9    . DG  A 1 138 ? -64.634 42.580  -62.351 1.00 46.22  ? 138  DG  I N9    1 
ATOM   2816  C C8    . DG  A 1 138 ? -65.261 41.374  -62.704 1.00 46.22  ? 138  DG  I C8    1 
ATOM   2817  N N7    . DG  A 1 138 ? -64.526 40.304  -62.454 1.00 46.22  ? 138  DG  I N7    1 
ATOM   2818  C C5    . DG  A 1 138 ? -63.344 40.823  -61.905 1.00 46.22  ? 138  DG  I C5    1 
ATOM   2819  C C6    . DG  A 1 138 ? -62.166 40.157  -61.424 1.00 46.22  ? 138  DG  I C6    1 
ATOM   2820  O O6    . DG  A 1 138 ? -61.957 38.914  -61.296 1.00 46.22  ? 138  DG  I O6    1 
ATOM   2821  N N1    . DG  A 1 138 ? -61.189 41.079  -61.025 1.00 46.22  ? 138  DG  I N1    1 
ATOM   2822  C C2    . DG  A 1 138 ? -61.333 42.457  -61.034 1.00 46.22  ? 138  DG  I C2    1 
ATOM   2823  N N2    . DG  A 1 138 ? -60.272 43.156  -60.645 1.00 46.22  ? 138  DG  I N2    1 
ATOM   2824  N N3    . DG  A 1 138 ? -62.438 43.095  -61.411 1.00 46.22  ? 138  DG  I N3    1 
ATOM   2825  C C4    . DG  A 1 138 ? -63.390 42.227  -61.846 1.00 46.22  ? 138  DG  I C4    1 
ATOM   2826  P P     . DA  A 1 139 ? -66.083 47.170  -64.403 1.00 66.86  ? 139  DA  I P     1 
ATOM   2827  O OP1   . DA  A 1 139 ? -67.508 47.634  -64.571 1.00 56.83  ? 139  DA  I OP1   1 
ATOM   2828  O OP2   . DA  A 1 139 ? -65.493 46.142  -65.341 1.00 56.83  ? 139  DA  I OP2   1 
ATOM   2829  O "O5'" . DA  A 1 139 ? -65.045 48.378  -64.292 1.00 66.86  ? 139  DA  I "O5'" 1 
ATOM   2830  C "C5'" . DA  A 1 139 ? -64.320 48.604  -63.093 1.00 66.86  ? 139  DA  I "C5'" 1 
ATOM   2831  C "C4'" . DA  A 1 139 ? -62.864 48.297  -63.314 1.00 66.86  ? 139  DA  I "C4'" 1 
ATOM   2832  O "O4'" . DA  A 1 139 ? -62.603 46.886  -63.147 1.00 66.86  ? 139  DA  I "O4'" 1 
ATOM   2833  C "C3'" . DA  A 1 139 ? -62.330 48.682  -64.700 1.00 66.86  ? 139  DA  I "C3'" 1 
ATOM   2834  O "O3'" . DA  A 1 139 ? -61.088 49.397  -64.547 1.00 66.86  ? 139  DA  I "O3'" 1 
ATOM   2835  C "C2'" . DA  A 1 139 ? -62.103 47.339  -65.372 1.00 66.86  ? 139  DA  I "C2'" 1 
ATOM   2836  C "C1'" . DA  A 1 139 ? -61.712 46.502  -64.180 1.00 66.86  ? 139  DA  I "C1'" 1 
ATOM   2837  N N9    . DA  A 1 139 ? -61.844 45.067  -64.361 1.00 56.83  ? 139  DA  I N9    1 
ATOM   2838  C C8    . DA  A 1 139 ? -63.003 44.360  -64.614 1.00 56.83  ? 139  DA  I C8    1 
ATOM   2839  N N7    . DA  A 1 139 ? -62.826 43.055  -64.687 1.00 56.83  ? 139  DA  I N7    1 
ATOM   2840  C C5    . DA  A 1 139 ? -61.458 42.894  -64.478 1.00 56.83  ? 139  DA  I C5    1 
ATOM   2841  C C6    . DA  A 1 139 ? -60.651 41.763  -64.428 1.00 56.83  ? 139  DA  I C6    1 
ATOM   2842  N N6    . DA  A 1 139 ? -61.140 40.512  -64.511 1.00 56.83  ? 139  DA  I N6    1 
ATOM   2843  N N1    . DA  A 1 139 ? -59.315 41.951  -64.252 1.00 56.83  ? 139  DA  I N1    1 
ATOM   2844  C C2    . DA  A 1 139 ? -58.853 43.192  -64.071 1.00 56.83  ? 139  DA  I C2    1 
ATOM   2845  N N3    . DA  A 1 139 ? -59.521 44.337  -64.051 1.00 56.83  ? 139  DA  I N3    1 
ATOM   2846  C C4    . DA  A 1 139 ? -60.835 44.123  -64.281 1.00 56.83  ? 139  DA  I C4    1 
ATOM   2847  P P     . DT  A 1 140 ? -60.312 49.981  -65.854 1.00 80.51  ? 140  DT  I P     1 
ATOM   2848  O OP1   . DT  A 1 140 ? -59.603 51.294  -65.582 1.00 38.35  ? 140  DT  I OP1   1 
ATOM   2849  O OP2   . DT  A 1 140 ? -61.277 49.921  -66.984 1.00 38.35  ? 140  DT  I OP2   1 
ATOM   2850  O "O5'" . DT  A 1 140 ? -59.198 48.859  -66.124 1.00 80.51  ? 140  DT  I "O5'" 1 
ATOM   2851  C "C5'" . DT  A 1 140 ? -58.122 48.617  -65.193 1.00 80.51  ? 140  DT  I "C5'" 1 
ATOM   2852  C "C4'" . DT  A 1 140 ? -57.051 47.784  -65.861 1.00 80.51  ? 140  DT  I "C4'" 1 
ATOM   2853  O "O4'" . DT  A 1 140 ? -57.474 46.420  -65.928 1.00 80.51  ? 140  DT  I "O4'" 1 
ATOM   2854  C "C3'" . DT  A 1 140 ? -56.775 48.184  -67.317 1.00 80.51  ? 140  DT  I "C3'" 1 
ATOM   2855  O "O3'" . DT  A 1 140 ? -55.471 47.736  -67.574 1.00 80.51  ? 140  DT  I "O3'" 1 
ATOM   2856  C "C2'" . DT  A 1 140 ? -57.624 47.197  -68.124 1.00 80.51  ? 140  DT  I "C2'" 1 
ATOM   2857  C "C1'" . DT  A 1 140 ? -57.445 45.978  -67.269 1.00 80.51  ? 140  DT  I "C1'" 1 
ATOM   2858  N N1    . DT  A 1 140 ? -58.431 44.916  -67.393 1.00 38.35  ? 140  DT  I N1    1 
ATOM   2859  C C2    . DT  A 1 140 ? -57.996 43.563  -67.191 1.00 38.35  ? 140  DT  I C2    1 
ATOM   2860  O O2    . DT  A 1 140 ? -56.874 43.256  -66.777 1.00 38.35  ? 140  DT  I O2    1 
ATOM   2861  N N3    . DT  A 1 140 ? -58.966 42.596  -67.449 1.00 38.35  ? 140  DT  I N3    1 
ATOM   2862  C C4    . DT  A 1 140 ? -60.299 42.832  -67.801 1.00 38.35  ? 140  DT  I C4    1 
ATOM   2863  O O4    . DT  A 1 140 ? -61.038 41.879  -68.033 1.00 38.35  ? 140  DT  I O4    1 
ATOM   2864  C C5    . DT  A 1 140 ? -60.710 44.243  -67.877 1.00 38.35  ? 140  DT  I C5    1 
ATOM   2865  C C7    . DT  A 1 140 ? -62.143 44.552  -68.116 1.00 38.35  ? 140  DT  I C7    1 
ATOM   2866  C C6    . DT  A 1 140 ? -59.764 45.203  -67.703 1.00 38.35  ? 140  DT  I C6    1 
ATOM   2867  P P     . DA  A 1 141 ? -54.287 48.814  -67.810 1.00 66.84  ? 141  DA  I P     1 
ATOM   2868  O OP1   . DA  A 1 141 ? -54.383 50.024  -66.834 1.00 37.40  ? 141  DA  I OP1   1 
ATOM   2869  O OP2   . DA  A 1 141 ? -54.233 49.039  -69.331 1.00 37.40  ? 141  DA  I OP2   1 
ATOM   2870  O "O5'" . DA  A 1 141 ? -52.998 47.850  -67.605 1.00 66.84  ? 141  DA  I "O5'" 1 
ATOM   2871  C "C5'" . DA  A 1 141 ? -53.075 46.884  -66.572 1.00 66.84  ? 141  DA  I "C5'" 1 
ATOM   2872  C "C4'" . DA  A 1 141 ? -52.566 45.532  -67.033 1.00 66.84  ? 141  DA  I "C4'" 1 
ATOM   2873  O "O4'" . DA  A 1 141 ? -53.575 44.552  -67.330 1.00 66.84  ? 141  DA  I "O4'" 1 
ATOM   2874  C "C3'" . DA  A 1 141 ? -51.617 45.509  -68.226 1.00 66.84  ? 141  DA  I "C3'" 1 
ATOM   2875  O "O3'" . DA  A 1 141 ? -50.531 44.579  -68.044 1.00 66.84  ? 141  DA  I "O3'" 1 
ATOM   2876  C "C2'" . DA  A 1 141 ? -52.491 45.006  -69.343 1.00 66.84  ? 141  DA  I "C2'" 1 
ATOM   2877  C "C1'" . DA  A 1 141 ? -53.344 44.003  -68.618 1.00 66.84  ? 141  DA  I "C1'" 1 
ATOM   2878  N N9    . DA  A 1 141 ? -54.651 43.811  -69.251 1.00 37.40  ? 141  DA  I N9    1 
ATOM   2879  C C8    . DA  A 1 141 ? -55.555 44.789  -69.577 1.00 37.40  ? 141  DA  I C8    1 
ATOM   2880  N N7    . DA  A 1 141 ? -56.678 44.340  -70.087 1.00 37.40  ? 141  DA  I N7    1 
ATOM   2881  C C5    . DA  A 1 141 ? -56.506 42.975  -70.097 1.00 37.40  ? 141  DA  I C5    1 
ATOM   2882  C C6    . DA  A 1 141 ? -57.360 41.952  -70.478 1.00 37.40  ? 141  DA  I C6    1 
ATOM   2883  N N6    . DA  A 1 141 ? -58.634 42.198  -70.874 1.00 37.40  ? 141  DA  I N6    1 
ATOM   2884  N N1    . DA  A 1 141 ? -56.881 40.663  -70.428 1.00 37.40  ? 141  DA  I N1    1 
ATOM   2885  C C2    . DA  A 1 141 ? -55.603 40.479  -69.992 1.00 37.40  ? 141  DA  I C2    1 
ATOM   2886  N N3    . DA  A 1 141 ? -54.723 41.378  -69.557 1.00 37.40  ? 141  DA  I N3    1 
ATOM   2887  C C4    . DA  A 1 141 ? -55.247 42.624  -69.632 1.00 37.40  ? 141  DA  I C4    1 
ATOM   2888  P P     . DT  A 1 142 ? -49.284 44.584  -69.094 1.00 52.34  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 142 ? -47.997 44.922  -68.512 1.00 53.01  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 142 ? -49.706 45.249  -70.346 1.00 53.01  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 142 ? -49.169 43.066  -69.435 1.00 52.34  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 142 ? -49.867 42.154  -68.667 1.00 52.34  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 142 ? -49.877 40.847  -69.406 1.00 52.34  ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 142 ? -51.190 40.623  -69.952 1.00 52.34  ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 142 ? -48.888 40.700  -70.578 1.00 52.34  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 142 ? -48.278 39.413  -70.421 1.00 52.34  ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 142 ? -49.778 40.786  -71.825 1.00 52.34  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 142 ? -51.084 40.214  -71.308 1.00 52.34  ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 142 ? -52.318 40.657  -71.934 1.00 53.01  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 142 ? -53.325 39.708  -72.198 1.00 53.01  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 142 ? -53.245 38.504  -71.913 1.00 53.01  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 142 ? -54.446 40.240  -72.776 1.00 53.01  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 142 ? -54.681 41.574  -73.056 1.00 53.01  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 142 ? -55.745 41.899  -73.552 1.00 53.01  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 142 ? -53.623 42.490  -72.720 1.00 53.01  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 142 ? -53.841 43.941  -72.923 1.00 53.01  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 142 ? -52.497 41.992  -72.213 1.00 53.01  ? 142  DT  I C6    1 
ATOM   2908  P P     . DT  A 1 143 ? -47.128 38.927  -71.419 1.00 49.54  ? 143  DT  I P     1 
ATOM   2909  O OP1   . DT  A 1 143 ? -46.435 37.919  -70.593 1.00 48.45  ? 143  DT  I OP1   1 
ATOM   2910  O OP2   . DT  A 1 143 ? -46.385 40.153  -71.867 1.00 48.45  ? 143  DT  I OP2   1 
ATOM   2911  O "O5'" . DT  A 1 143 ? -47.960 38.141  -72.540 1.00 49.54  ? 143  DT  I "O5'" 1 
ATOM   2912  C "C5'" . DT  A 1 143 ? -48.675 37.020  -72.061 1.00 49.54  ? 143  DT  I "C5'" 1 
ATOM   2913  C "C4'" . DT  A 1 143 ? -49.551 36.373  -73.101 1.00 49.54  ? 143  DT  I "C4'" 1 
ATOM   2914  O "O4'" . DT  A 1 143 ? -50.581 37.304  -73.459 1.00 49.54  ? 143  DT  I "O4'" 1 
ATOM   2915  C "C3'" . DT  A 1 143 ? -48.864 35.967  -74.397 1.00 49.54  ? 143  DT  I "C3'" 1 
ATOM   2916  O "O3'" . DT  A 1 143 ? -49.169 34.610  -74.753 1.00 49.54  ? 143  DT  I "O3'" 1 
ATOM   2917  C "C2'" . DT  A 1 143 ? -49.423 36.945  -75.409 1.00 49.54  ? 143  DT  I "C2'" 1 
ATOM   2918  C "C1'" . DT  A 1 143 ? -50.807 37.193  -74.834 1.00 49.54  ? 143  DT  I "C1'" 1 
ATOM   2919  N N1    . DT  A 1 143 ? -51.490 38.426  -75.265 1.00 48.45  ? 143  DT  I N1    1 
ATOM   2920  C C2    . DT  A 1 143 ? -52.758 38.338  -75.810 1.00 48.45  ? 143  DT  I C2    1 
ATOM   2921  O O2    . DT  A 1 143 ? -53.306 37.281  -76.055 1.00 48.45  ? 143  DT  I O2    1 
ATOM   2922  N N3    . DT  A 1 143 ? -53.343 39.551  -76.069 1.00 48.45  ? 143  DT  I N3    1 
ATOM   2923  C C4    . DT  A 1 143 ? -52.779 40.804  -75.861 1.00 48.45  ? 143  DT  I C4    1 
ATOM   2924  O O4    . DT  A 1 143 ? -53.417 41.807  -76.050 1.00 48.45  ? 143  DT  I O4    1 
ATOM   2925  C C5    . DT  A 1 143 ? -51.447 40.818  -75.390 1.00 48.45  ? 143  DT  I C5    1 
ATOM   2926  C C7    . DT  A 1 143 ? -50.766 42.129  -75.249 1.00 48.45  ? 143  DT  I C7    1 
ATOM   2927  C C6    . DT  A 1 143 ? -50.871 39.648  -75.098 1.00 48.45  ? 143  DT  I C6    1 
ATOM   2928  P P     . DG  A 1 144 ? -48.339 33.915  -75.959 1.00 46.99  ? 144  DG  I P     1 
ATOM   2929  O OP1   . DG  A 1 144 ? -48.171 32.452  -75.703 1.00 40.93  ? 144  DG  I OP1   1 
ATOM   2930  O OP2   . DG  A 1 144 ? -47.210 34.772  -76.383 1.00 40.93  ? 144  DG  I OP2   1 
ATOM   2931  O "O5'" . DG  A 1 144 ? -49.354 33.975  -77.156 1.00 46.99  ? 144  DG  I "O5'" 1 
ATOM   2932  C "C5'" . DG  A 1 144 ? -50.488 33.109  -77.123 1.00 46.99  ? 144  DG  I "C5'" 1 
ATOM   2933  C "C4'" . DG  A 1 144 ? -51.369 33.381  -78.318 1.00 46.99  ? 144  DG  I "C4'" 1 
ATOM   2934  O "O4'" . DG  A 1 144 ? -51.871 34.748  -78.242 1.00 46.99  ? 144  DG  I "O4'" 1 
ATOM   2935  C "C3'" . DG  A 1 144 ? -50.592 33.294  -79.626 1.00 46.99  ? 144  DG  I "C3'" 1 
ATOM   2936  O "O3'" . DG  A 1 144 ? -51.450 32.690  -80.563 1.00 46.99  ? 144  DG  I "O3'" 1 
ATOM   2937  C "C2'" . DG  A 1 144 ? -50.306 34.750  -79.979 1.00 46.99  ? 144  DG  I "C2'" 1 
ATOM   2938  C "C1'" . DG  A 1 144 ? -51.549 35.422  -79.447 1.00 46.99  ? 144  DG  I "C1'" 1 
ATOM   2939  N N9    . DG  A 1 144 ? -51.523 36.867  -79.219 1.00 40.93  ? 144  DG  I N9    1 
ATOM   2940  C C8    . DG  A 1 144 ? -50.474 37.648  -78.791 1.00 40.93  ? 144  DG  I C8    1 
ATOM   2941  N N7    . DG  A 1 144 ? -50.756 38.942  -78.750 1.00 40.93  ? 144  DG  I N7    1 
ATOM   2942  C C5    . DG  A 1 144 ? -52.090 39.016  -79.169 1.00 40.93  ? 144  DG  I C5    1 
ATOM   2943  C C6    . DG  A 1 144 ? -52.964 40.162  -79.350 1.00 40.93  ? 144  DG  I C6    1 
ATOM   2944  O O6    . DG  A 1 144 ? -52.681 41.374  -79.183 1.00 40.93  ? 144  DG  I O6    1 
ATOM   2945  N N1    . DG  A 1 144 ? -54.261 39.770  -79.770 1.00 40.93  ? 144  DG  I N1    1 
ATOM   2946  C C2    . DG  A 1 144 ? -54.662 38.436  -79.992 1.00 40.93  ? 144  DG  I C2    1 
ATOM   2947  N N2    . DG  A 1 144 ? -55.969 38.211  -80.329 1.00 40.93  ? 144  DG  I N2    1 
ATOM   2948  N N3    . DG  A 1 144 ? -53.837 37.382  -79.869 1.00 40.93  ? 144  DG  I N3    1 
ATOM   2949  C C4    . DG  A 1 144 ? -52.585 37.741  -79.449 1.00 40.93  ? 144  DG  I C4    1 
ATOM   2950  P P     . DA  A 1 145 ? -50.915 32.324  -82.053 1.00 91.10  ? 145  DA  I P     1 
ATOM   2951  O OP1   . DA  A 1 145 ? -50.954 30.811  -82.149 1.00 49.78  ? 145  DA  I OP1   1 
ATOM   2952  O OP2   . DA  A 1 145 ? -49.678 33.073  -82.508 1.00 49.78  ? 145  DA  I OP2   1 
ATOM   2953  O "O5'" . DA  A 1 145 ? -52.130 32.870  -82.912 1.00 91.10  ? 145  DA  I "O5'" 1 
ATOM   2954  C "C5'" . DA  A 1 145 ? -53.447 32.427  -82.616 1.00 91.10  ? 145  DA  I "C5'" 1 
ATOM   2955  C "C4'" . DA  A 1 145 ? -54.411 33.178  -83.484 1.00 91.10  ? 145  DA  I "C4'" 1 
ATOM   2956  O "O4'" . DA  A 1 145 ? -54.451 34.511  -82.931 1.00 91.10  ? 145  DA  I "O4'" 1 
ATOM   2957  C "C3'" . DA  A 1 145 ? -53.849 33.307  -84.905 1.00 91.10  ? 145  DA  I "C3'" 1 
ATOM   2958  O "O3'" . DA  A 1 145 ? -54.859 33.230  -85.934 1.00 91.10  ? 145  DA  I "O3'" 1 
ATOM   2959  C "C2'" . DA  A 1 145 ? -53.201 34.662  -84.874 1.00 91.10  ? 145  DA  I "C2'" 1 
ATOM   2960  C "C1'" . DA  A 1 145 ? -54.121 35.411  -83.945 1.00 91.10  ? 145  DA  I "C1'" 1 
ATOM   2961  N N9    . DA  A 1 145 ? -53.364 36.504  -83.377 1.00 49.78  ? 145  DA  I N9    1 
ATOM   2962  C C8    . DA  A 1 145 ? -52.055 36.435  -83.026 1.00 49.78  ? 145  DA  I C8    1 
ATOM   2963  N N7    . DA  A 1 145 ? -51.522 37.604  -82.718 1.00 49.78  ? 145  DA  I N7    1 
ATOM   2964  C C5    . DA  A 1 145 ? -52.573 38.487  -82.839 1.00 49.78  ? 145  DA  I C5    1 
ATOM   2965  C C6    . DA  A 1 145 ? -52.646 39.857  -82.676 1.00 49.78  ? 145  DA  I C6    1 
ATOM   2966  N N6    . DA  A 1 145 ? -51.576 40.629  -82.429 1.00 49.78  ? 145  DA  I N6    1 
ATOM   2967  N N1    . DA  A 1 145 ? -53.860 40.435  -82.813 1.00 49.78  ? 145  DA  I N1    1 
ATOM   2968  C C2    . DA  A 1 145 ? -54.894 39.675  -83.167 1.00 49.78  ? 145  DA  I C2    1 
ATOM   2969  N N3    . DA  A 1 145 ? -54.935 38.376  -83.403 1.00 49.78  ? 145  DA  I N3    1 
ATOM   2970  C C4    . DA  A 1 145 ? -53.727 37.824  -83.204 1.00 49.78  ? 145  DA  I C4    1 
ATOM   2971  P P     . DT  A 1 146 ? -54.436 33.271  -87.518 1.00 93.10  ? 146  DT  I P     1 
ATOM   2972  O OP1   . DT  A 1 146 ? -54.190 31.868  -88.024 1.00 55.42  ? 146  DT  I OP1   1 
ATOM   2973  O OP2   . DT  A 1 146 ? -53.391 34.336  -87.756 1.00 55.42  ? 146  DT  I OP2   1 
ATOM   2974  O "O5'" . DT  A 1 146 ? -55.761 33.848  -88.186 1.00 93.10  ? 146  DT  I "O5'" 1 
ATOM   2975  C "C5'" . DT  A 1 146 ? -56.636 34.661  -87.419 1.00 93.10  ? 146  DT  I "C5'" 1 
ATOM   2976  C "C4'" . DT  A 1 146 ? -56.554 36.102  -87.867 1.00 93.10  ? 146  DT  I "C4'" 1 
ATOM   2977  O "O4'" . DT  A 1 146 ? -55.719 36.912  -86.997 1.00 93.10  ? 146  DT  I "O4'" 1 
ATOM   2978  C "C3'" . DT  A 1 146 ? -56.067 36.335  -89.306 1.00 93.10  ? 146  DT  I "C3'" 1 
ATOM   2979  O "O3'" . DT  A 1 146 ? -57.045 36.915  -90.221 1.00 93.10  ? 146  DT  I "O3'" 1 
ATOM   2980  C "C2'" . DT  A 1 146 ? -54.828 37.199  -89.134 1.00 93.10  ? 146  DT  I "C2'" 1 
ATOM   2981  C "C1'" . DT  A 1 146 ? -55.108 37.900  -87.811 1.00 93.10  ? 146  DT  I "C1'" 1 
ATOM   2982  N N1    . DT  A 1 146 ? -53.866 38.361  -87.154 1.00 55.42  ? 146  DT  I N1    1 
ATOM   2983  C C2    . DT  A 1 146 ? -53.736 39.704  -86.798 1.00 55.42  ? 146  DT  I C2    1 
ATOM   2984  O O2    . DT  A 1 146 ? -54.643 40.526  -86.871 1.00 55.42  ? 146  DT  I O2    1 
ATOM   2985  N N3    . DT  A 1 146 ? -52.495 40.043  -86.317 1.00 55.42  ? 146  DT  I N3    1 
ATOM   2986  C C4    . DT  A 1 146 ? -51.406 39.208  -86.095 1.00 55.42  ? 146  DT  I C4    1 
ATOM   2987  O O4    . DT  A 1 146 ? -50.342 39.690  -85.667 1.00 55.42  ? 146  DT  I O4    1 
ATOM   2988  C C5    . DT  A 1 146 ? -51.626 37.807  -86.410 1.00 55.42  ? 146  DT  I C5    1 
ATOM   2989  C C7    . DT  A 1 146 ? -50.538 36.811  -86.143 1.00 55.42  ? 146  DT  I C7    1 
ATOM   2990  C C6    . DT  A 1 146 ? -52.826 37.463  -86.933 1.00 55.42  ? 146  DT  I C6    1 
ATOM   2991  O "O5'" . DA  B 1 1   ? -50.624 49.629  -84.839 1.00 89.34  ? 147  DA  J "O5'" 1 
ATOM   2992  C "C5'" . DA  B 1 1   ? -51.354 50.763  -85.316 1.00 89.34  ? 147  DA  J "C5'" 1 
ATOM   2993  C "C4'" . DA  B 1 1   ? -52.686 50.239  -85.788 1.00 89.34  ? 147  DA  J "C4'" 1 
ATOM   2994  O "O4'" . DA  B 1 1   ? -52.389 48.989  -86.483 1.00 89.34  ? 147  DA  J "O4'" 1 
ATOM   2995  C "C3'" . DA  B 1 1   ? -53.655 49.899  -84.642 1.00 89.34  ? 147  DA  J "C3'" 1 
ATOM   2996  O "O3'" . DA  B 1 1   ? -55.051 50.197  -84.895 1.00 89.34  ? 147  DA  J "O3'" 1 
ATOM   2997  C "C2'" . DA  B 1 1   ? -53.498 48.399  -84.484 1.00 89.34  ? 147  DA  J "C2'" 1 
ATOM   2998  C "C1'" . DA  B 1 1   ? -53.081 47.901  -85.876 1.00 89.34  ? 147  DA  J "C1'" 1 
ATOM   2999  N N9    . DA  B 1 1   ? -52.178 46.738  -85.795 1.00 45.84  ? 147  DA  J N9    1 
ATOM   3000  C C8    . DA  B 1 1   ? -50.856 46.730  -85.355 1.00 45.84  ? 147  DA  J C8    1 
ATOM   3001  N N7    . DA  B 1 1   ? -50.330 45.513  -85.254 1.00 45.84  ? 147  DA  J N7    1 
ATOM   3002  C C5    . DA  B 1 1   ? -51.346 44.663  -85.677 1.00 45.84  ? 147  DA  J C5    1 
ATOM   3003  C C6    . DA  B 1 1   ? -51.425 43.249  -85.764 1.00 45.84  ? 147  DA  J C6    1 
ATOM   3004  N N6    . DA  B 1 1   ? -50.431 42.433  -85.364 1.00 45.84  ? 147  DA  J N6    1 
ATOM   3005  N N1    . DA  B 1 1   ? -52.579 42.700  -86.248 1.00 45.84  ? 147  DA  J N1    1 
ATOM   3006  C C2    . DA  B 1 1   ? -53.592 43.528  -86.594 1.00 45.84  ? 147  DA  J C2    1 
ATOM   3007  N N3    . DA  B 1 1   ? -53.653 44.891  -86.532 1.00 45.84  ? 147  DA  J N3    1 
ATOM   3008  C C4    . DA  B 1 1   ? -52.487 45.403  -86.056 1.00 45.84  ? 147  DA  J C4    1 
ATOM   3009  P P     . DT  B 1 2   ? -56.169 49.544  -83.932 1.00 115.83 ? 148  DT  J P     1 
ATOM   3010  O OP1   . DT  B 1 2   ? -57.546 50.095  -84.022 1.00 71.75  ? 148  DT  J OP1   1 
ATOM   3011  O OP2   . DT  B 1 2   ? -55.503 49.470  -82.637 1.00 71.75  ? 148  DT  J OP2   1 
ATOM   3012  O "O5'" . DT  B 1 2   ? -56.300 48.075  -84.498 1.00 115.83 ? 148  DT  J "O5'" 1 
ATOM   3013  C "C5'" . DT  B 1 2   ? -56.882 47.877  -85.781 1.00 115.83 ? 148  DT  J "C5'" 1 
ATOM   3014  C "C4'" . DT  B 1 2   ? -57.875 46.737  -85.740 1.00 115.83 ? 148  DT  J "C4'" 1 
ATOM   3015  O "O4'" . DT  B 1 2   ? -57.172 45.485  -85.609 1.00 115.83 ? 148  DT  J "O4'" 1 
ATOM   3016  C "C3'" . DT  B 1 2   ? -58.835 46.772  -84.558 1.00 115.83 ? 148  DT  J "C3'" 1 
ATOM   3017  O "O3'" . DT  B 1 2   ? -60.043 46.083  -84.928 1.00 115.83 ? 148  DT  J "O3'" 1 
ATOM   3018  C "C2'" . DT  B 1 2   ? -58.065 46.020  -83.483 1.00 115.83 ? 148  DT  J "C2'" 1 
ATOM   3019  C "C1'" . DT  B 1 2   ? -57.330 44.959  -84.291 1.00 115.83 ? 148  DT  J "C1'" 1 
ATOM   3020  N N1    . DT  B 1 2   ? -55.982 44.606  -83.807 1.00 71.75  ? 148  DT  J N1    1 
ATOM   3021  C C2    . DT  B 1 2   ? -55.595 43.278  -83.910 1.00 71.75  ? 148  DT  J C2    1 
ATOM   3022  O O2    . DT  B 1 2   ? -56.319 42.407  -84.374 1.00 71.75  ? 148  DT  J O2    1 
ATOM   3023  N N3    . DT  B 1 2   ? -54.310 43.018  -83.483 1.00 71.75  ? 148  DT  J N3    1 
ATOM   3024  C C4    . DT  B 1 2   ? -53.379 43.939  -83.013 1.00 71.75  ? 148  DT  J C4    1 
ATOM   3025  O O4    . DT  B 1 2   ? -52.244 43.576  -82.706 1.00 71.75  ? 148  DT  J O4    1 
ATOM   3026  C C5    . DT  B 1 2   ? -53.844 45.305  -82.937 1.00 71.75  ? 148  DT  J C5    1 
ATOM   3027  C C7    . DT  B 1 2   ? -52.885 46.350  -82.465 1.00 71.75  ? 148  DT  J C7    1 
ATOM   3028  C C6    . DT  B 1 2   ? -55.115 45.569  -83.309 1.00 71.75  ? 148  DT  J C6    1 
ATOM   3029  P P     . DC  B 1 3   ? -61.392 46.292  -84.066 1.00 129.97 ? 149  DC  J P     1 
ATOM   3030  O OP1   . DC  B 1 3   ? -62.435 45.375  -84.633 1.00 63.20  ? 149  DC  J OP1   1 
ATOM   3031  O OP2   . DC  B 1 3   ? -61.684 47.746  -84.029 1.00 63.20  ? 149  DC  J OP2   1 
ATOM   3032  O "O5'" . DC  B 1 3   ? -60.945 45.807  -82.607 1.00 129.97 ? 149  DC  J "O5'" 1 
ATOM   3033  C "C5'" . DC  B 1 3   ? -61.898 45.344  -81.635 1.00 129.97 ? 149  DC  J "C5'" 1 
ATOM   3034  C "C4'" . DC  B 1 3   ? -62.206 43.880  -81.856 1.00 129.97 ? 149  DC  J "C4'" 1 
ATOM   3035  O "O4'" . DC  B 1 3   ? -61.021 43.267  -82.441 1.00 129.97 ? 149  DC  J "O4'" 1 
ATOM   3036  C "C3'" . DC  B 1 3   ? -62.553 43.087  -80.586 1.00 129.97 ? 149  DC  J "C3'" 1 
ATOM   3037  O "O3'" . DC  B 1 3   ? -63.711 42.248  -80.717 1.00 129.97 ? 149  DC  J "O3'" 1 
ATOM   3038  C "C2'" . DC  B 1 3   ? -61.301 42.283  -80.298 1.00 129.97 ? 149  DC  J "C2'" 1 
ATOM   3039  C "C1'" . DC  B 1 3   ? -60.506 42.231  -81.615 1.00 129.97 ? 149  DC  J "C1'" 1 
ATOM   3040  N N1    . DC  B 1 3   ? -59.064 42.495  -81.339 1.00 63.20  ? 149  DC  J N1    1 
ATOM   3041  C C2    . DC  B 1 3   ? -58.152 41.391  -81.265 1.00 63.20  ? 149  DC  J C2    1 
ATOM   3042  O O2    . DC  B 1 3   ? -58.545 40.255  -81.638 1.00 63.20  ? 149  DC  J O2    1 
ATOM   3043  N N3    . DC  B 1 3   ? -56.876 41.612  -80.779 1.00 63.20  ? 149  DC  J N3    1 
ATOM   3044  C C4    . DC  B 1 3   ? -56.504 42.855  -80.415 1.00 63.20  ? 149  DC  J C4    1 
ATOM   3045  N N4    . DC  B 1 3   ? -55.291 43.024  -79.887 1.00 63.20  ? 149  DC  J N4    1 
ATOM   3046  C C5    . DC  B 1 3   ? -57.373 43.989  -80.568 1.00 63.20  ? 149  DC  J C5    1 
ATOM   3047  C C6    . DC  B 1 3   ? -58.622 43.767  -81.045 1.00 63.20  ? 149  DC  J C6    1 
ATOM   3048  P P     . DA  B 1 4   ? -63.638 40.939  -81.648 1.00 80.88  ? 150  DA  J P     1 
ATOM   3049  O OP1   . DA  B 1 4   ? -62.944 41.420  -82.929 1.00 49.10  ? 150  DA  J OP1   1 
ATOM   3050  O OP2   . DA  B 1 4   ? -64.937 40.202  -81.742 1.00 49.10  ? 150  DA  J OP2   1 
ATOM   3051  O "O5'" . DA  B 1 4   ? -62.747 39.883  -80.850 1.00 80.88  ? 150  DA  J "O5'" 1 
ATOM   3052  C "C5'" . DA  B 1 4   ? -62.337 38.683  -81.524 1.00 80.88  ? 150  DA  J "C5'" 1 
ATOM   3053  C "C4'" . DA  B 1 4   ? -61.768 37.680  -80.556 1.00 80.88  ? 150  DA  J "C4'" 1 
ATOM   3054  O "O4'" . DA  B 1 4   ? -60.553 38.180  -79.988 1.00 80.88  ? 150  DA  J "O4'" 1 
ATOM   3055  C "C3'" . DA  B 1 4   ? -62.664 37.397  -79.377 1.00 80.88  ? 150  DA  J "C3'" 1 
ATOM   3056  O "O3'" . DA  B 1 4   ? -62.457 36.046  -79.077 1.00 80.88  ? 150  DA  J "O3'" 1 
ATOM   3057  C "C2'" . DA  B 1 4   ? -62.141 38.299  -78.270 1.00 80.88  ? 150  DA  J "C2'" 1 
ATOM   3058  C "C1'" . DA  B 1 4   ? -60.662 38.251  -78.567 1.00 80.88  ? 150  DA  J "C1'" 1 
ATOM   3059  N N9    . DA  B 1 4   ? -59.814 39.369  -78.133 1.00 49.10  ? 150  DA  J N9    1 
ATOM   3060  C C8    . DA  B 1 4   ? -60.059 40.719  -78.059 1.00 49.10  ? 150  DA  J C8    1 
ATOM   3061  N N7    . DA  B 1 4   ? -59.005 41.435  -77.757 1.00 49.10  ? 150  DA  J N7    1 
ATOM   3062  C C5    . DA  B 1 4   ? -57.996 40.484  -77.588 1.00 49.10  ? 150  DA  J C5    1 
ATOM   3063  C C6    . DA  B 1 4   ? -56.636 40.590  -77.290 1.00 49.10  ? 150  DA  J C6    1 
ATOM   3064  N N6    . DA  B 1 4   ? -56.033 41.734  -77.079 1.00 49.10  ? 150  DA  J N6    1 
ATOM   3065  N N1    . DA  B 1 4   ? -55.915 39.459  -77.215 1.00 49.10  ? 150  DA  J N1    1 
ATOM   3066  C C2    . DA  B 1 4   ? -56.529 38.286  -77.393 1.00 49.10  ? 150  DA  J C2    1 
ATOM   3067  N N3    . DA  B 1 4   ? -57.793 38.045  -77.658 1.00 49.10  ? 150  DA  J N3    1 
ATOM   3068  C C4    . DA  B 1 4   ? -58.489 39.209  -77.768 1.00 49.10  ? 150  DA  J C4    1 
ATOM   3069  P P     . DA  B 1 5   ? -63.277 35.401  -77.873 1.00 69.59  ? 151  DA  J P     1 
ATOM   3070  O OP1   . DA  B 1 5   ? -64.129 34.264  -78.388 1.00 42.06  ? 151  DA  J OP1   1 
ATOM   3071  O OP2   . DA  B 1 5   ? -63.885 36.594  -77.207 1.00 42.06  ? 151  DA  J OP2   1 
ATOM   3072  O "O5'" . DA  B 1 5   ? -62.152 34.779  -76.950 1.00 69.59  ? 151  DA  J "O5'" 1 
ATOM   3073  C "C5'" . DA  B 1 5   ? -61.273 33.801  -77.505 1.00 69.59  ? 151  DA  J "C5'" 1 
ATOM   3074  C "C4'" . DA  B 1 5   ? -60.171 33.478  -76.528 1.00 69.59  ? 151  DA  J "C4'" 1 
ATOM   3075  O "O4'" . DA  B 1 5   ? -59.421 34.679  -76.209 1.00 69.59  ? 151  DA  J "O4'" 1 
ATOM   3076  C "C3'" . DA  B 1 5   ? -60.633 32.911  -75.190 1.00 69.59  ? 151  DA  J "C3'" 1 
ATOM   3077  O "O3'" . DA  B 1 5   ? -59.756 31.797  -74.933 1.00 69.59  ? 151  DA  J "O3'" 1 
ATOM   3078  C "C2'" . DA  B 1 5   ? -60.549 34.106  -74.235 1.00 69.59  ? 151  DA  J "C2'" 1 
ATOM   3079  C "C1'" . DA  B 1 5   ? -59.388 34.896  -74.826 1.00 69.59  ? 151  DA  J "C1'" 1 
ATOM   3080  N N9    . DA  B 1 5   ? -59.345 36.345  -74.652 1.00 42.06  ? 151  DA  J N9    1 
ATOM   3081  C C8    . DA  B 1 5   ? -60.347 37.256  -74.873 1.00 42.06  ? 151  DA  J C8    1 
ATOM   3082  N N7    . DA  B 1 5   ? -59.967 38.519  -74.711 1.00 42.06  ? 151  DA  J N7    1 
ATOM   3083  C C5    . DA  B 1 5   ? -58.621 38.427  -74.364 1.00 42.06  ? 151  DA  J C5    1 
ATOM   3084  C C6    . DA  B 1 5   ? -57.645 39.391  -74.100 1.00 42.06  ? 151  DA  J C6    1 
ATOM   3085  N N6    . DA  B 1 5   ? -57.842 40.699  -74.227 1.00 42.06  ? 151  DA  J N6    1 
ATOM   3086  N N1    . DA  B 1 5   ? -56.435 38.969  -73.712 1.00 42.06  ? 151  DA  J N1    1 
ATOM   3087  C C2    . DA  B 1 5   ? -56.209 37.683  -73.617 1.00 42.06  ? 151  DA  J C2    1 
ATOM   3088  N N3    . DA  B 1 5   ? -57.013 36.667  -73.872 1.00 42.06  ? 151  DA  J N3    1 
ATOM   3089  C C4    . DA  B 1 5   ? -58.231 37.103  -74.264 1.00 42.06  ? 151  DA  J C4    1 
ATOM   3090  P P     . DT  B 1 6   ? -60.095 30.779  -73.743 1.00 54.51  ? 152  DT  J P     1 
ATOM   3091  O OP1   . DT  B 1 6   ? -59.682 29.320  -73.995 1.00 49.04  ? 152  DT  J OP1   1 
ATOM   3092  O OP2   . DT  B 1 6   ? -61.516 31.113  -73.336 1.00 49.04  ? 152  DT  J OP2   1 
ATOM   3093  O "O5'" . DT  B 1 6   ? -59.124 31.336  -72.635 1.00 54.51  ? 152  DT  J "O5'" 1 
ATOM   3094  C "C5'" . DT  B 1 6   ? -58.879 32.714  -72.589 1.00 54.51  ? 152  DT  J "C5'" 1 
ATOM   3095  C "C4'" . DT  B 1 6   ? -57.672 32.975  -71.741 1.00 54.51  ? 152  DT  J "C4'" 1 
ATOM   3096  O "O4'" . DT  B 1 6   ? -57.397 34.385  -71.848 1.00 54.51  ? 152  DT  J "O4'" 1 
ATOM   3097  C "C3'" . DT  B 1 6   ? -57.904 32.658  -70.260 1.00 54.51  ? 152  DT  J "C3'" 1 
ATOM   3098  O "O3'" . DT  B 1 6   ? -56.747 31.976  -69.746 1.00 54.51  ? 152  DT  J "O3'" 1 
ATOM   3099  C "C2'" . DT  B 1 6   ? -58.242 34.003  -69.662 1.00 54.51  ? 152  DT  J "C2'" 1 
ATOM   3100  C "C1'" . DT  B 1 6   ? -57.505 34.982  -70.577 1.00 54.51  ? 152  DT  J "C1'" 1 
ATOM   3101  N N1    . DT  B 1 6   ? -58.208 36.228  -70.771 1.00 49.04  ? 152  DT  J N1    1 
ATOM   3102  C C2    . DT  B 1 6   ? -57.504 37.401  -70.643 1.00 49.04  ? 152  DT  J C2    1 
ATOM   3103  O O2    . DT  B 1 6   ? -56.345 37.420  -70.302 1.00 49.04  ? 152  DT  J O2    1 
ATOM   3104  N N3    . DT  B 1 6   ? -58.212 38.543  -70.891 1.00 49.04  ? 152  DT  J N3    1 
ATOM   3105  C C4    . DT  B 1 6   ? -59.551 38.615  -71.204 1.00 49.04  ? 152  DT  J C4    1 
ATOM   3106  O O4    . DT  B 1 6   ? -60.085 39.704  -71.368 1.00 49.04  ? 152  DT  J O4    1 
ATOM   3107  C C5    . DT  B 1 6   ? -60.246 37.318  -71.293 1.00 49.04  ? 152  DT  J C5    1 
ATOM   3108  C C7    . DT  B 1 6   ? -61.710 37.275  -71.611 1.00 49.04  ? 152  DT  J C7    1 
ATOM   3109  C C6    . DT  B 1 6   ? -59.535 36.211  -71.077 1.00 49.04  ? 152  DT  J C6    1 
ATOM   3110  P P     . DA  B 1 7   ? -56.612 31.587  -68.176 1.00 41.35  ? 153  DA  J P     1 
ATOM   3111  O OP1   . DA  B 1 7   ? -55.740 30.335  -68.244 1.00 31.38  ? 153  DA  J OP1   1 
ATOM   3112  O OP2   . DA  B 1 7   ? -57.924 31.506  -67.441 1.00 31.38  ? 153  DA  J OP2   1 
ATOM   3113  O "O5'" . DA  B 1 7   ? -55.700 32.800  -67.702 1.00 41.35  ? 153  DA  J "O5'" 1 
ATOM   3114  C "C5'" . DA  B 1 7   ? -54.462 32.930  -68.345 1.00 41.35  ? 153  DA  J "C5'" 1 
ATOM   3115  C "C4'" . DA  B 1 7   ? -53.759 34.150  -67.862 1.00 41.35  ? 153  DA  J "C4'" 1 
ATOM   3116  O "O4'" . DA  B 1 7   ? -54.661 35.240  -68.106 1.00 41.35  ? 153  DA  J "O4'" 1 
ATOM   3117  C "C3'" . DA  B 1 7   ? -53.521 34.116  -66.368 1.00 41.35  ? 153  DA  J "C3'" 1 
ATOM   3118  O "O3'" . DA  B 1 7   ? -52.255 34.679  -66.068 1.00 41.35  ? 153  DA  J "O3'" 1 
ATOM   3119  C "C2'" . DA  B 1 7   ? -54.629 34.984  -65.821 1.00 41.35  ? 153  DA  J "C2'" 1 
ATOM   3120  C "C1'" . DA  B 1 7   ? -54.846 35.980  -66.925 1.00 41.35  ? 153  DA  J "C1'" 1 
ATOM   3121  N N9    . DA  B 1 7   ? -56.205 36.520  -66.958 1.00 31.38  ? 153  DA  J N9    1 
ATOM   3122  C C8    . DA  B 1 7   ? -57.396 35.818  -66.976 1.00 31.38  ? 153  DA  J C8    1 
ATOM   3123  N N7    . DA  B 1 7   ? -58.463 36.580  -67.128 1.00 31.38  ? 153  DA  J N7    1 
ATOM   3124  C C5    . DA  B 1 7   ? -57.942 37.854  -67.182 1.00 31.38  ? 153  DA  J C5    1 
ATOM   3125  C C6    . DA  B 1 7   ? -58.561 39.096  -67.348 1.00 31.38  ? 153  DA  J C6    1 
ATOM   3126  N N6    . DA  B 1 7   ? -59.880 39.251  -67.554 1.00 31.38  ? 153  DA  J N6    1 
ATOM   3127  N N1    . DA  B 1 7   ? -57.779 40.190  -67.302 1.00 31.38  ? 153  DA  J N1    1 
ATOM   3128  C C2    . DA  B 1 7   ? -56.437 40.004  -67.094 1.00 31.38  ? 153  DA  J C2    1 
ATOM   3129  N N3    . DA  B 1 7   ? -55.734 38.864  -66.959 1.00 31.38  ? 153  DA  J N3    1 
ATOM   3130  C C4    . DA  B 1 7   ? -56.556 37.831  -67.025 1.00 31.38  ? 153  DA  J C4    1 
ATOM   3131  P P     . DT  B 1 8   ? -51.677 34.561  -64.578 1.00 38.91  ? 154  DT  J P     1 
ATOM   3132  O OP1   . DT  B 1 8   ? -50.225 34.579  -64.818 1.00 49.02  ? 154  DT  J OP1   1 
ATOM   3133  O OP2   . DT  B 1 8   ? -52.330 33.432  -63.868 1.00 49.02  ? 154  DT  J OP2   1 
ATOM   3134  O "O5'" . DT  B 1 8   ? -51.988 35.992  -63.999 1.00 38.91  ? 154  DT  J "O5'" 1 
ATOM   3135  C "C5'" . DT  B 1 8   ? -51.594 37.094  -64.791 1.00 38.91  ? 154  DT  J "C5'" 1 
ATOM   3136  C "C4'" . DT  B 1 8   ? -51.918 38.390  -64.103 1.00 38.91  ? 154  DT  J "C4'" 1 
ATOM   3137  O "O4'" . DT  B 1 8   ? -53.234 38.885  -64.422 1.00 38.91  ? 154  DT  J "O4'" 1 
ATOM   3138  C "C3'" . DT  B 1 8   ? -51.878 38.315  -62.593 1.00 38.91  ? 154  DT  J "C3'" 1 
ATOM   3139  O "O3'" . DT  B 1 8   ? -51.433 39.596  -62.190 1.00 38.91  ? 154  DT  J "O3'" 1 
ATOM   3140  C "C2'" . DT  B 1 8   ? -53.338 38.167  -62.213 1.00 38.91  ? 154  DT  J "C2'" 1 
ATOM   3141  C "C1'" . DT  B 1 8   ? -53.979 39.090  -63.220 1.00 38.91  ? 154  DT  J "C1'" 1 
ATOM   3142  N N1    . DT  B 1 8   ? -55.422 38.857  -63.484 1.00 49.02  ? 154  DT  J N1    1 
ATOM   3143  C C2    . DT  B 1 8   ? -56.246 39.945  -63.693 1.00 49.02  ? 154  DT  J C2    1 
ATOM   3144  O O2    . DT  B 1 8   ? -55.862 41.097  -63.763 1.00 49.02  ? 154  DT  J O2    1 
ATOM   3145  N N3    . DT  B 1 8   ? -57.558 39.643  -63.839 1.00 49.02  ? 154  DT  J N3    1 
ATOM   3146  C C4    . DT  B 1 8   ? -58.135 38.403  -63.872 1.00 49.02  ? 154  DT  J C4    1 
ATOM   3147  O O4    . DT  B 1 8   ? -59.379 38.292  -64.006 1.00 49.02  ? 154  DT  J O4    1 
ATOM   3148  C C5    . DT  B 1 8   ? -57.209 37.310  -63.743 1.00 49.02  ? 154  DT  J C5    1 
ATOM   3149  C C7    . DT  B 1 8   ? -57.723 35.921  -63.947 1.00 49.02  ? 154  DT  J C7    1 
ATOM   3150  C C6    . DT  B 1 8   ? -55.921 37.586  -63.505 1.00 49.02  ? 154  DT  J C6    1 
ATOM   3151  P P     . DC  B 1 9   ? -50.957 39.851  -60.679 1.00 60.63  ? 155  DC  J P     1 
ATOM   3152  O OP1   . DC  B 1 9   ? -49.473 40.230  -60.725 1.00 46.19  ? 155  DC  J OP1   1 
ATOM   3153  O OP2   . DC  B 1 9   ? -51.452 38.671  -59.872 1.00 46.19  ? 155  DC  J OP2   1 
ATOM   3154  O "O5'" . DC  B 1 9   ? -51.762 41.163  -60.309 1.00 60.63  ? 155  DC  J "O5'" 1 
ATOM   3155  C "C5'" . DC  B 1 9   ? -51.863 42.210  -61.258 1.00 60.63  ? 155  DC  J "C5'" 1 
ATOM   3156  C "C4'" . DC  B 1 9   ? -52.933 43.169  -60.805 1.00 60.63  ? 155  DC  J "C4'" 1 
ATOM   3157  O "O4'" . DC  B 1 9   ? -54.250 42.671  -61.172 1.00 60.63  ? 155  DC  J "O4'" 1 
ATOM   3158  C "C3'" . DC  B 1 9   ? -52.923 43.265  -59.271 1.00 60.63  ? 155  DC  J "C3'" 1 
ATOM   3159  O "O3'" . DC  B 1 9   ? -53.172 44.621  -58.854 1.00 60.63  ? 155  DC  J "O3'" 1 
ATOM   3160  C "C2'" . DC  B 1 9   ? -54.015 42.299  -58.858 1.00 60.63  ? 155  DC  J "C2'" 1 
ATOM   3161  C "C1'" . DC  B 1 9   ? -55.015 42.490  -59.990 1.00 60.63  ? 155  DC  J "C1'" 1 
ATOM   3162  N N1    . DC  B 1 9   ? -55.982 41.394  -60.199 1.00 46.19  ? 155  DC  J N1    1 
ATOM   3163  C C2    . DC  B 1 9   ? -57.294 41.746  -60.483 1.00 46.19  ? 155  DC  J C2    1 
ATOM   3164  O O2    . DC  B 1 9   ? -57.561 42.982  -60.544 1.00 46.19  ? 155  DC  J O2    1 
ATOM   3165  N N3    . DC  B 1 9   ? -58.232 40.757  -60.684 1.00 46.19  ? 155  DC  J N3    1 
ATOM   3166  C C4    . DC  B 1 9   ? -57.877 39.472  -60.610 1.00 46.19  ? 155  DC  J C4    1 
ATOM   3167  N N4    . DC  B 1 9   ? -58.802 38.542  -60.838 1.00 46.19  ? 155  DC  J N4    1 
ATOM   3168  C C5    . DC  B 1 9   ? -56.542 39.086  -60.302 1.00 46.19  ? 155  DC  J C5    1 
ATOM   3169  C C6    . DC  B 1 9   ? -55.628 40.076  -60.109 1.00 46.19  ? 155  DC  J C6    1 
ATOM   3170  P P     . DC  B 1 10  ? -52.732 45.114  -57.375 1.00 68.86  ? 156  DC  J P     1 
ATOM   3171  O OP1   . DC  B 1 10  ? -51.675 46.176  -57.505 1.00 43.43  ? 156  DC  J OP1   1 
ATOM   3172  O OP2   . DC  B 1 10  ? -52.488 43.920  -56.501 1.00 43.43  ? 156  DC  J OP2   1 
ATOM   3173  O "O5'" . DC  B 1 10  ? -54.077 45.827  -56.921 1.00 68.86  ? 156  DC  J "O5'" 1 
ATOM   3174  C "C5'" . DC  B 1 10  ? -54.885 46.502  -57.900 1.00 68.86  ? 156  DC  J "C5'" 1 
ATOM   3175  C "C4'" . DC  B 1 10  ? -56.289 46.667  -57.378 1.00 68.86  ? 156  DC  J "C4'" 1 
ATOM   3176  O "O4'" . DC  B 1 10  ? -57.121 45.555  -57.799 1.00 68.86  ? 156  DC  J "O4'" 1 
ATOM   3177  C "C3'" . DC  B 1 10  ? -56.313 46.675  -55.841 1.00 68.86  ? 156  DC  J "C3'" 1 
ATOM   3178  O "O3'" . DC  B 1 10  ? -57.261 47.620  -55.359 1.00 68.86  ? 156  DC  J "O3'" 1 
ATOM   3179  C "C2'" . DC  B 1 10  ? -56.777 45.277  -55.487 1.00 68.86  ? 156  DC  J "C2'" 1 
ATOM   3180  C "C1'" . DC  B 1 10  ? -57.710 44.989  -56.648 1.00 68.86  ? 156  DC  J "C1'" 1 
ATOM   3181  N N1    . DC  B 1 10  ? -57.908 43.583  -56.904 1.00 43.43  ? 156  DC  J N1    1 
ATOM   3182  C C2    . DC  B 1 10  ? -59.196 43.141  -57.197 1.00 43.43  ? 156  DC  J C2    1 
ATOM   3183  O O2    . DC  B 1 10  ? -60.102 44.011  -57.271 1.00 43.43  ? 156  DC  J O2    1 
ATOM   3184  N N3    . DC  B 1 10  ? -59.414 41.787  -57.392 1.00 43.43  ? 156  DC  J N3    1 
ATOM   3185  C C4    . DC  B 1 10  ? -58.369 40.924  -57.306 1.00 43.43  ? 156  DC  J C4    1 
ATOM   3186  N N4    . DC  B 1 10  ? -58.581 39.607  -57.464 1.00 43.43  ? 156  DC  J N4    1 
ATOM   3187  C C5    . DC  B 1 10  ? -57.049 41.375  -57.038 1.00 43.43  ? 156  DC  J C5    1 
ATOM   3188  C C6    . DC  B 1 10  ? -56.867 42.704  -56.842 1.00 43.43  ? 156  DC  J C6    1 
ATOM   3189  P P     . DA  B 1 11  ? -56.943 48.514  -54.048 1.00 57.75  ? 157  DA  J P     1 
ATOM   3190  O OP1   . DA  B 1 11  ? -56.507 49.923  -54.542 1.00 38.40  ? 157  DA  J OP1   1 
ATOM   3191  O OP2   . DA  B 1 11  ? -56.154 47.716  -53.025 1.00 38.40  ? 157  DA  J OP2   1 
ATOM   3192  O "O5'" . DA  B 1 11  ? -58.389 48.661  -53.424 1.00 57.75  ? 157  DA  J "O5'" 1 
ATOM   3193  C "C5'" . DA  B 1 11  ? -59.392 49.214  -54.231 1.00 57.75  ? 157  DA  J "C5'" 1 
ATOM   3194  C "C4'" . DA  B 1 11  ? -60.684 48.547  -53.900 1.00 57.75  ? 157  DA  J "C4'" 1 
ATOM   3195  O "O4'" . DA  B 1 11  ? -60.540 47.177  -54.289 1.00 57.75  ? 157  DA  J "O4'" 1 
ATOM   3196  C "C3'" . DA  B 1 11  ? -60.876 48.534  -52.397 1.00 57.75  ? 157  DA  J "C3'" 1 
ATOM   3197  O "O3'" . DA  B 1 11  ? -62.090 49.160  -52.022 1.00 57.75  ? 157  DA  J "O3'" 1 
ATOM   3198  C "C2'" . DA  B 1 11  ? -60.868 47.066  -52.029 1.00 57.75  ? 157  DA  J "C2'" 1 
ATOM   3199  C "C1'" . DA  B 1 11  ? -61.167 46.402  -53.335 1.00 57.75  ? 157  DA  J "C1'" 1 
ATOM   3200  N N9    . DA  B 1 11  ? -60.603 45.091  -53.470 1.00 38.40  ? 157  DA  J N9    1 
ATOM   3201  C C8    . DA  B 1 11  ? -59.293 44.720  -53.209 1.00 38.40  ? 157  DA  J C8    1 
ATOM   3202  N N7    . DA  B 1 11  ? -59.057 43.434  -53.433 1.00 38.40  ? 157  DA  J N7    1 
ATOM   3203  C C5    . DA  B 1 11  ? -60.284 42.941  -53.890 1.00 38.40  ? 157  DA  J C5    1 
ATOM   3204  C C6    . DA  B 1 11  ? -60.691 41.669  -54.317 1.00 38.40  ? 157  DA  J C6    1 
ATOM   3205  N N6    . DA  B 1 11  ? -59.839 40.662  -54.491 1.00 38.40  ? 157  DA  J N6    1 
ATOM   3206  N N1    . DA  B 1 11  ? -62.007 41.475  -54.608 1.00 38.40  ? 157  DA  J N1    1 
ATOM   3207  C C2    . DA  B 1 11  ? -62.829 42.528  -54.566 1.00 38.40  ? 157  DA  J C2    1 
ATOM   3208  N N3    . DA  B 1 11  ? -62.551 43.805  -54.253 1.00 38.40  ? 157  DA  J N3    1 
ATOM   3209  C C4    . DA  B 1 11  ? -61.250 43.945  -53.902 1.00 38.40  ? 157  DA  J C4    1 
ATOM   3210  P P     . DC  B 1 12  ? -62.359 49.436  -50.470 1.00 50.53  ? 158  DC  J P     1 
ATOM   3211  O OP1   . DC  B 1 12  ? -63.147 50.678  -50.357 1.00 45.05  ? 158  DC  J OP1   1 
ATOM   3212  O OP2   . DC  B 1 12  ? -61.016 49.381  -49.818 1.00 45.05  ? 158  DC  J OP2   1 
ATOM   3213  O "O5'" . DC  B 1 12  ? -63.284 48.183  -50.186 1.00 50.53  ? 158  DC  J "O5'" 1 
ATOM   3214  C "C5'" . DC  B 1 12  ? -64.118 47.801  -51.259 1.00 50.53  ? 158  DC  J "C5'" 1 
ATOM   3215  C "C4'" . DC  B 1 12  ? -64.999 46.650  -50.883 1.00 50.53  ? 158  DC  J "C4'" 1 
ATOM   3216  O "O4'" . DC  B 1 12  ? -64.378 45.495  -51.453 1.00 50.53  ? 158  DC  J "O4'" 1 
ATOM   3217  C "C3'" . DC  B 1 12  ? -65.184 46.350  -49.402 1.00 50.53  ? 158  DC  J "C3'" 1 
ATOM   3218  O "O3'" . DC  B 1 12  ? -66.509 45.875  -49.231 1.00 50.53  ? 158  DC  J "O3'" 1 
ATOM   3219  C "C2'" . DC  B 1 12  ? -64.223 45.199  -49.154 1.00 50.53  ? 158  DC  J "C2'" 1 
ATOM   3220  C "C1'" . DC  B 1 12  ? -64.331 44.471  -50.478 1.00 50.53  ? 158  DC  J "C1'" 1 
ATOM   3221  N N1    . DC  B 1 12  ? -63.210 43.580  -50.796 1.00 45.05  ? 158  DC  J N1    1 
ATOM   3222  C C2    . DC  B 1 12  ? -63.480 42.259  -51.218 1.00 45.05  ? 158  DC  J C2    1 
ATOM   3223  O O2    . DC  B 1 12  ? -64.632 41.952  -51.532 1.00 45.05  ? 158  DC  J O2    1 
ATOM   3224  N N3    . DC  B 1 12  ? -62.475 41.363  -51.281 1.00 45.05  ? 158  DC  J N3    1 
ATOM   3225  C C4    . DC  B 1 12  ? -61.238 41.740  -50.972 1.00 45.05  ? 158  DC  J C4    1 
ATOM   3226  N N4    . DC  B 1 12  ? -60.333 40.807  -50.896 1.00 45.05  ? 158  DC  J N4    1 
ATOM   3227  C C5    . DC  B 1 12  ? -60.901 43.111  -50.682 1.00 45.05  ? 158  DC  J C5    1 
ATOM   3228  C C6    . DC  B 1 12  ? -61.919 43.996  -50.611 1.00 45.05  ? 158  DC  J C6    1 
ATOM   3229  P P     . DC  B 1 13  ? -67.039 45.488  -47.774 1.00 57.54  ? 159  DC  J P     1 
ATOM   3230  O OP1   . DC  B 1 13  ? -68.474 45.856  -47.726 1.00 54.46  ? 159  DC  J OP1   1 
ATOM   3231  O OP2   . DC  B 1 13  ? -66.084 46.043  -46.790 1.00 54.46  ? 159  DC  J OP2   1 
ATOM   3232  O "O5'" . DC  B 1 13  ? -67.047 43.917  -47.789 1.00 57.54  ? 159  DC  J "O5'" 1 
ATOM   3233  C "C5'" . DC  B 1 13  ? -67.898 43.261  -48.698 1.00 57.54  ? 159  DC  J "C5'" 1 
ATOM   3234  C "C4'" . DC  B 1 13  ? -68.049 41.823  -48.272 1.00 57.54  ? 159  DC  J "C4'" 1 
ATOM   3235  O "O4'" . DC  B 1 13  ? -66.844 41.084  -48.617 1.00 57.54  ? 159  DC  J "O4'" 1 
ATOM   3236  C "C3'" . DC  B 1 13  ? -68.200 41.678  -46.746 1.00 57.54  ? 159  DC  J "C3'" 1 
ATOM   3237  O "O3'" . DC  B 1 13  ? -69.149 40.645  -46.395 1.00 57.54  ? 159  DC  J "O3'" 1 
ATOM   3238  C "C2'" . DC  B 1 13  ? -66.806 41.300  -46.265 1.00 57.54  ? 159  DC  J "C2'" 1 
ATOM   3239  C "C1'" . DC  B 1 13  ? -66.265 40.479  -47.444 1.00 57.54  ? 159  DC  J "C1'" 1 
ATOM   3240  N N1    . DC  B 1 13  ? -64.801 40.573  -47.591 1.00 54.46  ? 159  DC  J N1    1 
ATOM   3241  C C2    . DC  B 1 13  ? -63.982 39.393  -47.641 1.00 54.46  ? 159  DC  J C2    1 
ATOM   3242  O O2    . DC  B 1 13  ? -64.499 38.248  -47.589 1.00 54.46  ? 159  DC  J O2    1 
ATOM   3243  N N3    . DC  B 1 13  ? -62.650 39.550  -47.752 1.00 54.46  ? 159  DC  J N3    1 
ATOM   3244  C C4    . DC  B 1 13  ? -62.122 40.774  -47.845 1.00 54.46  ? 159  DC  J C4    1 
ATOM   3245  N N4    . DC  B 1 13  ? -60.801 40.869  -47.996 1.00 54.46  ? 159  DC  J N4    1 
ATOM   3246  C C5    . DC  B 1 13  ? -62.930 41.957  -47.804 1.00 54.46  ? 159  DC  J C5    1 
ATOM   3247  C C6    . DC  B 1 13  ? -64.238 41.810  -47.677 1.00 54.46  ? 159  DC  J C6    1 
ATOM   3248  P P     . DT  B 1 14  ? -69.854 40.658  -44.922 1.00 63.99  ? 160  DT  J P     1 
ATOM   3249  O OP1   . DT  B 1 14  ? -71.310 40.570  -45.150 1.00 47.73  ? 160  DT  J OP1   1 
ATOM   3250  O OP2   . DT  B 1 14  ? -69.332 41.746  -44.053 1.00 47.73  ? 160  DT  J OP2   1 
ATOM   3251  O "O5'" . DT  B 1 14  ? -69.419 39.225  -44.403 1.00 63.99  ? 160  DT  J "O5'" 1 
ATOM   3252  C "C5'" . DT  B 1 14  ? -69.152 38.221  -45.376 1.00 63.99  ? 160  DT  J "C5'" 1 
ATOM   3253  C "C4'" . DT  B 1 14  ? -68.351 37.107  -44.751 1.00 63.99  ? 160  DT  J "C4'" 1 
ATOM   3254  O "O4'" . DT  B 1 14  ? -66.918 37.289  -44.938 1.00 63.99  ? 160  DT  J "O4'" 1 
ATOM   3255  C "C3'" . DT  B 1 14  ? -68.584 37.048  -43.238 1.00 63.99  ? 160  DT  J "C3'" 1 
ATOM   3256  O "O3'" . DT  B 1 14  ? -68.596 35.692  -42.821 1.00 63.99  ? 160  DT  J "O3'" 1 
ATOM   3257  C "C2'" . DT  B 1 14  ? -67.371 37.760  -42.666 1.00 63.99  ? 160  DT  J "C2'" 1 
ATOM   3258  C "C1'" . DT  B 1 14  ? -66.313 37.278  -43.642 1.00 63.99  ? 160  DT  J "C1'" 1 
ATOM   3259  N N1    . DT  B 1 14  ? -65.069 38.055  -43.703 1.00 47.73  ? 160  DT  J N1    1 
ATOM   3260  C C2    . DT  B 1 14  ? -64.017 37.413  -44.293 1.00 47.73  ? 160  DT  J C2    1 
ATOM   3261  O O2    . DT  B 1 14  ? -64.088 36.268  -44.711 1.00 47.73  ? 160  DT  J O2    1 
ATOM   3262  N N3    . DT  B 1 14  ? -62.884 38.148  -44.395 1.00 47.73  ? 160  DT  J N3    1 
ATOM   3263  C C4    . DT  B 1 14  ? -62.689 39.434  -44.002 1.00 47.73  ? 160  DT  J C4    1 
ATOM   3264  O O4    . DT  B 1 14  ? -61.635 39.962  -44.222 1.00 47.73  ? 160  DT  J O4    1 
ATOM   3265  C C5    . DT  B 1 14  ? -63.811 40.069  -43.364 1.00 47.73  ? 160  DT  J C5    1 
ATOM   3266  C C7    . DT  B 1 14  ? -63.668 41.501  -42.911 1.00 47.73  ? 160  DT  J C7    1 
ATOM   3267  C C6    . DT  B 1 14  ? -64.945 39.344  -43.226 1.00 47.73  ? 160  DT  J C6    1 
ATOM   3268  P P     . DG  B 1 15  ? -69.713 35.185  -41.787 1.00 100.09 ? 161  DG  J P     1 
ATOM   3269  O OP1   . DG  B 1 15  ? -71.022 35.162  -42.521 1.00 89.43  ? 161  DG  J OP1   1 
ATOM   3270  O OP2   . DG  B 1 15  ? -69.558 35.967  -40.512 1.00 89.43  ? 161  DG  J OP2   1 
ATOM   3271  O "O5'" . DG  B 1 15  ? -69.251 33.681  -41.572 1.00 100.09 ? 161  DG  J "O5'" 1 
ATOM   3272  C "C5'" . DG  B 1 15  ? -68.800 32.926  -42.697 1.00 100.09 ? 161  DG  J "C5'" 1 
ATOM   3273  C "C4'" . DG  B 1 15  ? -67.523 32.191  -42.361 1.00 100.09 ? 161  DG  J "C4'" 1 
ATOM   3274  O "O4'" . DG  B 1 15  ? -66.347 33.029  -42.227 1.00 100.09 ? 161  DG  J "O4'" 1 
ATOM   3275  C "C3'" . DG  B 1 15  ? -67.593 31.417  -41.070 1.00 100.09 ? 161  DG  J "C3'" 1 
ATOM   3276  O "O3'" . DG  B 1 15  ? -66.786 30.306  -41.323 1.00 100.09 ? 161  DG  J "O3'" 1 
ATOM   3277  C "C2'" . DG  B 1 15  ? -66.918 32.339  -40.067 1.00 100.09 ? 161  DG  J "C2'" 1 
ATOM   3278  C "C1'" . DG  B 1 15  ? -65.797 32.934  -40.907 1.00 100.09 ? 161  DG  J "C1'" 1 
ATOM   3279  N N9    . DG  B 1 15  ? -65.347 34.278  -40.531 1.00 89.43  ? 161  DG  J N9    1 
ATOM   3280  C C8    . DG  B 1 15  ? -66.082 35.259  -39.895 1.00 89.43  ? 161  DG  J C8    1 
ATOM   3281  N N7    . DG  B 1 15  ? -65.470 36.414  -39.855 1.00 89.43  ? 161  DG  J N7    1 
ATOM   3282  C C5    . DG  B 1 15  ? -64.235 36.173  -40.467 1.00 89.43  ? 161  DG  J C5    1 
ATOM   3283  C C6    . DG  B 1 15  ? -63.122 37.065  -40.757 1.00 89.43  ? 161  DG  J C6    1 
ATOM   3284  O O6    . DG  B 1 15  ? -63.021 38.285  -40.552 1.00 89.43  ? 161  DG  J O6    1 
ATOM   3285  N N1    . DG  B 1 15  ? -62.072 36.386  -41.354 1.00 89.43  ? 161  DG  J N1    1 
ATOM   3286  C C2    . DG  B 1 15  ? -62.064 35.047  -41.656 1.00 89.43  ? 161  DG  J C2    1 
ATOM   3287  N N2    . DG  B 1 15  ? -60.929 34.566  -42.196 1.00 89.43  ? 161  DG  J N2    1 
ATOM   3288  N N3    . DG  B 1 15  ? -63.088 34.223  -41.434 1.00 89.43  ? 161  DG  J N3    1 
ATOM   3289  C C4    . DG  B 1 15  ? -64.128 34.848  -40.841 1.00 89.43  ? 161  DG  J C4    1 
ATOM   3290  P P     . DC  B 1 16  ? -67.044 28.954  -40.533 1.00 80.96  ? 162  DC  J P     1 
ATOM   3291  O OP1   . DC  B 1 16  ? -67.462 28.048  -41.668 1.00 64.56  ? 162  DC  J OP1   1 
ATOM   3292  O OP2   . DC  B 1 16  ? -67.965 29.196  -39.346 1.00 64.56  ? 162  DC  J OP2   1 
ATOM   3293  O "O5'" . DC  B 1 16  ? -65.599 28.623  -39.883 1.00 80.96  ? 162  DC  J "O5'" 1 
ATOM   3294  C "C5'" . DC  B 1 16  ? -64.360 28.663  -40.644 1.00 80.96  ? 162  DC  J "C5'" 1 
ATOM   3295  C "C4'" . DC  B 1 16  ? -63.169 28.899  -39.739 1.00 80.96  ? 162  DC  J "C4'" 1 
ATOM   3296  O "O4'" . DC  B 1 16  ? -62.812 30.296  -39.647 1.00 80.96  ? 162  DC  J "O4'" 1 
ATOM   3297  C "C3'" . DC  B 1 16  ? -63.310 28.389  -38.300 1.00 80.96  ? 162  DC  J "C3'" 1 
ATOM   3298  O "O3'" . DC  B 1 16  ? -62.129 27.715  -37.943 1.00 80.96  ? 162  DC  J "O3'" 1 
ATOM   3299  C "C2'" . DC  B 1 16  ? -63.398 29.653  -37.470 1.00 80.96  ? 162  DC  J "C2'" 1 
ATOM   3300  C "C1'" . DC  B 1 16  ? -62.517 30.577  -38.286 1.00 80.96  ? 162  DC  J "C1'" 1 
ATOM   3301  N N1    . DC  B 1 16  ? -62.760 31.992  -38.033 1.00 64.56  ? 162  DC  J N1    1 
ATOM   3302  C C2    . DC  B 1 16  ? -61.750 32.917  -38.300 1.00 64.56  ? 162  DC  J C2    1 
ATOM   3303  O O2    . DC  B 1 16  ? -60.729 32.543  -38.895 1.00 64.56  ? 162  DC  J O2    1 
ATOM   3304  N N3    . DC  B 1 16  ? -61.929 34.198  -37.938 1.00 64.56  ? 162  DC  J N3    1 
ATOM   3305  C C4    . DC  B 1 16  ? -63.097 34.585  -37.403 1.00 64.56  ? 162  DC  J C4    1 
ATOM   3306  N N4    . DC  B 1 16  ? -63.247 35.876  -37.042 1.00 64.56  ? 162  DC  J N4    1 
ATOM   3307  C C5    . DC  B 1 16  ? -64.163 33.673  -37.203 1.00 64.56  ? 162  DC  J C5    1 
ATOM   3308  C C6    . DC  B 1 16  ? -63.947 32.397  -37.516 1.00 64.56  ? 162  DC  J C6    1 
ATOM   3309  P P     . DA  B 1 17  ? -61.935 26.216  -38.414 1.00 82.18  ? 163  DA  J P     1 
ATOM   3310  O OP1   . DA  B 1 17  ? -62.474 26.076  -39.783 1.00 79.41  ? 163  DA  J OP1   1 
ATOM   3311  O OP2   . DA  B 1 17  ? -62.494 25.386  -37.304 1.00 79.41  ? 163  DA  J OP2   1 
ATOM   3312  O "O5'" . DA  B 1 17  ? -60.361 26.037  -38.498 1.00 82.18  ? 163  DA  J "O5'" 1 
ATOM   3313  C "C5'" . DA  B 1 17  ? -59.641 26.499  -39.617 1.00 82.18  ? 163  DA  J "C5'" 1 
ATOM   3314  C "C4'" . DA  B 1 17  ? -58.417 27.239  -39.147 1.00 82.18  ? 163  DA  J "C4'" 1 
ATOM   3315  O "O4'" . DA  B 1 17  ? -58.802 28.463  -38.487 1.00 82.18  ? 163  DA  J "O4'" 1 
ATOM   3316  C "C3'" . DA  B 1 17  ? -57.602 26.467  -38.118 1.00 82.18  ? 163  DA  J "C3'" 1 
ATOM   3317  O "O3'" . DA  B 1 17  ? -56.263 26.941  -38.236 1.00 82.18  ? 163  DA  J "O3'" 1 
ATOM   3318  C "C2'" . DA  B 1 17  ? -58.185 26.942  -36.802 1.00 82.18  ? 163  DA  J "C2'" 1 
ATOM   3319  C "C1'" . DA  B 1 17  ? -58.474 28.396  -37.108 1.00 82.18  ? 163  DA  J "C1'" 1 
ATOM   3320  N N9    . DA  B 1 17  ? -59.568 29.013  -36.350 1.00 79.41  ? 163  DA  J N9    1 
ATOM   3321  C C8    . DA  B 1 17  ? -60.650 28.444  -35.720 1.00 79.41  ? 163  DA  J C8    1 
ATOM   3322  N N7    . DA  B 1 17  ? -61.430 29.318  -35.129 1.00 79.41  ? 163  DA  J N7    1 
ATOM   3323  C C5    . DA  B 1 17  ? -60.823 30.542  -35.387 1.00 79.41  ? 163  DA  J C5    1 
ATOM   3324  C C6    . DA  B 1 17  ? -61.153 31.885  -35.033 1.00 79.41  ? 163  DA  J C6    1 
ATOM   3325  N N6    . DA  B 1 17  ? -62.210 32.239  -34.311 1.00 79.41  ? 163  DA  J N6    1 
ATOM   3326  N N1    . DA  B 1 17  ? -60.330 32.863  -35.451 1.00 79.41  ? 163  DA  J N1    1 
ATOM   3327  C C2    . DA  B 1 17  ? -59.254 32.522  -36.165 1.00 79.41  ? 163  DA  J C2    1 
ATOM   3328  N N3    . DA  B 1 17  ? -58.840 31.313  -36.564 1.00 79.41  ? 163  DA  J N3    1 
ATOM   3329  C C4    . DA  B 1 17  ? -59.679 30.363  -36.136 1.00 79.41  ? 163  DA  J C4    1 
ATOM   3330  P P     . DG  B 1 18  ? -55.010 25.929  -38.092 1.00 83.12  ? 164  DG  J P     1 
ATOM   3331  O OP1   . DG  B 1 18  ? -54.490 25.537  -39.441 1.00 65.33  ? 164  DG  J OP1   1 
ATOM   3332  O OP2   . DG  B 1 18  ? -55.439 24.867  -37.142 1.00 65.33  ? 164  DG  J OP2   1 
ATOM   3333  O "O5'" . DG  B 1 18  ? -53.958 26.922  -37.435 1.00 83.12  ? 164  DG  J "O5'" 1 
ATOM   3334  C "C5'" . DG  B 1 18  ? -53.903 28.257  -37.884 1.00 83.12  ? 164  DG  J "C5'" 1 
ATOM   3335  C "C4'" . DG  B 1 18  ? -54.124 29.203  -36.733 1.00 83.12  ? 164  DG  J "C4'" 1 
ATOM   3336  O "O4'" . DG  B 1 18  ? -55.467 29.170  -36.195 1.00 83.12  ? 164  DG  J "O4'" 1 
ATOM   3337  C "C3'" . DG  B 1 18  ? -53.219 28.999  -35.526 1.00 83.12  ? 164  DG  J "C3'" 1 
ATOM   3338  O "O3'" . DG  B 1 18  ? -52.695 30.251  -35.189 1.00 83.12  ? 164  DG  J "O3'" 1 
ATOM   3339  C "C2'" . DG  B 1 18  ? -54.173 28.661  -34.395 1.00 83.12  ? 164  DG  J "C2'" 1 
ATOM   3340  C "C1'" . DG  B 1 18  ? -55.292 29.543  -34.835 1.00 83.12  ? 164  DG  J "C1'" 1 
ATOM   3341  N N9    . DG  B 1 18  ? -56.572 29.550  -34.123 1.00 65.33  ? 164  DG  J N9    1 
ATOM   3342  C C8    . DG  B 1 18  ? -57.377 28.489  -33.804 1.00 65.33  ? 164  DG  J C8    1 
ATOM   3343  N N7    . DG  B 1 18  ? -58.478 28.852  -33.196 1.00 65.33  ? 164  DG  J N7    1 
ATOM   3344  C C5    . DG  B 1 18  ? -58.402 30.228  -33.106 1.00 65.33  ? 164  DG  J C5    1 
ATOM   3345  C C6    . DG  B 1 18  ? -59.331 31.158  -32.620 1.00 65.33  ? 164  DG  J C6    1 
ATOM   3346  O O6    . DG  B 1 18  ? -60.470 30.938  -32.219 1.00 65.33  ? 164  DG  J O6    1 
ATOM   3347  N N1    . DG  B 1 18  ? -58.868 32.465  -32.703 1.00 65.33  ? 164  DG  J N1    1 
ATOM   3348  C C2    . DG  B 1 18  ? -57.701 32.844  -33.283 1.00 65.33  ? 164  DG  J C2    1 
ATOM   3349  N N2    . DG  B 1 18  ? -57.499 34.168  -33.365 1.00 65.33  ? 164  DG  J N2    1 
ATOM   3350  N N3    . DG  B 1 18  ? -56.816 31.985  -33.777 1.00 65.33  ? 164  DG  J N3    1 
ATOM   3351  C C4    . DG  B 1 18  ? -57.228 30.693  -33.652 1.00 65.33  ? 164  DG  J C4    1 
ATOM   3352  P P     . DA  B 1 19  ? -51.156 30.359  -34.846 1.00 48.86  ? 165  DA  J P     1 
ATOM   3353  O OP1   . DA  B 1 19  ? -50.441 30.215  -36.131 1.00 67.04  ? 165  DA  J OP1   1 
ATOM   3354  O OP2   . DA  B 1 19  ? -50.872 29.422  -33.704 1.00 67.04  ? 165  DA  J OP2   1 
ATOM   3355  O "O5'" . DA  B 1 19  ? -50.966 31.799  -34.223 1.00 48.86  ? 165  DA  J "O5'" 1 
ATOM   3356  C "C5'" . DA  B 1 19  ? -51.541 32.932  -34.808 1.00 48.86  ? 165  DA  J "C5'" 1 
ATOM   3357  C "C4'" . DA  B 1 19  ? -52.148 33.832  -33.750 1.00 48.86  ? 165  DA  J "C4'" 1 
ATOM   3358  O "O4'" . DA  B 1 19  ? -53.409 33.320  -33.304 1.00 48.86  ? 165  DA  J "O4'" 1 
ATOM   3359  C "C3'" . DA  B 1 19  ? -51.336 34.110  -32.479 1.00 48.86  ? 165  DA  J "C3'" 1 
ATOM   3360  O "O3'" . DA  B 1 19  ? -51.570 35.464  -32.112 1.00 48.86  ? 165  DA  J "O3'" 1 
ATOM   3361  C "C2'" . DA  B 1 19  ? -51.975 33.194  -31.462 1.00 48.86  ? 165  DA  J "C2'" 1 
ATOM   3362  C "C1'" . DA  B 1 19  ? -53.419 33.355  -31.889 1.00 48.86  ? 165  DA  J "C1'" 1 
ATOM   3363  N N9    . DA  B 1 19  ? -54.361 32.344  -31.449 1.00 67.04  ? 165  DA  J N9    1 
ATOM   3364  C C8    . DA  B 1 19  ? -54.353 31.012  -31.745 1.00 67.04  ? 165  DA  J C8    1 
ATOM   3365  N N7    . DA  B 1 19  ? -55.408 30.377  -31.304 1.00 67.04  ? 165  DA  J N7    1 
ATOM   3366  C C5    . DA  B 1 19  ? -56.142 31.354  -30.653 1.00 67.04  ? 165  DA  J C5    1 
ATOM   3367  C C6    . DA  B 1 19  ? -57.376 31.319  -29.994 1.00 67.04  ? 165  DA  J C6    1 
ATOM   3368  N N6    . DA  B 1 19  ? -58.114 30.216  -29.884 1.00 67.04  ? 165  DA  J N6    1 
ATOM   3369  N N1    . DA  B 1 19  ? -57.832 32.465  -29.453 1.00 67.04  ? 165  DA  J N1    1 
ATOM   3370  C C2    . DA  B 1 19  ? -57.074 33.569  -29.572 1.00 67.04  ? 165  DA  J C2    1 
ATOM   3371  N N3    . DA  B 1 19  ? -55.897 33.728  -30.169 1.00 67.04  ? 165  DA  J N3    1 
ATOM   3372  C C4    . DA  B 1 19  ? -55.491 32.567  -30.703 1.00 67.04  ? 165  DA  J C4    1 
ATOM   3373  P P     . DT  B 1 20  ? -50.678 36.126  -30.973 1.00 78.98  ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 20  ? -50.174 37.463  -31.412 1.00 81.35  ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 20  ? -49.656 35.068  -30.715 1.00 81.35  ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 20  ? -51.845 36.308  -29.892 1.00 78.98  ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 20  ? -52.978 37.098  -30.231 1.00 78.98  ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 20  ? -53.885 37.280  -29.033 1.00 78.98  ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 20  ? -54.714 36.101  -28.870 1.00 78.98  ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 20  ? -53.163 37.496  -27.692 1.00 78.98  ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 20  ? -53.870 38.406  -26.819 1.00 78.98  ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 20  ? -53.234 36.119  -27.075 1.00 78.98  ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 20  ? -54.627 35.717  -27.508 1.00 78.98  ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 20  ? -54.911 34.276  -27.396 1.00 81.35  ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 20  ? -56.064 33.874  -26.731 1.00 81.35  ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 20  ? -56.878 34.654  -26.233 1.00 81.35  ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 20  ? -56.237 32.519  -26.675 1.00 81.35  ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 20  ? -55.415 31.545  -27.215 1.00 81.35  ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 20  ? -55.723 30.360  -27.086 1.00 81.35  ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 20  ? -54.229 32.044  -27.913 1.00 81.35  ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 20  ? -53.291 31.088  -28.583 1.00 81.35  ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 20  ? -54.042 33.365  -27.943 1.00 81.35  ? 166  DT  J C6    1 
ATOM   3393  P P     . DT  B 1 21  ? -53.044 39.477  -25.910 1.00 115.76 ? 167  DT  J P     1 
ATOM   3394  O OP1   . DT  B 1 21  ? -52.940 40.783  -26.639 1.00 91.02  ? 167  DT  J OP1   1 
ATOM   3395  O OP2   . DT  B 1 21  ? -51.826 38.864  -25.354 1.00 91.02  ? 167  DT  J OP2   1 
ATOM   3396  O "O5'" . DT  B 1 21  ? -54.016 39.665  -24.679 1.00 115.76 ? 167  DT  J "O5'" 1 
ATOM   3397  C "C5'" . DT  B 1 21  ? -55.402 39.768  -24.934 1.00 115.76 ? 167  DT  J "C5'" 1 
ATOM   3398  C "C4'" . DT  B 1 21  ? -56.186 39.033  -23.878 1.00 115.76 ? 167  DT  J "C4'" 1 
ATOM   3399  O "O4'" . DT  B 1 21  ? -56.254 37.604  -24.100 1.00 115.76 ? 167  DT  J "O4'" 1 
ATOM   3400  C "C3'" . DT  B 1 21  ? -55.604 39.211  -22.483 1.00 115.76 ? 167  DT  J "C3'" 1 
ATOM   3401  O "O3'" . DT  B 1 21  ? -56.685 39.395  -21.584 1.00 115.76 ? 167  DT  J "O3'" 1 
ATOM   3402  C "C2'" . DT  B 1 21  ? -54.900 37.892  -22.221 1.00 115.76 ? 167  DT  J "C2'" 1 
ATOM   3403  C "C1'" . DT  B 1 21  ? -55.882 36.952  -22.894 1.00 115.76 ? 167  DT  J "C1'" 1 
ATOM   3404  N N1    . DT  B 1 21  ? -55.388 35.595  -23.224 1.00 91.02  ? 167  DT  J N1    1 
ATOM   3405  C C2    . DT  B 1 21  ? -56.235 34.522  -22.960 1.00 91.02  ? 167  DT  J C2    1 
ATOM   3406  O O2    . DT  B 1 21  ? -57.352 34.651  -22.494 1.00 91.02  ? 167  DT  J O2    1 
ATOM   3407  N N3    . DT  B 1 21  ? -55.717 33.286  -23.278 1.00 91.02  ? 167  DT  J N3    1 
ATOM   3408  C C4    . DT  B 1 21  ? -54.478 33.016  -23.833 1.00 91.02  ? 167  DT  J C4    1 
ATOM   3409  O O4    . DT  B 1 21  ? -54.154 31.849  -24.065 1.00 91.02  ? 167  DT  J O4    1 
ATOM   3410  C C5    . DT  B 1 21  ? -53.651 34.187  -24.095 1.00 91.02  ? 167  DT  J C5    1 
ATOM   3411  C C7    . DT  B 1 21  ? -52.306 34.006  -24.708 1.00 91.02  ? 167  DT  J C7    1 
ATOM   3412  C C6    . DT  B 1 21  ? -54.137 35.397  -23.774 1.00 91.02  ? 167  DT  J C6    1 
ATOM   3413  P P     . DC  B 1 22  ? -56.384 39.945  -20.122 1.00 125.96 ? 168  DC  J P     1 
ATOM   3414  O OP1   . DC  B 1 22  ? -57.005 41.290  -19.948 1.00 135.17 ? 168  DC  J OP1   1 
ATOM   3415  O OP2   . DC  B 1 22  ? -54.910 39.768  -19.908 1.00 135.17 ? 168  DC  J OP2   1 
ATOM   3416  O "O5'" . DC  B 1 22  ? -57.198 38.912  -19.255 1.00 125.96 ? 168  DC  J "O5'" 1 
ATOM   3417  C "C5'" . DC  B 1 22  ? -57.445 37.633  -19.762 1.00 125.96 ? 168  DC  J "C5'" 1 
ATOM   3418  C "C4'" . DC  B 1 22  ? -58.052 36.820  -18.664 1.00 125.96 ? 168  DC  J "C4'" 1 
ATOM   3419  O "O4'" . DC  B 1 22  ? -58.011 35.432  -19.045 1.00 125.96 ? 168  DC  J "O4'" 1 
ATOM   3420  C "C3'" . DC  B 1 22  ? -57.224 36.959  -17.389 1.00 125.96 ? 168  DC  J "C3'" 1 
ATOM   3421  O "O3'" . DC  B 1 22  ? -58.078 37.093  -16.260 1.00 125.96 ? 168  DC  J "O3'" 1 
ATOM   3422  C "C2'" . DC  B 1 22  ? -56.392 35.699  -17.349 1.00 125.96 ? 168  DC  J "C2'" 1 
ATOM   3423  C "C1'" . DC  B 1 22  ? -57.260 34.695  -18.100 1.00 125.96 ? 168  DC  J "C1'" 1 
ATOM   3424  N N1    . DC  B 1 22  ? -56.478 33.695  -18.839 1.00 135.17 ? 168  DC  J N1    1 
ATOM   3425  C C2    . DC  B 1 22  ? -56.866 32.344  -18.790 1.00 135.17 ? 168  DC  J C2    1 
ATOM   3426  O O2    . DC  B 1 22  ? -57.901 32.020  -18.153 1.00 135.17 ? 168  DC  J O2    1 
ATOM   3427  N N3    . DC  B 1 22  ? -56.104 31.428  -19.441 1.00 135.17 ? 168  DC  J N3    1 
ATOM   3428  C C4    . DC  B 1 22  ? -55.019 31.810  -20.124 1.00 135.17 ? 168  DC  J C4    1 
ATOM   3429  N N4    . DC  B 1 22  ? -54.312 30.866  -20.742 1.00 135.17 ? 168  DC  J N4    1 
ATOM   3430  C C5    . DC  B 1 22  ? -54.618 33.172  -20.203 1.00 135.17 ? 168  DC  J C5    1 
ATOM   3431  C C6    . DC  B 1 22  ? -55.372 34.073  -19.556 1.00 135.17 ? 168  DC  J C6    1 
ATOM   3432  P P     . DT  B 1 23  ? -57.500 36.853  -14.781 1.00 108.25 ? 169  DT  J P     1 
ATOM   3433  O OP1   . DT  B 1 23  ? -58.487 37.515  -13.863 1.00 116.81 ? 169  DT  J OP1   1 
ATOM   3434  O OP2   . DT  B 1 23  ? -56.045 37.221  -14.690 1.00 116.81 ? 169  DT  J OP2   1 
ATOM   3435  O "O5'" . DT  B 1 23  ? -57.640 35.278  -14.640 1.00 108.25 ? 169  DT  J "O5'" 1 
ATOM   3436  C "C5'" . DT  B 1 23  ? -58.913 34.661  -14.447 1.00 108.25 ? 169  DT  J "C5'" 1 
ATOM   3437  C "C4'" . DT  B 1 23  ? -58.738 33.404  -13.623 1.00 108.25 ? 169  DT  J "C4'" 1 
ATOM   3438  O "O4'" . DT  B 1 23  ? -58.080 32.408  -14.453 1.00 108.25 ? 169  DT  J "O4'" 1 
ATOM   3439  C "C3'" . DT  B 1 23  ? -57.815 33.622  -12.407 1.00 108.25 ? 169  DT  J "C3'" 1 
ATOM   3440  O "O3'" . DT  B 1 23  ? -58.197 32.894  -11.205 1.00 108.25 ? 169  DT  J "O3'" 1 
ATOM   3441  C "C2'" . DT  B 1 23  ? -56.455 33.158  -12.899 1.00 108.25 ? 169  DT  J "C2'" 1 
ATOM   3442  C "C1'" . DT  B 1 23  ? -56.797 32.066  -13.899 1.00 108.25 ? 169  DT  J "C1'" 1 
ATOM   3443  N N1    . DT  B 1 23  ? -55.799 31.985  -15.000 1.00 116.81 ? 169  DT  J N1    1 
ATOM   3444  C C2    . DT  B 1 23  ? -55.512 30.752  -15.540 1.00 116.81 ? 169  DT  J C2    1 
ATOM   3445  O O2    . DT  B 1 23  ? -56.067 29.724  -15.190 1.00 116.81 ? 169  DT  J O2    1 
ATOM   3446  N N3    . DT  B 1 23  ? -54.547 30.765  -16.527 1.00 116.81 ? 169  DT  J N3    1 
ATOM   3447  C C4    . DT  B 1 23  ? -53.881 31.866  -17.036 1.00 116.81 ? 169  DT  J C4    1 
ATOM   3448  O O4    . DT  B 1 23  ? -53.057 31.721  -17.936 1.00 116.81 ? 169  DT  J O4    1 
ATOM   3449  C C5    . DT  B 1 23  ? -54.242 33.130  -16.439 1.00 116.81 ? 169  DT  J C5    1 
ATOM   3450  C C7    . DT  B 1 23  ? -53.583 34.382  -16.938 1.00 116.81 ? 169  DT  J C7    1 
ATOM   3451  C C6    . DT  B 1 23  ? -55.165 33.126  -15.461 1.00 116.81 ? 169  DT  J C6    1 
ATOM   3452  P P     . DA  B 1 24  ? -57.201 32.875  -9.912  1.00 162.60 ? 170  DA  J P     1 
ATOM   3453  O OP1   . DA  B 1 24  ? -58.030 32.647  -8.699  1.00 124.74 ? 170  DA  J OP1   1 
ATOM   3454  O OP2   . DA  B 1 24  ? -56.253 34.037  -9.930  1.00 124.74 ? 170  DA  J OP2   1 
ATOM   3455  O "O5'" . DA  B 1 24  ? -56.321 31.576  -10.176 1.00 162.60 ? 170  DA  J "O5'" 1 
ATOM   3456  C "C5'" . DA  B 1 24  ? -56.900 30.415  -10.759 1.00 162.60 ? 170  DA  J "C5'" 1 
ATOM   3457  C "C4'" . DA  B 1 24  ? -55.880 29.304  -10.792 1.00 162.60 ? 170  DA  J "C4'" 1 
ATOM   3458  O "O4'" . DA  B 1 24  ? -55.033 29.372  -11.967 1.00 162.60 ? 170  DA  J "O4'" 1 
ATOM   3459  C "C3'" . DA  B 1 24  ? -54.935 29.364  -9.599  1.00 162.60 ? 170  DA  J "C3'" 1 
ATOM   3460  O "O3'" . DA  B 1 24  ? -54.639 28.037  -9.184  1.00 162.60 ? 170  DA  J "O3'" 1 
ATOM   3461  C "C2'" . DA  B 1 24  ? -53.690 30.016  -10.180 1.00 162.60 ? 170  DA  J "C2'" 1 
ATOM   3462  C "C1'" . DA  B 1 24  ? -53.666 29.396  -11.561 1.00 162.60 ? 170  DA  J "C1'" 1 
ATOM   3463  N N9    . DA  B 1 24  ? -52.883 30.086  -12.598 1.00 124.74 ? 170  DA  J N9    1 
ATOM   3464  C C8    . DA  B 1 24  ? -52.595 31.428  -12.730 1.00 124.74 ? 170  DA  J C8    1 
ATOM   3465  N N7    . DA  B 1 24  ? -51.942 31.724  -13.829 1.00 124.74 ? 170  DA  J N7    1 
ATOM   3466  C C5    . DA  B 1 24  ? -51.772 30.496  -14.456 1.00 124.74 ? 170  DA  J C5    1 
ATOM   3467  C C6    . DA  B 1 24  ? -51.183 30.130  -15.683 1.00 124.74 ? 170  DA  J C6    1 
ATOM   3468  N N6    . DA  B 1 24  ? -50.638 31.003  -16.540 1.00 124.74 ? 170  DA  J N6    1 
ATOM   3469  N N1    . DA  B 1 24  ? -51.179 28.817  -16.006 1.00 124.74 ? 170  DA  J N1    1 
ATOM   3470  C C2    . DA  B 1 24  ? -51.730 27.940  -15.151 1.00 124.74 ? 170  DA  J C2    1 
ATOM   3471  N N3    . DA  B 1 24  ? -52.321 28.161  -13.983 1.00 124.74 ? 170  DA  J N3    1 
ATOM   3472  C C4    . DA  B 1 24  ? -52.316 29.475  -13.693 1.00 124.74 ? 170  DA  J C4    1 
ATOM   3473  P P     . DC  B 1 25  ? -54.959 27.588  -7.681  1.00 143.87 ? 171  DC  J P     1 
ATOM   3474  O OP1   . DC  B 1 25  ? -56.405 27.200  -7.655  1.00 97.19  ? 171  DC  J OP1   1 
ATOM   3475  O OP2   . DC  B 1 25  ? -54.459 28.683  -6.767  1.00 97.19  ? 171  DC  J OP2   1 
ATOM   3476  O "O5'" . DC  B 1 25  ? -54.094 26.255  -7.531  1.00 143.87 ? 171  DC  J "O5'" 1 
ATOM   3477  C "C5'" . DC  B 1 25  ? -54.415 25.092  -8.295  1.00 143.87 ? 171  DC  J "C5'" 1 
ATOM   3478  C "C4'" . DC  B 1 25  ? -53.156 24.425  -8.800  1.00 143.87 ? 171  DC  J "C4'" 1 
ATOM   3479  O "O4'" . DC  B 1 25  ? -52.538 25.238  -9.822  1.00 143.87 ? 171  DC  J "O4'" 1 
ATOM   3480  C "C3'" . DC  B 1 25  ? -52.048 24.126  -7.778  1.00 143.87 ? 171  DC  J "C3'" 1 
ATOM   3481  O "O3'" . DC  B 1 25  ? -51.581 22.797  -8.040  1.00 143.87 ? 171  DC  J "O3'" 1 
ATOM   3482  C "C2'" . DC  B 1 25  ? -50.960 25.137  -8.121  1.00 143.87 ? 171  DC  J "C2'" 1 
ATOM   3483  C "C1'" . DC  B 1 25  ? -51.134 25.271  -9.617  1.00 143.87 ? 171  DC  J "C1'" 1 
ATOM   3484  N N1    . DC  B 1 25  ? -50.626 26.509  -10.231 1.00 97.19  ? 171  DC  J N1    1 
ATOM   3485  C C2    . DC  B 1 25  ? -49.698 26.415  -11.284 1.00 97.19  ? 171  DC  J C2    1 
ATOM   3486  O O2    . DC  B 1 25  ? -49.305 25.297  -11.627 1.00 97.19  ? 171  DC  J O2    1 
ATOM   3487  N N3    . DC  B 1 25  ? -49.260 27.547  -11.895 1.00 97.19  ? 171  DC  J N3    1 
ATOM   3488  C C4    . DC  B 1 25  ? -49.710 28.736  -11.492 1.00 97.19  ? 171  DC  J C4    1 
ATOM   3489  N N4    . DC  B 1 25  ? -49.281 29.817  -12.137 1.00 97.19  ? 171  DC  J N4    1 
ATOM   3490  C C5    . DC  B 1 25  ? -50.634 28.867  -10.407 1.00 97.19  ? 171  DC  J C5    1 
ATOM   3491  C C6    . DC  B 1 25  ? -51.062 27.736  -9.808  1.00 97.19  ? 171  DC  J C6    1 
ATOM   3492  P P     . DC  B 1 26  ? -50.378 22.161  -7.192  1.00 85.65  ? 172  DC  J P     1 
ATOM   3493  O OP1   . DC  B 1 26  ? -50.470 20.685  -7.411  1.00 115.22 ? 172  DC  J OP1   1 
ATOM   3494  O OP2   . DC  B 1 26  ? -50.334 22.708  -5.830  1.00 115.22 ? 172  DC  J OP2   1 
ATOM   3495  O "O5'" . DC  B 1 26  ? -49.056 22.683  -7.923  1.00 85.65  ? 172  DC  J "O5'" 1 
ATOM   3496  C "C5'" . DC  B 1 26  ? -48.401 21.870  -8.914  1.00 85.65  ? 172  DC  J "C5'" 1 
ATOM   3497  C "C4'" . DC  B 1 26  ? -46.919 22.162  -8.950  1.00 85.65  ? 172  DC  J "C4'" 1 
ATOM   3498  O "O4'" . DC  B 1 26  ? -46.680 23.444  -9.589  1.00 85.65  ? 172  DC  J "O4'" 1 
ATOM   3499  C "C3'" . DC  B 1 26  ? -46.216 22.240  -7.600  1.00 85.65  ? 172  DC  J "C3'" 1 
ATOM   3500  O "O3'" . DC  B 1 26  ? -44.930 21.614  -7.724  1.00 85.65  ? 172  DC  J "O3'" 1 
ATOM   3501  C "C2'" . DC  B 1 26  ? -46.055 23.745  -7.393  1.00 85.65  ? 172  DC  J "C2'" 1 
ATOM   3502  C "C1'" . DC  B 1 26  ? -45.785 24.213  -8.809  1.00 85.65  ? 172  DC  J "C1'" 1 
ATOM   3503  N N1    . DC  B 1 26  ? -46.004 25.637  -9.140  1.00 115.22 ? 172  DC  J N1    1 
ATOM   3504  C C2    . DC  B 1 26  ? -45.324 26.182  -10.221 1.00 115.22 ? 172  DC  J C2    1 
ATOM   3505  O O2    . DC  B 1 26  ? -44.557 25.467  -10.860 1.00 115.22 ? 172  DC  J O2    1 
ATOM   3506  N N3    . DC  B 1 26  ? -45.523 27.463  -10.541 1.00 115.22 ? 172  DC  J N3    1 
ATOM   3507  C C4    . DC  B 1 26  ? -46.374 28.198  -9.834  1.00 115.22 ? 172  DC  J C4    1 
ATOM   3508  N N4    . DC  B 1 26  ? -46.564 29.453  -10.213 1.00 115.22 ? 172  DC  J N4    1 
ATOM   3509  C C5    . DC  B 1 26  ? -47.074 27.673  -8.719  1.00 115.22 ? 172  DC  J C5    1 
ATOM   3510  C C6    . DC  B 1 26  ? -46.860 26.400  -8.412  1.00 115.22 ? 172  DC  J C6    1 
ATOM   3511  P P     . DA  B 1 27  ? -44.734 20.056  -7.306  1.00 86.69  ? 173  DA  J P     1 
ATOM   3512  O OP1   . DA  B 1 27  ? -45.865 19.272  -7.929  1.00 99.60  ? 173  DA  J OP1   1 
ATOM   3513  O OP2   . DA  B 1 27  ? -44.491 19.978  -5.827  1.00 99.60  ? 173  DA  J OP2   1 
ATOM   3514  O "O5'" . DA  B 1 27  ? -43.374 19.615  -8.039  1.00 86.69  ? 173  DA  J "O5'" 1 
ATOM   3515  C "C5'" . DA  B 1 27  ? -43.373 19.129  -9.396  1.00 86.69  ? 173  DA  J "C5'" 1 
ATOM   3516  C "C4'" . DA  B 1 27  ? -42.251 19.783  -10.169 1.00 86.69  ? 173  DA  J "C4'" 1 
ATOM   3517  O "O4'" . DA  B 1 27  ? -42.493 21.205  -10.139 1.00 86.69  ? 173  DA  J "O4'" 1 
ATOM   3518  C "C3'" . DA  B 1 27  ? -40.872 19.616  -9.515  1.00 86.69  ? 173  DA  J "C3'" 1 
ATOM   3519  O "O3'" . DA  B 1 27  ? -39.838 20.011  -10.414 1.00 86.69  ? 173  DA  J "O3'" 1 
ATOM   3520  C "C2'" . DA  B 1 27  ? -40.803 20.819  -8.592  1.00 86.69  ? 173  DA  J "C2'" 1 
ATOM   3521  C "C1'" . DA  B 1 27  ? -41.392 21.854  -9.514  1.00 86.69  ? 173  DA  J "C1'" 1 
ATOM   3522  N N9    . DA  B 1 27  ? -41.889 23.044  -8.854  1.00 99.60  ? 173  DA  J N9    1 
ATOM   3523  C C8    . DA  B 1 27  ? -42.494 23.107  -7.632  1.00 99.60  ? 173  DA  J C8    1 
ATOM   3524  N N7    . DA  B 1 27  ? -42.885 24.310  -7.298  1.00 99.60  ? 173  DA  J N7    1 
ATOM   3525  C C5    . DA  B 1 27  ? -42.512 25.096  -8.373  1.00 99.60  ? 173  DA  J C5    1 
ATOM   3526  C C6    . DA  B 1 27  ? -42.659 26.475  -8.632  1.00 99.60  ? 173  DA  J C6    1 
ATOM   3527  N N6    . DA  B 1 27  ? -43.288 27.330  -7.806  1.00 99.60  ? 173  DA  J N6    1 
ATOM   3528  N N1    . DA  B 1 27  ? -42.145 26.952  -9.791  1.00 99.60  ? 173  DA  J N1    1 
ATOM   3529  C C2    . DA  B 1 27  ? -41.552 26.087  -10.634 1.00 99.60  ? 173  DA  J C2    1 
ATOM   3530  N N3    . DA  B 1 27  ? -41.363 24.771  -10.503 1.00 99.60  ? 173  DA  J N3    1 
ATOM   3531  C C4    . DA  B 1 27  ? -41.874 24.330  -9.337  1.00 99.60  ? 173  DA  J C4    1 
ATOM   3532  P P     . DA  B 1 28  ? -38.870 18.948  -11.118 1.00 93.91  ? 174  DA  J P     1 
ATOM   3533  O OP1   . DA  B 1 28  ? -39.692 17.997  -11.940 1.00 69.72  ? 174  DA  J OP1   1 
ATOM   3534  O OP2   . DA  B 1 28  ? -37.825 18.445  -10.186 1.00 69.72  ? 174  DA  J OP2   1 
ATOM   3535  O "O5'" . DA  B 1 28  ? -38.090 19.908  -12.113 1.00 93.91  ? 174  DA  J "O5'" 1 
ATOM   3536  C "C5'" . DA  B 1 28  ? -38.808 20.694  -13.051 1.00 93.91  ? 174  DA  J "C5'" 1 
ATOM   3537  C "C4'" . DA  B 1 28  ? -38.262 22.099  -13.074 1.00 93.91  ? 174  DA  J "C4'" 1 
ATOM   3538  O "O4'" . DA  B 1 28  ? -38.775 22.965  -12.031 1.00 93.91  ? 174  DA  J "O4'" 1 
ATOM   3539  C "C3'" . DA  B 1 28  ? -36.747 22.207  -12.991 1.00 93.91  ? 174  DA  J "C3'" 1 
ATOM   3540  O "O3'" . DA  B 1 28  ? -36.360 23.189  -13.939 1.00 93.91  ? 174  DA  J "O3'" 1 
ATOM   3541  C "C2'" . DA  B 1 28  ? -36.506 22.709  -11.578 1.00 93.91  ? 174  DA  J "C2'" 1 
ATOM   3542  C "C1'" . DA  B 1 28  ? -37.694 23.634  -11.406 1.00 93.91  ? 174  DA  J "C1'" 1 
ATOM   3543  N N9    . DA  B 1 28  ? -38.094 23.906  -10.032 1.00 69.72  ? 174  DA  J N9    1 
ATOM   3544  C C8    . DA  B 1 28  ? -38.142 23.021  -8.994  1.00 69.72  ? 174  DA  J C8    1 
ATOM   3545  N N7    . DA  B 1 28  ? -38.618 23.542  -7.891  1.00 69.72  ? 174  DA  J N7    1 
ATOM   3546  C C5    . DA  B 1 28  ? -38.879 24.861  -8.233  1.00 69.72  ? 174  DA  J C5    1 
ATOM   3547  C C6    . DA  B 1 28  ? -39.401 25.925  -7.518  1.00 69.72  ? 174  DA  J C6    1 
ATOM   3548  N N6    . DA  B 1 28  ? -39.779 25.856  -6.238  1.00 69.72  ? 174  DA  J N6    1 
ATOM   3549  N N1    . DA  B 1 28  ? -39.535 27.094  -8.152  1.00 69.72  ? 174  DA  J N1    1 
ATOM   3550  C C2    . DA  B 1 28  ? -39.163 27.178  -9.397  1.00 69.72  ? 174  DA  J C2    1 
ATOM   3551  N N3    . DA  B 1 28  ? -38.665 26.256  -10.175 1.00 69.72  ? 174  DA  J N3    1 
ATOM   3552  C C4    . DA  B 1 28  ? -38.549 25.101  -9.530  1.00 69.72  ? 174  DA  J C4    1 
ATOM   3553  P P     . DA  B 1 29  ? -35.064 22.942  -14.831 1.00 72.84  ? 175  DA  J P     1 
ATOM   3554  O OP1   . DA  B 1 29  ? -35.421 23.239  -16.269 1.00 74.45  ? 175  DA  J OP1   1 
ATOM   3555  O OP2   . DA  B 1 29  ? -34.482 21.627  -14.433 1.00 74.45  ? 175  DA  J OP2   1 
ATOM   3556  O "O5'" . DA  B 1 29  ? -34.036 23.980  -14.247 1.00 72.84  ? 175  DA  J "O5'" 1 
ATOM   3557  C "C5'" . DA  B 1 29  ? -34.450 24.778  -13.192 1.00 72.84  ? 175  DA  J "C5'" 1 
ATOM   3558  C "C4'" . DA  B 1 29  ? -34.930 26.091  -13.741 1.00 72.84  ? 175  DA  J "C4'" 1 
ATOM   3559  O "O4'" . DA  B 1 29  ? -35.897 26.590  -12.812 1.00 72.84  ? 175  DA  J "O4'" 1 
ATOM   3560  C "C3'" . DA  B 1 29  ? -33.809 27.115  -13.769 1.00 72.84  ? 175  DA  J "C3'" 1 
ATOM   3561  O "O3'" . DA  B 1 29  ? -34.148 28.162  -14.671 1.00 72.84  ? 175  DA  J "O3'" 1 
ATOM   3562  C "C2'" . DA  B 1 29  ? -33.806 27.601  -12.339 1.00 72.84  ? 175  DA  J "C2'" 1 
ATOM   3563  C "C1'" . DA  B 1 29  ? -35.255 27.447  -11.885 1.00 72.84  ? 175  DA  J "C1'" 1 
ATOM   3564  N N9    . DA  B 1 29  ? -35.453 26.891  -10.533 1.00 74.45  ? 175  DA  J N9    1 
ATOM   3565  C C8    . DA  B 1 29  ? -35.345 25.591  -10.060 1.00 74.45  ? 175  DA  J C8    1 
ATOM   3566  N N7    . DA  B 1 29  ? -35.708 25.461  -8.801  1.00 74.45  ? 175  DA  J N7    1 
ATOM   3567  C C5    . DA  B 1 29  ? -36.041 26.754  -8.419  1.00 74.45  ? 175  DA  J C5    1 
ATOM   3568  C C6    . DA  B 1 29  ? -36.491 27.287  -7.230  1.00 74.45  ? 175  DA  J C6    1 
ATOM   3569  N N6    . DA  B 1 29  ? -36.756 26.567  -6.163  1.00 74.45  ? 175  DA  J N6    1 
ATOM   3570  N N1    . DA  B 1 29  ? -36.683 28.612  -7.162  1.00 74.45  ? 175  DA  J N1    1 
ATOM   3571  C C2    . DA  B 1 29  ? -36.456 29.344  -8.233  1.00 74.45  ? 175  DA  J C2    1 
ATOM   3572  N N3    . DA  B 1 29  ? -36.052 28.967  -9.424  1.00 74.45  ? 175  DA  J N3    1 
ATOM   3573  C C4    . DA  B 1 29  ? -35.859 27.641  -9.456  1.00 74.45  ? 175  DA  J C4    1 
ATOM   3574  P P     . DA  B 1 30  ? -33.042 29.245  -15.132 1.00 60.05  ? 176  DA  J P     1 
ATOM   3575  O OP1   . DA  B 1 30  ? -33.670 30.036  -16.241 1.00 73.37  ? 176  DA  J OP1   1 
ATOM   3576  O OP2   . DA  B 1 30  ? -31.724 28.530  -15.342 1.00 73.37  ? 176  DA  J OP2   1 
ATOM   3577  O "O5'" . DA  B 1 30  ? -32.952 30.252  -13.900 1.00 60.05  ? 176  DA  J "O5'" 1 
ATOM   3578  C "C5'" . DA  B 1 30  ? -33.965 31.185  -13.731 1.00 60.05  ? 176  DA  J "C5'" 1 
ATOM   3579  C "C4'" . DA  B 1 30  ? -33.661 32.026  -12.529 1.00 60.05  ? 176  DA  J "C4'" 1 
ATOM   3580  O "O4'" . DA  B 1 30  ? -33.987 31.279  -11.336 1.00 60.05  ? 176  DA  J "O4'" 1 
ATOM   3581  C "C3'" . DA  B 1 30  ? -32.205 32.447  -12.417 1.00 60.05  ? 176  DA  J "C3'" 1 
ATOM   3582  O "O3'" . DA  B 1 30  ? -32.232 33.816  -12.011 1.00 60.05  ? 176  DA  J "O3'" 1 
ATOM   3583  C "C2'" . DA  B 1 30  ? -31.678 31.526  -11.335 1.00 60.05  ? 176  DA  J "C2'" 1 
ATOM   3584  C "C1'" . DA  B 1 30  ? -32.904 31.328  -10.432 1.00 60.05  ? 176  DA  J "C1'" 1 
ATOM   3585  N N9    . DA  B 1 30  ? -32.965 30.122  -9.553  1.00 73.37  ? 176  DA  J N9    1 
ATOM   3586  C C8    . DA  B 1 30  ? -32.633 28.831  -9.897  1.00 73.37  ? 176  DA  J C8    1 
ATOM   3587  N N7    . DA  B 1 30  ? -32.785 27.951  -8.932  1.00 73.37  ? 176  DA  J N7    1 
ATOM   3588  C C5    . DA  B 1 30  ? -33.235 28.702  -7.868  1.00 73.37  ? 176  DA  J C5    1 
ATOM   3589  C C6    . DA  B 1 30  ? -33.558 28.351  -6.547  1.00 73.37  ? 176  DA  J C6    1 
ATOM   3590  N N6    . DA  B 1 30  ? -33.475 27.105  -6.070  1.00 73.37  ? 176  DA  J N6    1 
ATOM   3591  N N1    . DA  B 1 30  ? -33.968 29.339  -5.719  1.00 73.37  ? 176  DA  J N1    1 
ATOM   3592  C C2    . DA  B 1 30  ? -34.050 30.583  -6.193  1.00 73.37  ? 176  DA  J C2    1 
ATOM   3593  N N3    . DA  B 1 30  ? -33.778 31.043  -7.415  1.00 73.37  ? 176  DA  J N3    1 
ATOM   3594  C C4    . DA  B 1 30  ? -33.363 30.045  -8.223  1.00 73.37  ? 176  DA  J C4    1 
ATOM   3595  P P     . DG  B 1 31  ? -30.885 34.714  -12.019 1.00 73.22  ? 177  DG  J P     1 
ATOM   3596  O OP1   . DG  B 1 31  ? -30.896 35.817  -13.047 1.00 84.11  ? 177  DG  J OP1   1 
ATOM   3597  O OP2   . DG  B 1 31  ? -29.706 33.799  -11.936 1.00 84.11  ? 177  DG  J OP2   1 
ATOM   3598  O "O5'" . DG  B 1 31  ? -30.987 35.407  -10.587 1.00 73.22  ? 177  DG  J "O5'" 1 
ATOM   3599  C "C5'" . DG  B 1 31  ? -32.263 35.698  -10.026 1.00 73.22  ? 177  DG  J "C5'" 1 
ATOM   3600  C "C4'" . DG  B 1 31  ? -32.200 35.751  -8.518  1.00 73.22  ? 177  DG  J "C4'" 1 
ATOM   3601  O "O4'" . DG  B 1 31  ? -32.306 34.432  -7.942  1.00 73.22  ? 177  DG  J "O4'" 1 
ATOM   3602  C "C3'" . DG  B 1 31  ? -30.949 36.385  -7.940  1.00 73.22  ? 177  DG  J "C3'" 1 
ATOM   3603  O "O3'" . DG  B 1 31  ? -31.270 37.332  -6.926  1.00 73.22  ? 177  DG  J "O3'" 1 
ATOM   3604  C "C2'" . DG  B 1 31  ? -30.197 35.202  -7.351  1.00 73.22  ? 177  DG  J "C2'" 1 
ATOM   3605  C "C1'" . DG  B 1 31  ? -31.326 34.270  -6.934  1.00 73.22  ? 177  DG  J "C1'" 1 
ATOM   3606  N N9    . DG  B 1 31  ? -31.001 32.841  -6.841  1.00 84.11  ? 177  DG  J N9    1 
ATOM   3607  C C8    . DG  B 1 31  ? -30.531 32.038  -7.851  1.00 84.11  ? 177  DG  J C8    1 
ATOM   3608  N N7    . DG  B 1 31  ? -30.363 30.789  -7.497  1.00 84.11  ? 177  DG  J N7    1 
ATOM   3609  C C5    . DG  B 1 31  ? -30.736 30.760  -6.164  1.00 84.11  ? 177  DG  J C5    1 
ATOM   3610  C C6    . DG  B 1 31  ? -30.758 29.670  -5.225  1.00 84.11  ? 177  DG  J C6    1 
ATOM   3611  O O6    . DG  B 1 31  ? -30.492 28.464  -5.411  1.00 84.11  ? 177  DG  J O6    1 
ATOM   3612  N N1    . DG  B 1 31  ? -31.157 30.097  -3.967  1.00 84.11  ? 177  DG  J N1    1 
ATOM   3613  C C2    . DG  B 1 31  ? -31.520 31.382  -3.648  1.00 84.11  ? 177  DG  J C2    1 
ATOM   3614  N N2    . DG  B 1 31  ? -31.889 31.581  -2.369  1.00 84.11  ? 177  DG  J N2    1 
ATOM   3615  N N3    . DG  B 1 31  ? -31.528 32.396  -4.511  1.00 84.11  ? 177  DG  J N3    1 
ATOM   3616  C C4    . DG  B 1 31  ? -31.122 32.021  -5.738  1.00 84.11  ? 177  DG  J C4    1 
ATOM   3617  P P     . DT  B 1 32  ? -30.060 38.066  -6.142  1.00 89.35  ? 178  DT  J P     1 
ATOM   3618  O OP1   . DT  B 1 32  ? -30.556 39.415  -5.832  1.00 93.12  ? 178  DT  J OP1   1 
ATOM   3619  O OP2   . DT  B 1 32  ? -28.741 37.918  -6.820  1.00 93.12  ? 178  DT  J OP2   1 
ATOM   3620  O "O5'" . DT  B 1 32  ? -29.920 37.186  -4.816  1.00 89.35  ? 178  DT  J "O5'" 1 
ATOM   3621  C "C5'" . DT  B 1 32  ? -31.025 37.077  -3.926  1.00 89.35  ? 178  DT  J "C5'" 1 
ATOM   3622  C "C4'" . DT  B 1 32  ? -30.574 36.597  -2.568  1.00 89.35  ? 178  DT  J "C4'" 1 
ATOM   3623  O "O4'" . DT  B 1 32  ? -30.375 35.159  -2.553  1.00 89.35  ? 178  DT  J "O4'" 1 
ATOM   3624  C "C3'" . DT  B 1 32  ? -29.244 37.200  -2.106  1.00 89.35  ? 178  DT  J "C3'" 1 
ATOM   3625  O "O3'" . DT  B 1 32  ? -29.303 37.556  -0.711  1.00 89.35  ? 178  DT  J "O3'" 1 
ATOM   3626  C "C2'" . DT  B 1 32  ? -28.243 36.070  -2.323  1.00 89.35  ? 178  DT  J "C2'" 1 
ATOM   3627  C "C1'" . DT  B 1 32  ? -29.091 34.853  -2.018  1.00 89.35  ? 178  DT  J "C1'" 1 
ATOM   3628  N N1    . DT  B 1 32  ? -28.623 33.597  -2.637  1.00 93.12  ? 178  DT  J N1    1 
ATOM   3629  C C2    . DT  B 1 32  ? -28.467 32.455  -1.851  1.00 93.12  ? 178  DT  J C2    1 
ATOM   3630  O O2    . DT  B 1 32  ? -28.650 32.430  -0.651  1.00 93.12  ? 178  DT  J O2    1 
ATOM   3631  N N3    . DT  B 1 32  ? -28.073 31.338  -2.530  1.00 93.12  ? 178  DT  J N3    1 
ATOM   3632  C C4    . DT  B 1 32  ? -27.801 31.237  -3.866  1.00 93.12  ? 178  DT  J C4    1 
ATOM   3633  O O4    . DT  B 1 32  ? -27.462 30.158  -4.319  1.00 93.12  ? 178  DT  J O4    1 
ATOM   3634  C C5    . DT  B 1 32  ? -27.950 32.471  -4.639  1.00 93.12  ? 178  DT  J C5    1 
ATOM   3635  C C7    . DT  B 1 32  ? -27.649 32.460  -6.106  1.00 93.12  ? 178  DT  J C7    1 
ATOM   3636  C C6    . DT  B 1 32  ? -28.355 33.572  -3.985  1.00 93.12  ? 178  DT  J C6    1 
ATOM   3637  P P     . DG  B 1 33  ? -28.112 38.411  -0.036  1.00 101.07 ? 179  DG  J P     1 
ATOM   3638  O OP1   . DG  B 1 33  ? -28.741 39.464  0.796   1.00 81.22  ? 179  DG  J OP1   1 
ATOM   3639  O OP2   . DG  B 1 33  ? -27.085 38.786  -1.027  1.00 81.22  ? 179  DG  J OP2   1 
ATOM   3640  O "O5'" . DG  B 1 33  ? -27.448 37.344  0.915   1.00 101.07 ? 179  DG  J "O5'" 1 
ATOM   3641  C "C5'" . DG  B 1 33  ? -28.256 36.600  1.790   1.00 101.07 ? 179  DG  J "C5'" 1 
ATOM   3642  C "C4'" . DG  B 1 33  ? -27.385 35.626  2.528   1.00 101.07 ? 179  DG  J "C4'" 1 
ATOM   3643  O "O4'" . DG  B 1 33  ? -27.153 34.439  1.718   1.00 101.07 ? 179  DG  J "O4'" 1 
ATOM   3644  C "C3'" . DG  B 1 33  ? -26.006 36.237  2.801   1.00 101.07 ? 179  DG  J "C3'" 1 
ATOM   3645  O "O3'" . DG  B 1 33  ? -25.518 35.746  4.058   1.00 101.07 ? 179  DG  J "O3'" 1 
ATOM   3646  C "C2'" . DG  B 1 33  ? -25.162 35.688  1.665   1.00 101.07 ? 179  DG  J "C2'" 1 
ATOM   3647  C "C1'" . DG  B 1 33  ? -25.738 34.260  1.571   1.00 101.07 ? 179  DG  J "C1'" 1 
ATOM   3648  N N9    . DG  B 1 33  ? -25.451 33.573  0.306   1.00 81.22  ? 179  DG  J N9    1 
ATOM   3649  C C8    . DG  B 1 33  ? -25.201 34.198  -0.889  1.00 81.22  ? 179  DG  J C8    1 
ATOM   3650  N N7    . DG  B 1 33  ? -24.898 33.374  -1.846  1.00 81.22  ? 179  DG  J N7    1 
ATOM   3651  C C5    . DG  B 1 33  ? -24.951 32.121  -1.269  1.00 81.22  ? 179  DG  J C5    1 
ATOM   3652  C C6    . DG  B 1 33  ? -24.653 30.838  -1.818  1.00 81.22  ? 179  DG  J C6    1 
ATOM   3653  O O6    . DG  B 1 33  ? -24.247 30.565  -2.963  1.00 81.22  ? 179  DG  J O6    1 
ATOM   3654  N N1    . DG  B 1 33  ? -24.833 29.818  -0.886  1.00 81.22  ? 179  DG  J N1    1 
ATOM   3655  C C2    . DG  B 1 33  ? -25.217 30.007  0.417   1.00 81.22  ? 179  DG  J C2    1 
ATOM   3656  N N2    . DG  B 1 33  ? -25.314 28.877  1.154   1.00 81.22  ? 179  DG  J N2    1 
ATOM   3657  N N3    . DG  B 1 33  ? -25.477 31.206  0.953   1.00 81.22  ? 179  DG  J N3    1 
ATOM   3658  C C4    . DG  B 1 33  ? -25.322 32.208  0.059   1.00 81.22  ? 179  DG  J C4    1 
ATOM   3659  P P     . DT  B 1 34  ? -23.940 35.833  4.396   1.00 114.90 ? 180  DT  J P     1 
ATOM   3660  O OP1   . DT  B 1 34  ? -23.927 36.129  5.863   1.00 107.56 ? 180  DT  J OP1   1 
ATOM   3661  O OP2   . DT  B 1 34  ? -23.272 36.792  3.429   1.00 107.56 ? 180  DT  J OP2   1 
ATOM   3662  O "O5'" . DT  B 1 34  ? -23.410 34.328  4.187   1.00 114.90 ? 180  DT  J "O5'" 1 
ATOM   3663  C "C5'" . DT  B 1 34  ? -24.000 33.241  4.931   1.00 114.90 ? 180  DT  J "C5'" 1 
ATOM   3664  C "C4'" . DT  B 1 34  ? -23.041 32.074  5.073   1.00 114.90 ? 180  DT  J "C4'" 1 
ATOM   3665  O "O4'" . DT  B 1 34  ? -22.943 31.362  3.817   1.00 114.90 ? 180  DT  J "O4'" 1 
ATOM   3666  C "C3'" . DT  B 1 34  ? -21.601 32.412  5.487   1.00 114.90 ? 180  DT  J "C3'" 1 
ATOM   3667  O "O3'" . DT  B 1 34  ? -21.086 31.409  6.383   1.00 114.90 ? 180  DT  J "O3'" 1 
ATOM   3668  C "C2'" . DT  B 1 34  ? -20.868 32.442  4.165   1.00 114.90 ? 180  DT  J "C2'" 1 
ATOM   3669  C "C1'" . DT  B 1 34  ? -21.597 31.358  3.375   1.00 114.90 ? 180  DT  J "C1'" 1 
ATOM   3670  N N1    . DT  B 1 34  ? -21.581 31.527  1.901   1.00 107.56 ? 180  DT  J N1    1 
ATOM   3671  C C2    . DT  B 1 34  ? -21.493 30.402  1.112   1.00 107.56 ? 180  DT  J C2    1 
ATOM   3672  O O2    . DT  B 1 34  ? -21.598 29.263  1.545   1.00 107.56 ? 180  DT  J O2    1 
ATOM   3673  N N3    . DT  B 1 34  ? -21.303 30.662  -0.225  1.00 107.56 ? 180  DT  J N3    1 
ATOM   3674  C C4    . DT  B 1 34  ? -21.244 31.902  -0.843  1.00 107.56 ? 180  DT  J C4    1 
ATOM   3675  O O4    . DT  B 1 34  ? -21.000 31.981  -2.045  1.00 107.56 ? 180  DT  J O4    1 
ATOM   3676  C C5    . DT  B 1 34  ? -21.459 33.032  0.029   1.00 107.56 ? 180  DT  J C5    1 
ATOM   3677  C C7    . DT  B 1 34  ? -21.518 34.413  -0.559  1.00 107.56 ? 180  DT  J C7    1 
ATOM   3678  C C6    . DT  B 1 34  ? -21.605 32.788  1.341   1.00 107.56 ? 180  DT  J C6    1 
ATOM   3679  P P     . DA  B 1 35  ? -19.526 31.001  6.358   1.00 120.84 ? 181  DA  J P     1 
ATOM   3680  O OP1   . DA  B 1 35  ? -19.294 30.071  7.479   1.00 68.85  ? 181  DA  J OP1   1 
ATOM   3681  O OP2   . DA  B 1 35  ? -18.618 32.159  6.158   1.00 68.85  ? 181  DA  J OP2   1 
ATOM   3682  O "O5'" . DA  B 1 35  ? -19.428 30.057  5.093   1.00 120.84 ? 181  DA  J "O5'" 1 
ATOM   3683  C "C5'" . DA  B 1 35  ? -19.844 28.691  5.181   1.00 120.84 ? 181  DA  J "C5'" 1 
ATOM   3684  C "C4'" . DA  B 1 35  ? -18.767 27.800  4.609   1.00 120.84 ? 181  DA  J "C4'" 1 
ATOM   3685  O "O4'" . DA  B 1 35  ? -18.654 28.036  3.179   1.00 120.84 ? 181  DA  J "O4'" 1 
ATOM   3686  C "C3'" . DA  B 1 35  ? -17.395 28.128  5.197   1.00 120.84 ? 181  DA  J "C3'" 1 
ATOM   3687  O "O3'" . DA  B 1 35  ? -16.636 26.925  5.371   1.00 120.84 ? 181  DA  J "O3'" 1 
ATOM   3688  C "C2'" . DA  B 1 35  ? -16.790 29.097  4.189   1.00 120.84 ? 181  DA  J "C2'" 1 
ATOM   3689  C "C1'" . DA  B 1 35  ? -17.379 28.613  2.868   1.00 120.84 ? 181  DA  J "C1'" 1 
ATOM   3690  N N9    . DA  B 1 35  ? -17.576 29.660  1.854   1.00 68.85  ? 181  DA  J N9    1 
ATOM   3691  C C8    . DA  B 1 35  ? -17.624 31.044  2.032   1.00 68.85  ? 181  DA  J C8    1 
ATOM   3692  N N7    . DA  B 1 35  ? -17.832 31.718  0.921   1.00 68.85  ? 181  DA  J N7    1 
ATOM   3693  C C5    . DA  B 1 35  ? -17.914 30.723  -0.063  1.00 68.85  ? 181  DA  J C5    1 
ATOM   3694  C C6    . DA  B 1 35  ? -18.114 30.775  -1.464  1.00 68.85  ? 181  DA  J C6    1 
ATOM   3695  N N6    . DA  B 1 35  ? -18.302 31.904  -2.156  1.00 68.85  ? 181  DA  J N6    1 
ATOM   3696  N N1    . DA  B 1 35  ? -18.124 29.611  -2.131  1.00 68.85  ? 181  DA  J N1    1 
ATOM   3697  C C2    . DA  B 1 35  ? -17.966 28.468  -1.452  1.00 68.85  ? 181  DA  J C2    1 
ATOM   3698  N N3    . DA  B 1 35  ? -17.780 28.274  -0.156  1.00 68.85  ? 181  DA  J N3    1 
ATOM   3699  C C4    . DA  B 1 35  ? -17.758 29.452  0.499   1.00 68.85  ? 181  DA  J C4    1 
ATOM   3700  P P     . DT  B 1 36  ? -15.040 26.970  5.254   1.00 128.65 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 36  ? -14.509 25.849  6.063   1.00 82.86  ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 36  ? -14.568 28.369  5.500   1.00 82.86  ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 36  ? -14.814 26.611  3.723   1.00 128.65 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 36  ? -15.566 25.551  3.114   1.00 128.65 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 36  ? -14.880 25.089  1.849   1.00 128.65 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 36  ? -15.173 25.965  0.728   1.00 128.65 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 36  ? -13.363 25.083  2.006   1.00 128.65 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 36  ? -12.826 23.878  1.463   1.00 128.65 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 36  ? -12.917 26.341  1.278   1.00 128.65 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 36  ? -13.962 26.474  0.185   1.00 128.65 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 36  ? -14.189 27.865  -0.239  1.00 82.86  ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 36  ? -14.347 28.135  -1.588  1.00 82.86  ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 36  ? -14.327 27.278  -2.472  1.00 82.86  ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 36  ? -14.515 29.460  -1.877  1.00 82.86  ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 36  ? -14.527 30.509  -0.997  1.00 82.86  ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 36  ? -14.647 31.650  -1.405  1.00 82.86  ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 36  ? -14.379 30.165  0.374   1.00 82.86  ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 36  ? -14.418 31.267  1.378   1.00 82.86  ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 36  ? -14.218 28.874  0.693   1.00 82.86  ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 37  ? -11.299 23.835  0.979   1.00 79.15  ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 37  ? -10.882 22.378  0.977   1.00 67.59  ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 37  ? -10.465 24.885  1.699   1.00 67.59  ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 37  ? -11.467 24.312  -0.536  1.00 79.15  ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 37  ? -12.568 23.856  -1.358  1.00 79.15  ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 37  ? -12.237 24.086  -2.817  1.00 79.15  ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 37  ? -12.412 25.456  -3.250  1.00 79.15  ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 37  ? -10.786 23.744  -3.128  1.00 79.15  ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 37  ? -10.770 23.115  -4.384  1.00 79.15  ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 37  ? -10.094 25.090  -3.167  1.00 79.15  ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 37  ? -11.177 25.955  -3.742  1.00 79.15  ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 37  ? -11.069 27.347  -3.347  1.00 67.59  ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 37  ? -11.131 28.307  -4.324  1.00 67.59  ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 37  ? -11.314 28.059  -5.488  1.00 67.59  ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 37  ? -10.990 29.571  -3.903  1.00 67.59  ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 37  ? -10.847 29.991  -2.627  1.00 67.59  ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 37  ? -10.732 31.187  -2.402  1.00 67.59  ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 37  ? -10.847 28.945  -1.628  1.00 67.59  ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 37  ? -10.807 29.319  -0.180  1.00 67.59  ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 37  ? -10.919 27.681  -2.046  1.00 67.59  ? 183  DT  J C6    1 
ATOM   3740  P P     . DT  B 1 38  ? -9.400  22.605  -4.995  1.00 63.20  ? 184  DT  J P     1 
ATOM   3741  O OP1   . DT  B 1 38  ? -9.697  21.220  -5.530  1.00 65.04  ? 184  DT  J OP1   1 
ATOM   3742  O OP2   . DT  B 1 38  ? -8.272  22.837  -4.031  1.00 65.04  ? 184  DT  J OP2   1 
ATOM   3743  O "O5'" . DT  B 1 38  ? -9.135  23.665  -6.172  1.00 63.20  ? 184  DT  J "O5'" 1 
ATOM   3744  C "C5'" . DT  B 1 38  ? -10.135 23.978  -7.161  1.00 63.20  ? 184  DT  J "C5'" 1 
ATOM   3745  C "C4'" . DT  B 1 38  ? -9.667  25.109  -8.049  1.00 63.20  ? 184  DT  J "C4'" 1 
ATOM   3746  O "O4'" . DT  B 1 38  ? -9.681  26.365  -7.329  1.00 63.20  ? 184  DT  J "O4'" 1 
ATOM   3747  C "C3'" . DT  B 1 38  ? -8.240  24.944  -8.580  1.00 63.20  ? 184  DT  J "C3'" 1 
ATOM   3748  O "O3'" . DT  B 1 38  ? -8.170  25.480  -9.901  1.00 63.20  ? 184  DT  J "O3'" 1 
ATOM   3749  C "C2'" . DT  B 1 38  ? -7.449  25.864  -7.676  1.00 63.20  ? 184  DT  J "C2'" 1 
ATOM   3750  C "C1'" . DT  B 1 38  ? -8.443  26.989  -7.536  1.00 63.20  ? 184  DT  J "C1'" 1 
ATOM   3751  N N1    . DT  B 1 38  ? -8.206  27.908  -6.446  1.00 65.04  ? 184  DT  J N1    1 
ATOM   3752  C C2    . DT  B 1 38  ? -8.151  29.245  -6.759  1.00 65.04  ? 184  DT  J C2    1 
ATOM   3753  O O2    . DT  B 1 38  ? -8.334  29.660  -7.886  1.00 65.04  ? 184  DT  J O2    1 
ATOM   3754  N N3    . DT  B 1 38  ? -7.885  30.089  -5.712  1.00 65.04  ? 184  DT  J N3    1 
ATOM   3755  C C4    . DT  B 1 38  ? -7.693  29.738  -4.391  1.00 65.04  ? 184  DT  J C4    1 
ATOM   3756  O O4    . DT  B 1 38  ? -7.425  30.637  -3.563  1.00 65.04  ? 184  DT  J O4    1 
ATOM   3757  C C5    . DT  B 1 38  ? -7.821  28.274  -4.123  1.00 65.04  ? 184  DT  J C5    1 
ATOM   3758  C C7    . DT  B 1 38  ? -7.732  27.752  -2.732  1.00 65.04  ? 184  DT  J C7    1 
ATOM   3759  C C6    . DT  B 1 38  ? -8.044  27.461  -5.162  1.00 65.04  ? 184  DT  J C6    1 
ATOM   3760  P P     . DG  B 1 39  ? -7.866  24.519  -11.151 1.00 58.01  ? 185  DG  J P     1 
ATOM   3761  O OP1   . DG  B 1 39  ? -8.834  23.342  -11.208 1.00 58.87  ? 185  DG  J OP1   1 
ATOM   3762  O OP2   . DG  B 1 39  ? -6.392  24.279  -11.241 1.00 58.87  ? 185  DG  J OP2   1 
ATOM   3763  O "O5'" . DG  B 1 39  ? -8.165  25.533  -12.317 1.00 58.01  ? 185  DG  J "O5'" 1 
ATOM   3764  C "C5'" . DG  B 1 39  ? -9.455  26.014  -12.469 1.00 58.01  ? 185  DG  J "C5'" 1 
ATOM   3765  C "C4'" . DG  B 1 39  ? -9.398  27.371  -13.107 1.00 58.01  ? 185  DG  J "C4'" 1 
ATOM   3766  O "O4'" . DG  B 1 39  ? -8.849  28.357  -12.218 1.00 58.01  ? 185  DG  J "O4'" 1 
ATOM   3767  C "C3'" . DG  B 1 39  ? -8.506  27.431  -14.323 1.00 58.01  ? 185  DG  J "C3'" 1 
ATOM   3768  O "O3'" . DG  B 1 39  ? -9.011  28.513  -15.087 1.00 58.01  ? 185  DG  J "O3'" 1 
ATOM   3769  C "C2'" . DG  B 1 39  ? -7.152  27.785  -13.738 1.00 58.01  ? 185  DG  J "C2'" 1 
ATOM   3770  C "C1'" . DG  B 1 39  ? -7.526  28.723  -12.612 1.00 58.01  ? 185  DG  J "C1'" 1 
ATOM   3771  N N9    . DG  B 1 39  ? -6.699  28.540  -11.427 1.00 58.87  ? 185  DG  J N9    1 
ATOM   3772  C C8    . DG  B 1 39  ? -6.190  27.340  -10.908 1.00 58.87  ? 185  DG  J C8    1 
ATOM   3773  N N7    . DG  B 1 39  ? -5.610  27.489  -9.736  1.00 58.87  ? 185  DG  J N7    1 
ATOM   3774  C C5    . DG  B 1 39  ? -5.731  28.862  -9.476  1.00 58.87  ? 185  DG  J C5    1 
ATOM   3775  C C6    . DG  B 1 39  ? -5.354  29.644  -8.335  1.00 58.87  ? 185  DG  J C6    1 
ATOM   3776  O O6    . DG  B 1 39  ? -4.864  29.248  -7.280  1.00 58.87  ? 185  DG  J O6    1 
ATOM   3777  N N1    . DG  B 1 39  ? -5.634  31.010  -8.524  1.00 58.87  ? 185  DG  J N1    1 
ATOM   3778  C C2    . DG  B 1 39  ? -6.207  31.549  -9.672  1.00 58.87  ? 185  DG  J C2    1 
ATOM   3779  N N2    . DG  B 1 39  ? -6.352  32.896  -9.723  1.00 58.87  ? 185  DG  J N2    1 
ATOM   3780  N N3    . DG  B 1 39  ? -6.600  30.824  -10.708 1.00 58.87  ? 185  DG  J N3    1 
ATOM   3781  C C4    . DG  B 1 39  ? -6.345  29.520  -10.546 1.00 58.87  ? 185  DG  J C4    1 
ATOM   3782  P P     . DG  B 1 40  ? -8.562  28.686  -16.602 1.00 43.66  ? 186  DG  J P     1 
ATOM   3783  O OP1   . DG  B 1 40  ? -9.808  29.105  -17.314 1.00 50.53  ? 186  DG  J OP1   1 
ATOM   3784  O OP2   . DG  B 1 40  ? -7.829  27.445  -17.018 1.00 50.53  ? 186  DG  J OP2   1 
ATOM   3785  O "O5'" . DG  B 1 40  ? -7.574  29.926  -16.554 1.00 43.66  ? 186  DG  J "O5'" 1 
ATOM   3786  C "C5'" . DG  B 1 40  ? -7.916  31.079  -15.825 1.00 43.66  ? 186  DG  J "C5'" 1 
ATOM   3787  C "C4'" . DG  B 1 40  ? -6.669  31.846  -15.450 1.00 43.66  ? 186  DG  J "C4'" 1 
ATOM   3788  O "O4'" . DG  B 1 40  ? -5.975  31.221  -14.342 1.00 43.66  ? 186  DG  J "O4'" 1 
ATOM   3789  C "C3'" . DG  B 1 40  ? -5.627  31.950  -16.567 1.00 43.66  ? 186  DG  J "C3'" 1 
ATOM   3790  O "O3'" . DG  B 1 40  ? -5.014  33.255  -16.514 1.00 43.66  ? 186  DG  J "O3'" 1 
ATOM   3791  C "C2'" . DG  B 1 40  ? -4.644  30.832  -16.204 1.00 43.66  ? 186  DG  J "C2'" 1 
ATOM   3792  C "C1'" . DG  B 1 40  ? -4.611  31.054  -14.703 1.00 43.66  ? 186  DG  J "C1'" 1 
ATOM   3793  N N9    . DG  B 1 40  ? -3.984  30.103  -13.777 1.00 50.53  ? 186  DG  J N9    1 
ATOM   3794  C C8    . DG  B 1 40  ? -3.686  28.773  -13.962 1.00 50.53  ? 186  DG  J C8    1 
ATOM   3795  N N7    . DG  B 1 40  ? -3.168  28.202  -12.904 1.00 50.53  ? 186  DG  J N7    1 
ATOM   3796  C C5    . DG  B 1 40  ? -3.138  29.210  -11.963 1.00 50.53  ? 186  DG  J C5    1 
ATOM   3797  C C6    . DG  B 1 40  ? -2.746  29.175  -10.590 1.00 50.53  ? 186  DG  J C6    1 
ATOM   3798  O O6    . DG  B 1 40  ? -2.404  28.161  -9.881  1.00 50.53  ? 186  DG  J O6    1 
ATOM   3799  N N1    . DG  B 1 40  ? -2.831  30.453  -10.028 1.00 50.53  ? 186  DG  J N1    1 
ATOM   3800  C C2    . DG  B 1 40  ? -3.297  31.592  -10.690 1.00 50.53  ? 186  DG  J C2    1 
ATOM   3801  N N2    . DG  B 1 40  ? -3.354  32.734  -10.000 1.00 50.53  ? 186  DG  J N2    1 
ATOM   3802  N N3    . DG  B 1 40  ? -3.696  31.613  -11.945 1.00 50.53  ? 186  DG  J N3    1 
ATOM   3803  C C4    . DG  B 1 40  ? -3.596  30.405  -12.510 1.00 50.53  ? 186  DG  J C4    1 
ATOM   3804  P P     . DA  B 1 41  ? -5.192  34.294  -17.735 1.00 69.81  ? 187  DA  J P     1 
ATOM   3805  O OP1   . DA  B 1 41  ? -6.680  34.514  -17.928 1.00 58.55  ? 187  DA  J OP1   1 
ATOM   3806  O OP2   . DA  B 1 41  ? -4.338  33.867  -18.879 1.00 58.55  ? 187  DA  J OP2   1 
ATOM   3807  O "O5'" . DA  B 1 41  ? -4.535  35.637  -17.162 1.00 69.81  ? 187  DA  J "O5'" 1 
ATOM   3808  C "C5'" . DA  B 1 41  ? -5.317  36.533  -16.341 1.00 69.81  ? 187  DA  J "C5'" 1 
ATOM   3809  C "C4'" . DA  B 1 41  ? -4.449  37.273  -15.348 1.00 69.81  ? 187  DA  J "C4'" 1 
ATOM   3810  O "O4'" . DA  B 1 41  ? -3.893  36.330  -14.412 1.00 69.81  ? 187  DA  J "O4'" 1 
ATOM   3811  C "C3'" . DA  B 1 41  ? -3.256  38.059  -15.905 1.00 69.81  ? 187  DA  J "C3'" 1 
ATOM   3812  O "O3'" . DA  B 1 41  ? -3.100  39.245  -15.113 1.00 69.81  ? 187  DA  J "O3'" 1 
ATOM   3813  C "C2'" . DA  B 1 41  ? -2.086  37.113  -15.706 1.00 69.81  ? 187  DA  J "C2'" 1 
ATOM   3814  C "C1'" . DA  B 1 41  ? -2.469  36.398  -14.419 1.00 69.81  ? 187  DA  J "C1'" 1 
ATOM   3815  N N9    . DA  B 1 41  ? -1.958  35.025  -14.238 1.00 58.55  ? 187  DA  J N9    1 
ATOM   3816  C C8    . DA  B 1 41  ? -1.894  33.982  -15.139 1.00 58.55  ? 187  DA  J C8    1 
ATOM   3817  N N7    . DA  B 1 41  ? -1.409  32.868  -14.629 1.00 58.55  ? 187  DA  J N7    1 
ATOM   3818  C C5    . DA  B 1 41  ? -1.128  33.201  -13.312 1.00 58.55  ? 187  DA  J C5    1 
ATOM   3819  C C6    . DA  B 1 41  ? -0.579  32.465  -12.248 1.00 58.55  ? 187  DA  J C6    1 
ATOM   3820  N N6    . DA  B 1 41  ? -0.233  31.184  -12.314 1.00 58.55  ? 187  DA  J N6    1 
ATOM   3821  N N1    . DA  B 1 41  ? -0.400  33.103  -11.093 1.00 58.55  ? 187  DA  J N1    1 
ATOM   3822  C C2    . DA  B 1 41  ? -0.761  34.390  -11.004 1.00 58.55  ? 187  DA  J C2    1 
ATOM   3823  N N3    . DA  B 1 41  ? -1.293  35.185  -11.914 1.00 58.55  ? 187  DA  J N3    1 
ATOM   3824  C C4    . DA  B 1 41  ? -1.450  34.525  -13.063 1.00 58.55  ? 187  DA  J C4    1 
ATOM   3825  P P     . DA  B 1 42  ? -2.198  40.476  -15.630 1.00 79.65  ? 188  DA  J P     1 
ATOM   3826  O OP1   . DA  B 1 42  ? -2.823  41.757  -15.159 1.00 72.03  ? 188  DA  J OP1   1 
ATOM   3827  O OP2   . DA  B 1 42  ? -1.936  40.267  -17.087 1.00 72.03  ? 188  DA  J OP2   1 
ATOM   3828  O "O5'" . DA  B 1 42  ? -0.884  40.311  -14.754 1.00 79.65  ? 188  DA  J "O5'" 1 
ATOM   3829  C "C5'" . DA  B 1 42  ? -0.996  40.417  -13.333 1.00 79.65  ? 188  DA  J "C5'" 1 
ATOM   3830  C "C4'" . DA  B 1 42  ? 0.330   40.139  -12.668 1.00 79.65  ? 188  DA  J "C4'" 1 
ATOM   3831  O "O4'" . DA  B 1 42  ? 0.603   38.726  -12.495 1.00 79.65  ? 188  DA  J "O4'" 1 
ATOM   3832  C "C3'" . DA  B 1 42  ? 1.516   40.714  -13.429 1.00 79.65  ? 188  DA  J "C3'" 1 
ATOM   3833  O "O3'" . DA  B 1 42  ? 2.497   41.053  -12.480 1.00 79.65  ? 188  DA  J "O3'" 1 
ATOM   3834  C "C2'" . DA  B 1 42  ? 2.023   39.515  -14.187 1.00 79.65  ? 188  DA  J "C2'" 1 
ATOM   3835  C "C1'" . DA  B 1 42  ? 1.829   38.421  -13.146 1.00 79.65  ? 188  DA  J "C1'" 1 
ATOM   3836  N N9    . DA  B 1 42  ? 1.710   37.083  -13.724 1.00 72.03  ? 188  DA  J N9    1 
ATOM   3837  C C8    . DA  B 1 42  ? 1.138   36.715  -14.917 1.00 72.03  ? 188  DA  J C8    1 
ATOM   3838  N N7    . DA  B 1 42  ? 1.167   35.425  -15.140 1.00 72.03  ? 188  DA  J N7    1 
ATOM   3839  C C5    . DA  B 1 42  ? 1.806   34.911  -14.029 1.00 72.03  ? 188  DA  J C5    1 
ATOM   3840  C C6    . DA  B 1 42  ? 2.165   33.617  -13.676 1.00 72.03  ? 188  DA  J C6    1 
ATOM   3841  N N6    . DA  B 1 42  ? 1.871   32.553  -14.439 1.00 72.03  ? 188  DA  J N6    1 
ATOM   3842  N N1    . DA  B 1 42  ? 2.839   33.433  -12.513 1.00 72.03  ? 188  DA  J N1    1 
ATOM   3843  C C2    . DA  B 1 42  ? 3.116   34.503  -11.764 1.00 72.03  ? 188  DA  J C2    1 
ATOM   3844  N N3    . DA  B 1 42  ? 2.819   35.779  -11.984 1.00 72.03  ? 188  DA  J N3    1 
ATOM   3845  C C4    . DA  B 1 42  ? 2.158   35.914  -13.150 1.00 72.03  ? 188  DA  J C4    1 
ATOM   3846  P P     . DA  B 1 43  ? 3.177   42.486  -12.533 1.00 117.11 ? 189  DA  J P     1 
ATOM   3847  O OP1   . DA  B 1 43  ? 2.735   43.183  -11.310 1.00 61.56  ? 189  DA  J OP1   1 
ATOM   3848  O OP2   . DA  B 1 43  ? 2.893   43.090  -13.862 1.00 61.56  ? 189  DA  J OP2   1 
ATOM   3849  O "O5'" . DA  B 1 43  ? 4.681   42.069  -12.265 1.00 117.11 ? 189  DA  J "O5'" 1 
ATOM   3850  C "C5'" . DA  B 1 43  ? 4.980   41.461  -11.007 1.00 117.11 ? 189  DA  J "C5'" 1 
ATOM   3851  C "C4'" . DA  B 1 43  ? 6.079   40.437  -11.137 1.00 117.11 ? 189  DA  J "C4'" 1 
ATOM   3852  O "O4'" . DA  B 1 43  ? 5.598   39.159  -11.621 1.00 117.11 ? 189  DA  J "O4'" 1 
ATOM   3853  C "C3'" . DA  B 1 43  ? 7.233   40.844  -12.046 1.00 117.11 ? 189  DA  J "C3'" 1 
ATOM   3854  O "O3'" . DA  B 1 43  ? 8.446   40.553  -11.383 1.00 117.11 ? 189  DA  J "O3'" 1 
ATOM   3855  C "C2'" . DA  B 1 43  ? 7.109   39.888  -13.213 1.00 117.11 ? 189  DA  J "C2'" 1 
ATOM   3856  C "C1'" . DA  B 1 43  ? 6.559   38.649  -12.528 1.00 117.11 ? 189  DA  J "C1'" 1 
ATOM   3857  N N9    . DA  B 1 43  ? 5.881   37.746  -13.455 1.00 61.56  ? 189  DA  J N9    1 
ATOM   3858  C C8    . DA  B 1 43  ? 4.915   38.115  -14.331 1.00 61.56  ? 189  DA  J C8    1 
ATOM   3859  N N7    . DA  B 1 43  ? 4.492   37.135  -15.108 1.00 61.56  ? 189  DA  J N7    1 
ATOM   3860  C C5    . DA  B 1 43  ? 5.235   36.052  -14.706 1.00 61.56  ? 189  DA  J C5    1 
ATOM   3861  C C6    . DA  B 1 43  ? 5.237   34.715  -15.133 1.00 61.56  ? 189  DA  J C6    1 
ATOM   3862  N N6    . DA  B 1 43  ? 4.459   34.235  -16.099 1.00 61.56  ? 189  DA  J N6    1 
ATOM   3863  N N1    . DA  B 1 43  ? 6.060   33.872  -14.524 1.00 61.56  ? 189  DA  J N1    1 
ATOM   3864  C C2    . DA  B 1 43  ? 6.817   34.351  -13.529 1.00 61.56  ? 189  DA  J C2    1 
ATOM   3865  N N3    . DA  B 1 43  ? 6.897   35.598  -13.026 1.00 61.56  ? 189  DA  J N3    1 
ATOM   3866  C C4    . DA  B 1 43  ? 6.077   36.405  -13.673 1.00 61.56  ? 189  DA  J C4    1 
ATOM   3867  P P     . DC  B 1 44  ? 9.824   41.000  -12.044 1.00 98.53  ? 190  DC  J P     1 
ATOM   3868  O OP1   . DC  B 1 44  ? 10.539  41.697  -10.955 1.00 82.61  ? 190  DC  J OP1   1 
ATOM   3869  O OP2   . DC  B 1 44  ? 9.551   41.718  -13.333 1.00 82.61  ? 190  DC  J OP2   1 
ATOM   3870  O "O5'" . DC  B 1 44  ? 10.533  39.599  -12.284 1.00 98.53  ? 190  DC  J "O5'" 1 
ATOM   3871  C "C5'" . DC  B 1 44  ? 10.939  38.828  -11.156 1.00 98.53  ? 190  DC  J "C5'" 1 
ATOM   3872  C "C4'" . DC  B 1 44  ? 11.764  37.633  -11.581 1.00 98.53  ? 190  DC  J "C4'" 1 
ATOM   3873  O "O4'" . DC  B 1 44  ? 10.900  36.721  -12.304 1.00 98.53  ? 190  DC  J "O4'" 1 
ATOM   3874  C "C3'" . DC  B 1 44  ? 12.941  37.943  -12.520 1.00 98.53  ? 190  DC  J "C3'" 1 
ATOM   3875  O "O3'" . DC  B 1 44  ? 14.110  37.139  -12.251 1.00 98.53  ? 190  DC  J "O3'" 1 
ATOM   3876  C "C2'" . DC  B 1 44  ? 12.385  37.625  -13.902 1.00 98.53  ? 190  DC  J "C2'" 1 
ATOM   3877  C "C1'" . DC  B 1 44  ? 11.434  36.464  -13.605 1.00 98.53  ? 190  DC  J "C1'" 1 
ATOM   3878  N N1    . DC  B 1 44  ? 10.297  36.260  -14.545 1.00 82.61  ? 190  DC  J N1    1 
ATOM   3879  C C2    . DC  B 1 44  ? 9.914   34.926  -14.906 1.00 82.61  ? 190  DC  J C2    1 
ATOM   3880  O O2    . DC  B 1 44  ? 10.546  33.967  -14.429 1.00 82.61  ? 190  DC  J O2    1 
ATOM   3881  N N3    . DC  B 1 44  ? 8.858   34.742  -15.757 1.00 82.61  ? 190  DC  J N3    1 
ATOM   3882  C C4    . DC  B 1 44  ? 8.197   35.799  -16.238 1.00 82.61  ? 190  DC  J C4    1 
ATOM   3883  N N4    . DC  B 1 44  ? 7.179   35.574  -17.056 1.00 82.61  ? 190  DC  J N4    1 
ATOM   3884  C C5    . DC  B 1 44  ? 8.563   37.140  -15.894 1.00 82.61  ? 190  DC  J C5    1 
ATOM   3885  C C6    . DC  B 1 44  ? 9.610   37.323  -15.055 1.00 82.61  ? 190  DC  J C6    1 
ATOM   3886  P P     . DT  B 1 45  ? 15.294  37.082  -13.351 1.00 97.75  ? 191  DT  J P     1 
ATOM   3887  O OP1   . DT  B 1 45  ? 16.591  36.564  -12.761 1.00 69.99  ? 191  DT  J OP1   1 
ATOM   3888  O OP2   . DT  B 1 45  ? 15.239  38.395  -14.063 1.00 69.99  ? 191  DT  J OP2   1 
ATOM   3889  O "O5'" . DT  B 1 45  ? 14.781  36.031  -14.429 1.00 97.75  ? 191  DT  J "O5'" 1 
ATOM   3890  C "C5'" . DT  B 1 45  ? 14.545  34.686  -14.035 1.00 97.75  ? 191  DT  J "C5'" 1 
ATOM   3891  C "C4'" . DT  B 1 45  ? 14.567  33.771  -15.233 1.00 97.75  ? 191  DT  J "C4'" 1 
ATOM   3892  O "O4'" . DT  B 1 45  ? 13.318  33.833  -15.959 1.00 97.75  ? 191  DT  J "O4'" 1 
ATOM   3893  C "C3'" . DT  B 1 45  ? 15.655  34.107  -16.256 1.00 97.75  ? 191  DT  J "C3'" 1 
ATOM   3894  O "O3'" . DT  B 1 45  ? 16.094  32.893  -16.866 1.00 97.75  ? 191  DT  J "O3'" 1 
ATOM   3895  C "C2'" . DT  B 1 45  ? 14.890  34.882  -17.313 1.00 97.75  ? 191  DT  J "C2'" 1 
ATOM   3896  C "C1'" . DT  B 1 45  ? 13.616  34.075  -17.328 1.00 97.75  ? 191  DT  J "C1'" 1 
ATOM   3897  N N1    . DT  B 1 45  ? 12.457  34.698  -17.960 1.00 69.99  ? 191  DT  J N1    1 
ATOM   3898  C C2    . DT  B 1 45  ? 11.625  33.887  -18.735 1.00 69.99  ? 191  DT  J C2    1 
ATOM   3899  O O2    . DT  B 1 45  ? 11.797  32.663  -18.879 1.00 69.99  ? 191  DT  J O2    1 
ATOM   3900  N N3    . DT  B 1 45  ? 10.579  34.564  -19.318 1.00 69.99  ? 191  DT  J N3    1 
ATOM   3901  C C4    . DT  B 1 45  ? 10.277  35.922  -19.189 1.00 69.99  ? 191  DT  J C4    1 
ATOM   3902  O O4    . DT  B 1 45  ? 9.308   36.393  -19.770 1.00 69.99  ? 191  DT  J O4    1 
ATOM   3903  C C5    . DT  B 1 45  ? 11.170  36.691  -18.351 1.00 69.99  ? 191  DT  J C5    1 
ATOM   3904  C C7    . DT  B 1 45  ? 10.894  38.151  -18.155 1.00 69.99  ? 191  DT  J C7    1 
ATOM   3905  C C6    . DT  B 1 45  ? 12.208  36.048  -17.788 1.00 69.99  ? 191  DT  J C6    1 
ATOM   3906  P P     . DG  B 1 46  ? 17.629  32.451  -16.762 1.00 91.23  ? 192  DG  J P     1 
ATOM   3907  O OP1   . DG  B 1 46  ? 17.955  32.354  -15.275 1.00 69.32  ? 192  DG  J OP1   1 
ATOM   3908  O OP2   . DG  B 1 46  ? 18.408  33.346  -17.674 1.00 69.32  ? 192  DG  J OP2   1 
ATOM   3909  O "O5'" . DG  B 1 46  ? 17.655  31.002  -17.436 1.00 91.23  ? 192  DG  J "O5'" 1 
ATOM   3910  C "C5'" . DG  B 1 46  ? 16.924  29.912  -16.882 1.00 91.23  ? 192  DG  J "C5'" 1 
ATOM   3911  C "C4'" . DG  B 1 46  ? 16.412  29.028  -17.991 1.00 91.23  ? 192  DG  J "C4'" 1 
ATOM   3912  O "O4'" . DG  B 1 46  ? 15.348  29.709  -18.705 1.00 91.23  ? 192  DG  J "O4'" 1 
ATOM   3913  C "C3'" . DG  B 1 46  ? 17.463  28.672  -19.036 1.00 91.23  ? 192  DG  J "C3'" 1 
ATOM   3914  O "O3'" . DG  B 1 46  ? 17.258  27.306  -19.392 1.00 91.23  ? 192  DG  J "O3'" 1 
ATOM   3915  C "C2'" . DG  B 1 46  ? 17.205  29.668  -20.166 1.00 91.23  ? 192  DG  J "C2'" 1 
ATOM   3916  C "C1'" . DG  B 1 46  ? 15.693  29.872  -20.087 1.00 91.23  ? 192  DG  J "C1'" 1 
ATOM   3917  N N9    . DG  B 1 46  ? 15.163  31.166  -20.527 1.00 69.32  ? 192  DG  J N9    1 
ATOM   3918  C C8    . DG  B 1 46  ? 15.588  32.401  -20.099 1.00 69.32  ? 192  DG  J C8    1 
ATOM   3919  N N7    . DG  B 1 46  ? 14.881  33.398  -20.584 1.00 69.32  ? 192  DG  J N7    1 
ATOM   3920  C C5    . DG  B 1 46  ? 13.927  32.784  -21.393 1.00 69.32  ? 192  DG  J C5    1 
ATOM   3921  C C6    . DG  B 1 46  ? 12.848  33.347  -22.168 1.00 69.32  ? 192  DG  J C6    1 
ATOM   3922  O O6    . DG  B 1 46  ? 12.469  34.536  -22.240 1.00 69.32  ? 192  DG  J O6    1 
ATOM   3923  N N1    . DG  B 1 46  ? 12.172  32.362  -22.887 1.00 69.32  ? 192  DG  J N1    1 
ATOM   3924  C C2    . DG  B 1 46  ? 12.458  31.030  -22.854 1.00 69.32  ? 192  DG  J C2    1 
ATOM   3925  N N2    . DG  B 1 46  ? 11.716  30.286  -23.663 1.00 69.32  ? 192  DG  J N2    1 
ATOM   3926  N N3    . DG  B 1 46  ? 13.409  30.483  -22.099 1.00 69.32  ? 192  DG  J N3    1 
ATOM   3927  C C4    . DG  B 1 46  ? 14.106  31.409  -21.405 1.00 69.32  ? 192  DG  J C4    1 
ATOM   3928  P P     . DC  B 1 47  ? 17.925  26.715  -20.727 1.00 95.47  ? 193  DC  J P     1 
ATOM   3929  O OP1   . DC  B 1 47  ? 17.788  25.217  -20.696 1.00 65.20  ? 193  DC  J OP1   1 
ATOM   3930  O OP2   . DC  B 1 47  ? 19.271  27.345  -20.892 1.00 65.20  ? 193  DC  J OP2   1 
ATOM   3931  O "O5'" . DC  B 1 47  ? 17.061  27.352  -21.916 1.00 95.47  ? 193  DC  J "O5'" 1 
ATOM   3932  C "C5'" . DC  B 1 47  ? 15.738  26.888  -22.211 1.00 95.47  ? 193  DC  J "C5'" 1 
ATOM   3933  C "C4'" . DC  B 1 47  ? 15.374  27.219  -23.635 1.00 95.47  ? 193  DC  J "C4'" 1 
ATOM   3934  O "O4'" . DC  B 1 47  ? 15.008  28.600  -23.791 1.00 95.47  ? 193  DC  J "O4'" 1 
ATOM   3935  C "C3'" . DC  B 1 47  ? 16.504  27.008  -24.623 1.00 95.47  ? 193  DC  J "C3'" 1 
ATOM   3936  O "O3'" . DC  B 1 47  ? 15.890  26.673  -25.830 1.00 95.47  ? 193  DC  J "O3'" 1 
ATOM   3937  C "C2'" . DC  B 1 47  ? 17.082  28.388  -24.827 1.00 95.47  ? 193  DC  J "C2'" 1 
ATOM   3938  C "C1'" . DC  B 1 47  ? 15.790  29.162  -24.843 1.00 95.47  ? 193  DC  J "C1'" 1 
ATOM   3939  N N1    . DC  B 1 47  ? 15.919  30.606  -24.612 1.00 65.20  ? 193  DC  J N1    1 
ATOM   3940  C C2    . DC  B 1 47  ? 15.298  31.505  -25.521 1.00 65.20  ? 193  DC  J C2    1 
ATOM   3941  O O2    . DC  B 1 47  ? 14.612  31.050  -26.457 1.00 65.20  ? 193  DC  J O2    1 
ATOM   3942  N N3    . DC  B 1 47  ? 15.442  32.826  -25.333 1.00 65.20  ? 193  DC  J N3    1 
ATOM   3943  C C4    . DC  B 1 47  ? 16.122  33.274  -24.275 1.00 65.20  ? 193  DC  J C4    1 
ATOM   3944  N N4    . DC  B 1 47  ? 16.222  34.597  -24.118 1.00 65.20  ? 193  DC  J N4    1 
ATOM   3945  C C5    . DC  B 1 47  ? 16.730  32.391  -23.330 1.00 65.20  ? 193  DC  J C5    1 
ATOM   3946  C C6    . DC  B 1 47  ? 16.614  31.080  -23.542 1.00 65.20  ? 193  DC  J C6    1 
ATOM   3947  P P     . DT  B 1 48  ? 16.261  25.283  -26.524 1.00 54.29  ? 194  DT  J P     1 
ATOM   3948  O OP1   . DT  B 1 48  ? 15.946  24.111  -25.566 1.00 62.26  ? 194  DT  J OP1   1 
ATOM   3949  O OP2   . DT  B 1 48  ? 17.646  25.520  -27.086 1.00 62.26  ? 194  DT  J OP2   1 
ATOM   3950  O "O5'" . DT  B 1 48  ? 15.279  25.218  -27.782 1.00 54.29  ? 194  DT  J "O5'" 1 
ATOM   3951  C "C5'" . DT  B 1 48  ? 13.886  25.342  -27.572 1.00 54.29  ? 194  DT  J "C5'" 1 
ATOM   3952  C "C4'" . DT  B 1 48  ? 13.319  26.343  -28.537 1.00 54.29  ? 194  DT  J "C4'" 1 
ATOM   3953  O "O4'" . DT  B 1 48  ? 13.765  27.659  -28.183 1.00 54.29  ? 194  DT  J "O4'" 1 
ATOM   3954  C "C3'" . DT  B 1 48  ? 13.658  26.169  -30.013 1.00 54.29  ? 194  DT  J "C3'" 1 
ATOM   3955  O "O3'" . DT  B 1 48  ? 12.425  26.372  -30.627 1.00 54.29  ? 194  DT  J "O3'" 1 
ATOM   3956  C "C2'" . DT  B 1 48  ? 14.549  27.353  -30.331 1.00 54.29  ? 194  DT  J "C2'" 1 
ATOM   3957  C "C1'" . DT  B 1 48  ? 13.992  28.372  -29.360 1.00 54.29  ? 194  DT  J "C1'" 1 
ATOM   3958  N N1    . DT  B 1 48  ? 14.802  29.514  -29.000 1.00 62.26  ? 194  DT  J N1    1 
ATOM   3959  C C2    . DT  B 1 48  ? 14.256  30.762  -29.208 1.00 62.26  ? 194  DT  J C2    1 
ATOM   3960  O O2    . DT  B 1 48  ? 13.140  30.906  -29.677 1.00 62.26  ? 194  DT  J O2    1 
ATOM   3961  N N3    . DT  B 1 48  ? 15.066  31.839  -28.836 1.00 62.26  ? 194  DT  J N3    1 
ATOM   3962  C C4    . DT  B 1 48  ? 16.359  31.759  -28.292 1.00 62.26  ? 194  DT  J C4    1 
ATOM   3963  O O4    . DT  B 1 48  ? 16.993  32.786  -28.007 1.00 62.26  ? 194  DT  J O4    1 
ATOM   3964  C C5    . DT  B 1 48  ? 16.866  30.394  -28.103 1.00 62.26  ? 194  DT  J C5    1 
ATOM   3965  C C7    . DT  B 1 48  ? 18.243  30.207  -27.542 1.00 62.26  ? 194  DT  J C7    1 
ATOM   3966  C C6    . DT  B 1 48  ? 16.059  29.357  -28.458 1.00 62.26  ? 194  DT  J C6    1 
ATOM   3967  P P     . DC  B 1 49  ? 12.061  25.594  -31.959 1.00 55.56  ? 195  DC  J P     1 
ATOM   3968  O OP1   . DC  B 1 49  ? 10.908  24.628  -31.726 1.00 52.98  ? 195  DC  J OP1   1 
ATOM   3969  O OP2   . DC  B 1 49  ? 13.344  25.109  -32.603 1.00 52.98  ? 195  DC  J OP2   1 
ATOM   3970  O "O5'" . DC  B 1 49  ? 11.604  26.832  -32.851 1.00 55.56  ? 195  DC  J "O5'" 1 
ATOM   3971  C "C5'" . DC  B 1 49  ? 10.909  27.922  -32.304 1.00 55.56  ? 195  DC  J "C5'" 1 
ATOM   3972  C "C4'" . DC  B 1 49  ? 11.143  29.093  -33.201 1.00 55.56  ? 195  DC  J "C4'" 1 
ATOM   3973  O "O4'" . DC  B 1 49  ? 12.261  29.803  -32.668 1.00 55.56  ? 195  DC  J "O4'" 1 
ATOM   3974  C "C3'" . DC  B 1 49  ? 11.576  28.633  -34.602 1.00 55.56  ? 195  DC  J "C3'" 1 
ATOM   3975  O "O3'" . DC  B 1 49  ? 11.284  29.642  -35.588 1.00 55.56  ? 195  DC  J "O3'" 1 
ATOM   3976  C "C2'" . DC  B 1 49  ? 13.077  28.558  -34.460 1.00 55.56  ? 195  DC  J "C2'" 1 
ATOM   3977  C "C1'" . DC  B 1 49  ? 13.236  29.847  -33.712 1.00 55.56  ? 195  DC  J "C1'" 1 
ATOM   3978  N N1    . DC  B 1 49  ? 14.543  30.243  -33.146 1.00 52.98  ? 195  DC  J N1    1 
ATOM   3979  C C2    . DC  B 1 49  ? 14.640  31.566  -32.710 1.00 52.98  ? 195  DC  J C2    1 
ATOM   3980  O O2    . DC  B 1 49  ? 13.668  32.337  -32.919 1.00 52.98  ? 195  DC  J O2    1 
ATOM   3981  N N3    . DC  B 1 49  ? 15.768  31.983  -32.094 1.00 52.98  ? 195  DC  J N3    1 
ATOM   3982  C C4    . DC  B 1 49  ? 16.795  31.149  -31.950 1.00 52.98  ? 195  DC  J C4    1 
ATOM   3983  N N4    . DC  B 1 49  ? 17.868  31.642  -31.339 1.00 52.98  ? 195  DC  J N4    1 
ATOM   3984  C C5    . DC  B 1 49  ? 16.752  29.786  -32.430 1.00 52.98  ? 195  DC  J C5    1 
ATOM   3985  C C6    . DC  B 1 49  ? 15.614  29.381  -33.016 1.00 52.98  ? 195  DC  J C6    1 
ATOM   3986  P P     . DC  B 1 50  ? 9.804   29.764  -36.177 1.00 35.91  ? 196  DC  J P     1 
ATOM   3987  O OP1   . DC  B 1 50  ? 8.830   29.582  -35.075 1.00 46.97  ? 196  DC  J OP1   1 
ATOM   3988  O OP2   . DC  B 1 50  ? 9.703   28.957  -37.413 1.00 46.97  ? 196  DC  J OP2   1 
ATOM   3989  O "O5'" . DC  B 1 50  ? 9.607   31.254  -36.580 1.00 35.91  ? 196  DC  J "O5'" 1 
ATOM   3990  C "C5'" . DC  B 1 50  ? 9.190   32.190  -35.645 1.00 35.91  ? 196  DC  J "C5'" 1 
ATOM   3991  C "C4'" . DC  B 1 50  ? 9.923   33.486  -35.905 1.00 35.91  ? 196  DC  J "C4'" 1 
ATOM   3992  O "O4'" . DC  B 1 50  ? 11.275  33.266  -35.452 1.00 35.91  ? 196  DC  J "O4'" 1 
ATOM   3993  C "C3'" . DC  B 1 50  ? 10.035  33.945  -37.369 1.00 35.91  ? 196  DC  J "C3'" 1 
ATOM   3994  O "O3'" . DC  B 1 50  ? 9.603   35.252  -37.606 1.00 35.91  ? 196  DC  J "O3'" 1 
ATOM   3995  C "C2'" . DC  B 1 50  ? 11.508  33.874  -37.699 1.00 35.91  ? 196  DC  J "C2'" 1 
ATOM   3996  C "C1'" . DC  B 1 50  ? 12.161  33.924  -36.330 1.00 35.91  ? 196  DC  J "C1'" 1 
ATOM   3997  N N1    . DC  B 1 50  ? 13.451  33.256  -36.175 1.00 46.97  ? 196  DC  J N1    1 
ATOM   3998  C C2    . DC  B 1 50  ? 14.535  34.025  -35.812 1.00 46.97  ? 196  DC  J C2    1 
ATOM   3999  O O2    . DC  B 1 50  ? 14.378  35.253  -35.754 1.00 46.97  ? 196  DC  J O2    1 
ATOM   4000  N N3    . DC  B 1 50  ? 15.721  33.409  -35.535 1.00 46.97  ? 196  DC  J N3    1 
ATOM   4001  C C4    . DC  B 1 50  ? 15.820  32.062  -35.620 1.00 46.97  ? 196  DC  J C4    1 
ATOM   4002  N N4    . DC  B 1 50  ? 16.980  31.470  -35.253 1.00 46.97  ? 196  DC  J N4    1 
ATOM   4003  C C5    . DC  B 1 50  ? 14.724  31.257  -36.061 1.00 46.97  ? 196  DC  J C5    1 
ATOM   4004  C C6    . DC  B 1 50  ? 13.571  31.892  -36.332 1.00 46.97  ? 196  DC  J C6    1 
ATOM   4005  P P     . DA  B 1 51  ? 9.296   35.671  -39.120 1.00 31.90  ? 197  DA  J P     1 
ATOM   4006  O OP1   . DA  B 1 51  ? 7.939   36.274  -39.245 1.00 41.84  ? 197  DA  J OP1   1 
ATOM   4007  O OP2   . DA  B 1 51  ? 9.722   34.535  -40.003 1.00 41.84  ? 197  DA  J OP2   1 
ATOM   4008  O "O5'" . DA  B 1 51  ? 10.315  36.874  -39.327 1.00 31.90  ? 197  DA  J "O5'" 1 
ATOM   4009  C "C5'" . DA  B 1 51  ? 10.381  37.950  -38.358 1.00 31.90  ? 197  DA  J "C5'" 1 
ATOM   4010  C "C4'" . DA  B 1 51  ? 11.671  38.737  -38.477 1.00 31.90  ? 197  DA  J "C4'" 1 
ATOM   4011  O "O4'" . DA  B 1 51  ? 12.758  37.908  -38.121 1.00 31.90  ? 197  DA  J "O4'" 1 
ATOM   4012  C "C3'" . DA  B 1 51  ? 12.006  39.248  -39.856 1.00 31.90  ? 197  DA  J "C3'" 1 
ATOM   4013  O "O3'" . DA  B 1 51  ? 12.535  40.578  -39.765 1.00 31.90  ? 197  DA  J "O3'" 1 
ATOM   4014  C "C2'" . DA  B 1 51  ? 13.051  38.283  -40.345 1.00 31.90  ? 197  DA  J "C2'" 1 
ATOM   4015  C "C1'" . DA  B 1 51  ? 13.740  37.965  -39.095 1.00 31.90  ? 197  DA  J "C1'" 1 
ATOM   4016  N N9    . DA  B 1 51  ? 14.407  36.669  -39.081 1.00 41.84  ? 197  DA  J N9    1 
ATOM   4017  C C8    . DA  B 1 51  ? 13.930  35.416  -39.408 1.00 41.84  ? 197  DA  J C8    1 
ATOM   4018  N N7    . DA  B 1 51  ? 14.806  34.453  -39.223 1.00 41.84  ? 197  DA  J N7    1 
ATOM   4019  C C5    . DA  B 1 51  ? 15.918  35.111  -38.739 1.00 41.84  ? 197  DA  J C5    1 
ATOM   4020  C C6    . DA  B 1 51  ? 17.155  34.646  -38.297 1.00 41.84  ? 197  DA  J C6    1 
ATOM   4021  N N6    . DA  B 1 51  ? 17.499  33.346  -38.308 1.00 41.84  ? 197  DA  J N6    1 
ATOM   4022  N N1    . DA  B 1 51  ? 18.047  35.569  -37.835 1.00 41.84  ? 197  DA  J N1    1 
ATOM   4023  C C2    . DA  B 1 51  ? 17.693  36.879  -37.862 1.00 41.84  ? 197  DA  J C2    1 
ATOM   4024  N N3    . DA  B 1 51  ? 16.567  37.435  -38.264 1.00 41.84  ? 197  DA  J N3    1 
ATOM   4025  C C4    . DA  B 1 51  ? 15.706  36.483  -38.676 1.00 41.84  ? 197  DA  J C4    1 
ATOM   4026  P P     . DT  B 1 52  ? 12.619  41.519  -41.108 1.00 48.03  ? 198  DT  J P     1 
ATOM   4027  O OP1   . DT  B 1 52  ? 11.967  42.826  -40.702 1.00 48.90  ? 198  DT  J OP1   1 
ATOM   4028  O OP2   . DT  B 1 52  ? 12.133  40.786  -42.356 1.00 48.90  ? 198  DT  J OP2   1 
ATOM   4029  O "O5'" . DT  B 1 52  ? 14.197  41.706  -41.155 1.00 48.03  ? 198  DT  J "O5'" 1 
ATOM   4030  C "C5'" . DT  B 1 52  ? 14.977  40.815  -40.377 1.00 48.03  ? 198  DT  J "C5'" 1 
ATOM   4031  C "C4'" . DT  B 1 52  ? 16.423  41.036  -40.663 1.00 48.03  ? 198  DT  J "C4'" 1 
ATOM   4032  O "O4'" . DT  B 1 52  ? 17.084  39.799  -40.286 1.00 48.03  ? 198  DT  J "O4'" 1 
ATOM   4033  C "C3'" . DT  B 1 52  ? 16.643  41.265  -42.157 1.00 48.03  ? 198  DT  J "C3'" 1 
ATOM   4034  O "O3'" . DT  B 1 52  ? 17.581  42.328  -42.384 1.00 48.03  ? 198  DT  J "O3'" 1 
ATOM   4035  C "C2'" . DT  B 1 52  ? 17.138  39.927  -42.628 1.00 48.03  ? 198  DT  J "C2'" 1 
ATOM   4036  C "C1'" . DT  B 1 52  ? 17.774  39.309  -41.394 1.00 48.03  ? 198  DT  J "C1'" 1 
ATOM   4037  N N1    . DT  B 1 52  ? 17.531  37.899  -41.452 1.00 48.90  ? 198  DT  J N1    1 
ATOM   4038  C C2    . DT  B 1 52  ? 18.549  37.092  -41.069 1.00 48.90  ? 198  DT  J C2    1 
ATOM   4039  O O2    . DT  B 1 52  ? 19.566  37.547  -40.622 1.00 48.90  ? 198  DT  J O2    1 
ATOM   4040  N N3    . DT  B 1 52  ? 18.332  35.734  -41.219 1.00 48.90  ? 198  DT  J N3    1 
ATOM   4041  C C4    . DT  B 1 52  ? 17.169  35.124  -41.711 1.00 48.90  ? 198  DT  J C4    1 
ATOM   4042  O O4    . DT  B 1 52  ? 17.116  33.883  -41.844 1.00 48.90  ? 198  DT  J O4    1 
ATOM   4043  C C5    . DT  B 1 52  ? 16.082  36.078  -42.063 1.00 48.90  ? 198  DT  J C5    1 
ATOM   4044  C C7    . DT  B 1 52  ? 14.768  35.562  -42.566 1.00 48.90  ? 198  DT  J C7    1 
ATOM   4045  C C6    . DT  B 1 52  ? 16.327  37.395  -41.913 1.00 48.90  ? 198  DT  J C6    1 
ATOM   4046  P P     . DC  B 1 53  ? 17.788  42.930  -43.871 1.00 92.18  ? 199  DC  J P     1 
ATOM   4047  O OP1   . DC  B 1 53  ? 17.333  44.349  -43.828 1.00 75.86  ? 199  DC  J OP1   1 
ATOM   4048  O OP2   . DC  B 1 53  ? 17.308  42.030  -44.973 1.00 75.86  ? 199  DC  J OP2   1 
ATOM   4049  O "O5'" . DC  B 1 53  ? 19.362  42.859  -43.936 1.00 92.18  ? 199  DC  J "O5'" 1 
ATOM   4050  C "C5'" . DC  B 1 53  ? 20.081  42.765  -42.724 1.00 92.18  ? 199  DC  J "C5'" 1 
ATOM   4051  C "C4'" . DC  B 1 53  ? 21.380  42.051  -42.965 1.00 92.18  ? 199  DC  J "C4'" 1 
ATOM   4052  O "O4'" . DC  B 1 53  ? 21.171  40.633  -42.808 1.00 92.18  ? 199  DC  J "O4'" 1 
ATOM   4053  C "C3'" . DC  B 1 53  ? 21.858  42.261  -44.402 1.00 92.18  ? 199  DC  J "C3'" 1 
ATOM   4054  O "O3'" . DC  B 1 53  ? 23.285  42.427  -44.463 1.00 92.18  ? 199  DC  J "O3'" 1 
ATOM   4055  C "C2'" . DC  B 1 53  ? 21.415  40.992  -45.099 1.00 92.18  ? 199  DC  J "C2'" 1 
ATOM   4056  C "C1'" . DC  B 1 53  ? 21.609  39.980  -43.990 1.00 92.18  ? 199  DC  J "C1'" 1 
ATOM   4057  N N1    . DC  B 1 53  ? 20.849  38.734  -44.167 1.00 75.86  ? 199  DC  J N1    1 
ATOM   4058  C C2    . DC  B 1 53  ? 21.409  37.535  -43.747 1.00 75.86  ? 199  DC  J C2    1 
ATOM   4059  O O2    . DC  B 1 53  ? 22.518  37.553  -43.230 1.00 75.86  ? 199  DC  J O2    1 
ATOM   4060  N N3    . DC  B 1 53  ? 20.732  36.393  -43.914 1.00 75.86  ? 199  DC  J N3    1 
ATOM   4061  C C4    . DC  B 1 53  ? 19.533  36.418  -44.487 1.00 75.86  ? 199  DC  J C4    1 
ATOM   4062  N N4    . DC  B 1 53  ? 18.905  35.264  -44.650 1.00 75.86  ? 199  DC  J N4    1 
ATOM   4063  C C5    . DC  B 1 53  ? 18.926  37.632  -44.927 1.00 75.86  ? 199  DC  J C5    1 
ATOM   4064  C C6    . DC  B 1 53  ? 19.614  38.754  -44.747 1.00 75.86  ? 199  DC  J C6    1 
ATOM   4065  P P     . DA  B 1 54  ? 24.079  42.113  -45.833 1.00 82.19  ? 200  DA  J P     1 
ATOM   4066  O OP1   . DA  B 1 54  ? 25.441  42.702  -45.729 1.00 69.75  ? 200  DA  J OP1   1 
ATOM   4067  O OP2   . DA  B 1 54  ? 23.184  42.517  -46.994 1.00 69.75  ? 200  DA  J OP2   1 
ATOM   4068  O "O5'" . DA  B 1 54  ? 24.389  40.546  -45.713 1.00 82.19  ? 200  DA  J "O5'" 1 
ATOM   4069  C "C5'" . DA  B 1 54  ? 25.534  40.069  -44.996 1.00 82.19  ? 200  DA  J "C5'" 1 
ATOM   4070  C "C4'" . DA  B 1 54  ? 26.362  39.214  -45.917 1.00 82.19  ? 200  DA  J "C4'" 1 
ATOM   4071  O "O4'" . DA  B 1 54  ? 25.766  37.898  -46.036 1.00 82.19  ? 200  DA  J "O4'" 1 
ATOM   4072  C "C3'" . DA  B 1 54  ? 26.423  39.788  -47.332 1.00 82.19  ? 200  DA  J "C3'" 1 
ATOM   4073  O "O3'" . DA  B 1 54  ? 27.727  39.509  -47.900 1.00 82.19  ? 200  DA  J "O3'" 1 
ATOM   4074  C "C2'" . DA  B 1 54  ? 25.283  39.062  -48.033 1.00 82.19  ? 200  DA  J "C2'" 1 
ATOM   4075  C "C1'" . DA  B 1 54  ? 25.287  37.684  -47.356 1.00 82.19  ? 200  DA  J "C1'" 1 
ATOM   4076  N N9    . DA  B 1 54  ? 23.974  37.026  -47.271 1.00 69.75  ? 200  DA  J N9    1 
ATOM   4077  C C8    . DA  B 1 54  ? 22.744  37.634  -47.406 1.00 69.75  ? 200  DA  J C8    1 
ATOM   4078  N N7    . DA  B 1 54  ? 21.731  36.798  -47.342 1.00 69.75  ? 200  DA  J N7    1 
ATOM   4079  C C5    . DA  B 1 54  ? 22.330  35.566  -47.138 1.00 69.75  ? 200  DA  J C5    1 
ATOM   4080  C C6    . DA  B 1 54  ? 21.800  34.285  -46.994 1.00 69.75  ? 200  DA  J C6    1 
ATOM   4081  N N6    . DA  B 1 54  ? 20.510  34.037  -47.053 1.00 69.75  ? 200  DA  J N6    1 
ATOM   4082  N N1    . DA  B 1 54  ? 22.646  33.256  -46.788 1.00 69.75  ? 200  DA  J N1    1 
ATOM   4083  C C2    . DA  B 1 54  ? 23.937  33.518  -46.735 1.00 69.75  ? 200  DA  J C2    1 
ATOM   4084  N N3    . DA  B 1 54  ? 24.570  34.696  -46.873 1.00 69.75  ? 200  DA  J N3    1 
ATOM   4085  C C4    . DA  B 1 54  ? 23.702  35.689  -47.075 1.00 69.75  ? 200  DA  J C4    1 
ATOM   4086  P P     . DA  B 1 55  ? 28.046  39.813  -49.478 1.00 84.68  ? 201  DA  J P     1 
ATOM   4087  O OP1   . DA  B 1 55  ? 29.473  40.261  -49.551 1.00 76.10  ? 201  DA  J OP1   1 
ATOM   4088  O OP2   . DA  B 1 55  ? 26.981  40.611  -50.176 1.00 76.10  ? 201  DA  J OP2   1 
ATOM   4089  O "O5'" . DA  B 1 55  ? 28.022  38.368  -50.118 1.00 84.68  ? 201  DA  J "O5'" 1 
ATOM   4090  C "C5'" . DA  B 1 55  ? 28.766  37.329  -49.514 1.00 84.68  ? 201  DA  J "C5'" 1 
ATOM   4091  C "C4'" . DA  B 1 55  ? 28.804  36.161  -50.454 1.00 84.68  ? 201  DA  J "C4'" 1 
ATOM   4092  O "O4'" . DA  B 1 55  ? 27.549  35.449  -50.372 1.00 84.68  ? 201  DA  J "O4'" 1 
ATOM   4093  C "C3'" . DA  B 1 55  ? 28.934  36.652  -51.891 1.00 84.68  ? 201  DA  J "C3'" 1 
ATOM   4094  O "O3'" . DA  B 1 55  ? 29.716  35.672  -52.567 1.00 84.68  ? 201  DA  J "O3'" 1 
ATOM   4095  C "C2'" . DA  B 1 55  ? 27.481  36.764  -52.340 1.00 84.68  ? 201  DA  J "C2'" 1 
ATOM   4096  C "C1'" . DA  B 1 55  ? 26.817  35.603  -51.585 1.00 84.68  ? 201  DA  J "C1'" 1 
ATOM   4097  N N9    . DA  B 1 55  ? 25.377  35.718  -51.261 1.00 76.10  ? 201  DA  J N9    1 
ATOM   4098  C C8    . DA  B 1 55  ? 24.638  36.866  -51.170 1.00 76.10  ? 201  DA  J C8    1 
ATOM   4099  N N7    . DA  B 1 55  ? 23.364  36.662  -50.922 1.00 76.10  ? 201  DA  J N7    1 
ATOM   4100  C C5    . DA  B 1 55  ? 23.253  35.283  -50.827 1.00 76.10  ? 201  DA  J C5    1 
ATOM   4101  C C6    . DA  B 1 55  ? 22.134  34.425  -50.592 1.00 76.10  ? 201  DA  J C6    1 
ATOM   4102  N N6    . DA  B 1 55  ? 20.891  34.870  -50.416 1.00 76.10  ? 201  DA  J N6    1 
ATOM   4103  N N1    . DA  B 1 55  ? 22.354  33.087  -50.554 1.00 76.10  ? 201  DA  J N1    1 
ATOM   4104  C C2    . DA  B 1 55  ? 23.609  32.649  -50.752 1.00 76.10  ? 201  DA  J C2    1 
ATOM   4105  N N3    . DA  B 1 55  ? 24.735  33.355  -50.993 1.00 76.10  ? 201  DA  J N3    1 
ATOM   4106  C C4    . DA  B 1 55  ? 24.486  34.682  -51.018 1.00 76.10  ? 201  DA  J C4    1 
ATOM   4107  P P     . DA  B 1 56  ? 30.216  35.899  -54.072 1.00 114.87 ? 202  DA  J P     1 
ATOM   4108  O OP1   . DA  B 1 56  ? 31.668  35.669  -53.979 1.00 65.98  ? 202  DA  J OP1   1 
ATOM   4109  O OP2   . DA  B 1 56  ? 29.710  37.144  -54.722 1.00 65.98  ? 202  DA  J OP2   1 
ATOM   4110  O "O5'" . DA  B 1 56  ? 29.610  34.613  -54.779 1.00 114.87 ? 202  DA  J "O5'" 1 
ATOM   4111  C "C5'" . DA  B 1 56  ? 29.703  33.333  -54.135 1.00 114.87 ? 202  DA  J "C5'" 1 
ATOM   4112  C "C4'" . DA  B 1 56  ? 28.757  32.357  -54.790 1.00 114.87 ? 202  DA  J "C4'" 1 
ATOM   4113  O "O4'" . DA  B 1 56  ? 27.395  32.498  -54.312 1.00 114.87 ? 202  DA  J "O4'" 1 
ATOM   4114  C "C3'" . DA  B 1 56  ? 28.680  32.537  -56.303 1.00 114.87 ? 202  DA  J "C3'" 1 
ATOM   4115  O "O3'" . DA  B 1 56  ? 28.386  31.268  -56.866 1.00 114.87 ? 202  DA  J "O3'" 1 
ATOM   4116  C "C2'" . DA  B 1 56  ? 27.447  33.403  -56.467 1.00 114.87 ? 202  DA  J "C2'" 1 
ATOM   4117  C "C1'" . DA  B 1 56  ? 26.547  32.744  -55.429 1.00 114.87 ? 202  DA  J "C1'" 1 
ATOM   4118  N N9    . DA  B 1 56  ? 25.406  33.538  -54.973 1.00 65.98  ? 202  DA  J N9    1 
ATOM   4119  C C8    . DA  B 1 56  ? 25.376  34.889  -54.764 1.00 65.98  ? 202  DA  J C8    1 
ATOM   4120  N N7    . DA  B 1 56  ? 24.219  35.327  -54.332 1.00 65.98  ? 202  DA  J N7    1 
ATOM   4121  C C5    . DA  B 1 56  ? 23.428  34.187  -54.258 1.00 65.98  ? 202  DA  J C5    1 
ATOM   4122  C C6    . DA  B 1 56  ? 22.086  33.983  -53.873 1.00 65.98  ? 202  DA  J C6    1 
ATOM   4123  N N6    . DA  B 1 56  ? 21.283  34.941  -53.413 1.00 65.98  ? 202  DA  J N6    1 
ATOM   4124  N N1    . DA  B 1 56  ? 21.593  32.740  -53.959 1.00 65.98  ? 202  DA  J N1    1 
ATOM   4125  C C2    . DA  B 1 56  ? 22.398  31.768  -54.361 1.00 65.98  ? 202  DA  J C2    1 
ATOM   4126  N N3    . DA  B 1 56  ? 23.685  31.825  -54.724 1.00 65.98  ? 202  DA  J N3    1 
ATOM   4127  C C4    . DA  B 1 56  ? 24.143  33.082  -54.656 1.00 65.98  ? 202  DA  J C4    1 
ATOM   4128  P P     . DA  B 1 57  ? 29.293  30.700  -58.039 1.00 99.83  ? 203  DA  J P     1 
ATOM   4129  O OP1   . DA  B 1 57  ? 30.425  29.972  -57.385 1.00 55.93  ? 203  DA  J OP1   1 
ATOM   4130  O OP2   . DA  B 1 57  ? 29.530  31.892  -58.911 1.00 55.93  ? 203  DA  J OP2   1 
ATOM   4131  O "O5'" . DA  B 1 57  ? 28.341  29.699  -58.830 1.00 99.83  ? 203  DA  J "O5'" 1 
ATOM   4132  C "C5'" . DA  B 1 57  ? 27.461  28.805  -58.140 1.00 99.83  ? 203  DA  J "C5'" 1 
ATOM   4133  C "C4'" . DA  B 1 57  ? 26.093  28.784  -58.793 1.00 99.83  ? 203  DA  J "C4'" 1 
ATOM   4134  O "O4'" . DA  B 1 57  ? 25.186  29.807  -58.314 1.00 99.83  ? 203  DA  J "O4'" 1 
ATOM   4135  C "C3'" . DA  B 1 57  ? 26.025  28.860  -60.321 1.00 99.83  ? 203  DA  J "C3'" 1 
ATOM   4136  O "O3'" . DA  B 1 57  ? 25.011  27.952  -60.701 1.00 99.83  ? 203  DA  J "O3'" 1 
ATOM   4137  C "C2'" . DA  B 1 57  ? 25.484  30.253  -60.575 1.00 99.83  ? 203  DA  J "C2'" 1 
ATOM   4138  C "C1'" . DA  B 1 57  ? 24.488  30.325  -59.436 1.00 99.83  ? 203  DA  J "C1'" 1 
ATOM   4139  N N9    . DA  B 1 57  ? 23.974  31.638  -59.074 1.00 55.93  ? 203  DA  J N9    1 
ATOM   4140  C C8    . DA  B 1 57  ? 24.511  32.887  -59.300 1.00 55.93  ? 203  DA  J C8    1 
ATOM   4141  N N7    . DA  B 1 57  ? 23.801  33.878  -58.792 1.00 55.93  ? 203  DA  J N7    1 
ATOM   4142  C C5    . DA  B 1 57  ? 22.716  33.237  -58.209 1.00 55.93  ? 203  DA  J C5    1 
ATOM   4143  C C6    . DA  B 1 57  ? 21.616  33.710  -57.496 1.00 55.93  ? 203  DA  J C6    1 
ATOM   4144  N N6    . DA  B 1 57  ? 21.347  34.987  -57.312 1.00 55.93  ? 203  DA  J N6    1 
ATOM   4145  N N1    . DA  B 1 57  ? 20.767  32.804  -56.991 1.00 55.93  ? 203  DA  J N1    1 
ATOM   4146  C C2    . DA  B 1 57  ? 20.973  31.507  -57.246 1.00 55.93  ? 203  DA  J C2    1 
ATOM   4147  N N3    . DA  B 1 57  ? 21.941  30.930  -57.936 1.00 55.93  ? 203  DA  J N3    1 
ATOM   4148  C C4    . DA  B 1 57  ? 22.806  31.857  -58.383 1.00 55.93  ? 203  DA  J C4    1 
ATOM   4149  P P     . DG  B 1 58  ? 25.388  26.684  -61.603 1.00 74.41  ? 204  DG  J P     1 
ATOM   4150  O OP1   . DG  B 1 58  ? 26.318  25.702  -60.905 1.00 56.54  ? 204  DG  J OP1   1 
ATOM   4151  O OP2   . DG  B 1 58  ? 25.735  27.357  -62.923 1.00 56.54  ? 204  DG  J OP2   1 
ATOM   4152  O "O5'" . DG  B 1 58  ? 24.052  25.845  -61.796 1.00 74.41  ? 204  DG  J "O5'" 1 
ATOM   4153  C "C5'" . DG  B 1 58  ? 23.169  25.596  -60.705 1.00 74.41  ? 204  DG  J "C5'" 1 
ATOM   4154  C "C4'" . DG  B 1 58  ? 21.794  26.078  -61.084 1.00 74.41  ? 204  DG  J "C4'" 1 
ATOM   4155  O "O4'" . DG  B 1 58  ? 21.695  27.492  -60.792 1.00 74.41  ? 204  DG  J "O4'" 1 
ATOM   4156  C "C3'" . DG  B 1 58  ? 21.570  25.930  -62.596 1.00 74.41  ? 204  DG  J "C3'" 1 
ATOM   4157  O "O3'" . DG  B 1 58  ? 20.236  25.545  -62.853 1.00 74.41  ? 204  DG  J "O3'" 1 
ATOM   4158  C "C2'" . DG  B 1 58  ? 21.808  27.329  -63.136 1.00 74.41  ? 204  DG  J "C2'" 1 
ATOM   4159  C "C1'" . DG  B 1 58  ? 21.269  28.159  -61.976 1.00 74.41  ? 204  DG  J "C1'" 1 
ATOM   4160  N N9    . DG  B 1 58  ? 21.647  29.574  -61.902 1.00 56.54  ? 204  DG  J N9    1 
ATOM   4161  C C8    . DG  B 1 58  ? 22.828  30.114  -62.334 1.00 56.54  ? 204  DG  J C8    1 
ATOM   4162  N N7    . DG  B 1 58  ? 22.881  31.413  -62.217 1.00 56.54  ? 204  DG  J N7    1 
ATOM   4163  C C5    . DG  B 1 58  ? 21.654  31.762  -61.680 1.00 56.54  ? 204  DG  J C5    1 
ATOM   4164  C C6    . DG  B 1 58  ? 21.129  33.061  -61.344 1.00 56.54  ? 204  DG  J C6    1 
ATOM   4165  O O6    . DG  B 1 58  ? 21.637  34.185  -61.533 1.00 56.54  ? 204  DG  J O6    1 
ATOM   4166  N N1    . DG  B 1 58  ? 19.889  32.966  -60.735 1.00 56.54  ? 204  DG  J N1    1 
ATOM   4167  C C2    . DG  B 1 58  ? 19.234  31.785  -60.465 1.00 56.54  ? 204  DG  J C2    1 
ATOM   4168  N N2    . DG  B 1 58  ? 18.085  31.924  -59.750 1.00 56.54  ? 204  DG  J N2    1 
ATOM   4169  N N3    . DG  B 1 58  ? 19.683  30.561  -60.832 1.00 56.54  ? 204  DG  J N3    1 
ATOM   4170  C C4    . DG  B 1 58  ? 20.893  30.634  -61.428 1.00 56.54  ? 204  DG  J C4    1 
ATOM   4171  P P     . DG  B 1 59  ? 19.757  24.075  -62.491 1.00 55.69  ? 205  DG  J P     1 
ATOM   4172  O OP1   . DG  B 1 59  ? 20.260  23.653  -61.138 1.00 80.81  ? 205  DG  J OP1   1 
ATOM   4173  O OP2   . DG  B 1 59  ? 20.098  23.286  -63.687 1.00 80.81  ? 205  DG  J OP2   1 
ATOM   4174  O "O5'" . DG  B 1 59  ? 18.162  24.244  -62.319 1.00 55.69  ? 205  DG  J "O5'" 1 
ATOM   4175  C "C5'" . DG  B 1 59  ? 17.498  24.319  -61.015 1.00 55.69  ? 205  DG  J "C5'" 1 
ATOM   4176  C "C4'" . DG  B 1 59  ? 16.265  25.181  -61.114 1.00 55.69  ? 205  DG  J "C4'" 1 
ATOM   4177  O "O4'" . DG  B 1 59  ? 16.798  26.523  -61.290 1.00 55.69  ? 205  DG  J "O4'" 1 
ATOM   4178  C "C3'" . DG  B 1 59  ? 15.532  24.835  -62.406 1.00 55.69  ? 205  DG  J "C3'" 1 
ATOM   4179  O "O3'" . DG  B 1 59  ? 14.094  24.571  -62.496 1.00 55.69  ? 205  DG  J "O3'" 1 
ATOM   4180  C "C2'" . DG  B 1 59  ? 15.836  26.011  -63.317 1.00 55.69  ? 205  DG  J "C2'" 1 
ATOM   4181  C "C1'" . DG  B 1 59  ? 16.249  27.142  -62.425 1.00 55.69  ? 205  DG  J "C1'" 1 
ATOM   4182  N N9    . DG  B 1 59  ? 17.258  27.950  -63.121 1.00 80.81  ? 205  DG  J N9    1 
ATOM   4183  C C8    . DG  B 1 59  ? 18.318  27.469  -63.844 1.00 80.81  ? 205  DG  J C8    1 
ATOM   4184  N N7    . DG  B 1 59  ? 19.063  28.410  -64.381 1.00 80.81  ? 205  DG  J N7    1 
ATOM   4185  C C5    . DG  B 1 59  ? 18.465  29.599  -63.984 1.00 80.81  ? 205  DG  J C5    1 
ATOM   4186  C C6    . DG  B 1 59  ? 18.864  30.994  -64.204 1.00 80.81  ? 205  DG  J C6    1 
ATOM   4187  O O6    . DG  B 1 59  ? 19.885  31.443  -64.758 1.00 80.81  ? 205  DG  J O6    1 
ATOM   4188  N N1    . DG  B 1 59  ? 17.953  31.875  -63.659 1.00 80.81  ? 205  DG  J N1    1 
ATOM   4189  C C2    . DG  B 1 59  ? 16.839  31.508  -62.965 1.00 80.81  ? 205  DG  J C2    1 
ATOM   4190  N N2    . DG  B 1 59  ? 16.085  32.521  -62.539 1.00 80.81  ? 205  DG  J N2    1 
ATOM   4191  N N3    . DG  B 1 59  ? 16.478  30.243  -62.701 1.00 80.81  ? 205  DG  J N3    1 
ATOM   4192  C C4    . DG  B 1 59  ? 17.329  29.344  -63.233 1.00 80.81  ? 205  DG  J C4    1 
ATOM   4193  P P     . DC  B 1 60  ? 13.118  24.788  -61.268 1.00 35.24  ? 206  DC  J P     1 
ATOM   4194  O OP1   . DC  B 1 60  ? 13.626  24.180  -59.984 1.00 45.00  ? 206  DC  J OP1   1 
ATOM   4195  O OP2   . DC  B 1 60  ? 11.735  24.524  -61.719 1.00 45.00  ? 206  DC  J OP2   1 
ATOM   4196  O "O5'" . DC  B 1 60  ? 12.968  26.369  -61.312 1.00 35.24  ? 206  DC  J "O5'" 1 
ATOM   4197  C "C5'" . DC  B 1 60  ? 12.313  26.926  -62.411 1.00 35.24  ? 206  DC  J "C5'" 1 
ATOM   4198  C "C4'" . DC  B 1 60  ? 12.281  28.412  -62.311 1.00 35.24  ? 206  DC  J "C4'" 1 
ATOM   4199  O "O4'" . DC  B 1 60  ? 13.503  28.965  -62.872 1.00 35.24  ? 206  DC  J "O4'" 1 
ATOM   4200  C "C3'" . DC  B 1 60  ? 11.144  28.836  -63.226 1.00 35.24  ? 206  DC  J "C3'" 1 
ATOM   4201  O "O3'" . DC  B 1 60  ? 10.373  29.801  -62.581 1.00 35.24  ? 206  DC  J "O3'" 1 
ATOM   4202  C "C2'" . DC  B 1 60  ? 11.823  29.399  -64.462 1.00 35.24  ? 206  DC  J "C2'" 1 
ATOM   4203  C "C1'" . DC  B 1 60  ? 13.206  29.818  -63.998 1.00 35.24  ? 206  DC  J "C1'" 1 
ATOM   4204  N N1    . DC  B 1 60  ? 14.129  29.525  -65.111 1.00 45.00  ? 206  DC  J N1    1 
ATOM   4205  C C2    . DC  B 1 60  ? 14.806  30.560  -65.750 1.00 45.00  ? 206  DC  J C2    1 
ATOM   4206  O O2    . DC  B 1 60  ? 14.483  31.730  -65.473 1.00 45.00  ? 206  DC  J O2    1 
ATOM   4207  N N3    . DC  B 1 60  ? 15.767  30.251  -66.709 1.00 45.00  ? 206  DC  J N3    1 
ATOM   4208  C C4    . DC  B 1 60  ? 15.970  28.963  -67.071 1.00 45.00  ? 206  DC  J C4    1 
ATOM   4209  N N4    . DC  B 1 60  ? 16.958  28.673  -67.992 1.00 45.00  ? 206  DC  J N4    1 
ATOM   4210  C C5    . DC  B 1 60  ? 15.192  27.908  -66.503 1.00 45.00  ? 206  DC  J C5    1 
ATOM   4211  C C6    . DC  B 1 60  ? 14.311  28.242  -65.520 1.00 45.00  ? 206  DC  J C6    1 
ATOM   4212  P P     . DA  B 1 61  ? 8.818   29.831  -62.810 1.00 23.64  ? 207  DA  J P     1 
ATOM   4213  O OP1   . DA  B 1 61  ? 8.225   29.640  -61.436 1.00 43.53  ? 207  DA  J OP1   1 
ATOM   4214  O OP2   . DA  B 1 61  ? 8.391   28.945  -63.956 1.00 43.53  ? 207  DA  J OP2   1 
ATOM   4215  O "O5'" . DA  B 1 61  ? 8.590   31.324  -63.271 1.00 23.64  ? 207  DA  J "O5'" 1 
ATOM   4216  C "C5'" . DA  B 1 61  ? 8.984   32.345  -62.377 1.00 23.64  ? 207  DA  J "C5'" 1 
ATOM   4217  C "C4'" . DA  B 1 61  ? 9.237   33.649  -63.090 1.00 23.64  ? 207  DA  J "C4'" 1 
ATOM   4218  O "O4'" . DA  B 1 61  ? 10.378  33.484  -63.944 1.00 23.64  ? 207  DA  J "O4'" 1 
ATOM   4219  C "C3'" . DA  B 1 61  ? 8.105   34.174  -63.974 1.00 23.64  ? 207  DA  J "C3'" 1 
ATOM   4220  O "O3'" . DA  B 1 61  ? 7.821   35.530  -63.679 1.00 23.64  ? 207  DA  J "O3'" 1 
ATOM   4221  C "C2'" . DA  B 1 61  ? 8.546   33.929  -65.412 1.00 23.64  ? 207  DA  J "C2'" 1 
ATOM   4222  C "C1'" . DA  B 1 61  ? 10.076  33.823  -65.301 1.00 23.64  ? 207  DA  J "C1'" 1 
ATOM   4223  N N9    . DA  B 1 61  ? 10.756  32.821  -66.158 1.00 43.53  ? 207  DA  J N9    1 
ATOM   4224  C C8    . DA  B 1 61  ? 10.532  31.482  -66.170 1.00 43.53  ? 207  DA  J C8    1 
ATOM   4225  N N7    . DA  B 1 61  ? 11.312  30.815  -66.983 1.00 43.53  ? 207  DA  J N7    1 
ATOM   4226  C C5    . DA  B 1 61  ? 12.088  31.778  -67.559 1.00 43.53  ? 207  DA  J C5    1 
ATOM   4227  C C6    . DA  B 1 61  ? 13.112  31.703  -68.482 1.00 43.53  ? 207  DA  J C6    1 
ATOM   4228  N N6    . DA  B 1 61  ? 13.519  30.554  -69.040 1.00 43.53  ? 207  DA  J N6    1 
ATOM   4229  N N1    . DA  B 1 61  ? 13.723  32.877  -68.829 1.00 43.53  ? 207  DA  J N1    1 
ATOM   4230  C C2    . DA  B 1 61  ? 13.284  34.022  -68.285 1.00 43.53  ? 207  DA  J C2    1 
ATOM   4231  N N3    . DA  B 1 61  ? 12.312  34.208  -67.425 1.00 43.53  ? 207  DA  J N3    1 
ATOM   4232  C C4    . DA  B 1 61  ? 11.757  33.031  -67.079 1.00 43.53  ? 207  DA  J C4    1 
ATOM   4233  P P     . DT  B 1 62  ? 6.777   36.268  -64.582 1.00 35.93  ? 208  DT  J P     1 
ATOM   4234  O OP1   . DT  B 1 62  ? 6.256   37.482  -63.845 1.00 36.73  ? 208  DT  J OP1   1 
ATOM   4235  O OP2   . DT  B 1 62  ? 5.822   35.314  -65.225 1.00 36.73  ? 208  DT  J OP2   1 
ATOM   4236  O "O5'" . DT  B 1 62  ? 7.690   36.648  -65.831 1.00 35.93  ? 208  DT  J "O5'" 1 
ATOM   4237  C "C5'" . DT  B 1 62  ? 8.734   37.586  -65.688 1.00 35.93  ? 208  DT  J "C5'" 1 
ATOM   4238  C "C4'" . DT  B 1 62  ? 9.283   37.977  -67.029 1.00 35.93  ? 208  DT  J "C4'" 1 
ATOM   4239  O "O4'" . DT  B 1 62  ? 9.955   36.854  -67.679 1.00 35.93  ? 208  DT  J "O4'" 1 
ATOM   4240  C "C3'" . DT  B 1 62  ? 8.246   38.502  -68.013 1.00 35.93  ? 208  DT  J "C3'" 1 
ATOM   4241  O "O3'" . DT  B 1 62  ? 8.580   39.884  -68.349 1.00 35.93  ? 208  DT  J "O3'" 1 
ATOM   4242  C "C2'" . DT  B 1 62  ? 8.285   37.476  -69.170 1.00 35.93  ? 208  DT  J "C2'" 1 
ATOM   4243  C "C1'" . DT  B 1 62  ? 9.657   36.833  -69.063 1.00 35.93  ? 208  DT  J "C1'" 1 
ATOM   4244  N N1    . DT  B 1 62  ? 9.830   35.447  -69.521 1.00 36.73  ? 208  DT  J N1    1 
ATOM   4245  C C2    . DT  B 1 62  ? 10.954  35.132  -70.276 1.00 36.73  ? 208  DT  J C2    1 
ATOM   4246  O O2    . DT  B 1 62  ? 11.812  35.933  -70.551 1.00 36.73  ? 208  DT  J O2    1 
ATOM   4247  N N3    . DT  B 1 62  ? 11.053  33.823  -70.673 1.00 36.73  ? 208  DT  J N3    1 
ATOM   4248  C C4    . DT  B 1 62  ? 10.175  32.804  -70.360 1.00 36.73  ? 208  DT  J C4    1 
ATOM   4249  O O4    . DT  B 1 62  ? 10.379  31.666  -70.760 1.00 36.73  ? 208  DT  J O4    1 
ATOM   4250  C C5    . DT  B 1 62  ? 9.044   33.191  -69.560 1.00 36.73  ? 208  DT  J C5    1 
ATOM   4251  C C7    . DT  B 1 62  ? 8.056   32.138  -69.188 1.00 36.73  ? 208  DT  J C7    1 
ATOM   4252  C C6    . DT  B 1 62  ? 8.923   34.484  -69.194 1.00 36.73  ? 208  DT  J C6    1 
ATOM   4253  P P     . DG  B 1 63  ? 7.545   40.792  -69.184 1.00 43.15  ? 209  DG  J P     1 
ATOM   4254  O OP1   . DG  B 1 63  ? 7.649   42.153  -68.666 1.00 50.16  ? 209  DG  J OP1   1 
ATOM   4255  O OP2   . DG  B 1 63  ? 6.220   40.160  -69.288 1.00 50.16  ? 209  DG  J OP2   1 
ATOM   4256  O "O5'" . DG  B 1 63  ? 8.093   40.724  -70.678 1.00 43.15  ? 209  DG  J "O5'" 1 
ATOM   4257  C "C5'" . DG  B 1 63  ? 9.513   40.687  -70.968 1.00 43.15  ? 209  DG  J "C5'" 1 
ATOM   4258  C "C4'" . DG  B 1 63  ? 9.719   40.345  -72.426 1.00 43.15  ? 209  DG  J "C4'" 1 
ATOM   4259  O "O4'" . DG  B 1 63  ? 9.967   38.925  -72.599 1.00 43.15  ? 209  DG  J "O4'" 1 
ATOM   4260  C "C3'" . DG  B 1 63  ? 8.487   40.663  -73.297 1.00 43.15  ? 209  DG  J "C3'" 1 
ATOM   4261  O "O3'" . DG  B 1 63  ? 8.874   41.162  -74.573 1.00 43.15  ? 209  DG  J "O3'" 1 
ATOM   4262  C "C2'" . DG  B 1 63  ? 7.812   39.312  -73.476 1.00 43.15  ? 209  DG  J "C2'" 1 
ATOM   4263  C "C1'" . DG  B 1 63  ? 9.016   38.395  -73.558 1.00 43.15  ? 209  DG  J "C1'" 1 
ATOM   4264  N N9    . DG  B 1 63  ? 8.763   36.993  -73.235 1.00 50.16  ? 209  DG  J N9    1 
ATOM   4265  C C8    . DG  B 1 63  ? 7.961   36.493  -72.222 1.00 50.16  ? 209  DG  J C8    1 
ATOM   4266  N N7    . DG  B 1 63  ? 7.983   35.184  -72.131 1.00 50.16  ? 209  DG  J N7    1 
ATOM   4267  C C5    . DG  B 1 63  ? 8.835   34.790  -73.157 1.00 50.16  ? 209  DG  J C5    1 
ATOM   4268  C C6    . DG  B 1 63  ? 9.267   33.498  -73.560 1.00 50.16  ? 209  DG  J C6    1 
ATOM   4269  O O6    . DG  B 1 63  ? 8.925   32.391  -73.103 1.00 50.16  ? 209  DG  J O6    1 
ATOM   4270  N N1    . DG  B 1 63  ? 10.177  33.575  -74.608 1.00 50.16  ? 209  DG  J N1    1 
ATOM   4271  C C2    . DG  B 1 63  ? 10.598  34.740  -75.212 1.00 50.16  ? 209  DG  J C2    1 
ATOM   4272  N N2    . DG  B 1 63  ? 11.510  34.592  -76.157 1.00 50.16  ? 209  DG  J N2    1 
ATOM   4273  N N3    . DG  B 1 63  ? 10.168  35.941  -74.894 1.00 50.16  ? 209  DG  J N3    1 
ATOM   4274  C C4    . DG  B 1 63  ? 9.316   35.899  -73.859 1.00 50.16  ? 209  DG  J C4    1 
ATOM   4275  P P     . DT  B 1 64  ? 7.772   41.769  -75.526 1.00 51.18  ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 64  ? 7.922   43.224  -75.566 1.00 49.19  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 64  ? 6.456   41.231  -75.113 1.00 49.19  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 64  ? 8.127   41.081  -76.920 1.00 51.18  ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 64  ? 9.439   40.660  -77.207 1.00 51.18  ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 64  ? 9.427   39.563  -78.252 1.00 51.18  ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 64  ? 9.387   38.220  -77.675 1.00 51.18  ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 64  ? 8.364   39.586  -79.354 1.00 51.18  ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 64  ? 8.985   39.416  -80.605 1.00 51.18  ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 64  ? 7.603   38.277  -79.166 1.00 51.18  ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 64  ? 8.602   37.347  -78.496 1.00 51.18  ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 64  ? 7.984   36.308  -77.606 1.00 49.19  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 64  ? 8.156   34.940  -77.858 1.00 49.19  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 64  ? 8.869   34.472  -78.737 1.00 49.19  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 64  ? 7.493   34.115  -77.016 1.00 49.19  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 64  ? 6.764   34.457  -75.945 1.00 49.19  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 64  ? 6.307   33.581  -75.251 1.00 49.19  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 64  ? 6.633   35.884  -75.713 1.00 49.19  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 64  ? 5.823   36.362  -74.549 1.00 49.19  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 64  ? 7.241   36.721  -76.549 1.00 49.19  ? 210  DT  J C6    1 
ATOM   4295  P P     . DT  B 1 65  ? 8.213   39.844  -81.937 1.00 63.54  ? 211  DT  J P     1 
ATOM   4296  O OP1   . DT  B 1 65  ? 9.096   40.882  -82.530 1.00 60.90  ? 211  DT  J OP1   1 
ATOM   4297  O OP2   . DT  B 1 65  ? 6.763   40.110  -81.669 1.00 60.90  ? 211  DT  J OP2   1 
ATOM   4298  O "O5'" . DT  B 1 65  ? 8.283   38.539  -82.828 1.00 63.54  ? 211  DT  J "O5'" 1 
ATOM   4299  C "C5'" . DT  B 1 65  ? 9.474   37.796  -82.864 1.00 63.54  ? 211  DT  J "C5'" 1 
ATOM   4300  C "C4'" . DT  B 1 65  ? 9.197   36.432  -83.431 1.00 63.54  ? 211  DT  J "C4'" 1 
ATOM   4301  O "O4'" . DT  B 1 65  ? 8.640   35.592  -82.418 1.00 63.54  ? 211  DT  J "O4'" 1 
ATOM   4302  C "C3'" . DT  B 1 65  ? 8.173   36.460  -84.556 1.00 63.54  ? 211  DT  J "C3'" 1 
ATOM   4303  O "O3'" . DT  B 1 65  ? 8.576   35.525  -85.548 1.00 63.54  ? 211  DT  J "O3'" 1 
ATOM   4304  C "C2'" . DT  B 1 65  ? 6.895   35.997  -83.894 1.00 63.54  ? 211  DT  J "C2'" 1 
ATOM   4305  C "C1'" . DT  B 1 65  ? 7.448   35.014  -82.904 1.00 63.54  ? 211  DT  J "C1'" 1 
ATOM   4306  N N1    . DT  B 1 65  ? 6.598   34.750  -81.747 1.00 60.90  ? 211  DT  J N1    1 
ATOM   4307  C C2    . DT  B 1 65  ? 6.420   33.449  -81.311 1.00 60.90  ? 211  DT  J C2    1 
ATOM   4308  O O2    . DT  B 1 65  ? 6.984   32.465  -81.802 1.00 60.90  ? 211  DT  J O2    1 
ATOM   4309  N N3    . DT  B 1 65  ? 5.589   33.337  -80.237 1.00 60.90  ? 211  DT  J N3    1 
ATOM   4310  C C4    . DT  B 1 65  ? 4.990   34.354  -79.522 1.00 60.90  ? 211  DT  J C4    1 
ATOM   4311  O O4    . DT  B 1 65  ? 4.277   34.089  -78.557 1.00 60.90  ? 211  DT  J O4    1 
ATOM   4312  C C5    . DT  B 1 65  ? 5.270   35.679  -79.998 1.00 60.90  ? 211  DT  J C5    1 
ATOM   4313  C C7    . DT  B 1 65  ? 4.754   36.857  -79.242 1.00 60.90  ? 211  DT  J C7    1 
ATOM   4314  C C6    . DT  B 1 65  ? 6.013   35.804  -81.094 1.00 60.90  ? 211  DT  J C6    1 
ATOM   4315  P P     . DC  B 1 66  ? 7.966   35.609  -87.025 1.00 54.08  ? 212  DC  J P     1 
ATOM   4316  O OP1   . DC  B 1 66  ? 9.150   35.253  -87.849 1.00 44.67  ? 212  DC  J OP1   1 
ATOM   4317  O OP2   . DC  B 1 66  ? 7.214   36.867  -87.227 1.00 44.67  ? 212  DC  J OP2   1 
ATOM   4318  O "O5'" . DC  B 1 66  ? 6.949   34.410  -87.023 1.00 54.08  ? 212  DC  J "O5'" 1 
ATOM   4319  C "C5'" . DC  B 1 66  ? 7.416   33.142  -86.660 1.00 54.08  ? 212  DC  J "C5'" 1 
ATOM   4320  C "C4'" . DC  B 1 66  ? 6.236   32.262  -86.399 1.00 54.08  ? 212  DC  J "C4'" 1 
ATOM   4321  O "O4'" . DC  B 1 66  ? 5.610   32.473  -85.101 1.00 54.08  ? 212  DC  J "O4'" 1 
ATOM   4322  C "C3'" . DC  B 1 66  ? 5.148   32.526  -87.427 1.00 54.08  ? 212  DC  J "C3'" 1 
ATOM   4323  O "O3'" . DC  B 1 66  ? 4.719   31.248  -87.820 1.00 54.08  ? 212  DC  J "O3'" 1 
ATOM   4324  C "C2'" . DC  B 1 66  ? 4.036   33.221  -86.643 1.00 54.08  ? 212  DC  J "C2'" 1 
ATOM   4325  C "C1'" . DC  B 1 66  ? 4.199   32.531  -85.296 1.00 54.08  ? 212  DC  J "C1'" 1 
ATOM   4326  N N1    . DC  B 1 66  ? 3.612   33.206  -84.127 1.00 44.67  ? 212  DC  J N1    1 
ATOM   4327  C C2    . DC  B 1 66  ? 3.046   32.422  -83.092 1.00 44.67  ? 212  DC  J C2    1 
ATOM   4328  O O2    . DC  B 1 66  ? 2.955   31.232  -83.262 1.00 44.67  ? 212  DC  J O2    1 
ATOM   4329  N N3    . DC  B 1 66  ? 2.597   33.017  -81.962 1.00 44.67  ? 212  DC  J N3    1 
ATOM   4330  C C4    . DC  B 1 66  ? 2.639   34.355  -81.852 1.00 44.67  ? 212  DC  J C4    1 
ATOM   4331  N N4    . DC  B 1 66  ? 2.156   34.926  -80.749 1.00 44.67  ? 212  DC  J N4    1 
ATOM   4332  C C5    . DC  B 1 66  ? 3.166   35.188  -82.898 1.00 44.67  ? 212  DC  J C5    1 
ATOM   4333  C C6    . DC  B 1 66  ? 3.636   34.575  -84.018 1.00 44.67  ? 212  DC  J C6    1 
ATOM   4334  P P     . DA  B 1 67  ? 4.419   30.965  -89.348 1.00 46.35  ? 213  DA  J P     1 
ATOM   4335  O OP1   . DA  B 1 67  ? 5.714   30.409  -89.843 1.00 45.33  ? 213  DA  J OP1   1 
ATOM   4336  O OP2   . DA  B 1 67  ? 3.856   32.238  -89.859 1.00 45.33  ? 213  DA  J OP2   1 
ATOM   4337  O "O5'" . DA  B 1 67  ? 3.285   29.851  -89.261 1.00 46.35  ? 213  DA  J "O5'" 1 
ATOM   4338  C "C5'" . DA  B 1 67  ? 3.544   28.616  -88.572 1.00 46.35  ? 213  DA  J "C5'" 1 
ATOM   4339  C "C4'" . DA  B 1 67  ? 2.275   28.115  -87.939 1.00 46.35  ? 213  DA  J "C4'" 1 
ATOM   4340  O "O4'" . DA  B 1 67  ? 1.953   29.043  -86.903 1.00 46.35  ? 213  DA  J "O4'" 1 
ATOM   4341  C "C3'" . DA  B 1 67  ? 1.094   28.184  -88.918 1.00 46.35  ? 213  DA  J "C3'" 1 
ATOM   4342  O "O3'" . DA  B 1 67  ? 0.125   27.221  -88.536 1.00 46.35  ? 213  DA  J "O3'" 1 
ATOM   4343  C "C2'" . DA  B 1 67  ? 0.499   29.545  -88.628 1.00 46.35  ? 213  DA  J "C2'" 1 
ATOM   4344  C "C1'" . DA  B 1 67  ? 0.648   29.481  -87.148 1.00 46.35  ? 213  DA  J "C1'" 1 
ATOM   4345  N N9    . DA  B 1 67  ? 0.456   30.726  -86.467 1.00 45.33  ? 213  DA  J N9    1 
ATOM   4346  C C8    . DA  B 1 67  ? 0.555   31.985  -86.947 1.00 45.33  ? 213  DA  J C8    1 
ATOM   4347  N N7    . DA  B 1 67  ? 0.272   32.899  -86.054 1.00 45.33  ? 213  DA  J N7    1 
ATOM   4348  C C5    . DA  B 1 67  ? -0.017  32.172  -84.903 1.00 45.33  ? 213  DA  J C5    1 
ATOM   4349  C C6    . DA  B 1 67  ? -0.310  32.551  -83.582 1.00 45.33  ? 213  DA  J C6    1 
ATOM   4350  N N6    . DA  B 1 67  ? -0.449  33.811  -83.185 1.00 45.33  ? 213  DA  J N6    1 
ATOM   4351  N N1    . DA  B 1 67  ? -0.453  31.566  -82.664 1.00 45.33  ? 213  DA  J N1    1 
ATOM   4352  C C2    . DA  B 1 67  ? -0.329  30.295  -83.065 1.00 45.33  ? 213  DA  J C2    1 
ATOM   4353  N N3    . DA  B 1 67  ? -0.075  29.827  -84.270 1.00 45.33  ? 213  DA  J N3    1 
ATOM   4354  C C4    . DA  B 1 67  ? 0.089   30.834  -85.149 1.00 45.33  ? 213  DA  J C4    1 
ATOM   4355  P P     . DG  B 1 68  ? 0.196   25.766  -89.154 1.00 54.55  ? 214  DG  J P     1 
ATOM   4356  O OP1   . DG  B 1 68  ? 1.623   25.383  -89.039 1.00 44.58  ? 214  DG  J OP1   1 
ATOM   4357  O OP2   . DG  B 1 68  ? -0.518  25.789  -90.481 1.00 44.58  ? 214  DG  J OP2   1 
ATOM   4358  O "O5'" . DG  B 1 68  ? -0.598  24.888  -88.121 1.00 54.55  ? 214  DG  J "O5'" 1 
ATOM   4359  C "C5'" . DG  B 1 68  ? 0.070   24.438  -86.964 1.00 54.55  ? 214  DG  J "C5'" 1 
ATOM   4360  C "C4'" . DG  B 1 68  ? -0.927  24.302  -85.853 1.00 54.55  ? 214  DG  J "C4'" 1 
ATOM   4361  O "O4'" . DG  B 1 68  ? -1.431  25.588  -85.495 1.00 54.55  ? 214  DG  J "O4'" 1 
ATOM   4362  C "C3'" . DG  B 1 68  ? -2.123  23.521  -86.341 1.00 54.55  ? 214  DG  J "C3'" 1 
ATOM   4363  O "O3'" . DG  B 1 68  ? -2.495  22.682  -85.269 1.00 54.55  ? 214  DG  J "O3'" 1 
ATOM   4364  C "C2'" . DG  B 1 68  ? -3.142  24.586  -86.718 1.00 54.55  ? 214  DG  J "C2'" 1 
ATOM   4365  C "C1'" . DG  B 1 68  ? -2.814  25.657  -85.740 1.00 54.55  ? 214  DG  J "C1'" 1 
ATOM   4366  N N9    . DG  B 1 68  ? -3.079  27.020  -86.128 1.00 44.58  ? 214  DG  J N9    1 
ATOM   4367  C C8    . DG  B 1 68  ? -3.043  27.577  -87.376 1.00 44.58  ? 214  DG  J C8    1 
ATOM   4368  N N7    . DG  B 1 68  ? -3.152  28.878  -87.354 1.00 44.58  ? 214  DG  J N7    1 
ATOM   4369  C C5    . DG  B 1 68  ? -3.306  29.186  -86.016 1.00 44.58  ? 214  DG  J C5    1 
ATOM   4370  C C6    . DG  B 1 68  ? -3.391  30.419  -85.345 1.00 44.58  ? 214  DG  J C6    1 
ATOM   4371  O O6    . DG  B 1 68  ? -3.238  31.549  -85.771 1.00 44.58  ? 214  DG  J O6    1 
ATOM   4372  N N1    . DG  B 1 68  ? -3.590  30.265  -84.017 1.00 44.58  ? 214  DG  J N1    1 
ATOM   4373  C C2    . DG  B 1 68  ? -3.605  29.081  -83.349 1.00 44.58  ? 214  DG  J C2    1 
ATOM   4374  N N2    . DG  B 1 68  ? -3.779  29.163  -82.037 1.00 44.58  ? 214  DG  J N2    1 
ATOM   4375  N N3    . DG  B 1 68  ? -3.456  27.920  -83.918 1.00 44.58  ? 214  DG  J N3    1 
ATOM   4376  C C4    . DG  B 1 68  ? -3.317  28.045  -85.257 1.00 44.58  ? 214  DG  J C4    1 
ATOM   4377  P P     . DC  B 1 69  ? -3.672  21.654  -85.449 1.00 77.96  ? 215  DC  J P     1 
ATOM   4378  O OP1   . DC  B 1 69  ? -3.072  20.359  -85.025 1.00 48.90  ? 215  DC  J OP1   1 
ATOM   4379  O OP2   . DC  B 1 69  ? -4.367  21.809  -86.741 1.00 48.90  ? 215  DC  J OP2   1 
ATOM   4380  O "O5'" . DC  B 1 69  ? -4.788  22.216  -84.471 1.00 77.96  ? 215  DC  J "O5'" 1 
ATOM   4381  C "C5'" . DC  B 1 69  ? -4.451  22.704  -83.174 1.00 77.96  ? 215  DC  J "C5'" 1 
ATOM   4382  C "C4'" . DC  B 1 69  ? -5.601  23.500  -82.616 1.00 77.96  ? 215  DC  J "C4'" 1 
ATOM   4383  O "O4'" . DC  B 1 69  ? -5.619  24.802  -83.229 1.00 77.96  ? 215  DC  J "O4'" 1 
ATOM   4384  C "C3'" . DC  B 1 69  ? -6.962  22.889  -82.917 1.00 77.96  ? 215  DC  J "C3'" 1 
ATOM   4385  O "O3'" . DC  B 1 69  ? -7.817  23.155  -81.804 1.00 77.96  ? 215  DC  J "O3'" 1 
ATOM   4386  C "C2'" . DC  B 1 69  ? -7.400  23.620  -84.179 1.00 77.96  ? 215  DC  J "C2'" 1 
ATOM   4387  C "C1'" . DC  B 1 69  ? -6.876  25.006  -83.866 1.00 77.96  ? 215  DC  J "C1'" 1 
ATOM   4388  N N1    . DC  B 1 69  ? -6.671  25.886  -85.019 1.00 48.90  ? 215  DC  J N1    1 
ATOM   4389  C C2    . DC  B 1 69  ? -6.833  27.308  -84.864 1.00 48.90  ? 215  DC  J C2    1 
ATOM   4390  O O2    . DC  B 1 69  ? -7.088  27.783  -83.732 1.00 48.90  ? 215  DC  J O2    1 
ATOM   4391  N N3    . DC  B 1 69  ? -6.680  28.106  -85.951 1.00 48.90  ? 215  DC  J N3    1 
ATOM   4392  C C4    . DC  B 1 69  ? -6.357  27.558  -87.150 1.00 48.90  ? 215  DC  J C4    1 
ATOM   4393  N N4    . DC  B 1 69  ? -6.256  28.382  -88.224 1.00 48.90  ? 215  DC  J N4    1 
ATOM   4394  C C5    . DC  B 1 69  ? -6.138  26.142  -87.316 1.00 48.90  ? 215  DC  J C5    1 
ATOM   4395  C C6    . DC  B 1 69  ? -6.320  25.355  -86.234 1.00 48.90  ? 215  DC  J C6    1 
ATOM   4396  P P     . DG  B 1 70  ? -8.175  21.970  -80.804 1.00 48.02  ? 216  DG  J P     1 
ATOM   4397  O OP1   . DG  B 1 70  ? -6.888  21.307  -80.432 1.00 47.56  ? 216  DG  J OP1   1 
ATOM   4398  O OP2   . DG  B 1 70  ? -9.220  21.271  -81.654 1.00 47.56  ? 216  DG  J OP2   1 
ATOM   4399  O "O5'" . DG  B 1 70  ? -8.750  22.670  -79.496 1.00 48.02  ? 216  DG  J "O5'" 1 
ATOM   4400  C "C5'" . DG  B 1 70  ? -8.161  23.862  -78.972 1.00 48.02  ? 216  DG  J "C5'" 1 
ATOM   4401  C "C4'" . DG  B 1 70  ? -9.137  25.025  -79.039 1.00 48.02  ? 216  DG  J "C4'" 1 
ATOM   4402  O "O4'" . DG  B 1 70  ? -9.108  25.755  -80.290 1.00 48.02  ? 216  DG  J "O4'" 1 
ATOM   4403  C "C3'" . DG  B 1 70  ? -10.591 24.639  -78.844 1.00 48.02  ? 216  DG  J "C3'" 1 
ATOM   4404  O "O3'" . DG  B 1 70  ? -11.291 25.767  -78.340 1.00 48.02  ? 216  DG  J "O3'" 1 
ATOM   4405  C "C2'" . DG  B 1 70  ? -11.033 24.500  -80.268 1.00 48.02  ? 216  DG  J "C2'" 1 
ATOM   4406  C "C1'" . DG  B 1 70  ? -10.420 25.771  -80.788 1.00 48.02  ? 216  DG  J "C1'" 1 
ATOM   4407  N N9    . DG  B 1 70  ? -10.392 25.790  -82.242 1.00 47.56  ? 216  DG  J N9    1 
ATOM   4408  C C8    . DG  B 1 70  ? -10.384 24.692  -83.084 1.00 47.56  ? 216  DG  J C8    1 
ATOM   4409  N N7    . DG  B 1 70  ? -10.394 25.011  -84.351 1.00 47.56  ? 216  DG  J N7    1 
ATOM   4410  C C5    . DG  B 1 70  ? -10.369 26.394  -84.340 1.00 47.56  ? 216  DG  J C5    1 
ATOM   4411  C C6    . DG  B 1 70  ? -10.323 27.271  -85.400 1.00 47.56  ? 216  DG  J C6    1 
ATOM   4412  O O6    . DG  B 1 70  ? -10.158 26.993  -86.592 1.00 47.56  ? 216  DG  J O6    1 
ATOM   4413  N N1    . DG  B 1 70  ? -10.444 28.607  -84.979 1.00 47.56  ? 216  DG  J N1    1 
ATOM   4414  C C2    . DG  B 1 70  ? -10.522 29.018  -83.665 1.00 47.56  ? 216  DG  J C2    1 
ATOM   4415  N N2    . DG  B 1 70  ? -10.663 30.350  -83.466 1.00 47.56  ? 216  DG  J N2    1 
ATOM   4416  N N3    . DG  B 1 70  ? -10.474 28.172  -82.627 1.00 47.56  ? 216  DG  J N3    1 
ATOM   4417  C C4    . DG  B 1 70  ? -10.409 26.886  -83.044 1.00 47.56  ? 216  DG  J C4    1 
ATOM   4418  P P     . DG  B 1 71  ? -12.556 25.589  -77.372 1.00 27.86  ? 217  DG  J P     1 
ATOM   4419  O OP1   . DG  B 1 71  ? -12.004 25.486  -75.963 1.00 32.62  ? 217  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 1 71  ? -13.571 24.603  -77.805 1.00 32.62  ? 217  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 1 71  ? -13.179 27.000  -77.537 1.00 27.86  ? 217  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 1 71  ? -12.389 28.111  -77.177 1.00 27.86  ? 217  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 1 71  ? -12.986 29.356  -77.762 1.00 27.86  ? 217  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 1 71  ? -12.902 29.211  -79.205 1.00 27.86  ? 217  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 1 71  ? -14.479 29.466  -77.438 1.00 27.86  ? 217  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 1 71  ? -14.830 30.855  -77.331 1.00 27.86  ? 217  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 1 71  ? -15.145 28.760  -78.622 1.00 27.86  ? 217  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 1 71  ? -14.193 29.081  -79.768 1.00 27.86  ? 217  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 1 71  ? -14.089 28.223  -80.960 1.00 32.62  ? 217  DG  J N9    1 
ATOM   4430  C C8    . DG  B 1 71  ? -14.107 26.849  -81.111 1.00 32.62  ? 217  DG  J C8    1 
ATOM   4431  N N7    . DG  B 1 71  ? -14.003 26.470  -82.362 1.00 32.62  ? 217  DG  J N7    1 
ATOM   4432  C C5    . DG  B 1 71  ? -13.922 27.674  -83.082 1.00 32.62  ? 217  DG  J C5    1 
ATOM   4433  C C6    . DG  B 1 71  ? -13.812 27.944  -84.489 1.00 32.62  ? 217  DG  J C6    1 
ATOM   4434  O O6    . DG  B 1 71  ? -13.762 27.152  -85.411 1.00 32.62  ? 217  DG  J O6    1 
ATOM   4435  N N1    . DG  B 1 71  ? -13.739 29.295  -84.759 1.00 32.62  ? 217  DG  J N1    1 
ATOM   4436  C C2    . DG  B 1 71  ? -13.748 30.293  -83.808 1.00 32.62  ? 217  DG  J C2    1 
ATOM   4437  N N2    . DG  B 1 71  ? -13.595 31.590  -84.206 1.00 32.62  ? 217  DG  J N2    1 
ATOM   4438  N N3    . DG  B 1 71  ? -13.871 30.074  -82.526 1.00 32.62  ? 217  DG  J N3    1 
ATOM   4439  C C4    . DG  B 1 71  ? -13.950 28.747  -82.232 1.00 32.62  ? 217  DG  J C4    1 
ATOM   4440  P P     . DA  B 1 72  ? -16.279 31.240  -76.877 1.00 58.03  ? 218  DA  J P     1 
ATOM   4441  O OP1   . DA  B 1 72  ? -16.027 32.207  -75.818 1.00 38.01  ? 218  DA  J OP1   1 
ATOM   4442  O OP2   . DA  B 1 72  ? -17.095 29.951  -76.673 1.00 38.01  ? 218  DA  J OP2   1 
ATOM   4443  O "O5'" . DA  B 1 72  ? -16.904 32.059  -78.065 1.00 58.03  ? 218  DA  J "O5'" 1 
ATOM   4444  C "C5'" . DA  B 1 72  ? -16.196 33.082  -78.762 1.00 58.03  ? 218  DA  J "C5'" 1 
ATOM   4445  C "C4'" . DA  B 1 72  ? -16.873 33.300  -80.099 1.00 58.03  ? 218  DA  J "C4'" 1 
ATOM   4446  O "O4'" . DA  B 1 72  ? -16.577 32.203  -81.021 1.00 58.03  ? 218  DA  J "O4'" 1 
ATOM   4447  C "C3'" . DA  B 1 72  ? -18.407 33.322  -80.007 1.00 58.03  ? 218  DA  J "C3'" 1 
ATOM   4448  O "O3'" . DA  B 1 72  ? -18.858 34.284  -80.926 1.00 58.03  ? 218  DA  J "O3'" 1 
ATOM   4449  C "C2'" . DA  B 1 72  ? -18.836 31.948  -80.513 1.00 58.03  ? 218  DA  J "C2'" 1 
ATOM   4450  C "C1'" . DA  B 1 72  ? -17.796 31.751  -81.586 1.00 58.03  ? 218  DA  J "C1'" 1 
ATOM   4451  N N9    . DA  B 1 72  ? -17.597 30.396  -82.055 1.00 38.01  ? 218  DA  J N9    1 
ATOM   4452  C C8    . DA  B 1 72  ? -17.608 29.259  -81.319 1.00 38.01  ? 218  DA  J C8    1 
ATOM   4453  N N7    . DA  B 1 72  ? -17.488 28.162  -82.037 1.00 38.01  ? 218  DA  J N7    1 
ATOM   4454  C C5    . DA  B 1 72  ? -17.358 28.624  -83.332 1.00 38.01  ? 218  DA  J C5    1 
ATOM   4455  C C6    . DA  B 1 72  ? -17.206 27.978  -84.501 1.00 38.01  ? 218  DA  J C6    1 
ATOM   4456  N N6    . DA  B 1 72  ? -17.088 26.649  -84.576 1.00 38.01  ? 218  DA  J N6    1 
ATOM   4457  N N1    . DA  B 1 72  ? -17.153 28.718  -85.629 1.00 38.01  ? 218  DA  J N1    1 
ATOM   4458  C C2    . DA  B 1 72  ? -17.209 30.050  -85.543 1.00 38.01  ? 218  DA  J C2    1 
ATOM   4459  N N3    . DA  B 1 72  ? -17.318 30.783  -84.481 1.00 38.01  ? 218  DA  J N3    1 
ATOM   4460  C C4    . DA  B 1 72  ? -17.404 29.996  -83.374 1.00 38.01  ? 218  DA  J C4    1 
ATOM   4461  P P     . DA  B 1 73  ? -20.121 35.168  -80.574 1.00 65.36  ? 219  DA  J P     1 
ATOM   4462  O OP1   . DA  B 1 73  ? -19.604 36.419  -79.910 1.00 40.38  ? 219  DA  J OP1   1 
ATOM   4463  O OP2   . DA  B 1 73  ? -21.114 34.241  -79.927 1.00 40.38  ? 219  DA  J OP2   1 
ATOM   4464  O "O5'" . DA  B 1 73  ? -20.762 35.435  -81.989 1.00 65.36  ? 219  DA  J "O5'" 1 
ATOM   4465  C "C5'" . DA  B 1 73  ? -19.930 35.579  -83.094 1.00 65.36  ? 219  DA  J "C5'" 1 
ATOM   4466  C "C4'" . DA  B 1 73  ? -20.600 34.999  -84.299 1.00 65.36  ? 219  DA  J "C4'" 1 
ATOM   4467  O "O4'" . DA  B 1 73  ? -20.204 33.634  -84.526 1.00 65.36  ? 219  DA  J "O4'" 1 
ATOM   4468  C "C3'" . DA  B 1 73  ? -22.118 35.030  -84.223 1.00 65.36  ? 219  DA  J "C3'" 1 
ATOM   4469  O "O3'" . DA  B 1 73  ? -22.576 35.816  -85.344 1.00 65.36  ? 219  DA  J "O3'" 1 
ATOM   4470  C "C2'" . DA  B 1 73  ? -22.499 33.553  -84.276 1.00 65.36  ? 219  DA  J "C2'" 1 
ATOM   4471  C "C1'" . DA  B 1 73  ? -21.315 32.916  -84.998 1.00 65.36  ? 219  DA  J "C1'" 1 
ATOM   4472  N N9    . DA  B 1 73  ? -21.074 31.517  -84.669 1.00 40.38  ? 219  DA  J N9    1 
ATOM   4473  C C8    . DA  B 1 73  ? -21.148 30.993  -83.437 1.00 40.38  ? 219  DA  J C8    1 
ATOM   4474  N N7    . DA  B 1 73  ? -20.913 29.705  -83.387 1.00 40.38  ? 219  DA  J N7    1 
ATOM   4475  C C5    . DA  B 1 73  ? -20.667 29.363  -84.683 1.00 40.38  ? 219  DA  J C5    1 
ATOM   4476  C C6    . DA  B 1 73  ? -20.377 28.110  -85.300 1.00 40.38  ? 219  DA  J C6    1 
ATOM   4477  N N6    . DA  B 1 73  ? -20.290 26.949  -84.640 1.00 40.38  ? 219  DA  J N6    1 
ATOM   4478  N N1    . DA  B 1 73  ? -20.174 28.089  -86.636 1.00 40.38  ? 219  DA  J N1    1 
ATOM   4479  C C2    . DA  B 1 73  ? -20.234 29.263  -87.286 1.00 40.38  ? 219  DA  J C2    1 
ATOM   4480  N N3    . DA  B 1 73  ? -20.512 30.517  -86.797 1.00 40.38  ? 219  DA  J N3    1 
ATOM   4481  C C4    . DA  B 1 73  ? -20.731 30.476  -85.485 1.00 40.38  ? 219  DA  J C4    1 
ATOM   4482  P P     . DT  B 1 74  ? -24.150 35.983  -85.640 1.00 57.42  ? 220  DT  J P     1 
ATOM   4483  O OP1   . DT  B 1 74  ? -24.281 37.382  -86.098 1.00 61.14  ? 220  DT  J OP1   1 
ATOM   4484  O OP2   . DT  B 1 74  ? -24.999 35.488  -84.526 1.00 61.14  ? 220  DT  J OP2   1 
ATOM   4485  O "O5'" . DT  B 1 74  ? -24.352 34.940  -86.819 1.00 57.42  ? 220  DT  J "O5'" 1 
ATOM   4486  C "C5'" . DT  B 1 74  ? -23.423 34.862  -87.871 1.00 57.42  ? 220  DT  J "C5'" 1 
ATOM   4487  C "C4'" . DT  B 1 74  ? -23.834 33.732  -88.772 1.00 57.42  ? 220  DT  J "C4'" 1 
ATOM   4488  O "O4'" . DT  B 1 74  ? -23.333 32.470  -88.260 1.00 57.42  ? 220  DT  J "O4'" 1 
ATOM   4489  C "C3'" . DT  B 1 74  ? -25.352 33.575  -88.842 1.00 57.42  ? 220  DT  J "C3'" 1 
ATOM   4490  O "O3'" . DT  B 1 74  ? -25.812 33.373  -90.191 1.00 57.42  ? 220  DT  J "O3'" 1 
ATOM   4491  C "C2'" . DT  B 1 74  ? -25.612 32.306  -88.052 1.00 57.42  ? 220  DT  J "C2'" 1 
ATOM   4492  C "C1'" . DT  B 1 74  ? -24.372 31.510  -88.369 1.00 57.42  ? 220  DT  J "C1'" 1 
ATOM   4493  N N1    . DT  B 1 74  ? -24.117 30.385  -87.424 1.00 61.14  ? 220  DT  J N1    1 
ATOM   4494  C C2    . DT  B 1 74  ? -23.946 29.124  -87.932 1.00 61.14  ? 220  DT  J C2    1 
ATOM   4495  O O2    . DT  B 1 74  ? -24.000 28.879  -89.106 1.00 61.14  ? 220  DT  J O2    1 
ATOM   4496  N N3    . DT  B 1 74  ? -23.712 28.147  -86.997 1.00 61.14  ? 220  DT  J N3    1 
ATOM   4497  C C4    . DT  B 1 74  ? -23.647 28.296  -85.631 1.00 61.14  ? 220  DT  J C4    1 
ATOM   4498  O O4    . DT  B 1 74  ? -23.397 27.340  -84.936 1.00 61.14  ? 220  DT  J O4    1 
ATOM   4499  C C5    . DT  B 1 74  ? -23.875 29.622  -85.149 1.00 61.14  ? 220  DT  J C5    1 
ATOM   4500  C C7    . DT  B 1 74  ? -23.906 29.862  -83.675 1.00 61.14  ? 220  DT  J C7    1 
ATOM   4501  C C6    . DT  B 1 74  ? -24.071 30.598  -86.056 1.00 61.14  ? 220  DT  J C6    1 
ATOM   4502  P P     . DT  B 1 75  ? -27.413 33.340  -90.516 1.00 73.09  ? 221  DT  J P     1 
ATOM   4503  O OP1   . DT  B 1 75  ? -27.534 34.362  -91.591 1.00 59.53  ? 221  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 1 75  ? -28.222 33.505  -89.236 1.00 59.53  ? 221  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 1 75  ? -27.637 31.896  -91.154 1.00 73.09  ? 221  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 1 75  ? -26.690 31.370  -92.047 1.00 73.09  ? 221  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 1 75  ? -26.961 29.904  -92.258 1.00 73.09  ? 221  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 1 75  ? -26.570 29.132  -91.094 1.00 73.09  ? 221  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 1 75  ? -28.437 29.580  -92.501 1.00 73.09  ? 221  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 1 75  ? -28.595 28.656  -93.606 1.00 73.09  ? 221  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 1 75  ? -28.882 28.956  -91.181 1.00 73.09  ? 221  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 1 75  ? -27.625 28.236  -90.715 1.00 73.09  ? 221  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 1 75  ? -27.520 27.976  -89.224 1.00 59.53  ? 221  DT  J N1    1 
ATOM   4514  C C2    . DT  B 1 75  ? -27.237 26.688  -88.727 1.00 59.53  ? 221  DT  J C2    1 
ATOM   4515  O O2    . DT  B 1 75  ? -27.194 25.685  -89.396 1.00 59.53  ? 221  DT  J O2    1 
ATOM   4516  N N3    . DT  B 1 75  ? -27.015 26.630  -87.388 1.00 59.53  ? 221  DT  J N3    1 
ATOM   4517  C C4    . DT  B 1 75  ? -27.043 27.679  -86.495 1.00 59.53  ? 221  DT  J C4    1 
ATOM   4518  O O4    . DT  B 1 75  ? -26.704 27.516  -85.313 1.00 59.53  ? 221  DT  J O4    1 
ATOM   4519  C C5    . DT  B 1 75  ? -27.427 28.934  -87.037 1.00 59.53  ? 221  DT  J C5    1 
ATOM   4520  C C7    . DT  B 1 75  ? -27.524 30.086  -86.090 1.00 59.53  ? 221  DT  J C7    1 
ATOM   4521  C C6    . DT  B 1 75  ? -27.660 29.031  -88.356 1.00 59.53  ? 221  DT  J C6    1 
ATOM   4522  P P     . DC  B 1 76  ? -30.079 28.210  -94.065 1.00 117.22 ? 222  DC  J P     1 
ATOM   4523  O OP1   . DC  B 1 76  ? -30.089 27.835  -95.534 1.00 58.74  ? 222  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 1 76  ? -30.956 29.309  -93.561 1.00 58.74  ? 222  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 1 76  ? -30.329 26.889  -93.207 1.00 117.22 ? 222  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 1 76  ? -29.361 25.824  -93.225 1.00 117.22 ? 222  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 1 76  ? -29.972 24.561  -92.670 1.00 117.22 ? 222  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 1 76  ? -29.758 24.423  -91.248 1.00 117.22 ? 222  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 1 76  ? -31.471 24.631  -92.847 1.00 117.22 ? 222  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 1 76  ? -31.996 23.348  -93.026 1.00 117.22 ? 222  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 1 76  ? -31.956 25.158  -91.518 1.00 117.22 ? 222  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 1 76  ? -31.007 24.460  -90.583 1.00 117.22 ? 222  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 1 76  ? -30.825 25.150  -89.308 1.00 58.74  ? 222  DC  J N1    1 
ATOM   4534  C C2    . DC  B 1 76  ? -30.404 24.410  -88.261 1.00 58.74  ? 222  DC  J C2    1 
ATOM   4535  O O2    . DC  B 1 76  ? -30.142 23.209  -88.509 1.00 58.74  ? 222  DC  J O2    1 
ATOM   4536  N N3    . DC  B 1 76  ? -30.275 25.002  -87.017 1.00 58.74  ? 222  DC  J N3    1 
ATOM   4537  C C4    . DC  B 1 76  ? -30.520 26.323  -86.883 1.00 58.74  ? 222  DC  J C4    1 
ATOM   4538  N N4    . DC  B 1 76  ? -30.366 26.922  -85.689 1.00 58.74  ? 222  DC  J N4    1 
ATOM   4539  C C5    . DC  B 1 76  ? -30.928 27.109  -87.980 1.00 58.74  ? 222  DC  J C5    1 
ATOM   4540  C C6    . DC  B 1 76  ? -31.077 26.487  -89.163 1.00 58.74  ? 222  DC  J C6    1 
ATOM   4541  P P     . DC  B 1 77  ? -33.443 23.208  -93.675 1.00 107.68 ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 77  ? -33.365 23.916  -94.980 1.00 65.28  ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 77  ? -34.492 23.628  -92.655 1.00 65.28  ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 77  ? -33.509 21.660  -93.998 1.00 107.68 ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 77  ? -34.284 20.810  -93.188 1.00 107.68 ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 77  ? -33.386 19.946  -92.340 1.00 107.68 ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 77  ? -32.784 20.715  -91.277 1.00 107.68 ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 77  ? -34.205 18.885  -91.655 1.00 107.68 ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 77  ? -33.500 17.683  -91.630 1.00 107.68 ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 77  ? -34.475 19.434  -90.277 1.00 107.68 ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 77  ? -33.241 20.260  -90.007 1.00 107.68 ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 77  ? -33.527 21.444  -89.165 1.00 65.28  ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 77  ? -33.066 21.462  -87.846 1.00 65.28  ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 77  ? -32.452 20.456  -87.402 1.00 65.28  ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 77  ? -33.278 22.575  -87.089 1.00 65.28  ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 77  ? -33.881 23.642  -87.613 1.00 65.28  ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 77  ? -33.961 24.744  -86.870 1.00 65.28  ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 77  ? -34.396 23.634  -88.931 1.00 65.28  ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 77  ? -34.206 22.518  -89.665 1.00 65.28  ? 223  DC  J C6    1 
ATOM   4560  P P     . DG  B 1 78  ? -34.325 16.356  -91.910 1.00 63.60  ? 224  DG  J P     1 
ATOM   4561  O OP1   . DG  B 1 78  ? -33.435 15.237  -92.438 1.00 66.99  ? 224  DG  J OP1   1 
ATOM   4562  O OP2   . DG  B 1 78  ? -35.520 16.861  -92.686 1.00 66.99  ? 224  DG  J OP2   1 
ATOM   4563  O "O5'" . DG  B 1 78  ? -34.859 15.954  -90.456 1.00 63.60  ? 224  DG  J "O5'" 1 
ATOM   4564  C "C5'" . DG  B 1 78  ? -33.939 15.531  -89.441 1.00 63.60  ? 224  DG  J "C5'" 1 
ATOM   4565  C "C4'" . DG  B 1 78  ? -34.584 15.626  -88.082 1.00 63.60  ? 224  DG  J "C4'" 1 
ATOM   4566  O "O4'" . DG  B 1 78  ? -34.859 17.004  -87.717 1.00 63.60  ? 224  DG  J "O4'" 1 
ATOM   4567  C "C3'" . DG  B 1 78  ? -35.917 14.910  -87.997 1.00 63.60  ? 224  DG  J "C3'" 1 
ATOM   4568  O "O3'" . DG  B 1 78  ? -35.963 14.341  -86.734 1.00 63.60  ? 224  DG  J "O3'" 1 
ATOM   4569  C "C2'" . DG  B 1 78  ? -36.937 16.029  -88.012 1.00 63.60  ? 224  DG  J "C2'" 1 
ATOM   4570  C "C1'" . DG  B 1 78  ? -36.193 17.126  -87.289 1.00 63.60  ? 224  DG  J "C1'" 1 
ATOM   4571  N N9    . DG  B 1 78  ? -36.652 18.459  -87.639 1.00 66.99  ? 224  DG  J N9    1 
ATOM   4572  C C8    . DG  B 1 78  ? -37.396 18.808  -88.741 1.00 66.99  ? 224  DG  J C8    1 
ATOM   4573  N N7    . DG  B 1 78  ? -37.739 20.077  -88.773 1.00 66.99  ? 224  DG  J N7    1 
ATOM   4574  C C5    . DG  B 1 78  ? -37.150 20.600  -87.643 1.00 66.99  ? 224  DG  J C5    1 
ATOM   4575  C C6    . DG  B 1 78  ? -37.162 21.923  -87.159 1.00 66.99  ? 224  DG  J C6    1 
ATOM   4576  O O6    . DG  B 1 78  ? -37.707 22.937  -87.709 1.00 66.99  ? 224  DG  J O6    1 
ATOM   4577  N N1    . DG  B 1 78  ? -36.470 22.014  -85.914 1.00 66.99  ? 224  DG  J N1    1 
ATOM   4578  C C2    . DG  B 1 78  ? -35.874 20.934  -85.250 1.00 66.99  ? 224  DG  J C2    1 
ATOM   4579  N N2    . DG  B 1 78  ? -35.397 21.174  -84.005 1.00 66.99  ? 224  DG  J N2    1 
ATOM   4580  N N3    . DG  B 1 78  ? -35.801 19.703  -85.758 1.00 66.99  ? 224  DG  J N3    1 
ATOM   4581  C C4    . DG  B 1 78  ? -36.467 19.605  -86.929 1.00 66.99  ? 224  DG  J C4    1 
ATOM   4582  P P     . DC  B 1 79  ? -35.663 12.784  -86.557 1.00 81.20  ? 225  DC  J P     1 
ATOM   4583  O OP1   . DC  B 1 79  ? -34.381 12.332  -87.221 1.00 62.98  ? 225  DC  J OP1   1 
ATOM   4584  O OP2   . DC  B 1 79  ? -36.962 12.248  -87.000 1.00 62.98  ? 225  DC  J OP2   1 
ATOM   4585  O "O5'" . DC  B 1 79  ? -35.592 12.615  -84.965 1.00 81.20  ? 225  DC  J "O5'" 1 
ATOM   4586  C "C5'" . DC  B 1 79  ? -34.723 13.446  -84.173 1.00 81.20  ? 225  DC  J "C5'" 1 
ATOM   4587  C "C4'" . DC  B 1 79  ? -35.481 14.137  -83.057 1.00 81.20  ? 225  DC  J "C4'" 1 
ATOM   4588  O "O4'" . DC  B 1 79  ? -36.049 15.410  -83.462 1.00 81.20  ? 225  DC  J "O4'" 1 
ATOM   4589  C "C3'" . DC  B 1 79  ? -36.645 13.372  -82.422 1.00 81.20  ? 225  DC  J "C3'" 1 
ATOM   4590  O "O3'" . DC  B 1 79  ? -36.711 13.783  -81.069 1.00 81.20  ? 225  DC  J "O3'" 1 
ATOM   4591  C "C2'" . DC  B 1 79  ? -37.874 14.030  -83.039 1.00 81.20  ? 225  DC  J "C2'" 1 
ATOM   4592  C "C1'" . DC  B 1 79  ? -37.408 15.477  -83.023 1.00 81.20  ? 225  DC  J "C1'" 1 
ATOM   4593  N N1    . DC  B 1 79  ? -38.129 16.445  -83.874 1.00 62.98  ? 225  DC  J N1    1 
ATOM   4594  C C2    . DC  B 1 79  ? -38.342 17.791  -83.417 1.00 62.98  ? 225  DC  J C2    1 
ATOM   4595  O O2    . DC  B 1 79  ? -38.031 18.109  -82.259 1.00 62.98  ? 225  DC  J O2    1 
ATOM   4596  N N3    . DC  B 1 79  ? -38.900 18.701  -84.254 1.00 62.98  ? 225  DC  J N3    1 
ATOM   4597  C C4    . DC  B 1 79  ? -39.284 18.327  -85.484 1.00 62.98  ? 225  DC  J C4    1 
ATOM   4598  N N4    . DC  B 1 79  ? -39.788 19.284  -86.307 1.00 62.98  ? 225  DC  J N4    1 
ATOM   4599  C C5    . DC  B 1 79  ? -39.156 16.957  -85.940 1.00 62.98  ? 225  DC  J C5    1 
ATOM   4600  C C6    . DC  B 1 79  ? -38.568 16.070  -85.105 1.00 62.98  ? 225  DC  J C6    1 
ATOM   4601  P P     . DT  B 1 80  ? -36.119 12.856  -79.899 1.00 58.02  ? 226  DT  J P     1 
ATOM   4602  O OP1   . DT  B 1 80  ? -34.612 12.685  -80.031 1.00 61.31  ? 226  DT  J OP1   1 
ATOM   4603  O OP2   . DT  B 1 80  ? -37.065 11.693  -79.868 1.00 61.31  ? 226  DT  J OP2   1 
ATOM   4604  O "O5'" . DT  B 1 80  ? -36.323 13.789  -78.628 1.00 58.02  ? 226  DT  J "O5'" 1 
ATOM   4605  C "C5'" . DT  B 1 80  ? -35.861 15.122  -78.662 1.00 58.02  ? 226  DT  J "C5'" 1 
ATOM   4606  C "C4'" . DT  B 1 80  ? -36.854 15.992  -77.961 1.00 58.02  ? 226  DT  J "C4'" 1 
ATOM   4607  O "O4'" . DT  B 1 80  ? -37.735 16.587  -78.930 1.00 58.02  ? 226  DT  J "O4'" 1 
ATOM   4608  C "C3'" . DT  B 1 80  ? -37.733 15.126  -77.073 1.00 58.02  ? 226  DT  J "C3'" 1 
ATOM   4609  O "O3'" . DT  B 1 80  ? -38.066 15.824  -75.882 1.00 58.02  ? 226  DT  J "O3'" 1 
ATOM   4610  C "C2'" . DT  B 1 80  ? -38.975 14.905  -77.919 1.00 58.02  ? 226  DT  J "C2'" 1 
ATOM   4611  C "C1'" . DT  B 1 80  ? -39.076 16.243  -78.596 1.00 58.02  ? 226  DT  J "C1'" 1 
ATOM   4612  N N1    . DT  B 1 80  ? -39.876 16.299  -79.820 1.00 61.31  ? 226  DT  J N1    1 
ATOM   4613  C C2    . DT  B 1 80  ? -40.375 17.527  -80.114 1.00 61.31  ? 226  DT  J C2    1 
ATOM   4614  O O2    . DT  B 1 80  ? -40.205 18.467  -79.391 1.00 61.31  ? 226  DT  J O2    1 
ATOM   4615  N N3    . DT  B 1 80  ? -41.056 17.626  -81.288 1.00 61.31  ? 226  DT  J N3    1 
ATOM   4616  C C4    . DT  B 1 80  ? -41.263 16.628  -82.211 1.00 61.31  ? 226  DT  J C4    1 
ATOM   4617  O O4    . DT  B 1 80  ? -41.842 16.893  -83.261 1.00 61.31  ? 226  DT  J O4    1 
ATOM   4618  C C5    . DT  B 1 80  ? -40.729 15.312  -81.837 1.00 61.31  ? 226  DT  J C5    1 
ATOM   4619  C C7    . DT  B 1 80  ? -40.907 14.154  -82.774 1.00 61.31  ? 226  DT  J C7    1 
ATOM   4620  C C6    . DT  B 1 80  ? -40.085 15.217  -80.651 1.00 61.31  ? 226  DT  J C6    1 
ATOM   4621  P P     . DG  B 1 81  ? -37.060 15.777  -74.644 1.00 37.19  ? 227  DG  J P     1 
ATOM   4622  O OP1   . DG  B 1 81  ? -35.683 15.371  -75.069 1.00 51.71  ? 227  DG  J OP1   1 
ATOM   4623  O OP2   . DG  B 1 81  ? -37.794 15.009  -73.588 1.00 51.71  ? 227  DG  J OP2   1 
ATOM   4624  O "O5'" . DG  B 1 81  ? -36.984 17.297  -74.283 1.00 37.19  ? 227  DG  J "O5'" 1 
ATOM   4625  C "C5'" . DG  B 1 81  ? -37.883 17.738  -73.339 1.00 37.19  ? 227  DG  J "C5'" 1 
ATOM   4626  C "C4'" . DG  B 1 81  ? -38.779 18.819  -73.875 1.00 37.19  ? 227  DG  J "C4'" 1 
ATOM   4627  O "O4'" . DG  B 1 81  ? -39.374 18.440  -75.122 1.00 37.19  ? 227  DG  J "O4'" 1 
ATOM   4628  C "C3'" . DG  B 1 81  ? -39.929 18.952  -72.892 1.00 37.19  ? 227  DG  J "C3'" 1 
ATOM   4629  O "O3'" . DG  B 1 81  ? -40.175 20.275  -72.550 1.00 37.19  ? 227  DG  J "O3'" 1 
ATOM   4630  C "C2'" . DG  B 1 81  ? -41.128 18.367  -73.592 1.00 37.19  ? 227  DG  J "C2'" 1 
ATOM   4631  C "C1'" . DG  B 1 81  ? -40.786 18.647  -75.041 1.00 37.19  ? 227  DG  J "C1'" 1 
ATOM   4632  N N9    . DG  B 1 81  ? -41.468 17.741  -75.973 1.00 51.71  ? 227  DG  J N9    1 
ATOM   4633  C C8    . DG  B 1 81  ? -41.293 16.386  -76.067 1.00 51.71  ? 227  DG  J C8    1 
ATOM   4634  N N7    . DG  B 1 81  ? -42.055 15.821  -76.969 1.00 51.71  ? 227  DG  J N7    1 
ATOM   4635  C C5    . DG  B 1 81  ? -42.767 16.876  -77.512 1.00 51.71  ? 227  DG  J C5    1 
ATOM   4636  C C6    . DG  B 1 81  ? -43.706 16.894  -78.560 1.00 51.71  ? 227  DG  J C6    1 
ATOM   4637  O O6    . DG  B 1 81  ? -44.117 15.946  -79.238 1.00 51.71  ? 227  DG  J O6    1 
ATOM   4638  N N1    . DG  B 1 81  ? -44.162 18.174  -78.796 1.00 51.71  ? 227  DG  J N1    1 
ATOM   4639  C C2    . DG  B 1 81  ? -43.761 19.288  -78.113 1.00 51.71  ? 227  DG  J C2    1 
ATOM   4640  N N2    . DG  B 1 81  ? -44.377 20.421  -78.481 1.00 51.71  ? 227  DG  J N2    1 
ATOM   4641  N N3    . DG  B 1 81  ? -42.859 19.296  -77.150 1.00 51.71  ? 227  DG  J N3    1 
ATOM   4642  C C4    . DG  B 1 81  ? -42.413 18.068  -76.904 1.00 51.71  ? 227  DG  J C4    1 
ATOM   4643  P P     . DA  B 1 82  ? -41.180 20.552  -71.345 1.00 27.49  ? 228  DA  J P     1 
ATOM   4644  O OP1   . DA  B 1 82  ? -40.555 21.512  -70.333 1.00 31.05  ? 228  DA  J OP1   1 
ATOM   4645  O OP2   . DA  B 1 82  ? -41.748 19.225  -70.886 1.00 31.05  ? 228  DA  J OP2   1 
ATOM   4646  O "O5'" . DA  B 1 82  ? -42.276 21.356  -72.167 1.00 27.49  ? 228  DA  J "O5'" 1 
ATOM   4647  C "C5'" . DA  B 1 82  ? -41.910 22.518  -72.897 1.00 27.49  ? 228  DA  J "C5'" 1 
ATOM   4648  C "C4'" . DA  B 1 82  ? -43.154 23.232  -73.377 1.00 27.49  ? 228  DA  J "C4'" 1 
ATOM   4649  O "O4'" . DA  B 1 82  ? -43.785 22.427  -74.408 1.00 27.49  ? 228  DA  J "O4'" 1 
ATOM   4650  C "C3'" . DA  B 1 82  ? -44.233 23.459  -72.313 1.00 27.49  ? 228  DA  J "C3'" 1 
ATOM   4651  O "O3'" . DA  B 1 82  ? -44.821 24.707  -72.562 1.00 27.49  ? 228  DA  J "O3'" 1 
ATOM   4652  C "C2'" . DA  B 1 82  ? -45.197 22.306  -72.500 1.00 27.49  ? 228  DA  J "C2'" 1 
ATOM   4653  C "C1'" . DA  B 1 82  ? -45.062 21.999  -73.980 1.00 27.49  ? 228  DA  J "C1'" 1 
ATOM   4654  N N9    . DA  B 1 82  ? -45.155 20.605  -74.360 1.00 31.05  ? 228  DA  J N9    1 
ATOM   4655  C C8    . DA  B 1 82  ? -44.555 19.504  -73.825 1.00 31.05  ? 228  DA  J C8    1 
ATOM   4656  N N7    . DA  B 1 82  ? -44.805 18.380  -74.489 1.00 31.05  ? 228  DA  J N7    1 
ATOM   4657  C C5    . DA  B 1 82  ? -45.642 18.794  -75.530 1.00 31.05  ? 228  DA  J C5    1 
ATOM   4658  C C6    . DA  B 1 82  ? -46.200 18.134  -76.642 1.00 31.05  ? 228  DA  J C6    1 
ATOM   4659  N N6    . DA  B 1 82  ? -45.974 16.870  -76.938 1.00 31.05  ? 228  DA  J N6    1 
ATOM   4660  N N1    . DA  B 1 82  ? -46.976 18.858  -77.483 1.00 31.05  ? 228  DA  J N1    1 
ATOM   4661  C C2    . DA  B 1 82  ? -47.148 20.171  -77.264 1.00 31.05  ? 228  DA  J C2    1 
ATOM   4662  N N3    . DA  B 1 82  ? -46.660 20.909  -76.294 1.00 31.05  ? 228  DA  J N3    1 
ATOM   4663  C C4    . DA  B 1 82  ? -45.894 20.156  -75.442 1.00 31.05  ? 228  DA  J C4    1 
ATOM   4664  P P     . DA  B 1 83  ? -45.901 25.294  -71.559 1.00 39.38  ? 229  DA  J P     1 
ATOM   4665  O OP1   . DA  B 1 83  ? -45.676 26.802  -71.495 1.00 44.07  ? 229  DA  J OP1   1 
ATOM   4666  O OP2   . DA  B 1 83  ? -45.906 24.466  -70.328 1.00 44.07  ? 229  DA  J OP2   1 
ATOM   4667  O "O5'" . DA  B 1 83  ? -47.270 24.994  -72.324 1.00 39.38  ? 229  DA  J "O5'" 1 
ATOM   4668  C "C5'" . DA  B 1 83  ? -47.566 25.666  -73.584 1.00 39.38  ? 229  DA  J "C5'" 1 
ATOM   4669  C "C4'" . DA  B 1 83  ? -48.873 25.194  -74.193 1.00 39.38  ? 229  DA  J "C4'" 1 
ATOM   4670  O "O4'" . DA  B 1 83  ? -48.738 23.854  -74.702 1.00 39.38  ? 229  DA  J "O4'" 1 
ATOM   4671  C "C3'" . DA  B 1 83  ? -50.120 25.191  -73.303 1.00 39.38  ? 229  DA  J "C3'" 1 
ATOM   4672  O "O3'" . DA  B 1 83  ? -51.172 25.824  -74.009 1.00 39.38  ? 229  DA  J "O3'" 1 
ATOM   4673  C "C2'" . DA  B 1 83  ? -50.493 23.733  -73.136 1.00 39.38  ? 229  DA  J "C2'" 1 
ATOM   4674  C "C1'" . DA  B 1 83  ? -49.856 23.092  -74.357 1.00 39.38  ? 229  DA  J "C1'" 1 
ATOM   4675  N N9    . DA  B 1 83  ? -49.375 21.738  -74.128 1.00 44.07  ? 229  DA  J N9    1 
ATOM   4676  C C8    . DA  B 1 83  ? -48.626 21.297  -73.096 1.00 44.07  ? 229  DA  J C8    1 
ATOM   4677  N N7    . DA  B 1 83  ? -48.348 20.009  -73.156 1.00 44.07  ? 229  DA  J N7    1 
ATOM   4678  C C5    . DA  B 1 83  ? -48.946 19.585  -74.317 1.00 44.07  ? 229  DA  J C5    1 
ATOM   4679  C C6    . DA  B 1 83  ? -49.008 18.315  -74.963 1.00 44.07  ? 229  DA  J C6    1 
ATOM   4680  N N6    . DA  B 1 83  ? -48.440 17.195  -74.515 1.00 44.07  ? 229  DA  J N6    1 
ATOM   4681  N N1    . DA  B 1 83  ? -49.694 18.233  -76.110 1.00 44.07  ? 229  DA  J N1    1 
ATOM   4682  C C2    . DA  B 1 83  ? -50.294 19.341  -76.572 1.00 44.07  ? 229  DA  J C2    1 
ATOM   4683  N N3    . DA  B 1 83  ? -50.314 20.582  -76.054 1.00 44.07  ? 229  DA  J N3    1 
ATOM   4684  C C4    . DA  B 1 83  ? -49.601 20.636  -74.920 1.00 44.07  ? 229  DA  J C4    1 
ATOM   4685  P P     . DC  B 1 84  ? -52.457 26.398  -73.221 1.00 42.10  ? 230  DC  J P     1 
ATOM   4686  O OP1   . DC  B 1 84  ? -52.888 27.587  -74.041 1.00 43.51  ? 230  DC  J OP1   1 
ATOM   4687  O OP2   . DC  B 1 84  ? -52.010 26.640  -71.811 1.00 43.51  ? 230  DC  J OP2   1 
ATOM   4688  O "O5'" . DC  B 1 84  ? -53.441 25.149  -73.435 1.00 42.10  ? 230  DC  J "O5'" 1 
ATOM   4689  C "C5'" . DC  B 1 84  ? -53.513 24.554  -74.713 1.00 42.10  ? 230  DC  J "C5'" 1 
ATOM   4690  C "C4'" . DC  B 1 84  ? -54.449 23.366  -74.705 1.00 42.10  ? 230  DC  J "C4'" 1 
ATOM   4691  O "O4'" . DC  B 1 84  ? -53.833 22.032  -74.840 1.00 42.10  ? 230  DC  J "O4'" 1 
ATOM   4692  C "C3'" . DC  B 1 84  ? -55.468 23.293  -73.571 1.00 42.10  ? 230  DC  J "C3'" 1 
ATOM   4693  O "O3'" . DC  B 1 84  ? -56.827 23.259  -74.107 1.00 42.10  ? 230  DC  J "O3'" 1 
ATOM   4694  C "C2'" . DC  B 1 84  ? -55.112 21.974  -72.898 1.00 42.10  ? 230  DC  J "C2'" 1 
ATOM   4695  C "C1'" . DC  B 1 84  ? -54.442 21.098  -73.956 1.00 42.10  ? 230  DC  J "C1'" 1 
ATOM   4696  N N1    . DC  B 1 84  ? -53.369 20.205  -73.391 1.00 43.51  ? 230  DC  J N1    1 
ATOM   4697  C C2    . DC  B 1 84  ? -53.094 18.924  -73.968 1.00 43.51  ? 230  DC  J C2    1 
ATOM   4698  O O2    . DC  B 1 84  ? -53.688 18.551  -74.945 1.00 43.51  ? 230  DC  J O2    1 
ATOM   4699  N N3    . DC  B 1 84  ? -52.155 18.127  -73.438 1.00 43.51  ? 230  DC  J N3    1 
ATOM   4700  C C4    . DC  B 1 84  ? -51.460 18.532  -72.397 1.00 43.51  ? 230  DC  J C4    1 
ATOM   4701  N N4    . DC  B 1 84  ? -50.548 17.681  -71.922 1.00 43.51  ? 230  DC  J N4    1 
ATOM   4702  C C5    . DC  B 1 84  ? -51.671 19.825  -71.793 1.00 43.51  ? 230  DC  J C5    1 
ATOM   4703  C C6    . DC  B 1 84  ? -52.636 20.616  -72.308 1.00 43.51  ? 230  DC  J C6    1 
ATOM   4704  P P     . DA  B 1 85  ? -58.078 23.909  -73.295 1.00 90.24  ? 231  DA  J P     1 
ATOM   4705  O OP1   . DA  B 1 85  ? -58.320 25.307  -73.751 1.00 125.35 ? 231  DA  J OP1   1 
ATOM   4706  O OP2   . DA  B 1 85  ? -58.014 23.617  -71.843 1.00 125.35 ? 231  DA  J OP2   1 
ATOM   4707  O "O5'" . DA  B 1 85  ? -59.219 23.002  -73.907 1.00 90.24  ? 231  DA  J "O5'" 1 
ATOM   4708  C "C5'" . DA  B 1 85  ? -59.002 22.313  -75.156 1.00 90.24  ? 231  DA  J "C5'" 1 
ATOM   4709  C "C4'" . DA  B 1 85  ? -59.195 20.814  -74.988 1.00 90.24  ? 231  DA  J "C4'" 1 
ATOM   4710  O "O4'" . DA  B 1 85  ? -58.038 20.212  -74.348 1.00 90.24  ? 231  DA  J "O4'" 1 
ATOM   4711  C "C3'" . DA  B 1 85  ? -60.416 20.355  -74.160 1.00 90.24  ? 231  DA  J "C3'" 1 
ATOM   4712  O "O3'" . DA  B 1 85  ? -61.056 19.161  -74.708 1.00 90.24  ? 231  DA  J "O3'" 1 
ATOM   4713  C "C2'" . DA  B 1 85  ? -59.794 20.005  -72.824 1.00 90.24  ? 231  DA  J "C2'" 1 
ATOM   4714  C "C1'" . DA  B 1 85  ? -58.484 19.387  -73.279 1.00 90.24  ? 231  DA  J "C1'" 1 
ATOM   4715  N N9    . DA  B 1 85  ? -57.484 19.406  -72.215 1.00 125.35 ? 231  DA  J N9    1 
ATOM   4716  C C8    . DA  B 1 85  ? -57.189 20.451  -71.362 1.00 125.35 ? 231  DA  J C8    1 
ATOM   4717  N N7    . DA  B 1 85  ? -56.277 20.160  -70.462 1.00 125.35 ? 231  DA  J N7    1 
ATOM   4718  C C5    . DA  B 1 85  ? -55.934 18.841  -70.746 1.00 125.35 ? 231  DA  J C5    1 
ATOM   4719  C C6    . DA  B 1 85  ? -55.021 17.943  -70.139 1.00 125.35 ? 231  DA  J C6    1 
ATOM   4720  N N6    . DA  B 1 85  ? -54.200 18.286  -69.127 1.00 125.35 ? 231  DA  J N6    1 
ATOM   4721  N N1    . DA  B 1 85  ? -54.969 16.678  -70.629 1.00 125.35 ? 231  DA  J N1    1 
ATOM   4722  C C2    . DA  B 1 85  ? -55.748 16.362  -71.687 1.00 125.35 ? 231  DA  J C2    1 
ATOM   4723  N N3    . DA  B 1 85  ? -56.613 17.128  -72.365 1.00 125.35 ? 231  DA  J N3    1 
ATOM   4724  C C4    . DA  B 1 85  ? -56.669 18.364  -71.830 1.00 125.35 ? 231  DA  J C4    1 
ATOM   4725  P P     . DT  B 1 86  ? -62.280 18.443  -73.906 1.00 151.91 ? 232  DT  J P     1 
ATOM   4726  O OP1   . DT  B 1 86  ? -63.262 18.183  -74.994 1.00 127.26 ? 232  DT  J OP1   1 
ATOM   4727  O OP2   . DT  B 1 86  ? -62.720 19.163  -72.646 1.00 127.26 ? 232  DT  J OP2   1 
ATOM   4728  O "O5'" . DT  B 1 86  ? -61.673 17.049  -73.412 1.00 151.91 ? 232  DT  J "O5'" 1 
ATOM   4729  C "C5'" . DT  B 1 86  ? -61.156 16.078  -74.330 1.00 151.91 ? 232  DT  J "C5'" 1 
ATOM   4730  C "C4'" . DT  B 1 86  ? -60.976 14.747  -73.633 1.00 151.91 ? 232  DT  J "C4'" 1 
ATOM   4731  O "O4'" . DT  B 1 86  ? -59.803 14.764  -72.776 1.00 151.91 ? 232  DT  J "O4'" 1 
ATOM   4732  C "C3'" . DT  B 1 86  ? -62.152 14.356  -72.733 1.00 151.91 ? 232  DT  J "C3'" 1 
ATOM   4733  O "O3'" . DT  B 1 86  ? -62.410 12.940  -72.837 1.00 151.91 ? 232  DT  J "O3'" 1 
ATOM   4734  C "C2'" . DT  B 1 86  ? -61.668 14.746  -71.344 1.00 151.91 ? 232  DT  J "C2'" 1 
ATOM   4735  C "C1'" . DT  B 1 86  ? -60.177 14.459  -71.432 1.00 151.91 ? 232  DT  J "C1'" 1 
ATOM   4736  N N1    . DT  B 1 86  ? -59.309 15.236  -70.493 1.00 127.26 ? 232  DT  J N1    1 
ATOM   4737  C C2    . DT  B 1 86  ? -58.183 14.605  -70.015 1.00 127.26 ? 232  DT  J C2    1 
ATOM   4738  O O2    . DT  B 1 86  ? -57.871 13.468  -70.355 1.00 127.26 ? 232  DT  J O2    1 
ATOM   4739  N N3    . DT  B 1 86  ? -57.434 15.356  -69.118 1.00 127.26 ? 232  DT  J N3    1 
ATOM   4740  C C4    . DT  B 1 86  ? -57.706 16.646  -68.662 1.00 127.26 ? 232  DT  J C4    1 
ATOM   4741  O O4    . DT  B 1 86  ? -56.986 17.175  -67.807 1.00 127.26 ? 232  DT  J O4    1 
ATOM   4742  C C5    . DT  B 1 86  ? -58.873 17.264  -69.241 1.00 127.26 ? 232  DT  J C5    1 
ATOM   4743  C C7    . DT  B 1 86  ? -59.189 18.680  -68.875 1.00 127.26 ? 232  DT  J C7    1 
ATOM   4744  C C6    . DT  B 1 86  ? -59.617 16.536  -70.102 1.00 127.26 ? 232  DT  J C6    1 
ATOM   4745  P P     . DG  B 1 87  ? -63.732 12.302  -72.156 1.00 152.79 ? 233  DG  J P     1 
ATOM   4746  O OP1   . DG  B 1 87  ? -64.371 11.417  -73.159 1.00 149.82 ? 233  DG  J OP1   1 
ATOM   4747  O OP2   . DG  B 1 87  ? -64.535 13.396  -71.524 1.00 149.82 ? 233  DG  J OP2   1 
ATOM   4748  O "O5'" . DG  B 1 87  ? -63.151 11.370  -70.989 1.00 152.79 ? 233  DG  J "O5'" 1 
ATOM   4749  C "C5'" . DG  B 1 87  ? -62.116 10.389  -71.227 1.00 152.79 ? 233  DG  J "C5'" 1 
ATOM   4750  C "C4'" . DG  B 1 87  ? -61.792 9.653   -69.944 1.00 152.79 ? 233  DG  J "C4'" 1 
ATOM   4751  O "O4'" . DG  B 1 87  ? -60.960 10.469  -69.068 1.00 152.79 ? 233  DG  J "O4'" 1 
ATOM   4752  C "C3'" . DG  B 1 87  ? -63.057 9.331   -69.145 1.00 152.79 ? 233  DG  J "C3'" 1 
ATOM   4753  O "O3'" . DG  B 1 87  ? -62.985 8.035   -68.546 1.00 152.79 ? 233  DG  J "O3'" 1 
ATOM   4754  C "C2'" . DG  B 1 87  ? -63.109 10.430  -68.097 1.00 152.79 ? 233  DG  J "C2'" 1 
ATOM   4755  C "C1'" . DG  B 1 87  ? -61.641 10.717  -67.826 1.00 152.79 ? 233  DG  J "C1'" 1 
ATOM   4756  N N9    . DG  B 1 87  ? -61.399 12.100  -67.399 1.00 149.82 ? 233  DG  J N9    1 
ATOM   4757  C C8    . DG  B 1 87  ? -62.169 13.214  -67.698 1.00 149.82 ? 233  DG  J C8    1 
ATOM   4758  N N7    . DG  B 1 87  ? -61.694 14.321  -67.197 1.00 149.82 ? 233  DG  J N7    1 
ATOM   4759  C C5    . DG  B 1 87  ? -60.548 13.926  -66.522 1.00 149.82 ? 233  DG  J C5    1 
ATOM   4760  C C6    . DG  B 1 87  ? -59.611 14.689  -65.810 1.00 149.82 ? 233  DG  J C6    1 
ATOM   4761  O O6    . DG  B 1 87  ? -59.588 15.923  -65.655 1.00 149.82 ? 233  DG  J O6    1 
ATOM   4762  N N1    . DG  B 1 87  ? -58.611 13.883  -65.259 1.00 149.82 ? 233  DG  J N1    1 
ATOM   4763  C C2    . DG  B 1 87  ? -58.525 12.514  -65.400 1.00 149.82 ? 233  DG  J C2    1 
ATOM   4764  N N2    . DG  B 1 87  ? -57.495 11.914  -64.795 1.00 149.82 ? 233  DG  J N2    1 
ATOM   4765  N N3    . DG  B 1 87  ? -59.387 11.792  -66.085 1.00 149.82 ? 233  DG  J N3    1 
ATOM   4766  C C4    . DG  B 1 87  ? -60.364 12.554  -66.618 1.00 149.82 ? 233  DG  J C4    1 
ATOM   4767  P P     . DC  B 1 88  ? -63.804 7.722   -67.176 1.00 130.40 ? 234  DC  J P     1 
ATOM   4768  O OP1   . DC  B 1 88  ? -63.965 6.235   -67.132 1.00 122.48 ? 234  DC  J OP1   1 
ATOM   4769  O OP2   . DC  B 1 88  ? -65.017 8.600   -67.063 1.00 122.48 ? 234  DC  J OP2   1 
ATOM   4770  O "O5'" . DC  B 1 88  ? -62.793 8.147   -65.991 1.00 130.40 ? 234  DC  J "O5'" 1 
ATOM   4771  C "C5'" . DC  B 1 88  ? -61.429 7.658   -65.947 1.00 130.40 ? 234  DC  J "C5'" 1 
ATOM   4772  C "C4'" . DC  B 1 88  ? -60.983 7.431   -64.519 1.00 130.40 ? 234  DC  J "C4'" 1 
ATOM   4773  O "O4'" . DC  B 1 88  ? -60.663 8.700   -63.908 1.00 130.40 ? 234  DC  J "O4'" 1 
ATOM   4774  C "C3'" . DC  B 1 88  ? -62.048 6.770   -63.648 1.00 130.40 ? 234  DC  J "C3'" 1 
ATOM   4775  O "O3'" . DC  B 1 88  ? -61.544 5.723   -62.784 1.00 130.40 ? 234  DC  J "O3'" 1 
ATOM   4776  C "C2'" . DC  B 1 88  ? -62.645 7.941   -62.877 1.00 130.40 ? 234  DC  J "C2'" 1 
ATOM   4777  C "C1'" . DC  B 1 88  ? -61.534 8.998   -62.833 1.00 130.40 ? 234  DC  J "C1'" 1 
ATOM   4778  N N1    . DC  B 1 88  ? -61.974 10.406  -63.022 1.00 122.48 ? 234  DC  J N1    1 
ATOM   4779  C C2    . DC  B 1 88  ? -61.097 11.461  -62.664 1.00 122.48 ? 234  DC  J C2    1 
ATOM   4780  O O2    . DC  B 1 88  ? -59.978 11.182  -62.182 1.00 122.48 ? 234  DC  J O2    1 
ATOM   4781  N N3    . DC  B 1 88  ? -61.497 12.752  -62.860 1.00 122.48 ? 234  DC  J N3    1 
ATOM   4782  C C4    . DC  B 1 88  ? -62.701 13.010  -63.382 1.00 122.48 ? 234  DC  J C4    1 
ATOM   4783  N N4    . DC  B 1 88  ? -63.056 14.296  -63.554 1.00 122.48 ? 234  DC  J N4    1 
ATOM   4784  C C5    . DC  B 1 88  ? -63.602 11.964  -63.748 1.00 122.48 ? 234  DC  J C5    1 
ATOM   4785  C C6    . DC  B 1 88  ? -63.204 10.692  -63.549 1.00 122.48 ? 234  DC  J C6    1 
ATOM   4786  P P     . DC  B 1 89  ? -60.214 4.869   -63.192 1.00 88.98  ? 235  DC  J P     1 
ATOM   4787  O OP1   . DC  B 1 89  ? -59.990 4.826   -64.661 1.00 83.40  ? 235  DC  J OP1   1 
ATOM   4788  O OP2   . DC  B 1 89  ? -60.226 3.570   -62.441 1.00 83.40  ? 235  DC  J OP2   1 
ATOM   4789  O "O5'" . DC  B 1 89  ? -59.101 5.855   -62.578 1.00 88.98  ? 235  DC  J "O5'" 1 
ATOM   4790  C "C5'" . DC  B 1 89  ? -57.722 5.520   -62.492 1.00 88.98  ? 235  DC  J "C5'" 1 
ATOM   4791  C "C4'" . DC  B 1 89  ? -57.163 6.002   -61.176 1.00 88.98  ? 235  DC  J "C4'" 1 
ATOM   4792  O "O4'" . DC  B 1 89  ? -57.866 7.168   -60.697 1.00 88.98  ? 235  DC  J "O4'" 1 
ATOM   4793  C "C3'" . DC  B 1 89  ? -57.221 4.989   -60.047 1.00 88.98  ? 235  DC  J "C3'" 1 
ATOM   4794  O "O3'" . DC  B 1 89  ? -55.882 4.865   -59.613 1.00 88.98  ? 235  DC  J "O3'" 1 
ATOM   4795  C "C2'" . DC  B 1 89  ? -58.175 5.588   -59.018 1.00 88.98  ? 235  DC  J "C2'" 1 
ATOM   4796  C "C1'" . DC  B 1 89  ? -58.132 7.058   -59.321 1.00 88.98  ? 235  DC  J "C1'" 1 
ATOM   4797  N N1    . DC  B 1 89  ? -59.340 7.843   -59.080 1.00 83.40  ? 235  DC  J N1    1 
ATOM   4798  C C2    . DC  B 1 89  ? -59.170 9.198   -58.974 1.00 83.40  ? 235  DC  J C2    1 
ATOM   4799  O O2    . DC  B 1 89  ? -58.027 9.640   -59.009 1.00 83.40  ? 235  DC  J O2    1 
ATOM   4800  N N3    . DC  B 1 89  ? -60.230 10.009  -58.824 1.00 83.40  ? 235  DC  J N3    1 
ATOM   4801  C C4    . DC  B 1 89  ? -61.447 9.496   -58.738 1.00 83.40  ? 235  DC  J C4    1 
ATOM   4802  N N4    . DC  B 1 89  ? -62.454 10.363  -58.571 1.00 83.40  ? 235  DC  J N4    1 
ATOM   4803  C C5    . DC  B 1 89  ? -61.675 8.081   -58.812 1.00 83.40  ? 235  DC  J C5    1 
ATOM   4804  C C6    . DC  B 1 89  ? -60.591 7.295   -58.986 1.00 83.40  ? 235  DC  J C6    1 
ATOM   4805  P P     . DT  B 1 90  ? -55.549 4.146   -58.243 1.00 70.38  ? 236  DT  J P     1 
ATOM   4806  O OP1   . DT  B 1 90  ? -54.468 3.151   -58.508 1.00 95.39  ? 236  DT  J OP1   1 
ATOM   4807  O OP2   . DT  B 1 90  ? -56.792 3.750   -57.514 1.00 95.39  ? 236  DT  J OP2   1 
ATOM   4808  O "O5'" . DT  B 1 90  ? -54.962 5.355   -57.429 1.00 70.38  ? 236  DT  J "O5'" 1 
ATOM   4809  C "C5'" . DT  B 1 90  ? -54.246 6.334   -58.105 1.00 70.38  ? 236  DT  J "C5'" 1 
ATOM   4810  C "C4'" . DT  B 1 90  ? -54.155 7.550   -57.236 1.00 70.38  ? 236  DT  J "C4'" 1 
ATOM   4811  O "O4'" . DT  B 1 90  ? -55.468 8.135   -57.135 1.00 70.38  ? 236  DT  J "O4'" 1 
ATOM   4812  C "C3'" . DT  B 1 90  ? -53.687 7.285   -55.809 1.00 70.38  ? 236  DT  J "C3'" 1 
ATOM   4813  O "O3'" . DT  B 1 90  ? -52.835 8.350   -55.506 1.00 70.38  ? 236  DT  J "O3'" 1 
ATOM   4814  C "C2'" . DT  B 1 90  ? -54.948 7.442   -54.980 1.00 70.38  ? 236  DT  J "C2'" 1 
ATOM   4815  C "C1'" . DT  B 1 90  ? -55.713 8.477   -55.786 1.00 70.38  ? 236  DT  J "C1'" 1 
ATOM   4816  N N1    . DT  B 1 90  ? -57.174 8.479   -55.598 1.00 95.39  ? 236  DT  J N1    1 
ATOM   4817  C C2    . DT  B 1 90  ? -57.830 9.666   -55.312 1.00 95.39  ? 236  DT  J C2    1 
ATOM   4818  O O2    . DT  B 1 90  ? -57.265 10.738  -55.202 1.00 95.39  ? 236  DT  J O2    1 
ATOM   4819  N N3    . DT  B 1 90  ? -59.190 9.544   -55.160 1.00 95.39  ? 236  DT  J N3    1 
ATOM   4820  C C4    . DT  B 1 90  ? -59.943 8.384   -55.266 1.00 95.39  ? 236  DT  J C4    1 
ATOM   4821  O O4    . DT  B 1 90  ? -61.170 8.421   -55.093 1.00 95.39  ? 236  DT  J O4    1 
ATOM   4822  C C5    . DT  B 1 90  ? -59.184 7.190   -55.581 1.00 95.39  ? 236  DT  J C5    1 
ATOM   4823  C C7    . DT  B 1 90  ? -59.900 5.897   -55.743 1.00 95.39  ? 236  DT  J C7    1 
ATOM   4824  C C6    . DT  B 1 90  ? -57.864 7.297   -55.720 1.00 95.39  ? 236  DT  J C6    1 
ATOM   4825  P P     . DT  B 1 91  ? -51.910 8.291   -54.231 1.00 38.53  ? 237  DT  J P     1 
ATOM   4826  O OP1   . DT  B 1 91  ? -50.521 8.532   -54.775 1.00 52.08  ? 237  DT  J OP1   1 
ATOM   4827  O OP2   . DT  B 1 91  ? -52.199 7.064   -53.408 1.00 52.08  ? 237  DT  J OP2   1 
ATOM   4828  O "O5'" . DT  B 1 91  ? -52.379 9.621   -53.517 1.00 38.53  ? 237  DT  J "O5'" 1 
ATOM   4829  C "C5'" . DT  B 1 91  ? -52.451 10.785  -54.308 1.00 38.53  ? 237  DT  J "C5'" 1 
ATOM   4830  C "C4'" . DT  B 1 91  ? -53.234 11.874  -53.623 1.00 38.53  ? 237  DT  J "C4'" 1 
ATOM   4831  O "O4'" . DT  B 1 91  ? -54.629 11.506  -53.593 1.00 38.53  ? 237  DT  J "O4'" 1 
ATOM   4832  C "C3'" . DT  B 1 91  ? -52.823 12.149  -52.182 1.00 38.53  ? 237  DT  J "C3'" 1 
ATOM   4833  O "O3'" . DT  B 1 91  ? -52.831 13.551  -52.025 1.00 38.53  ? 237  DT  J "O3'" 1 
ATOM   4834  C "C2'" . DT  B 1 91  ? -53.949 11.549  -51.366 1.00 38.53  ? 237  DT  J "C2'" 1 
ATOM   4835  C "C1'" . DT  B 1 91  ? -55.155 11.736  -52.276 1.00 38.53  ? 237  DT  J "C1'" 1 
ATOM   4836  N N1    . DT  B 1 91  ? -56.287 10.778  -52.071 1.00 52.08  ? 237  DT  J N1    1 
ATOM   4837  C C2    . DT  B 1 91  ? -57.649 11.177  -51.933 1.00 52.08  ? 237  DT  J C2    1 
ATOM   4838  O O2    . DT  B 1 91  ? -58.069 12.341  -51.920 1.00 52.08  ? 237  DT  J O2    1 
ATOM   4839  N N3    . DT  B 1 91  ? -58.517 10.146  -51.793 1.00 52.08  ? 237  DT  J N3    1 
ATOM   4840  C C4    . DT  B 1 91  ? -58.223 8.814   -51.746 1.00 52.08  ? 237  DT  J C4    1 
ATOM   4841  O O4    . DT  B 1 91  ? -59.143 8.011   -51.593 1.00 52.08  ? 237  DT  J O4    1 
ATOM   4842  C C5    . DT  B 1 91  ? -56.798 8.471   -51.879 1.00 52.08  ? 237  DT  J C5    1 
ATOM   4843  C C7    . DT  B 1 91  ? -56.348 7.037   -51.834 1.00 52.08  ? 237  DT  J C7    1 
ATOM   4844  C C6    . DT  B 1 91  ? -55.937 9.463   -52.033 1.00 52.08  ? 237  DT  J C6    1 
ATOM   4845  P P     . DT  B 1 92  ? -52.318 14.179  -50.660 1.00 47.82  ? 238  DT  J P     1 
ATOM   4846  O OP1   . DT  B 1 92  ? -51.585 15.482  -50.828 1.00 65.52  ? 238  DT  J OP1   1 
ATOM   4847  O OP2   . DT  B 1 92  ? -51.716 13.068  -49.866 1.00 65.52  ? 238  DT  J OP2   1 
ATOM   4848  O "O5'" . DT  B 1 92  ? -53.697 14.605  -50.035 1.00 47.82  ? 238  DT  J "O5'" 1 
ATOM   4849  C "C5'" . DT  B 1 92  ? -54.614 15.342  -50.809 1.00 47.82  ? 238  DT  J "C5'" 1 
ATOM   4850  C "C4'" . DT  B 1 92  ? -55.907 15.519  -50.057 1.00 47.82  ? 238  DT  J "C4'" 1 
ATOM   4851  O "O4'" . DT  B 1 92  ? -56.629 14.272  -50.011 1.00 47.82  ? 238  DT  J "O4'" 1 
ATOM   4852  C "C3'" . DT  B 1 92  ? -55.771 15.977  -48.607 1.00 47.82  ? 238  DT  J "C3'" 1 
ATOM   4853  O "O3'" . DT  B 1 92  ? -56.691 17.020  -48.393 1.00 47.82  ? 238  DT  J "O3'" 1 
ATOM   4854  C "C2'" . DT  B 1 92  ? -56.168 14.773  -47.766 1.00 47.82  ? 238  DT  J "C2'" 1 
ATOM   4855  C "C1'" . DT  B 1 92  ? -57.140 14.068  -48.692 1.00 47.82  ? 238  DT  J "C1'" 1 
ATOM   4856  N N1    . DT  B 1 92  ? -57.333 12.593  -48.504 1.00 65.52  ? 238  DT  J N1    1 
ATOM   4857  C C2    . DT  B 1 92  ? -58.618 12.100  -48.281 1.00 65.52  ? 238  DT  J C2    1 
ATOM   4858  O O2    . DT  B 1 92  ? -59.598 12.817  -48.073 1.00 65.52  ? 238  DT  J O2    1 
ATOM   4859  N N3    . DT  B 1 92  ? -58.701 10.728  -48.275 1.00 65.52  ? 238  DT  J N3    1 
ATOM   4860  C C4    . DT  B 1 92  ? -57.655 9.823   -48.408 1.00 65.52  ? 238  DT  J C4    1 
ATOM   4861  O O4    . DT  B 1 92  ? -57.859 8.607   -48.421 1.00 65.52  ? 238  DT  J O4    1 
ATOM   4862  C C5    . DT  B 1 92  ? -56.368 10.394  -48.541 1.00 65.52  ? 238  DT  J C5    1 
ATOM   4863  C C7    . DT  B 1 92  ? -55.201 9.462   -48.617 1.00 65.52  ? 238  DT  J C7    1 
ATOM   4864  C C6    . DT  B 1 92  ? -56.261 11.738  -48.591 1.00 65.52  ? 238  DT  J C6    1 
ATOM   4865  P P     . DT  B 1 93  ? -56.504 17.991  -47.138 1.00 61.18  ? 239  DT  J P     1 
ATOM   4866  O OP1   . DT  B 1 93  ? -56.778 19.398  -47.588 1.00 73.52  ? 239  DT  J OP1   1 
ATOM   4867  O OP2   . DT  B 1 93  ? -55.194 17.625  -46.520 1.00 73.52  ? 239  DT  J OP2   1 
ATOM   4868  O "O5'" . DT  B 1 93  ? -57.712 17.532  -46.204 1.00 61.18  ? 239  DT  J "O5'" 1 
ATOM   4869  C "C5'" . DT  B 1 93  ? -59.063 17.579  -46.685 1.00 61.18  ? 239  DT  J "C5'" 1 
ATOM   4870  C "C4'" . DT  B 1 93  ? -59.990 16.775  -45.786 1.00 61.18  ? 239  DT  J "C4'" 1 
ATOM   4871  O "O4'" . DT  B 1 93  ? -60.002 15.346  -46.090 1.00 61.18  ? 239  DT  J "O4'" 1 
ATOM   4872  C "C3'" . DT  B 1 93  ? -59.852 16.905  -44.256 1.00 61.18  ? 239  DT  J "C3'" 1 
ATOM   4873  O "O3'" . DT  B 1 93  ? -61.152 17.014  -43.659 1.00 61.18  ? 239  DT  J "O3'" 1 
ATOM   4874  C "C2'" . DT  B 1 93  ? -59.293 15.558  -43.868 1.00 61.18  ? 239  DT  J "C2'" 1 
ATOM   4875  C "C1'" . DT  B 1 93  ? -59.984 14.646  -44.868 1.00 61.18  ? 239  DT  J "C1'" 1 
ATOM   4876  N N1    . DT  B 1 93  ? -59.274 13.405  -45.093 1.00 73.52  ? 239  DT  J N1    1 
ATOM   4877  C C2    . DT  B 1 93  ? -60.019 12.288  -45.298 1.00 73.52  ? 239  DT  J C2    1 
ATOM   4878  O O2    . DT  B 1 93  ? -61.234 12.313  -45.410 1.00 73.52  ? 239  DT  J O2    1 
ATOM   4879  N N3    . DT  B 1 93  ? -59.301 11.145  -45.394 1.00 73.52  ? 239  DT  J N3    1 
ATOM   4880  C C4    . DT  B 1 93  ? -57.940 11.022  -45.352 1.00 73.52  ? 239  DT  J C4    1 
ATOM   4881  O O4    . DT  B 1 93  ? -57.429 9.923   -45.446 1.00 73.52  ? 239  DT  J O4    1 
ATOM   4882  C C5    . DT  B 1 93  ? -57.217 12.242  -45.198 1.00 73.52  ? 239  DT  J C5    1 
ATOM   4883  C C7    . DT  B 1 93  ? -55.724 12.198  -45.190 1.00 73.52  ? 239  DT  J C7    1 
ATOM   4884  C C6    . DT  B 1 93  ? -57.910 13.366  -45.074 1.00 73.52  ? 239  DT  J C6    1 
ATOM   4885  P P     . DG  B 1 94  ? -61.357 17.728  -42.223 1.00 114.27 ? 240  DG  J P     1 
ATOM   4886  O OP1   . DG  B 1 94  ? -62.233 18.916  -42.444 1.00 97.04  ? 240  DG  J OP1   1 
ATOM   4887  O OP2   . DG  B 1 94  ? -60.056 17.899  -41.513 1.00 97.04  ? 240  DG  J OP2   1 
ATOM   4888  O "O5'" . DG  B 1 94  ? -62.200 16.626  -41.437 1.00 114.27 ? 240  DG  J "O5'" 1 
ATOM   4889  C "C5'" . DG  B 1 94  ? -63.270 15.928  -42.090 1.00 114.27 ? 240  DG  J "C5'" 1 
ATOM   4890  C "C4'" . DG  B 1 94  ? -63.512 14.604  -41.411 1.00 114.27 ? 240  DG  J "C4'" 1 
ATOM   4891  O "O4'" . DG  B 1 94  ? -62.641 13.585  -41.971 1.00 114.27 ? 240  DG  J "O4'" 1 
ATOM   4892  C "C3'" . DG  B 1 94  ? -63.219 14.664  -39.904 1.00 114.27 ? 240  DG  J "C3'" 1 
ATOM   4893  O "O3'" . DG  B 1 94  ? -64.152 13.849  -39.157 1.00 114.27 ? 240  DG  J "O3'" 1 
ATOM   4894  C "C2'" . DG  B 1 94  ? -61.837 14.048  -39.834 1.00 114.27 ? 240  DG  J "C2'" 1 
ATOM   4895  C "C1'" . DG  B 1 94  ? -61.967 12.973  -40.895 1.00 114.27 ? 240  DG  J "C1'" 1 
ATOM   4896  N N9    . DG  B 1 94  ? -60.690 12.478  -41.364 1.00 97.04  ? 240  DG  J N9    1 
ATOM   4897  C C8    . DG  B 1 94  ? -59.605 13.214  -41.757 1.00 97.04  ? 240  DG  J C8    1 
ATOM   4898  N N7    . DG  B 1 94  ? -58.588 12.479  -42.097 1.00 97.04  ? 240  DG  J N7    1 
ATOM   4899  C C5    . DG  B 1 94  ? -59.031 11.178  -41.912 1.00 97.04  ? 240  DG  J C5    1 
ATOM   4900  C C6    . DG  B 1 94  ? -58.354 9.938   -42.095 1.00 97.04  ? 240  DG  J C6    1 
ATOM   4901  O O6    . DG  B 1 94  ? -57.182 9.749   -42.477 1.00 97.04  ? 240  DG  J O6    1 
ATOM   4902  N N1    . DG  B 1 94  ? -59.183 8.847   -41.775 1.00 97.04  ? 240  DG  J N1    1 
ATOM   4903  C C2    . DG  B 1 94  ? -60.493 8.949   -41.331 1.00 97.04  ? 240  DG  J C2    1 
ATOM   4904  N N2    . DG  B 1 94  ? -61.132 7.793   -41.076 1.00 97.04  ? 240  DG  J N2    1 
ATOM   4905  N N3    . DG  B 1 94  ? -61.124 10.106  -41.156 1.00 97.04  ? 240  DG  J N3    1 
ATOM   4906  C C4    . DG  B 1 94  ? -60.336 11.168  -41.464 1.00 97.04  ? 240  DG  J C4    1 
ATOM   4907  P P     . DA  B 1 95  ? -64.597 14.267  -37.655 1.00 109.63 ? 241  DA  J P     1 
ATOM   4908  O OP1   . DA  B 1 95  ? -65.853 15.006  -37.826 1.00 90.14  ? 241  DA  J OP1   1 
ATOM   4909  O OP2   . DA  B 1 95  ? -63.514 14.860  -36.818 1.00 90.14  ? 241  DA  J OP2   1 
ATOM   4910  O "O5'" . DA  B 1 95  ? -65.004 12.865  -37.049 1.00 109.63 ? 241  DA  J "O5'" 1 
ATOM   4911  C "C5'" . DA  B 1 95  ? -65.871 12.012  -37.781 1.00 109.63 ? 241  DA  J "C5'" 1 
ATOM   4912  C "C4'" . DA  B 1 95  ? -65.550 10.571  -37.471 1.00 109.63 ? 241  DA  J "C4'" 1 
ATOM   4913  O "O4'" . DA  B 1 95  ? -64.257 10.267  -38.063 1.00 109.63 ? 241  DA  J "O4'" 1 
ATOM   4914  C "C3'" . DA  B 1 95  ? -65.415 10.310  -35.958 1.00 109.63 ? 241  DA  J "C3'" 1 
ATOM   4915  O "O3'" . DA  B 1 95  ? -65.930 9.020   -35.558 1.00 109.63 ? 241  DA  J "O3'" 1 
ATOM   4916  C "C2'" . DA  B 1 95  ? -63.916 10.371  -35.738 1.00 109.63 ? 241  DA  J "C2'" 1 
ATOM   4917  C "C1'" . DA  B 1 95  ? -63.407 9.773   -37.038 1.00 109.63 ? 241  DA  J "C1'" 1 
ATOM   4918  N N9    . DA  B 1 95  ? -62.023 10.112  -37.359 1.00 90.14  ? 241  DA  J N9    1 
ATOM   4919  C C8    . DA  B 1 95  ? -61.437 11.330  -37.619 1.00 90.14  ? 241  DA  J C8    1 
ATOM   4920  N N7    . DA  B 1 95  ? -60.155 11.249  -37.893 1.00 90.14  ? 241  DA  J N7    1 
ATOM   4921  C C5    . DA  B 1 95  ? -59.880 9.884   -37.801 1.00 90.14  ? 241  DA  J C5    1 
ATOM   4922  C C6    . DA  B 1 95  ? -58.697 9.129   -37.982 1.00 90.14  ? 241  DA  J C6    1 
ATOM   4923  N N6    . DA  B 1 95  ? -57.521 9.653   -38.341 1.00 90.14  ? 241  DA  J N6    1 
ATOM   4924  N N1    . DA  B 1 95  ? -58.775 7.793   -37.781 1.00 90.14  ? 241  DA  J N1    1 
ATOM   4925  C C2    . DA  B 1 95  ? -59.962 7.253   -37.430 1.00 90.14  ? 241  DA  J C2    1 
ATOM   4926  N N3    . DA  B 1 95  ? -61.131 7.847   -37.246 1.00 90.14  ? 241  DA  J N3    1 
ATOM   4927  C C4    . DA  B 1 95  ? -61.021 9.177   -37.454 1.00 90.14  ? 241  DA  J C4    1 
ATOM   4928  P P     . DT  B 1 96  ? -65.539 8.421   -34.113 1.00 91.96  ? 242  DT  J P     1 
ATOM   4929  O OP1   . DT  B 1 96  ? -66.480 7.314   -33.747 1.00 87.33  ? 242  DT  J OP1   1 
ATOM   4930  O OP2   . DT  B 1 96  ? -65.352 9.607   -33.220 1.00 87.33  ? 242  DT  J OP2   1 
ATOM   4931  O "O5'" . DT  B 1 96  ? -64.162 7.656   -34.320 1.00 91.96  ? 242  DT  J "O5'" 1 
ATOM   4932  C "C5'" . DT  B 1 96  ? -64.168 6.401   -34.975 1.00 91.96  ? 242  DT  J "C5'" 1 
ATOM   4933  C "C4'" . DT  B 1 96  ? -63.158 5.465   -34.355 1.00 91.96  ? 242  DT  J "C4'" 1 
ATOM   4934  O "O4'" . DT  B 1 96  ? -61.823 5.820   -34.783 1.00 91.96  ? 242  DT  J "O4'" 1 
ATOM   4935  C "C3'" . DT  B 1 96  ? -63.118 5.360   -32.822 1.00 91.96  ? 242  DT  J "C3'" 1 
ATOM   4936  O "O3'" . DT  B 1 96  ? -62.879 3.989   -32.474 1.00 91.96  ? 242  DT  J "O3'" 1 
ATOM   4937  C "C2'" . DT  B 1 96  ? -61.868 6.146   -32.460 1.00 91.96  ? 242  DT  J "C2'" 1 
ATOM   4938  C "C1'" . DT  B 1 96  ? -60.972 5.873   -33.654 1.00 91.96  ? 242  DT  J "C1'" 1 
ATOM   4939  N N1    . DT  B 1 96  ? -60.032 6.926   -33.915 1.00 87.33  ? 242  DT  J N1    1 
ATOM   4940  C C2    . DT  B 1 96  ? -58.770 6.569   -34.287 1.00 87.33  ? 242  DT  J C2    1 
ATOM   4941  O O2    . DT  B 1 96  ? -58.429 5.394   -34.461 1.00 87.33  ? 242  DT  J O2    1 
ATOM   4942  N N3    . DT  B 1 96  ? -57.922 7.636   -34.474 1.00 87.33  ? 242  DT  J N3    1 
ATOM   4943  C C4    . DT  B 1 96  ? -58.236 8.984   -34.351 1.00 87.33  ? 242  DT  J C4    1 
ATOM   4944  O O4    . DT  B 1 96  ? -57.375 9.832   -34.505 1.00 87.33  ? 242  DT  J O4    1 
ATOM   4945  C C5    . DT  B 1 96  ? -59.597 9.275   -34.021 1.00 87.33  ? 242  DT  J C5    1 
ATOM   4946  C C7    . DT  B 1 96  ? -60.043 10.704  -33.954 1.00 87.33  ? 242  DT  J C7    1 
ATOM   4947  C C6    . DT  B 1 96  ? -60.412 8.243   -33.798 1.00 87.33  ? 242  DT  J C6    1 
ATOM   4948  P P     . DG  B 1 97  ? -63.682 3.298   -31.256 1.00 79.66  ? 243  DG  J P     1 
ATOM   4949  O OP1   . DG  B 1 97  ? -65.135 3.514   -31.637 1.00 104.55 ? 243  DG  J OP1   1 
ATOM   4950  O OP2   . DG  B 1 97  ? -63.162 3.916   -29.998 1.00 104.55 ? 243  DG  J OP2   1 
ATOM   4951  O "O5'" . DG  B 1 97  ? -63.169 1.750   -31.306 1.00 79.66  ? 243  DG  J "O5'" 1 
ATOM   4952  C "C5'" . DG  B 1 97  ? -62.192 1.199   -30.342 1.00 79.66  ? 243  DG  J "C5'" 1 
ATOM   4953  C "C4'" . DG  B 1 97  ? -60.912 0.686   -31.017 1.00 79.66  ? 243  DG  J "C4'" 1 
ATOM   4954  O "O4'" . DG  B 1 97  ? -60.158 1.761   -31.669 1.00 79.66  ? 243  DG  J "O4'" 1 
ATOM   4955  C "C3'" . DG  B 1 97  ? -59.871 0.008   -30.099 1.00 79.66  ? 243  DG  J "C3'" 1 
ATOM   4956  O "O3'" . DG  B 1 97  ? -59.213 -1.104  -30.725 1.00 79.66  ? 243  DG  J "O3'" 1 
ATOM   4957  C "C2'" . DG  B 1 97  ? -58.855 1.111   -29.792 1.00 79.66  ? 243  DG  J "C2'" 1 
ATOM   4958  C "C1'" . DG  B 1 97  ? -58.867 1.976   -31.051 1.00 79.66  ? 243  DG  J "C1'" 1 
ATOM   4959  N N9    . DG  B 1 97  ? -58.717 3.422   -30.828 1.00 104.55 ? 243  DG  J N9    1 
ATOM   4960  C C8    . DG  B 1 97  ? -59.652 4.299   -30.304 1.00 104.55 ? 243  DG  J C8    1 
ATOM   4961  N N7    . DG  B 1 97  ? -59.271 5.548   -30.339 1.00 104.55 ? 243  DG  J N7    1 
ATOM   4962  C C5    . DG  B 1 97  ? -58.002 5.496   -30.894 1.00 104.55 ? 243  DG  J C5    1 
ATOM   4963  C C6    . DG  B 1 97  ? -57.113 6.536   -31.225 1.00 104.55 ? 243  DG  J C6    1 
ATOM   4964  O O6    . DG  B 1 97  ? -57.271 7.746   -31.099 1.00 104.55 ? 243  DG  J O6    1 
ATOM   4965  N N1    . DG  B 1 97  ? -55.945 6.045   -31.776 1.00 104.55 ? 243  DG  J N1    1 
ATOM   4966  C C2    . DG  B 1 97  ? -55.670 4.718   -31.993 1.00 104.55 ? 243  DG  J C2    1 
ATOM   4967  N N2    . DG  B 1 97  ? -54.490 4.452   -32.531 1.00 104.55 ? 243  DG  J N2    1 
ATOM   4968  N N3    . DG  B 1 97  ? -56.490 3.731   -31.701 1.00 104.55 ? 243  DG  J N3    1 
ATOM   4969  C C4    . DG  B 1 97  ? -57.633 4.186   -31.165 1.00 104.55 ? 243  DG  J C4    1 
ATOM   4970  P P     . DG  B 1 98  ? -58.304 -2.086  -29.818 1.00 81.94  ? 244  DG  J P     1 
ATOM   4971  O OP1   . DG  B 1 98  ? -58.140 -3.470  -30.405 1.00 79.42  ? 244  DG  J OP1   1 
ATOM   4972  O OP2   . DG  B 1 98  ? -58.751 -1.933  -28.402 1.00 79.42  ? 244  DG  J OP2   1 
ATOM   4973  O "O5'" . DG  B 1 98  ? -56.860 -1.419  -29.811 1.00 81.94  ? 244  DG  J "O5'" 1 
ATOM   4974  C "C5'" . DG  B 1 98  ? -55.824 -1.853  -30.716 1.00 81.94  ? 244  DG  J "C5'" 1 
ATOM   4975  C "C4'" . DG  B 1 98  ? -54.536 -1.116  -30.425 1.00 81.94  ? 244  DG  J "C4'" 1 
ATOM   4976  O "O4'" . DG  B 1 98  ? -54.775 0.322   -30.287 1.00 81.94  ? 244  DG  J "O4'" 1 
ATOM   4977  C "C3'" . DG  B 1 98  ? -53.904 -1.544  -29.105 1.00 81.94  ? 244  DG  J "C3'" 1 
ATOM   4978  O "O3'" . DG  B 1 98  ? -52.507 -1.456  -29.240 1.00 81.94  ? 244  DG  J "O3'" 1 
ATOM   4979  C "C2'" . DG  B 1 98  ? -54.282 -0.431  -28.139 1.00 81.94  ? 244  DG  J "C2'" 1 
ATOM   4980  C "C1'" . DG  B 1 98  ? -54.249 0.782   -29.044 1.00 81.94  ? 244  DG  J "C1'" 1 
ATOM   4981  N N9    . DG  B 1 98  ? -55.058 1.908   -28.573 1.00 79.42  ? 244  DG  J N9    1 
ATOM   4982  C C8    . DG  B 1 98  ? -56.174 1.833   -27.760 1.00 79.42  ? 244  DG  J C8    1 
ATOM   4983  N N7    . DG  B 1 98  ? -56.662 3.008   -27.428 1.00 79.42  ? 244  DG  J N7    1 
ATOM   4984  C C5    . DG  B 1 98  ? -55.835 3.916   -28.081 1.00 79.42  ? 244  DG  J C5    1 
ATOM   4985  C C6    . DG  B 1 98  ? -55.871 5.330   -28.111 1.00 79.42  ? 244  DG  J C6    1 
ATOM   4986  O O6    . DG  B 1 98  ? -56.669 6.084   -27.574 1.00 79.42  ? 244  DG  J O6    1 
ATOM   4987  N N1    . DG  B 1 98  ? -54.851 5.852   -28.881 1.00 79.42  ? 244  DG  J N1    1 
ATOM   4988  C C2    . DG  B 1 98  ? -53.925 5.120   -29.558 1.00 79.42  ? 244  DG  J C2    1 
ATOM   4989  N N2    . DG  B 1 98  ? -53.036 5.836   -30.252 1.00 79.42  ? 244  DG  J N2    1 
ATOM   4990  N N3    . DG  B 1 98  ? -53.875 3.795   -29.562 1.00 79.42  ? 244  DG  J N3    1 
ATOM   4991  C C4    . DG  B 1 98  ? -54.847 3.259   -28.805 1.00 79.42  ? 244  DG  J C4    1 
ATOM   4992  P P     . DA  B 1 99  ? -51.648 -2.732  -29.628 1.00 75.67  ? 245  DA  J P     1 
ATOM   4993  O OP1   . DA  B 1 99  ? -52.149 -3.287  -30.915 1.00 77.52  ? 245  DA  J OP1   1 
ATOM   4994  O OP2   . DA  B 1 99  ? -51.502 -3.580  -28.434 1.00 77.52  ? 245  DA  J OP2   1 
ATOM   4995  O "O5'" . DA  B 1 99  ? -50.252 -2.048  -29.890 1.00 75.67  ? 245  DA  J "O5'" 1 
ATOM   4996  C "C5'" . DA  B 1 99  ? -50.056 -1.342  -31.082 1.00 75.67  ? 245  DA  J "C5'" 1 
ATOM   4997  C "C4'" . DA  B 1 99  ? -49.127 -0.197  -30.824 1.00 75.67  ? 245  DA  J "C4'" 1 
ATOM   4998  O "O4'" . DA  B 1 99  ? -49.804 0.828   -30.076 1.00 75.67  ? 245  DA  J "O4'" 1 
ATOM   4999  C "C3'" . DA  B 1 99  ? -47.960 -0.623  -29.968 1.00 75.67  ? 245  DA  J "C3'" 1 
ATOM   5000  O "O3'" . DA  B 1 99  ? -46.887 0.187   -30.396 1.00 75.67  ? 245  DA  J "O3'" 1 
ATOM   5001  C "C2'" . DA  B 1 99  ? -48.410 -0.249  -28.562 1.00 75.67  ? 245  DA  J "C2'" 1 
ATOM   5002  C "C1'" . DA  B 1 99  ? -49.183 1.029   -28.817 1.00 75.67  ? 245  DA  J "C1'" 1 
ATOM   5003  N N9    . DA  B 1 99  ? -50.263 1.285   -27.877 1.00 77.52  ? 245  DA  J N9    1 
ATOM   5004  C C8    . DA  B 1 99  ? -50.940 0.303   -27.202 1.00 77.52  ? 245  DA  J C8    1 
ATOM   5005  N N7    . DA  B 1 99  ? -51.974 0.741   -26.532 1.00 77.52  ? 245  DA  J N7    1 
ATOM   5006  C C5    . DA  B 1 99  ? -51.956 2.112   -26.742 1.00 77.52  ? 245  DA  J C5    1 
ATOM   5007  C C6    . DA  B 1 99  ? -52.784 3.124   -26.272 1.00 77.52  ? 245  DA  J C6    1 
ATOM   5008  N N6    . DA  B 1 99  ? -53.813 2.897   -25.422 1.00 77.52  ? 245  DA  J N6    1 
ATOM   5009  N N1    . DA  B 1 99  ? -52.508 4.392   -26.668 1.00 77.52  ? 245  DA  J N1    1 
ATOM   5010  C C2    . DA  B 1 99  ? -51.436 4.605   -27.445 1.00 77.52  ? 245  DA  J C2    1 
ATOM   5011  N N3    . DA  B 1 99  ? -50.564 3.732   -27.927 1.00 77.52  ? 245  DA  J N3    1 
ATOM   5012  C C4    . DA  B 1 99  ? -50.886 2.477   -27.544 1.00 77.52  ? 245  DA  J C4    1 
ATOM   5013  P P     . DG  B 1 100 ? -45.530 -0.485  -30.879 1.00 59.92  ? 246  DG  J P     1 
ATOM   5014  O OP1   . DG  B 1 100 ? -45.599 -0.960  -32.289 1.00 81.42  ? 246  DG  J OP1   1 
ATOM   5015  O OP2   . DG  B 1 100 ? -45.009 -1.368  -29.807 1.00 81.42  ? 246  DG  J OP2   1 
ATOM   5016  O "O5'" . DG  B 1 100 ? -44.552 0.744   -30.788 1.00 59.92  ? 246  DG  J "O5'" 1 
ATOM   5017  C "C5'" . DG  B 1 100 ? -44.114 1.126   -29.494 1.00 59.92  ? 246  DG  J "C5'" 1 
ATOM   5018  C "C4'" . DG  B 1 100 ? -44.591 2.513   -29.158 1.00 59.92  ? 246  DG  J "C4'" 1 
ATOM   5019  O "O4'" . DG  B 1 100 ? -45.913 2.438   -28.568 1.00 59.92  ? 246  DG  J "O4'" 1 
ATOM   5020  C "C3'" . DG  B 1 100 ? -43.699 3.089   -28.081 1.00 59.92  ? 246  DG  J "C3'" 1 
ATOM   5021  O "O3'" . DG  B 1 100 ? -43.314 4.383   -28.353 1.00 59.92  ? 246  DG  J "O3'" 1 
ATOM   5022  C "C2'" . DG  B 1 100 ? -44.517 3.043   -26.829 1.00 59.92  ? 246  DG  J "C2'" 1 
ATOM   5023  C "C1'" . DG  B 1 100 ? -45.919 3.179   -27.341 1.00 59.92  ? 246  DG  J "C1'" 1 
ATOM   5024  N N9    . DG  B 1 100 ? -46.876 2.585   -26.403 1.00 81.42  ? 246  DG  J N9    1 
ATOM   5025  C C8    . DG  B 1 100 ? -46.940 1.280   -26.003 1.00 81.42  ? 246  DG  J C8    1 
ATOM   5026  N N7    . DG  B 1 100 ? -47.950 1.024   -25.228 1.00 81.42  ? 246  DG  J N7    1 
ATOM   5027  C C5    . DG  B 1 100 ? -48.571 2.246   -25.090 1.00 81.42  ? 246  DG  J C5    1 
ATOM   5028  C C6    . DG  B 1 100 ? -49.733 2.588   -24.392 1.00 81.42  ? 246  DG  J C6    1 
ATOM   5029  O O6    . DG  B 1 100 ? -50.465 1.835   -23.721 1.00 81.42  ? 246  DG  J O6    1 
ATOM   5030  N N1    . DG  B 1 100 ? -50.029 3.954   -24.528 1.00 81.42  ? 246  DG  J N1    1 
ATOM   5031  C C2    . DG  B 1 100 ? -49.271 4.861   -25.246 1.00 81.42  ? 246  DG  J C2    1 
ATOM   5032  N N2    . DG  B 1 100 ? -49.717 6.136   -25.291 1.00 81.42  ? 246  DG  J N2    1 
ATOM   5033  N N3    . DG  B 1 100 ? -48.159 4.531   -25.886 1.00 81.42  ? 246  DG  J N3    1 
ATOM   5034  C C4    . DG  B 1 100 ? -47.889 3.222   -25.780 1.00 81.42  ? 246  DG  J C4    1 
ATOM   5035  P P     . DC  B 1 101 ? -41.791 4.635   -28.670 1.00 42.99  ? 247  DC  J P     1 
ATOM   5036  O OP1   . DC  B 1 101 ? -41.551 4.180   -30.039 1.00 53.19  ? 247  DC  J OP1   1 
ATOM   5037  O OP2   . DC  B 1 101 ? -40.955 4.123   -27.595 1.00 53.19  ? 247  DC  J OP2   1 
ATOM   5038  O "O5'" . DC  B 1 101 ? -41.700 6.200   -28.593 1.00 42.99  ? 247  DC  J "O5'" 1 
ATOM   5039  C "C5'" . DC  B 1 101 ? -42.802 6.965   -29.055 1.00 42.99  ? 247  DC  J "C5'" 1 
ATOM   5040  C "C4'" . DC  B 1 101 ? -43.214 7.964   -27.998 1.00 42.99  ? 247  DC  J "C4'" 1 
ATOM   5041  O "O4'" . DC  B 1 101 ? -44.022 7.321   -26.972 1.00 42.99  ? 247  DC  J "O4'" 1 
ATOM   5042  C "C3'" . DC  B 1 101 ? -42.008 8.565   -27.271 1.00 42.99  ? 247  DC  J "C3'" 1 
ATOM   5043  O "O3'" . DC  B 1 101 ? -42.113 10.003  -27.209 1.00 42.99  ? 247  DC  J "O3'" 1 
ATOM   5044  C "C2'" . DC  B 1 101 ? -41.991 7.849   -25.910 1.00 42.99  ? 247  DC  J "C2'" 1 
ATOM   5045  C "C1'" . DC  B 1 101 ? -43.464 7.529   -25.675 1.00 42.99  ? 247  DC  J "C1'" 1 
ATOM   5046  N N1    . DC  B 1 101 ? -43.792 6.341   -24.865 1.00 53.19  ? 247  DC  J N1    1 
ATOM   5047  C C2    . DC  B 1 101 ? -44.988 6.346   -24.145 1.00 53.19  ? 247  DC  J C2    1 
ATOM   5048  O O2    . DC  B 1 101 ? -45.654 7.399   -24.091 1.00 53.19  ? 247  DC  J O2    1 
ATOM   5049  N N3    . DC  B 1 101 ? -45.401 5.217   -23.537 1.00 53.19  ? 247  DC  J N3    1 
ATOM   5050  C C4    . DC  B 1 101 ? -44.670 4.112   -23.623 1.00 53.19  ? 247  DC  J C4    1 
ATOM   5051  N N4    . DC  B 1 101 ? -45.193 2.992   -23.121 1.00 53.19  ? 247  DC  J N4    1 
ATOM   5052  C C5    . DC  B 1 101 ? -43.389 4.101   -24.260 1.00 53.19  ? 247  DC  J C5    1 
ATOM   5053  C C6    . DC  B 1 101 ? -42.994 5.233   -24.864 1.00 53.19  ? 247  DC  J C6    1 
ATOM   5054  P P     . DA  B 1 102 ? -41.274 10.802  -26.121 1.00 58.22  ? 248  DA  J P     1 
ATOM   5055  O OP1   . DA  B 1 102 ? -40.820 12.089  -26.682 1.00 67.49  ? 248  DA  J OP1   1 
ATOM   5056  O OP2   . DA  B 1 102 ? -40.282 9.878   -25.408 1.00 67.49  ? 248  DA  J OP2   1 
ATOM   5057  O "O5'" . DA  B 1 102 ? -42.402 11.197  -25.098 1.00 58.22  ? 248  DA  J "O5'" 1 
ATOM   5058  C "C5'" . DA  B 1 102 ? -42.009 11.564  -23.823 1.00 58.22  ? 248  DA  J "C5'" 1 
ATOM   5059  C "C4'" . DA  B 1 102 ? -43.076 11.239  -22.813 1.00 58.22  ? 248  DA  J "C4'" 1 
ATOM   5060  O "O4'" . DA  B 1 102 ? -43.389 9.837   -22.817 1.00 58.22  ? 248  DA  J "O4'" 1 
ATOM   5061  C "C3'" . DA  B 1 102 ? -42.409 11.489  -21.479 1.00 58.22  ? 248  DA  J "C3'" 1 
ATOM   5062  O "O3'" . DA  B 1 102 ? -43.305 12.048  -20.576 1.00 58.22  ? 248  DA  J "O3'" 1 
ATOM   5063  C "C2'" . DA  B 1 102 ? -41.963 10.122  -21.024 1.00 58.22  ? 248  DA  J "C2'" 1 
ATOM   5064  C "C1'" . DA  B 1 102 ? -43.103 9.319   -21.542 1.00 58.22  ? 248  DA  J "C1'" 1 
ATOM   5065  N N9    . DA  B 1 102 ? -42.708 7.955   -21.706 1.00 67.49  ? 248  DA  J N9    1 
ATOM   5066  C C8    . DA  B 1 102 ? -41.690 7.417   -22.419 1.00 67.49  ? 248  DA  J C8    1 
ATOM   5067  N N7    . DA  B 1 102 ? -41.576 6.126   -22.266 1.00 67.49  ? 248  DA  J N7    1 
ATOM   5068  C C5    . DA  B 1 102 ? -42.614 5.806   -21.407 1.00 67.49  ? 248  DA  J C5    1 
ATOM   5069  C C6    . DA  B 1 102 ? -43.039 4.597   -20.847 1.00 67.49  ? 248  DA  J C6    1 
ATOM   5070  N N6    . DA  B 1 102 ? -42.420 3.418   -21.077 1.00 67.49  ? 248  DA  J N6    1 
ATOM   5071  N N1    . DA  B 1 102 ? -44.127 4.639   -20.034 1.00 67.49  ? 248  DA  J N1    1 
ATOM   5072  C C2    . DA  B 1 102 ? -44.715 5.832   -19.805 1.00 67.49  ? 248  DA  J C2    1 
ATOM   5073  N N3    . DA  B 1 102 ? -44.393 7.026   -20.270 1.00 67.49  ? 248  DA  J N3    1 
ATOM   5074  C C4    . DA  B 1 102 ? -43.327 6.932   -21.073 1.00 67.49  ? 248  DA  J C4    1 
ATOM   5075  P P     . DG  B 1 103 ? -42.709 12.967  -19.433 1.00 98.46  ? 249  DG  J P     1 
ATOM   5076  O OP1   . DG  B 1 103 ? -43.305 14.292  -19.818 1.00 74.08  ? 249  DG  J OP1   1 
ATOM   5077  O OP2   . DG  B 1 103 ? -41.232 12.814  -19.292 1.00 74.08  ? 249  DG  J OP2   1 
ATOM   5078  O "O5'" . DG  B 1 103 ? -43.305 12.318  -18.116 1.00 98.46  ? 249  DG  J "O5'" 1 
ATOM   5079  C "C5'" . DG  B 1 103 ? -44.663 12.494  -17.754 1.00 98.46  ? 249  DG  J "C5'" 1 
ATOM   5080  C "C4'" . DG  B 1 103 ? -44.839 11.982  -16.351 1.00 98.46  ? 249  DG  J "C4'" 1 
ATOM   5081  O "O4'" . DG  B 1 103 ? -44.652 10.549  -16.423 1.00 98.46  ? 249  DG  J "O4'" 1 
ATOM   5082  C "C3'" . DG  B 1 103 ? -43.731 12.505  -15.437 1.00 98.46  ? 249  DG  J "C3'" 1 
ATOM   5083  O "O3'" . DG  B 1 103 ? -44.220 12.780  -14.113 1.00 98.46  ? 249  DG  J "O3'" 1 
ATOM   5084  C "C2'" . DG  B 1 103 ? -42.672 11.414  -15.500 1.00 98.46  ? 249  DG  J "C2'" 1 
ATOM   5085  C "C1'" . DG  B 1 103 ? -43.470 10.149  -15.745 1.00 98.46  ? 249  DG  J "C1'" 1 
ATOM   5086  N N9    . DG  B 1 103 ? -42.784 9.183   -16.591 1.00 74.08  ? 249  DG  J N9    1 
ATOM   5087  C C8    . DG  B 1 103 ? -41.909 9.464   -17.617 1.00 74.08  ? 249  DG  J C8    1 
ATOM   5088  N N7    . DG  B 1 103 ? -41.466 8.399   -18.224 1.00 74.08  ? 249  DG  J N7    1 
ATOM   5089  C C5    . DG  B 1 103 ? -42.075 7.351   -17.555 1.00 74.08  ? 249  DG  J C5    1 
ATOM   5090  C C6    . DG  B 1 103 ? -41.954 5.981   -17.748 1.00 74.08  ? 249  DG  J C6    1 
ATOM   5091  O O6    . DG  B 1 103 ? -41.287 5.400   -18.585 1.00 74.08  ? 249  DG  J O6    1 
ATOM   5092  N N1    . DG  B 1 103 ? -42.701 5.259   -16.838 1.00 74.08  ? 249  DG  J N1    1 
ATOM   5093  C C2    . DG  B 1 103 ? -43.467 5.805   -15.858 1.00 74.08  ? 249  DG  J C2    1 
ATOM   5094  N N2    . DG  B 1 103 ? -44.048 4.937   -15.065 1.00 74.08  ? 249  DG  J N2    1 
ATOM   5095  N N3    . DG  B 1 103 ? -43.626 7.104   -15.668 1.00 74.08  ? 249  DG  J N3    1 
ATOM   5096  C C4    . DG  B 1 103 ? -42.890 7.817   -16.543 1.00 74.08  ? 249  DG  J C4    1 
ATOM   5097  P P     . DT  B 1 104 ? -43.197 12.810  -12.853 1.00 94.32  ? 250  DT  J P     1 
ATOM   5098  O OP1   . DT  B 1 104 ? -44.050 13.410  -11.799 1.00 90.75  ? 250  DT  J OP1   1 
ATOM   5099  O OP2   . DT  B 1 104 ? -41.839 13.434  -13.127 1.00 90.75  ? 250  DT  J OP2   1 
ATOM   5100  O "O5'" . DT  B 1 104 ? -43.020 11.253  -12.526 1.00 94.32  ? 250  DT  J "O5'" 1 
ATOM   5101  C "C5'" . DT  B 1 104 ? -44.170 10.401  -12.557 1.00 94.32  ? 250  DT  J "C5'" 1 
ATOM   5102  C "C4'" . DT  B 1 104 ? -43.998 9.243   -11.608 1.00 94.32  ? 250  DT  J "C4'" 1 
ATOM   5103  O "O4'" . DT  B 1 104 ? -43.471 8.087   -12.287 1.00 94.32  ? 250  DT  J "O4'" 1 
ATOM   5104  C "C3'" . DT  B 1 104 ? -43.054 9.524   -10.449 1.00 94.32  ? 250  DT  J "C3'" 1 
ATOM   5105  O "O3'" . DT  B 1 104 ? -43.600 8.914   -9.276  1.00 94.32  ? 250  DT  J "O3'" 1 
ATOM   5106  C "C2'" . DT  B 1 104 ? -41.761 8.880   -10.908 1.00 94.32  ? 250  DT  J "C2'" 1 
ATOM   5107  C "C1'" . DT  B 1 104 ? -42.265 7.681   -11.685 1.00 94.32  ? 250  DT  J "C1'" 1 
ATOM   5108  N N1    . DT  B 1 104 ? -41.401 7.247   -12.761 1.00 90.75  ? 250  DT  J N1    1 
ATOM   5109  C C2    . DT  B 1 104 ? -41.318 5.922   -12.994 1.00 90.75  ? 250  DT  J C2    1 
ATOM   5110  O O2    . DT  B 1 104 ? -41.924 5.117   -12.339 1.00 90.75  ? 250  DT  J O2    1 
ATOM   5111  N N3    . DT  B 1 104 ? -40.516 5.568   -14.030 1.00 90.75  ? 250  DT  J N3    1 
ATOM   5112  C C4    . DT  B 1 104 ? -39.831 6.406   -14.845 1.00 90.75  ? 250  DT  J C4    1 
ATOM   5113  O O4    . DT  B 1 104 ? -39.184 5.958   -15.758 1.00 90.75  ? 250  DT  J O4    1 
ATOM   5114  C C5    . DT  B 1 104 ? -39.955 7.790   -14.546 1.00 90.75  ? 250  DT  J C5    1 
ATOM   5115  C C7    . DT  B 1 104 ? -39.231 8.774   -15.398 1.00 90.75  ? 250  DT  J C7    1 
ATOM   5116  C C6    . DT  B 1 104 ? -40.721 8.146   -13.521 1.00 90.75  ? 250  DT  J C6    1 
ATOM   5117  P P     . DT  B 1 105 ? -42.789 8.957   -7.900  1.00 103.88 ? 251  DT  J P     1 
ATOM   5118  O OP1   . DT  B 1 105 ? -43.754 8.968   -6.765  1.00 89.43  ? 251  DT  J OP1   1 
ATOM   5119  O OP2   . DT  B 1 105 ? -41.761 10.042  -8.019  1.00 89.43  ? 251  DT  J OP2   1 
ATOM   5120  O "O5'" . DT  B 1 105 ? -42.103 7.524   -7.882  1.00 103.88 ? 251  DT  J "O5'" 1 
ATOM   5121  C "C5'" . DT  B 1 105 ? -42.903 6.350   -8.043  1.00 103.88 ? 251  DT  J "C5'" 1 
ATOM   5122  C "C4'" . DT  B 1 105 ? -42.050 5.116   -7.858  1.00 103.88 ? 251  DT  J "C4'" 1 
ATOM   5123  O "O4'" . DT  B 1 105 ? -41.249 4.862   -9.036  1.00 103.88 ? 251  DT  J "O4'" 1 
ATOM   5124  C "C3'" . DT  B 1 105 ? -41.064 5.244   -6.698  1.00 103.88 ? 251  DT  J "C3'" 1 
ATOM   5125  O "O3'" . DT  B 1 105 ? -40.924 3.967   -6.053  1.00 103.88 ? 251  DT  J "O3'" 1 
ATOM   5126  C "C2'" . DT  B 1 105 ? -39.778 5.638   -7.397  1.00 103.88 ? 251  DT  J "C2'" 1 
ATOM   5127  C "C1'" . DT  B 1 105 ? -39.891 4.790   -8.657  1.00 103.88 ? 251  DT  J "C1'" 1 
ATOM   5128  N N1    . DT  B 1 105 ? -39.084 5.230   -9.794  1.00 89.43  ? 251  DT  J N1    1 
ATOM   5129  C C2    . DT  B 1 105 ? -38.575 4.271   -10.636 1.00 89.43  ? 251  DT  J C2    1 
ATOM   5130  O O2    . DT  B 1 105 ? -38.750 3.087   -10.459 1.00 89.43  ? 251  DT  J O2    1 
ATOM   5131  N N3    . DT  B 1 105 ? -37.848 4.757   -11.687 1.00 89.43  ? 251  DT  J N3    1 
ATOM   5132  C C4    . DT  B 1 105 ? -37.582 6.083   -11.958 1.00 89.43  ? 251  DT  J C4    1 
ATOM   5133  O O4    . DT  B 1 105 ? -36.938 6.395   -12.942 1.00 89.43  ? 251  DT  J O4    1 
ATOM   5134  C C5    . DT  B 1 105 ? -38.113 7.023   -11.023 1.00 89.43  ? 251  DT  J C5    1 
ATOM   5135  C C7    . DT  B 1 105 ? -37.813 8.472   -11.221 1.00 89.43  ? 251  DT  J C7    1 
ATOM   5136  C C6    . DT  B 1 105 ? -38.844 6.562   -10.005 1.00 89.43  ? 251  DT  J C6    1 
ATOM   5137  P P     . DT  B 1 106 ? -40.165 3.867   -4.642  1.00 93.23  ? 252  DT  J P     1 
ATOM   5138  O OP1   . DT  B 1 106 ? -41.205 3.472   -3.648  1.00 95.42  ? 252  DT  J OP1   1 
ATOM   5139  O OP2   . DT  B 1 106 ? -39.376 5.130   -4.474  1.00 95.42  ? 252  DT  J OP2   1 
ATOM   5140  O "O5'" . DT  B 1 106 ? -39.200 2.633   -4.848  1.00 93.23  ? 252  DT  J "O5'" 1 
ATOM   5141  C "C5'" . DT  B 1 106 ? -39.637 1.537   -5.635  1.00 93.23  ? 252  DT  J "C5'" 1 
ATOM   5142  C "C4'" . DT  B 1 106 ? -38.448 0.783   -6.174  1.00 93.23  ? 252  DT  J "C4'" 1 
ATOM   5143  O "O4'" . DT  B 1 106 ? -37.888 1.383   -7.376  1.00 93.23  ? 252  DT  J "O4'" 1 
ATOM   5144  C "C3'" . DT  B 1 106 ? -37.307 0.671   -5.166  1.00 93.23  ? 252  DT  J "C3'" 1 
ATOM   5145  O "O3'" . DT  B 1 106 ? -36.933 -0.698  -5.117  1.00 93.23  ? 252  DT  J "O3'" 1 
ATOM   5146  C "C2'" . DT  B 1 106 ? -36.207 1.574   -5.737  1.00 93.23  ? 252  DT  J "C2'" 1 
ATOM   5147  C "C1'" . DT  B 1 106 ? -36.464 1.500   -7.238  1.00 93.23  ? 252  DT  J "C1'" 1 
ATOM   5148  N N1    . DT  B 1 106 ? -36.013 2.659   -8.060  1.00 95.42  ? 252  DT  J N1    1 
ATOM   5149  C C2    . DT  B 1 106 ? -35.294 2.421   -9.233  1.00 95.42  ? 252  DT  J C2    1 
ATOM   5150  O O2    . DT  B 1 106 ? -34.936 1.303   -9.595  1.00 95.42  ? 252  DT  J O2    1 
ATOM   5151  N N3    . DT  B 1 106 ? -34.998 3.553   -9.966  1.00 95.42  ? 252  DT  J N3    1 
ATOM   5152  C C4    . DT  B 1 106 ? -35.315 4.856   -9.651  1.00 95.42  ? 252  DT  J C4    1 
ATOM   5153  O O4    . DT  B 1 106 ? -34.978 5.767   -10.401 1.00 95.42  ? 252  DT  J O4    1 
ATOM   5154  C C5    . DT  B 1 106 ? -36.037 5.033   -8.406  1.00 95.42  ? 252  DT  J C5    1 
ATOM   5155  C C7    . DT  B 1 106 ? -36.422 6.419   -7.985  1.00 95.42  ? 252  DT  J C7    1 
ATOM   5156  C C6    . DT  B 1 106 ? -36.337 3.942   -7.680  1.00 95.42  ? 252  DT  J C6    1 
ATOM   5157  P P     . DC  B 1 107 ? -35.950 -1.215  -3.973  1.00 112.56 ? 253  DC  J P     1 
ATOM   5158  O OP1   . DC  B 1 107 ? -36.401 -2.628  -3.776  1.00 78.74  ? 253  DC  J OP1   1 
ATOM   5159  O OP2   . DC  B 1 107 ? -35.906 -0.265  -2.814  1.00 78.74  ? 253  DC  J OP2   1 
ATOM   5160  O "O5'" . DC  B 1 107 ? -34.526 -1.216  -4.694  1.00 112.56 ? 253  DC  J "O5'" 1 
ATOM   5161  C "C5'" . DC  B 1 107 ? -34.186 -2.230  -5.641  1.00 112.56 ? 253  DC  J "C5'" 1 
ATOM   5162  C "C4'" . DC  B 1 107 ? -32.734 -2.107  -6.035  1.00 112.56 ? 253  DC  J "C4'" 1 
ATOM   5163  O "O4'" . DC  B 1 107 ? -32.539 -0.906  -6.804  1.00 112.56 ? 253  DC  J "O4'" 1 
ATOM   5164  C "C3'" . DC  B 1 107 ? -31.731 -2.026  -4.884  1.00 112.56 ? 253  DC  J "C3'" 1 
ATOM   5165  O "O3'" . DC  B 1 107 ? -30.564 -2.719  -5.294  1.00 112.56 ? 253  DC  J "O3'" 1 
ATOM   5166  C "C2'" . DC  B 1 107 ? -31.419 -0.547  -4.796  1.00 112.56 ? 253  DC  J "C2'" 1 
ATOM   5167  C "C1'" . DC  B 1 107 ? -31.459 -0.190  -6.259  1.00 112.56 ? 253  DC  J "C1'" 1 
ATOM   5168  N N1    . DC  B 1 107 ? -31.696 1.193   -6.580  1.00 78.74  ? 253  DC  J N1    1 
ATOM   5169  C C2    . DC  B 1 107 ? -31.264 1.616   -7.786  1.00 78.74  ? 253  DC  J C2    1 
ATOM   5170  O O2    . DC  B 1 107 ? -30.691 0.797   -8.488  1.00 78.74  ? 253  DC  J O2    1 
ATOM   5171  N N3    . DC  B 1 107 ? -31.479 2.897   -8.180  1.00 78.74  ? 253  DC  J N3    1 
ATOM   5172  C C4    . DC  B 1 107 ? -32.124 3.729   -7.369  1.00 78.74  ? 253  DC  J C4    1 
ATOM   5173  N N4    . DC  B 1 107 ? -32.315 4.987   -7.777  1.00 78.74  ? 253  DC  J N4    1 
ATOM   5174  C C5    . DC  B 1 107 ? -32.594 3.308   -6.094  1.00 78.74  ? 253  DC  J C5    1 
ATOM   5175  C C6    . DC  B 1 107 ? -32.349 2.037   -5.737  1.00 78.74  ? 253  DC  J C6    1 
ATOM   5176  P P     . DC  B 1 108 ? -30.539 -4.320  -5.197  1.00 85.07  ? 254  DC  J P     1 
ATOM   5177  O OP1   . DC  B 1 108 ? -31.842 -4.843  -5.774  1.00 77.59  ? 254  DC  J OP1   1 
ATOM   5178  O OP2   . DC  B 1 108 ? -30.140 -4.619  -3.773  1.00 77.59  ? 254  DC  J OP2   1 
ATOM   5179  O "O5'" . DC  B 1 108 ? -29.353 -4.804  -6.136  1.00 85.07  ? 254  DC  J "O5'" 1 
ATOM   5180  C "C5'" . DC  B 1 108 ? -29.570 -5.012  -7.517  1.00 85.07  ? 254  DC  J "C5'" 1 
ATOM   5181  C "C4'" . DC  B 1 108 ? -28.442 -4.385  -8.292  1.00 85.07  ? 254  DC  J "C4'" 1 
ATOM   5182  O "O4'" . DC  B 1 108 ? -28.571 -2.944  -8.332  1.00 85.07  ? 254  DC  J "O4'" 1 
ATOM   5183  C "C3'" . DC  B 1 108 ? -27.079 -4.653  -7.660  1.00 85.07  ? 254  DC  J "C3'" 1 
ATOM   5184  O "O3'" . DC  B 1 108 ? -26.175 -4.784  -8.729  1.00 85.07  ? 254  DC  J "O3'" 1 
ATOM   5185  C "C2'" . DC  B 1 108 ? -26.779 -3.366  -6.914  1.00 85.07  ? 254  DC  J "C2'" 1 
ATOM   5186  C "C1'" . DC  B 1 108 ? -27.321 -2.390  -7.914  1.00 85.07  ? 254  DC  J "C1'" 1 
ATOM   5187  N N1    . DC  B 1 108 ? -27.528 -1.001  -7.473  1.00 77.59  ? 254  DC  J N1    1 
ATOM   5188  C C2    . DC  B 1 108 ? -27.613 0.018   -8.463  1.00 77.59  ? 254  DC  J C2    1 
ATOM   5189  O O2    . DC  B 1 108 ? -27.428 -0.284  -9.688  1.00 77.59  ? 254  DC  J O2    1 
ATOM   5190  N N3    . DC  B 1 108 ? -27.895 1.285   -8.063  1.00 77.59  ? 254  DC  J N3    1 
ATOM   5191  C C4    . DC  B 1 108 ? -28.090 1.548   -6.770  1.00 77.59  ? 254  DC  J C4    1 
ATOM   5192  N N4    . DC  B 1 108 ? -28.464 2.769   -6.425  1.00 77.59  ? 254  DC  J N4    1 
ATOM   5193  C C5    . DC  B 1 108 ? -27.941 0.556   -5.770  1.00 77.59  ? 254  DC  J C5    1 
ATOM   5194  C C6    . DC  B 1 108 ? -27.660 -0.692  -6.156  1.00 77.59  ? 254  DC  J C6    1 
ATOM   5195  P P     . DA  B 1 109 ? -24.896 -5.728  -8.590  1.00 76.06  ? 255  DA  J P     1 
ATOM   5196  O OP1   . DA  B 1 109 ? -25.378 -7.052  -8.072  1.00 72.85  ? 255  DA  J OP1   1 
ATOM   5197  O OP2   . DA  B 1 109 ? -23.799 -4.978  -7.867  1.00 72.85  ? 255  DA  J OP2   1 
ATOM   5198  O "O5'" . DA  B 1 109 ? -24.486 -5.907  -10.126 1.00 76.06  ? 255  DA  J "O5'" 1 
ATOM   5199  C "C5'" . DA  B 1 109 ? -25.348 -5.399  -11.163 1.00 76.06  ? 255  DA  J "C5'" 1 
ATOM   5200  C "C4'" . DA  B 1 109 ? -24.746 -4.178  -11.848 1.00 76.06  ? 255  DA  J "C4'" 1 
ATOM   5201  O "O4'" . DA  B 1 109 ? -25.000 -2.900  -11.208 1.00 76.06  ? 255  DA  J "O4'" 1 
ATOM   5202  C "C3'" . DA  B 1 109 ? -23.252 -4.196  -12.114 1.00 76.06  ? 255  DA  J "C3'" 1 
ATOM   5203  O "O3'" . DA  B 1 109 ? -23.042 -3.702  -13.413 1.00 76.06  ? 255  DA  J "O3'" 1 
ATOM   5204  C "C2'" . DA  B 1 109 ? -22.685 -3.204  -11.116 1.00 76.06  ? 255  DA  J "C2'" 1 
ATOM   5205  C "C1'" . DA  B 1 109 ? -23.792 -2.193  -11.008 1.00 76.06  ? 255  DA  J "C1'" 1 
ATOM   5206  N N9    . DA  B 1 109 ? -23.882 -1.604  -9.693  1.00 72.85  ? 255  DA  J N9    1 
ATOM   5207  C C8    . DA  B 1 109 ? -23.789 -2.228  -8.480  1.00 72.85  ? 255  DA  J C8    1 
ATOM   5208  N N7    . DA  B 1 109 ? -23.978 -1.423  -7.458  1.00 72.85  ? 255  DA  J N7    1 
ATOM   5209  C C5    . DA  B 1 109 ? -24.209 -0.182  -8.046  1.00 72.85  ? 255  DA  J C5    1 
ATOM   5210  C C6    . DA  B 1 109 ? -24.504 1.121   -7.516  1.00 72.85  ? 255  DA  J C6    1 
ATOM   5211  N N6    . DA  B 1 109 ? -24.711 1.404   -6.238  1.00 72.85  ? 255  DA  J N6    1 
ATOM   5212  N N1    . DA  B 1 109 ? -24.602 2.132   -8.386  1.00 72.85  ? 255  DA  J N1    1 
ATOM   5213  C C2    . DA  B 1 109 ? -24.468 1.864   -9.695  1.00 72.85  ? 255  DA  J C2    1 
ATOM   5214  N N3    . DA  B 1 109 ? -24.246 0.701   -10.313 1.00 72.85  ? 255  DA  J N3    1 
ATOM   5215  C C4    . DA  B 1 109 ? -24.121 -0.286  -9.425  1.00 72.85  ? 255  DA  J C4    1 
ATOM   5216  P P     . DA  B 1 110 ? -21.562 -3.628  -13.975 1.00 73.31  ? 256  DA  J P     1 
ATOM   5217  O OP1   . DA  B 1 110 ? -21.690 -4.238  -15.324 1.00 79.25  ? 256  DA  J OP1   1 
ATOM   5218  O OP2   . DA  B 1 110 ? -20.649 -4.223  -12.976 1.00 79.25  ? 256  DA  J OP2   1 
ATOM   5219  O "O5'" . DA  B 1 110 ? -21.247 -2.062  -13.987 1.00 73.31  ? 256  DA  J "O5'" 1 
ATOM   5220  C "C5'" . DA  B 1 110 ? -22.182 -1.126  -14.522 1.00 73.31  ? 256  DA  J "C5'" 1 
ATOM   5221  C "C4'" . DA  B 1 110 ? -21.680 0.274   -14.295 1.00 73.31  ? 256  DA  J "C4'" 1 
ATOM   5222  O "O4'" . DA  B 1 110 ? -21.947 0.686   -12.943 1.00 73.31  ? 256  DA  J "O4'" 1 
ATOM   5223  C "C3'" . DA  B 1 110 ? -20.173 0.468   -14.500 1.00 73.31  ? 256  DA  J "C3'" 1 
ATOM   5224  O "O3'" . DA  B 1 110 ? -19.981 1.810   -14.936 1.00 73.31  ? 256  DA  J "O3'" 1 
ATOM   5225  C "C2'" . DA  B 1 110 ? -19.631 0.360   -13.094 1.00 73.31  ? 256  DA  J "C2'" 1 
ATOM   5226  C "C1'" . DA  B 1 110 ? -20.725 1.064   -12.324 1.00 73.31  ? 256  DA  J "C1'" 1 
ATOM   5227  N N9    . DA  B 1 110 ? -20.819 0.688   -10.925 1.00 79.25  ? 256  DA  J N9    1 
ATOM   5228  C C8    . DA  B 1 110 ? -20.717 -0.547  -10.346 1.00 79.25  ? 256  DA  J C8    1 
ATOM   5229  N N7    . DA  B 1 110 ? -20.922 -0.543  -9.051  1.00 79.25  ? 256  DA  J N7    1 
ATOM   5230  C C5    . DA  B 1 110 ? -21.163 0.786   -8.768  1.00 79.25  ? 256  DA  J C5    1 
ATOM   5231  C C6    . DA  B 1 110 ? -21.481 1.447   -7.586  1.00 79.25  ? 256  DA  J C6    1 
ATOM   5232  N N6    . DA  B 1 110 ? -21.629 0.831   -6.417  1.00 79.25  ? 256  DA  J N6    1 
ATOM   5233  N N1    . DA  B 1 110 ? -21.661 2.788   -7.647  1.00 79.25  ? 256  DA  J N1    1 
ATOM   5234  C C2    . DA  B 1 110 ? -21.532 3.399   -8.835  1.00 79.25  ? 256  DA  J C2    1 
ATOM   5235  N N3    . DA  B 1 110 ? -21.246 2.875   -10.015 1.00 79.25  ? 256  DA  J N3    1 
ATOM   5236  C C4    . DA  B 1 110 ? -21.078 1.554   -9.911  1.00 79.25  ? 256  DA  J C4    1 
ATOM   5237  P P     . DA  B 1 111 ? -18.551 2.296   -15.482 1.00 60.07  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 111 ? -18.718 2.296   -16.985 1.00 54.17  ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 111 ? -17.465 1.553   -14.813 1.00 54.17  ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 111 ? -18.482 3.790   -14.951 1.00 60.07  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 111 ? -19.694 4.544   -14.918 1.00 60.07  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 111 ? -19.474 5.829   -14.170 1.00 60.07  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 111 ? -19.736 5.637   -12.771 1.00 60.07  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 111 ? -18.041 6.298   -14.290 1.00 60.07  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 111 ? -18.005 7.690   -14.336 1.00 60.07  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 111 ? -17.413 5.828   -13.010 1.00 60.07  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 111 ? -18.566 5.804   -12.018 1.00 60.07  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 111 ? -18.452 4.636   -11.147 1.00 54.17  ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 111 ? -18.068 3.373   -11.552 1.00 54.17  ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 111 ? -17.982 2.500   -10.579 1.00 54.17  ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 111 ? -18.369 3.216   -9.456  1.00 54.17  ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 111 ? -18.489 2.844   -8.105  1.00 54.17  ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 111 ? -18.320 1.580   -7.685  1.00 54.17  ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 111 ? -18.817 3.811   -7.205  1.00 54.17  ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 111 ? -19.062 5.064   -7.667  1.00 54.17  ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 111 ? -19.029 5.528   -8.934  1.00 54.17  ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 111 ? -18.660 4.544   -9.789  1.00 54.17  ? 257  DA  J C4    1 
ATOM   5258  P P     . DT  B 1 112 ? -16.619 8.414   -14.147 1.00 57.47  ? 258  DT  J P     1 
ATOM   5259  O OP1   . DT  B 1 112 ? -16.516 9.647   -14.972 1.00 65.61  ? 258  DT  J OP1   1 
ATOM   5260  O OP2   . DT  B 1 112 ? -15.564 7.391   -14.237 1.00 65.61  ? 258  DT  J OP2   1 
ATOM   5261  O "O5'" . DT  B 1 112 ? -16.814 8.862   -12.657 1.00 57.47  ? 258  DT  J "O5'" 1 
ATOM   5262  C "C5'" . DT  B 1 112 ? -16.239 10.058  -12.246 1.00 57.47  ? 258  DT  J "C5'" 1 
ATOM   5263  C "C4'" . DT  B 1 112 ? -16.833 10.472  -10.942 1.00 57.47  ? 258  DT  J "C4'" 1 
ATOM   5264  O "O4'" . DT  B 1 112 ? -17.131 9.260   -10.224 1.00 57.47  ? 258  DT  J "O4'" 1 
ATOM   5265  C "C3'" . DT  B 1 112 ? -15.750 11.179  -10.159 1.00 57.47  ? 258  DT  J "C3'" 1 
ATOM   5266  O "O3'" . DT  B 1 112 ? -16.244 12.198  -9.317  1.00 57.47  ? 258  DT  J "O3'" 1 
ATOM   5267  C "C2'" . DT  B 1 112 ? -15.146 10.081  -9.332  1.00 57.47  ? 258  DT  J "C2'" 1 
ATOM   5268  C "C1'" . DT  B 1 112 ? -16.333 9.209   -9.056  1.00 57.47  ? 258  DT  J "C1'" 1 
ATOM   5269  N N1    . DT  B 1 112 ? -15.938 7.809   -8.829  1.00 65.61  ? 258  DT  J N1    1 
ATOM   5270  C C2    . DT  B 1 112 ? -15.707 7.366   -7.520  1.00 65.61  ? 258  DT  J C2    1 
ATOM   5271  O O2    . DT  B 1 112 ? -15.667 8.115   -6.542  1.00 65.61  ? 258  DT  J O2    1 
ATOM   5272  N N3    . DT  B 1 112 ? -15.463 6.025   -7.407  1.00 65.61  ? 258  DT  J N3    1 
ATOM   5273  C C4    . DT  B 1 112 ? -15.341 5.116   -8.424  1.00 65.61  ? 258  DT  J C4    1 
ATOM   5274  O O4    . DT  B 1 112 ? -15.140 3.940   -8.154  1.00 65.61  ? 258  DT  J O4    1 
ATOM   5275  C C5    . DT  B 1 112 ? -15.487 5.670   -9.789  1.00 65.61  ? 258  DT  J C5    1 
ATOM   5276  C C7    . DT  B 1 112 ? -15.265 4.778   -10.981 1.00 65.61  ? 258  DT  J C7    1 
ATOM   5277  C C6    . DT  B 1 112 ? -15.804 6.970   -9.906  1.00 65.61  ? 258  DT  J C6    1 
ATOM   5278  P P     . DA  B 1 113 ? -15.294 13.446  -9.011  1.00 97.90  ? 259  DA  J P     1 
ATOM   5279  O OP1   . DA  B 1 113 ? -16.233 14.543  -8.570  1.00 79.46  ? 259  DA  J OP1   1 
ATOM   5280  O OP2   . DA  B 1 113 ? -14.397 13.661  -10.189 1.00 79.46  ? 259  DA  J OP2   1 
ATOM   5281  O "O5'" . DA  B 1 113 ? -14.419 12.860  -7.817  1.00 97.90  ? 259  DA  J "O5'" 1 
ATOM   5282  C "C5'" . DA  B 1 113 ? -15.094 12.267  -6.702  1.00 97.90  ? 259  DA  J "C5'" 1 
ATOM   5283  C "C4'" . DA  B 1 113 ? -14.104 11.912  -5.622  1.00 97.90  ? 259  DA  J "C4'" 1 
ATOM   5284  O "O4'" . DA  B 1 113 ? -13.921 10.477  -5.568  1.00 97.90  ? 259  DA  J "O4'" 1 
ATOM   5285  C "C3'" . DA  B 1 113 ? -12.721 12.532  -5.860  1.00 97.90  ? 259  DA  J "C3'" 1 
ATOM   5286  O "O3'" . DA  B 1 113 ? -12.112 12.885  -4.594  1.00 97.90  ? 259  DA  J "O3'" 1 
ATOM   5287  C "C2'" . DA  B 1 113 ? -11.971 11.379  -6.488  1.00 97.90  ? 259  DA  J "C2'" 1 
ATOM   5288  C "C1'" . DA  B 1 113 ? -12.533 10.211  -5.681  1.00 97.90  ? 259  DA  J "C1'" 1 
ATOM   5289  N N9    . DA  B 1 113 ? -12.358 8.903   -6.313  1.00 79.46  ? 259  DA  J N9    1 
ATOM   5290  C C8    . DA  B 1 113 ? -12.499 8.667   -7.651  1.00 79.46  ? 259  DA  J C8    1 
ATOM   5291  N N7    . DA  B 1 113 ? -12.313 7.412   -7.993  1.00 79.46  ? 259  DA  J N7    1 
ATOM   5292  C C5    . DA  B 1 113 ? -12.021 6.777   -6.797  1.00 79.46  ? 259  DA  J C5    1 
ATOM   5293  C C6    . DA  B 1 113 ? -11.735 5.453   -6.502  1.00 79.46  ? 259  DA  J C6    1 
ATOM   5294  N N6    . DA  B 1 113 ? -11.680 4.506   -7.438  1.00 79.46  ? 259  DA  J N6    1 
ATOM   5295  N N1    . DA  B 1 113 ? -11.495 5.131   -5.217  1.00 79.46  ? 259  DA  J N1    1 
ATOM   5296  C C2    . DA  B 1 113 ? -11.508 6.098   -4.306  1.00 79.46  ? 259  DA  J C2    1 
ATOM   5297  N N3    . DA  B 1 113 ? -11.751 7.391   -4.460  1.00 79.46  ? 259  DA  J N3    1 
ATOM   5298  C C4    . DA  B 1 113 ? -12.024 7.679   -5.748  1.00 79.46  ? 259  DA  J C4    1 
ATOM   5299  P P     . DC  B 1 114 ? -11.177 14.207  -4.457  1.00 110.96 ? 260  DC  J P     1 
ATOM   5300  O OP1   . DC  B 1 114 ? -11.993 15.259  -3.759  1.00 108.55 ? 260  DC  J OP1   1 
ATOM   5301  O OP2   . DC  B 1 114 ? -10.474 14.548  -5.733  1.00 108.55 ? 260  DC  J OP2   1 
ATOM   5302  O "O5'" . DC  B 1 114 ? -10.111 13.670  -3.412  1.00 110.96 ? 260  DC  J "O5'" 1 
ATOM   5303  C "C5'" . DC  B 1 114 ? -10.551 12.858  -2.323  1.00 110.96 ? 260  DC  J "C5'" 1 
ATOM   5304  C "C4'" . DC  B 1 114 ? -9.515  11.812  -1.969  1.00 110.96 ? 260  DC  J "C4'" 1 
ATOM   5305  O "O4'" . DC  B 1 114 ? -9.653  10.635  -2.814  1.00 110.96 ? 260  DC  J "O4'" 1 
ATOM   5306  C "C3'" . DC  B 1 114 ? -8.059  12.282  -2.089  1.00 110.96 ? 260  DC  J "C3'" 1 
ATOM   5307  O "O3'" . DC  B 1 114 ? -7.261  11.931  -0.939  1.00 110.96 ? 260  DC  J "O3'" 1 
ATOM   5308  C "C2'" . DC  B 1 114 ? -7.570  11.563  -3.333  1.00 110.96 ? 260  DC  J "C2'" 1 
ATOM   5309  C "C1'" . DC  B 1 114 ? -8.376  10.278  -3.316  1.00 110.96 ? 260  DC  J "C1'" 1 
ATOM   5310  N N1    . DC  B 1 114 ? -8.541  9.665   -4.645  1.00 108.55 ? 260  DC  J N1    1 
ATOM   5311  C C2    . DC  B 1 114 ? -8.528  8.271   -4.745  1.00 108.55 ? 260  DC  J C2    1 
ATOM   5312  O O2    . DC  B 1 114 ? -8.383  7.603   -3.728  1.00 108.55 ? 260  DC  J O2    1 
ATOM   5313  N N3    . DC  B 1 114 ? -8.677  7.687   -5.946  1.00 108.55 ? 260  DC  J N3    1 
ATOM   5314  C C4    . DC  B 1 114 ? -8.847  8.434   -7.028  1.00 108.55 ? 260  DC  J C4    1 
ATOM   5315  N N4    . DC  B 1 114 ? -9.032  7.799   -8.183  1.00 108.55 ? 260  DC  J N4    1 
ATOM   5316  C C5    . DC  B 1 114 ? -8.848  9.866   -6.970  1.00 108.55 ? 260  DC  J C5    1 
ATOM   5317  C C6    . DC  B 1 114 ? -8.696  10.434  -5.767  1.00 108.55 ? 260  DC  J C6    1 
ATOM   5318  P P     . DA  B 1 115 ? -5.640  11.938  -1.052  1.00 97.57  ? 261  DA  J P     1 
ATOM   5319  O OP1   . DA  B 1 115 ? -5.065  12.531  0.172   1.00 99.91  ? 261  DA  J OP1   1 
ATOM   5320  O OP2   . DA  B 1 115 ? -5.225  12.492  -2.363  1.00 99.91  ? 261  DA  J OP2   1 
ATOM   5321  O "O5'" . DA  B 1 115 ? -5.272  10.383  -1.076  1.00 97.57  ? 261  DA  J "O5'" 1 
ATOM   5322  C "C5'" . DA  B 1 115 ? -5.858  9.456   -0.144  1.00 97.57  ? 261  DA  J "C5'" 1 
ATOM   5323  C "C4'" . DA  B 1 115 ? -5.001  8.212   -0.080  1.00 97.57  ? 261  DA  J "C4'" 1 
ATOM   5324  O "O4'" . DA  B 1 115 ? -5.173  7.417   -1.280  1.00 97.57  ? 261  DA  J "O4'" 1 
ATOM   5325  C "C3'" . DA  B 1 115 ? -3.519  8.585   -0.060  1.00 97.57  ? 261  DA  J "C3'" 1 
ATOM   5326  O "O3'" . DA  B 1 115 ? -2.748  7.569   0.606   1.00 97.57  ? 261  DA  J "O3'" 1 
ATOM   5327  C "C2'" . DA  B 1 115 ? -3.178  8.669   -1.539  1.00 97.57  ? 261  DA  J "C2'" 1 
ATOM   5328  C "C1'" . DA  B 1 115 ? -3.982  7.498   -2.092  1.00 97.57  ? 261  DA  J "C1'" 1 
ATOM   5329  N N9    . DA  B 1 115 ? -4.374  7.622   -3.505  1.00 99.91  ? 261  DA  J N9    1 
ATOM   5330  C C8    . DA  B 1 115 ? -4.670  8.778   -4.188  1.00 99.91  ? 261  DA  J C8    1 
ATOM   5331  N N7    . DA  B 1 115 ? -5.067  8.581   -5.420  1.00 99.91  ? 261  DA  J N7    1 
ATOM   5332  C C5    . DA  B 1 115 ? -5.009  7.206   -5.571  1.00 99.91  ? 261  DA  J C5    1 
ATOM   5333  C C6    . DA  B 1 115 ? -5.309  6.365   -6.660  1.00 99.91  ? 261  DA  J C6    1 
ATOM   5334  N N6    . DA  B 1 115 ? -5.776  6.819   -7.837  1.00 99.91  ? 261  DA  J N6    1 
ATOM   5335  N N1    . DA  B 1 115 ? -5.113  5.026   -6.495  1.00 99.91  ? 261  DA  J N1    1 
ATOM   5336  C C2    . DA  B 1 115 ? -4.652  4.584   -5.309  1.00 99.91  ? 261  DA  J C2    1 
ATOM   5337  N N3    . DA  B 1 115 ? -4.351  5.279   -4.213  1.00 99.91  ? 261  DA  J N3    1 
ATOM   5338  C C4    . DA  B 1 115 ? -4.556  6.599   -4.410  1.00 99.91  ? 261  DA  J C4    1 
ATOM   5339  P P     . DC  B 1 116 ? -1.455  7.987   1.453   1.00 112.81 ? 262  DC  J P     1 
ATOM   5340  O OP1   . DC  B 1 116 ? -1.560  7.196   2.708   1.00 129.82 ? 262  DC  J OP1   1 
ATOM   5341  O OP2   . DC  B 1 116 ? -1.366  9.482   1.484   1.00 129.82 ? 262  DC  J OP2   1 
ATOM   5342  O "O5'" . DC  B 1 116 ? -0.199  7.487   0.622   1.00 112.81 ? 262  DC  J "O5'" 1 
ATOM   5343  C "C5'" . DC  B 1 116 ? -0.346  7.199   -0.736  1.00 112.81 ? 262  DC  J "C5'" 1 
ATOM   5344  C "C4'" . DC  B 1 116 ? -0.122  5.729   -0.963  1.00 112.81 ? 262  DC  J "C4'" 1 
ATOM   5345  O "O4'" . DC  B 1 116 ? -0.926  5.315   -2.082  1.00 112.81 ? 262  DC  J "O4'" 1 
ATOM   5346  C "C3'" . DC  B 1 116 ? 1.314   5.441   -1.349  1.00 112.81 ? 262  DC  J "C3'" 1 
ATOM   5347  O "O3'" . DC  B 1 116 ? 1.687   4.135   -0.971  1.00 112.81 ? 262  DC  J "O3'" 1 
ATOM   5348  C "C2'" . DC  B 1 116 ? 1.303   5.551   -2.860  1.00 112.81 ? 262  DC  J "C2'" 1 
ATOM   5349  C "C1'" . DC  B 1 116 ? -0.125  5.164   -3.248  1.00 112.81 ? 262  DC  J "C1'" 1 
ATOM   5350  N N1    . DC  B 1 116 ? -0.690  6.043   -4.289  1.00 129.82 ? 262  DC  J N1    1 
ATOM   5351  C C2    . DC  B 1 116 ? -0.997  5.496   -5.512  1.00 129.82 ? 262  DC  J C2    1 
ATOM   5352  O O2    . DC  B 1 116 ? -0.886  4.262   -5.649  1.00 129.82 ? 262  DC  J O2    1 
ATOM   5353  N N3    . DC  B 1 116 ? -1.419  6.316   -6.512  1.00 129.82 ? 262  DC  J N3    1 
ATOM   5354  C C4    . DC  B 1 116 ? -1.561  7.630   -6.289  1.00 129.82 ? 262  DC  J C4    1 
ATOM   5355  N N4    . DC  B 1 116 ? -1.937  8.411   -7.297  1.00 129.82 ? 262  DC  J N4    1 
ATOM   5356  C C5    . DC  B 1 116 ? -1.312  8.201   -5.023  1.00 129.82 ? 262  DC  J C5    1 
ATOM   5357  C C6    . DC  B 1 116 ? -0.878  7.383   -4.059  1.00 129.82 ? 262  DC  J C6    1 
ATOM   5358  P P     . DT  B 1 117 ? 3.170   3.655   -1.274  1.00 92.57  ? 263  DT  J P     1 
ATOM   5359  O OP1   . DT  B 1 117 ? 3.547   2.660   -0.190  1.00 57.68  ? 263  DT  J OP1   1 
ATOM   5360  O OP2   . DT  B 1 117 ? 3.964   4.924   -1.518  1.00 57.68  ? 263  DT  J OP2   1 
ATOM   5361  O "O5'" . DT  B 1 117 ? 3.074   2.925   -2.681  1.00 92.57  ? 263  DT  J "O5'" 1 
ATOM   5362  C "C5'" . DT  B 1 117 ? 2.361   1.700   -2.824  1.00 92.57  ? 263  DT  J "C5'" 1 
ATOM   5363  C "C4'" . DT  B 1 117 ? 2.637   1.109   -4.188  1.00 92.57  ? 263  DT  J "C4'" 1 
ATOM   5364  O "O4'" . DT  B 1 117 ? 2.001   1.870   -5.251  1.00 92.57  ? 263  DT  J "O4'" 1 
ATOM   5365  C "C3'" . DT  B 1 117 ? 4.125   1.105   -4.501  1.00 92.57  ? 263  DT  J "C3'" 1 
ATOM   5366  O "O3'" . DT  B 1 117 ? 4.427   -0.105  -5.182  1.00 92.57  ? 263  DT  J "O3'" 1 
ATOM   5367  C "C2'" . DT  B 1 117 ? 4.304   2.332   -5.374  1.00 92.57  ? 263  DT  J "C2'" 1 
ATOM   5368  C "C1'" . DT  B 1 117 ? 3.004   2.333   -6.157  1.00 92.57  ? 263  DT  J "C1'" 1 
ATOM   5369  N N1    . DT  B 1 117 ? 2.594   3.669   -6.711  1.00 57.68  ? 263  DT  J N1    1 
ATOM   5370  C C2    . DT  B 1 117 ? 2.230   3.769   -8.095  1.00 57.68  ? 263  DT  J C2    1 
ATOM   5371  O O2    . DT  B 1 117 ? 2.258   2.819   -8.910  1.00 57.68  ? 263  DT  J O2    1 
ATOM   5372  N N3    . DT  B 1 117 ? 1.830   5.036   -8.486  1.00 57.68  ? 263  DT  J N3    1 
ATOM   5373  C C4    . DT  B 1 117 ? 1.737   6.172   -7.692  1.00 57.68  ? 263  DT  J C4    1 
ATOM   5374  O O4    . DT  B 1 117 ? 1.263   7.203   -8.159  1.00 57.68  ? 263  DT  J O4    1 
ATOM   5375  C C5    . DT  B 1 117 ? 2.183   6.028   -6.310  1.00 57.68  ? 263  DT  J C5    1 
ATOM   5376  C C7    . DT  B 1 117 ? 2.190   7.245   -5.432  1.00 57.68  ? 263  DT  J C7    1 
ATOM   5377  C C6    . DT  B 1 117 ? 2.574   4.800   -5.887  1.00 57.68  ? 263  DT  J C6    1 
ATOM   5378  P P     . DT  B 1 118 ? 5.826   -0.265  -5.956  1.00 81.28  ? 264  DT  J P     1 
ATOM   5379  O OP1   . DT  B 1 118 ? 6.185   -1.713  -5.782  1.00 63.62  ? 264  DT  J OP1   1 
ATOM   5380  O OP2   . DT  B 1 118 ? 6.808   0.851   -5.598  1.00 63.62  ? 264  DT  J OP2   1 
ATOM   5381  O "O5'" . DT  B 1 118 ? 5.423   -0.057  -7.482  1.00 81.28  ? 264  DT  J "O5'" 1 
ATOM   5382  C "C5'" . DT  B 1 118 ? 4.329   -0.771  -8.039  1.00 81.28  ? 264  DT  J "C5'" 1 
ATOM   5383  C "C4'" . DT  B 1 118 ? 4.255   -0.483  -9.513  1.00 81.28  ? 264  DT  J "C4'" 1 
ATOM   5384  O "O4'" . DT  B 1 118 ? 3.895   0.900   -9.696  1.00 81.28  ? 264  DT  J "O4'" 1 
ATOM   5385  C "C3'" . DT  B 1 118 ? 5.594   -0.661  -10.223 1.00 81.28  ? 264  DT  J "C3'" 1 
ATOM   5386  O "O3'" . DT  B 1 118 ? 5.319   -1.092  -11.527 1.00 81.28  ? 264  DT  J "O3'" 1 
ATOM   5387  C "C2'" . DT  B 1 118 ? 6.178   0.737   -10.275 1.00 81.28  ? 264  DT  J "C2'" 1 
ATOM   5388  C "C1'" . DT  B 1 118 ? 4.916   1.565   -10.443 1.00 81.28  ? 264  DT  J "C1'" 1 
ATOM   5389  N N1    . DT  B 1 118 ? 4.950   2.989   -10.007 1.00 63.62  ? 264  DT  J N1    1 
ATOM   5390  C C2    . DT  B 1 118 ? 4.392   3.902   -10.866 1.00 63.62  ? 264  DT  J C2    1 
ATOM   5391  O O2    . DT  B 1 118 ? 3.995   3.608   -11.983 1.00 63.62  ? 264  DT  J O2    1 
ATOM   5392  N N3    . DT  B 1 118 ? 4.340   5.186   -10.393 1.00 63.62  ? 264  DT  J N3    1 
ATOM   5393  C C4    . DT  B 1 118 ? 4.829   5.656   -9.215  1.00 63.62  ? 264  DT  J C4    1 
ATOM   5394  O O4    . DT  B 1 118 ? 4.719   6.839   -8.947  1.00 63.62  ? 264  DT  J O4    1 
ATOM   5395  C C5    . DT  B 1 118 ? 5.461   4.671   -8.377  1.00 63.62  ? 264  DT  J C5    1 
ATOM   5396  C C7    . DT  B 1 118 ? 6.066   5.123   -7.085  1.00 63.62  ? 264  DT  J C7    1 
ATOM   5397  C C6    . DT  B 1 118 ? 5.482   3.392   -8.800  1.00 63.62  ? 264  DT  J C6    1 
ATOM   5398  P P     . DT  B 1 119 ? 6.307   -2.111  -12.236 1.00 83.12  ? 265  DT  J P     1 
ATOM   5399  O OP1   . DT  B 1 119 ? 6.128   -3.456  -11.610 1.00 82.73  ? 265  DT  J OP1   1 
ATOM   5400  O OP2   . DT  B 1 119 ? 7.649   -1.451  -12.292 1.00 82.73  ? 265  DT  J OP2   1 
ATOM   5401  O "O5'" . DT  B 1 119 ? 5.773   -2.159  -13.728 1.00 83.12  ? 265  DT  J "O5'" 1 
ATOM   5402  C "C5'" . DT  B 1 119 ? 4.509   -1.603  -14.056 1.00 83.12  ? 265  DT  J "C5'" 1 
ATOM   5403  C "C4'" . DT  B 1 119 ? 4.656   -0.463  -15.042 1.00 83.12  ? 265  DT  J "C4'" 1 
ATOM   5404  O "O4'" . DT  B 1 119 ? 4.872   0.834   -14.435 1.00 83.12  ? 265  DT  J "O4'" 1 
ATOM   5405  C "C3'" . DT  B 1 119 ? 5.716   -0.605  -16.134 1.00 83.12  ? 265  DT  J "C3'" 1 
ATOM   5406  O "O3'" . DT  B 1 119 ? 5.089   -0.270  -17.365 1.00 83.12  ? 265  DT  J "O3'" 1 
ATOM   5407  C "C2'" . DT  B 1 119 ? 6.735   0.469   -15.773 1.00 83.12  ? 265  DT  J "C2'" 1 
ATOM   5408  C "C1'" . DT  B 1 119 ? 5.800   1.530   -15.253 1.00 83.12  ? 265  DT  J "C1'" 1 
ATOM   5409  N N1    . DT  B 1 119 ? 6.328   2.713   -14.512 1.00 82.73  ? 265  DT  J N1    1 
ATOM   5410  C C2    . DT  B 1 119 ? 6.200   3.945   -15.127 1.00 82.73  ? 265  DT  J C2    1 
ATOM   5411  O O2    . DT  B 1 119 ? 5.809   4.082   -16.258 1.00 82.73  ? 265  DT  J O2    1 
ATOM   5412  N N3    . DT  B 1 119 ? 6.549   5.020   -14.380 1.00 82.73  ? 265  DT  J N3    1 
ATOM   5413  C C4    . DT  B 1 119 ? 7.024   5.024   -13.112 1.00 82.73  ? 265  DT  J C4    1 
ATOM   5414  O O4    . DT  B 1 119 ? 7.265   6.112   -12.585 1.00 82.73  ? 265  DT  J O4    1 
ATOM   5415  C C5    . DT  B 1 119 ? 7.189   3.683   -12.511 1.00 82.73  ? 265  DT  J C5    1 
ATOM   5416  C C7    . DT  B 1 119 ? 7.680   3.547   -11.107 1.00 82.73  ? 265  DT  J C7    1 
ATOM   5417  C C6    . DT  B 1 119 ? 6.862   2.615   -13.252 1.00 82.73  ? 265  DT  J C6    1 
ATOM   5418  P P     . DT  B 1 120 ? 5.637   -0.871  -18.724 1.00 76.47  ? 266  DT  J P     1 
ATOM   5419  O OP1   . DT  B 1 120 ? 4.924   -2.127  -19.066 1.00 74.58  ? 266  DT  J OP1   1 
ATOM   5420  O OP2   . DT  B 1 120 ? 7.129   -0.828  -18.674 1.00 74.58  ? 266  DT  J OP2   1 
ATOM   5421  O "O5'" . DT  B 1 120 ? 5.158   0.224   -19.745 1.00 76.47  ? 266  DT  J "O5'" 1 
ATOM   5422  C "C5'" . DT  B 1 120 ? 4.119   1.116   -19.409 1.00 76.47  ? 266  DT  J "C5'" 1 
ATOM   5423  C "C4'" . DT  B 1 120 ? 4.457   2.495   -19.925 1.00 76.47  ? 266  DT  J "C4'" 1 
ATOM   5424  O "O4'" . DT  B 1 120 ? 5.159   3.303   -18.947 1.00 76.47  ? 266  DT  J "O4'" 1 
ATOM   5425  C "C3'" . DT  B 1 120 ? 5.307   2.540   -21.201 1.00 76.47  ? 266  DT  J "C3'" 1 
ATOM   5426  O "O3'" . DT  B 1 120 ? 4.826   3.568   -22.028 1.00 76.47  ? 266  DT  J "O3'" 1 
ATOM   5427  C "C2'" . DT  B 1 120 ? 6.638   3.080   -20.719 1.00 76.47  ? 266  DT  J "C2'" 1 
ATOM   5428  C "C1'" . DT  B 1 120 ? 6.194   4.020   -19.609 1.00 76.47  ? 266  DT  J "C1'" 1 
ATOM   5429  N N1    . DT  B 1 120 ? 7.267   4.318   -18.625 1.00 74.58  ? 266  DT  J N1    1 
ATOM   5430  C C2    . DT  B 1 120 ? 7.452   5.606   -18.109 1.00 74.58  ? 266  DT  J C2    1 
ATOM   5431  O O2    . DT  B 1 120 ? 6.861   6.571   -18.472 1.00 74.58  ? 266  DT  J O2    1 
ATOM   5432  N N3    . DT  B 1 120 ? 8.405   5.720   -17.164 1.00 74.58  ? 266  DT  J N3    1 
ATOM   5433  C C4    . DT  B 1 120 ? 9.241   4.736   -16.696 1.00 74.58  ? 266  DT  J C4    1 
ATOM   5434  O O4    . DT  B 1 120 ? 10.039  5.029   -15.780 1.00 74.58  ? 266  DT  J O4    1 
ATOM   5435  C C5    . DT  B 1 120 ? 9.065   3.402   -17.354 1.00 74.58  ? 266  DT  J C5    1 
ATOM   5436  C C7    . DT  B 1 120 ? 9.977   2.258   -17.040 1.00 74.58  ? 266  DT  J C7    1 
ATOM   5437  C C6    . DT  B 1 120 ? 8.083   3.280   -18.242 1.00 74.58  ? 266  DT  J C6    1 
ATOM   5438  P P     . DG  B 1 121 ? 4.334   3.243   -23.508 1.00 52.17  ? 267  DG  J P     1 
ATOM   5439  O OP1   . DG  B 1 121 ? 3.032   2.451   -23.458 1.00 91.50  ? 267  DG  J OP1   1 
ATOM   5440  O OP2   . DG  B 1 121 ? 5.554   2.704   -24.203 1.00 91.50  ? 267  DG  J OP2   1 
ATOM   5441  O "O5'" . DG  B 1 121 ? 4.098   4.710   -24.113 1.00 52.17  ? 267  DG  J "O5'" 1 
ATOM   5442  C "C5'" . DG  B 1 121 ? 3.617   5.783   -23.318 1.00 52.17  ? 267  DG  J "C5'" 1 
ATOM   5443  C "C4'" . DG  B 1 121 ? 4.506   6.989   -23.494 1.00 52.17  ? 267  DG  J "C4'" 1 
ATOM   5444  O "O4'" . DG  B 1 121 ? 5.715   6.835   -22.744 1.00 52.17  ? 267  DG  J "O4'" 1 
ATOM   5445  C "C3'" . DG  B 1 121 ? 4.943   7.197   -24.918 1.00 52.17  ? 267  DG  J "C3'" 1 
ATOM   5446  O "O3'" . DG  B 1 121 ? 5.145   8.570   -25.108 1.00 52.17  ? 267  DG  J "O3'" 1 
ATOM   5447  C "C2'" . DG  B 1 121 ? 6.289   6.524   -24.957 1.00 52.17  ? 267  DG  J "C2'" 1 
ATOM   5448  C "C1'" . DG  B 1 121 ? 6.838   6.828   -23.595 1.00 52.17  ? 267  DG  J "C1'" 1 
ATOM   5449  N N9    . DG  B 1 121 ? 7.798   5.819   -23.121 1.00 91.50  ? 267  DG  J N9    1 
ATOM   5450  C C8    . DG  B 1 121 ? 8.017   4.564   -23.667 1.00 91.50  ? 267  DG  J C8    1 
ATOM   5451  N N7    . DG  B 1 121 ? 8.983   3.898   -23.079 1.00 91.50  ? 267  DG  J N7    1 
ATOM   5452  C C5    . DG  B 1 121 ? 9.416   4.744   -22.076 1.00 91.50  ? 267  DG  J C5    1 
ATOM   5453  C C6    . DG  B 1 121 ? 10.413  4.553   -21.114 1.00 91.50  ? 267  DG  J C6    1 
ATOM   5454  O O6    . DG  B 1 121 ? 11.166  3.565   -20.983 1.00 91.50  ? 267  DG  J O6    1 
ATOM   5455  N N1    . DG  B 1 121 ? 10.498  5.652   -20.249 1.00 91.50  ? 267  DG  J N1    1 
ATOM   5456  C C2    . DG  B 1 121 ? 9.710   6.795   -20.342 1.00 91.50  ? 267  DG  J C2    1 
ATOM   5457  N N2    . DG  B 1 121 ? 9.887   7.743   -19.445 1.00 91.50  ? 267  DG  J N2    1 
ATOM   5458  N N3    . DG  B 1 121 ? 8.798   6.986   -21.262 1.00 91.50  ? 267  DG  J N3    1 
ATOM   5459  C C4    . DG  B 1 121 ? 8.690   5.934   -22.079 1.00 91.50  ? 267  DG  J C4    1 
ATOM   5460  P P     . DG  B 1 122 ? 4.522   9.315   -26.406 1.00 30.75  ? 268  DG  J P     1 
ATOM   5461  O OP1   . DG  B 1 122 ? 3.053   9.143   -26.388 1.00 98.94  ? 268  DG  J OP1   1 
ATOM   5462  O OP2   . DG  B 1 122 ? 5.320   8.954   -27.614 1.00 98.94  ? 268  DG  J OP2   1 
ATOM   5463  O "O5'" . DG  B 1 122 ? 4.705   10.811  -25.977 1.00 30.75  ? 268  DG  J "O5'" 1 
ATOM   5464  C "C5'" . DG  B 1 122 ? 5.871   11.463  -26.381 1.00 30.75  ? 268  DG  J "C5'" 1 
ATOM   5465  C "C4'" . DG  B 1 122 ? 6.528   12.233  -25.254 1.00 30.75  ? 268  DG  J "C4'" 1 
ATOM   5466  O "O4'" . DG  B 1 122 ? 7.044   11.328  -24.264 1.00 30.75  ? 268  DG  J "O4'" 1 
ATOM   5467  C "C3'" . DG  B 1 122 ? 7.746   12.879  -25.907 1.00 30.75  ? 268  DG  J "C3'" 1 
ATOM   5468  O "O3'" . DG  B 1 122 ? 7.849   14.219  -25.698 1.00 30.75  ? 268  DG  J "O3'" 1 
ATOM   5469  C "C2'" . DG  B 1 122 ? 8.958   12.119  -25.447 1.00 30.75  ? 268  DG  J "C2'" 1 
ATOM   5470  C "C1'" . DG  B 1 122 ? 8.467   11.472  -24.180 1.00 30.75  ? 268  DG  J "C1'" 1 
ATOM   5471  N N9    . DG  B 1 122 ? 9.030   10.161  -24.036 1.00 98.94  ? 268  DG  J N9    1 
ATOM   5472  C C8    . DG  B 1 122 ? 8.643   9.001   -24.640 1.00 98.94  ? 268  DG  J C8    1 
ATOM   5473  N N7    . DG  B 1 122 ? 9.353   7.981   -24.275 1.00 98.94  ? 268  DG  J N7    1 
ATOM   5474  C C5    . DG  B 1 122 ? 10.258  8.519   -23.385 1.00 98.94  ? 268  DG  J C5    1 
ATOM   5475  C C6    . DG  B 1 122 ? 11.301  7.910   -22.660 1.00 98.94  ? 268  DG  J C6    1 
ATOM   5476  O O6    . DG  B 1 122 ? 11.639  6.685   -22.631 1.00 98.94  ? 268  DG  J O6    1 
ATOM   5477  N N1    . DG  B 1 122 ? 11.998  8.855   -21.908 1.00 98.94  ? 268  DG  J N1    1 
ATOM   5478  C C2    . DG  B 1 122 ? 11.719  10.202  -21.876 1.00 98.94  ? 268  DG  J C2    1 
ATOM   5479  N N2    . DG  B 1 122 ? 12.527  10.966  -21.153 1.00 98.94  ? 268  DG  J N2    1 
ATOM   5480  N N3    . DG  B 1 122 ? 10.734  10.758  -22.522 1.00 98.94  ? 268  DG  J N3    1 
ATOM   5481  C C4    . DG  B 1 122 ? 10.060  9.865   -23.252 1.00 98.94  ? 268  DG  J C4    1 
ATOM   5482  P P     . DT  B 1 123 ? 8.699   15.035  -26.737 1.00 63.53  ? 269  DT  J P     1 
ATOM   5483  O OP1   . DT  B 1 123 ? 8.144   16.427  -26.779 1.00 75.72  ? 269  DT  J OP1   1 
ATOM   5484  O OP2   . DT  B 1 123 ? 8.855   14.223  -27.964 1.00 75.72  ? 269  DT  J OP2   1 
ATOM   5485  O "O5'" . DT  B 1 123 ? 10.141  14.888  -26.098 1.00 63.53  ? 269  DT  J "O5'" 1 
ATOM   5486  C "C5'" . DT  B 1 123 ? 10.320  14.930  -24.683 1.00 63.53  ? 269  DT  J "C5'" 1 
ATOM   5487  C "C4'" . DT  B 1 123 ? 11.785  15.037  -24.388 1.00 63.53  ? 269  DT  J "C4'" 1 
ATOM   5488  O "O4'" . DT  B 1 123 ? 12.280  13.704  -24.207 1.00 63.53  ? 269  DT  J "O4'" 1 
ATOM   5489  C "C3'" . DT  B 1 123 ? 12.537  15.619  -25.582 1.00 63.53  ? 269  DT  J "C3'" 1 
ATOM   5490  O "O3'" . DT  B 1 123 ? 13.597  16.476  -25.088 1.00 63.53  ? 269  DT  J "O3'" 1 
ATOM   5491  C "C2'" . DT  B 1 123 ? 13.011  14.371  -26.322 1.00 63.53  ? 269  DT  J "C2'" 1 
ATOM   5492  C "C1'" . DT  B 1 123 ? 13.285  13.426  -25.161 1.00 63.53  ? 269  DT  J "C1'" 1 
ATOM   5493  N N1    . DT  B 1 123 ? 13.300  11.947  -25.392 1.00 75.72  ? 269  DT  J N1    1 
ATOM   5494  C C2    . DT  B 1 123 ? 13.948  11.118  -24.453 1.00 75.72  ? 269  DT  J C2    1 
ATOM   5495  O O2    . DT  B 1 123 ? 14.429  11.534  -23.410 1.00 75.72  ? 269  DT  J O2    1 
ATOM   5496  N N3    . DT  B 1 123 ? 13.971  9.768   -24.765 1.00 75.72  ? 269  DT  J N3    1 
ATOM   5497  C C4    . DT  B 1 123 ? 13.373  9.163   -25.840 1.00 75.72  ? 269  DT  J C4    1 
ATOM   5498  O O4    . DT  B 1 123 ? 13.474  7.943   -25.987 1.00 75.72  ? 269  DT  J O4    1 
ATOM   5499  C C5    . DT  B 1 123 ? 12.647  10.077  -26.735 1.00 75.72  ? 269  DT  J C5    1 
ATOM   5500  C C7    . DT  B 1 123 ? 11.858  9.504   -27.872 1.00 75.72  ? 269  DT  J C7    1 
ATOM   5501  C C6    . DT  B 1 123 ? 12.686  11.403  -26.489 1.00 75.72  ? 269  DT  J C6    1 
ATOM   5502  P P     . DA  B 1 124 ? 13.755  18.006  -25.627 1.00 123.38 ? 270  DA  J P     1 
ATOM   5503  O OP1   . DA  B 1 124 ? 12.911  18.934  -24.816 1.00 120.28 ? 270  DA  J OP1   1 
ATOM   5504  O OP2   . DA  B 1 124 ? 13.690  18.041  -27.122 1.00 120.28 ? 270  DA  J OP2   1 
ATOM   5505  O "O5'" . DA  B 1 124 ? 15.235  18.373  -25.208 1.00 123.38 ? 270  DA  J "O5'" 1 
ATOM   5506  C "C5'" . DA  B 1 124 ? 15.656  18.180  -23.869 1.00 123.38 ? 270  DA  J "C5'" 1 
ATOM   5507  C "C4'" . DA  B 1 124 ? 16.956  17.407  -23.838 1.00 123.38 ? 270  DA  J "C4'" 1 
ATOM   5508  O "O4'" . DA  B 1 124 ? 16.771  15.970  -24.027 1.00 123.38 ? 270  DA  J "O4'" 1 
ATOM   5509  C "C3'" . DA  B 1 124 ? 18.000  17.846  -24.873 1.00 123.38 ? 270  DA  J "C3'" 1 
ATOM   5510  O "O3'" . DA  B 1 124 ? 19.265  18.048  -24.216 1.00 123.38 ? 270  DA  J "O3'" 1 
ATOM   5511  C "C2'" . DA  B 1 124 ? 18.042  16.671  -25.848 1.00 123.38 ? 270  DA  J "C2'" 1 
ATOM   5512  C "C1'" . DA  B 1 124 ? 17.779  15.497  -24.914 1.00 123.38 ? 270  DA  J "C1'" 1 
ATOM   5513  N N9    . DA  B 1 124 ? 17.342  14.221  -25.512 1.00 120.28 ? 270  DA  J N9    1 
ATOM   5514  C C8    . DA  B 1 124 ? 16.278  14.001  -26.360 1.00 120.28 ? 270  DA  J C8    1 
ATOM   5515  N N7    . DA  B 1 124 ? 16.115  12.734  -26.703 1.00 120.28 ? 270  DA  J N7    1 
ATOM   5516  C C5    . DA  B 1 124 ? 17.145  12.070  -26.045 1.00 120.28 ? 270  DA  J C5    1 
ATOM   5517  C C6    . DA  B 1 124 ? 17.525  10.693  -25.995 1.00 120.28 ? 270  DA  J C6    1 
ATOM   5518  N N6    . DA  B 1 124 ? 16.871  9.711   -26.639 1.00 120.28 ? 270  DA  J N6    1 
ATOM   5519  N N1    . DA  B 1 124 ? 18.615  10.367  -25.250 1.00 120.28 ? 270  DA  J N1    1 
ATOM   5520  C C2    . DA  B 1 124 ? 19.277  11.351  -24.610 1.00 120.28 ? 270  DA  J C2    1 
ATOM   5521  N N3    . DA  B 1 124 ? 19.020  12.670  -24.578 1.00 120.28 ? 270  DA  J N3    1 
ATOM   5522  C C4    . DA  B 1 124 ? 17.925  12.972  -25.317 1.00 120.28 ? 270  DA  J C4    1 
ATOM   5523  P P     . DG  B 1 125 ? 20.563  18.426  -25.078 1.00 110.36 ? 271  DG  J P     1 
ATOM   5524  O OP1   . DG  B 1 125 ? 21.598  18.939  -24.127 1.00 136.67 ? 271  DG  J OP1   1 
ATOM   5525  O OP2   . DG  B 1 125 ? 20.111  19.294  -26.208 1.00 136.67 ? 271  DG  J OP2   1 
ATOM   5526  O "O5'" . DG  B 1 125 ? 21.037  17.021  -25.688 1.00 110.36 ? 271  DG  J "O5'" 1 
ATOM   5527  C "C5'" . DG  B 1 125 ? 21.700  16.033  -24.881 1.00 110.36 ? 271  DG  J "C5'" 1 
ATOM   5528  C "C4'" . DG  B 1 125 ? 22.418  15.035  -25.764 1.00 110.36 ? 271  DG  J "C4'" 1 
ATOM   5529  O "O4'" . DG  B 1 125 ? 21.566  13.927  -26.177 1.00 110.36 ? 271  DG  J "O4'" 1 
ATOM   5530  C "C3'" . DG  B 1 125 ? 22.985  15.652  -27.052 1.00 110.36 ? 271  DG  J "C3'" 1 
ATOM   5531  O "O3'" . DG  B 1 125 ? 24.349  15.169  -27.282 1.00 110.36 ? 271  DG  J "O3'" 1 
ATOM   5532  C "C2'" . DG  B 1 125 ? 22.002  15.155  -28.105 1.00 110.36 ? 271  DG  J "C2'" 1 
ATOM   5533  C "C1'" . DG  B 1 125 ? 21.681  13.774  -27.578 1.00 110.36 ? 271  DG  J "C1'" 1 
ATOM   5534  N N9    . DG  B 1 125 ? 20.461  13.168  -28.108 1.00 136.67 ? 271  DG  J N9    1 
ATOM   5535  C C8    . DG  B 1 125 ? 19.360  13.802  -28.654 1.00 136.67 ? 271  DG  J C8    1 
ATOM   5536  N N7    . DG  B 1 125 ? 18.468  12.971  -29.135 1.00 136.67 ? 271  DG  J N7    1 
ATOM   5537  C C5    . DG  B 1 125 ? 18.998  11.715  -28.872 1.00 136.67 ? 271  DG  J C5    1 
ATOM   5538  C C6    . DG  B 1 125 ? 18.490  10.432  -29.163 1.00 136.67 ? 271  DG  J C6    1 
ATOM   5539  O O6    . DG  B 1 125 ? 17.437  10.131  -29.726 1.00 136.67 ? 271  DG  J O6    1 
ATOM   5540  N N1    . DG  B 1 125 ? 19.349  9.433   -28.721 1.00 136.67 ? 271  DG  J N1    1 
ATOM   5541  C C2    . DG  B 1 125 ? 20.546  9.642   -28.075 1.00 136.67 ? 271  DG  J C2    1 
ATOM   5542  N N2    . DG  B 1 125 ? 21.235  8.547   -27.738 1.00 136.67 ? 271  DG  J N2    1 
ATOM   5543  N N3    . DG  B 1 125 ? 21.031  10.835  -27.786 1.00 136.67 ? 271  DG  J N3    1 
ATOM   5544  C C4    . DG  B 1 125 ? 20.215  11.820  -28.216 1.00 136.67 ? 271  DG  J C4    1 
ATOM   5545  P P     . DA  B 1 126 ? 25.475  16.085  -28.065 1.00 138.69 ? 272  DA  J P     1 
ATOM   5546  O OP1   . DA  B 1 126 ? 26.001  17.158  -27.166 1.00 160.57 ? 272  DA  J OP1   1 
ATOM   5547  O OP2   . DA  B 1 126 ? 24.983  16.460  -29.416 1.00 160.57 ? 272  DA  J OP2   1 
ATOM   5548  O "O5'" . DA  B 1 126 ? 26.647  15.018  -28.298 1.00 138.69 ? 272  DA  J "O5'" 1 
ATOM   5549  C "C5'" . DA  B 1 126 ? 26.989  14.074  -27.262 1.00 138.69 ? 272  DA  J "C5'" 1 
ATOM   5550  C "C4'" . DA  B 1 126 ? 27.091  12.659  -27.803 1.00 138.69 ? 272  DA  J "C4'" 1 
ATOM   5551  O "O4'" . DA  B 1 126 ? 25.788  12.030  -28.009 1.00 138.69 ? 272  DA  J "O4'" 1 
ATOM   5552  C "C3'" . DA  B 1 126 ? 27.868  12.495  -29.115 1.00 138.69 ? 272  DA  J "C3'" 1 
ATOM   5553  O "O3'" . DA  B 1 126 ? 28.806  11.396  -29.009 1.00 138.69 ? 272  DA  J "O3'" 1 
ATOM   5554  C "C2'" . DA  B 1 126 ? 26.768  12.219  -30.127 1.00 138.69 ? 272  DA  J "C2'" 1 
ATOM   5555  C "C1'" . DA  B 1 126 ? 25.753  11.432  -29.301 1.00 138.69 ? 272  DA  J "C1'" 1 
ATOM   5556  N N9    . DA  B 1 126 ? 24.376  11.484  -29.828 1.00 160.57 ? 272  DA  J N9    1 
ATOM   5557  C C8    . DA  B 1 126 ? 23.669  12.611  -30.180 1.00 160.57 ? 272  DA  J C8    1 
ATOM   5558  N N7    . DA  B 1 126 ? 22.478  12.363  -30.684 1.00 160.57 ? 272  DA  J N7    1 
ATOM   5559  C C5    . DA  B 1 126 ? 22.380  10.979  -30.654 1.00 160.57 ? 272  DA  J C5    1 
ATOM   5560  C C6    . DA  B 1 126 ? 21.348  10.087  -31.055 1.00 160.57 ? 272  DA  J C6    1 
ATOM   5561  N N6    . DA  B 1 126 ? 20.183  10.481  -31.583 1.00 160.57 ? 272  DA  J N6    1 
ATOM   5562  N N1    . DA  B 1 126 ? 21.563  8.763   -30.888 1.00 160.57 ? 272  DA  J N1    1 
ATOM   5563  C C2    . DA  B 1 126 ? 22.734  8.365   -30.349 1.00 160.57 ? 272  DA  J C2    1 
ATOM   5564  N N3    . DA  B 1 126 ? 23.777  9.102   -29.932 1.00 160.57 ? 272  DA  J N3    1 
ATOM   5565  C C4    . DA  B 1 126 ? 23.537  10.417  -30.114 1.00 160.57 ? 272  DA  J C4    1 
ATOM   5566  P P     . DA  B 1 127 ? 29.402  10.693  -30.341 1.00 150.82 ? 273  DA  J P     1 
ATOM   5567  O OP1   . DA  B 1 127 ? 30.659  9.971   -29.995 1.00 143.84 ? 273  DA  J OP1   1 
ATOM   5568  O OP2   . DA  B 1 127 ? 29.403  11.689  -31.454 1.00 143.84 ? 273  DA  J OP2   1 
ATOM   5569  O "O5'" . DA  B 1 127 ? 28.314  9.583   -30.687 1.00 150.82 ? 273  DA  J "O5'" 1 
ATOM   5570  C "C5'" . DA  B 1 127 ? 28.007  8.543   -29.754 1.00 150.82 ? 273  DA  J "C5'" 1 
ATOM   5571  C "C4'" . DA  B 1 127 ? 27.675  7.276   -30.502 1.00 150.82 ? 273  DA  J "C4'" 1 
ATOM   5572  O "O4'" . DA  B 1 127 ? 26.317  7.339   -31.019 1.00 150.82 ? 273  DA  J "O4'" 1 
ATOM   5573  C "C3'" . DA  B 1 127 ? 28.589  7.139   -31.705 1.00 150.82 ? 273  DA  J "C3'" 1 
ATOM   5574  O "O3'" . DA  B 1 127 ? 28.959  5.786   -31.915 1.00 150.82 ? 273  DA  J "O3'" 1 
ATOM   5575  C "C2'" . DA  B 1 127 ? 27.763  7.733   -32.843 1.00 150.82 ? 273  DA  J "C2'" 1 
ATOM   5576  C "C1'" . DA  B 1 127 ? 26.328  7.380   -32.450 1.00 150.82 ? 273  DA  J "C1'" 1 
ATOM   5577  N N9    . DA  B 1 127 ? 25.287  8.322   -32.928 1.00 143.84 ? 273  DA  J N9    1 
ATOM   5578  C C8    . DA  B 1 127 ? 25.385  9.696   -33.045 1.00 143.84 ? 273  DA  J C8    1 
ATOM   5579  N N7    . DA  B 1 127 ? 24.303  10.270  -33.525 1.00 143.84 ? 273  DA  J N7    1 
ATOM   5580  C C5    . DA  B 1 127 ? 23.425  9.212   -33.736 1.00 143.84 ? 273  DA  J C5    1 
ATOM   5581  C C6    . DA  B 1 127 ? 22.095  9.160   -34.225 1.00 143.84 ? 273  DA  J C6    1 
ATOM   5582  N N6    . DA  B 1 127 ? 21.386  10.234  -34.575 1.00 143.84 ? 273  DA  J N6    1 
ATOM   5583  N N1    . DA  B 1 127 ? 21.511  7.949   -34.330 1.00 143.84 ? 273  DA  J N1    1 
ATOM   5584  C C2    . DA  B 1 127 ? 22.205  6.871   -33.954 1.00 143.84 ? 273  DA  J C2    1 
ATOM   5585  N N3    . DA  B 1 127 ? 23.446  6.786   -33.466 1.00 143.84 ? 273  DA  J N3    1 
ATOM   5586  C C4    . DA  B 1 127 ? 24.014  8.004   -33.379 1.00 143.84 ? 273  DA  J C4    1 
ATOM   5587  P P     . DT  B 1 128 ? 29.299  5.319   -33.404 1.00 179.77 ? 274  DT  J P     1 
ATOM   5588  O OP1   . DT  B 1 128 ? 30.161  4.113   -33.348 1.00 107.65 ? 274  DT  J OP1   1 
ATOM   5589  O OP2   . DT  B 1 128 ? 29.800  6.530   -34.145 1.00 107.65 ? 274  DT  J OP2   1 
ATOM   5590  O "O5'" . DT  B 1 128 ? 27.848  4.938   -33.945 1.00 179.77 ? 274  DT  J "O5'" 1 
ATOM   5591  C "C5'" . DT  B 1 128 ? 27.187  3.782   -33.454 1.00 179.77 ? 274  DT  J "C5'" 1 
ATOM   5592  C "C4'" . DT  B 1 128 ? 26.427  3.108   -34.573 1.00 179.77 ? 274  DT  J "C4'" 1 
ATOM   5593  O "O4'" . DT  B 1 128 ? 25.261  3.908   -34.907 1.00 179.77 ? 274  DT  J "O4'" 1 
ATOM   5594  C "C3'" . DT  B 1 128 ? 27.217  2.950   -35.883 1.00 179.77 ? 274  DT  J "C3'" 1 
ATOM   5595  O "O3'" . DT  B 1 128 ? 26.948  1.672   -36.494 1.00 179.77 ? 274  DT  J "O3'" 1 
ATOM   5596  C "C2'" . DT  B 1 128 ? 26.735  4.110   -36.737 1.00 179.77 ? 274  DT  J "C2'" 1 
ATOM   5597  C "C1'" . DT  B 1 128 ? 25.287  4.228   -36.309 1.00 179.77 ? 274  DT  J "C1'" 1 
ATOM   5598  N N1    . DT  B 1 128 ? 24.687  5.581   -36.536 1.00 107.65 ? 274  DT  J N1    1 
ATOM   5599  C C2    . DT  B 1 128 ? 23.296  5.683   -36.606 1.00 107.65 ? 274  DT  J C2    1 
ATOM   5600  O O2    . DT  B 1 128 ? 22.547  4.730   -36.442 1.00 107.65 ? 274  DT  J O2    1 
ATOM   5601  N N3    . DT  B 1 128 ? 22.820  6.955   -36.870 1.00 107.65 ? 274  DT  J N3    1 
ATOM   5602  C C4    . DT  B 1 128 ? 23.573  8.115   -37.056 1.00 107.65 ? 274  DT  J C4    1 
ATOM   5603  O O4    . DT  B 1 128 ? 23.007  9.181   -37.321 1.00 107.65 ? 274  DT  J O4    1 
ATOM   5604  C C5    . DT  B 1 128 ? 25.025  7.949   -36.931 1.00 107.65 ? 274  DT  J C5    1 
ATOM   5605  C C7    . DT  B 1 128 ? 25.913  9.151   -37.057 1.00 107.65 ? 274  DT  J C7    1 
ATOM   5606  C C6    . DT  B 1 128 ? 25.499  6.706   -36.693 1.00 107.65 ? 274  DT  J C6    1 
ATOM   5607  P P     . DC  B 1 129 ? 27.050  1.490   -38.098 1.00 116.99 ? 275  DC  J P     1 
ATOM   5608  O OP1   . DC  B 1 129 ? 27.489  0.081   -38.354 1.00 108.55 ? 275  DC  J OP1   1 
ATOM   5609  O OP2   . DC  B 1 129 ? 27.830  2.610   -38.710 1.00 108.55 ? 275  DC  J OP2   1 
ATOM   5610  O "O5'" . DC  B 1 129 ? 25.516  1.646   -38.548 1.00 116.99 ? 275  DC  J "O5'" 1 
ATOM   5611  C "C5'" . DC  B 1 129 ? 24.430  1.198   -37.692 1.00 116.99 ? 275  DC  J "C5'" 1 
ATOM   5612  C "C4'" . DC  B 1 129 ? 23.078  1.362   -38.371 1.00 116.99 ? 275  DC  J "C4'" 1 
ATOM   5613  O "O4'" . DC  B 1 129 ? 22.742  2.759   -38.523 1.00 116.99 ? 275  DC  J "O4'" 1 
ATOM   5614  C "C3'" . DC  B 1 129 ? 22.934  0.741   -39.759 1.00 116.99 ? 275  DC  J "C3'" 1 
ATOM   5615  O "O3'" . DC  B 1 129 ? 21.633  0.151   -39.889 1.00 116.99 ? 275  DC  J "O3'" 1 
ATOM   5616  C "C2'" . DC  B 1 129 ? 23.129  1.923   -40.693 1.00 116.99 ? 275  DC  J "C2'" 1 
ATOM   5617  C "C1'" . DC  B 1 129 ? 22.499  3.049   -39.893 1.00 116.99 ? 275  DC  J "C1'" 1 
ATOM   5618  N N1    . DC  B 1 129 ? 23.000  4.410   -40.163 1.00 108.55 ? 275  DC  J N1    1 
ATOM   5619  C C2    . DC  B 1 129 ? 22.081  5.387   -40.579 1.00 108.55 ? 275  DC  J C2    1 
ATOM   5620  O O2    . DC  B 1 129 ? 20.902  5.055   -40.789 1.00 108.55 ? 275  DC  J O2    1 
ATOM   5621  N N3    . DC  B 1 129 ? 22.499  6.663   -40.736 1.00 108.55 ? 275  DC  J N3    1 
ATOM   5622  C C4    . DC  B 1 129 ? 23.767  6.982   -40.484 1.00 108.55 ? 275  DC  J C4    1 
ATOM   5623  N N4    . DC  B 1 129 ? 24.102  8.262   -40.552 1.00 108.55 ? 275  DC  J N4    1 
ATOM   5624  C C5    . DC  B 1 129 ? 24.736  6.001   -40.122 1.00 108.55 ? 275  DC  J C5    1 
ATOM   5625  C C6    . DC  B 1 129 ? 24.315  4.735   -39.979 1.00 108.55 ? 275  DC  J C6    1 
ATOM   5626  P P     . DT  B 1 130 ? 21.348  -0.901  -41.084 1.00 65.58  ? 276  DT  J P     1 
ATOM   5627  O OP1   . DT  B 1 130 ? 20.345  -1.931  -40.666 1.00 90.41  ? 276  DT  J OP1   1 
ATOM   5628  O OP2   . DT  B 1 130 ? 22.602  -1.308  -41.771 1.00 90.41  ? 276  DT  J OP2   1 
ATOM   5629  O "O5'" . DT  B 1 130 ? 20.686  -0.002  -42.237 1.00 65.58  ? 276  DT  J "O5'" 1 
ATOM   5630  C "C5'" . DT  B 1 130 ? 19.411  0.624   -42.079 1.00 65.58  ? 276  DT  J "C5'" 1 
ATOM   5631  C "C4'" . DT  B 1 130 ? 19.107  1.478   -43.284 1.00 65.58  ? 276  DT  J "C4'" 1 
ATOM   5632  O "O4'" . DT  B 1 130 ? 19.985  2.613   -43.255 1.00 65.58  ? 276  DT  J "O4'" 1 
ATOM   5633  C "C3'" . DT  B 1 130 ? 19.246  0.877   -44.691 1.00 65.58  ? 276  DT  J "C3'" 1 
ATOM   5634  O "O3'" . DT  B 1 130 ? 18.048  1.140   -45.416 1.00 65.58  ? 276  DT  J "O3'" 1 
ATOM   5635  C "C2'" . DT  B 1 130 ? 20.343  1.724   -45.325 1.00 65.58  ? 276  DT  J "C2'" 1 
ATOM   5636  C "C1'" . DT  B 1 130 ? 20.173  3.019   -44.582 1.00 65.58  ? 276  DT  J "C1'" 1 
ATOM   5637  N N1    . DT  B 1 130 ? 21.197  4.082   -44.585 1.00 90.41  ? 276  DT  J N1    1 
ATOM   5638  C C2    . DT  B 1 130 ? 20.779  5.368   -44.876 1.00 90.41  ? 276  DT  J C2    1 
ATOM   5639  O O2    . DT  B 1 130 ? 19.668  5.625   -45.294 1.00 90.41  ? 276  DT  J O2    1 
ATOM   5640  N N3    . DT  B 1 130 ? 21.720  6.347   -44.671 1.00 90.41  ? 276  DT  J N3    1 
ATOM   5641  C C4    . DT  B 1 130 ? 23.020  6.169   -44.250 1.00 90.41  ? 276  DT  J C4    1 
ATOM   5642  O O4    . DT  B 1 130 ? 23.756  7.139   -44.087 1.00 90.41  ? 276  DT  J O4    1 
ATOM   5643  C C5    . DT  B 1 130 ? 23.406  4.794   -44.028 1.00 90.41  ? 276  DT  J C5    1 
ATOM   5644  C C7    . DT  B 1 130 ? 24.790  4.508   -43.545 1.00 90.41  ? 276  DT  J C7    1 
ATOM   5645  C C6    . DT  B 1 130 ? 22.495  3.829   -44.234 1.00 90.41  ? 276  DT  J C6    1 
ATOM   5646  P P     . DG  B 1 131 ? 17.357  0.000   -46.318 1.00 44.75  ? 277  DG  J P     1 
ATOM   5647  O OP1   . DG  B 1 131 ? 16.666  -0.952  -45.450 1.00 61.12  ? 277  DG  J OP1   1 
ATOM   5648  O OP2   . DG  B 1 131 ? 18.250  -0.503  -47.399 1.00 61.12  ? 277  DG  J OP2   1 
ATOM   5649  O "O5'" . DG  B 1 131 ? 16.223  0.802   -47.101 1.00 44.75  ? 277  DG  J "O5'" 1 
ATOM   5650  C "C5'" . DG  B 1 131 ? 15.208  1.492   -46.372 1.00 44.75  ? 277  DG  J "C5'" 1 
ATOM   5651  C "C4'" . DG  B 1 131 ? 14.850  2.800   -47.030 1.00 44.75  ? 277  DG  J "C4'" 1 
ATOM   5652  O "O4'" . DG  B 1 131 ? 15.975  3.661   -46.929 1.00 44.75  ? 277  DG  J "O4'" 1 
ATOM   5653  C "C3'" . DG  B 1 131 ? 14.478  2.739   -48.505 1.00 44.75  ? 277  DG  J "C3'" 1 
ATOM   5654  O "O3'" . DG  B 1 131 ? 13.479  3.706   -48.763 1.00 44.75  ? 277  DG  J "O3'" 1 
ATOM   5655  C "C2'" . DG  B 1 131 ? 15.756  3.121   -49.208 1.00 44.75  ? 277  DG  J "C2'" 1 
ATOM   5656  C "C1'" . DG  B 1 131 ? 16.405  4.054   -48.221 1.00 44.75  ? 277  DG  J "C1'" 1 
ATOM   5657  N N9    . DG  B 1 131 ? 17.857  3.934   -48.241 1.00 61.12  ? 277  DG  J N9    1 
ATOM   5658  C C8    . DG  B 1 131 ? 18.583  2.767   -48.200 1.00 61.12  ? 277  DG  J C8    1 
ATOM   5659  N N7    . DG  B 1 131 ? 19.873  2.965   -48.165 1.00 61.12  ? 277  DG  J N7    1 
ATOM   5660  C C5    . DG  B 1 131 ? 20.017  4.349   -48.209 1.00 61.12  ? 277  DG  J C5    1 
ATOM   5661  C C6    . DG  B 1 131 ? 21.207  5.188   -48.207 1.00 61.12  ? 277  DG  J C6    1 
ATOM   5662  O O6    . DG  B 1 131 ? 22.434  4.834   -48.233 1.00 61.12  ? 277  DG  J O6    1 
ATOM   5663  N N1    . DG  B 1 131 ? 20.864  6.556   -48.217 1.00 61.12  ? 277  DG  J N1    1 
ATOM   5664  C C2    . DG  B 1 131 ? 19.588  7.046   -48.300 1.00 61.12  ? 277  DG  J C2    1 
ATOM   5665  N N2    . DG  B 1 131 ? 19.471  8.367   -48.374 1.00 61.12  ? 277  DG  J N2    1 
ATOM   5666  N N3    . DG  B 1 131 ? 18.497  6.291   -48.328 1.00 61.12  ? 277  DG  J N3    1 
ATOM   5667  C C4    . DG  B 1 131 ? 18.780  4.966   -48.268 1.00 61.12  ? 277  DG  J C4    1 
ATOM   5668  P P     . DC  B 1 132 ? 12.696  3.718   -50.170 1.00 35.70  ? 278  DC  J P     1 
ATOM   5669  O OP1   . DC  B 1 132 ? 11.313  3.853   -49.677 1.00 51.73  ? 278  DC  J OP1   1 
ATOM   5670  O OP2   . DC  B 1 132 ? 13.007  2.627   -51.116 1.00 51.73  ? 278  DC  J OP2   1 
ATOM   5671  O "O5'" . DC  B 1 132 ? 13.192  5.104   -50.794 1.00 35.70  ? 278  DC  J "O5'" 1 
ATOM   5672  C "C5'" . DC  B 1 132 ? 13.988  6.020   -50.000 1.00 35.70  ? 278  DC  J "C5'" 1 
ATOM   5673  C "C4'" . DC  B 1 132 ? 14.667  7.065   -50.868 1.00 35.70  ? 278  DC  J "C4'" 1 
ATOM   5674  O "O4'" . DC  B 1 132 ? 16.124  7.049   -50.805 1.00 35.70  ? 278  DC  J "O4'" 1 
ATOM   5675  C "C3'" . DC  B 1 132 ? 14.345  7.022   -52.357 1.00 35.70  ? 278  DC  J "C3'" 1 
ATOM   5676  O "O3'" . DC  B 1 132 ? 14.544  8.362   -52.805 1.00 35.70  ? 278  DC  J "O3'" 1 
ATOM   5677  C "C2'" . DC  B 1 132 ? 15.490  6.186   -52.925 1.00 35.70  ? 278  DC  J "C2'" 1 
ATOM   5678  C "C1'" . DC  B 1 132 ? 16.674  6.708   -52.124 1.00 35.70  ? 278  DC  J "C1'" 1 
ATOM   5679  N N1    . DC  B 1 132 ? 17.809  5.759   -51.931 1.00 51.73  ? 278  DC  J N1    1 
ATOM   5680  C C2    . DC  B 1 132 ? 19.084  6.288   -51.841 1.00 51.73  ? 278  DC  J C2    1 
ATOM   5681  O O2    . DC  B 1 132 ? 19.228  7.468   -52.052 1.00 51.73  ? 278  DC  J O2    1 
ATOM   5682  N N3    . DC  B 1 132 ? 20.118  5.501   -51.525 1.00 51.73  ? 278  DC  J N3    1 
ATOM   5683  C C4    . DC  B 1 132 ? 19.918  4.198   -51.306 1.00 51.73  ? 278  DC  J C4    1 
ATOM   5684  N N4    . DC  B 1 132 ? 20.967  3.465   -50.912 1.00 51.73  ? 278  DC  J N4    1 
ATOM   5685  C C5    . DC  B 1 132 ? 18.630  3.596   -51.463 1.00 51.73  ? 278  DC  J C5    1 
ATOM   5686  C C6    . DC  B 1 132 ? 17.608  4.409   -51.785 1.00 51.73  ? 278  DC  J C6    1 
ATOM   5687  P P     . DA  B 1 133 ? 13.343  9.206   -53.404 1.00 56.81  ? 279  DA  J P     1 
ATOM   5688  O OP1   . DA  B 1 133 ? 12.371  9.052   -52.314 1.00 59.28  ? 279  DA  J OP1   1 
ATOM   5689  O OP2   . DA  B 1 133 ? 12.990  8.817   -54.794 1.00 59.28  ? 279  DA  J OP2   1 
ATOM   5690  O "O5'" . DA  B 1 133 ? 13.938  10.674  -53.439 1.00 56.81  ? 279  DA  J "O5'" 1 
ATOM   5691  C "C5'" . DA  B 1 133 ? 14.576  11.220  -52.311 1.00 56.81  ? 279  DA  J "C5'" 1 
ATOM   5692  C "C4'" . DA  B 1 133 ? 15.695  12.138  -52.763 1.00 56.81  ? 279  DA  J "C4'" 1 
ATOM   5693  O "O4'" . DA  B 1 133 ? 16.950  11.437  -52.994 1.00 56.81  ? 279  DA  J "O4'" 1 
ATOM   5694  C "C3'" . DA  B 1 133 ? 15.417  12.889  -54.069 1.00 56.81  ? 279  DA  J "C3'" 1 
ATOM   5695  O "O3'" . DA  B 1 133 ? 16.185  14.122  -54.119 1.00 56.81  ? 279  DA  J "O3'" 1 
ATOM   5696  C "C2'" . DA  B 1 133 ? 15.951  11.928  -55.108 1.00 56.81  ? 279  DA  J "C2'" 1 
ATOM   5697  C "C1'" . DA  B 1 133 ? 17.194  11.373  -54.406 1.00 56.81  ? 279  DA  J "C1'" 1 
ATOM   5698  N N9    . DA  B 1 133 ? 17.384  9.971   -54.735 1.00 59.28  ? 279  DA  J N9    1 
ATOM   5699  C C8    . DA  B 1 133 ? 16.416  9.092   -55.125 1.00 59.28  ? 279  DA  J C8    1 
ATOM   5700  N N7    . DA  B 1 133 ? 16.849  7.876   -55.271 1.00 59.28  ? 279  DA  J N7    1 
ATOM   5701  C C5    . DA  B 1 133 ? 18.194  7.963   -54.984 1.00 59.28  ? 279  DA  J C5    1 
ATOM   5702  C C6    . DA  B 1 133 ? 19.202  7.019   -54.991 1.00 59.28  ? 279  DA  J C6    1 
ATOM   5703  N N6    . DA  B 1 133 ? 18.999  5.738   -55.254 1.00 59.28  ? 279  DA  J N6    1 
ATOM   5704  N N1    . DA  B 1 133 ? 20.444  7.431   -54.718 1.00 59.28  ? 279  DA  J N1    1 
ATOM   5705  C C2    . DA  B 1 133 ? 20.634  8.730   -54.432 1.00 59.28  ? 279  DA  J C2    1 
ATOM   5706  N N3    . DA  B 1 133 ? 19.757  9.712   -54.373 1.00 59.28  ? 279  DA  J N3    1 
ATOM   5707  C C4    . DA  B 1 133 ? 18.542  9.254   -54.672 1.00 59.28  ? 279  DA  J C4    1 
ATOM   5708  P P     . DG  B 1 134 ? 16.023  15.105  -55.390 1.00 69.94  ? 280  DG  J P     1 
ATOM   5709  O OP1   . DG  B 1 134 ? 15.838  16.477  -54.862 1.00 70.80  ? 280  DG  J OP1   1 
ATOM   5710  O OP2   . DG  B 1 134 ? 14.981  14.546  -56.319 1.00 70.80  ? 280  DG  J OP2   1 
ATOM   5711  O "O5'" . DG  B 1 134 ? 17.420  14.923  -56.165 1.00 69.94  ? 280  DG  J "O5'" 1 
ATOM   5712  C "C5'" . DG  B 1 134 ? 18.690  14.818  -55.506 1.00 69.94  ? 280  DG  J "C5'" 1 
ATOM   5713  C "C4'" . DG  B 1 134 ? 19.763  14.510  -56.533 1.00 69.94  ? 280  DG  J "C4'" 1 
ATOM   5714  O "O4'" . DG  B 1 134 ? 19.899  13.076  -56.748 1.00 69.94  ? 280  DG  J "O4'" 1 
ATOM   5715  C "C3'" . DG  B 1 134 ? 19.537  15.130  -57.930 1.00 69.94  ? 280  DG  J "C3'" 1 
ATOM   5716  O "O3'" . DG  B 1 134 ? 20.769  15.734  -58.470 1.00 69.94  ? 280  DG  J "O3'" 1 
ATOM   5717  C "C2'" . DG  B 1 134 ? 18.970  13.977  -58.752 1.00 69.94  ? 280  DG  J "C2'" 1 
ATOM   5718  C "C1'" . DG  B 1 134 ? 19.612  12.719  -58.114 1.00 69.94  ? 280  DG  J "C1'" 1 
ATOM   5719  N N9    . DG  B 1 134 ? 18.741  11.519  -58.167 1.00 70.80  ? 280  DG  J N9    1 
ATOM   5720  C C8    . DG  B 1 134 ? 17.379  11.540  -58.442 1.00 70.80  ? 280  DG  J C8    1 
ATOM   5721  N N7    . DG  B 1 134 ? 16.847  10.345  -58.592 1.00 70.80  ? 280  DG  J N7    1 
ATOM   5722  C C5    . DG  B 1 134 ? 17.877  9.468   -58.371 1.00 70.80  ? 280  DG  J C5    1 
ATOM   5723  C C6    . DG  B 1 134 ? 17.882  8.058   -58.445 1.00 70.80  ? 280  DG  J C6    1 
ATOM   5724  O O6    . DG  B 1 134 ? 16.915  7.319   -58.750 1.00 70.80  ? 280  DG  J O6    1 
ATOM   5725  N N1    . DG  B 1 134 ? 19.149  7.527   -58.155 1.00 70.80  ? 280  DG  J N1    1 
ATOM   5726  C C2    . DG  B 1 134 ? 20.285  8.313   -57.855 1.00 70.80  ? 280  DG  J C2    1 
ATOM   5727  N N2    . DG  B 1 134 ? 21.433  7.683   -57.625 1.00 70.80  ? 280  DG  J N2    1 
ATOM   5728  N N3    . DG  B 1 134 ? 20.282  9.644   -57.793 1.00 70.80  ? 280  DG  J N3    1 
ATOM   5729  C C4    . DG  B 1 134 ? 19.067  10.155  -58.060 1.00 70.80  ? 280  DG  J C4    1 
ATOM   5730  P P     . DG  B 1 135 ? 20.871  16.162  -60.035 1.00 82.16  ? 281  DG  J P     1 
ATOM   5731  O OP1   . DG  B 1 135 ? 21.635  17.424  -60.001 1.00 81.33  ? 281  DG  J OP1   1 
ATOM   5732  O OP2   . DG  B 1 135 ? 19.562  16.085  -60.761 1.00 81.33  ? 281  DG  J OP2   1 
ATOM   5733  O "O5'" . DG  B 1 135 ? 21.838  15.068  -60.663 1.00 82.16  ? 281  DG  J "O5'" 1 
ATOM   5734  C "C5'" . DG  B 1 135 ? 23.043  14.705  -59.983 1.00 82.16  ? 281  DG  J "C5'" 1 
ATOM   5735  C "C4'" . DG  B 1 135 ? 23.814  13.684  -60.792 1.00 82.16  ? 281  DG  J "C4'" 1 
ATOM   5736  O "O4'" . DG  B 1 135 ? 23.377  12.337  -60.466 1.00 82.16  ? 281  DG  J "O4'" 1 
ATOM   5737  C "C3'" . DG  B 1 135 ? 23.656  13.842  -62.314 1.00 82.16  ? 281  DG  J "C3'" 1 
ATOM   5738  O "O3'" . DG  B 1 135 ? 24.921  13.753  -63.032 1.00 82.16  ? 281  DG  J "O3'" 1 
ATOM   5739  C "C2'" . DG  B 1 135 ? 22.716  12.707  -62.679 1.00 82.16  ? 281  DG  J "C2'" 1 
ATOM   5740  C "C1'" . DG  B 1 135 ? 23.070  11.638  -61.662 1.00 82.16  ? 281  DG  J "C1'" 1 
ATOM   5741  N N9    . DG  B 1 135 ? 21.933  10.767  -61.405 1.00 81.33  ? 281  DG  J N9    1 
ATOM   5742  C C8    . DG  B 1 135 ? 20.675  11.175  -61.084 1.00 81.33  ? 281  DG  J C8    1 
ATOM   5743  N N7    . DG  B 1 135 ? 19.826  10.191  -60.989 1.00 81.33  ? 281  DG  J N7    1 
ATOM   5744  C C5    . DG  B 1 135 ? 20.575  9.059   -61.246 1.00 81.33  ? 281  DG  J C5    1 
ATOM   5745  C C6    . DG  B 1 135 ? 20.188  7.711   -61.302 1.00 81.33  ? 281  DG  J C6    1 
ATOM   5746  O O6    . DG  B 1 135 ? 19.065  7.243   -61.172 1.00 81.33  ? 281  DG  J O6    1 
ATOM   5747  N N1    . DG  B 1 135 ? 21.254  6.870   -61.562 1.00 81.33  ? 281  DG  J N1    1 
ATOM   5748  C C2    . DG  B 1 135 ? 22.534  7.278   -61.776 1.00 81.33  ? 281  DG  J C2    1 
ATOM   5749  N N2    . DG  B 1 135 ? 23.413  6.293   -62.018 1.00 81.33  ? 281  DG  J N2    1 
ATOM   5750  N N3    . DG  B 1 135 ? 22.918  8.552   -61.756 1.00 81.33  ? 281  DG  J N3    1 
ATOM   5751  C C4    . DG  B 1 135 ? 21.886  9.385   -61.481 1.00 81.33  ? 281  DG  J C4    1 
ATOM   5752  P P     . DT  B 1 136 ? 24.933  13.489  -64.644 1.00 123.99 ? 282  DT  J P     1 
ATOM   5753  O OP1   . DT  B 1 136 ? 26.348  13.762  -65.113 1.00 63.03  ? 282  DT  J OP1   1 
ATOM   5754  O OP2   . DT  B 1 136 ? 23.752  14.148  -65.355 1.00 63.03  ? 282  DT  J OP2   1 
ATOM   5755  O "O5'" . DT  B 1 136 ? 24.652  11.921  -64.710 1.00 123.99 ? 282  DT  J "O5'" 1 
ATOM   5756  C "C5'" . DT  B 1 136 ? 25.542  11.000  -64.087 1.00 123.99 ? 282  DT  J "C5'" 1 
ATOM   5757  C "C4'" . DT  B 1 136 ? 25.731  9.805   -64.985 1.00 123.99 ? 282  DT  J "C4'" 1 
ATOM   5758  O "O4'" . DT  B 1 136 ? 24.690  8.833   -64.716 1.00 123.99 ? 282  DT  J "O4'" 1 
ATOM   5759  C "C3'" . DT  B 1 136 ? 25.591  10.195  -66.457 1.00 123.99 ? 282  DT  J "C3'" 1 
ATOM   5760  O "O3'" . DT  B 1 136 ? 26.479  9.467   -67.308 1.00 123.99 ? 282  DT  J "O3'" 1 
ATOM   5761  C "C2'" . DT  B 1 136 ? 24.165  9.812   -66.784 1.00 123.99 ? 282  DT  J "C2'" 1 
ATOM   5762  C "C1'" . DT  B 1 136 ? 23.953  8.590   -65.911 1.00 123.99 ? 282  DT  J "C1'" 1 
ATOM   5763  N N1    . DT  B 1 136 ? 22.519  8.380   -65.577 1.00 63.03  ? 282  DT  J N1    1 
ATOM   5764  C C2    . DT  B 1 136 ? 22.048  7.082   -65.479 1.00 63.03  ? 282  DT  J C2    1 
ATOM   5765  O O2    . DT  B 1 136 ? 22.761  6.113   -65.631 1.00 63.03  ? 282  DT  J O2    1 
ATOM   5766  N N3    . DT  B 1 136 ? 20.707  6.973   -65.212 1.00 63.03  ? 282  DT  J N3    1 
ATOM   5767  C C4    . DT  B 1 136 ? 19.809  8.017   -65.054 1.00 63.03  ? 282  DT  J C4    1 
ATOM   5768  O O4    . DT  B 1 136 ? 18.628  7.776   -64.850 1.00 63.03  ? 282  DT  J O4    1 
ATOM   5769  C C5    . DT  B 1 136 ? 20.375  9.359   -65.161 1.00 63.03  ? 282  DT  J C5    1 
ATOM   5770  C C7    . DT  B 1 136 ? 19.484  10.551  -64.998 1.00 63.03  ? 282  DT  J C7    1 
ATOM   5771  C C6    . DT  B 1 136 ? 21.682  9.466   -65.405 1.00 63.03  ? 282  DT  J C6    1 
ATOM   5772  P P     . DG  B 1 137 ? 26.573  9.851   -68.883 1.00 148.76 ? 283  DG  J P     1 
ATOM   5773  O OP1   . DG  B 1 137 ? 27.858  10.609  -69.169 1.00 80.79  ? 283  DG  J OP1   1 
ATOM   5774  O OP2   . DG  B 1 137 ? 25.267  10.502  -69.236 1.00 80.79  ? 283  DG  J OP2   1 
ATOM   5775  O "O5'" . DG  B 1 137 ? 26.601  8.411   -69.593 1.00 148.76 ? 283  DG  J "O5'" 1 
ATOM   5776  C "C5'" . DG  B 1 137 ? 26.804  7.203   -68.840 1.00 148.76 ? 283  DG  J "C5'" 1 
ATOM   5777  C "C4'" . DG  B 1 137 ? 25.981  6.085   -69.432 1.00 148.76 ? 283  DG  J "C4'" 1 
ATOM   5778  O "O4'" . DG  B 1 137 ? 24.582  6.296   -69.098 1.00 148.76 ? 283  DG  J "O4'" 1 
ATOM   5779  C "C3'" . DG  B 1 137 ? 26.033  6.089   -70.959 1.00 148.76 ? 283  DG  J "C3'" 1 
ATOM   5780  O "O3'" . DG  B 1 137 ? 25.854  4.790   -71.512 1.00 148.76 ? 283  DG  J "O3'" 1 
ATOM   5781  C "C2'" . DG  B 1 137 ? 24.807  6.886   -71.352 1.00 148.76 ? 283  DG  J "C2'" 1 
ATOM   5782  C "C1'" . DG  B 1 137 ? 23.811  6.436   -70.298 1.00 148.76 ? 283  DG  J "C1'" 1 
ATOM   5783  N N9    . DG  B 1 137 ? 22.696  7.368   -70.072 1.00 80.79  ? 283  DG  J N9    1 
ATOM   5784  C C8    . DG  B 1 137 ? 22.643  8.703   -70.466 1.00 80.79  ? 283  DG  J C8    1 
ATOM   5785  N N7    . DG  B 1 137 ? 21.518  9.307   -70.161 1.00 80.79  ? 283  DG  J N7    1 
ATOM   5786  C C5    . DG  B 1 137 ? 20.772  8.326   -69.516 1.00 80.79  ? 283  DG  J C5    1 
ATOM   5787  C C6    . DG  B 1 137 ? 19.473  8.399   -68.967 1.00 80.79  ? 283  DG  J C6    1 
ATOM   5788  O O6    . DG  B 1 137 ? 18.724  9.390   -68.922 1.00 80.79  ? 283  DG  J O6    1 
ATOM   5789  N N1    . DG  B 1 137 ? 19.067  7.160   -68.437 1.00 80.79  ? 283  DG  J N1    1 
ATOM   5790  C C2    . DG  B 1 137 ? 19.835  5.994   -68.445 1.00 80.79  ? 283  DG  J C2    1 
ATOM   5791  N N2    . DG  B 1 137 ? 19.233  4.917   -67.930 1.00 80.79  ? 283  DG  J N2    1 
ATOM   5792  N N3    . DG  B 1 137 ? 21.082  5.910   -68.936 1.00 80.79  ? 283  DG  J N3    1 
ATOM   5793  C C4    . DG  B 1 137 ? 21.481  7.106   -69.455 1.00 80.79  ? 283  DG  J C4    1 
ATOM   5794  P P     . DG  B 1 138 ? 25.870  4.617   -73.118 1.00 132.91 ? 284  DG  J P     1 
ATOM   5795  O OP1   . DG  B 1 138 ? 27.239  5.062   -73.554 1.00 74.44  ? 284  DG  J OP1   1 
ATOM   5796  O OP2   . DG  B 1 138 ? 24.685  5.328   -73.667 1.00 74.44  ? 284  DG  J OP2   1 
ATOM   5797  O "O5'" . DG  B 1 138 ? 25.594  3.049   -73.309 1.00 132.91 ? 284  DG  J "O5'" 1 
ATOM   5798  C "C5'" . DG  B 1 138 ? 25.073  2.248   -72.225 1.00 132.91 ? 284  DG  J "C5'" 1 
ATOM   5799  C "C4'" . DG  B 1 138 ? 23.608  1.923   -72.439 1.00 132.91 ? 284  DG  J "C4'" 1 
ATOM   5800  O "O4'" . DG  B 1 138 ? 22.753  2.988   -71.944 1.00 132.91 ? 284  DG  J "O4'" 1 
ATOM   5801  C "C3'" . DG  B 1 138 ? 23.172  1.704   -73.889 1.00 132.91 ? 284  DG  J "C3'" 1 
ATOM   5802  O "O3'" . DG  B 1 138 ? 22.131  0.749   -73.914 1.00 132.91 ? 284  DG  J "O3'" 1 
ATOM   5803  C "C2'" . DG  B 1 138 ? 22.493  3.011   -74.266 1.00 132.91 ? 284  DG  J "C2'" 1 
ATOM   5804  C "C1'" . DG  B 1 138 ? 21.778  3.298   -72.960 1.00 132.91 ? 284  DG  J "C1'" 1 
ATOM   5805  N N9    . DG  B 1 138 ? 21.193  4.638   -72.737 1.00 74.44  ? 284  DG  J N9    1 
ATOM   5806  C C8    . DG  B 1 138 ? 21.696  5.873   -73.135 1.00 74.44  ? 284  DG  J C8    1 
ATOM   5807  N N7    . DG  B 1 138 ? 20.929  6.882   -72.791 1.00 74.44  ? 284  DG  J N7    1 
ATOM   5808  C C5    . DG  B 1 138 ? 19.842  6.286   -72.133 1.00 74.44  ? 284  DG  J C5    1 
ATOM   5809  C C6    . DG  B 1 138 ? 18.643  6.875   -71.531 1.00 74.44  ? 284  DG  J C6    1 
ATOM   5810  O O6    . DG  B 1 138 ? 18.294  8.074   -71.496 1.00 74.44  ? 284  DG  J O6    1 
ATOM   5811  N N1    . DG  B 1 138 ? 17.819  5.897   -70.949 1.00 74.44  ? 284  DG  J N1    1 
ATOM   5812  C C2    . DG  B 1 138 ? 18.076  4.534   -70.952 1.00 74.44  ? 284  DG  J C2    1 
ATOM   5813  N N2    . DG  B 1 138 ? 17.152  3.773   -70.337 1.00 74.44  ? 284  DG  J N2    1 
ATOM   5814  N N3    . DG  B 1 138 ? 19.155  3.972   -71.515 1.00 74.44  ? 284  DG  J N3    1 
ATOM   5815  C C4    . DG  B 1 138 ? 19.991  4.900   -72.078 1.00 74.44  ? 284  DG  J C4    1 
ATOM   5816  P P     . DA  B 1 139 ? 21.711  0.107   -75.308 1.00 134.35 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 139 ? 22.488  -1.142  -75.449 1.00 87.98  ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 139 ? 21.840  1.176   -76.341 1.00 87.98  ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 139 ? 20.205  -0.322  -75.062 1.00 134.35 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 139 ? 19.889  -1.269  -74.048 1.00 134.35 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 139 ? 18.392  -1.401  -73.948 1.00 134.35 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 139 ? 17.867  -0.166  -73.395 1.00 134.35 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 139 ? 17.767  -1.544  -75.333 1.00 134.35 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 139 ? 16.619  -2.385  -75.301 1.00 134.35 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 139 ? 17.372  -0.127  -75.701 1.00 134.35 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 139 ? 17.029  0.489   -74.349 1.00 134.35 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 139 ? 17.263  1.948   -74.279 1.00 87.98  ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 139 ? 18.414  2.653   -74.587 1.00 87.98  ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 139 ? 18.267  3.956   -74.525 1.00 87.98  ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 139 ? 16.943  4.125   -74.125 1.00 87.98  ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 139 ? 16.166  5.272   -73.885 1.00 87.98  ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 139 ? 16.613  6.530   -74.020 1.00 87.98  ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 139 ? 14.894  5.085   -73.498 1.00 87.98  ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 139 ? 14.437  3.839   -73.361 1.00 87.98  ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 139 ? 15.058  2.691   -73.555 1.00 87.98  ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 139 ? 16.324  2.901   -73.944 1.00 87.98  ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 140 ? 15.637  -2.399  -76.566 1.00 152.70 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 140 ? 14.828  -3.713  -76.646 1.00 61.36  ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 140 ? 16.584  -1.965  -77.705 1.00 61.36  ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 140 ? 14.559  -1.313  -76.121 1.00 152.70 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 140 ? 13.833  -1.533  -74.901 1.00 152.70 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 140 ? 12.514  -0.790  -74.892 1.00 152.70 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 140 ? 12.747  0.630   -74.770 1.00 152.70 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 140 ? 11.578  -0.963  -76.092 1.00 152.70 ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 140 ? 10.217  -1.024  -75.605 1.00 152.70 ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 140 ? 11.848  0.291   -76.904 1.00 152.70 ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 140 ? 12.066  1.311   -75.809 1.00 152.70 ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 140 ? 12.872  2.485   -76.187 1.00 61.36  ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 140 ? 12.350  3.743   -75.877 1.00 61.36  ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 140 ? 11.268  3.905   -75.335 1.00 61.36  ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 140 ? 13.142  4.807   -76.231 1.00 61.36  ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 140 ? 14.374  4.747   -76.856 1.00 61.36  ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 140 ? 14.962  5.778   -77.142 1.00 61.36  ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 140 ? 14.871  3.412   -77.137 1.00 61.36  ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 140 ? 16.226  3.284   -77.752 1.00 61.36  ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 140 ? 14.097  2.352   -76.811 1.00 61.36  ? 286  DT  J C6    1 
ATOM   5857  P P     . DA  B 1 141 ? 8.959   -0.761  -76.601 1.00 87.53  ? 287  DA  J P     1 
ATOM   5858  O OP1   . DA  B 1 141 ? 7.718   -0.599  -75.731 1.00 56.72  ? 287  DA  J OP1   1 
ATOM   5859  O OP2   . DA  B 1 141 ? 8.891   -1.690  -77.806 1.00 56.72  ? 287  DA  J OP2   1 
ATOM   5860  O "O5'" . DA  B 1 141 ? 9.274   0.691   -77.164 1.00 87.53  ? 287  DA  J "O5'" 1 
ATOM   5861  C "C5'" . DA  B 1 141 ? 8.205   1.532   -77.575 1.00 87.53  ? 287  DA  J "C5'" 1 
ATOM   5862  C "C4'" . DA  B 1 141 ? 7.646   2.315   -76.400 1.00 87.53  ? 287  DA  J "C4'" 1 
ATOM   5863  O "O4'" . DA  B 1 141 ? 8.542   3.356   -75.979 1.00 87.53  ? 287  DA  J "O4'" 1 
ATOM   5864  C "C3'" . DA  B 1 141 ? 6.437   3.059   -76.905 1.00 87.53  ? 287  DA  J "C3'" 1 
ATOM   5865  O "O3'" . DA  B 1 141 ? 5.501   3.336   -75.904 1.00 87.53  ? 287  DA  J "O3'" 1 
ATOM   5866  C "C2'" . DA  B 1 141 ? 7.015   4.308   -77.513 1.00 87.53  ? 287  DA  J "C2'" 1 
ATOM   5867  C "C1'" . DA  B 1 141 ? 8.282   4.524   -76.743 1.00 87.53  ? 287  DA  J "C1'" 1 
ATOM   5868  N N9    . DA  B 1 141 ? 9.403   4.694   -77.649 1.00 56.72  ? 287  DA  J N9    1 
ATOM   5869  C C8    . DA  B 1 141 ? 10.153  3.726   -78.238 1.00 56.72  ? 287  DA  J C8    1 
ATOM   5870  N N7    . DA  B 1 141 ? 11.206  4.181   -78.881 1.00 56.72  ? 287  DA  J N7    1 
ATOM   5871  C C5    . DA  B 1 141 ? 11.118  5.547   -78.738 1.00 56.72  ? 287  DA  J C5    1 
ATOM   5872  C C6    . DA  B 1 141 ? 11.931  6.593   -79.193 1.00 56.72  ? 287  DA  J C6    1 
ATOM   5873  N N6    . DA  B 1 141 ? 13.059  6.407   -79.848 1.00 56.72  ? 287  DA  J N6    1 
ATOM   5874  N N1    . DA  B 1 141 ? 11.529  7.863   -78.934 1.00 56.72  ? 287  DA  J N1    1 
ATOM   5875  C C2    . DA  B 1 141 ? 10.371  8.045   -78.244 1.00 56.72  ? 287  DA  J C2    1 
ATOM   5876  N N3    . DA  B 1 141 ? 9.535   7.125   -77.728 1.00 56.72  ? 287  DA  J N3    1 
ATOM   5877  C C4    . DA  B 1 141 ? 9.976   5.885   -78.017 1.00 56.72  ? 287  DA  J C4    1 
ATOM   5878  P P     . DT  B 1 142 ? 4.092   3.925   -76.363 1.00 60.64  ? 288  DT  J P     1 
ATOM   5879  O OP1   . DT  B 1 142 ? 3.113   4.119   -75.222 1.00 56.68  ? 288  DT  J OP1   1 
ATOM   5880  O OP2   . DT  B 1 142 ? 3.650   3.139   -77.564 1.00 56.68  ? 288  DT  J OP2   1 
ATOM   5881  O "O5'" . DT  B 1 142 ? 4.521   5.386   -76.879 1.00 60.64  ? 288  DT  J "O5'" 1 
ATOM   5882  C "C5'" . DT  B 1 142 ? 5.006   6.408   -75.996 1.00 60.64  ? 288  DT  J "C5'" 1 
ATOM   5883  C "C4'" . DT  B 1 142 ? 4.991   7.729   -76.724 1.00 60.64  ? 288  DT  J "C4'" 1 
ATOM   5884  O "O4'" . DT  B 1 142 ? 6.175   7.877   -77.518 1.00 60.64  ? 288  DT  J "O4'" 1 
ATOM   5885  C "C3'" . DT  B 1 142 ? 3.821   7.909   -77.696 1.00 60.64  ? 288  DT  J "C3'" 1 
ATOM   5886  O "O3'" . DT  B 1 142 ? 3.468   9.292   -77.670 1.00 60.64  ? 288  DT  J "O3'" 1 
ATOM   5887  C "C2'" . DT  B 1 142 ? 4.428   7.568   -79.047 1.00 60.64  ? 288  DT  J "C2'" 1 
ATOM   5888  C "C1'" . DT  B 1 142 ? 5.808   8.137   -78.875 1.00 60.64  ? 288  DT  J "C1'" 1 
ATOM   5889  N N1    . DT  B 1 142 ? 6.909   7.657   -79.784 1.00 56.68  ? 288  DT  J N1    1 
ATOM   5890  C C2    . DT  B 1 142 ? 7.786   8.617   -80.246 1.00 56.68  ? 288  DT  J C2    1 
ATOM   5891  O O2    . DT  B 1 142 ? 7.589   9.810   -80.113 1.00 56.68  ? 288  DT  J O2    1 
ATOM   5892  N N3    . DT  B 1 142 ? 8.880   8.137   -80.917 1.00 56.68  ? 288  DT  J N3    1 
ATOM   5893  C C4    . DT  B 1 142 ? 9.158   6.830   -81.229 1.00 56.68  ? 288  DT  J C4    1 
ATOM   5894  O O4    . DT  B 1 142 ? 10.214  6.572   -81.808 1.00 56.68  ? 288  DT  J O4    1 
ATOM   5895  C C5    . DT  B 1 142 ? 8.144   5.872   -80.804 1.00 56.68  ? 288  DT  J C5    1 
ATOM   5896  C C7    . DT  B 1 142 ? 8.317   4.428   -81.109 1.00 56.68  ? 288  DT  J C7    1 
ATOM   5897  C C6    . DT  B 1 142 ? 7.088   6.334   -80.122 1.00 56.68  ? 288  DT  J C6    1 
ATOM   5898  P P     . DT  B 1 143 ? 1.969   9.801   -78.060 1.00 45.42  ? 289  DT  J P     1 
ATOM   5899  O OP1   . DT  B 1 143 ? 1.372   10.209  -76.764 1.00 38.29  ? 289  DT  J OP1   1 
ATOM   5900  O OP2   . DT  B 1 143 ? 1.215   8.860   -78.940 1.00 38.29  ? 289  DT  J OP2   1 
ATOM   5901  O "O5'" . DT  B 1 143 ? 2.425   11.070  -78.900 1.00 45.42  ? 289  DT  J "O5'" 1 
ATOM   5902  C "C5'" . DT  B 1 143 ? 3.727   11.023  -79.391 1.00 45.42  ? 289  DT  J "C5'" 1 
ATOM   5903  C "C4'" . DT  B 1 143 ? 4.148   12.325  -79.987 1.00 45.42  ? 289  DT  J "C4'" 1 
ATOM   5904  O "O4'" . DT  B 1 143 ? 5.382   11.966  -80.639 1.00 45.42  ? 289  DT  J "O4'" 1 
ATOM   5905  C "C3'" . DT  B 1 143 ? 3.257   12.893  -81.088 1.00 45.42  ? 289  DT  J "C3'" 1 
ATOM   5906  O "O3'" . DT  B 1 143 ? 3.644   14.234  -81.221 1.00 45.42  ? 289  DT  J "O3'" 1 
ATOM   5907  C "C2'" . DT  B 1 143 ? 3.739   12.177  -82.322 1.00 45.42  ? 289  DT  J "C2'" 1 
ATOM   5908  C "C1'" . DT  B 1 143 ? 5.229   12.004  -82.055 1.00 45.42  ? 289  DT  J "C1'" 1 
ATOM   5909  N N1    . DT  B 1 143 ? 5.783   10.745  -82.629 1.00 38.29  ? 289  DT  J N1    1 
ATOM   5910  C C2    . DT  B 1 143 ? 6.925   10.795  -83.454 1.00 38.29  ? 289  DT  J C2    1 
ATOM   5911  O O2    . DT  B 1 143 ? 7.563   11.818  -83.679 1.00 38.29  ? 289  DT  J O2    1 
ATOM   5912  N N3    . DT  B 1 143 ? 7.286   9.615   -84.007 1.00 38.29  ? 289  DT  J N3    1 
ATOM   5913  C C4    . DT  B 1 143 ? 6.677   8.408   -83.821 1.00 38.29  ? 289  DT  J C4    1 
ATOM   5914  O O4    . DT  B 1 143 ? 7.153   7.405   -84.351 1.00 38.29  ? 289  DT  J O4    1 
ATOM   5915  C C5    . DT  B 1 143 ? 5.504   8.415   -82.969 1.00 38.29  ? 289  DT  J C5    1 
ATOM   5916  C C7    . DT  B 1 143 ? 4.738   7.144   -82.795 1.00 38.29  ? 289  DT  J C7    1 
ATOM   5917  C C6    . DT  B 1 143 ? 5.139   9.568   -82.393 1.00 38.29  ? 289  DT  J C6    1 
ATOM   5918  P P     . DG  B 1 144 ? 2.710   15.257  -81.953 1.00 37.50  ? 290  DG  J P     1 
ATOM   5919  O OP1   . DG  B 1 144 ? 2.716   16.545  -81.192 1.00 37.06  ? 290  DG  J OP1   1 
ATOM   5920  O OP2   . DG  B 1 144 ? 1.437   14.637  -82.342 1.00 37.06  ? 290  DG  J OP2   1 
ATOM   5921  O "O5'" . DG  B 1 144 ? 3.486   15.475  -83.311 1.00 37.50  ? 290  DG  J "O5'" 1 
ATOM   5922  C "C5'" . DG  B 1 144 ? 4.709   16.205  -83.391 1.00 37.50  ? 290  DG  J "C5'" 1 
ATOM   5923  C "C4'" . DG  B 1 144 ? 5.300   16.039  -84.775 1.00 37.50  ? 290  DG  J "C4'" 1 
ATOM   5924  O "O4'" . DG  B 1 144 ? 5.652   14.653  -85.006 1.00 37.50  ? 290  DG  J "O4'" 1 
ATOM   5925  C "C3'" . DG  B 1 144 ? 4.344   16.415  -85.931 1.00 37.50  ? 290  DG  J "C3'" 1 
ATOM   5926  O "O3'" . DG  B 1 144 ? 5.075   16.958  -87.030 1.00 37.50  ? 290  DG  J "O3'" 1 
ATOM   5927  C "C2'" . DG  B 1 144 ? 3.749   15.092  -86.359 1.00 37.50  ? 290  DG  J "C2'" 1 
ATOM   5928  C "C1'" . DG  B 1 144 ? 4.979   14.219  -86.213 1.00 37.50  ? 290  DG  J "C1'" 1 
ATOM   5929  N N9    . DG  B 1 144 ? 4.773   12.794  -86.176 1.00 37.06  ? 290  DG  J N9    1 
ATOM   5930  C C8    . DG  B 1 144 ? 3.722   12.041  -85.654 1.00 37.06  ? 290  DG  J C8    1 
ATOM   5931  N N7    . DG  B 1 144 ? 3.864   10.754  -85.825 1.00 37.06  ? 290  DG  J N7    1 
ATOM   5932  C C5    . DG  B 1 144 ? 5.089   10.619  -86.489 1.00 37.06  ? 290  DG  J C5    1 
ATOM   5933  C C6    . DG  B 1 144 ? 5.810   9.466   -86.942 1.00 37.06  ? 290  DG  J C6    1 
ATOM   5934  O O6    . DG  B 1 144 ? 5.435   8.275   -86.905 1.00 37.06  ? 290  DG  J O6    1 
ATOM   5935  N N1    . DG  B 1 144 ? 7.037   9.810   -87.523 1.00 37.06  ? 290  DG  J N1    1 
ATOM   5936  C C2    . DG  B 1 144 ? 7.468   11.116  -87.728 1.00 37.06  ? 290  DG  J C2    1 
ATOM   5937  N N2    . DG  B 1 144 ? 8.606   11.335  -88.412 1.00 37.06  ? 290  DG  J N2    1 
ATOM   5938  N N3    . DG  B 1 144 ? 6.812   12.177  -87.322 1.00 37.06  ? 290  DG  J N3    1 
ATOM   5939  C C4    . DG  B 1 144 ? 5.652   11.860  -86.713 1.00 37.06  ? 290  DG  J C4    1 
ATOM   5940  P P     . DA  B 1 145 ? 4.324   17.859  -88.094 1.00 63.43  ? 291  DA  J P     1 
ATOM   5941  O OP1   . DA  B 1 145 ? 4.591   19.229  -87.703 1.00 37.22  ? 291  DA  J OP1   1 
ATOM   5942  O OP2   . DA  B 1 145 ? 2.933   17.366  -88.236 1.00 37.22  ? 291  DA  J OP2   1 
ATOM   5943  O "O5'" . DA  B 1 145 ? 5.239   17.718  -89.371 1.00 63.43  ? 291  DA  J "O5'" 1 
ATOM   5944  C "C5'" . DA  B 1 145 ? 6.653   17.774  -89.227 1.00 63.43  ? 291  DA  J "C5'" 1 
ATOM   5945  C "C4'" . DA  B 1 145 ? 7.303   16.893  -90.273 1.00 63.43  ? 291  DA  J "C4'" 1 
ATOM   5946  O "O4'" . DA  B 1 145 ? 7.209   15.472  -89.972 1.00 63.43  ? 291  DA  J "O4'" 1 
ATOM   5947  C "C3'" . DA  B 1 145 ? 6.682   17.054  -91.663 1.00 63.43  ? 291  DA  J "C3'" 1 
ATOM   5948  O "O3'" . DA  B 1 145 ? 7.738   16.953  -92.658 1.00 63.43  ? 291  DA  J "O3'" 1 
ATOM   5949  C "C2'" . DA  B 1 145 ? 5.766   15.851  -91.744 1.00 63.43  ? 291  DA  J "C2'" 1 
ATOM   5950  C "C1'" . DA  B 1 145 ? 6.604   14.798  -91.056 1.00 63.43  ? 291  DA  J "C1'" 1 
ATOM   5951  N N9    . DA  B 1 145 ? 5.768   13.722  -90.533 1.00 37.22  ? 291  DA  J N9    1 
ATOM   5952  C C8    . DA  B 1 145 ? 4.599   13.864  -89.794 1.00 37.22  ? 291  DA  J C8    1 
ATOM   5953  N N7    . DA  B 1 145 ? 4.015   12.710  -89.490 1.00 37.22  ? 291  DA  J N7    1 
ATOM   5954  C C5    . DA  B 1 145 ? 4.854   11.763  -90.046 1.00 37.22  ? 291  DA  J C5    1 
ATOM   5955  C C6    . DA  B 1 145 ? 4.808   10.390  -90.050 1.00 37.22  ? 291  DA  J C6    1 
ATOM   5956  N N6    . DA  B 1 145 ? 3.805   9.699   -89.483 1.00 37.22  ? 291  DA  J N6    1 
ATOM   5957  N N1    . DA  B 1 145 ? 5.825   9.717   -90.665 1.00 37.22  ? 291  DA  J N1    1 
ATOM   5958  C C2    . DA  B 1 145 ? 6.777   10.411  -91.234 1.00 37.22  ? 291  DA  J C2    1 
ATOM   5959  N N3    . DA  B 1 145 ? 6.924   11.718  -91.316 1.00 37.22  ? 291  DA  J N3    1 
ATOM   5960  C C4    . DA  B 1 145 ? 5.931   12.356  -90.693 1.00 37.22  ? 291  DA  J C4    1 
ATOM   5961  P P     . DT  B 1 146 ? 7.496   17.421  -94.208 1.00 66.82  ? 292  DT  J P     1 
ATOM   5962  O OP1   . DT  B 1 146 ? 8.789   18.125  -94.526 1.00 42.21  ? 292  DT  J OP1   1 
ATOM   5963  O OP2   . DT  B 1 146 ? 6.165   18.135  -94.358 1.00 42.21  ? 292  DT  J OP2   1 
ATOM   5964  O "O5'" . DT  B 1 146 ? 7.451   16.047  -95.003 1.00 66.82  ? 292  DT  J "O5'" 1 
ATOM   5965  C "C5'" . DT  B 1 146 ? 8.485   15.082  -94.811 1.00 66.82  ? 292  DT  J "C5'" 1 
ATOM   5966  C "C4'" . DT  B 1 146 ? 8.193   13.853  -95.635 1.00 66.82  ? 292  DT  J "C4'" 1 
ATOM   5967  O "O4'" . DT  B 1 146 ? 7.411   12.869  -94.916 1.00 66.82  ? 292  DT  J "O4'" 1 
ATOM   5968  C "C3'" . DT  B 1 146 ? 7.385   14.180  -96.892 1.00 66.82  ? 292  DT  J "C3'" 1 
ATOM   5969  O "O3'" . DT  B 1 146 ? 7.777   13.185  -97.900 1.00 66.82  ? 292  DT  J "O3'" 1 
ATOM   5970  C "C2'" . DT  B 1 146 ? 5.955   13.988  -96.402 1.00 66.82  ? 292  DT  J "C2'" 1 
ATOM   5971  C "C1'" . DT  B 1 146 ? 6.156   12.735  -95.571 1.00 66.82  ? 292  DT  J "C1'" 1 
ATOM   5972  N N1    . DT  B 1 146 ? 5.132   12.430  -94.575 1.00 42.21  ? 292  DT  J N1    1 
ATOM   5973  C C2    . DT  B 1 146 ? 4.976   11.114  -94.338 1.00 42.21  ? 292  DT  J C2    1 
ATOM   5974  O O2    . DT  B 1 146 ? 5.708   10.285  -94.843 1.00 42.21  ? 292  DT  J O2    1 
ATOM   5975  N N3    . DT  B 1 146 ? 3.938   10.782  -93.514 1.00 42.21  ? 292  DT  J N3    1 
ATOM   5976  C C4    . DT  B 1 146 ? 3.039   11.637  -92.939 1.00 42.21  ? 292  DT  J C4    1 
ATOM   5977  O O4    . DT  B 1 146 ? 2.073   11.173  -92.305 1.00 42.21  ? 292  DT  J O4    1 
ATOM   5978  C C5    . DT  B 1 146 ? 3.303   13.042  -93.184 1.00 42.21  ? 292  DT  J C5    1 
ATOM   5979  C C7    . DT  B 1 146 ? 2.381   14.055  -92.594 1.00 42.21  ? 292  DT  J C7    1 
ATOM   5980  C C6    . DT  B 1 146 ? 4.344   13.367  -93.959 1.00 42.21  ? 292  DT  J C6    1 
ATOM   5981  N N     . LYS C 2 37  ? -62.516 30.485  -81.495 1.00 157.62 ? 437  LYS A N     1 
ATOM   5982  C CA    . LYS C 2 37  ? -62.290 29.621  -80.336 1.00 157.62 ? 437  LYS A CA    1 
ATOM   5983  C C     . LYS C 2 37  ? -60.790 29.570  -80.020 1.00 157.62 ? 437  LYS A C     1 
ATOM   5984  O O     . LYS C 2 37  ? -60.355 30.188  -79.045 1.00 157.62 ? 437  LYS A O     1 
ATOM   5985  C CB    . LYS C 2 37  ? -62.840 28.195  -80.622 1.00 85.99  ? 437  LYS A CB    1 
ATOM   5986  C CG    . LYS C 2 37  ? -63.203 27.276  -79.417 1.00 18.53  ? 437  LYS A CG    1 
ATOM   5987  C CD    . LYS C 2 37  ? -63.780 25.854  -80.054 1.00 18.53  ? 437  LYS A CD    1 
ATOM   5988  C CE    . LYS C 2 37  ? -63.108 24.648  -79.061 1.00 18.53  ? 437  LYS A CE    1 
ATOM   5989  N NZ    . LYS C 2 37  ? -64.367 24.050  -78.173 1.00 18.53  ? 437  LYS A NZ    1 
ATOM   5990  N N     . PRO C 2 38  ? -59.975 28.929  -80.897 1.00 100.89 ? 438  PRO A N     1 
ATOM   5991  C CA    . PRO C 2 38  ? -58.527 28.743  -80.733 1.00 100.89 ? 438  PRO A CA    1 
ATOM   5992  C C     . PRO C 2 38  ? -57.574 29.672  -80.019 1.00 100.89 ? 438  PRO A C     1 
ATOM   5993  O O     . PRO C 2 38  ? -57.227 30.752  -80.514 1.00 100.89 ? 438  PRO A O     1 
ATOM   5994  C CB    . PRO C 2 38  ? -58.060 28.411  -82.135 1.00 92.96  ? 438  PRO A CB    1 
ATOM   5995  C CG    . PRO C 2 38  ? -59.076 27.495  -82.515 1.00 92.96  ? 438  PRO A CG    1 
ATOM   5996  C CD    . PRO C 2 38  ? -60.364 28.287  -82.166 1.00 92.96  ? 438  PRO A CD    1 
ATOM   5997  N N     . HIS C 2 39  ? -57.147 29.224  -78.829 1.00 97.88  ? 439  HIS A N     1 
ATOM   5998  C CA    . HIS C 2 39  ? -56.149 29.937  -78.026 1.00 97.88  ? 439  HIS A CA    1 
ATOM   5999  C C     . HIS C 2 39  ? -55.181 28.852  -77.848 1.00 97.88  ? 439  HIS A C     1 
ATOM   6000  O O     . HIS C 2 39  ? -55.523 27.703  -77.989 1.00 97.88  ? 439  HIS A O     1 
ATOM   6001  C CB    . HIS C 2 39  ? -56.511 30.296  -76.596 1.00 66.37  ? 439  HIS A CB    1 
ATOM   6002  C CG    . HIS C 2 39  ? -55.726 31.441  -76.154 1.00 66.37  ? 439  HIS A CG    1 
ATOM   6003  N ND1   . HIS C 2 39  ? -56.198 32.715  -76.345 1.00 66.37  ? 439  HIS A ND1   1 
ATOM   6004  C CD2   . HIS C 2 39  ? -54.428 31.562  -75.772 1.00 66.37  ? 439  HIS A CD2   1 
ATOM   6005  C CE1   . HIS C 2 39  ? -55.233 33.586  -76.092 1.00 66.37  ? 439  HIS A CE1   1 
ATOM   6006  N NE2   . HIS C 2 39  ? -54.147 32.914  -75.741 1.00 66.37  ? 439  HIS A NE2   1 
ATOM   6007  N N     . ARG C 2 40  ? -53.988 29.221  -77.471 1.00 75.20  ? 440  ARG A N     1 
ATOM   6008  C CA    . ARG C 2 40  ? -52.957 28.286  -77.249 1.00 75.20  ? 440  ARG A CA    1 
ATOM   6009  C C     . ARG C 2 40  ? -51.840 29.163  -76.922 1.00 75.20  ? 440  ARG A C     1 
ATOM   6010  O O     . ARG C 2 40  ? -51.443 30.097  -77.635 1.00 75.20  ? 440  ARG A O     1 
ATOM   6011  C CB    . ARG C 2 40  ? -52.695 27.434  -78.486 1.00 44.92  ? 440  ARG A CB    1 
ATOM   6012  C CG    . ARG C 2 40  ? -52.136 26.070  -78.142 1.00 44.92  ? 440  ARG A CG    1 
ATOM   6013  C CD    . ARG C 2 40  ? -51.809 25.323  -79.331 1.00 44.92  ? 440  ARG A CD    1 
ATOM   6014  N NE    . ARG C 2 40  ? -50.813 24.286  -79.101 1.00 44.92  ? 440  ARG A NE    1 
ATOM   6015  C CZ    . ARG C 2 40  ? -51.059 23.144  -78.473 1.00 44.92  ? 440  ARG A CZ    1 
ATOM   6016  N NH1   . ARG C 2 40  ? -52.263 22.907  -78.000 1.00 44.92  ? 440  ARG A NH1   1 
ATOM   6017  N NH2   . ARG C 2 40  ? -50.106 22.214  -78.362 1.00 44.92  ? 440  ARG A NH2   1 
ATOM   6018  N N     . TYR C 2 41  ? -51.370 28.924  -75.744 1.00 54.39  ? 441  TYR A N     1 
ATOM   6019  C CA    . TYR C 2 41  ? -50.225 29.684  -75.396 1.00 54.39  ? 441  TYR A CA    1 
ATOM   6020  C C     . TYR C 2 41  ? -48.961 29.046  -76.080 1.00 54.39  ? 441  TYR A C     1 
ATOM   6021  O O     . TYR C 2 41  ? -48.896 27.801  -76.318 1.00 54.39  ? 441  TYR A O     1 
ATOM   6022  C CB    . TYR C 2 41  ? -50.106 29.700  -73.893 1.00 34.07  ? 441  TYR A CB    1 
ATOM   6023  C CG    . TYR C 2 41  ? -51.073 30.620  -73.234 1.00 34.07  ? 441  TYR A CG    1 
ATOM   6024  C CD1   . TYR C 2 41  ? -52.075 30.116  -72.401 1.00 34.07  ? 441  TYR A CD1   1 
ATOM   6025  C CD2   . TYR C 2 41  ? -50.990 32.011  -73.438 1.00 34.07  ? 441  TYR A CD2   1 
ATOM   6026  C CE1   . TYR C 2 41  ? -52.975 30.967  -71.781 1.00 34.07  ? 441  TYR A CE1   1 
ATOM   6027  C CE2   . TYR C 2 41  ? -51.901 32.851  -72.832 1.00 34.07  ? 441  TYR A CE2   1 
ATOM   6028  C CZ    . TYR C 2 41  ? -52.889 32.303  -72.015 1.00 34.07  ? 441  TYR A CZ    1 
ATOM   6029  O OH    . TYR C 2 41  ? -53.846 33.102  -71.512 1.00 34.07  ? 441  TYR A OH    1 
ATOM   6030  N N     . ARG C 2 42  ? -47.961 29.881  -76.387 1.00 42.78  ? 442  ARG A N     1 
ATOM   6031  C CA    . ARG C 2 42  ? -46.765 29.355  -77.011 1.00 42.78  ? 442  ARG A CA    1 
ATOM   6032  C C     . ARG C 2 42  ? -45.860 28.650  -76.018 1.00 42.78  ? 442  ARG A C     1 
ATOM   6033  O O     . ARG C 2 42  ? -45.876 28.951  -74.798 1.00 42.78  ? 442  ARG A O     1 
ATOM   6034  C CB    . ARG C 2 42  ? -46.051 30.451  -77.765 1.00 85.56  ? 442  ARG A CB    1 
ATOM   6035  C CG    . ARG C 2 42  ? -46.930 30.988  -78.853 1.00 85.56  ? 442  ARG A CG    1 
ATOM   6036  C CD    . ARG C 2 42  ? -46.149 31.697  -79.909 1.00 85.56  ? 442  ARG A CD    1 
ATOM   6037  N NE    . ARG C 2 42  ? -45.172 32.566  -79.263 1.00 85.56  ? 442  ARG A NE    1 
ATOM   6038  C CZ    . ARG C 2 42  ? -44.163 33.178  -79.881 1.00 85.56  ? 442  ARG A CZ    1 
ATOM   6039  N NH1   . ARG C 2 42  ? -43.991 33.018  -81.195 1.00 85.56  ? 442  ARG A NH1   1 
ATOM   6040  N NH2   . ARG C 2 42  ? -43.318 33.937  -79.179 1.00 85.56  ? 442  ARG A NH2   1 
ATOM   6041  N N     . PRO C 2 43  ? -45.088 27.657  -76.504 1.00 31.82  ? 443  PRO A N     1 
ATOM   6042  C CA    . PRO C 2 43  ? -44.223 26.987  -75.540 1.00 31.82  ? 443  PRO A CA    1 
ATOM   6043  C C     . PRO C 2 43  ? -43.392 27.970  -74.740 1.00 31.82  ? 443  PRO A C     1 
ATOM   6044  O O     . PRO C 2 43  ? -42.765 28.856  -75.280 1.00 31.82  ? 443  PRO A O     1 
ATOM   6045  C CB    . PRO C 2 43  ? -43.403 26.055  -76.422 1.00 54.02  ? 443  PRO A CB    1 
ATOM   6046  C CG    . PRO C 2 43  ? -44.376 25.717  -77.508 1.00 54.02  ? 443  PRO A CG    1 
ATOM   6047  C CD    . PRO C 2 43  ? -44.918 27.050  -77.838 1.00 54.02  ? 443  PRO A CD    1 
ATOM   6048  N N     . GLY C 2 44  ? -43.507 27.842  -73.424 1.00 41.68  ? 444  GLY A N     1 
ATOM   6049  C CA    . GLY C 2 44  ? -42.738 28.673  -72.506 1.00 41.68  ? 444  GLY A CA    1 
ATOM   6050  C C     . GLY C 2 44  ? -43.535 29.677  -71.728 1.00 41.68  ? 444  GLY A C     1 
ATOM   6051  O O     . GLY C 2 44  ? -43.137 30.113  -70.704 1.00 41.68  ? 444  GLY A O     1 
ATOM   6052  N N     . THR C 2 45  ? -44.703 30.030  -72.207 1.00 35.04  ? 445  THR A N     1 
ATOM   6053  C CA    . THR C 2 45  ? -45.455 31.040  -71.523 1.00 35.04  ? 445  THR A CA    1 
ATOM   6054  C C     . THR C 2 45  ? -46.087 30.518  -70.289 1.00 35.04  ? 445  THR A C     1 
ATOM   6055  O O     . THR C 2 45  ? -46.190 31.217  -69.288 1.00 35.04  ? 445  THR A O     1 
ATOM   6056  C CB    . THR C 2 45  ? -46.547 31.636  -72.427 1.00 41.34  ? 445  THR A CB    1 
ATOM   6057  O OG1   . THR C 2 45  ? -45.932 32.188  -73.588 1.00 41.34  ? 445  THR A OG1   1 
ATOM   6058  C CG2   . THR C 2 45  ? -47.286 32.741  -71.714 1.00 41.34  ? 445  THR A CG2   1 
ATOM   6059  N N     . VAL C 2 46  ? -46.546 29.294  -70.349 1.00 34.55  ? 446  VAL A N     1 
ATOM   6060  C CA    . VAL C 2 46  ? -47.167 28.786  -69.167 1.00 34.55  ? 446  VAL A CA    1 
ATOM   6061  C C     . VAL C 2 46  ? -46.108 28.309  -68.222 1.00 34.55  ? 446  VAL A C     1 
ATOM   6062  O O     . VAL C 2 46  ? -46.298 28.306  -67.019 1.00 34.55  ? 446  VAL A O     1 
ATOM   6063  C CB    . VAL C 2 46  ? -48.034 27.655  -69.442 1.00 44.90  ? 446  VAL A CB    1 
ATOM   6064  C CG1   . VAL C 2 46  ? -48.894 27.412  -68.204 1.00 44.90  ? 446  VAL A CG1   1 
ATOM   6065  C CG2   . VAL C 2 46  ? -48.794 27.928  -70.695 1.00 44.90  ? 446  VAL A CG2   1 
ATOM   6066  N N     . ALA C 2 47  ? -44.997 27.870  -68.774 1.00 49.82  ? 447  ALA A N     1 
ATOM   6067  C CA    . ALA C 2 47  ? -43.955 27.438  -67.917 1.00 49.82  ? 447  ALA A CA    1 
ATOM   6068  C C     . ALA C 2 47  ? -43.636 28.679  -67.062 1.00 49.82  ? 447  ALA A C     1 
ATOM   6069  O O     . ALA C 2 47  ? -43.647 28.626  -65.850 1.00 49.82  ? 447  ALA A O     1 
ATOM   6070  C CB    . ALA C 2 47  ? -42.785 27.021  -68.747 1.00 39.22  ? 447  ALA A CB    1 
ATOM   6071  N N     . LEU C 2 48  ? -43.396 29.800  -67.714 1.00 28.96  ? 448  LEU A N     1 
ATOM   6072  C CA    . LEU C 2 48  ? -43.047 31.053  -67.076 1.00 28.96  ? 448  LEU A CA    1 
ATOM   6073  C C     . LEU C 2 48  ? -44.070 31.478  -66.021 1.00 28.96  ? 448  LEU A C     1 
ATOM   6074  O O     . LEU C 2 48  ? -43.788 31.924  -64.910 1.00 28.96  ? 448  LEU A O     1 
ATOM   6075  C CB    . LEU C 2 48  ? -42.943 32.123  -68.152 1.00 33.85  ? 448  LEU A CB    1 
ATOM   6076  C CG    . LEU C 2 48  ? -41.535 32.635  -68.077 1.00 33.85  ? 448  LEU A CG    1 
ATOM   6077  C CD1   . LEU C 2 48  ? -40.592 31.629  -68.565 1.00 33.85  ? 448  LEU A CD1   1 
ATOM   6078  C CD2   . LEU C 2 48  ? -41.450 33.821  -68.915 1.00 33.85  ? 448  LEU A CD2   1 
ATOM   6079  N N     . ARG C 2 49  ? -45.301 31.349  -66.412 1.00 46.14  ? 449  ARG A N     1 
ATOM   6080  C CA    . ARG C 2 49  ? -46.359 31.681  -65.528 1.00 46.14  ? 449  ARG A CA    1 
ATOM   6081  C C     . ARG C 2 49  ? -46.208 30.831  -64.196 1.00 46.14  ? 449  ARG A C     1 
ATOM   6082  O O     . ARG C 2 49  ? -46.266 31.339  -63.069 1.00 46.14  ? 449  ARG A O     1 
ATOM   6083  C CB    . ARG C 2 49  ? -47.642 31.425  -66.341 1.00 38.00  ? 449  ARG A CB    1 
ATOM   6084  C CG    . ARG C 2 49  ? -48.816 32.058  -65.728 1.00 38.00  ? 449  ARG A CG    1 
ATOM   6085  C CD    . ARG C 2 49  ? -49.822 32.543  -66.668 1.00 38.00  ? 449  ARG A CD    1 
ATOM   6086  N NE    . ARG C 2 49  ? -50.449 31.420  -67.348 1.00 38.00  ? 449  ARG A NE    1 
ATOM   6087  C CZ    . ARG C 2 49  ? -50.903 31.515  -68.597 1.00 38.00  ? 449  ARG A CZ    1 
ATOM   6088  N NH1   . ARG C 2 49  ? -50.786 32.703  -69.246 1.00 38.00  ? 449  ARG A NH1   1 
ATOM   6089  N NH2   . ARG C 2 49  ? -51.431 30.430  -69.183 1.00 38.00  ? 449  ARG A NH2   1 
ATOM   6090  N N     . GLU C 2 50  ? -45.994 29.535  -64.381 1.00 35.63  ? 450  GLU A N     1 
ATOM   6091  C CA    . GLU C 2 50  ? -45.799 28.599  -63.324 1.00 35.63  ? 450  GLU A CA    1 
ATOM   6092  C C     . GLU C 2 50  ? -44.585 28.989  -62.494 1.00 35.63  ? 450  GLU A C     1 
ATOM   6093  O O     . GLU C 2 50  ? -44.679 28.915  -61.284 1.00 35.63  ? 450  GLU A O     1 
ATOM   6094  C CB    . GLU C 2 50  ? -45.621 27.216  -63.881 1.00 40.87  ? 450  GLU A CB    1 
ATOM   6095  C CG    . GLU C 2 50  ? -46.808 26.617  -64.462 1.00 40.87  ? 450  GLU A CG    1 
ATOM   6096  C CD    . GLU C 2 50  ? -46.550 25.193  -64.973 1.00 40.87  ? 450  GLU A CD    1 
ATOM   6097  O OE1   . GLU C 2 50  ? -46.372 24.291  -64.129 1.00 40.87  ? 450  GLU A OE1   1 
ATOM   6098  O OE2   . GLU C 2 50  ? -46.515 24.947  -66.229 1.00 40.87  ? 450  GLU A OE2   1 
ATOM   6099  N N     . ILE C 2 51  ? -43.438 29.348  -63.091 1.00 33.66  ? 451  ILE A N     1 
ATOM   6100  C CA    . ILE C 2 51  ? -42.313 29.790  -62.289 1.00 33.66  ? 451  ILE A CA    1 
ATOM   6101  C C     . ILE C 2 51  ? -42.825 30.973  -61.487 1.00 33.66  ? 451  ILE A C     1 
ATOM   6102  O O     . ILE C 2 51  ? -42.890 30.930  -60.286 1.00 33.66  ? 451  ILE A O     1 
ATOM   6103  C CB    . ILE C 2 51  ? -41.145 30.281  -63.120 1.00 36.17  ? 451  ILE A CB    1 
ATOM   6104  C CG1   . ILE C 2 51  ? -40.374 29.082  -63.695 1.00 36.17  ? 451  ILE A CG1   1 
ATOM   6105  C CG2   . ILE C 2 51  ? -40.222 31.176  -62.266 1.00 36.17  ? 451  ILE A CG2   1 
ATOM   6106  C CD1   . ILE C 2 51  ? -39.275 29.475  -64.745 1.00 36.17  ? 451  ILE A CD1   1 
ATOM   6107  N N     . ARG C 2 52  ? -43.235 32.043  -62.119 1.00 25.37  ? 452  ARG A N     1 
ATOM   6108  C CA    . ARG C 2 52  ? -43.700 33.123  -61.272 1.00 25.37  ? 452  ARG A CA    1 
ATOM   6109  C C     . ARG C 2 52  ? -44.588 32.652  -60.132 1.00 25.37  ? 452  ARG A C     1 
ATOM   6110  O O     . ARG C 2 52  ? -44.367 33.039  -58.978 1.00 25.37  ? 452  ARG A O     1 
ATOM   6111  C CB    . ARG C 2 52  ? -44.392 34.235  -62.071 1.00 45.36  ? 452  ARG A CB    1 
ATOM   6112  C CG    . ARG C 2 52  ? -43.453 34.726  -63.088 1.00 45.36  ? 452  ARG A CG    1 
ATOM   6113  C CD    . ARG C 2 52  ? -43.349 36.228  -63.246 1.00 45.36  ? 452  ARG A CD    1 
ATOM   6114  N NE    . ARG C 2 52  ? -42.496 36.600  -64.418 1.00 45.36  ? 452  ARG A NE    1 
ATOM   6115  C CZ    . ARG C 2 52  ? -42.822 36.307  -65.691 1.00 45.36  ? 452  ARG A CZ    1 
ATOM   6116  N NH1   . ARG C 2 52  ? -43.979 35.659  -65.956 1.00 45.36  ? 452  ARG A NH1   1 
ATOM   6117  N NH2   . ARG C 2 52  ? -41.995 36.586  -66.696 1.00 45.36  ? 452  ARG A NH2   1 
ATOM   6118  N N     . ARG C 2 53  ? -45.561 31.816  -60.438 1.00 35.80  ? 453  ARG A N     1 
ATOM   6119  C CA    . ARG C 2 53  ? -46.438 31.351  -59.406 1.00 35.80  ? 453  ARG A CA    1 
ATOM   6120  C C     . ARG C 2 53  ? -45.758 30.685  -58.206 1.00 35.80  ? 453  ARG A C     1 
ATOM   6121  O O     . ARG C 2 53  ? -45.886 31.122  -57.059 1.00 35.80  ? 453  ARG A O     1 
ATOM   6122  C CB    . ARG C 2 53  ? -47.433 30.400  -59.991 1.00 84.34  ? 453  ARG A CB    1 
ATOM   6123  C CG    . ARG C 2 53  ? -48.261 29.800  -58.946 1.00 84.34  ? 453  ARG A CG    1 
ATOM   6124  C CD    . ARG C 2 53  ? -49.176 28.838  -59.560 1.00 84.34  ? 453  ARG A CD    1 
ATOM   6125  N NE    . ARG C 2 53  ? -49.891 28.093  -58.539 1.00 84.34  ? 453  ARG A NE    1 
ATOM   6126  C CZ    . ARG C 2 53  ? -50.706 27.081  -58.812 1.00 84.34  ? 453  ARG A CZ    1 
ATOM   6127  N NH1   . ARG C 2 53  ? -50.877 26.723  -60.079 1.00 84.34  ? 453  ARG A NH1   1 
ATOM   6128  N NH2   . ARG C 2 53  ? -51.355 26.440  -57.842 1.00 84.34  ? 453  ARG A NH2   1 
ATOM   6129  N N     . TYR C 2 54  ? -45.028 29.622  -58.480 1.00 35.08  ? 454  TYR A N     1 
ATOM   6130  C CA    . TYR C 2 54  ? -44.365 28.880  -57.458 1.00 35.08  ? 454  TYR A CA    1 
ATOM   6131  C C     . TYR C 2 54  ? -43.233 29.573  -56.684 1.00 35.08  ? 454  TYR A C     1 
ATOM   6132  O O     . TYR C 2 54  ? -42.925 29.228  -55.538 1.00 35.08  ? 454  TYR A O     1 
ATOM   6133  C CB    . TYR C 2 54  ? -43.931 27.600  -58.082 1.00 30.24  ? 454  TYR A CB    1 
ATOM   6134  C CG    . TYR C 2 54  ? -45.112 26.708  -58.383 1.00 30.24  ? 454  TYR A CG    1 
ATOM   6135  C CD1   . TYR C 2 54  ? -45.379 26.293  -59.691 1.00 30.24  ? 454  TYR A CD1   1 
ATOM   6136  C CD2   . TYR C 2 54  ? -45.975 26.291  -57.380 1.00 30.24  ? 454  TYR A CD2   1 
ATOM   6137  C CE1   . TYR C 2 54  ? -46.445 25.510  -60.014 1.00 30.24  ? 454  TYR A CE1   1 
ATOM   6138  C CE2   . TYR C 2 54  ? -47.072 25.493  -57.700 1.00 30.24  ? 454  TYR A CE2   1 
ATOM   6139  C CZ    . TYR C 2 54  ? -47.292 25.115  -59.047 1.00 30.24  ? 454  TYR A CZ    1 
ATOM   6140  O OH    . TYR C 2 54  ? -48.401 24.383  -59.404 1.00 30.24  ? 454  TYR A OH    1 
ATOM   6141  N N     . GLN C 2 55  ? -42.606 30.551  -57.283 1.00 19.23  ? 455  GLN A N     1 
ATOM   6142  C CA    . GLN C 2 55  ? -41.629 31.252  -56.518 1.00 19.23  ? 455  GLN A CA    1 
ATOM   6143  C C     . GLN C 2 55  ? -42.422 32.166  -55.574 1.00 19.23  ? 455  GLN A C     1 
ATOM   6144  O O     . GLN C 2 55  ? -41.891 32.747  -54.599 1.00 19.23  ? 455  GLN A O     1 
ATOM   6145  C CB    . GLN C 2 55  ? -40.640 32.030  -57.424 1.00 26.55  ? 455  GLN A CB    1 
ATOM   6146  C CG    . GLN C 2 55  ? -39.963 31.117  -58.512 1.00 26.55  ? 455  GLN A CG    1 
ATOM   6147  C CD    . GLN C 2 55  ? -38.625 31.645  -59.087 1.00 26.55  ? 455  GLN A CD    1 
ATOM   6148  O OE1   . GLN C 2 55  ? -38.492 32.869  -59.341 1.00 26.55  ? 455  GLN A OE1   1 
ATOM   6149  N NE2   . GLN C 2 55  ? -37.638 30.725  -59.327 1.00 26.55  ? 455  GLN A NE2   1 
ATOM   6150  N N     . LYS C 2 56  ? -43.721 32.300  -55.821 1.00 29.34  ? 456  LYS A N     1 
ATOM   6151  C CA    . LYS C 2 56  ? -44.494 33.158  -54.925 1.00 29.34  ? 456  LYS A CA    1 
ATOM   6152  C C     . LYS C 2 56  ? -44.854 32.347  -53.738 1.00 29.34  ? 456  LYS A C     1 
ATOM   6153  O O     . LYS C 2 56  ? -44.579 32.732  -52.667 1.00 29.34  ? 456  LYS A O     1 
ATOM   6154  C CB    . LYS C 2 56  ? -45.771 33.684  -55.576 1.00 63.96  ? 456  LYS A CB    1 
ATOM   6155  C CG    . LYS C 2 56  ? -45.518 34.634  -56.742 1.00 63.96  ? 456  LYS A CG    1 
ATOM   6156  C CD    . LYS C 2 56  ? -46.824 35.140  -57.431 1.00 63.96  ? 456  LYS A CD    1 
ATOM   6157  C CE    . LYS C 2 56  ? -46.613 35.758  -58.869 1.00 63.96  ? 456  LYS A CE    1 
ATOM   6158  N NZ    . LYS C 2 56  ? -47.670 35.232  -59.848 1.00 63.96  ? 456  LYS A NZ    1 
ATOM   6159  N N     . SER C 2 57  ? -45.412 31.172  -53.925 1.00 37.74  ? 457  SER A N     1 
ATOM   6160  C CA    . SER C 2 57  ? -45.836 30.439  -52.780 1.00 37.74  ? 457  SER A CA    1 
ATOM   6161  C C     . SER C 2 57  ? -44.772 29.663  -52.076 1.00 37.74  ? 457  SER A C     1 
ATOM   6162  O O     . SER C 2 57  ? -43.609 29.699  -52.499 1.00 37.74  ? 457  SER A O     1 
ATOM   6163  C CB    . SER C 2 57  ? -46.911 29.477  -53.196 1.00 39.15  ? 457  SER A CB    1 
ATOM   6164  O OG    . SER C 2 57  ? -46.343 28.485  -53.983 1.00 39.15  ? 457  SER A OG    1 
ATOM   6165  N N     . THR C 2 58  ? -45.207 28.916  -51.042 1.00 26.26  ? 458  THR A N     1 
ATOM   6166  C CA    . THR C 2 58  ? -44.335 28.070  -50.254 1.00 26.26  ? 458  THR A CA    1 
ATOM   6167  C C     . THR C 2 58  ? -44.836 26.698  -49.895 1.00 26.26  ? 458  THR A C     1 
ATOM   6168  O O     . THR C 2 58  ? -44.196 26.010  -49.152 1.00 26.26  ? 458  THR A O     1 
ATOM   6169  C CB    . THR C 2 58  ? -43.960 28.725  -48.961 1.00 32.09  ? 458  THR A CB    1 
ATOM   6170  O OG1   . THR C 2 58  ? -45.117 28.816  -48.169 1.00 32.09  ? 458  THR A OG1   1 
ATOM   6171  C CG2   . THR C 2 58  ? -43.466 30.086  -49.190 1.00 32.09  ? 458  THR A CG2   1 
ATOM   6172  N N     . GLU C 2 59  ? -45.981 26.295  -50.410 1.00 33.56  ? 459  GLU A N     1 
ATOM   6173  C CA    . GLU C 2 59  ? -46.514 24.958  -50.105 1.00 33.56  ? 459  GLU A CA    1 
ATOM   6174  C C     . GLU C 2 59  ? -45.573 23.938  -50.624 1.00 33.56  ? 459  GLU A C     1 
ATOM   6175  O O     . GLU C 2 59  ? -44.737 24.212  -51.492 1.00 33.56  ? 459  GLU A O     1 
ATOM   6176  C CB    . GLU C 2 59  ? -47.858 24.672  -50.779 1.00 60.23  ? 459  GLU A CB    1 
ATOM   6177  C CG    . GLU C 2 59  ? -48.481 25.768  -51.578 1.00 60.23  ? 459  GLU A CG    1 
ATOM   6178  C CD    . GLU C 2 59  ? -47.947 25.830  -52.979 1.00 60.23  ? 459  GLU A CD    1 
ATOM   6179  O OE1   . GLU C 2 59  ? -47.403 24.810  -53.436 1.00 60.23  ? 459  GLU A OE1   1 
ATOM   6180  O OE2   . GLU C 2 59  ? -48.086 26.880  -53.640 1.00 60.23  ? 459  GLU A OE2   1 
ATOM   6181  N N     . LEU C 2 60  ? -45.710 22.745  -50.104 1.00 35.72  ? 460  LEU A N     1 
ATOM   6182  C CA    . LEU C 2 60  ? -44.884 21.676  -50.591 1.00 35.72  ? 460  LEU A CA    1 
ATOM   6183  C C     . LEU C 2 60  ? -45.483 21.329  -51.951 1.00 35.72  ? 460  LEU A C     1 
ATOM   6184  O O     . LEU C 2 60  ? -46.621 21.675  -52.217 1.00 35.72  ? 460  LEU A O     1 
ATOM   6185  C CB    . LEU C 2 60  ? -44.938 20.493  -49.632 1.00 25.42  ? 460  LEU A CB    1 
ATOM   6186  C CG    . LEU C 2 60  ? -44.398 20.947  -48.275 1.00 25.42  ? 460  LEU A CG    1 
ATOM   6187  C CD1   . LEU C 2 60  ? -44.551 19.879  -47.257 1.00 25.42  ? 460  LEU A CD1   1 
ATOM   6188  C CD2   . LEU C 2 60  ? -42.982 21.370  -48.429 1.00 25.42  ? 460  LEU A CD2   1 
ATOM   6189  N N     . LEU C 2 61  ? -44.754 20.632  -52.805 1.00 32.03  ? 461  LEU A N     1 
ATOM   6190  C CA    . LEU C 2 61  ? -45.274 20.388  -54.090 1.00 32.03  ? 461  LEU A CA    1 
ATOM   6191  C C     . LEU C 2 61  ? -45.344 18.901  -54.321 1.00 32.03  ? 461  LEU A C     1 
ATOM   6192  O O     . LEU C 2 61  ? -45.849 18.440  -55.365 1.00 32.03  ? 461  LEU A O     1 
ATOM   6193  C CB    . LEU C 2 61  ? -44.385 21.126  -55.073 1.00 18.05  ? 461  LEU A CB    1 
ATOM   6194  C CG    . LEU C 2 61  ? -44.128 22.598  -54.634 1.00 18.05  ? 461  LEU A CG    1 
ATOM   6195  C CD1   . LEU C 2 61  ? -43.065 23.214  -55.423 1.00 18.05  ? 461  LEU A CD1   1 
ATOM   6196  C CD2   . LEU C 2 61  ? -45.307 23.500  -54.760 1.00 18.05  ? 461  LEU A CD2   1 
ATOM   6197  N N     . ILE C 2 62  ? -44.839 18.106  -53.385 1.00 30.15  ? 462  ILE A N     1 
ATOM   6198  C CA    . ILE C 2 62  ? -44.967 16.662  -53.579 1.00 30.15  ? 462  ILE A CA    1 
ATOM   6199  C C     . ILE C 2 62  ? -46.166 16.241  -52.759 1.00 30.15  ? 462  ILE A C     1 
ATOM   6200  O O     . ILE C 2 62  ? -46.332 16.732  -51.646 1.00 30.15  ? 462  ILE A O     1 
ATOM   6201  C CB    . ILE C 2 62  ? -43.750 15.936  -53.098 1.00 17.27  ? 462  ILE A CB    1 
ATOM   6202  C CG1   . ILE C 2 62  ? -42.554 16.495  -53.823 1.00 17.27  ? 462  ILE A CG1   1 
ATOM   6203  C CG2   . ILE C 2 62  ? -43.909 14.418  -53.330 1.00 17.27  ? 462  ILE A CG2   1 
ATOM   6204  C CD1   . ILE C 2 62  ? -41.421 15.661  -53.594 1.00 17.27  ? 462  ILE A CD1   1 
ATOM   6205  N N     . ARG C 2 63  ? -47.014 15.352  -53.274 1.00 25.45  ? 463  ARG A N     1 
ATOM   6206  C CA    . ARG C 2 63  ? -48.219 14.956  -52.511 1.00 25.45  ? 463  ARG A CA    1 
ATOM   6207  C C     . ARG C 2 63  ? -47.866 14.068  -51.336 1.00 25.45  ? 463  ARG A C     1 
ATOM   6208  O O     . ARG C 2 63  ? -47.175 13.043  -51.451 1.00 25.45  ? 463  ARG A O     1 
ATOM   6209  C CB    . ARG C 2 63  ? -49.253 14.313  -53.428 1.00 65.50  ? 463  ARG A CB    1 
ATOM   6210  C CG    . ARG C 2 63  ? -49.887 15.276  -54.405 1.00 65.50  ? 463  ARG A CG    1 
ATOM   6211  C CD    . ARG C 2 63  ? -50.782 14.490  -55.382 1.00 65.50  ? 463  ARG A CD    1 
ATOM   6212  N NE    . ARG C 2 63  ? -50.126 13.266  -55.919 1.00 65.50  ? 463  ARG A NE    1 
ATOM   6213  C CZ    . ARG C 2 63  ? -50.724 12.279  -56.632 1.00 65.50  ? 463  ARG A CZ    1 
ATOM   6214  N NH1   . ARG C 2 63  ? -52.035 12.371  -56.920 1.00 65.50  ? 463  ARG A NH1   1 
ATOM   6215  N NH2   . ARG C 2 63  ? -50.023 11.169  -57.001 1.00 65.50  ? 463  ARG A NH2   1 
ATOM   6216  N N     . LYS C 2 64  ? -48.363 14.501  -50.188 1.00 19.82  ? 464  LYS A N     1 
ATOM   6217  C CA    . LYS C 2 64  ? -48.101 13.859  -48.888 1.00 19.82  ? 464  LYS A CA    1 
ATOM   6218  C C     . LYS C 2 64  ? -48.042 12.356  -48.816 1.00 19.82  ? 464  LYS A C     1 
ATOM   6219  O O     . LYS C 2 64  ? -46.993 11.737  -48.593 1.00 19.82  ? 464  LYS A O     1 
ATOM   6220  C CB    . LYS C 2 64  ? -49.100 14.338  -47.848 1.00 36.67  ? 464  LYS A CB    1 
ATOM   6221  C CG    . LYS C 2 64  ? -48.862 15.807  -47.507 1.00 36.67  ? 464  LYS A CG    1 
ATOM   6222  C CD    . LYS C 2 64  ? -49.248 16.199  -46.063 1.00 36.67  ? 464  LYS A CD    1 
ATOM   6223  C CE    . LYS C 2 64  ? -48.760 17.683  -45.728 1.00 36.67  ? 464  LYS A CE    1 
ATOM   6224  N NZ    . LYS C 2 64  ? -49.141 18.135  -44.282 1.00 36.67  ? 464  LYS A NZ    1 
ATOM   6225  N N     . LEU C 2 65  ? -49.179 11.746  -49.053 1.00 33.35  ? 465  LEU A N     1 
ATOM   6226  C CA    . LEU C 2 65  ? -49.213 10.334  -48.870 1.00 33.35  ? 465  LEU A CA    1 
ATOM   6227  C C     . LEU C 2 65  ? -48.210 9.548   -49.724 1.00 33.35  ? 465  LEU A C     1 
ATOM   6228  O O     . LEU C 2 65  ? -47.493 8.688   -49.223 1.00 33.35  ? 465  LEU A O     1 
ATOM   6229  C CB    . LEU C 2 65  ? -50.673 9.884   -48.966 1.00 25.00  ? 465  LEU A CB    1 
ATOM   6230  C CG    . LEU C 2 65  ? -50.811 8.367   -48.940 1.00 25.00  ? 465  LEU A CG    1 
ATOM   6231  C CD1   . LEU C 2 65  ? -50.873 7.876   -47.606 1.00 25.00  ? 465  LEU A CD1   1 
ATOM   6232  C CD2   . LEU C 2 65  ? -52.016 7.987   -49.767 1.00 25.00  ? 465  LEU A CD2   1 
ATOM   6233  N N     . PRO C 2 66  ? -48.134 9.832   -51.001 1.00 18.71  ? 466  PRO A N     1 
ATOM   6234  C CA    . PRO C 2 66  ? -47.137 9.064   -51.780 1.00 18.71  ? 466  PRO A CA    1 
ATOM   6235  C C     . PRO C 2 66  ? -45.788 9.270   -51.080 1.00 18.71  ? 466  PRO A C     1 
ATOM   6236  O O     . PRO C 2 66  ? -45.021 8.301   -50.885 1.00 18.71  ? 466  PRO A O     1 
ATOM   6237  C CB    . PRO C 2 66  ? -47.073 9.733   -53.134 1.00 24.23  ? 466  PRO A CB    1 
ATOM   6238  C CG    . PRO C 2 66  ? -48.267 10.642  -53.136 1.00 24.23  ? 466  PRO A CG    1 
ATOM   6239  C CD    . PRO C 2 66  ? -48.780 10.905  -51.747 1.00 24.23  ? 466  PRO A CD    1 
ATOM   6240  N N     . PHE C 2 67  ? -45.505 10.522  -50.679 1.00 23.76  ? 467  PHE A N     1 
ATOM   6241  C CA    . PHE C 2 67  ? -44.253 10.802  -50.032 1.00 23.76  ? 467  PHE A CA    1 
ATOM   6242  C C     . PHE C 2 67  ? -44.126 10.000  -48.787 1.00 23.76  ? 467  PHE A C     1 
ATOM   6243  O O     . PHE C 2 67  ? -43.112 9.383   -48.523 1.00 23.76  ? 467  PHE A O     1 
ATOM   6244  C CB    . PHE C 2 67  ? -44.162 12.235  -49.615 1.00 37.39  ? 467  PHE A CB    1 
ATOM   6245  C CG    . PHE C 2 67  ? -42.810 12.622  -49.114 1.00 37.39  ? 467  PHE A CG    1 
ATOM   6246  C CD1   . PHE C 2 67  ? -41.806 13.010  -50.007 1.00 37.39  ? 467  PHE A CD1   1 
ATOM   6247  C CD2   . PHE C 2 67  ? -42.539 12.629  -47.751 1.00 37.39  ? 467  PHE A CD2   1 
ATOM   6248  C CE1   . PHE C 2 67  ? -40.563 13.400  -49.570 1.00 37.39  ? 467  PHE A CE1   1 
ATOM   6249  C CE2   . PHE C 2 67  ? -41.257 13.029  -47.298 1.00 37.39  ? 467  PHE A CE2   1 
ATOM   6250  C CZ    . PHE C 2 67  ? -40.278 13.418  -48.229 1.00 37.39  ? 467  PHE A CZ    1 
ATOM   6251  N N     . GLN C 2 68  ? -45.174 10.025  -47.999 1.00 35.85  ? 468  GLN A N     1 
ATOM   6252  C CA    . GLN C 2 68  ? -45.116 9.341   -46.748 1.00 35.85  ? 468  GLN A CA    1 
ATOM   6253  C C     . GLN C 2 68  ? -44.775 7.920   -47.005 1.00 35.85  ? 468  GLN A C     1 
ATOM   6254  O O     . GLN C 2 68  ? -43.981 7.308   -46.290 1.00 35.85  ? 468  GLN A O     1 
ATOM   6255  C CB    . GLN C 2 68  ? -46.425 9.472   -45.995 1.00 61.25  ? 468  GLN A CB    1 
ATOM   6256  C CG    . GLN C 2 68  ? -46.209 9.160   -44.534 1.00 61.25  ? 468  GLN A CG    1 
ATOM   6257  C CD    . GLN C 2 68  ? -47.373 9.550   -43.679 1.00 61.25  ? 468  GLN A CD    1 
ATOM   6258  O OE1   . GLN C 2 68  ? -48.508 9.275   -44.064 1.00 61.25  ? 468  GLN A OE1   1 
ATOM   6259  N NE2   . GLN C 2 68  ? -47.121 10.171  -42.502 1.00 61.25  ? 468  GLN A NE2   1 
ATOM   6260  N N     . ARG C 2 69  ? -45.360 7.399   -48.064 1.00 16.61  ? 469  ARG A N     1 
ATOM   6261  C CA    . ARG C 2 69  ? -45.100 6.012   -48.471 1.00 16.61  ? 469  ARG A CA    1 
ATOM   6262  C C     . ARG C 2 69  ? -43.640 5.770   -48.804 1.00 16.61  ? 469  ARG A C     1 
ATOM   6263  O O     . ARG C 2 69  ? -43.048 4.807   -48.355 1.00 16.61  ? 469  ARG A O     1 
ATOM   6264  C CB    . ARG C 2 69  ? -45.938 5.634   -49.724 1.00 59.39  ? 469  ARG A CB    1 
ATOM   6265  C CG    . ARG C 2 69  ? -47.268 4.845   -49.491 1.00 59.39  ? 469  ARG A CG    1 
ATOM   6266  C CD    . ARG C 2 69  ? -47.816 4.114   -50.744 1.00 59.39  ? 469  ARG A CD    1 
ATOM   6267  N NE    . ARG C 2 69  ? -48.038 4.930   -51.938 1.00 59.39  ? 469  ARG A NE    1 
ATOM   6268  C CZ    . ARG C 2 69  ? -49.083 5.722   -52.169 1.00 59.39  ? 469  ARG A CZ    1 
ATOM   6269  N NH1   . ARG C 2 69  ? -50.069 5.854   -51.293 1.00 59.39  ? 469  ARG A NH1   1 
ATOM   6270  N NH2   . ARG C 2 69  ? -49.149 6.376   -53.314 1.00 59.39  ? 469  ARG A NH2   1 
ATOM   6271  N N     . LEU C 2 70  ? -43.078 6.651   -49.621 1.00 32.05  ? 470  LEU A N     1 
ATOM   6272  C CA    . LEU C 2 70  ? -41.709 6.528   -50.023 1.00 32.05  ? 470  LEU A CA    1 
ATOM   6273  C C     . LEU C 2 70  ? -40.749 6.532   -48.832 1.00 32.05  ? 470  LEU A C     1 
ATOM   6274  O O     . LEU C 2 70  ? -39.804 5.725   -48.756 1.00 32.05  ? 470  LEU A O     1 
ATOM   6275  C CB    . LEU C 2 70  ? -41.393 7.665   -50.920 1.00 29.66  ? 470  LEU A CB    1 
ATOM   6276  C CG    . LEU C 2 70  ? -39.935 7.743   -51.344 1.00 29.66  ? 470  LEU A CG    1 
ATOM   6277  C CD1   . LEU C 2 70  ? -39.511 6.514   -52.034 1.00 29.66  ? 470  LEU A CD1   1 
ATOM   6278  C CD2   . LEU C 2 70  ? -39.793 8.960   -52.241 1.00 29.66  ? 470  LEU A CD2   1 
ATOM   6279  N N     . VAL C 2 71  ? -40.978 7.463   -47.920 1.00 17.69  ? 471  VAL A N     1 
ATOM   6280  C CA    . VAL C 2 71  ? -40.187 7.532   -46.750 1.00 17.69  ? 471  VAL A CA    1 
ATOM   6281  C C     . VAL C 2 71  ? -40.271 6.229   -45.981 1.00 17.69  ? 471  VAL A C     1 
ATOM   6282  O O     . VAL C 2 71  ? -39.264 5.579   -45.593 1.00 17.69  ? 471  VAL A O     1 
ATOM   6283  C CB    . VAL C 2 71  ? -40.728 8.525   -45.833 1.00 31.77  ? 471  VAL A CB    1 
ATOM   6284  C CG1   . VAL C 2 71  ? -40.043 8.392   -44.482 1.00 31.77  ? 471  VAL A CG1   1 
ATOM   6285  C CG2   . VAL C 2 71  ? -40.557 9.873   -46.433 1.00 31.77  ? 471  VAL A CG2   1 
ATOM   6286  N N     . ARG C 2 72  ? -41.505 5.835   -45.703 1.00 34.38  ? 472  ARG A N     1 
ATOM   6287  C CA    . ARG C 2 72  ? -41.695 4.601   -44.929 1.00 34.38  ? 472  ARG A CA    1 
ATOM   6288  C C     . ARG C 2 72  ? -41.015 3.415   -45.550 1.00 34.38  ? 472  ARG A C     1 
ATOM   6289  O O     . ARG C 2 72  ? -40.485 2.609   -44.834 1.00 34.38  ? 472  ARG A O     1 
ATOM   6290  C CB    . ARG C 2 72  ? -43.181 4.324   -44.716 1.00 39.84  ? 472  ARG A CB    1 
ATOM   6291  C CG    . ARG C 2 72  ? -43.762 5.136   -43.596 1.00 39.84  ? 472  ARG A CG    1 
ATOM   6292  C CD    . ARG C 2 72  ? -45.105 4.674   -43.197 1.00 39.84  ? 472  ARG A CD    1 
ATOM   6293  N NE    . ARG C 2 72  ? -45.787 5.821   -42.644 1.00 39.84  ? 472  ARG A NE    1 
ATOM   6294  C CZ    . ARG C 2 72  ? -46.027 6.007   -41.352 1.00 39.84  ? 472  ARG A CZ    1 
ATOM   6295  N NH1   . ARG C 2 72  ? -45.642 5.096   -40.450 1.00 39.84  ? 472  ARG A NH1   1 
ATOM   6296  N NH2   . ARG C 2 72  ? -46.635 7.129   -40.971 1.00 39.84  ? 472  ARG A NH2   1 
ATOM   6297  N N     . GLU C 2 73  ? -41.008 3.341   -46.883 1.00 44.47  ? 473  GLU A N     1 
ATOM   6298  C CA    . GLU C 2 73  ? -40.423 2.225   -47.607 1.00 44.47  ? 473  GLU A CA    1 
ATOM   6299  C C     . GLU C 2 73  ? -38.917 2.161   -47.549 1.00 44.47  ? 473  GLU A C     1 
ATOM   6300  O O     . GLU C 2 73  ? -38.322 1.082   -47.519 1.00 44.47  ? 473  GLU A O     1 
ATOM   6301  C CB    . GLU C 2 73  ? -40.801 2.292   -49.067 1.00 57.02  ? 473  GLU A CB    1 
ATOM   6302  C CG    . GLU C 2 73  ? -40.121 1.216   -49.885 1.00 57.02  ? 473  GLU A CG    1 
ATOM   6303  C CD    . GLU C 2 73  ? -40.142 1.523   -51.380 1.00 57.02  ? 473  GLU A CD    1 
ATOM   6304  O OE1   . GLU C 2 73  ? -41.275 1.732   -51.908 1.00 57.02  ? 473  GLU A OE1   1 
ATOM   6305  O OE2   . GLU C 2 73  ? -39.033 1.561   -52.020 1.00 57.02  ? 473  GLU A OE2   1 
ATOM   6306  N N     . ILE C 2 74  ? -38.313 3.338   -47.588 1.00 39.81  ? 474  ILE A N     1 
ATOM   6307  C CA    . ILE C 2 74  ? -36.894 3.452   -47.609 1.00 39.81  ? 474  ILE A CA    1 
ATOM   6308  C C     . ILE C 2 74  ? -36.411 3.042   -46.281 1.00 39.81  ? 474  ILE A C     1 
ATOM   6309  O O     . ILE C 2 74  ? -35.390 2.346   -46.169 1.00 39.81  ? 474  ILE A O     1 
ATOM   6310  C CB    . ILE C 2 74  ? -36.473 4.935   -47.798 1.00 24.73  ? 474  ILE A CB    1 
ATOM   6311  C CG1   . ILE C 2 74  ? -36.502 5.374   -49.266 1.00 24.73  ? 474  ILE A CG1   1 
ATOM   6312  C CG2   . ILE C 2 74  ? -35.093 5.144   -47.241 1.00 24.73  ? 474  ILE A CG2   1 
ATOM   6313  C CD1   . ILE C 2 74  ? -36.430 6.875   -49.486 1.00 24.73  ? 474  ILE A CD1   1 
ATOM   6314  N N     . ALA C 2 75  ? -37.157 3.519   -45.281 1.00 26.55  ? 475  ALA A N     1 
ATOM   6315  C CA    . ALA C 2 75  ? -36.806 3.339   -43.882 1.00 26.55  ? 475  ALA A CA    1 
ATOM   6316  C C     . ALA C 2 75  ? -36.947 1.925   -43.419 1.00 26.55  ? 475  ALA A C     1 
ATOM   6317  O O     . ALA C 2 75  ? -36.208 1.420   -42.543 1.00 26.55  ? 475  ALA A O     1 
ATOM   6318  C CB    . ALA C 2 75  ? -37.627 4.207   -43.055 1.00 24.64  ? 475  ALA A CB    1 
ATOM   6319  N N     . GLN C 2 76  ? -37.913 1.273   -44.060 1.00 30.38  ? 476  GLN A N     1 
ATOM   6320  C CA    . GLN C 2 76  ? -38.188 -0.101  -43.778 1.00 30.38  ? 476  GLN A CA    1 
ATOM   6321  C C     . GLN C 2 76  ? -36.999 -0.899  -44.138 1.00 30.38  ? 476  GLN A C     1 
ATOM   6322  O O     . GLN C 2 76  ? -37.044 -2.000  -43.842 1.00 30.38  ? 476  GLN A O     1 
ATOM   6323  C CB    . GLN C 2 76  ? -39.393 -0.605  -44.553 1.00 80.89  ? 476  GLN A CB    1 
ATOM   6324  C CG    . GLN C 2 76  ? -39.827 -2.065  -44.259 1.00 80.89  ? 476  GLN A CG    1 
ATOM   6325  C CD    . GLN C 2 76  ? -40.133 -2.358  -42.797 1.00 80.89  ? 476  GLN A CD    1 
ATOM   6326  O OE1   . GLN C 2 76  ? -40.442 -1.456  -42.018 1.00 80.89  ? 476  GLN A OE1   1 
ATOM   6327  N NE2   . GLN C 2 76  ? -40.061 -3.631  -42.422 1.00 80.89  ? 476  GLN A NE2   1 
ATOM   6328  N N     . ASP C 2 77  ? -35.939 -0.403  -44.773 1.00 34.68  ? 477  ASP A N     1 
ATOM   6329  C CA    . ASP C 2 77  ? -34.804 -1.283  -45.014 1.00 34.68  ? 477  ASP A CA    1 
ATOM   6330  C C     . ASP C 2 77  ? -33.857 -1.039  -43.875 1.00 34.68  ? 477  ASP A C     1 
ATOM   6331  O O     . ASP C 2 77  ? -32.977 -1.802  -43.619 1.00 34.68  ? 477  ASP A O     1 
ATOM   6332  C CB    . ASP C 2 77  ? -34.139 -0.984  -46.344 1.00 72.45  ? 477  ASP A CB    1 
ATOM   6333  C CG    . ASP C 2 77  ? -35.043 -1.316  -47.523 1.00 72.45  ? 477  ASP A CG    1 
ATOM   6334  O OD1   . ASP C 2 77  ? -36.064 -0.619  -47.709 1.00 72.45  ? 477  ASP A OD1   1 
ATOM   6335  O OD2   . ASP C 2 77  ? -34.759 -2.284  -48.259 1.00 72.45  ? 477  ASP A OD2   1 
ATOM   6336  N N     . PHE C 2 78  ? -34.063 0.010   -43.112 1.00 41.48  ? 478  PHE A N     1 
ATOM   6337  C CA    . PHE C 2 78  ? -33.110 0.254   -42.052 1.00 41.48  ? 478  PHE A CA    1 
ATOM   6338  C C     . PHE C 2 78  ? -33.467 -0.397  -40.735 1.00 41.48  ? 478  PHE A C     1 
ATOM   6339  O O     . PHE C 2 78  ? -32.589 -0.809  -39.979 1.00 41.48  ? 478  PHE A O     1 
ATOM   6340  C CB    . PHE C 2 78  ? -32.896 1.784   -41.885 1.00 32.78  ? 478  PHE A CB    1 
ATOM   6341  C CG    . PHE C 2 78  ? -32.194 2.396   -43.045 1.00 32.78  ? 478  PHE A CG    1 
ATOM   6342  C CD1   . PHE C 2 78  ? -32.780 3.475   -43.709 1.00 32.78  ? 478  PHE A CD1   1 
ATOM   6343  C CD2   . PHE C 2 78  ? -31.092 1.725   -43.657 1.00 32.78  ? 478  PHE A CD2   1 
ATOM   6344  C CE1   . PHE C 2 78  ? -32.297 3.874   -44.943 1.00 32.78  ? 478  PHE A CE1   1 
ATOM   6345  C CE2   . PHE C 2 78  ? -30.641 2.165   -44.898 1.00 32.78  ? 478  PHE A CE2   1 
ATOM   6346  C CZ    . PHE C 2 78  ? -31.269 3.209   -45.521 1.00 32.78  ? 478  PHE A CZ    1 
ATOM   6347  N N     . LYS C 2 79  ? -34.749 -0.425  -40.413 1.00 34.98  ? 479  LYS A N     1 
ATOM   6348  C CA    . LYS C 2 79  ? -35.234 -1.045  -39.201 1.00 34.98  ? 479  LYS A CA    1 
ATOM   6349  C C     . LYS C 2 79  ? -36.686 -1.344  -39.530 1.00 34.98  ? 479  LYS A C     1 
ATOM   6350  O O     . LYS C 2 79  ? -37.339 -0.663  -40.323 1.00 34.98  ? 479  LYS A O     1 
ATOM   6351  C CB    . LYS C 2 79  ? -35.134 -0.129  -38.024 1.00 51.93  ? 479  LYS A CB    1 
ATOM   6352  C CG    . LYS C 2 79  ? -34.988 -0.969  -36.842 1.00 51.93  ? 479  LYS A CG    1 
ATOM   6353  C CD    . LYS C 2 79  ? -35.298 -0.302  -35.485 1.00 51.93  ? 479  LYS A CD    1 
ATOM   6354  C CE    . LYS C 2 79  ? -35.658 -1.392  -34.403 1.00 51.93  ? 479  LYS A CE    1 
ATOM   6355  N NZ    . LYS C 2 79  ? -35.896 -0.736  -33.086 1.00 51.93  ? 479  LYS A NZ    1 
ATOM   6356  N N     . THR C 2 80  ? -37.202 -2.390  -38.932 1.00 39.24  ? 480  THR A N     1 
ATOM   6357  C CA    . THR C 2 80  ? -38.564 -2.797  -39.223 1.00 39.24  ? 480  THR A CA    1 
ATOM   6358  C C     . THR C 2 80  ? -39.573 -2.290  -38.205 1.00 39.24  ? 480  THR A C     1 
ATOM   6359  O O     . THR C 2 80  ? -39.195 -1.889  -37.128 1.00 39.24  ? 480  THR A O     1 
ATOM   6360  C CB    . THR C 2 80  ? -38.639 -4.303  -39.207 1.00 42.08  ? 480  THR A CB    1 
ATOM   6361  O OG1   . THR C 2 80  ? -37.874 -4.743  -38.079 1.00 42.08  ? 480  THR A OG1   1 
ATOM   6362  C CG2   . THR C 2 80  ? -38.113 -4.918  -40.468 1.00 42.08  ? 480  THR A CG2   1 
ATOM   6363  N N     . ASP C 2 81  ? -40.850 -2.343  -38.589 1.00 48.97  ? 481  ASP A N     1 
ATOM   6364  C CA    . ASP C 2 81  ? -41.996 -1.959  -37.757 1.00 48.97  ? 481  ASP A CA    1 
ATOM   6365  C C     . ASP C 2 81  ? -41.759 -0.625  -37.116 1.00 48.97  ? 481  ASP A C     1 
ATOM   6366  O O     . ASP C 2 81  ? -41.750 -0.452  -35.903 1.00 48.97  ? 481  ASP A O     1 
ATOM   6367  C CB    . ASP C 2 81  ? -42.260 -3.057  -36.710 1.00 59.09  ? 481  ASP A CB    1 
ATOM   6368  C CG    . ASP C 2 81  ? -43.574 -2.866  -35.946 1.00 59.09  ? 481  ASP A CG    1 
ATOM   6369  O OD1   . ASP C 2 81  ? -44.557 -2.262  -36.530 1.00 59.09  ? 481  ASP A OD1   1 
ATOM   6370  O OD2   . ASP C 2 81  ? -43.594 -3.351  -34.762 1.00 59.09  ? 481  ASP A OD2   1 
ATOM   6371  N N     . LEU C 2 82  ? -41.583 0.354   -37.960 1.00 23.89  ? 482  LEU A N     1 
ATOM   6372  C CA    . LEU C 2 82  ? -41.276 1.637   -37.412 1.00 23.89  ? 482  LEU A CA    1 
ATOM   6373  C C     . LEU C 2 82  ? -42.511 2.497   -37.484 1.00 23.89  ? 482  LEU A C     1 
ATOM   6374  O O     . LEU C 2 82  ? -43.404 2.193   -38.249 1.00 23.89  ? 482  LEU A O     1 
ATOM   6375  C CB    . LEU C 2 82  ? -40.092 2.260   -38.194 1.00 35.12  ? 482  LEU A CB    1 
ATOM   6376  C CG    . LEU C 2 82  ? -38.682 2.017   -37.670 1.00 35.12  ? 482  LEU A CG    1 
ATOM   6377  C CD1   . LEU C 2 82  ? -37.623 2.410   -38.621 1.00 35.12  ? 482  LEU A CD1   1 
ATOM   6378  C CD2   . LEU C 2 82  ? -38.579 2.799   -36.450 1.00 35.12  ? 482  LEU A CD2   1 
ATOM   6379  N N     . ARG C 2 83  ? -42.573 3.512   -36.642 1.00 33.55  ? 483  ARG A N     1 
ATOM   6380  C CA    . ARG C 2 83  ? -43.664 4.407   -36.694 1.00 33.55  ? 483  ARG A CA    1 
ATOM   6381  C C     . ARG C 2 83  ? -42.924 5.724   -36.851 1.00 33.55  ? 483  ARG A C     1 
ATOM   6382  O O     . ARG C 2 83  ? -41.777 5.835   -36.403 1.00 33.55  ? 483  ARG A O     1 
ATOM   6383  C CB    . ARG C 2 83  ? -44.444 4.417   -35.383 1.00 71.13  ? 483  ARG A CB    1 
ATOM   6384  C CG    . ARG C 2 83  ? -44.937 3.079   -34.882 1.00 71.13  ? 483  ARG A CG    1 
ATOM   6385  C CD    . ARG C 2 83  ? -45.500 3.206   -33.464 1.00 71.13  ? 483  ARG A CD    1 
ATOM   6386  N NE    . ARG C 2 83  ? -46.931 3.449   -33.501 1.00 71.13  ? 483  ARG A NE    1 
ATOM   6387  C CZ    . ARG C 2 83  ? -47.829 2.553   -33.912 1.00 71.13  ? 483  ARG A CZ    1 
ATOM   6388  N NH1   . ARG C 2 83  ? -47.442 1.324   -34.317 1.00 71.13  ? 483  ARG A NH1   1 
ATOM   6389  N NH2   . ARG C 2 83  ? -49.112 2.912   -33.949 1.00 71.13  ? 483  ARG A NH2   1 
ATOM   6390  N N     . PHE C 2 84  ? -43.602 6.715   -37.433 1.00 34.53  ? 484  PHE A N     1 
ATOM   6391  C CA    . PHE C 2 84  ? -43.058 8.026   -37.669 1.00 34.53  ? 484  PHE A CA    1 
ATOM   6392  C C     . PHE C 2 84  ? -43.975 9.154   -37.094 1.00 34.53  ? 484  PHE A C     1 
ATOM   6393  O O     . PHE C 2 84  ? -45.182 9.199   -37.408 1.00 34.53  ? 484  PHE A O     1 
ATOM   6394  C CB    . PHE C 2 84  ? -42.984 8.208   -39.174 1.00 23.30  ? 484  PHE A CB    1 
ATOM   6395  C CG    . PHE C 2 84  ? -41.735 7.707   -39.809 1.00 23.30  ? 484  PHE A CG    1 
ATOM   6396  C CD1   . PHE C 2 84  ? -41.610 6.354   -40.170 1.00 23.30  ? 484  PHE A CD1   1 
ATOM   6397  C CD2   . PHE C 2 84  ? -40.653 8.598   -40.099 1.00 23.30  ? 484  PHE A CD2   1 
ATOM   6398  C CE1   . PHE C 2 84  ? -40.376 5.906   -40.829 1.00 23.30  ? 484  PHE A CE1   1 
ATOM   6399  C CE2   . PHE C 2 84  ? -39.461 8.140   -40.741 1.00 23.30  ? 484  PHE A CE2   1 
ATOM   6400  C CZ    . PHE C 2 84  ? -39.332 6.839   -41.095 1.00 23.30  ? 484  PHE A CZ    1 
ATOM   6401  N N     . GLN C 2 85  ? -43.464 10.059  -36.258 1.00 25.90  ? 485  GLN A N     1 
ATOM   6402  C CA    . GLN C 2 85  ? -44.318 11.154  -35.826 1.00 25.90  ? 485  GLN A CA    1 
ATOM   6403  C C     . GLN C 2 85  ? -44.714 11.868  -37.116 1.00 25.90  ? 485  GLN A C     1 
ATOM   6404  O O     . GLN C 2 85  ? -43.981 11.876  -38.131 1.00 25.90  ? 485  GLN A O     1 
ATOM   6405  C CB    . GLN C 2 85  ? -43.606 12.180  -35.001 1.00 23.64  ? 485  GLN A CB    1 
ATOM   6406  C CG    . GLN C 2 85  ? -42.781 11.590  -33.933 1.00 23.64  ? 485  GLN A CG    1 
ATOM   6407  C CD    . GLN C 2 85  ? -42.557 12.598  -32.803 1.00 23.64  ? 485  GLN A CD    1 
ATOM   6408  O OE1   . GLN C 2 85  ? -42.218 13.781  -33.074 1.00 23.64  ? 485  GLN A OE1   1 
ATOM   6409  N NE2   . GLN C 2 85  ? -42.761 12.167  -31.539 1.00 23.64  ? 485  GLN A NE2   1 
ATOM   6410  N N     . SER C 2 86  ? -45.874 12.484  -37.097 1.00 28.36  ? 486  SER A N     1 
ATOM   6411  C CA    . SER C 2 86  ? -46.325 13.178  -38.217 1.00 28.36  ? 486  SER A CA    1 
ATOM   6412  C C     . SER C 2 86  ? -45.309 14.279  -38.504 1.00 28.36  ? 486  SER A C     1 
ATOM   6413  O O     . SER C 2 86  ? -45.069 14.592  -39.667 1.00 28.36  ? 486  SER A O     1 
ATOM   6414  C CB    . SER C 2 86  ? -47.645 13.719  -37.867 1.00 51.49  ? 486  SER A CB    1 
ATOM   6415  O OG    . SER C 2 86  ? -47.744 14.936  -38.507 1.00 51.49  ? 486  SER A OG    1 
ATOM   6416  N N     . SER C 2 87  ? -44.679 14.854  -37.475 1.00 35.42  ? 487  SER A N     1 
ATOM   6417  C CA    . SER C 2 87  ? -43.706 15.948  -37.680 1.00 35.42  ? 487  SER A CA    1 
ATOM   6418  C C     . SER C 2 87  ? -42.421 15.510  -38.392 1.00 35.42  ? 487  SER A C     1 
ATOM   6419  O O     . SER C 2 87  ? -41.825 16.230  -39.222 1.00 35.42  ? 487  SER A O     1 
ATOM   6420  C CB    . SER C 2 87  ? -43.354 16.560  -36.347 1.00 67.15  ? 487  SER A CB    1 
ATOM   6421  O OG    . SER C 2 87  ? -43.022 15.538  -35.444 1.00 67.15  ? 487  SER A OG    1 
ATOM   6422  N N     . ALA C 2 88  ? -41.982 14.310  -38.058 1.00 44.01  ? 488  ALA A N     1 
ATOM   6423  C CA    . ALA C 2 88  ? -40.794 13.821  -38.673 1.00 44.01  ? 488  ALA A CA    1 
ATOM   6424  C C     . ALA C 2 88  ? -41.030 13.638  -40.178 1.00 44.01  ? 488  ALA A C     1 
ATOM   6425  O O     . ALA C 2 88  ? -40.137 13.851  -40.970 1.00 44.01  ? 488  ALA A O     1 
ATOM   6426  C CB    . ALA C 2 88  ? -40.362 12.564  -37.996 1.00 26.12  ? 488  ALA A CB    1 
ATOM   6427  N N     . VAL C 2 89  ? -42.223 13.275  -40.611 1.00 20.32  ? 489  VAL A N     1 
ATOM   6428  C CA    . VAL C 2 89  ? -42.366 13.143  -42.059 1.00 20.32  ? 489  VAL A CA    1 
ATOM   6429  C C     . VAL C 2 89  ? -42.426 14.530  -42.655 1.00 20.32  ? 489  VAL A C     1 
ATOM   6430  O O     . VAL C 2 89  ? -41.743 14.862  -43.651 1.00 20.32  ? 489  VAL A O     1 
ATOM   6431  C CB    . VAL C 2 89  ? -43.582 12.360  -42.439 1.00 16.00  ? 489  VAL A CB    1 
ATOM   6432  C CG1   . VAL C 2 89  ? -43.582 12.119  -43.898 1.00 16.00  ? 489  VAL A CG1   1 
ATOM   6433  C CG2   . VAL C 2 89  ? -43.541 11.101  -41.774 1.00 16.00  ? 489  VAL A CG2   1 
ATOM   6434  N N     . MET C 2 90  ? -43.237 15.348  -42.016 1.00 31.39  ? 490  MET A N     1 
ATOM   6435  C CA    . MET C 2 90  ? -43.357 16.705  -42.471 1.00 31.39  ? 490  MET A CA    1 
ATOM   6436  C C     . MET C 2 90  ? -41.961 17.307  -42.491 1.00 31.39  ? 490  MET A C     1 
ATOM   6437  O O     . MET C 2 90  ? -41.660 17.905  -43.469 1.00 31.39  ? 490  MET A O     1 
ATOM   6438  C CB    . MET C 2 90  ? -44.334 17.552  -41.613 1.00 67.31  ? 490  MET A CB    1 
ATOM   6439  C CG    . MET C 2 90  ? -45.801 17.401  -41.962 1.00 67.31  ? 490  MET A CG    1 
ATOM   6440  S SD    . MET C 2 90  ? -46.013 17.000  -43.757 1.00 67.31  ? 490  MET A SD    1 
ATOM   6441  C CE    . MET C 2 90  ? -46.126 18.541  -44.524 1.00 67.31  ? 490  MET A CE    1 
ATOM   6442  N N     . ALA C 2 91  ? -41.086 17.135  -41.479 1.00 30.80  ? 491  ALA A N     1 
ATOM   6443  C CA    . ALA C 2 91  ? -39.729 17.740  -41.558 1.00 30.80  ? 491  ALA A CA    1 
ATOM   6444  C C     . ALA C 2 91  ? -38.899 17.180  -42.724 1.00 30.80  ? 491  ALA A C     1 
ATOM   6445  O O     . ALA C 2 91  ? -38.310 17.940  -43.486 1.00 30.80  ? 491  ALA A O     1 
ATOM   6446  C CB    . ALA C 2 91  ? -39.004 17.567  -40.279 1.00 35.12  ? 491  ALA A CB    1 
ATOM   6447  N N     . LEU C 2 92  ? -38.859 15.865  -42.852 1.00 25.26  ? 492  LEU A N     1 
ATOM   6448  C CA    . LEU C 2 92  ? -38.187 15.229  -43.954 1.00 25.26  ? 492  LEU A CA    1 
ATOM   6449  C C     . LEU C 2 92  ? -38.719 15.776  -45.294 1.00 25.26  ? 492  LEU A C     1 
ATOM   6450  O O     . LEU C 2 92  ? -37.946 16.028  -46.240 1.00 25.26  ? 492  LEU A O     1 
ATOM   6451  C CB    . LEU C 2 92  ? -38.471 13.731  -43.954 1.00 17.10  ? 492  LEU A CB    1 
ATOM   6452  C CG    . LEU C 2 92  ? -37.570 12.737  -43.187 1.00 17.10  ? 492  LEU A CG    1 
ATOM   6453  C CD1   . LEU C 2 92  ? -38.146 11.423  -43.275 1.00 17.10  ? 492  LEU A CD1   1 
ATOM   6454  C CD2   . LEU C 2 92  ? -36.198 12.646  -43.743 1.00 17.10  ? 492  LEU A CD2   1 
ATOM   6455  N N     . GLN C 2 93  ? -40.038 15.930  -45.435 1.00 31.02  ? 493  GLN A N     1 
ATOM   6456  C CA    . GLN C 2 93  ? -40.521 16.397  -46.723 1.00 31.02  ? 493  GLN A CA    1 
ATOM   6457  C C     . GLN C 2 93  ? -40.062 17.778  -46.953 1.00 31.02  ? 493  GLN A C     1 
ATOM   6458  O O     . GLN C 2 93  ? -39.577 18.146  -47.973 1.00 31.02  ? 493  GLN A O     1 
ATOM   6459  C CB    . GLN C 2 93  ? -42.014 16.391  -46.796 1.00 29.06  ? 493  GLN A CB    1 
ATOM   6460  C CG    . GLN C 2 93  ? -42.401 16.233  -48.188 1.00 29.06  ? 493  GLN A CG    1 
ATOM   6461  C CD    . GLN C 2 93  ? -43.817 16.550  -48.461 1.00 29.06  ? 493  GLN A CD    1 
ATOM   6462  O OE1   . GLN C 2 93  ? -44.690 15.961  -47.872 1.00 29.06  ? 493  GLN A OE1   1 
ATOM   6463  N NE2   . GLN C 2 93  ? -44.065 17.477  -49.377 1.00 29.06  ? 493  GLN A NE2   1 
ATOM   6464  N N     . GLU C 2 94  ? -40.205 18.565  -45.957 1.00 25.69  ? 494  GLU A N     1 
ATOM   6465  C CA    . GLU C 2 94  ? -39.805 19.887  -46.146 1.00 25.69  ? 494  GLU A CA    1 
ATOM   6466  C C     . GLU C 2 94  ? -38.339 20.054  -46.517 1.00 25.69  ? 494  GLU A C     1 
ATOM   6467  O O     . GLU C 2 94  ? -37.992 20.997  -47.196 1.00 25.69  ? 494  GLU A O     1 
ATOM   6468  C CB    . GLU C 2 94  ? -40.072 20.637  -44.899 1.00 42.17  ? 494  GLU A CB    1 
ATOM   6469  C CG    . GLU C 2 94  ? -41.412 21.091  -44.839 1.00 42.17  ? 494  GLU A CG    1 
ATOM   6470  C CD    . GLU C 2 94  ? -41.458 22.474  -45.257 1.00 42.17  ? 494  GLU A CD    1 
ATOM   6471  O OE1   . GLU C 2 94  ? -42.616 22.920  -45.416 1.00 42.17  ? 494  GLU A OE1   1 
ATOM   6472  O OE2   . GLU C 2 94  ? -40.365 23.102  -45.430 1.00 42.17  ? 494  GLU A OE2   1 
ATOM   6473  N N     . ALA C 2 95  ? -37.503 19.160  -46.004 1.00 28.18  ? 495  ALA A N     1 
ATOM   6474  C CA    . ALA C 2 95  ? -36.095 19.181  -46.238 1.00 28.18  ? 495  ALA A CA    1 
ATOM   6475  C C     . ALA C 2 95  ? -35.760 18.677  -47.630 1.00 28.18  ? 495  ALA A C     1 
ATOM   6476  O O     . ALA C 2 95  ? -34.824 19.193  -48.249 1.00 28.18  ? 495  ALA A O     1 
ATOM   6477  C CB    . ALA C 2 95  ? -35.365 18.348  -45.177 1.00 11.48  ? 495  ALA A CB    1 
ATOM   6478  N N     . SER C 2 96  ? -36.501 17.692  -48.145 1.00 22.76  ? 496  SER A N     1 
ATOM   6479  C CA    . SER C 2 96  ? -36.205 17.212  -49.505 1.00 22.76  ? 496  SER A CA    1 
ATOM   6480  C C     . SER C 2 96  ? -36.610 18.199  -50.552 1.00 22.76  ? 496  SER A C     1 
ATOM   6481  O O     . SER C 2 96  ? -35.992 18.347  -51.567 1.00 22.76  ? 496  SER A O     1 
ATOM   6482  C CB    . SER C 2 96  ? -36.954 15.970  -49.843 1.00 20.75  ? 496  SER A CB    1 
ATOM   6483  O OG    . SER C 2 96  ? -37.052 15.253  -48.686 1.00 20.75  ? 496  SER A OG    1 
ATOM   6484  N N     . GLU C 2 97  ? -37.691 18.901  -50.349 1.00 29.62  ? 497  GLU A N     1 
ATOM   6485  C CA    . GLU C 2 97  ? -38.070 19.761  -51.448 1.00 29.62  ? 497  GLU A CA    1 
ATOM   6486  C C     . GLU C 2 97  ? -37.087 20.909  -51.582 1.00 29.62  ? 497  GLU A C     1 
ATOM   6487  O O     . GLU C 2 97  ? -36.678 21.283  -52.672 1.00 29.62  ? 497  GLU A O     1 
ATOM   6488  C CB    . GLU C 2 97  ? -39.518 20.211  -51.246 1.00 36.43  ? 497  GLU A CB    1 
ATOM   6489  C CG    . GLU C 2 97  ? -40.520 19.024  -51.081 1.00 36.43  ? 497  GLU A CG    1 
ATOM   6490  C CD    . GLU C 2 97  ? -41.968 19.442  -51.443 1.00 36.43  ? 497  GLU A CD    1 
ATOM   6491  O OE1   . GLU C 2 97  ? -42.118 20.606  -51.898 1.00 36.43  ? 497  GLU A OE1   1 
ATOM   6492  O OE2   . GLU C 2 97  ? -42.960 18.667  -51.302 1.00 36.43  ? 497  GLU A OE2   1 
ATOM   6493  N N     . ALA C 2 98  ? -36.636 21.405  -50.450 1.00 26.70  ? 498  ALA A N     1 
ATOM   6494  C CA    . ALA C 2 98  ? -35.737 22.525  -50.474 1.00 26.70  ? 498  ALA A CA    1 
ATOM   6495  C C     . ALA C 2 98  ? -34.426 22.101  -51.080 1.00 26.70  ? 498  ALA A C     1 
ATOM   6496  O O     . ALA C 2 98  ? -33.695 22.885  -51.583 1.00 26.70  ? 498  ALA A O     1 
ATOM   6497  C CB    . ALA C 2 98  ? -35.551 23.017  -49.099 1.00 11.43  ? 498  ALA A CB    1 
ATOM   6498  N N     . TYR C 2 99  ? -34.156 20.819  -51.006 1.00 29.40  ? 499  TYR A N     1 
ATOM   6499  C CA    . TYR C 2 99  ? -32.947 20.261  -51.518 1.00 29.40  ? 499  TYR A CA    1 
ATOM   6500  C C     . TYR C 2 99  ? -33.161 20.190  -52.975 1.00 29.40  ? 499  TYR A C     1 
ATOM   6501  O O     . TYR C 2 99  ? -32.452 20.788  -53.709 1.00 29.40  ? 499  TYR A O     1 
ATOM   6502  C CB    . TYR C 2 99  ? -32.730 18.876  -50.907 1.00 18.69  ? 499  TYR A CB    1 
ATOM   6503  C CG    . TYR C 2 99  ? -31.758 18.030  -51.666 1.00 18.69  ? 499  TYR A CG    1 
ATOM   6504  C CD1   . TYR C 2 99  ? -30.400 18.159  -51.474 1.00 18.69  ? 499  TYR A CD1   1 
ATOM   6505  C CD2   . TYR C 2 99  ? -32.164 17.190  -52.683 1.00 18.69  ? 499  TYR A CD2   1 
ATOM   6506  C CE1   . TYR C 2 99  ? -29.468 17.502  -52.261 1.00 18.69  ? 499  TYR A CE1   1 
ATOM   6507  C CE2   . TYR C 2 99  ? -31.195 16.499  -53.489 1.00 18.69  ? 499  TYR A CE2   1 
ATOM   6508  C CZ    . TYR C 2 99  ? -29.870 16.673  -53.239 1.00 18.69  ? 499  TYR A CZ    1 
ATOM   6509  O OH    . TYR C 2 99  ? -28.940 15.922  -53.886 1.00 18.69  ? 499  TYR A OH    1 
ATOM   6510  N N     . LEU C 2 100 ? -34.149 19.460  -53.411 1.00 19.39  ? 500  LEU A N     1 
ATOM   6511  C CA    . LEU C 2 100 ? -34.372 19.359  -54.803 1.00 19.39  ? 500  LEU A CA    1 
ATOM   6512  C C     . LEU C 2 100 ? -34.609 20.711  -55.458 1.00 19.39  ? 500  LEU A C     1 
ATOM   6513  O O     . LEU C 2 100 ? -34.145 20.906  -56.611 1.00 19.39  ? 500  LEU A O     1 
ATOM   6514  C CB    . LEU C 2 100 ? -35.561 18.499  -55.068 1.00 21.82  ? 500  LEU A CB    1 
ATOM   6515  C CG    . LEU C 2 100 ? -35.338 17.053  -54.799 1.00 21.82  ? 500  LEU A CG    1 
ATOM   6516  C CD1   . LEU C 2 100 ? -36.503 16.221  -55.168 1.00 21.82  ? 500  LEU A CD1   1 
ATOM   6517  C CD2   . LEU C 2 100 ? -34.196 16.668  -55.583 1.00 21.82  ? 500  LEU A CD2   1 
ATOM   6518  N N     . VAL C 2 101 ? -35.330 21.647  -54.803 1.00 14.27  ? 501  VAL A N     1 
ATOM   6519  C CA    . VAL C 2 101 ? -35.564 22.919  -55.474 1.00 14.27  ? 501  VAL A CA    1 
ATOM   6520  C C     . VAL C 2 101 ? -34.230 23.625  -55.765 1.00 14.27  ? 501  VAL A C     1 
ATOM   6521  O O     . VAL C 2 101 ? -34.033 24.240  -56.848 1.00 14.27  ? 501  VAL A O     1 
ATOM   6522  C CB    . VAL C 2 101 ? -36.359 23.910  -54.678 1.00 12.29  ? 501  VAL A CB    1 
ATOM   6523  C CG1   . VAL C 2 101 ? -36.018 25.330  -55.226 1.00 12.29  ? 501  VAL A CG1   1 
ATOM   6524  C CG2   . VAL C 2 101 ? -37.814 23.609  -54.723 1.00 12.29  ? 501  VAL A CG2   1 
ATOM   6525  N N     . ALA C 2 102 ? -33.331 23.581  -54.788 1.00 16.38  ? 502  ALA A N     1 
ATOM   6526  C CA    . ALA C 2 102 ? -31.994 24.142  -54.931 1.00 16.38  ? 502  ALA A CA    1 
ATOM   6527  C C     . ALA C 2 102 ? -31.170 23.402  -55.955 1.00 16.38  ? 502  ALA A C     1 
ATOM   6528  O O     . ALA C 2 102 ? -30.433 24.019  -56.646 1.00 16.38  ? 502  ALA A O     1 
ATOM   6529  C CB    . ALA C 2 102 ? -31.287 24.127  -53.634 1.00 30.04  ? 502  ALA A CB    1 
ATOM   6530  N N     . LEU C 2 103 ? -31.281 22.088  -56.029 1.00 22.67  ? 503  LEU A N     1 
ATOM   6531  C CA    . LEU C 2 103 ? -30.533 21.334  -57.007 1.00 22.67  ? 503  LEU A CA    1 
ATOM   6532  C C     . LEU C 2 103 ? -31.059 21.696  -58.374 1.00 22.67  ? 503  LEU A C     1 
ATOM   6533  O O     . LEU C 2 103 ? -30.398 21.532  -59.432 1.00 22.67  ? 503  LEU A O     1 
ATOM   6534  C CB    . LEU C 2 103 ? -30.735 19.839  -56.818 1.00 12.76  ? 503  LEU A CB    1 
ATOM   6535  C CG    . LEU C 2 103 ? -29.966 18.897  -57.781 1.00 12.76  ? 503  LEU A CG    1 
ATOM   6536  C CD1   . LEU C 2 103 ? -28.563 19.154  -57.410 1.00 12.76  ? 503  LEU A CD1   1 
ATOM   6537  C CD2   . LEU C 2 103 ? -30.326 17.422  -57.691 1.00 12.76  ? 503  LEU A CD2   1 
ATOM   6538  N N     . PHE C 2 104 ? -32.291 22.156  -58.366 1.00 25.90  ? 504  PHE A N     1 
ATOM   6539  C CA    . PHE C 2 104 ? -32.843 22.567  -59.619 1.00 25.90  ? 504  PHE A CA    1 
ATOM   6540  C C     . PHE C 2 104 ? -32.143 23.940  -60.000 1.00 25.90  ? 504  PHE A C     1 
ATOM   6541  O O     . PHE C 2 104 ? -31.659 24.103  -61.104 1.00 25.90  ? 504  PHE A O     1 
ATOM   6542  C CB    . PHE C 2 104 ? -34.391 22.557  -59.499 1.00 16.86  ? 504  PHE A CB    1 
ATOM   6543  C CG    . PHE C 2 104 ? -35.028 21.216  -59.917 1.00 16.86  ? 504  PHE A CG    1 
ATOM   6544  C CD1   . PHE C 2 104 ? -35.978 20.569  -59.123 1.00 16.86  ? 504  PHE A CD1   1 
ATOM   6545  C CD2   . PHE C 2 104 ? -34.584 20.543  -61.048 1.00 16.86  ? 504  PHE A CD2   1 
ATOM   6546  C CE1   . PHE C 2 104 ? -36.449 19.283  -59.446 1.00 16.86  ? 504  PHE A CE1   1 
ATOM   6547  C CE2   . PHE C 2 104 ? -35.076 19.231  -61.357 1.00 16.86  ? 504  PHE A CE2   1 
ATOM   6548  C CZ    . PHE C 2 104 ? -35.996 18.621  -60.553 1.00 16.86  ? 504  PHE A CZ    1 
ATOM   6549  N N     . GLU C 2 105 ? -31.995 24.878  -59.071 1.00 28.88  ? 505  GLU A N     1 
ATOM   6550  C CA    . GLU C 2 105 ? -31.260 26.111  -59.387 1.00 28.88  ? 505  GLU A CA    1 
ATOM   6551  C C     . GLU C 2 105 ? -29.817 25.819  -59.844 1.00 28.88  ? 505  GLU A C     1 
ATOM   6552  O O     . GLU C 2 105 ? -29.336 26.458  -60.782 1.00 28.88  ? 505  GLU A O     1 
ATOM   6553  C CB    . GLU C 2 105 ? -31.078 26.925  -58.227 1.00 37.84  ? 505  GLU A CB    1 
ATOM   6554  C CG    . GLU C 2 105 ? -32.330 27.334  -57.652 1.00 37.84  ? 505  GLU A CG    1 
ATOM   6555  C CD    . GLU C 2 105 ? -32.183 28.106  -56.353 1.00 37.84  ? 505  GLU A CD    1 
ATOM   6556  O OE1   . GLU C 2 105 ? -31.070 28.675  -56.152 1.00 37.84  ? 505  GLU A OE1   1 
ATOM   6557  O OE2   . GLU C 2 105 ? -33.185 28.152  -55.552 1.00 37.84  ? 505  GLU A OE2   1 
ATOM   6558  N N     . ASP C 2 106 ? -29.102 24.846  -59.331 1.00 23.50  ? 506  ASP A N     1 
ATOM   6559  C CA    . ASP C 2 106 ? -27.771 24.696  -59.891 1.00 23.50  ? 506  ASP A CA    1 
ATOM   6560  C C     . ASP C 2 106 ? -27.839 23.964  -61.231 1.00 23.50  ? 506  ASP A C     1 
ATOM   6561  O O     . ASP C 2 106 ? -27.013 24.220  -62.119 1.00 23.50  ? 506  ASP A O     1 
ATOM   6562  C CB    . ASP C 2 106 ? -26.878 23.981  -58.931 1.00 36.88  ? 506  ASP A CB    1 
ATOM   6563  C CG    . ASP C 2 106 ? -26.896 24.624  -57.580 1.00 36.88  ? 506  ASP A CG    1 
ATOM   6564  O OD1   . ASP C 2 106 ? -27.334 25.803  -57.522 1.00 36.88  ? 506  ASP A OD1   1 
ATOM   6565  O OD2   . ASP C 2 106 ? -26.475 23.992  -56.555 1.00 36.88  ? 506  ASP A OD2   1 
ATOM   6566  N N     . THR C 2 107 ? -28.853 23.116  -61.427 1.00 25.87  ? 507  THR A N     1 
ATOM   6567  C CA    . THR C 2 107 ? -28.954 22.433  -62.718 1.00 25.87  ? 507  THR A CA    1 
ATOM   6568  C C     . THR C 2 107 ? -29.226 23.425  -63.845 1.00 25.87  ? 507  THR A C     1 
ATOM   6569  O O     . THR C 2 107 ? -28.518 23.461  -64.848 1.00 25.87  ? 507  THR A O     1 
ATOM   6570  C CB    . THR C 2 107 ? -30.037 21.372  -62.645 1.00 31.86  ? 507  THR A CB    1 
ATOM   6571  O OG1   . THR C 2 107 ? -29.669 20.369  -61.673 1.00 31.86  ? 507  THR A OG1   1 
ATOM   6572  C CG2   . THR C 2 107 ? -30.204 20.737  -63.984 1.00 31.86  ? 507  THR A CG2   1 
ATOM   6573  N N     . ASN C 2 108 ? -30.222 24.274  -63.607 1.00 35.88  ? 508  ASN A N     1 
ATOM   6574  C CA    . ASN C 2 108 ? -30.616 25.275  -64.529 1.00 35.88  ? 508  ASN A CA    1 
ATOM   6575  C C     . ASN C 2 108 ? -29.410 26.106  -64.877 1.00 35.88  ? 508  ASN A C     1 
ATOM   6576  O O     . ASN C 2 108 ? -29.239 26.509  -66.042 1.00 35.88  ? 508  ASN A O     1 
ATOM   6577  C CB    . ASN C 2 108 ? -31.658 26.137  -63.917 1.00 25.86  ? 508  ASN A CB    1 
ATOM   6578  C CG    . ASN C 2 108 ? -32.482 26.854  -64.970 1.00 25.86  ? 508  ASN A CG    1 
ATOM   6579  O OD1   . ASN C 2 108 ? -32.688 26.314  -66.036 1.00 25.86  ? 508  ASN A OD1   1 
ATOM   6580  N ND2   . ASN C 2 108 ? -32.977 28.067  -64.672 1.00 25.86  ? 508  ASN A ND2   1 
ATOM   6581  N N     . LEU C 2 109 ? -28.560 26.378  -63.892 1.00 21.76  ? 509  LEU A N     1 
ATOM   6582  C CA    . LEU C 2 109 ? -27.384 27.160  -64.183 1.00 21.76  ? 509  LEU A CA    1 
ATOM   6583  C C     . LEU C 2 109 ? -26.480 26.303  -65.067 1.00 21.76  ? 509  LEU A C     1 
ATOM   6584  O O     . LEU C 2 109 ? -25.994 26.762  -66.109 1.00 21.76  ? 509  LEU A O     1 
ATOM   6585  C CB    . LEU C 2 109 ? -26.645 27.560  -62.927 1.00 17.21  ? 509  LEU A CB    1 
ATOM   6586  C CG    . LEU C 2 109 ? -27.109 28.804  -62.097 1.00 17.21  ? 509  LEU A CG    1 
ATOM   6587  C CD1   . LEU C 2 109 ? -26.396 28.814  -60.739 1.00 17.21  ? 509  LEU A CD1   1 
ATOM   6588  C CD2   . LEU C 2 109 ? -26.956 30.152  -62.871 1.00 17.21  ? 509  LEU A CD2   1 
ATOM   6589  N N     . CYS C 2 110 ? -26.268 25.055  -64.702 1.00 32.00  ? 510  CYS A N     1 
ATOM   6590  C CA    . CYS C 2 110 ? -25.456 24.253  -65.544 1.00 32.00  ? 510  CYS A CA    1 
ATOM   6591  C C     . CYS C 2 110 ? -25.983 24.142  -66.972 1.00 32.00  ? 510  CYS A C     1 
ATOM   6592  O O     . CYS C 2 110 ? -25.204 23.975  -67.913 1.00 32.00  ? 510  CYS A O     1 
ATOM   6593  C CB    . CYS C 2 110 ? -25.331 22.884  -64.954 1.00 31.30  ? 510  CYS A CB    1 
ATOM   6594  S SG    . CYS C 2 110 ? -24.308 22.950  -63.558 1.00 31.30  ? 510  CYS A SG    1 
ATOM   6595  N N     . ALA C 2 111 ? -27.293 24.159  -67.156 1.00 24.70  ? 511  ALA A N     1 
ATOM   6596  C CA    . ALA C 2 111 ? -27.776 24.075  -68.507 1.00 24.70  ? 511  ALA A CA    1 
ATOM   6597  C C     . ALA C 2 111 ? -27.487 25.434  -69.262 1.00 24.70  ? 511  ALA A C     1 
ATOM   6598  O O     . ALA C 2 111 ? -27.016 25.517  -70.401 1.00 24.70  ? 511  ALA A O     1 
ATOM   6599  C CB    . ALA C 2 111 ? -29.219 23.779  -68.455 1.00 61.76  ? 511  ALA A CB    1 
ATOM   6600  N N     . ILE C 2 112 ? -27.759 26.519  -68.611 1.00 34.67  ? 512  ILE A N     1 
ATOM   6601  C CA    . ILE C 2 112 ? -27.502 27.737  -69.261 1.00 34.67  ? 512  ILE A CA    1 
ATOM   6602  C C     . ILE C 2 112 ? -26.020 27.862  -69.564 1.00 34.67  ? 512  ILE A C     1 
ATOM   6603  O O     . ILE C 2 112 ? -25.618 28.506  -70.512 1.00 34.67  ? 512  ILE A O     1 
ATOM   6604  C CB    . ILE C 2 112 ? -27.920 28.882  -68.360 1.00 9.12   ? 512  ILE A CB    1 
ATOM   6605  C CG1   . ILE C 2 112 ? -29.415 28.749  -67.979 1.00 9.12   ? 512  ILE A CG1   1 
ATOM   6606  C CG2   . ILE C 2 112 ? -27.728 30.225  -69.040 1.00 9.12   ? 512  ILE A CG2   1 
ATOM   6607  C CD1   . ILE C 2 112 ? -29.925 29.950  -67.119 1.00 9.12   ? 512  ILE A CD1   1 
ATOM   6608  N N     . HIS C 2 113 ? -25.154 27.265  -68.794 1.00 45.09  ? 513  HIS A N     1 
ATOM   6609  C CA    . HIS C 2 113 ? -23.744 27.477  -69.110 1.00 45.09  ? 513  HIS A CA    1 
ATOM   6610  C C     . HIS C 2 113 ? -23.396 26.852  -70.410 1.00 45.09  ? 513  HIS A C     1 
ATOM   6611  O O     . HIS C 2 113 ? -22.439 27.270  -71.055 1.00 45.09  ? 513  HIS A O     1 
ATOM   6612  C CB    . HIS C 2 113 ? -22.918 26.877  -67.996 1.00 13.25  ? 513  HIS A CB    1 
ATOM   6613  C CG    . HIS C 2 113 ? -21.440 26.876  -68.188 1.00 13.25  ? 513  HIS A CG    1 
ATOM   6614  N ND1   . HIS C 2 113 ? -20.667 28.007  -68.023 1.00 13.25  ? 513  HIS A ND1   1 
ATOM   6615  C CD2   . HIS C 2 113 ? -20.567 25.847  -68.382 1.00 13.25  ? 513  HIS A CD2   1 
ATOM   6616  C CE1   . HIS C 2 113 ? -19.377 27.675  -68.116 1.00 13.25  ? 513  HIS A CE1   1 
ATOM   6617  N NE2   . HIS C 2 113 ? -19.291 26.367  -68.329 1.00 13.25  ? 513  HIS A NE2   1 
ATOM   6618  N N     . ALA C 2 114 ? -24.201 25.857  -70.789 1.00 20.62  ? 514  ALA A N     1 
ATOM   6619  C CA    . ALA C 2 114 ? -24.006 25.030  -72.000 1.00 20.62  ? 514  ALA A CA    1 
ATOM   6620  C C     . ALA C 2 114 ? -24.867 25.614  -73.057 1.00 20.62  ? 514  ALA A C     1 
ATOM   6621  O O     . ALA C 2 114 ? -25.031 25.023  -74.183 1.00 20.62  ? 514  ALA A O     1 
ATOM   6622  C CB    . ALA C 2 114 ? -24.399 23.578  -71.779 1.00 24.64  ? 514  ALA A CB    1 
ATOM   6623  N N     . LYS C 2 115 ? -25.336 26.808  -72.713 1.00 32.31  ? 515  LYS A N     1 
ATOM   6624  C CA    . LYS C 2 115 ? -26.131 27.573  -73.613 1.00 32.31  ? 515  LYS A CA    1 
ATOM   6625  C C     . LYS C 2 115 ? -27.373 26.812  -74.044 1.00 32.31  ? 515  LYS A C     1 
ATOM   6626  O O     . LYS C 2 115 ? -27.744 26.751  -75.228 1.00 32.31  ? 515  LYS A O     1 
ATOM   6627  C CB    . LYS C 2 115 ? -25.329 27.984  -74.855 1.00 54.69  ? 515  LYS A CB    1 
ATOM   6628  C CG    . LYS C 2 115 ? -24.000 28.662  -74.575 1.00 54.69  ? 515  LYS A CG    1 
ATOM   6629  C CD    . LYS C 2 115 ? -23.435 29.450  -75.780 1.00 54.69  ? 515  LYS A CD    1 
ATOM   6630  C CE    . LYS C 2 115 ? -22.072 30.044  -75.429 1.00 54.69  ? 515  LYS A CE    1 
ATOM   6631  N NZ    . LYS C 2 115 ? -21.551 31.106  -76.349 1.00 54.69  ? 515  LYS A NZ    1 
ATOM   6632  N N     . ARG C 2 116 ? -27.983 26.182  -73.070 1.00 19.61  ? 516  ARG A N     1 
ATOM   6633  C CA    . ARG C 2 116 ? -29.199 25.514  -73.348 1.00 19.61  ? 516  ARG A CA    1 
ATOM   6634  C C     . ARG C 2 116 ? -30.211 26.158  -72.415 1.00 19.61  ? 516  ARG A C     1 
ATOM   6635  O O     . ARG C 2 116 ? -29.831 26.995  -71.597 1.00 19.61  ? 516  ARG A O     1 
ATOM   6636  C CB    . ARG C 2 116 ? -29.038 24.045  -73.062 1.00 21.67  ? 516  ARG A CB    1 
ATOM   6637  C CG    . ARG C 2 116 ? -28.302 23.342  -74.125 1.00 21.67  ? 516  ARG A CG    1 
ATOM   6638  C CD    . ARG C 2 116 ? -28.302 21.920  -73.845 1.00 21.67  ? 516  ARG A CD    1 
ATOM   6639  N NE    . ARG C 2 116 ? -27.324 21.564  -72.808 1.00 21.67  ? 516  ARG A NE    1 
ATOM   6640  C CZ    . ARG C 2 116 ? -27.628 21.151  -71.563 1.00 21.67  ? 516  ARG A CZ    1 
ATOM   6641  N NH1   . ARG C 2 116 ? -28.901 21.037  -71.155 1.00 21.67  ? 516  ARG A NH1   1 
ATOM   6642  N NH2   . ARG C 2 116 ? -26.636 20.854  -70.713 1.00 21.67  ? 516  ARG A NH2   1 
ATOM   6643  N N     . VAL C 2 117 ? -31.486 25.812  -72.543 1.00 18.81  ? 517  VAL A N     1 
ATOM   6644  C CA    . VAL C 2 117 ? -32.474 26.375  -71.635 1.00 18.81  ? 517  VAL A CA    1 
ATOM   6645  C C     . VAL C 2 117 ? -33.279 25.197  -71.172 1.00 18.81  ? 517  VAL A C     1 
ATOM   6646  O O     . VAL C 2 117 ? -34.337 25.312  -70.525 1.00 18.81  ? 517  VAL A O     1 
ATOM   6647  C CB    . VAL C 2 117 ? -33.411 27.324  -72.317 1.00 25.77  ? 517  VAL A CB    1 
ATOM   6648  C CG1   . VAL C 2 117 ? -32.695 28.559  -72.716 1.00 25.77  ? 517  VAL A CG1   1 
ATOM   6649  C CG2   . VAL C 2 117 ? -34.088 26.595  -73.444 1.00 25.77  ? 517  VAL A CG2   1 
ATOM   6650  N N     . THR C 2 118 ? -32.768 24.034  -71.538 1.00 27.88  ? 518  THR A N     1 
ATOM   6651  C CA    . THR C 2 118 ? -33.455 22.847  -71.142 1.00 27.88  ? 518  THR A CA    1 
ATOM   6652  C C     . THR C 2 118 ? -32.637 22.051  -70.226 1.00 27.88  ? 518  THR A C     1 
ATOM   6653  O O     . THR C 2 118 ? -31.672 21.492  -70.679 1.00 27.88  ? 518  THR A O     1 
ATOM   6654  C CB    . THR C 2 118 ? -33.705 21.912  -72.299 1.00 41.69  ? 518  THR A CB    1 
ATOM   6655  O OG1   . THR C 2 118 ? -34.280 22.612  -73.414 1.00 41.69  ? 518  THR A OG1   1 
ATOM   6656  C CG2   . THR C 2 118 ? -34.641 20.841  -71.847 1.00 41.69  ? 518  THR A CG2   1 
ATOM   6657  N N     . ILE C 2 119 ? -32.983 21.935  -68.969 1.00 29.24  ? 519  ILE A N     1 
ATOM   6658  C CA    . ILE C 2 119 ? -32.154 21.091  -68.137 1.00 29.24  ? 519  ILE A CA    1 
ATOM   6659  C C     . ILE C 2 119 ? -32.101 19.604  -68.492 1.00 29.24  ? 519  ILE A C     1 
ATOM   6660  O O     . ILE C 2 119 ? -33.092 18.993  -68.888 1.00 29.24  ? 519  ILE A O     1 
ATOM   6661  C CB    . ILE C 2 119 ? -32.584 21.197  -66.735 1.00 14.73  ? 519  ILE A CB    1 
ATOM   6662  C CG1   . ILE C 2 119 ? -33.953 20.624  -66.578 1.00 14.73  ? 519  ILE A CG1   1 
ATOM   6663  C CG2   . ILE C 2 119 ? -32.638 22.628  -66.366 1.00 14.73  ? 519  ILE A CG2   1 
ATOM   6664  C CD1   . ILE C 2 119 ? -34.396 20.590  -65.162 1.00 14.73  ? 519  ILE A CD1   1 
ATOM   6665  N N     . MET C 2 120 ? -30.927 19.011  -68.327 1.00 26.23  ? 520  MET A N     1 
ATOM   6666  C CA    . MET C 2 120 ? -30.785 17.592  -68.613 1.00 26.23  ? 520  MET A CA    1 
ATOM   6667  C C     . MET C 2 120 ? -30.109 16.767  -67.554 1.00 26.23  ? 520  MET A C     1 
ATOM   6668  O O     . MET C 2 120 ? -29.536 17.240  -66.619 1.00 26.23  ? 520  MET A O     1 
ATOM   6669  C CB    . MET C 2 120 ? -30.088 17.378  -69.911 1.00 44.34  ? 520  MET A CB    1 
ATOM   6670  C CG    . MET C 2 120 ? -30.667 18.274  -70.933 1.00 44.34  ? 520  MET A CG    1 
ATOM   6671  S SD    . MET C 2 120 ? -30.290 17.880  -72.632 1.00 44.34  ? 520  MET A SD    1 
ATOM   6672  C CE    . MET C 2 120 ? -28.584 17.411  -72.605 1.00 44.34  ? 520  MET A CE    1 
ATOM   6673  N N     . PRO C 2 121 ? -30.215 15.480  -67.709 1.00 23.31  ? 521  PRO A N     1 
ATOM   6674  C CA    . PRO C 2 121 ? -29.599 14.624  -66.735 1.00 23.31  ? 521  PRO A CA    1 
ATOM   6675  C C     . PRO C 2 121 ? -28.180 15.050  -66.507 1.00 23.31  ? 521  PRO A C     1 
ATOM   6676  O O     . PRO C 2 121 ? -27.762 15.237  -65.374 1.00 23.31  ? 521  PRO A O     1 
ATOM   6677  C CB    . PRO C 2 121 ? -29.713 13.257  -67.390 1.00 27.97  ? 521  PRO A CB    1 
ATOM   6678  C CG    . PRO C 2 121 ? -31.027 13.331  -68.019 1.00 27.97  ? 521  PRO A CG    1 
ATOM   6679  C CD    . PRO C 2 121 ? -31.037 14.693  -68.655 1.00 27.97  ? 521  PRO A CD    1 
ATOM   6680  N N     . LYS C 2 122 ? -27.424 15.236  -67.576 1.00 26.78  ? 522  LYS A N     1 
ATOM   6681  C CA    . LYS C 2 122 ? -26.073 15.581  -67.351 1.00 26.78  ? 522  LYS A CA    1 
ATOM   6682  C C     . LYS C 2 122 ? -25.986 16.863  -66.501 1.00 26.78  ? 522  LYS A C     1 
ATOM   6683  O O     . LYS C 2 122 ? -25.188 16.960  -65.603 1.00 26.78  ? 522  LYS A O     1 
ATOM   6684  C CB    . LYS C 2 122 ? -25.419 15.712  -68.685 1.00 37.77  ? 522  LYS A CB    1 
ATOM   6685  C CG    . LYS C 2 122 ? -26.068 16.783  -69.478 1.00 37.77  ? 522  LYS A CG    1 
ATOM   6686  C CD    . LYS C 2 122 ? -25.304 17.201  -70.740 1.00 37.77  ? 522  LYS A CD    1 
ATOM   6687  C CE    . LYS C 2 122 ? -25.699 16.310  -71.866 1.00 37.77  ? 522  LYS A CE    1 
ATOM   6688  N NZ    . LYS C 2 122 ? -24.857 16.480  -73.068 1.00 37.77  ? 522  LYS A NZ    1 
ATOM   6689  N N     . ASP C 2 123 ? -26.832 17.847  -66.752 1.00 19.05  ? 523  ASP A N     1 
ATOM   6690  C CA    . ASP C 2 123 ? -26.790 19.061  -65.984 1.00 19.05  ? 523  ASP A CA    1 
ATOM   6691  C C     . ASP C 2 123 ? -26.893 18.786  -64.472 1.00 19.05  ? 523  ASP A C     1 
ATOM   6692  O O     . ASP C 2 123 ? -26.303 19.491  -63.662 1.00 19.05  ? 523  ASP A O     1 
ATOM   6693  C CB    . ASP C 2 123 ? -27.951 19.878  -66.358 1.00 32.45  ? 523  ASP A CB    1 
ATOM   6694  C CG    . ASP C 2 123 ? -27.880 20.364  -67.736 1.00 32.45  ? 523  ASP A CG    1 
ATOM   6695  O OD1   . ASP C 2 123 ? -26.860 20.985  -68.076 1.00 32.45  ? 523  ASP A OD1   1 
ATOM   6696  O OD2   . ASP C 2 123 ? -28.860 20.164  -68.478 1.00 32.45  ? 523  ASP A OD2   1 
ATOM   6697  N N     . ILE C 2 124 ? -27.690 17.792  -64.076 1.00 23.07  ? 524  ILE A N     1 
ATOM   6698  C CA    . ILE C 2 124 ? -27.887 17.464  -62.675 1.00 23.07  ? 524  ILE A CA    1 
ATOM   6699  C C     . ILE C 2 124 ? -26.664 16.758  -62.291 1.00 23.07  ? 524  ILE A C     1 
ATOM   6700  O O     . ILE C 2 124 ? -26.142 16.971  -61.264 1.00 23.07  ? 524  ILE A O     1 
ATOM   6701  C CB    . ILE C 2 124 ? -29.070 16.519  -62.462 1.00 32.63  ? 524  ILE A CB    1 
ATOM   6702  C CG1   . ILE C 2 124 ? -30.358 17.319  -62.460 1.00 32.63  ? 524  ILE A CG1   1 
ATOM   6703  C CG2   . ILE C 2 124 ? -28.955 15.770  -61.178 1.00 32.63  ? 524  ILE A CG2   1 
ATOM   6704  C CD1   . ILE C 2 124 ? -31.604 16.415  -62.254 1.00 32.63  ? 524  ILE A CD1   1 
ATOM   6705  N N     . GLN C 2 125 ? -26.189 15.902  -63.149 1.00 25.46  ? 525  GLN A N     1 
ATOM   6706  C CA    . GLN C 2 125 ? -24.996 15.171  -62.826 1.00 25.46  ? 525  GLN A CA    1 
ATOM   6707  C C     . GLN C 2 125 ? -23.805 16.099  -62.500 1.00 25.46  ? 525  GLN A C     1 
ATOM   6708  O O     . GLN C 2 125 ? -23.117 15.931  -61.512 1.00 25.46  ? 525  GLN A O     1 
ATOM   6709  C CB    . GLN C 2 125 ? -24.727 14.272  -63.991 1.00 41.79  ? 525  GLN A CB    1 
ATOM   6710  C CG    . GLN C 2 125 ? -25.558 13.030  -64.005 1.00 41.79  ? 525  GLN A CG    1 
ATOM   6711  C CD    . GLN C 2 125 ? -25.463 12.339  -65.339 1.00 41.79  ? 525  GLN A CD    1 
ATOM   6712  O OE1   . GLN C 2 125 ? -24.455 12.466  -66.053 1.00 41.79  ? 525  GLN A OE1   1 
ATOM   6713  N NE2   . GLN C 2 125 ? -26.512 11.607  -65.699 1.00 41.79  ? 525  GLN A NE2   1 
ATOM   6714  N N     . LEU C 2 126 ? -23.600 17.106  -63.344 1.00 22.87  ? 526  LEU A N     1 
ATOM   6715  C CA    . LEU C 2 126 ? -22.527 18.052  -63.171 1.00 22.87  ? 526  LEU A CA    1 
ATOM   6716  C C     . LEU C 2 126 ? -22.696 18.845  -61.863 1.00 22.87  ? 526  LEU A C     1 
ATOM   6717  O O     . LEU C 2 126 ? -21.720 19.013  -61.112 1.00 22.87  ? 526  LEU A O     1 
ATOM   6718  C CB    . LEU C 2 126 ? -22.457 18.993  -64.354 1.00 11.51  ? 526  LEU A CB    1 
ATOM   6719  C CG    . LEU C 2 126 ? -21.440 20.103  -64.072 1.00 11.51  ? 526  LEU A CG    1 
ATOM   6720  C CD1   . LEU C 2 126 ? -20.102 19.456  -63.918 1.00 11.51  ? 526  LEU A CD1   1 
ATOM   6721  C CD2   . LEU C 2 126 ? -21.456 21.176  -65.150 1.00 11.51  ? 526  LEU A CD2   1 
ATOM   6722  N N     . ALA C 2 127 ? -23.881 19.369  -61.594 1.00 26.77  ? 527  ALA A N     1 
ATOM   6723  C CA    . ALA C 2 127 ? -24.051 20.047  -60.314 1.00 26.77  ? 527  ALA A CA    1 
ATOM   6724  C C     . ALA C 2 127 ? -23.699 19.115  -59.123 1.00 26.77  ? 527  ALA A C     1 
ATOM   6725  O O     . ALA C 2 127 ? -22.921 19.478  -58.261 1.00 26.77  ? 527  ALA A O     1 
ATOM   6726  C CB    . ALA C 2 127 ? -25.444 20.537  -60.169 1.00 54.19  ? 527  ALA A CB    1 
ATOM   6727  N N     . ARG C 2 128 ? -24.236 17.907  -59.079 1.00 23.08  ? 528  ARG A N     1 
ATOM   6728  C CA    . ARG C 2 128 ? -23.920 17.077  -57.967 1.00 23.08  ? 528  ARG A CA    1 
ATOM   6729  C C     . ARG C 2 128 ? -22.470 16.757  -57.999 1.00 23.08  ? 528  ARG A C     1 
ATOM   6730  O O     . ARG C 2 128 ? -21.893 16.517  -56.978 1.00 23.08  ? 528  ARG A O     1 
ATOM   6731  C CB    . ARG C 2 128 ? -24.797 15.819  -57.937 1.00 23.50  ? 528  ARG A CB    1 
ATOM   6732  C CG    . ARG C 2 128 ? -26.209 16.043  -57.384 1.00 23.50  ? 528  ARG A CG    1 
ATOM   6733  C CD    . ARG C 2 128 ? -27.050 14.824  -57.254 1.00 23.50  ? 528  ARG A CD    1 
ATOM   6734  N NE    . ARG C 2 128 ? -26.504 13.904  -56.273 1.00 23.50  ? 528  ARG A NE    1 
ATOM   6735  C CZ    . ARG C 2 128 ? -26.233 12.615  -56.516 1.00 23.50  ? 528  ARG A CZ    1 
ATOM   6736  N NH1   . ARG C 2 128 ? -26.461 12.116  -57.709 1.00 23.50  ? 528  ARG A NH1   1 
ATOM   6737  N NH2   . ARG C 2 128 ? -25.744 11.800  -55.581 1.00 23.50  ? 528  ARG A NH2   1 
ATOM   6738  N N     . ARG C 2 129 ? -21.826 16.750  -59.146 1.00 23.11  ? 529  ARG A N     1 
ATOM   6739  C CA    . ARG C 2 129 ? -20.405 16.482  -58.997 1.00 23.11  ? 529  ARG A CA    1 
ATOM   6740  C C     . ARG C 2 129 ? -19.670 17.661  -58.289 1.00 23.11  ? 529  ARG A C     1 
ATOM   6741  O O     . ARG C 2 129 ? -18.964 17.524  -57.305 1.00 23.11  ? 529  ARG A O     1 
ATOM   6742  C CB    . ARG C 2 129 ? -19.741 16.181  -60.299 1.00 50.96  ? 529  ARG A CB    1 
ATOM   6743  C CG    . ARG C 2 129 ? -18.471 15.552  -59.964 1.00 50.96  ? 529  ARG A CG    1 
ATOM   6744  C CD    . ARG C 2 129 ? -17.533 15.310  -61.112 1.00 50.96  ? 529  ARG A CD    1 
ATOM   6745  N NE    . ARG C 2 129 ? -16.230 14.859  -60.612 1.00 50.96  ? 529  ARG A NE    1 
ATOM   6746  C CZ    . ARG C 2 129 ? -15.479 15.493  -59.673 1.00 50.96  ? 529  ARG A CZ    1 
ATOM   6747  N NH1   . ARG C 2 129 ? -15.863 16.677  -59.098 1.00 50.96  ? 529  ARG A NH1   1 
ATOM   6748  N NH2   . ARG C 2 129 ? -14.345 14.868  -59.244 1.00 50.96  ? 529  ARG A NH2   1 
ATOM   6749  N N     . ILE C 2 130 ? -19.855 18.851  -58.804 1.00 33.82  ? 530  ILE A N     1 
ATOM   6750  C CA    . ILE C 2 130 ? -19.219 19.982  -58.184 1.00 33.82  ? 530  ILE A CA    1 
ATOM   6751  C C     . ILE C 2 130 ? -19.624 20.177  -56.732 1.00 33.82  ? 530  ILE A C     1 
ATOM   6752  O O     . ILE C 2 130 ? -18.895 20.747  -55.959 1.00 33.82  ? 530  ILE A O     1 
ATOM   6753  C CB    . ILE C 2 130 ? -19.470 21.187  -59.058 1.00 20.78  ? 530  ILE A CB    1 
ATOM   6754  C CG1   . ILE C 2 130 ? -18.621 20.939  -60.241 1.00 20.78  ? 530  ILE A CG1   1 
ATOM   6755  C CG2   . ILE C 2 130 ? -18.964 22.492  -58.517 1.00 20.78  ? 530  ILE A CG2   1 
ATOM   6756  C CD1   . ILE C 2 130 ? -19.041 21.783  -61.394 1.00 20.78  ? 530  ILE A CD1   1 
ATOM   6757  N N     . ARG C 2 131 ? -20.756 19.643  -56.353 1.00 31.85  ? 531  ARG A N     1 
ATOM   6758  C CA    . ARG C 2 131 ? -21.210 19.765  -54.988 1.00 31.85  ? 531  ARG A CA    1 
ATOM   6759  C C     . ARG C 2 131 ? -20.463 18.789  -54.051 1.00 31.85  ? 531  ARG A C     1 
ATOM   6760  O O     . ARG C 2 131 ? -20.357 19.004  -52.875 1.00 31.85  ? 531  ARG A O     1 
ATOM   6761  C CB    . ARG C 2 131 ? -22.729 19.501  -54.951 1.00 19.99  ? 531  ARG A CB    1 
ATOM   6762  C CG    . ARG C 2 131 ? -23.622 20.779  -54.936 1.00 19.99  ? 531  ARG A CG    1 
ATOM   6763  C CD    . ARG C 2 131 ? -24.931 20.465  -55.521 1.00 19.99  ? 531  ARG A CD    1 
ATOM   6764  N NE    . ARG C 2 131 ? -26.029 21.379  -55.190 1.00 19.99  ? 531  ARG A NE    1 
ATOM   6765  C CZ    . ARG C 2 131 ? -27.090 21.058  -54.424 1.00 19.99  ? 531  ARG A CZ    1 
ATOM   6766  N NH1   . ARG C 2 131 ? -27.218 19.815  -53.858 1.00 19.99  ? 531  ARG A NH1   1 
ATOM   6767  N NH2   . ARG C 2 131 ? -28.055 21.957  -54.239 1.00 19.99  ? 531  ARG A NH2   1 
ATOM   6768  N N     . GLY C 2 132 ? -19.951 17.687  -54.551 1.00 33.76  ? 532  GLY A N     1 
ATOM   6769  C CA    . GLY C 2 132 ? -19.270 16.820  -53.661 1.00 33.76  ? 532  GLY A CA    1 
ATOM   6770  C C     . GLY C 2 132 ? -20.072 15.579  -53.397 1.00 33.76  ? 532  GLY A C     1 
ATOM   6771  O O     . GLY C 2 132 ? -19.805 14.828  -52.447 1.00 33.76  ? 532  GLY A O     1 
ATOM   6772  N N     . GLU C 2 133 ? -21.020 15.251  -54.237 1.00 37.25  ? 533  GLU A N     1 
ATOM   6773  C CA    . GLU C 2 133 ? -21.685 14.013  -53.992 1.00 37.25  ? 533  GLU A CA    1 
ATOM   6774  C C     . GLU C 2 133 ? -21.495 13.068  -55.236 1.00 37.25  ? 533  GLU A C     1 
ATOM   6775  O O     . GLU C 2 133 ? -22.452 12.229  -55.356 1.00 37.25  ? 533  GLU A O     1 
ATOM   6776  C CB    . GLU C 2 133 ? -23.235 14.331  -53.782 1.00 28.06  ? 533  GLU A CB    1 
ATOM   6777  C CG    . GLU C 2 133 ? -23.673 15.885  -53.442 1.00 28.06  ? 533  GLU A CG    1 
ATOM   6778  C CD    . GLU C 2 133 ? -25.269 16.381  -53.551 1.00 28.06  ? 533  GLU A CD    1 
ATOM   6779  O OE1   . GLU C 2 133 ? -26.144 15.792  -54.269 1.00 28.06  ? 533  GLU A OE1   1 
ATOM   6780  O OE2   . GLU C 2 133 ? -25.629 17.456  -52.931 1.00 28.06  ? 533  GLU A OE2   1 
ATOM   6781  N N     . ARG C 2 134 ? -20.371 12.976  -56.058 1.00 91.86  ? 534  ARG A N     1 
ATOM   6782  C CA    . ARG C 2 134 ? -20.681 12.238  -57.349 1.00 91.86  ? 534  ARG A CA    1 
ATOM   6783  C C     . ARG C 2 134 ? -20.217 11.040  -58.345 1.00 91.86  ? 534  ARG A C     1 
ATOM   6784  O O     . ARG C 2 134 ? -21.191 10.373  -58.863 1.00 91.86  ? 534  ARG A O     1 
ATOM   6785  C CB    . ARG C 2 134 ? -20.915 13.370  -58.336 1.00 134.72 ? 534  ARG A CB    1 
ATOM   6786  C CG    . ARG C 2 134 ? -22.394 13.722  -58.304 1.00 134.72 ? 534  ARG A CG    1 
ATOM   6787  C CD    . ARG C 2 134 ? -23.017 13.533  -59.700 1.00 134.72 ? 534  ARG A CD    1 
ATOM   6788  N NE    . ARG C 2 134 ? -22.801 12.213  -60.325 1.00 134.72 ? 534  ARG A NE    1 
ATOM   6789  C CZ    . ARG C 2 134 ? -23.754 11.301  -60.578 1.00 134.72 ? 534  ARG A CZ    1 
ATOM   6790  N NH1   . ARG C 2 134 ? -25.036 11.524  -60.274 1.00 134.72 ? 534  ARG A NH1   1 
ATOM   6791  N NH2   . ARG C 2 134 ? -23.422 10.135  -61.120 1.00 134.72 ? 534  ARG A NH2   1 
ATOM   6792  N N     . ALA C 2 135 ? -18.936 10.712  -58.730 1.00 145.59 ? 535  ALA A N     1 
ATOM   6793  C CA    . ALA C 2 135 ? -18.722 9.512   -59.707 1.00 145.59 ? 535  ALA A CA    1 
ATOM   6794  C C     . ALA C 2 135 ? -18.931 9.388   -61.331 1.00 145.59 ? 535  ALA A C     1 
ATOM   6795  O O     . ALA C 2 135 ? -18.206 9.983   -62.125 1.00 145.59 ? 535  ALA A O     1 
ATOM   6796  C CB    . ALA C 2 135 ? -19.506 8.332   -59.022 1.00 80.46  ? 535  ALA A CB    1 
ATOM   6797  O OXT   . ALA C 2 135 ? -19.847 8.664   -61.796 1.00 80.46  ? 535  ALA A OXT   1 
ATOM   6798  N N     . ARG D 3 23  ? -48.661 0.050   -58.880 1.00 108.41 ? 23   ARG B N     1 
ATOM   6799  C CA    . ARG D 3 23  ? -47.581 1.080   -58.692 1.00 108.41 ? 23   ARG B CA    1 
ATOM   6800  C C     . ARG D 3 23  ? -46.419 0.758   -57.693 1.00 108.41 ? 23   ARG B C     1 
ATOM   6801  O O     . ARG D 3 23  ? -46.507 -0.133  -56.839 1.00 108.41 ? 23   ARG B O     1 
ATOM   6802  C CB    . ARG D 3 23  ? -48.217 2.438   -58.299 1.00 118.88 ? 23   ARG B CB    1 
ATOM   6803  C CG    . ARG D 3 23  ? -47.214 3.475   -57.708 1.00 118.88 ? 23   ARG B CG    1 
ATOM   6804  C CD    . ARG D 3 23  ? -47.820 4.811   -57.277 1.00 118.88 ? 23   ARG B CD    1 
ATOM   6805  N NE    . ARG D 3 23  ? -48.816 5.258   -58.238 1.00 118.88 ? 23   ARG B NE    1 
ATOM   6806  C CZ    . ARG D 3 23  ? -48.987 6.515   -58.631 1.00 118.88 ? 23   ARG B CZ    1 
ATOM   6807  N NH1   . ARG D 3 23  ? -48.230 7.495   -58.163 1.00 118.88 ? 23   ARG B NH1   1 
ATOM   6808  N NH2   . ARG D 3 23  ? -49.936 6.794   -59.503 1.00 118.88 ? 23   ARG B NH2   1 
ATOM   6809  N N     . ASP D 3 24  ? -45.333 1.524   -57.845 1.00 74.07  ? 24   ASP B N     1 
ATOM   6810  C CA    . ASP D 3 24  ? -44.115 1.492   -57.041 1.00 74.07  ? 24   ASP B CA    1 
ATOM   6811  C C     . ASP D 3 24  ? -44.067 2.893   -56.368 1.00 74.07  ? 24   ASP B C     1 
ATOM   6812  O O     . ASP D 3 24  ? -44.434 3.911   -56.988 1.00 74.07  ? 24   ASP B O     1 
ATOM   6813  C CB    . ASP D 3 24  ? -42.907 1.309   -57.951 1.00 104.28 ? 24   ASP B CB    1 
ATOM   6814  C CG    . ASP D 3 24  ? -41.649 0.948   -57.189 1.00 104.28 ? 24   ASP B CG    1 
ATOM   6815  O OD1   . ASP D 3 24  ? -41.272 1.646   -56.211 1.00 104.28 ? 24   ASP B OD1   1 
ATOM   6816  O OD2   . ASP D 3 24  ? -41.030 -0.054  -57.587 1.00 104.28 ? 24   ASP B OD2   1 
ATOM   6817  N N     . ASN D 3 25  ? -43.585 2.951   -55.118 1.00 42.14  ? 25   ASN B N     1 
ATOM   6818  C CA    . ASN D 3 25  ? -43.581 4.204   -54.323 1.00 42.14  ? 25   ASN B CA    1 
ATOM   6819  C C     . ASN D 3 25  ? -42.754 5.338   -54.848 1.00 42.14  ? 25   ASN B C     1 
ATOM   6820  O O     . ASN D 3 25  ? -43.191 6.468   -54.822 1.00 42.14  ? 25   ASN B O     1 
ATOM   6821  C CB    . ASN D 3 25  ? -43.189 3.895   -52.886 1.00 52.81  ? 25   ASN B CB    1 
ATOM   6822  C CG    . ASN D 3 25  ? -44.176 2.957   -52.213 1.00 52.81  ? 25   ASN B CG    1 
ATOM   6823  O OD1   . ASN D 3 25  ? -45.384 3.220   -52.170 1.00 52.81  ? 25   ASN B OD1   1 
ATOM   6824  N ND2   . ASN D 3 25  ? -43.667 1.841   -51.707 1.00 52.81  ? 25   ASN B ND2   1 
ATOM   6825  N N     . ILE D 3 26  ? -41.563 5.042   -55.349 1.00 32.29  ? 26   ILE B N     1 
ATOM   6826  C CA    . ILE D 3 26  ? -40.742 6.100   -55.872 1.00 32.29  ? 26   ILE B CA    1 
ATOM   6827  C C     . ILE D 3 26  ? -41.407 6.700   -57.078 1.00 32.29  ? 26   ILE B C     1 
ATOM   6828  O O     . ILE D 3 26  ? -41.168 7.827   -57.377 1.00 32.29  ? 26   ILE B O     1 
ATOM   6829  C CB    . ILE D 3 26  ? -39.425 5.594   -56.303 1.00 27.71  ? 26   ILE B CB    1 
ATOM   6830  C CG1   . ILE D 3 26  ? -38.412 6.775   -56.505 1.00 27.71  ? 26   ILE B CG1   1 
ATOM   6831  C CG2   . ILE D 3 26  ? -39.644 4.898   -57.641 1.00 27.71  ? 26   ILE B CG2   1 
ATOM   6832  C CD1   . ILE D 3 26  ? -38.433 7.896   -55.537 1.00 27.71  ? 26   ILE B CD1   1 
ATOM   6833  N N     . GLN D 3 27  ? -42.226 5.927   -57.780 1.00 51.15  ? 27   GLN B N     1 
ATOM   6834  C CA    . GLN D 3 27  ? -42.942 6.401   -58.974 1.00 51.15  ? 27   GLN B CA    1 
ATOM   6835  C C     . GLN D 3 27  ? -44.165 7.099   -58.456 1.00 51.15  ? 27   GLN B C     1 
ATOM   6836  O O     . GLN D 3 27  ? -44.935 7.710   -59.166 1.00 51.15  ? 27   GLN B O     1 
ATOM   6837  C CB    . GLN D 3 27  ? -43.295 5.230   -59.839 1.00 53.73  ? 27   GLN B CB    1 
ATOM   6838  C CG    . GLN D 3 27  ? -42.081 4.600   -60.490 1.00 53.73  ? 27   GLN B CG    1 
ATOM   6839  C CD    . GLN D 3 27  ? -41.400 5.525   -61.528 1.00 53.73  ? 27   GLN B CD    1 
ATOM   6840  O OE1   . GLN D 3 27  ? -42.089 6.218   -62.311 1.00 53.73  ? 27   GLN B OE1   1 
ATOM   6841  N NE2   . GLN D 3 27  ? -40.040 5.524   -61.548 1.00 53.73  ? 27   GLN B NE2   1 
ATOM   6842  N N     . GLY D 3 28  ? -44.311 7.008   -57.157 1.00 55.35  ? 28   GLY B N     1 
ATOM   6843  C CA    . GLY D 3 28  ? -45.385 7.695   -56.535 1.00 55.35  ? 28   GLY B CA    1 
ATOM   6844  C C     . GLY D 3 28  ? -45.012 9.148   -56.580 1.00 55.35  ? 28   GLY B C     1 
ATOM   6845  O O     . GLY D 3 28  ? -45.890 9.953   -56.435 1.00 55.35  ? 28   GLY B O     1 
ATOM   6846  N N     . ILE D 3 29  ? -43.743 9.503   -56.743 1.00 53.31  ? 29   ILE B N     1 
ATOM   6847  C CA    . ILE D 3 29  ? -43.369 10.909  -56.818 1.00 53.31  ? 29   ILE B CA    1 
ATOM   6848  C C     . ILE D 3 29  ? -43.566 11.147  -58.254 1.00 53.31  ? 29   ILE B C     1 
ATOM   6849  O O     . ILE D 3 29  ? -42.741 10.725  -59.041 1.00 53.31  ? 29   ILE B O     1 
ATOM   6850  C CB    . ILE D 3 29  ? -41.915 11.143  -56.548 1.00 22.16  ? 29   ILE B CB    1 
ATOM   6851  C CG1   . ILE D 3 29  ? -41.552 10.448  -55.285 1.00 22.16  ? 29   ILE B CG1   1 
ATOM   6852  C CG2   . ILE D 3 29  ? -41.667 12.600  -56.128 1.00 22.16  ? 29   ILE B CG2   1 
ATOM   6853  C CD1   . ILE D 3 29  ? -42.247 11.063  -54.035 1.00 22.16  ? 29   ILE B CD1   1 
ATOM   6854  N N     . THR D 3 30  ? -44.624 11.865  -58.596 1.00 46.61  ? 30   THR B N     1 
ATOM   6855  C CA    . THR D 3 30  ? -44.982 12.084  -59.986 1.00 46.61  ? 30   THR B CA    1 
ATOM   6856  C C     . THR D 3 30  ? -44.318 13.163  -60.819 1.00 46.61  ? 30   THR B C     1 
ATOM   6857  O O     . THR D 3 30  ? -43.705 14.068  -60.315 1.00 46.61  ? 30   THR B O     1 
ATOM   6858  C CB    . THR D 3 30  ? -46.497 12.303  -60.083 1.00 24.24  ? 30   THR B CB    1 
ATOM   6859  O OG1   . THR D 3 30  ? -46.831 13.589  -59.600 1.00 24.24  ? 30   THR B OG1   1 
ATOM   6860  C CG2   . THR D 3 30  ? -47.234 11.286  -59.264 1.00 24.24  ? 30   THR B CG2   1 
ATOM   6861  N N     . LYS D 3 31  ? -44.474 13.072  -62.119 1.00 34.16  ? 31   LYS B N     1 
ATOM   6862  C CA    . LYS D 3 31  ? -43.918 14.053  -63.050 1.00 34.16  ? 31   LYS B CA    1 
ATOM   6863  C C     . LYS D 3 31  ? -44.443 15.474  -62.800 1.00 34.16  ? 31   LYS B C     1 
ATOM   6864  O O     . LYS D 3 31  ? -43.722 16.462  -62.850 1.00 34.16  ? 31   LYS B O     1 
ATOM   6865  C CB    . LYS D 3 31  ? -44.218 13.613  -64.473 1.00 41.88  ? 31   LYS B CB    1 
ATOM   6866  C CG    . LYS D 3 31  ? -44.052 14.673  -65.445 1.00 41.88  ? 31   LYS B CG    1 
ATOM   6867  C CD    . LYS D 3 31  ? -44.125 14.144  -66.851 1.00 41.88  ? 31   LYS B CD    1 
ATOM   6868  C CE    . LYS D 3 31  ? -44.643 15.209  -67.865 1.00 41.88  ? 31   LYS B CE    1 
ATOM   6869  N NZ    . LYS D 3 31  ? -44.752 14.622  -69.237 1.00 41.88  ? 31   LYS B NZ    1 
ATOM   6870  N N     . PRO D 3 32  ? -45.715 15.619  -62.548 1.00 25.70  ? 32   PRO B N     1 
ATOM   6871  C CA    . PRO D 3 32  ? -46.220 16.974  -62.279 1.00 25.70  ? 32   PRO B CA    1 
ATOM   6872  C C     . PRO D 3 32  ? -45.574 17.567  -60.979 1.00 25.70  ? 32   PRO B C     1 
ATOM   6873  O O     . PRO D 3 32  ? -45.380 18.786  -60.826 1.00 25.70  ? 32   PRO B O     1 
ATOM   6874  C CB    . PRO D 3 32  ? -47.693 16.734  -62.065 1.00 21.24  ? 32   PRO B CB    1 
ATOM   6875  C CG    . PRO D 3 32  ? -47.919 15.441  -62.900 1.00 21.24  ? 32   PRO B CG    1 
ATOM   6876  C CD    . PRO D 3 32  ? -46.770 14.625  -62.506 1.00 21.24  ? 32   PRO B CD    1 
ATOM   6877  N N     . ALA D 3 33  ? -45.258 16.723  -60.016 1.00 35.82  ? 33   ALA B N     1 
ATOM   6878  C CA    . ALA D 3 33  ? -44.645 17.279  -58.835 1.00 35.82  ? 33   ALA B CA    1 
ATOM   6879  C C     . ALA D 3 33  ? -43.211 17.635  -59.140 1.00 35.82  ? 33   ALA B C     1 
ATOM   6880  O O     . ALA D 3 33  ? -42.698 18.739  -58.763 1.00 35.82  ? 33   ALA B O     1 
ATOM   6881  C CB    . ALA D 3 33  ? -44.692 16.320  -57.761 1.00 51.91  ? 33   ALA B CB    1 
ATOM   6882  N N     . ILE D 3 34  ? -42.521 16.704  -59.793 1.00 19.03  ? 34   ILE B N     1 
ATOM   6883  C CA    . ILE D 3 34  ? -41.159 17.077  -60.116 1.00 19.03  ? 34   ILE B CA    1 
ATOM   6884  C C     . ILE D 3 34  ? -41.202 18.325  -60.980 1.00 19.03  ? 34   ILE B C     1 
ATOM   6885  O O     . ILE D 3 34  ? -40.339 19.220  -60.832 1.00 19.03  ? 34   ILE B O     1 
ATOM   6886  C CB    . ILE D 3 34  ? -40.503 16.095  -60.884 1.00 9.66   ? 34   ILE B CB    1 
ATOM   6887  C CG1   . ILE D 3 34  ? -40.347 14.856  -60.030 1.00 9.66   ? 34   ILE B CG1   1 
ATOM   6888  C CG2   . ILE D 3 34  ? -39.260 16.673  -61.403 1.00 9.66   ? 34   ILE B CG2   1 
ATOM   6889  C CD1   . ILE D 3 34  ? -40.151 13.565  -60.899 1.00 9.66   ? 34   ILE B CD1   1 
ATOM   6890  N N     . ARG D 3 35  ? -42.218 18.408  -61.850 1.00 34.94  ? 35   ARG B N     1 
ATOM   6891  C CA    . ARG D 3 35  ? -42.313 19.554  -62.668 1.00 34.94  ? 35   ARG B CA    1 
ATOM   6892  C C     . ARG D 3 35  ? -42.485 20.709  -61.689 1.00 34.94  ? 35   ARG B C     1 
ATOM   6893  O O     . ARG D 3 35  ? -41.611 21.572  -61.647 1.00 34.94  ? 35   ARG B O     1 
ATOM   6894  C CB    . ARG D 3 35  ? -43.436 19.427  -63.668 1.00 72.46  ? 35   ARG B CB    1 
ATOM   6895  C CG    . ARG D 3 35  ? -43.562 20.624  -64.608 1.00 72.46  ? 35   ARG B CG    1 
ATOM   6896  C CD    . ARG D 3 35  ? -44.400 20.280  -65.793 1.00 72.46  ? 35   ARG B CD    1 
ATOM   6897  N NE    . ARG D 3 35  ? -43.692 19.329  -66.633 1.00 72.46  ? 35   ARG B NE    1 
ATOM   6898  C CZ    . ARG D 3 35  ? -43.140 19.675  -67.796 1.00 72.46  ? 35   ARG B CZ    1 
ATOM   6899  N NH1   . ARG D 3 35  ? -43.238 20.933  -68.229 1.00 72.46  ? 35   ARG B NH1   1 
ATOM   6900  N NH2   . ARG D 3 35  ? -42.471 18.785  -68.528 1.00 72.46  ? 35   ARG B NH2   1 
ATOM   6901  N N     . ARG D 3 36  ? -43.527 20.751  -60.847 1.00 29.85  ? 36   ARG B N     1 
ATOM   6902  C CA    . ARG D 3 36  ? -43.653 21.891  -59.915 1.00 29.85  ? 36   ARG B CA    1 
ATOM   6903  C C     . ARG D 3 36  ? -42.340 22.291  -59.196 1.00 29.85  ? 36   ARG B C     1 
ATOM   6904  O O     . ARG D 3 36  ? -42.062 23.488  -59.050 1.00 29.85  ? 36   ARG B O     1 
ATOM   6905  C CB    . ARG D 3 36  ? -44.702 21.595  -58.860 1.00 30.76  ? 36   ARG B CB    1 
ATOM   6906  C CG    . ARG D 3 36  ? -46.082 21.993  -59.162 1.00 30.76  ? 36   ARG B CG    1 
ATOM   6907  C CD    . ARG D 3 36  ? -47.020 21.803  -57.926 1.00 30.76  ? 36   ARG B CD    1 
ATOM   6908  N NE    . ARG D 3 36  ? -47.203 20.412  -57.499 1.00 30.76  ? 36   ARG B NE    1 
ATOM   6909  C CZ    . ARG D 3 36  ? -47.811 19.471  -58.213 1.00 30.76  ? 36   ARG B CZ    1 
ATOM   6910  N NH1   . ARG D 3 36  ? -48.315 19.726  -59.404 1.00 30.76  ? 36   ARG B NH1   1 
ATOM   6911  N NH2   . ARG D 3 36  ? -47.915 18.259  -57.756 1.00 30.76  ? 36   ARG B NH2   1 
ATOM   6912  N N     . LEU D 3 37  ? -41.538 21.294  -58.756 1.00 15.39  ? 37   LEU B N     1 
ATOM   6913  C CA    . LEU D 3 37  ? -40.283 21.603  -58.018 1.00 15.39  ? 37   LEU B CA    1 
ATOM   6914  C C     . LEU D 3 37  ? -39.370 22.421  -58.871 1.00 15.39  ? 37   LEU B C     1 
ATOM   6915  O O     . LEU D 3 37  ? -38.973 23.555  -58.519 1.00 15.39  ? 37   LEU B O     1 
ATOM   6916  C CB    . LEU D 3 37  ? -39.546 20.351  -57.598 1.00 16.05  ? 37   LEU B CB    1 
ATOM   6917  C CG    . LEU D 3 37  ? -40.324 19.662  -56.452 1.00 16.05  ? 37   LEU B CG    1 
ATOM   6918  C CD1   . LEU D 3 37  ? -39.877 18.090  -56.462 1.00 16.05  ? 37   LEU B CD1   1 
ATOM   6919  C CD2   . LEU D 3 37  ? -40.219 20.380  -55.105 1.00 16.05  ? 37   LEU B CD2   1 
ATOM   6920  N N     . ALA D 3 38  ? -39.077 21.830  -60.017 1.00 24.54  ? 38   ALA B N     1 
ATOM   6921  C CA    . ALA D 3 38  ? -38.280 22.477  -61.029 1.00 24.54  ? 38   ALA B CA    1 
ATOM   6922  C C     . ALA D 3 38  ? -38.682 23.954  -61.213 1.00 24.54  ? 38   ALA B C     1 
ATOM   6923  O O     . ALA D 3 38  ? -37.891 24.887  -61.267 1.00 24.54  ? 38   ALA B O     1 
ATOM   6924  C CB    . ALA D 3 38  ? -38.479 21.720  -62.323 1.00 6.62   ? 38   ALA B CB    1 
ATOM   6925  N N     . ARG D 3 39  ? -39.965 24.135  -61.368 1.00 21.77  ? 39   ARG B N     1 
ATOM   6926  C CA    . ARG D 3 39  ? -40.490 25.444  -61.542 1.00 21.77  ? 39   ARG B CA    1 
ATOM   6927  C C     . ARG D 3 39  ? -40.057 26.311  -60.389 1.00 21.77  ? 39   ARG B C     1 
ATOM   6928  O O     . ARG D 3 39  ? -39.578 27.432  -60.596 1.00 21.77  ? 39   ARG B O     1 
ATOM   6929  C CB    . ARG D 3 39  ? -42.002 25.359  -61.594 1.00 33.62  ? 39   ARG B CB    1 
ATOM   6930  C CG    . ARG D 3 39  ? -42.521 24.611  -62.752 1.00 33.62  ? 39   ARG B CG    1 
ATOM   6931  C CD    . ARG D 3 39  ? -42.473 25.477  -63.978 1.00 33.62  ? 39   ARG B CD    1 
ATOM   6932  N NE    . ARG D 3 39  ? -43.109 24.816  -65.091 1.00 33.62  ? 39   ARG B NE    1 
ATOM   6933  C CZ    . ARG D 3 39  ? -42.424 24.420  -66.140 1.00 33.62  ? 39   ARG B CZ    1 
ATOM   6934  N NH1   . ARG D 3 39  ? -41.159 24.639  -66.172 1.00 33.62  ? 39   ARG B NH1   1 
ATOM   6935  N NH2   . ARG D 3 39  ? -42.971 23.774  -67.133 1.00 33.62  ? 39   ARG B NH2   1 
ATOM   6936  N N     . ARG D 3 40  ? -40.226 25.822  -59.169 1.00 27.37  ? 40   ARG B N     1 
ATOM   6937  C CA    . ARG D 3 40  ? -39.854 26.655  -58.061 1.00 27.37  ? 40   ARG B CA    1 
ATOM   6938  C C     . ARG D 3 40  ? -38.402 27.011  -58.138 1.00 27.37  ? 40   ARG B C     1 
ATOM   6939  O O     . ARG D 3 40  ? -38.007 28.091  -57.710 1.00 27.37  ? 40   ARG B O     1 
ATOM   6940  C CB    . ARG D 3 40  ? -40.163 25.961  -56.781 1.00 31.25  ? 40   ARG B CB    1 
ATOM   6941  C CG    . ARG D 3 40  ? -39.991 26.815  -55.582 1.00 31.25  ? 40   ARG B CG    1 
ATOM   6942  C CD    . ARG D 3 40  ? -40.766 26.164  -54.468 1.00 31.25  ? 40   ARG B CD    1 
ATOM   6943  N NE    . ARG D 3 40  ? -42.074 26.774  -54.265 1.00 31.25  ? 40   ARG B NE    1 
ATOM   6944  C CZ    . ARG D 3 40  ? -42.985 26.284  -53.443 1.00 31.25  ? 40   ARG B CZ    1 
ATOM   6945  N NH1   . ARG D 3 40  ? -42.738 25.175  -52.783 1.00 31.25  ? 40   ARG B NH1   1 
ATOM   6946  N NH2   . ARG D 3 40  ? -44.093 26.954  -53.201 1.00 31.25  ? 40   ARG B NH2   1 
ATOM   6947  N N     . GLY D 3 41  ? -37.594 26.109  -58.691 1.00 27.86  ? 41   GLY B N     1 
ATOM   6948  C CA    . GLY D 3 41  ? -36.163 26.380  -58.879 1.00 27.86  ? 41   GLY B CA    1 
ATOM   6949  C C     . GLY D 3 41  ? -35.849 27.231  -60.120 1.00 27.86  ? 41   GLY B C     1 
ATOM   6950  O O     . GLY D 3 41  ? -34.707 27.343  -60.532 1.00 27.86  ? 41   GLY B O     1 
ATOM   6951  N N     . GLY D 3 42  ? -36.904 27.821  -60.697 1.00 34.13  ? 42   GLY B N     1 
ATOM   6952  C CA    . GLY D 3 42  ? -36.842 28.689  -61.864 1.00 34.13  ? 42   GLY B CA    1 
ATOM   6953  C C     . GLY D 3 42  ? -36.486 28.033  -63.177 1.00 34.13  ? 42   GLY B C     1 
ATOM   6954  O O     . GLY D 3 42  ? -35.806 28.649  -63.988 1.00 34.13  ? 42   GLY B O     1 
ATOM   6955  N N     . VAL D 3 43  ? -36.905 26.788  -63.381 1.00 26.88  ? 43   VAL B N     1 
ATOM   6956  C CA    . VAL D 3 43  ? -36.584 26.066  -64.620 1.00 26.88  ? 43   VAL B CA    1 
ATOM   6957  C C     . VAL D 3 43  ? -37.779 26.123  -65.567 1.00 26.88  ? 43   VAL B C     1 
ATOM   6958  O O     . VAL D 3 43  ? -38.913 25.855  -65.123 1.00 26.88  ? 43   VAL B O     1 
ATOM   6959  C CB    . VAL D 3 43  ? -36.334 24.595  -64.353 1.00 30.58  ? 43   VAL B CB    1 
ATOM   6960  C CG1   . VAL D 3 43  ? -36.380 23.802  -65.656 1.00 30.58  ? 43   VAL B CG1   1 
ATOM   6961  C CG2   . VAL D 3 43  ? -35.065 24.429  -63.699 1.00 30.58  ? 43   VAL B CG2   1 
ATOM   6962  N N     . LYS D 3 44  ? -37.510 26.413  -66.852 1.00 39.91  ? 44   LYS B N     1 
ATOM   6963  C CA    . LYS D 3 44  ? -38.531 26.573  -67.885 1.00 39.91  ? 44   LYS B CA    1 
ATOM   6964  C C     . LYS D 3 44  ? -38.696 25.435  -68.834 1.00 39.91  ? 44   LYS B C     1 
ATOM   6965  O O     . LYS D 3 44  ? -39.798 25.100  -69.192 1.00 39.91  ? 44   LYS B O     1 
ATOM   6966  C CB    . LYS D 3 44  ? -38.237 27.830  -68.635 1.00 47.22  ? 44   LYS B CB    1 
ATOM   6967  C CG    . LYS D 3 44  ? -38.797 27.940  -69.995 1.00 47.22  ? 44   LYS B CG    1 
ATOM   6968  C CD    . LYS D 3 44  ? -38.460 29.370  -70.538 1.00 47.22  ? 44   LYS B CD    1 
ATOM   6969  C CE    . LYS D 3 44  ? -39.325 29.756  -71.759 1.00 47.22  ? 44   LYS B CE    1 
ATOM   6970  N NZ    . LYS D 3 44  ? -38.797 30.977  -72.406 1.00 47.22  ? 44   LYS B NZ    1 
ATOM   6971  N N     . CYS D 3 45  ? -37.635 24.779  -69.229 1.00 36.98  ? 45   CYS B N     1 
ATOM   6972  C CA    . CYS D 3 45  ? -37.807 23.675  -70.161 1.00 36.98  ? 45   CYS B CA    1 
ATOM   6973  C C     . CYS D 3 45  ? -37.221 22.430  -69.544 1.00 36.98  ? 45   CYS B C     1 
ATOM   6974  O O     . CYS D 3 45  ? -36.108 22.490  -69.028 1.00 36.98  ? 45   CYS B O     1 
ATOM   6975  C CB    . CYS D 3 45  ? -37.168 24.056  -71.489 1.00 36.95  ? 45   CYS B CB    1 
ATOM   6976  S SG    . CYS D 3 45  ? -38.119 25.411  -72.161 1.00 36.95  ? 45   CYS B SG    1 
ATOM   6977  N N     . ILE D 3 46  ? -37.933 21.300  -69.617 1.00 32.31  ? 46   ILE B N     1 
ATOM   6978  C CA    . ILE D 3 46  ? -37.465 20.113  -68.960 1.00 32.31  ? 46   ILE B CA    1 
ATOM   6979  C C     . ILE D 3 46  ? -37.347 18.834  -69.752 1.00 32.31  ? 46   ILE B C     1 
ATOM   6980  O O     . ILE D 3 46  ? -38.414 18.187  -69.975 1.00 32.31  ? 46   ILE B O     1 
ATOM   6981  C CB    . ILE D 3 46  ? -38.390 19.842  -67.767 1.00 26.81  ? 46   ILE B CB    1 
ATOM   6982  C CG1   . ILE D 3 46  ? -38.262 20.979  -66.825 1.00 26.81  ? 46   ILE B CG1   1 
ATOM   6983  C CG2   . ILE D 3 46  ? -38.016 18.622  -67.006 1.00 26.81  ? 46   ILE B CG2   1 
ATOM   6984  C CD1   . ILE D 3 46  ? -39.307 20.909  -65.730 1.00 26.81  ? 46   ILE B CD1   1 
ATOM   6985  N N     . SER D 3 47  ? -36.116 18.415  -70.098 1.00 36.03  ? 47   SER B N     1 
ATOM   6986  C CA    . SER D 3 47  ? -35.885 17.100  -70.745 1.00 36.03  ? 47   SER B CA    1 
ATOM   6987  C C     . SER D 3 47  ? -36.671 15.889  -70.080 1.00 36.03  ? 47   SER B C     1 
ATOM   6988  O O     . SER D 3 47  ? -36.724 15.708  -68.853 1.00 36.03  ? 47   SER B O     1 
ATOM   6989  C CB    . SER D 3 47  ? -34.424 16.765  -70.723 1.00 38.57  ? 47   SER B CB    1 
ATOM   6990  O OG    . SER D 3 47  ? -34.261 15.378  -71.013 1.00 38.57  ? 47   SER B OG    1 
ATOM   6991  N N     . GLY D 3 48  ? -37.273 15.054  -70.907 1.00 43.84  ? 48   GLY B N     1 
ATOM   6992  C CA    . GLY D 3 48  ? -38.069 13.988  -70.376 1.00 43.84  ? 48   GLY B CA    1 
ATOM   6993  C C     . GLY D 3 48  ? -37.315 13.032  -69.521 1.00 43.84  ? 48   GLY B C     1 
ATOM   6994  O O     . GLY D 3 48  ? -37.918 12.385  -68.676 1.00 43.84  ? 48   GLY B O     1 
ATOM   6995  N N     . LEU D 3 49  ? -36.001 12.961  -69.694 1.00 30.46  ? 49   LEU B N     1 
ATOM   6996  C CA    . LEU D 3 49  ? -35.204 12.007  -68.968 1.00 30.46  ? 49   LEU B CA    1 
ATOM   6997  C C     . LEU D 3 49  ? -34.880 12.390  -67.515 1.00 30.46  ? 49   LEU B C     1 
ATOM   6998  O O     . LEU D 3 49  ? -34.309 11.584  -66.740 1.00 30.46  ? 49   LEU B O     1 
ATOM   6999  C CB    . LEU D 3 49  ? -33.960 11.803  -69.758 1.00 28.50  ? 49   LEU B CB    1 
ATOM   7000  C CG    . LEU D 3 49  ? -33.990 10.791  -70.876 1.00 28.50  ? 49   LEU B CG    1 
ATOM   7001  C CD1   . LEU D 3 49  ? -32.887 11.140  -71.778 1.00 28.50  ? 49   LEU B CD1   1 
ATOM   7002  C CD2   . LEU D 3 49  ? -33.835 9.403   -70.387 1.00 28.50  ? 49   LEU B CD2   1 
ATOM   7003  N N     . ILE D 3 50  ? -35.245 13.634  -67.180 1.00 28.82  ? 50   ILE B N     1 
ATOM   7004  C CA    . ILE D 3 50  ? -35.107 14.228  -65.859 1.00 28.82  ? 50   ILE B CA    1 
ATOM   7005  C C     . ILE D 3 50  ? -35.885 13.466  -64.817 1.00 28.82  ? 50   ILE B C     1 
ATOM   7006  O O     . ILE D 3 50  ? -35.354 12.977  -63.881 1.00 28.82  ? 50   ILE B O     1 
ATOM   7007  C CB    . ILE D 3 50  ? -35.689 15.630  -65.837 1.00 26.66  ? 50   ILE B CB    1 
ATOM   7008  C CG1   . ILE D 3 50  ? -34.770 16.631  -66.569 1.00 26.66  ? 50   ILE B CG1   1 
ATOM   7009  C CG2   . ILE D 3 50  ? -36.113 15.978  -64.471 1.00 26.66  ? 50   ILE B CG2   1 
ATOM   7010  C CD1   . ILE D 3 50  ? -33.324 16.842  -66.139 1.00 26.66  ? 50   ILE B CD1   1 
ATOM   7011  N N     . TYR D 3 51  ? -37.174 13.337  -64.964 1.00 40.72  ? 51   TYR B N     1 
ATOM   7012  C CA    . TYR D 3 51  ? -37.882 12.671  -63.891 1.00 40.72  ? 51   TYR B CA    1 
ATOM   7013  C C     . TYR D 3 51  ? -37.186 11.411  -63.357 1.00 40.72  ? 51   TYR B C     1 
ATOM   7014  O O     . TYR D 3 51  ? -36.927 11.267  -62.172 1.00 40.72  ? 51   TYR B O     1 
ATOM   7015  C CB    . TYR D 3 51  ? -39.301 12.373  -64.342 1.00 18.55  ? 51   TYR B CB    1 
ATOM   7016  C CG    . TYR D 3 51  ? -39.901 13.541  -65.099 1.00 18.55  ? 51   TYR B CG    1 
ATOM   7017  C CD1   . TYR D 3 51  ? -40.343 14.707  -64.421 1.00 18.55  ? 51   TYR B CD1   1 
ATOM   7018  C CD2   . TYR D 3 51  ? -39.819 13.608  -66.485 1.00 18.55  ? 51   TYR B CD2   1 
ATOM   7019  C CE1   . TYR D 3 51  ? -40.630 15.894  -65.149 1.00 18.55  ? 51   TYR B CE1   1 
ATOM   7020  C CE2   . TYR D 3 51  ? -40.113 14.732  -67.153 1.00 18.55  ? 51   TYR B CE2   1 
ATOM   7021  C CZ    . TYR D 3 51  ? -40.501 15.884  -66.526 1.00 18.55  ? 51   TYR B CZ    1 
ATOM   7022  O OH    . TYR D 3 51  ? -40.644 17.074  -67.303 1.00 18.55  ? 51   TYR B OH    1 
ATOM   7023  N N     . GLU D 3 52  ? -36.863 10.476  -64.213 1.00 33.40  ? 52   GLU B N     1 
ATOM   7024  C CA    . GLU D 3 52  ? -36.258 9.340   -63.640 1.00 33.40  ? 52   GLU B CA    1 
ATOM   7025  C C     . GLU D 3 52  ? -34.995 9.795   -62.985 1.00 33.40  ? 52   GLU B C     1 
ATOM   7026  O O     . GLU D 3 52  ? -34.769 9.477   -61.858 1.00 33.40  ? 52   GLU B O     1 
ATOM   7027  C CB    . GLU D 3 52  ? -35.960 8.305   -64.688 1.00 54.84  ? 52   GLU B CB    1 
ATOM   7028  C CG    . GLU D 3 52  ? -37.173 7.624   -65.118 1.00 54.84  ? 52   GLU B CG    1 
ATOM   7029  C CD    . GLU D 3 52  ? -37.790 6.862   -63.986 1.00 54.84  ? 52   GLU B CD    1 
ATOM   7030  O OE1   . GLU D 3 52  ? -37.055 6.045   -63.422 1.00 54.84  ? 52   GLU B OE1   1 
ATOM   7031  O OE2   . GLU D 3 52  ? -38.996 7.062   -63.661 1.00 54.84  ? 52   GLU B OE2   1 
ATOM   7032  N N     . GLU D 3 53  ? -34.161 10.548  -63.667 1.00 38.90  ? 53   GLU B N     1 
ATOM   7033  C CA    . GLU D 3 53  ? -32.924 10.922  -63.031 1.00 38.90  ? 53   GLU B CA    1 
ATOM   7034  C C     . GLU D 3 53  ? -33.124 11.592  -61.680 1.00 38.90  ? 53   GLU B C     1 
ATOM   7035  O O     . GLU D 3 53  ? -32.303 11.361  -60.784 1.00 38.90  ? 53   GLU B O     1 
ATOM   7036  C CB    . GLU D 3 53  ? -32.107 11.800  -63.948 1.00 36.60  ? 53   GLU B CB    1 
ATOM   7037  C CG    . GLU D 3 53  ? -30.873 12.316  -63.341 1.00 36.60  ? 53   GLU B CG    1 
ATOM   7038  C CD    . GLU D 3 53  ? -29.702 11.345  -63.482 1.00 36.60  ? 53   GLU B CD    1 
ATOM   7039  O OE1   . GLU D 3 53  ? -29.660 10.549  -64.513 1.00 36.60  ? 53   GLU B OE1   1 
ATOM   7040  O OE2   . GLU D 3 53  ? -28.820 11.403  -62.557 1.00 36.60  ? 53   GLU B OE2   1 
ATOM   7041  N N     . THR D 3 54  ? -34.212 12.366  -61.528 1.00 36.38  ? 54   THR B N     1 
ATOM   7042  C CA    . THR D 3 54  ? -34.569 13.083  -60.296 1.00 36.38  ? 54   THR B CA    1 
ATOM   7043  C C     . THR D 3 54  ? -34.927 12.167  -59.156 1.00 36.38  ? 54   THR B C     1 
ATOM   7044  O O     . THR D 3 54  ? -34.475 12.323  -58.016 1.00 36.38  ? 54   THR B O     1 
ATOM   7045  C CB    . THR D 3 54  ? -35.752 13.958  -60.527 1.00 26.97  ? 54   THR B CB    1 
ATOM   7046  O OG1   . THR D 3 54  ? -35.437 14.831  -61.590 1.00 26.97  ? 54   THR B OG1   1 
ATOM   7047  C CG2   . THR D 3 54  ? -36.103 14.809  -59.336 1.00 26.97  ? 54   THR B CG2   1 
ATOM   7048  N N     . ARG D 3 55  ? -35.770 11.201  -59.451 1.00 37.18  ? 55   ARG B N     1 
ATOM   7049  C CA    . ARG D 3 55  ? -36.170 10.275  -58.410 1.00 37.18  ? 55   ARG B CA    1 
ATOM   7050  C C     . ARG D 3 55  ? -34.994 9.601   -57.755 1.00 37.18  ? 55   ARG B C     1 
ATOM   7051  O O     . ARG D 3 55  ? -34.921 9.493   -56.517 1.00 37.18  ? 55   ARG B O     1 
ATOM   7052  C CB    . ARG D 3 55  ? -37.178 9.259   -58.942 1.00 32.59  ? 55   ARG B CB    1 
ATOM   7053  C CG    . ARG D 3 55  ? -38.491 9.908   -59.476 1.00 32.59  ? 55   ARG B CG    1 
ATOM   7054  C CD    . ARG D 3 55  ? -39.611 8.832   -59.692 1.00 32.59  ? 55   ARG B CD    1 
ATOM   7055  N NE    . ARG D 3 55  ? -40.778 9.439   -60.321 1.00 32.59  ? 55   ARG B NE    1 
ATOM   7056  C CZ    . ARG D 3 55  ? -40.990 9.444   -61.617 1.00 32.59  ? 55   ARG B CZ    1 
ATOM   7057  N NH1   . ARG D 3 55  ? -40.140 8.851   -62.423 1.00 32.59  ? 55   ARG B NH1   1 
ATOM   7058  N NH2   . ARG D 3 55  ? -42.003 10.138  -62.094 1.00 32.59  ? 55   ARG B NH2   1 
ATOM   7059  N N     . GLY D 3 56  ? -34.041 9.178   -58.556 1.00 30.03  ? 56   GLY B N     1 
ATOM   7060  C CA    . GLY D 3 56  ? -32.894 8.547   -57.943 1.00 30.03  ? 56   GLY B CA    1 
ATOM   7061  C C     . GLY D 3 56  ? -32.150 9.487   -57.016 1.00 30.03  ? 56   GLY B C     1 
ATOM   7062  O O     . GLY D 3 56  ? -31.562 9.066   -56.013 1.00 30.03  ? 56   GLY B O     1 
ATOM   7063  N N     . VAL D 3 57  ? -32.172 10.763  -57.359 1.00 27.82  ? 57   VAL B N     1 
ATOM   7064  C CA    . VAL D 3 57  ? -31.517 11.715  -56.532 1.00 27.82  ? 57   VAL B CA    1 
ATOM   7065  C C     . VAL D 3 57  ? -32.405 11.816  -55.265 1.00 27.82  ? 57   VAL B C     1 
ATOM   7066  O O     . VAL D 3 57  ? -31.876 11.842  -54.160 1.00 27.82  ? 57   VAL B O     1 
ATOM   7067  C CB    . VAL D 3 57  ? -31.348 13.114  -57.270 1.00 30.07  ? 57   VAL B CB    1 
ATOM   7068  C CG1   . VAL D 3 57  ? -31.402 14.243  -56.269 1.00 30.07  ? 57   VAL B CG1   1 
ATOM   7069  C CG2   . VAL D 3 57  ? -30.041 13.215  -57.988 1.00 30.07  ? 57   VAL B CG2   1 
ATOM   7070  N N     . LEU D 3 58  ? -33.733 11.835  -55.371 1.00 19.19  ? 58   LEU B N     1 
ATOM   7071  C CA    . LEU D 3 58  ? -34.484 11.931  -54.124 1.00 19.19  ? 58   LEU B CA    1 
ATOM   7072  C C     . LEU D 3 58  ? -34.392 10.676  -53.296 1.00 19.19  ? 58   LEU B C     1 
ATOM   7073  O O     . LEU D 3 58  ? -34.461 10.706  -52.042 1.00 19.19  ? 58   LEU B O     1 
ATOM   7074  C CB    . LEU D 3 58  ? -35.920 12.181  -54.414 1.00 22.13  ? 58   LEU B CB    1 
ATOM   7075  C CG    . LEU D 3 58  ? -36.799 12.144  -53.186 1.00 22.13  ? 58   LEU B CG    1 
ATOM   7076  C CD1   . LEU D 3 58  ? -36.416 13.215  -52.246 1.00 22.13  ? 58   LEU B CD1   1 
ATOM   7077  C CD2   . LEU D 3 58  ? -38.281 12.183  -53.674 1.00 22.13  ? 58   LEU B CD2   1 
ATOM   7078  N N     . LYS D 3 59  ? -34.253 9.548   -53.983 1.00 31.36  ? 59   LYS B N     1 
ATOM   7079  C CA    . LYS D 3 59  ? -34.140 8.326   -53.241 1.00 31.36  ? 59   LYS B CA    1 
ATOM   7080  C C     . LYS D 3 59  ? -32.860 8.381   -52.400 1.00 31.36  ? 59   LYS B C     1 
ATOM   7081  O O     . LYS D 3 59  ? -32.899 8.283   -51.180 1.00 31.36  ? 59   LYS B O     1 
ATOM   7082  C CB    . LYS D 3 59  ? -34.068 7.166   -54.169 1.00 38.72  ? 59   LYS B CB    1 
ATOM   7083  C CG    . LYS D 3 59  ? -33.967 5.867   -53.417 1.00 38.72  ? 59   LYS B CG    1 
ATOM   7084  C CD    . LYS D 3 59  ? -33.818 4.693   -54.361 1.00 38.72  ? 59   LYS B CD    1 
ATOM   7085  C CE    . LYS D 3 59  ? -33.517 3.416   -53.643 1.00 38.72  ? 59   LYS B CE    1 
ATOM   7086  N NZ    . LYS D 3 59  ? -32.901 2.435   -54.583 1.00 38.72  ? 59   LYS B NZ    1 
ATOM   7087  N N     . VAL D 3 60  ? -31.724 8.581   -53.065 1.00 27.57  ? 60   VAL B N     1 
ATOM   7088  C CA    . VAL D 3 60  ? -30.449 8.689   -52.379 1.00 27.57  ? 60   VAL B CA    1 
ATOM   7089  C C     . VAL D 3 60  ? -30.486 9.761   -51.281 1.00 27.57  ? 60   VAL B C     1 
ATOM   7090  O O     . VAL D 3 60  ? -29.829 9.627   -50.282 1.00 27.57  ? 60   VAL B O     1 
ATOM   7091  C CB    . VAL D 3 60  ? -29.329 9.075   -53.319 1.00 11.88  ? 60   VAL B CB    1 
ATOM   7092  C CG1   . VAL D 3 60  ? -28.227 9.518   -52.488 1.00 11.88  ? 60   VAL B CG1   1 
ATOM   7093  C CG2   . VAL D 3 60  ? -28.850 7.974   -54.164 1.00 11.88  ? 60   VAL B CG2   1 
ATOM   7094  N N     . PHE D 3 61  ? -31.255 10.820  -51.462 1.00 29.32  ? 61   PHE B N     1 
ATOM   7095  C CA    . PHE D 3 61  ? -31.317 11.855  -50.435 1.00 29.32  ? 61   PHE B CA    1 
ATOM   7096  C C     . PHE D 3 61  ? -31.966 11.340  -49.216 1.00 29.32  ? 61   PHE B C     1 
ATOM   7097  O O     . PHE D 3 61  ? -31.427 11.445  -48.155 1.00 29.32  ? 61   PHE B O     1 
ATOM   7098  C CB    . PHE D 3 61  ? -32.141 13.064  -50.865 1.00 10.96  ? 61   PHE B CB    1 
ATOM   7099  C CG    . PHE D 3 61  ? -32.157 14.252  -49.843 1.00 10.96  ? 61   PHE B CG    1 
ATOM   7100  C CD1   . PHE D 3 61  ? -31.034 15.086  -49.680 1.00 10.96  ? 61   PHE B CD1   1 
ATOM   7101  C CD2   . PHE D 3 61  ? -33.255 14.483  -48.985 1.00 10.96  ? 61   PHE B CD2   1 
ATOM   7102  C CE1   . PHE D 3 61  ? -30.980 16.108  -48.665 1.00 10.96  ? 61   PHE B CE1   1 
ATOM   7103  C CE2   . PHE D 3 61  ? -33.231 15.477  -47.999 1.00 10.96  ? 61   PHE B CE2   1 
ATOM   7104  C CZ    . PHE D 3 61  ? -32.116 16.268  -47.831 1.00 10.96  ? 61   PHE B CZ    1 
ATOM   7105  N N     . LEU D 3 62  ? -33.152 10.777  -49.371 1.00 32.62  ? 62   LEU B N     1 
ATOM   7106  C CA    . LEU D 3 62  ? -33.851 10.276  -48.223 1.00 32.62  ? 62   LEU B CA    1 
ATOM   7107  C C     . LEU D 3 62  ? -33.128 9.077   -47.602 1.00 32.62  ? 62   LEU B C     1 
ATOM   7108  O O     . LEU D 3 62  ? -33.105 8.955   -46.385 1.00 32.62  ? 62   LEU B O     1 
ATOM   7109  C CB    . LEU D 3 62  ? -35.299 9.937   -48.618 1.00 31.88  ? 62   LEU B CB    1 
ATOM   7110  C CG    . LEU D 3 62  ? -36.160 11.100  -49.169 1.00 31.88  ? 62   LEU B CG    1 
ATOM   7111  C CD1   . LEU D 3 62  ? -37.341 10.648  -49.877 1.00 31.88  ? 62   LEU B CD1   1 
ATOM   7112  C CD2   . LEU D 3 62  ? -36.587 11.937  -48.091 1.00 31.88  ? 62   LEU B CD2   1 
ATOM   7113  N N     . GLU D 3 63  ? -32.509 8.200   -48.399 1.00 26.30  ? 63   GLU B N     1 
ATOM   7114  C CA    . GLU D 3 63  ? -31.793 7.063   -47.814 1.00 26.30  ? 63   GLU B CA    1 
ATOM   7115  C C     . GLU D 3 63  ? -30.719 7.592   -46.870 1.00 26.30  ? 63   GLU B C     1 
ATOM   7116  O O     . GLU D 3 63  ? -30.601 7.122   -45.729 1.00 26.30  ? 63   GLU B O     1 
ATOM   7117  C CB    . GLU D 3 63  ? -31.129 6.169   -48.844 1.00 35.70  ? 63   GLU B CB    1 
ATOM   7118  C CG    . GLU D 3 63  ? -31.877 5.990   -50.099 1.00 35.70  ? 63   GLU B CG    1 
ATOM   7119  C CD    . GLU D 3 63  ? -31.287 4.881   -50.920 1.00 35.70  ? 63   GLU B CD    1 
ATOM   7120  O OE1   . GLU D 3 63  ? -30.056 4.876   -51.074 1.00 35.70  ? 63   GLU B OE1   1 
ATOM   7121  O OE2   . GLU D 3 63  ? -32.039 4.007   -51.408 1.00 35.70  ? 63   GLU B OE2   1 
ATOM   7122  N N     . ASN D 3 64  ? -29.947 8.584   -47.320 1.00 24.91  ? 64   ASN B N     1 
ATOM   7123  C CA    . ASN D 3 64  ? -28.938 9.142   -46.438 1.00 24.91  ? 64   ASN B CA    1 
ATOM   7124  C C     . ASN D 3 64  ? -29.498 9.751   -45.139 1.00 24.91  ? 64   ASN B C     1 
ATOM   7125  O O     . ASN D 3 64  ? -28.959 9.440   -44.074 1.00 24.91  ? 64   ASN B O     1 
ATOM   7126  C CB    . ASN D 3 64  ? -28.087 10.173  -47.128 1.00 22.32  ? 64   ASN B CB    1 
ATOM   7127  C CG    . ASN D 3 64  ? -27.029 9.573   -48.014 1.00 22.32  ? 64   ASN B CG    1 
ATOM   7128  O OD1   . ASN D 3 64  ? -26.414 8.579   -47.673 1.00 22.32  ? 64   ASN B OD1   1 
ATOM   7129  N ND2   . ASN D 3 64  ? -26.774 10.187  -49.145 1.00 22.32  ? 64   ASN B ND2   1 
ATOM   7130  N N     . VAL D 3 65  ? -30.549 10.574  -45.186 1.00 30.14  ? 65   VAL B N     1 
ATOM   7131  C CA    . VAL D 3 65  ? -31.048 11.160  -43.985 1.00 30.14  ? 65   VAL B CA    1 
ATOM   7132  C C     . VAL D 3 65  ? -31.644 10.157  -43.037 1.00 30.14  ? 65   VAL B C     1 
ATOM   7133  O O     . VAL D 3 65  ? -31.237 10.053  -41.856 1.00 30.14  ? 65   VAL B O     1 
ATOM   7134  C CB    . VAL D 3 65  ? -32.114 12.116  -44.253 1.00 30.76  ? 65   VAL B CB    1 
ATOM   7135  C CG1   . VAL D 3 65  ? -32.681 12.589  -42.997 1.00 30.76  ? 65   VAL B CG1   1 
ATOM   7136  C CG2   . VAL D 3 65  ? -31.616 13.239  -44.930 1.00 30.76  ? 65   VAL B CG2   1 
ATOM   7137  N N     . ILE D 3 66  ? -32.656 9.449   -43.539 1.00 23.87  ? 66   ILE B N     1 
ATOM   7138  C CA    . ILE D 3 66  ? -33.377 8.426   -42.767 1.00 23.87  ? 66   ILE B CA    1 
ATOM   7139  C C     . ILE D 3 66  ? -32.412 7.463   -42.050 1.00 23.87  ? 66   ILE B C     1 
ATOM   7140  O O     . ILE D 3 66  ? -32.568 7.154   -40.864 1.00 23.87  ? 66   ILE B O     1 
ATOM   7141  C CB    . ILE D 3 66  ? -34.285 7.597   -43.698 1.00 22.77  ? 66   ILE B CB    1 
ATOM   7142  C CG1   . ILE D 3 66  ? -35.458 8.445   -44.233 1.00 22.77  ? 66   ILE B CG1   1 
ATOM   7143  C CG2   . ILE D 3 66  ? -34.827 6.395   -42.928 1.00 22.77  ? 66   ILE B CG2   1 
ATOM   7144  C CD1   . ILE D 3 66  ? -36.280 7.718   -45.295 1.00 22.77  ? 66   ILE B CD1   1 
ATOM   7145  N N     . ARG D 3 67  ? -31.419 6.969   -42.784 1.00 32.77  ? 67   ARG B N     1 
ATOM   7146  C CA    . ARG D 3 67  ? -30.507 6.088   -42.139 1.00 32.77  ? 67   ARG B CA    1 
ATOM   7147  C C     . ARG D 3 67  ? -29.983 6.722   -40.856 1.00 32.77  ? 67   ARG B C     1 
ATOM   7148  O O     . ARG D 3 67  ? -29.982 6.080   -39.810 1.00 32.77  ? 67   ARG B O     1 
ATOM   7149  C CB    . ARG D 3 67  ? -29.373 5.734   -43.030 1.00 47.23  ? 67   ARG B CB    1 
ATOM   7150  C CG    . ARG D 3 67  ? -28.380 4.871   -42.343 1.00 47.23  ? 67   ARG B CG    1 
ATOM   7151  C CD    . ARG D 3 67  ? -27.082 4.711   -43.192 1.00 47.23  ? 67   ARG B CD    1 
ATOM   7152  N NE    . ARG D 3 67  ? -27.371 4.201   -44.543 1.00 47.23  ? 67   ARG B NE    1 
ATOM   7153  C CZ    . ARG D 3 67  ? -27.056 4.801   -45.720 1.00 47.23  ? 67   ARG B CZ    1 
ATOM   7154  N NH1   . ARG D 3 67  ? -26.382 5.974   -45.760 1.00 47.23  ? 67   ARG B NH1   1 
ATOM   7155  N NH2   . ARG D 3 67  ? -27.504 4.252   -46.877 1.00 47.23  ? 67   ARG B NH2   1 
ATOM   7156  N N     . ASP D 3 68  ? -29.564 7.974   -40.895 1.00 27.93  ? 68   ASP B N     1 
ATOM   7157  C CA    . ASP D 3 68  ? -29.055 8.583   -39.674 1.00 27.93  ? 68   ASP B CA    1 
ATOM   7158  C C     . ASP D 3 68  ? -30.181 8.843   -38.696 1.00 27.93  ? 68   ASP B C     1 
ATOM   7159  O O     . ASP D 3 68  ? -29.987 8.631   -37.553 1.00 27.93  ? 68   ASP B O     1 
ATOM   7160  C CB    . ASP D 3 68  ? -28.335 9.926   -39.925 1.00 31.22  ? 68   ASP B CB    1 
ATOM   7161  C CG    . ASP D 3 68  ? -27.076 9.788   -40.690 1.00 31.22  ? 68   ASP B CG    1 
ATOM   7162  O OD1   . ASP D 3 68  ? -27.013 8.890   -41.477 1.00 31.22  ? 68   ASP B OD1   1 
ATOM   7163  O OD2   . ASP D 3 68  ? -26.153 10.575  -40.568 1.00 31.22  ? 68   ASP B OD2   1 
ATOM   7164  N N     . ALA D 3 69  ? -31.326 9.365   -39.120 1.00 30.69  ? 69   ALA B N     1 
ATOM   7165  C CA    . ALA D 3 69  ? -32.439 9.560   -38.181 1.00 30.69  ? 69   ALA B CA    1 
ATOM   7166  C C     . ALA D 3 69  ? -32.807 8.223   -37.505 1.00 30.69  ? 69   ALA B C     1 
ATOM   7167  O O     . ALA D 3 69  ? -32.940 8.130   -36.308 1.00 30.69  ? 69   ALA B O     1 
ATOM   7168  C CB    . ALA D 3 69  ? -33.658 10.077  -38.923 1.00 24.90  ? 69   ALA B CB    1 
ATOM   7169  N N     . VAL D 3 70  ? -32.990 7.173   -38.281 1.00 23.39  ? 70   VAL B N     1 
ATOM   7170  C CA    . VAL D 3 70  ? -33.311 5.926   -37.675 1.00 23.39  ? 70   VAL B CA    1 
ATOM   7171  C C     . VAL D 3 70  ? -32.236 5.377   -36.772 1.00 23.39  ? 70   VAL B C     1 
ATOM   7172  O O     . VAL D 3 70  ? -32.507 4.580   -35.874 1.00 23.39  ? 70   VAL B O     1 
ATOM   7173  C CB    . VAL D 3 70  ? -33.658 4.931   -38.728 1.00 6.62   ? 70   VAL B CB    1 
ATOM   7174  C CG1   . VAL D 3 70  ? -33.729 3.526   -38.143 1.00 6.62   ? 70   VAL B CG1   1 
ATOM   7175  C CG2   . VAL D 3 70  ? -35.068 5.285   -39.186 1.00 6.62   ? 70   VAL B CG2   1 
ATOM   7176  N N     . THR D 3 71  ? -31.003 5.749   -37.029 1.00 25.25  ? 71   THR B N     1 
ATOM   7177  C CA    . THR D 3 71  ? -29.956 5.301   -36.160 1.00 25.25  ? 71   THR B CA    1 
ATOM   7178  C C     . THR D 3 71  ? -30.088 6.034   -34.841 1.00 25.25  ? 71   THR B C     1 
ATOM   7179  O O     . THR D 3 71  ? -29.793 5.509   -33.775 1.00 25.25  ? 71   THR B O     1 
ATOM   7180  C CB    . THR D 3 71  ? -28.635 5.603   -36.741 1.00 25.49  ? 71   THR B CB    1 
ATOM   7181  O OG1   . THR D 3 71  ? -28.352 4.630   -37.717 1.00 25.49  ? 71   THR B OG1   1 
ATOM   7182  C CG2   . THR D 3 71  ? -27.539 5.595   -35.703 1.00 25.49  ? 71   THR B CG2   1 
ATOM   7183  N N     . TYR D 3 72  ? -30.491 7.284   -34.906 1.00 39.32  ? 72   TYR B N     1 
ATOM   7184  C CA    . TYR D 3 72  ? -30.657 8.013   -33.701 1.00 39.32  ? 72   TYR B CA    1 
ATOM   7185  C C     . TYR D 3 72  ? -31.801 7.299   -32.969 1.00 39.32  ? 72   TYR B C     1 
ATOM   7186  O O     . TYR D 3 72  ? -31.708 6.981   -31.791 1.00 39.32  ? 72   TYR B O     1 
ATOM   7187  C CB    . TYR D 3 72  ? -31.000 9.470   -34.026 1.00 27.74  ? 72   TYR B CB    1 
ATOM   7188  C CG    . TYR D 3 72  ? -29.793 10.427  -34.097 1.00 27.74  ? 72   TYR B CG    1 
ATOM   7189  C CD1   . TYR D 3 72  ? -29.506 11.129  -35.254 1.00 27.74  ? 72   TYR B CD1   1 
ATOM   7190  C CD2   . TYR D 3 72  ? -28.870 10.489  -33.060 1.00 27.74  ? 72   TYR B CD2   1 
ATOM   7191  C CE1   . TYR D 3 72  ? -28.363 11.812  -35.397 1.00 27.74  ? 72   TYR B CE1   1 
ATOM   7192  C CE2   . TYR D 3 72  ? -27.745 11.175  -33.205 1.00 27.74  ? 72   TYR B CE2   1 
ATOM   7193  C CZ    . TYR D 3 72  ? -27.476 11.836  -34.388 1.00 27.74  ? 72   TYR B CZ    1 
ATOM   7194  O OH    . TYR D 3 72  ? -26.266 12.478  -34.561 1.00 27.74  ? 72   TYR B OH    1 
ATOM   7195  N N     . THR D 3 73  ? -32.865 7.000   -33.683 1.00 51.10  ? 73   THR B N     1 
ATOM   7196  C CA    . THR D 3 73  ? -33.992 6.335   -33.082 1.00 51.10  ? 73   THR B CA    1 
ATOM   7197  C C     . THR D 3 73  ? -33.610 5.157   -32.202 1.00 51.10  ? 73   THR B C     1 
ATOM   7198  O O     . THR D 3 73  ? -33.942 5.077   -31.021 1.00 51.10  ? 73   THR B O     1 
ATOM   7199  C CB    . THR D 3 73  ? -34.897 5.815   -34.151 1.00 20.68  ? 73   THR B CB    1 
ATOM   7200  O OG1   . THR D 3 73  ? -35.363 6.904   -34.932 1.00 20.68  ? 73   THR B OG1   1 
ATOM   7201  C CG2   . THR D 3 73  ? -36.082 5.114   -33.526 1.00 20.68  ? 73   THR B CG2   1 
ATOM   7202  N N     . GLU D 3 74  ? -32.945 4.212   -32.819 1.00 23.76  ? 74   GLU B N     1 
ATOM   7203  C CA    . GLU D 3 74  ? -32.515 3.036   -32.128 1.00 23.76  ? 74   GLU B CA    1 
ATOM   7204  C C     . GLU D 3 74  ? -31.622 3.452   -30.968 1.00 23.76  ? 74   GLU B C     1 
ATOM   7205  O O     . GLU D 3 74  ? -31.761 2.996   -29.815 1.00 23.76  ? 74   GLU B O     1 
ATOM   7206  C CB    . GLU D 3 74  ? -31.709 2.087   -33.047 1.00 61.69  ? 74   GLU B CB    1 
ATOM   7207  C CG    . GLU D 3 74  ? -32.439 1.568   -34.259 1.00 61.69  ? 74   GLU B CG    1 
ATOM   7208  C CD    . GLU D 3 74  ? -31.655 0.503   -35.017 1.00 61.69  ? 74   GLU B CD    1 
ATOM   7209  O OE1   . GLU D 3 74  ? -31.497 -0.640  -34.492 1.00 61.69  ? 74   GLU B OE1   1 
ATOM   7210  O OE2   . GLU D 3 74  ? -31.197 0.816   -36.154 1.00 61.69  ? 74   GLU B OE2   1 
ATOM   7211  N N     . HIS D 3 75  ? -30.679 4.324   -31.207 1.00 35.59  ? 75   HIS B N     1 
ATOM   7212  C CA    . HIS D 3 75  ? -29.888 4.590   -30.048 1.00 35.59  ? 75   HIS B CA    1 
ATOM   7213  C C     . HIS D 3 75  ? -30.751 4.850   -28.772 1.00 35.59  ? 75   HIS B C     1 
ATOM   7214  O O     . HIS D 3 75  ? -30.311 4.565   -27.660 1.00 35.59  ? 75   HIS B O     1 
ATOM   7215  C CB    . HIS D 3 75  ? -28.979 5.760   -30.274 1.00 22.41  ? 75   HIS B CB    1 
ATOM   7216  C CG    . HIS D 3 75  ? -28.026 5.926   -29.164 1.00 22.41  ? 75   HIS B CG    1 
ATOM   7217  N ND1   . HIS D 3 75  ? -26.933 5.108   -29.024 1.00 22.41  ? 75   HIS B ND1   1 
ATOM   7218  C CD2   . HIS D 3 75  ? -28.072 6.698   -28.058 1.00 22.41  ? 75   HIS B CD2   1 
ATOM   7219  C CE1   . HIS D 3 75  ? -26.343 5.370   -27.870 1.00 22.41  ? 75   HIS B CE1   1 
ATOM   7220  N NE2   . HIS D 3 75  ? -27.020 6.328   -27.260 1.00 22.41  ? 75   HIS B NE2   1 
ATOM   7221  N N     . ALA D 3 76  ? -31.966 5.377   -28.948 1.00 30.00  ? 76   ALA B N     1 
ATOM   7222  C CA    . ALA D 3 76  ? -32.810 5.747   -27.833 1.00 30.00  ? 76   ALA B CA    1 
ATOM   7223  C C     . ALA D 3 76  ? -33.864 4.669   -27.522 1.00 30.00  ? 76   ALA B C     1 
ATOM   7224  O O     . ALA D 3 76  ? -34.822 4.846   -26.722 1.00 30.00  ? 76   ALA B O     1 
ATOM   7225  C CB    . ALA D 3 76  ? -33.438 7.141   -28.103 1.00 9.62   ? 76   ALA B CB    1 
ATOM   7226  N N     . LYS D 3 77  ? -33.671 3.526   -28.152 1.00 38.21  ? 77   LYS B N     1 
ATOM   7227  C CA    . LYS D 3 77  ? -34.541 2.426   -27.885 1.00 38.21  ? 77   LYS B CA    1 
ATOM   7228  C C     . LYS D 3 77  ? -35.971 2.738   -28.219 1.00 38.21  ? 77   LYS B C     1 
ATOM   7229  O O     . LYS D 3 77  ? -36.808 2.366   -27.456 1.00 38.21  ? 77   LYS B O     1 
ATOM   7230  C CB    . LYS D 3 77  ? -34.435 2.084   -26.404 1.00 59.60  ? 77   LYS B CB    1 
ATOM   7231  C CG    . LYS D 3 77  ? -33.020 1.764   -25.936 1.00 59.60  ? 77   LYS B CG    1 
ATOM   7232  C CD    . LYS D 3 77  ? -32.898 1.836   -24.406 1.00 59.60  ? 77   LYS B CD    1 
ATOM   7233  C CE    . LYS D 3 77  ? -31.431 1.769   -23.920 1.00 59.60  ? 77   LYS B CE    1 
ATOM   7234  N NZ    . LYS D 3 77  ? -31.233 1.257   -22.493 1.00 59.60  ? 77   LYS B NZ    1 
ATOM   7235  N N     . ARG D 3 78  ? -36.300 3.413   -29.316 1.00 27.54  ? 78   ARG B N     1 
ATOM   7236  C CA    . ARG D 3 78  ? -37.732 3.659   -29.582 1.00 27.54  ? 78   ARG B CA    1 
ATOM   7237  C C     . ARG D 3 78  ? -38.206 2.958   -30.865 1.00 27.54  ? 78   ARG B C     1 
ATOM   7238  O O     . ARG D 3 78  ? -37.483 2.194   -31.468 1.00 27.54  ? 78   ARG B O     1 
ATOM   7239  C CB    . ARG D 3 78  ? -38.054 5.164   -29.693 1.00 31.76  ? 78   ARG B CB    1 
ATOM   7240  C CG    . ARG D 3 78  ? -37.648 6.010   -28.500 1.00 31.76  ? 78   ARG B CG    1 
ATOM   7241  C CD    . ARG D 3 78  ? -38.000 7.543   -28.651 1.00 31.76  ? 78   ARG B CD    1 
ATOM   7242  N NE    . ARG D 3 78  ? -36.884 8.407   -29.067 1.00 31.76  ? 78   ARG B NE    1 
ATOM   7243  C CZ    . ARG D 3 78  ? -36.604 8.635   -30.341 1.00 31.76  ? 78   ARG B CZ    1 
ATOM   7244  N NH1   . ARG D 3 78  ? -37.355 8.081   -31.277 1.00 31.76  ? 78   ARG B NH1   1 
ATOM   7245  N NH2   . ARG D 3 78  ? -35.595 9.373   -30.685 1.00 31.76  ? 78   ARG B NH2   1 
ATOM   7246  N N     . LYS D 3 79  ? -39.432 3.201   -31.300 1.00 50.52  ? 79   LYS B N     1 
ATOM   7247  C CA    . LYS D 3 79  ? -39.878 2.541   -32.523 1.00 50.52  ? 79   LYS B CA    1 
ATOM   7248  C C     . LYS D 3 79  ? -40.493 3.594   -33.401 1.00 50.52  ? 79   LYS B C     1 
ATOM   7249  O O     . LYS D 3 79  ? -41.059 3.317   -34.467 1.00 50.52  ? 79   LYS B O     1 
ATOM   7250  C CB    . LYS D 3 79  ? -40.895 1.454   -32.222 1.00 45.92  ? 79   LYS B CB    1 
ATOM   7251  C CG    . LYS D 3 79  ? -40.309 0.210   -31.698 1.00 45.92  ? 79   LYS B CG    1 
ATOM   7252  C CD    . LYS D 3 79  ? -41.367 -0.773  -31.465 1.00 45.92  ? 79   LYS B CD    1 
ATOM   7253  C CE    . LYS D 3 79  ? -40.867 -2.145  -31.961 1.00 45.92  ? 79   LYS B CE    1 
ATOM   7254  N NZ    . LYS D 3 79  ? -41.915 -2.823  -32.874 1.00 45.92  ? 79   LYS B NZ    1 
ATOM   7255  N N     . THR D 3 80  ? -40.377 4.828   -32.934 1.00 33.44  ? 80   THR B N     1 
ATOM   7256  C CA    . THR D 3 80  ? -40.903 5.942   -33.677 1.00 33.44  ? 80   THR B CA    1 
ATOM   7257  C C     . THR D 3 80  ? -39.832 6.941   -34.101 1.00 33.44  ? 80   THR B C     1 
ATOM   7258  O O     . THR D 3 80  ? -39.225 7.608   -33.250 1.00 33.44  ? 80   THR B O     1 
ATOM   7259  C CB    . THR D 3 80  ? -41.870 6.720   -32.856 1.00 49.99  ? 80   THR B CB    1 
ATOM   7260  O OG1   . THR D 3 80  ? -42.534 5.869   -31.932 1.00 49.99  ? 80   THR B OG1   1 
ATOM   7261  C CG2   . THR D 3 80  ? -42.871 7.267   -33.724 1.00 49.99  ? 80   THR B CG2   1 
ATOM   7262  N N     . VAL D 3 81  ? -39.557 7.037   -35.394 1.00 20.92  ? 81   VAL B N     1 
ATOM   7263  C CA    . VAL D 3 81  ? -38.640 8.083   -35.767 1.00 20.92  ? 81   VAL B CA    1 
ATOM   7264  C C     . VAL D 3 81  ? -39.247 9.414   -35.254 1.00 20.92  ? 81   VAL B C     1 
ATOM   7265  O O     . VAL D 3 81  ? -40.399 9.686   -35.540 1.00 20.92  ? 81   VAL B O     1 
ATOM   7266  C CB    . VAL D 3 81  ? -38.542 8.208   -37.257 1.00 45.01  ? 81   VAL B CB    1 
ATOM   7267  C CG1   . VAL D 3 81  ? -37.527 9.304   -37.603 1.00 45.01  ? 81   VAL B CG1   1 
ATOM   7268  C CG2   . VAL D 3 81  ? -38.112 6.926   -37.805 1.00 45.01  ? 81   VAL B CG2   1 
ATOM   7269  N N     . THR D 3 82  ? -38.489 10.268  -34.562 1.00 29.49  ? 82   THR B N     1 
ATOM   7270  C CA    . THR D 3 82  ? -39.063 11.533  -34.058 1.00 29.49  ? 82   THR B CA    1 
ATOM   7271  C C     . THR D 3 82  ? -38.631 12.718  -34.842 1.00 29.49  ? 82   THR B C     1 
ATOM   7272  O O     . THR D 3 82  ? -37.584 12.688  -35.436 1.00 29.49  ? 82   THR B O     1 
ATOM   7273  C CB    . THR D 3 82  ? -38.697 11.797  -32.607 1.00 52.32  ? 82   THR B CB    1 
ATOM   7274  O OG1   . THR D 3 82  ? -37.314 11.483  -32.345 1.00 52.32  ? 82   THR B OG1   1 
ATOM   7275  C CG2   . THR D 3 82  ? -39.577 10.976  -31.738 1.00 52.32  ? 82   THR B CG2   1 
ATOM   7276  N N     . ALA D 3 83  ? -39.439 13.777  -34.849 1.00 37.35  ? 83   ALA B N     1 
ATOM   7277  C CA    . ALA D 3 83  ? -39.088 14.969  -35.627 1.00 37.35  ? 83   ALA B CA    1 
ATOM   7278  C C     . ALA D 3 83  ? -37.651 15.231  -35.377 1.00 37.35  ? 83   ALA B C     1 
ATOM   7279  O O     . ALA D 3 83  ? -36.920 15.319  -36.311 1.00 37.35  ? 83   ALA B O     1 
ATOM   7280  C CB    . ALA D 3 83  ? -39.898 16.162  -35.214 1.00 41.95  ? 83   ALA B CB    1 
ATOM   7281  N N     . MET D 3 84  ? -37.279 15.312  -34.103 1.00 28.81  ? 84   MET B N     1 
ATOM   7282  C CA    . MET D 3 84  ? -35.916 15.531  -33.679 1.00 28.81  ? 84   MET B CA    1 
ATOM   7283  C C     . MET D 3 84  ? -34.952 14.547  -34.268 1.00 28.81  ? 84   MET B C     1 
ATOM   7284  O O     . MET D 3 84  ? -33.857 14.918  -34.697 1.00 28.81  ? 84   MET B O     1 
ATOM   7285  C CB    . MET D 3 84  ? -35.741 15.368  -32.211 1.00 33.60  ? 84   MET B CB    1 
ATOM   7286  C CG    . MET D 3 84  ? -36.136 16.529  -31.442 1.00 33.60  ? 84   MET B CG    1 
ATOM   7287  S SD    . MET D 3 84  ? -35.703 18.094  -32.066 1.00 33.60  ? 84   MET B SD    1 
ATOM   7288  C CE    . MET D 3 84  ? -33.694 18.143  -31.848 1.00 33.60  ? 84   MET B CE    1 
ATOM   7289  N N     . ASP D 3 85  ? -35.292 13.273  -34.255 1.00 30.20  ? 85   ASP B N     1 
ATOM   7290  C CA    . ASP D 3 85  ? -34.363 12.397  -34.863 1.00 30.20  ? 85   ASP B CA    1 
ATOM   7291  C C     . ASP D 3 85  ? -34.145 12.855  -36.306 1.00 30.20  ? 85   ASP B C     1 
ATOM   7292  O O     . ASP D 3 85  ? -33.091 12.693  -36.772 1.00 30.20  ? 85   ASP B O     1 
ATOM   7293  C CB    . ASP D 3 85  ? -34.855 10.968  -34.897 1.00 27.32  ? 85   ASP B CB    1 
ATOM   7294  C CG    . ASP D 3 85  ? -34.946 10.288  -33.517 1.00 27.32  ? 85   ASP B CG    1 
ATOM   7295  O OD1   . ASP D 3 85  ? -34.273 10.712  -32.548 1.00 27.32  ? 85   ASP B OD1   1 
ATOM   7296  O OD2   . ASP D 3 85  ? -35.683 9.257   -33.439 1.00 27.32  ? 85   ASP B OD2   1 
ATOM   7297  N N     . VAL D 3 86  ? -35.101 13.420  -37.051 1.00 26.65  ? 86   VAL B N     1 
ATOM   7298  C CA    . VAL D 3 86  ? -34.823 13.802  -38.466 1.00 26.65  ? 86   VAL B CA    1 
ATOM   7299  C C     . VAL D 3 86  ? -33.871 15.028  -38.487 1.00 26.65  ? 86   VAL B C     1 
ATOM   7300  O O     . VAL D 3 86  ? -32.952 15.153  -39.257 1.00 26.65  ? 86   VAL B O     1 
ATOM   7301  C CB    . VAL D 3 86  ? -36.218 14.086  -39.265 1.00 27.46  ? 86   VAL B CB    1 
ATOM   7302  C CG1   . VAL D 3 86  ? -36.035 14.923  -40.531 1.00 27.46  ? 86   VAL B CG1   1 
ATOM   7303  C CG2   . VAL D 3 86  ? -36.837 12.763  -39.730 1.00 27.46  ? 86   VAL B CG2   1 
ATOM   7304  N N     . VAL D 3 87  ? -34.113 15.910  -37.568 1.00 23.10  ? 87   VAL B N     1 
ATOM   7305  C CA    . VAL D 3 87  ? -33.366 17.108  -37.420 1.00 23.10  ? 87   VAL B CA    1 
ATOM   7306  C C     . VAL D 3 87  ? -31.951 16.869  -37.052 1.00 23.10  ? 87   VAL B C     1 
ATOM   7307  O O     . VAL D 3 87  ? -31.084 17.559  -37.549 1.00 23.10  ? 87   VAL B O     1 
ATOM   7308  C CB    . VAL D 3 87  ? -33.871 17.902  -36.329 1.00 32.45  ? 87   VAL B CB    1 
ATOM   7309  C CG1   . VAL D 3 87  ? -33.027 19.112  -36.217 1.00 32.45  ? 87   VAL B CG1   1 
ATOM   7310  C CG2   . VAL D 3 87  ? -35.287 18.120  -36.515 1.00 32.45  ? 87   VAL B CG2   1 
ATOM   7311  N N     . TYR D 3 88  ? -31.723 15.998  -36.098 1.00 23.76  ? 88   TYR B N     1 
ATOM   7312  C CA    . TYR D 3 88  ? -30.371 15.703  -35.774 1.00 23.76  ? 88   TYR B CA    1 
ATOM   7313  C C     . TYR D 3 88  ? -29.743 15.174  -37.041 1.00 23.76  ? 88   TYR B C     1 
ATOM   7314  O O     . TYR D 3 88  ? -28.582 15.493  -37.345 1.00 23.76  ? 88   TYR B O     1 
ATOM   7315  C CB    . TYR D 3 88  ? -30.269 14.615  -34.706 1.00 39.79  ? 88   TYR B CB    1 
ATOM   7316  C CG    . TYR D 3 88  ? -30.572 15.196  -33.398 1.00 39.79  ? 88   TYR B CG    1 
ATOM   7317  C CD1   . TYR D 3 88  ? -31.373 14.552  -32.481 1.00 39.79  ? 88   TYR B CD1   1 
ATOM   7318  C CD2   . TYR D 3 88  ? -30.178 16.479  -33.130 1.00 39.79  ? 88   TYR B CD2   1 
ATOM   7319  C CE1   . TYR D 3 88  ? -31.786 15.200  -31.332 1.00 39.79  ? 88   TYR B CE1   1 
ATOM   7320  C CE2   . TYR D 3 88  ? -30.568 17.108  -32.028 1.00 39.79  ? 88   TYR B CE2   1 
ATOM   7321  C CZ    . TYR D 3 88  ? -31.368 16.478  -31.141 1.00 39.79  ? 88   TYR B CZ    1 
ATOM   7322  O OH    . TYR D 3 88  ? -31.739 17.222  -30.053 1.00 39.79  ? 88   TYR B OH    1 
ATOM   7323  N N     . ALA D 3 89  ? -30.497 14.379  -37.797 1.00 26.42  ? 89   ALA B N     1 
ATOM   7324  C CA    . ALA D 3 89  ? -29.940 13.809  -39.007 1.00 26.42  ? 89   ALA B CA    1 
ATOM   7325  C C     . ALA D 3 89  ? -29.622 14.876  -40.014 1.00 26.42  ? 89   ALA B C     1 
ATOM   7326  O O     . ALA D 3 89  ? -28.485 14.932  -40.449 1.00 26.42  ? 89   ALA B O     1 
ATOM   7327  C CB    . ALA D 3 89  ? -30.860 12.750  -39.606 1.00 9.25   ? 89   ALA B CB    1 
ATOM   7328  N N     . LEU D 3 90  ? -30.567 15.735  -40.358 1.00 25.30  ? 90   LEU B N     1 
ATOM   7329  C CA    . LEU D 3 90  ? -30.256 16.766  -41.296 1.00 25.30  ? 90   LEU B CA    1 
ATOM   7330  C C     . LEU D 3 90  ? -29.023 17.576  -40.851 1.00 25.30  ? 90   LEU B C     1 
ATOM   7331  O O     . LEU D 3 90  ? -28.122 17.895  -41.690 1.00 25.30  ? 90   LEU B O     1 
ATOM   7332  C CB    . LEU D 3 90  ? -31.465 17.640  -41.522 1.00 28.39  ? 90   LEU B CB    1 
ATOM   7333  C CG    . LEU D 3 90  ? -32.569 16.844  -42.235 1.00 28.39  ? 90   LEU B CG    1 
ATOM   7334  C CD1   . LEU D 3 90  ? -33.938 17.429  -42.037 1.00 28.39  ? 90   LEU B CD1   1 
ATOM   7335  C CD2   . LEU D 3 90  ? -32.254 16.711  -43.684 1.00 28.39  ? 90   LEU B CD2   1 
ATOM   7336  N N     . LYS D 3 91  ? -28.929 17.870  -39.550 1.00 17.51  ? 91   LYS B N     1 
ATOM   7337  C CA    . LYS D 3 91  ? -27.762 18.606  -39.069 1.00 17.51  ? 91   LYS B CA    1 
ATOM   7338  C C     . LYS D 3 91  ? -26.425 17.860  -39.381 1.00 17.51  ? 91   LYS B C     1 
ATOM   7339  O O     . LYS D 3 91  ? -25.460 18.467  -39.818 1.00 17.51  ? 91   LYS B O     1 
ATOM   7340  C CB    . LYS D 3 91  ? -27.866 18.875  -37.590 1.00 38.40  ? 91   LYS B CB    1 
ATOM   7341  C CG    . LYS D 3 91  ? -26.835 19.807  -37.041 1.00 38.40  ? 91   LYS B CG    1 
ATOM   7342  C CD    . LYS D 3 91  ? -27.521 20.906  -36.162 1.00 38.40  ? 91   LYS B CD    1 
ATOM   7343  C CE    . LYS D 3 91  ? -28.070 20.501  -34.682 1.00 38.40  ? 91   LYS B CE    1 
ATOM   7344  N NZ    . LYS D 3 91  ? -29.532 20.869  -34.278 1.00 38.40  ? 91   LYS B NZ    1 
ATOM   7345  N N     . ARG D 3 92  ? -26.341 16.563  -39.148 1.00 22.28  ? 92   ARG B N     1 
ATOM   7346  C CA    . ARG D 3 92  ? -25.119 15.867  -39.503 1.00 22.28  ? 92   ARG B CA    1 
ATOM   7347  C C     . ARG D 3 92  ? -24.891 15.902  -40.996 1.00 22.28  ? 92   ARG B C     1 
ATOM   7348  O O     . ARG D 3 92  ? -23.710 16.010  -41.413 1.00 22.28  ? 92   ARG B O     1 
ATOM   7349  C CB    . ARG D 3 92  ? -25.202 14.399  -39.211 1.00 28.48  ? 92   ARG B CB    1 
ATOM   7350  C CG    . ARG D 3 92  ? -25.352 14.070  -37.865 1.00 28.48  ? 92   ARG B CG    1 
ATOM   7351  C CD    . ARG D 3 92  ? -25.184 12.684  -37.886 1.00 28.48  ? 92   ARG B CD    1 
ATOM   7352  N NE    . ARG D 3 92  ? -23.778 12.469  -37.997 1.00 28.48  ? 92   ARG B NE    1 
ATOM   7353  C CZ    . ARG D 3 92  ? -23.227 11.801  -38.973 1.00 28.48  ? 92   ARG B CZ    1 
ATOM   7354  N NH1   . ARG D 3 92  ? -23.996 11.296  -39.926 1.00 28.48  ? 92   ARG B NH1   1 
ATOM   7355  N NH2   . ARG D 3 92  ? -21.916 11.640  -38.970 1.00 28.48  ? 92   ARG B NH2   1 
ATOM   7356  N N     . GLN D 3 93  ? -25.974 15.666  -41.789 1.00 20.90  ? 93   GLN B N     1 
ATOM   7357  C CA    . GLN D 3 93  ? -25.821 15.731  -43.218 1.00 20.90  ? 93   GLN B CA    1 
ATOM   7358  C C     . GLN D 3 93  ? -25.429 17.215  -43.598 1.00 20.90  ? 93   GLN B C     1 
ATOM   7359  O O     . GLN D 3 93  ? -25.052 17.500  -44.741 1.00 20.90  ? 93   GLN B O     1 
ATOM   7360  C CB    . GLN D 3 93  ? -27.119 15.354  -43.967 1.00 32.72  ? 93   GLN B CB    1 
ATOM   7361  C CG    . GLN D 3 93  ? -27.731 13.975  -43.808 1.00 32.72  ? 93   GLN B CG    1 
ATOM   7362  C CD    . GLN D 3 93  ? -26.723 12.832  -43.744 1.00 32.72  ? 93   GLN B CD    1 
ATOM   7363  O OE1   . GLN D 3 93  ? -26.208 12.397  -44.780 1.00 32.72  ? 93   GLN B OE1   1 
ATOM   7364  N NE2   . GLN D 3 93  ? -26.435 12.324  -42.522 1.00 32.72  ? 93   GLN B NE2   1 
ATOM   7365  N N     . GLY D 3 94  ? -25.538 18.168  -42.679 1.00 19.98  ? 94   GLY B N     1 
ATOM   7366  C CA    . GLY D 3 94  ? -25.162 19.501  -43.033 1.00 19.98  ? 94   GLY B CA    1 
ATOM   7367  C C     . GLY D 3 94  ? -26.315 20.192  -43.747 1.00 19.98  ? 94   GLY B C     1 
ATOM   7368  O O     . GLY D 3 94  ? -26.092 21.088  -44.543 1.00 19.98  ? 94   GLY B O     1 
ATOM   7369  N N     . ARG D 3 95  ? -27.553 19.754  -43.520 1.00 23.38  ? 95   ARG B N     1 
ATOM   7370  C CA    . ARG D 3 95  ? -28.679 20.381  -44.131 1.00 23.38  ? 95   ARG B CA    1 
ATOM   7371  C C     . ARG D 3 95  ? -29.541 20.877  -42.936 1.00 23.38  ? 95   ARG B C     1 
ATOM   7372  O O     . ARG D 3 95  ? -30.736 20.517  -42.888 1.00 23.38  ? 95   ARG B O     1 
ATOM   7373  C CB    . ARG D 3 95  ? -29.501 19.364  -44.920 1.00 45.24  ? 95   ARG B CB    1 
ATOM   7374  C CG    . ARG D 3 95  ? -28.814 18.427  -45.787 1.00 45.24  ? 95   ARG B CG    1 
ATOM   7375  C CD    . ARG D 3 95  ? -28.527 18.962  -47.139 1.00 45.24  ? 95   ARG B CD    1 
ATOM   7376  N NE    . ARG D 3 95  ? -29.602 19.825  -47.642 1.00 45.24  ? 95   ARG B NE    1 
ATOM   7377  C CZ    . ARG D 3 95  ? -29.451 20.683  -48.682 1.00 45.24  ? 95   ARG B CZ    1 
ATOM   7378  N NH1   . ARG D 3 95  ? -28.249 20.750  -49.317 1.00 45.24  ? 95   ARG B NH1   1 
ATOM   7379  N NH2   . ARG D 3 95  ? -30.462 21.498  -49.067 1.00 45.24  ? 95   ARG B NH2   1 
ATOM   7380  N N     . THR D 3 96  ? -28.994 21.672  -41.994 1.00 22.39  ? 96   THR B N     1 
ATOM   7381  C CA    . THR D 3 96  ? -29.763 22.146  -40.809 1.00 22.39  ? 96   THR B CA    1 
ATOM   7382  C C     . THR D 3 96  ? -31.137 22.624  -41.156 1.00 22.39  ? 96   THR B C     1 
ATOM   7383  O O     . THR D 3 96  ? -31.287 23.445  -42.039 1.00 22.39  ? 96   THR B O     1 
ATOM   7384  C CB    . THR D 3 96  ? -29.136 23.323  -40.150 1.00 15.19  ? 96   THR B CB    1 
ATOM   7385  O OG1   . THR D 3 96  ? -27.911 22.938  -39.534 1.00 15.19  ? 96   THR B OG1   1 
ATOM   7386  C CG2   . THR D 3 96  ? -30.042 23.911  -39.065 1.00 15.19  ? 96   THR B CG2   1 
ATOM   7387  N N     . LEU D 3 97  ? -32.159 22.147  -40.446 1.00 19.14  ? 97   LEU B N     1 
ATOM   7388  C CA    . LEU D 3 97  ? -33.542 22.556  -40.735 1.00 19.14  ? 97   LEU B CA    1 
ATOM   7389  C C     . LEU D 3 97  ? -34.146 23.386  -39.612 1.00 19.14  ? 97   LEU B C     1 
ATOM   7390  O O     . LEU D 3 97  ? -33.955 23.037  -38.536 1.00 19.14  ? 97   LEU B O     1 
ATOM   7391  C CB    . LEU D 3 97  ? -34.399 21.298  -40.929 1.00 15.13  ? 97   LEU B CB    1 
ATOM   7392  C CG    . LEU D 3 97  ? -35.922 21.488  -41.127 1.00 15.13  ? 97   LEU B CG    1 
ATOM   7393  C CD1   . LEU D 3 97  ? -36.139 22.295  -42.360 1.00 15.13  ? 97   LEU B CD1   1 
ATOM   7394  C CD2   . LEU D 3 97  ? -36.668 20.188  -41.166 1.00 15.13  ? 97   LEU B CD2   1 
ATOM   7395  N N     . TYR D 3 98  ? -34.841 24.490  -39.859 1.00 32.13  ? 98   TYR B N     1 
ATOM   7396  C CA    . TYR D 3 98  ? -35.480 25.221  -38.767 1.00 32.13  ? 98   TYR B CA    1 
ATOM   7397  C C     . TYR D 3 98  ? -36.984 25.005  -38.807 1.00 32.13  ? 98   TYR B C     1 
ATOM   7398  O O     . TYR D 3 98  ? -37.614 24.930  -39.868 1.00 32.13  ? 98   TYR B O     1 
ATOM   7399  C CB    . TYR D 3 98  ? -35.302 26.693  -38.892 1.00 11.69  ? 98   TYR B CB    1 
ATOM   7400  C CG    . TYR D 3 98  ? -33.942 27.240  -38.569 1.00 11.69  ? 98   TYR B CG    1 
ATOM   7401  C CD1   . TYR D 3 98  ? -32.888 26.378  -38.134 1.00 11.69  ? 98   TYR B CD1   1 
ATOM   7402  C CD2   . TYR D 3 98  ? -33.703 28.650  -38.675 1.00 11.69  ? 98   TYR B CD2   1 
ATOM   7403  C CE1   . TYR D 3 98  ? -31.653 26.891  -37.800 1.00 11.69  ? 98   TYR B CE1   1 
ATOM   7404  C CE2   . TYR D 3 98  ? -32.532 29.180  -38.363 1.00 11.69  ? 98   TYR B CE2   1 
ATOM   7405  C CZ    . TYR D 3 98  ? -31.497 28.311  -37.900 1.00 11.69  ? 98   TYR B CZ    1 
ATOM   7406  O OH    . TYR D 3 98  ? -30.367 28.899  -37.367 1.00 11.69  ? 98   TYR B OH    1 
ATOM   7407  N N     . GLY D 3 99  ? -37.580 24.915  -37.639 1.00 37.71  ? 99   GLY B N     1 
ATOM   7408  C CA    . GLY D 3 99  ? -39.017 24.753  -37.570 1.00 37.71  ? 99   GLY B CA    1 
ATOM   7409  C C     . GLY D 3 99  ? -39.570 23.528  -36.895 1.00 37.71  ? 99   GLY B C     1 
ATOM   7410  O O     . GLY D 3 99  ? -40.775 23.430  -36.810 1.00 37.71  ? 99   GLY B O     1 
ATOM   7411  N N     . PHE D 3 100 ? -38.733 22.598  -36.439 1.00 21.13  ? 100  PHE B N     1 
ATOM   7412  C CA    . PHE D 3 100 ? -39.244 21.378  -35.859 1.00 21.13  ? 100  PHE B CA    1 
ATOM   7413  C C     . PHE D 3 100 ? -38.444 21.107  -34.614 1.00 21.13  ? 100  PHE B C     1 
ATOM   7414  O O     . PHE D 3 100 ? -38.259 19.968  -34.234 1.00 21.13  ? 100  PHE B O     1 
ATOM   7415  C CB    . PHE D 3 100 ? -39.159 20.209  -36.885 1.00 31.32  ? 100  PHE B CB    1 
ATOM   7416  C CG    . PHE D 3 100 ? -39.909 20.493  -38.218 1.00 31.32  ? 100  PHE B CG    1 
ATOM   7417  C CD1   . PHE D 3 100 ? -39.394 21.351  -39.160 1.00 31.32  ? 100  PHE B CD1   1 
ATOM   7418  C CD2   . PHE D 3 100 ? -41.148 19.936  -38.489 1.00 31.32  ? 100  PHE B CD2   1 
ATOM   7419  C CE1   . PHE D 3 100 ? -40.084 21.635  -40.317 1.00 31.32  ? 100  PHE B CE1   1 
ATOM   7420  C CE2   . PHE D 3 100 ? -41.845 20.219  -39.652 1.00 31.32  ? 100  PHE B CE2   1 
ATOM   7421  C CZ    . PHE D 3 100 ? -41.321 21.064  -40.559 1.00 31.32  ? 100  PHE B CZ    1 
ATOM   7422  N N     . GLY D 3 101 ? -38.072 22.156  -33.886 1.00 39.02  ? 101  GLY B N     1 
ATOM   7423  C CA    . GLY D 3 101 ? -37.237 21.966  -32.674 1.00 39.02  ? 101  GLY B CA    1 
ATOM   7424  C C     . GLY D 3 101 ? -35.942 22.150  -33.382 1.00 39.02  ? 101  GLY B C     1 
ATOM   7425  O O     . GLY D 3 101 ? -35.395 23.283  -33.609 1.00 39.02  ? 101  GLY B O     1 
ATOM   7426  N N     . GLY D 3 102 ? -35.499 21.041  -33.921 1.00 132.63 ? 102  GLY B N     1 
ATOM   7427  C CA    . GLY D 3 102 ? -34.323 21.197  -34.731 1.00 132.63 ? 102  GLY B CA    1 
ATOM   7428  C C     . GLY D 3 102 ? -35.110 21.521  -36.022 1.00 132.63 ? 102  GLY B C     1 
ATOM   7429  O O     . GLY D 3 102 ? -35.689 22.651  -36.108 1.00 132.63 ? 102  GLY B O     1 
ATOM   7430  O OXT   . GLY D 3 102 ? -35.218 20.625  -36.942 1.00 43.17  ? 102  GLY B OXT   1 
ATOM   7431  N N     . LYS E 4 15  ? -1.127  -5.444  -15.082 1.00 58.92  ? 815  LYS C N     1 
ATOM   7432  C CA    . LYS E 4 15  ? -1.402  -5.438  -16.580 1.00 58.92  ? 815  LYS C CA    1 
ATOM   7433  C C     . LYS E 4 15  ? -2.156  -4.209  -17.151 1.00 58.92  ? 815  LYS C C     1 
ATOM   7434  O O     . LYS E 4 15  ? -3.196  -3.811  -16.596 1.00 58.92  ? 815  LYS C O     1 
ATOM   7435  C CB    . LYS E 4 15  ? -2.204  -6.679  -17.015 1.00 73.85  ? 815  LYS C CB    1 
ATOM   7436  C CG    . LYS E 4 15  ? -1.345  -7.905  -17.241 1.00 73.85  ? 815  LYS C CG    1 
ATOM   7437  C CD    . LYS E 4 15  ? -2.104  -9.113  -17.847 1.00 73.85  ? 815  LYS C CD    1 
ATOM   7438  C CE    . LYS E 4 15  ? -1.376  -10.477 -17.429 1.00 73.85  ? 815  LYS C CE    1 
ATOM   7439  N NZ    . LYS E 4 15  ? -2.050  -11.831 -17.728 1.00 73.85  ? 815  LYS C NZ    1 
ATOM   7440  N N     . THR E 4 16  ? -1.673  -3.622  -18.266 1.00 44.54  ? 816  THR C N     1 
ATOM   7441  C CA    . THR E 4 16  ? -2.368  -2.462  -18.864 1.00 44.54  ? 816  THR C CA    1 
ATOM   7442  C C     . THR E 4 16  ? -3.734  -2.829  -19.432 1.00 44.54  ? 816  THR C C     1 
ATOM   7443  O O     . THR E 4 16  ? -4.016  -3.976  -19.811 1.00 44.54  ? 816  THR C O     1 
ATOM   7444  C CB    . THR E 4 16  ? -1.602  -1.818  -20.014 1.00 34.29  ? 816  THR C CB    1 
ATOM   7445  O OG1   . THR E 4 16  ? -1.374  -2.779  -21.053 1.00 34.29  ? 816  THR C OG1   1 
ATOM   7446  C CG2   . THR E 4 16  ? -0.334  -1.231  -19.535 1.00 34.29  ? 816  THR C CG2   1 
ATOM   7447  N N     . ARG E 4 17  ? -4.578  -1.822  -19.532 1.00 59.15  ? 817  ARG C N     1 
ATOM   7448  C CA    . ARG E 4 17  ? -5.909  -2.079  -20.013 1.00 59.15  ? 817  ARG C CA    1 
ATOM   7449  C C     . ARG E 4 17  ? -5.913  -2.413  -21.471 1.00 59.15  ? 817  ARG C C     1 
ATOM   7450  O O     . ARG E 4 17  ? -6.912  -2.919  -21.991 1.00 59.15  ? 817  ARG C O     1 
ATOM   7451  C CB    . ARG E 4 17  ? -6.820  -0.884  -19.749 1.00 35.78  ? 817  ARG C CB    1 
ATOM   7452  C CG    . ARG E 4 17  ? -6.732  -0.311  -18.339 1.00 35.78  ? 817  ARG C CG    1 
ATOM   7453  C CD    . ARG E 4 17  ? -8.013  0.261   -18.028 1.00 35.78  ? 817  ARG C CD    1 
ATOM   7454  N NE    . ARG E 4 17  ? -7.809  1.681   -18.082 1.00 35.78  ? 817  ARG C NE    1 
ATOM   7455  C CZ    . ARG E 4 17  ? -8.759  2.547   -18.462 1.00 35.78  ? 817  ARG C CZ    1 
ATOM   7456  N NH1   . ARG E 4 17  ? -9.994  2.062   -18.810 1.00 35.78  ? 817  ARG C NH1   1 
ATOM   7457  N NH2   . ARG E 4 17  ? -8.454  3.865   -18.500 1.00 35.78  ? 817  ARG C NH2   1 
ATOM   7458  N N     . SER E 4 18  ? -4.808  -2.149  -22.154 1.00 35.82  ? 818  SER C N     1 
ATOM   7459  C CA    . SER E 4 18  ? -4.843  -2.473  -23.551 1.00 35.82  ? 818  SER C CA    1 
ATOM   7460  C C     . SER E 4 18  ? -4.613  -3.947  -23.750 1.00 35.82  ? 818  SER C C     1 
ATOM   7461  O O     . SER E 4 18  ? -5.276  -4.585  -24.574 1.00 35.82  ? 818  SER C O     1 
ATOM   7462  C CB    . SER E 4 18  ? -3.820  -1.666  -24.282 1.00 24.91  ? 818  SER C CB    1 
ATOM   7463  O OG    . SER E 4 18  ? -3.972  -0.369  -23.903 1.00 24.91  ? 818  SER C OG    1 
ATOM   7464  N N     . SER E 4 19  ? -3.648  -4.475  -23.001 1.00 39.53  ? 819  SER C N     1 
ATOM   7465  C CA    . SER E 4 19  ? -3.366  -5.894  -23.101 1.00 39.53  ? 819  SER C CA    1 
ATOM   7466  C C     . SER E 4 19  ? -4.660  -6.555  -22.633 1.00 39.53  ? 819  SER C C     1 
ATOM   7467  O O     . SER E 4 19  ? -5.151  -7.478  -23.292 1.00 39.53  ? 819  SER C O     1 
ATOM   7468  C CB    . SER E 4 19  ? -2.219  -6.249  -22.213 1.00 44.74  ? 819  SER C CB    1 
ATOM   7469  O OG    . SER E 4 19  ? -2.374  -5.421  -21.099 1.00 44.74  ? 819  SER C OG    1 
ATOM   7470  N N     . ARG E 4 20  ? -5.234  -6.070  -21.531 1.00 42.05  ? 820  ARG C N     1 
ATOM   7471  C CA    . ARG E 4 20  ? -6.452  -6.660  -21.080 1.00 42.05  ? 820  ARG C CA    1 
ATOM   7472  C C     . ARG E 4 20  ? -7.437  -6.646  -22.291 1.00 42.05  ? 820  ARG C C     1 
ATOM   7473  O O     . ARG E 4 20  ? -8.102  -7.671  -22.537 1.00 42.05  ? 820  ARG C O     1 
ATOM   7474  C CB    . ARG E 4 20  ? -6.966  -5.901  -19.846 1.00 86.56  ? 820  ARG C CB    1 
ATOM   7475  C CG    . ARG E 4 20  ? -8.211  -6.504  -19.218 1.00 86.56  ? 820  ARG C CG    1 
ATOM   7476  C CD    . ARG E 4 20  ? -8.671  -5.775  -17.939 1.00 86.56  ? 820  ARG C CD    1 
ATOM   7477  N NE    . ARG E 4 20  ? -10.008 -6.220  -17.471 1.00 86.56  ? 820  ARG C NE    1 
ATOM   7478  C CZ    . ARG E 4 20  ? -10.721 -5.613  -16.510 1.00 86.56  ? 820  ARG C CZ    1 
ATOM   7479  N NH1   . ARG E 4 20  ? -10.222 -4.539  -15.919 1.00 86.56  ? 820  ARG C NH1   1 
ATOM   7480  N NH2   . ARG E 4 20  ? -11.929 -6.060  -16.136 1.00 86.56  ? 820  ARG C NH2   1 
ATOM   7481  N N     . ALA E 4 21  ? -7.477  -5.568  -23.101 1.00 41.97  ? 821  ALA C N     1 
ATOM   7482  C CA    . ALA E 4 21  ? -8.428  -5.483  -24.252 1.00 41.97  ? 821  ALA C CA    1 
ATOM   7483  C C     . ALA E 4 21  ? -7.981  -6.066  -25.590 1.00 41.97  ? 821  ALA C C     1 
ATOM   7484  O O     . ALA E 4 21  ? -8.726  -6.022  -26.577 1.00 41.97  ? 821  ALA C O     1 
ATOM   7485  C CB    . ALA E 4 21  ? -8.850  -4.043  -24.485 1.00 69.85  ? 821  ALA C CB    1 
ATOM   7486  N N     . GLY E 4 22  ? -6.767  -6.618  -25.621 1.00 27.85  ? 822  GLY C N     1 
ATOM   7487  C CA    . GLY E 4 22  ? -6.222  -7.168  -26.853 1.00 27.85  ? 822  GLY C CA    1 
ATOM   7488  C C     . GLY E 4 22  ? -5.796  -6.102  -27.863 1.00 27.85  ? 822  GLY C C     1 
ATOM   7489  O O     . GLY E 4 22  ? -5.897  -6.326  -29.081 1.00 27.85  ? 822  GLY C O     1 
ATOM   7490  N N     . LEU E 4 23  ? -5.237  -4.990  -27.372 1.00 28.81  ? 823  LEU C N     1 
ATOM   7491  C CA    . LEU E 4 23  ? -4.931  -3.882  -28.269 1.00 28.81  ? 823  LEU C CA    1 
ATOM   7492  C C     . LEU E 4 23  ? -3.569  -3.253  -28.208 1.00 28.81  ? 823  LEU C C     1 
ATOM   7493  O O     . LEU E 4 23  ? -2.915  -3.232  -27.170 1.00 28.81  ? 823  LEU C O     1 
ATOM   7494  C CB    . LEU E 4 23  ? -5.987  -2.759  -28.093 1.00 22.99  ? 823  LEU C CB    1 
ATOM   7495  C CG    . LEU E 4 23  ? -7.497  -3.112  -28.215 1.00 22.99  ? 823  LEU C CG    1 
ATOM   7496  C CD1   . LEU E 4 23  ? -8.408  -1.914  -27.750 1.00 22.99  ? 823  LEU C CD1   1 
ATOM   7497  C CD2   . LEU E 4 23  ? -7.856  -3.425  -29.655 1.00 22.99  ? 823  LEU C CD2   1 
ATOM   7498  N N     . GLN E 4 24  ? -3.149  -2.737  -29.349 1.00 22.42  ? 824  GLN C N     1 
ATOM   7499  C CA    . GLN E 4 24  ? -1.916  -2.041  -29.481 1.00 22.42  ? 824  GLN C CA    1 
ATOM   7500  C C     . GLN E 4 24  ? -2.141  -0.571  -29.193 1.00 22.42  ? 824  GLN C C     1 
ATOM   7501  O O     . GLN E 4 24  ? -1.257  -0.014  -28.702 1.00 22.42  ? 824  GLN C O     1 
ATOM   7502  C CB    . GLN E 4 24  ? -1.426  -2.129  -30.873 1.00 22.83  ? 824  GLN C CB    1 
ATOM   7503  C CG    . GLN E 4 24  ? -1.349  -3.496  -31.408 1.00 22.83  ? 824  GLN C CG    1 
ATOM   7504  C CD    . GLN E 4 24  ? -0.390  -4.292  -30.573 1.00 22.83  ? 824  GLN C CD    1 
ATOM   7505  O OE1   . GLN E 4 24  ? 0.750   -3.875  -30.271 1.00 22.83  ? 824  GLN C OE1   1 
ATOM   7506  N NE2   . GLN E 4 24  ? -0.850  -5.456  -30.185 1.00 22.83  ? 824  GLN C NE2   1 
ATOM   7507  N N     . PHE E 4 25  ? -3.256  0.095   -29.547 1.00 26.32  ? 825  PHE C N     1 
ATOM   7508  C CA    . PHE E 4 25  ? -3.504  1.510   -29.213 1.00 26.32  ? 825  PHE C CA    1 
ATOM   7509  C C     . PHE E 4 25  ? -3.685  1.527   -27.668 1.00 26.32  ? 825  PHE C C     1 
ATOM   7510  O O     . PHE E 4 25  ? -4.045  0.523   -27.046 1.00 26.32  ? 825  PHE C O     1 
ATOM   7511  C CB    . PHE E 4 25  ? -4.713  1.988   -30.001 1.00 27.92  ? 825  PHE C CB    1 
ATOM   7512  C CG    . PHE E 4 25  ? -4.342  2.599   -31.335 1.00 27.92  ? 825  PHE C CG    1 
ATOM   7513  C CD1   . PHE E 4 25  ? -3.549  1.920   -32.227 1.00 27.92  ? 825  PHE C CD1   1 
ATOM   7514  C CD2   . PHE E 4 25  ? -4.785  3.902   -31.702 1.00 27.92  ? 825  PHE C CD2   1 
ATOM   7515  C CE1   . PHE E 4 25  ? -3.190  2.512   -33.427 1.00 27.92  ? 825  PHE C CE1   1 
ATOM   7516  C CE2   . PHE E 4 25  ? -4.430  4.493   -32.908 1.00 27.92  ? 825  PHE C CE2   1 
ATOM   7517  C CZ    . PHE E 4 25  ? -3.631  3.787   -33.763 1.00 27.92  ? 825  PHE C CZ    1 
ATOM   7518  N N     . PRO E 4 26  ? -3.363  2.642   -27.010 1.00 24.39  ? 826  PRO C N     1 
ATOM   7519  C CA    . PRO E 4 26  ? -3.366  3.023   -25.585 1.00 24.39  ? 826  PRO C CA    1 
ATOM   7520  C C     . PRO E 4 26  ? -4.666  3.167   -24.985 1.00 24.39  ? 826  PRO C C     1 
ATOM   7521  O O     . PRO E 4 26  ? -5.190  4.264   -25.057 1.00 24.39  ? 826  PRO C O     1 
ATOM   7522  C CB    . PRO E 4 26  ? -2.796  4.414   -25.573 1.00 20.49  ? 826  PRO C CB    1 
ATOM   7523  C CG    . PRO E 4 26  ? -2.187  4.584   -26.810 1.00 20.49  ? 826  PRO C CG    1 
ATOM   7524  C CD    . PRO E 4 26  ? -3.054  3.821   -27.824 1.00 20.49  ? 826  PRO C CD    1 
ATOM   7525  N N     . VAL E 4 27  ? -5.236  2.142   -24.371 1.00 20.67  ? 827  VAL C N     1 
ATOM   7526  C CA    . VAL E 4 27  ? -6.541  2.342   -23.785 1.00 20.67  ? 827  VAL C CA    1 
ATOM   7527  C C     . VAL E 4 27  ? -6.551  3.450   -22.748 1.00 20.67  ? 827  VAL C C     1 
ATOM   7528  O O     . VAL E 4 27  ? -7.408  4.353   -22.777 1.00 20.67  ? 827  VAL C O     1 
ATOM   7529  C CB    . VAL E 4 27  ? -7.042  1.136   -23.146 1.00 21.05  ? 827  VAL C CB    1 
ATOM   7530  C CG1   . VAL E 4 27  ? -8.237  1.581   -22.265 1.00 21.05  ? 827  VAL C CG1   1 
ATOM   7531  C CG2   . VAL E 4 27  ? -7.403  0.115   -24.212 1.00 21.05  ? 827  VAL C CG2   1 
ATOM   7532  N N     . GLY E 4 28  ? -5.600  3.406   -21.832 1.00 25.03  ? 828  GLY C N     1 
ATOM   7533  C CA    . GLY E 4 28  ? -5.604  4.459   -20.840 1.00 25.03  ? 828  GLY C CA    1 
ATOM   7534  C C     . GLY E 4 28  ? -5.427  5.889   -21.368 1.00 25.03  ? 828  GLY C C     1 
ATOM   7535  O O     . GLY E 4 28  ? -6.011  6.827   -20.855 1.00 25.03  ? 828  GLY C O     1 
ATOM   7536  N N     . ARG E 4 29  ? -4.571  6.084   -22.361 1.00 28.18  ? 829  ARG C N     1 
ATOM   7537  C CA    . ARG E 4 29  ? -4.389  7.437   -22.905 1.00 28.18  ? 829  ARG C CA    1 
ATOM   7538  C C     . ARG E 4 29  ? -5.708  7.939   -23.527 1.00 28.18  ? 829  ARG C C     1 
ATOM   7539  O O     . ARG E 4 29  ? -6.171  9.026   -23.249 1.00 28.18  ? 829  ARG C O     1 
ATOM   7540  C CB    . ARG E 4 29  ? -3.255  7.379   -23.927 1.00 38.99  ? 829  ARG C CB    1 
ATOM   7541  C CG    . ARG E 4 29  ? -3.361  8.286   -25.073 1.00 38.99  ? 829  ARG C CG    1 
ATOM   7542  C CD    . ARG E 4 29  ? -2.485  9.390   -24.888 1.00 38.99  ? 829  ARG C CD    1 
ATOM   7543  N NE    . ARG E 4 29  ? -1.151  8.932   -24.655 1.00 38.99  ? 829  ARG C NE    1 
ATOM   7544  C CZ    . ARG E 4 29  ? -0.188  8.925   -25.563 1.00 38.99  ? 829  ARG C CZ    1 
ATOM   7545  N NH1   . ARG E 4 29  ? -0.423  9.345   -26.784 1.00 38.99  ? 829  ARG C NH1   1 
ATOM   7546  N NH2   . ARG E 4 29  ? 1.039   8.550   -25.226 1.00 38.99  ? 829  ARG C NH2   1 
ATOM   7547  N N     . VAL E 4 30  ? -6.320  7.123   -24.364 1.00 38.07  ? 830  VAL C N     1 
ATOM   7548  C CA    . VAL E 4 30  ? -7.560  7.510   -24.975 1.00 38.07  ? 830  VAL C CA    1 
ATOM   7549  C C     . VAL E 4 30  ? -8.501  7.810   -23.820 1.00 38.07  ? 830  VAL C C     1 
ATOM   7550  O O     . VAL E 4 30  ? -9.226  8.772   -23.809 1.00 38.07  ? 830  VAL C O     1 
ATOM   7551  C CB    . VAL E 4 30  ? -8.145  6.342   -25.867 1.00 28.15  ? 830  VAL C CB    1 
ATOM   7552  C CG1   . VAL E 4 30  ? -9.543  6.666   -26.348 1.00 28.15  ? 830  VAL C CG1   1 
ATOM   7553  C CG2   . VAL E 4 30  ? -7.309  6.107   -27.007 1.00 28.15  ? 830  VAL C CG2   1 
ATOM   7554  N N     . HIS E 4 31  ? -8.495  6.978   -22.808 1.00 28.16  ? 831  HIS C N     1 
ATOM   7555  C CA    . HIS E 4 31  ? -9.427  7.240   -21.702 1.00 28.16  ? 831  HIS C CA    1 
ATOM   7556  C C     . HIS E 4 31  ? -9.238  8.625   -21.084 1.00 28.16  ? 831  HIS C C     1 
ATOM   7557  O O     . HIS E 4 31  ? -10.174 9.328   -20.754 1.00 28.16  ? 831  HIS C O     1 
ATOM   7558  C CB    . HIS E 4 31  ? -9.235  6.198   -20.628 1.00 46.32  ? 831  HIS C CB    1 
ATOM   7559  C CG    . HIS E 4 31  ? -10.380 6.098   -19.676 1.00 46.32  ? 831  HIS C CG    1 
ATOM   7560  N ND1   . HIS E 4 31  ? -11.424 6.988   -19.693 1.00 46.32  ? 831  HIS C ND1   1 
ATOM   7561  C CD2   . HIS E 4 31  ? -10.660 5.193   -18.710 1.00 46.32  ? 831  HIS C CD2   1 
ATOM   7562  C CE1   . HIS E 4 31  ? -12.306 6.634   -18.778 1.00 46.32  ? 831  HIS C CE1   1 
ATOM   7563  N NE2   . HIS E 4 31  ? -11.862 5.551   -18.167 1.00 46.32  ? 831  HIS C NE2   1 
ATOM   7564  N N     . ARG E 4 32  ? -7.981  9.007   -20.974 1.00 44.43  ? 832  ARG C N     1 
ATOM   7565  C CA    . ARG E 4 32  ? -7.645  10.291  -20.400 1.00 44.43  ? 832  ARG C CA    1 
ATOM   7566  C C     . ARG E 4 32  ? -8.135  11.390  -21.268 1.00 44.43  ? 832  ARG C C     1 
ATOM   7567  O O     . ARG E 4 32  ? -8.716  12.331  -20.757 1.00 44.43  ? 832  ARG C O     1 
ATOM   7568  C CB    . ARG E 4 32  ? -6.135  10.431  -20.171 1.00 33.62  ? 832  ARG C CB    1 
ATOM   7569  C CG    . ARG E 4 32  ? -5.774  11.798  -19.812 1.00 33.62  ? 832  ARG C CG    1 
ATOM   7570  C CD    . ARG E 4 32  ? -4.321  11.944  -19.549 1.00 33.62  ? 832  ARG C CD    1 
ATOM   7571  N NE    . ARG E 4 32  ? -3.589  12.212  -20.773 1.00 33.62  ? 832  ARG C NE    1 
ATOM   7572  C CZ    . ARG E 4 32  ? -2.710  11.378  -21.338 1.00 33.62  ? 832  ARG C CZ    1 
ATOM   7573  N NH1   . ARG E 4 32  ? -2.383  10.183  -20.794 1.00 33.62  ? 832  ARG C NH1   1 
ATOM   7574  N NH2   . ARG E 4 32  ? -2.230  11.722  -22.531 1.00 33.62  ? 832  ARG C NH2   1 
ATOM   7575  N N     . LEU E 4 33  ? -7.907  11.214  -22.581 1.00 31.02  ? 833  LEU C N     1 
ATOM   7576  C CA    . LEU E 4 33  ? -8.273  12.142  -23.633 1.00 31.02  ? 833  LEU C CA    1 
ATOM   7577  C C     . LEU E 4 33  ? -9.747  12.332  -23.650 1.00 31.02  ? 833  LEU C C     1 
ATOM   7578  O O     . LEU E 4 33  ? -10.208 13.434  -23.678 1.00 31.02  ? 833  LEU C O     1 
ATOM   7579  C CB    . LEU E 4 33  ? -7.695  11.681  -24.973 1.00 28.41  ? 833  LEU C CB    1 
ATOM   7580  C CG    . LEU E 4 33  ? -6.149  11.967  -25.040 1.00 28.41  ? 833  LEU C CG    1 
ATOM   7581  C CD1   . LEU E 4 33  ? -5.311  11.560  -26.307 1.00 28.41  ? 833  LEU C CD1   1 
ATOM   7582  C CD2   . LEU E 4 33  ? -6.103  13.386  -24.971 1.00 28.41  ? 833  LEU C CD2   1 
ATOM   7583  N N     . LEU E 4 34  ? -10.524 11.298  -23.535 1.00 22.10  ? 834  LEU C N     1 
ATOM   7584  C CA    . LEU E 4 34  ? -11.960 11.541  -23.505 1.00 22.10  ? 834  LEU C CA    1 
ATOM   7585  C C     . LEU E 4 34  ? -12.434 12.543  -22.395 1.00 22.10  ? 834  LEU C C     1 
ATOM   7586  O O     . LEU E 4 34  ? -13.439 13.302  -22.545 1.00 22.10  ? 834  LEU C O     1 
ATOM   7587  C CB    . LEU E 4 34  ? -12.693 10.224  -23.312 1.00 15.57  ? 834  LEU C CB    1 
ATOM   7588  C CG    . LEU E 4 34  ? -12.897 9.407   -24.586 1.00 15.57  ? 834  LEU C CG    1 
ATOM   7589  C CD1   . LEU E 4 34  ? -13.699 8.152   -24.188 1.00 15.57  ? 834  LEU C CD1   1 
ATOM   7590  C CD2   . LEU E 4 34  ? -13.656 10.174  -25.672 1.00 15.57  ? 834  LEU C CD2   1 
ATOM   7591  N N     . ARG E 4 35  ? -11.729 12.502  -21.264 1.00 37.40  ? 835  ARG C N     1 
ATOM   7592  C CA    . ARG E 4 35  ? -12.073 13.301  -20.120 1.00 37.40  ? 835  ARG C CA    1 
ATOM   7593  C C     . ARG E 4 35  ? -11.688 14.720  -20.353 1.00 37.40  ? 835  ARG C C     1 
ATOM   7594  O O     . ARG E 4 35  ? -12.491 15.626  -20.155 1.00 37.40  ? 835  ARG C O     1 
ATOM   7595  C CB    . ARG E 4 35  ? -11.397 12.744  -18.901 1.00 49.71  ? 835  ARG C CB    1 
ATOM   7596  C CG    . ARG E 4 35  ? -11.939 11.390  -18.506 1.00 49.71  ? 835  ARG C CG    1 
ATOM   7597  C CD    . ARG E 4 35  ? -11.482 11.074  -17.081 1.00 49.71  ? 835  ARG C CD    1 
ATOM   7598  N NE    . ARG E 4 35  ? -11.405 9.650   -16.765 1.00 49.71  ? 835  ARG C NE    1 
ATOM   7599  C CZ    . ARG E 4 35  ? -12.450 8.822   -16.580 1.00 49.71  ? 835  ARG C CZ    1 
ATOM   7600  N NH1   . ARG E 4 35  ? -13.726 9.239   -16.676 1.00 49.71  ? 835  ARG C NH1   1 
ATOM   7601  N NH2   . ARG E 4 35  ? -12.218 7.546   -16.274 1.00 49.71  ? 835  ARG C NH2   1 
ATOM   7602  N N     . LYS E 4 36  ? -10.479 14.951  -20.810 1.00 31.52  ? 836  LYS C N     1 
ATOM   7603  C CA    . LYS E 4 36  ? -10.090 16.333  -21.042 1.00 31.52  ? 836  LYS C CA    1 
ATOM   7604  C C     . LYS E 4 36  ? -10.890 16.935  -22.228 1.00 31.52  ? 836  LYS C C     1 
ATOM   7605  O O     . LYS E 4 36  ? -11.020 18.150  -22.395 1.00 31.52  ? 836  LYS C O     1 
ATOM   7606  C CB    . LYS E 4 36  ? -8.572  16.444  -21.259 1.00 89.22  ? 836  LYS C CB    1 
ATOM   7607  C CG    . LYS E 4 36  ? -8.141  16.279  -22.691 1.00 89.22  ? 836  LYS C CG    1 
ATOM   7608  C CD    . LYS E 4 36  ? -6.654  16.064  -22.780 1.00 89.22  ? 836  LYS C CD    1 
ATOM   7609  C CE    . LYS E 4 36  ? -5.901  17.233  -22.239 1.00 89.22  ? 836  LYS C CE    1 
ATOM   7610  N NZ    . LYS E 4 36  ? -4.437  16.983  -22.312 1.00 89.22  ? 836  LYS C NZ    1 
ATOM   7611  N N     . GLY E 4 37  ? -11.449 16.084  -23.059 1.00 49.37  ? 837  GLY C N     1 
ATOM   7612  C CA    . GLY E 4 37  ? -12.205 16.622  -24.177 1.00 49.37  ? 837  GLY C CA    1 
ATOM   7613  C C     . GLY E 4 37  ? -13.541 17.137  -23.736 1.00 49.37  ? 837  GLY C C     1 
ATOM   7614  O O     . GLY E 4 37  ? -14.257 17.782  -24.527 1.00 49.37  ? 837  GLY C O     1 
ATOM   7615  N N     . ASN E 4 38  ? -13.851 16.790  -22.480 1.00 52.97  ? 838  ASN C N     1 
ATOM   7616  C CA    . ASN E 4 38  ? -15.059 17.193  -21.798 1.00 52.97  ? 838  ASN C CA    1 
ATOM   7617  C C     . ASN E 4 38  ? -16.252 16.983  -22.690 1.00 52.97  ? 838  ASN C C     1 
ATOM   7618  O O     . ASN E 4 38  ? -16.906 17.925  -23.090 1.00 52.97  ? 838  ASN C O     1 
ATOM   7619  C CB    . ASN E 4 38  ? -14.913 18.648  -21.463 1.00 71.72  ? 838  ASN C CB    1 
ATOM   7620  C CG    . ASN E 4 38  ? -15.542 18.984  -20.209 1.00 71.72  ? 838  ASN C CG    1 
ATOM   7621  O OD1   . ASN E 4 38  ? -15.177 18.428  -19.172 1.00 71.72  ? 838  ASN C OD1   1 
ATOM   7622  N ND2   . ASN E 4 38  ? -16.519 19.878  -20.250 1.00 71.72  ? 838  ASN C ND2   1 
ATOM   7623  N N     . TYR E 4 39  ? -16.546 15.733  -22.983 1.00 48.06  ? 839  TYR C N     1 
ATOM   7624  C CA    . TYR E 4 39  ? -17.608 15.429  -23.910 1.00 48.06  ? 839  TYR C CA    1 
ATOM   7625  C C     . TYR E 4 39  ? -18.883 15.042  -23.176 1.00 48.06  ? 839  TYR C C     1 
ATOM   7626  O O     . TYR E 4 39  ? -19.987 15.004  -23.735 1.00 48.06  ? 839  TYR C O     1 
ATOM   7627  C CB    . TYR E 4 39  ? -17.102 14.299  -24.815 1.00 39.76  ? 839  TYR C CB    1 
ATOM   7628  C CG    . TYR E 4 39  ? -15.899 14.635  -25.689 1.00 39.76  ? 839  TYR C CG    1 
ATOM   7629  C CD1   . TYR E 4 39  ? -14.631 14.233  -25.359 1.00 39.76  ? 839  TYR C CD1   1 
ATOM   7630  C CD2   . TYR E 4 39  ? -16.069 15.317  -26.883 1.00 39.76  ? 839  TYR C CD2   1 
ATOM   7631  C CE1   . TYR E 4 39  ? -13.591 14.506  -26.186 1.00 39.76  ? 839  TYR C CE1   1 
ATOM   7632  C CE2   . TYR E 4 39  ? -15.020 15.584  -27.716 1.00 39.76  ? 839  TYR C CE2   1 
ATOM   7633  C CZ    . TYR E 4 39  ? -13.795 15.192  -27.374 1.00 39.76  ? 839  TYR C CZ    1 
ATOM   7634  O OH    . TYR E 4 39  ? -12.772 15.567  -28.230 1.00 39.76  ? 839  TYR C OH    1 
ATOM   7635  N N     . ALA E 4 40  ? -18.701 14.735  -21.908 1.00 30.32  ? 840  ALA C N     1 
ATOM   7636  C CA    . ALA E 4 40  ? -19.791 14.354  -21.032 1.00 30.32  ? 840  ALA C CA    1 
ATOM   7637  C C     . ALA E 4 40  ? -19.298 14.408  -19.588 1.00 30.32  ? 840  ALA C C     1 
ATOM   7638  O O     . ALA E 4 40  ? -18.074 14.497  -19.313 1.00 30.32  ? 840  ALA C O     1 
ATOM   7639  C CB    . ALA E 4 40  ? -20.266 13.024  -21.374 1.00 21.14  ? 840  ALA C CB    1 
ATOM   7640  N N     . GLU E 4 41  ? -20.237 14.438  -18.658 1.00 44.00  ? 841  GLU C N     1 
ATOM   7641  C CA    . GLU E 4 41  ? -19.804 14.501  -17.286 1.00 44.00  ? 841  GLU C CA    1 
ATOM   7642  C C     . GLU E 4 41  ? -19.048 13.211  -16.953 1.00 44.00  ? 841  GLU C C     1 
ATOM   7643  O O     . GLU E 4 41  ? -18.116 13.211  -16.169 1.00 44.00  ? 841  GLU C O     1 
ATOM   7644  C CB    . GLU E 4 41  ? -20.999 14.696  -16.348 1.00 109.57 ? 841  GLU C CB    1 
ATOM   7645  C CG    . GLU E 4 41  ? -21.639 16.086  -16.379 1.00 109.57 ? 841  GLU C CG    1 
ATOM   7646  C CD    . GLU E 4 41  ? -20.688 17.197  -15.939 1.00 109.57 ? 841  GLU C CD    1 
ATOM   7647  O OE1   . GLU E 4 41  ? -20.143 17.119  -14.819 1.00 109.57 ? 841  GLU C OE1   1 
ATOM   7648  O OE2   . GLU E 4 41  ? -20.486 18.161  -16.709 1.00 109.57 ? 841  GLU C OE2   1 
ATOM   7649  N N     . ARG E 4 42  ? -19.416 12.087  -17.537 1.00 36.91  ? 842  ARG C N     1 
ATOM   7650  C CA    . ARG E 4 42  ? -18.677 10.873  -17.191 1.00 36.91  ? 842  ARG C CA    1 
ATOM   7651  C C     . ARG E 4 42  ? -18.387 9.883   -18.365 1.00 36.91  ? 842  ARG C C     1 
ATOM   7652  O O     . ARG E 4 42  ? -19.113 9.824   -19.355 1.00 36.91  ? 842  ARG C O     1 
ATOM   7653  C CB    . ARG E 4 42  ? -19.365 10.170  -16.017 1.00 76.46  ? 842  ARG C CB    1 
ATOM   7654  C CG    . ARG E 4 42  ? -20.842 10.374  -16.043 1.00 76.46  ? 842  ARG C CG    1 
ATOM   7655  C CD    . ARG E 4 42  ? -21.600 9.324   -15.290 1.00 76.46  ? 842  ARG C CD    1 
ATOM   7656  N NE    . ARG E 4 42  ? -21.363 9.402   -13.869 1.00 76.46  ? 842  ARG C NE    1 
ATOM   7657  C CZ    . ARG E 4 42  ? -21.834 8.528   -12.992 1.00 76.46  ? 842  ARG C CZ    1 
ATOM   7658  N NH1   . ARG E 4 42  ? -22.582 7.497   -13.379 1.00 76.46  ? 842  ARG C NH1   1 
ATOM   7659  N NH2   . ARG E 4 42  ? -21.527 8.682   -11.719 1.00 76.46  ? 842  ARG C NH2   1 
ATOM   7660  N N     . VAL E 4 43  ? -17.301 9.122   -18.219 1.00 34.77  ? 843  VAL C N     1 
ATOM   7661  C CA    . VAL E 4 43  ? -16.907 8.195   -19.244 1.00 34.77  ? 843  VAL C CA    1 
ATOM   7662  C C     . VAL E 4 43  ? -16.781 6.806   -18.794 1.00 34.77  ? 843  VAL C C     1 
ATOM   7663  O O     . VAL E 4 43  ? -15.804 6.484   -18.126 1.00 34.77  ? 843  VAL C O     1 
ATOM   7664  C CB    . VAL E 4 43  ? -15.564 8.517   -19.828 1.00 8.92   ? 843  VAL C CB    1 
ATOM   7665  C CG1   . VAL E 4 43  ? -15.266 7.529   -20.942 1.00 8.92   ? 843  VAL C CG1   1 
ATOM   7666  C CG2   . VAL E 4 43  ? -15.587 9.913   -20.342 1.00 8.92   ? 843  VAL C CG2   1 
ATOM   7667  N N     . GLY E 4 44  ? -17.708 5.974   -19.226 1.00 35.39  ? 844  GLY C N     1 
ATOM   7668  C CA    . GLY E 4 44  ? -17.690 4.591   -18.799 1.00 35.39  ? 844  GLY C CA    1 
ATOM   7669  C C     . GLY E 4 44  ? -16.458 3.905   -19.314 1.00 35.39  ? 844  GLY C C     1 
ATOM   7670  O O     . GLY E 4 44  ? -15.913 4.329   -20.326 1.00 35.39  ? 844  GLY C O     1 
ATOM   7671  N N     . ALA E 4 45  ? -16.043 2.835   -18.651 1.00 35.85  ? 845  ALA C N     1 
ATOM   7672  C CA    . ALA E 4 45  ? -14.801 2.157   -19.011 1.00 35.85  ? 845  ALA C CA    1 
ATOM   7673  C C     . ALA E 4 45  ? -14.819 1.446   -20.328 1.00 35.85  ? 845  ALA C C     1 
ATOM   7674  O O     . ALA E 4 45  ? -13.749 1.098   -20.870 1.00 35.85  ? 845  ALA C O     1 
ATOM   7675  C CB    . ALA E 4 45  ? -14.407 1.180   -17.929 1.00 45.23  ? 845  ALA C CB    1 
ATOM   7676  N N     . GLY E 4 46  ? -16.042 1.224   -20.805 1.00 39.59  ? 846  GLY C N     1 
ATOM   7677  C CA    . GLY E 4 46  ? -16.199 0.534   -22.048 1.00 39.59  ? 846  GLY C CA    1 
ATOM   7678  C C     . GLY E 4 46  ? -15.810 1.432   -23.195 1.00 39.59  ? 846  GLY C C     1 
ATOM   7679  O O     . GLY E 4 46  ? -15.302 0.960   -24.200 1.00 39.59  ? 846  GLY C O     1 
ATOM   7680  N N     . ALA E 4 47  ? -16.046 2.730   -23.016 1.00 24.05  ? 847  ALA C N     1 
ATOM   7681  C CA    . ALA E 4 47  ? -15.773 3.725   -23.999 1.00 24.05  ? 847  ALA C CA    1 
ATOM   7682  C C     . ALA E 4 47  ? -14.334 3.817   -24.451 1.00 24.05  ? 847  ALA C C     1 
ATOM   7683  O O     . ALA E 4 47  ? -13.999 3.592   -25.616 1.00 24.05  ? 847  ALA C O     1 
ATOM   7684  C CB    . ALA E 4 47  ? -16.228 5.018   -23.503 1.00 32.71  ? 847  ALA C CB    1 
ATOM   7685  N N     . PRO E 4 48  ? -13.449 4.153   -23.550 1.00 26.38  ? 848  PRO C N     1 
ATOM   7686  C CA    . PRO E 4 48  ? -12.133 4.200   -24.185 1.00 26.38  ? 848  PRO C CA    1 
ATOM   7687  C C     . PRO E 4 48  ? -11.723 2.856   -24.775 1.00 26.38  ? 848  PRO C C     1 
ATOM   7688  O O     . PRO E 4 48  ? -11.000 2.843   -25.768 1.00 26.38  ? 848  PRO C O     1 
ATOM   7689  C CB    . PRO E 4 48  ? -11.214 4.703   -23.072 1.00 25.29  ? 848  PRO C CB    1 
ATOM   7690  C CG    . PRO E 4 48  ? -11.842 4.122   -21.860 1.00 25.29  ? 848  PRO C CG    1 
ATOM   7691  C CD    . PRO E 4 48  ? -13.358 4.045   -22.095 1.00 25.29  ? 848  PRO C CD    1 
ATOM   7692  N N     . VAL E 4 49  ? -12.205 1.741   -24.248 1.00 23.29  ? 849  VAL C N     1 
ATOM   7693  C CA    . VAL E 4 49  ? -11.739 0.533   -24.839 1.00 23.29  ? 849  VAL C CA    1 
ATOM   7694  C C     . VAL E 4 49  ? -12.186 0.454   -26.278 1.00 23.29  ? 849  VAL C C     1 
ATOM   7695  O O     . VAL E 4 49  ? -11.410 0.264   -27.191 1.00 23.29  ? 849  VAL C O     1 
ATOM   7696  C CB    . VAL E 4 49  ? -12.204 -0.702  -24.038 1.00 21.33  ? 849  VAL C CB    1 
ATOM   7697  C CG1   . VAL E 4 49  ? -12.298 -1.937  -24.951 1.00 21.33  ? 849  VAL C CG1   1 
ATOM   7698  C CG2   . VAL E 4 49  ? -11.252 -0.989  -22.883 1.00 21.33  ? 849  VAL C CG2   1 
ATOM   7699  N N     . TYR E 4 50  ? -13.453 0.630   -26.492 1.00 26.93  ? 850  TYR C N     1 
ATOM   7700  C CA    . TYR E 4 50  ? -14.023 0.568   -27.828 1.00 26.93  ? 850  TYR C CA    1 
ATOM   7701  C C     . TYR E 4 50  ? -13.450 1.564   -28.822 1.00 26.93  ? 850  TYR C C     1 
ATOM   7702  O O     . TYR E 4 50  ? -13.148 1.259   -29.932 1.00 26.93  ? 850  TYR C O     1 
ATOM   7703  C CB    . TYR E 4 50  ? -15.516 0.794   -27.705 1.00 27.95  ? 850  TYR C CB    1 
ATOM   7704  C CG    . TYR E 4 50  ? -16.308 0.266   -28.830 1.00 27.95  ? 850  TYR C CG    1 
ATOM   7705  C CD1   . TYR E 4 50  ? -17.360 -0.621  -28.611 1.00 27.95  ? 850  TYR C CD1   1 
ATOM   7706  C CD2   . TYR E 4 50  ? -16.115 0.741   -30.116 1.00 27.95  ? 850  TYR C CD2   1 
ATOM   7707  C CE1   . TYR E 4 50  ? -18.197 -0.993  -29.629 1.00 27.95  ? 850  TYR C CE1   1 
ATOM   7708  C CE2   . TYR E 4 50  ? -16.981 0.354   -31.131 1.00 27.95  ? 850  TYR C CE2   1 
ATOM   7709  C CZ    . TYR E 4 50  ? -18.008 -0.505  -30.857 1.00 27.95  ? 850  TYR C CZ    1 
ATOM   7710  O OH    . TYR E 4 50  ? -18.846 -0.843  -31.832 1.00 27.95  ? 850  TYR C OH    1 
ATOM   7711  N N     . LEU E 4 51  ? -13.327 2.802   -28.419 1.00 27.20  ? 851  LEU C N     1 
ATOM   7712  C CA    . LEU E 4 51  ? -12.796 3.812   -29.307 1.00 27.20  ? 851  LEU C CA    1 
ATOM   7713  C C     . LEU E 4 51  ? -11.310 3.541   -29.569 1.00 27.20  ? 851  LEU C C     1 
ATOM   7714  O O     . LEU E 4 51  ? -10.833 3.849   -30.643 1.00 27.20  ? 851  LEU C O     1 
ATOM   7715  C CB    . LEU E 4 51  ? -13.033 5.193   -28.696 1.00 13.42  ? 851  LEU C CB    1 
ATOM   7716  C CG    . LEU E 4 51  ? -12.318 6.301   -29.470 1.00 13.42  ? 851  LEU C CG    1 
ATOM   7717  C CD1   . LEU E 4 51  ? -12.920 6.536   -30.855 1.00 13.42  ? 851  LEU C CD1   1 
ATOM   7718  C CD2   . LEU E 4 51  ? -12.478 7.545   -28.667 1.00 13.42  ? 851  LEU C CD2   1 
ATOM   7719  N N     . ALA E 4 52  ? -10.560 2.993   -28.627 1.00 21.95  ? 852  ALA C N     1 
ATOM   7720  C CA    . ALA E 4 52  ? -9.206  2.716   -29.010 1.00 21.95  ? 852  ALA C CA    1 
ATOM   7721  C C     . ALA E 4 52  ? -9.197  1.565   -30.047 1.00 21.95  ? 852  ALA C C     1 
ATOM   7722  O O     . ALA E 4 52  ? -8.299  1.473   -30.880 1.00 21.95  ? 852  ALA C O     1 
ATOM   7723  C CB    . ALA E 4 52  ? -8.387  2.349   -27.860 1.00 35.90  ? 852  ALA C CB    1 
ATOM   7724  N N     . ALA E 4 53  ? -10.182 0.684   -30.031 1.00 28.34  ? 853  ALA C N     1 
ATOM   7725  C CA    . ALA E 4 53  ? -10.173 -0.359  -31.019 1.00 28.34  ? 853  ALA C CA    1 
ATOM   7726  C C     . ALA E 4 53  ? -10.394 0.281   -32.408 1.00 28.34  ? 853  ALA C C     1 
ATOM   7727  O O     . ALA E 4 53  ? -9.520  0.277   -33.241 1.00 28.34  ? 853  ALA C O     1 
ATOM   7728  C CB    . ALA E 4 53  ? -11.234 -1.336  -30.693 1.00 26.07  ? 853  ALA C CB    1 
ATOM   7729  N N     . VAL E 4 54  ? -11.575 0.812   -32.648 1.00 28.24  ? 854  VAL C N     1 
ATOM   7730  C CA    . VAL E 4 54  ? -11.934 1.485   -33.846 1.00 28.24  ? 854  VAL C CA    1 
ATOM   7731  C C     . VAL E 4 54  ? -10.743 2.328   -34.301 1.00 28.24  ? 854  VAL C C     1 
ATOM   7732  O O     . VAL E 4 54  ? -10.383 2.316   -35.443 1.00 28.24  ? 854  VAL C O     1 
ATOM   7733  C CB    . VAL E 4 54  ? -13.199 2.340   -33.499 1.00 24.08  ? 854  VAL C CB    1 
ATOM   7734  C CG1   . VAL E 4 54  ? -13.577 3.428   -34.521 1.00 24.08  ? 854  VAL C CG1   1 
ATOM   7735  C CG2   . VAL E 4 54  ? -14.319 1.426   -33.385 1.00 24.08  ? 854  VAL C CG2   1 
ATOM   7736  N N     . LEU E 4 55  ? -10.080 3.044   -33.413 1.00 21.97  ? 855  LEU C N     1 
ATOM   7737  C CA    . LEU E 4 55  ? -8.948  3.888   -33.867 1.00 21.97  ? 855  LEU C CA    1 
ATOM   7738  C C     . LEU E 4 55  ? -7.780  3.119   -34.433 1.00 21.97  ? 855  LEU C C     1 
ATOM   7739  O O     . LEU E 4 55  ? -7.147  3.517   -35.421 1.00 21.97  ? 855  LEU C O     1 
ATOM   7740  C CB    . LEU E 4 55  ? -8.421  4.819   -32.747 1.00 25.02  ? 855  LEU C CB    1 
ATOM   7741  C CG    . LEU E 4 55  ? -9.297  6.094   -32.577 1.00 25.02  ? 855  LEU C CG    1 
ATOM   7742  C CD1   . LEU E 4 55  ? -8.613  7.063   -31.663 1.00 25.02  ? 855  LEU C CD1   1 
ATOM   7743  C CD2   . LEU E 4 55  ? -9.526  6.832   -33.869 1.00 25.02  ? 855  LEU C CD2   1 
ATOM   7744  N N     . GLU E 4 56  ? -7.482  2.031   -33.767 1.00 32.62  ? 856  GLU C N     1 
ATOM   7745  C CA    . GLU E 4 56  ? -6.427  1.196   -34.202 1.00 32.62  ? 856  GLU C CA    1 
ATOM   7746  C C     . GLU E 4 56  ? -6.883  0.433   -35.425 1.00 32.62  ? 856  GLU C C     1 
ATOM   7747  O O     . GLU E 4 56  ? -6.051  0.055   -36.274 1.00 32.62  ? 856  GLU C O     1 
ATOM   7748  C CB    . GLU E 4 56  ? -6.092  0.237   -33.097 1.00 36.00  ? 856  GLU C CB    1 
ATOM   7749  C CG    . GLU E 4 56  ? -5.355  -1.022  -33.507 1.00 36.00  ? 856  GLU C CG    1 
ATOM   7750  C CD    . GLU E 4 56  ? -4.994  -1.870  -32.258 1.00 36.00  ? 856  GLU C CD    1 
ATOM   7751  O OE1   . GLU E 4 56  ? -4.561  -1.222  -31.259 1.00 36.00  ? 856  GLU C OE1   1 
ATOM   7752  O OE2   . GLU E 4 56  ? -5.143  -3.143  -32.263 1.00 36.00  ? 856  GLU C OE2   1 
ATOM   7753  N N     . TYR E 4 57  ? -8.197  0.216   -35.553 1.00 21.96  ? 857  TYR C N     1 
ATOM   7754  C CA    . TYR E 4 57  ? -8.613  -0.600  -36.662 1.00 21.96  ? 857  TYR C CA    1 
ATOM   7755  C C     . TYR E 4 57  ? -8.433  0.145   -37.904 1.00 21.96  ? 857  TYR C C     1 
ATOM   7756  O O     . TYR E 4 57  ? -7.989  -0.469  -38.924 1.00 21.96  ? 857  TYR C O     1 
ATOM   7757  C CB    . TYR E 4 57  ? -10.052 -1.064  -36.573 1.00 38.11  ? 857  TYR C CB    1 
ATOM   7758  C CG    . TYR E 4 57  ? -10.673 -1.446  -37.934 1.00 38.11  ? 857  TYR C CG    1 
ATOM   7759  C CD1   . TYR E 4 57  ? -9.992  -2.265  -38.846 1.00 38.11  ? 857  TYR C CD1   1 
ATOM   7760  C CD2   . TYR E 4 57  ? -11.867 -0.875  -38.355 1.00 38.11  ? 857  TYR C CD2   1 
ATOM   7761  C CE1   . TYR E 4 57  ? -10.486 -2.457  -40.119 1.00 38.11  ? 857  TYR C CE1   1 
ATOM   7762  C CE2   . TYR E 4 57  ? -12.354 -1.071  -39.594 1.00 38.11  ? 857  TYR C CE2   1 
ATOM   7763  C CZ    . TYR E 4 57  ? -11.672 -1.840  -40.477 1.00 38.11  ? 857  TYR C CZ    1 
ATOM   7764  O OH    . TYR E 4 57  ? -12.145 -1.916  -41.772 1.00 38.11  ? 857  TYR C OH    1 
ATOM   7765  N N     . LEU E 4 58  ? -8.781  1.450   -37.843 1.00 23.58  ? 858  LEU C N     1 
ATOM   7766  C CA    . LEU E 4 58  ? -8.674  2.322   -38.996 1.00 23.58  ? 858  LEU C CA    1 
ATOM   7767  C C     . LEU E 4 58  ? -7.274  2.660   -39.316 1.00 23.58  ? 858  LEU C C     1 
ATOM   7768  O O     . LEU E 4 58  ? -7.005  2.896   -40.458 1.00 23.58  ? 858  LEU C O     1 
ATOM   7769  C CB    . LEU E 4 58  ? -9.378  3.633   -38.818 1.00 12.73  ? 858  LEU C CB    1 
ATOM   7770  C CG    . LEU E 4 58  ? -10.877 3.696   -38.603 1.00 12.73  ? 858  LEU C CG    1 
ATOM   7771  C CD1   . LEU E 4 58  ? -11.361 5.017   -38.065 1.00 12.73  ? 858  LEU C CD1   1 
ATOM   7772  C CD2   . LEU E 4 58  ? -11.467 3.376   -39.944 1.00 12.73  ? 858  LEU C CD2   1 
ATOM   7773  N N     . THR E 4 59  ? -6.349  2.699   -38.372 1.00 32.68  ? 859  THR C N     1 
ATOM   7774  C CA    . THR E 4 59  ? -5.028  3.042   -38.868 1.00 32.68  ? 859  THR C CA    1 
ATOM   7775  C C     . THR E 4 59  ? -4.419  1.823   -39.588 1.00 32.68  ? 859  THR C C     1 
ATOM   7776  O O     . THR E 4 59  ? -3.600  1.907   -40.508 1.00 32.68  ? 859  THR C O     1 
ATOM   7777  C CB    . THR E 4 59  ? -4.084  3.579   -37.761 1.00 26.20  ? 859  THR C CB    1 
ATOM   7778  O OG1   . THR E 4 59  ? -3.280  2.516   -37.313 1.00 26.20  ? 859  THR C OG1   1 
ATOM   7779  C CG2   . THR E 4 59  ? -4.843  4.221   -36.584 1.00 26.20  ? 859  THR C CG2   1 
ATOM   7780  N N     . ALA E 4 60  ? -4.911  0.672   -39.184 1.00 19.86  ? 860  ALA C N     1 
ATOM   7781  C CA    . ALA E 4 60  ? -4.488  -0.614  -39.721 1.00 19.86  ? 860  ALA C CA    1 
ATOM   7782  C C     . ALA E 4 60  ? -4.822  -0.710  -41.199 1.00 19.86  ? 860  ALA C C     1 
ATOM   7783  O O     . ALA E 4 60  ? -3.974  -1.115  -41.974 1.00 19.86  ? 860  ALA C O     1 
ATOM   7784  C CB    . ALA E 4 60  ? -5.168  -1.746  -38.919 1.00 21.04  ? 860  ALA C CB    1 
ATOM   7785  N N     . GLU E 4 61  ? -6.063  -0.354  -41.551 1.00 33.27  ? 861  GLU C N     1 
ATOM   7786  C CA    . GLU E 4 61  ? -6.646  -0.323  -42.898 1.00 33.27  ? 861  GLU C CA    1 
ATOM   7787  C C     . GLU E 4 61  ? -5.876  0.687   -43.839 1.00 33.27  ? 861  GLU C C     1 
ATOM   7788  O O     . GLU E 4 61  ? -5.464  0.384   -44.993 1.00 33.27  ? 861  GLU C O     1 
ATOM   7789  C CB    . GLU E 4 61  ? -8.096  0.108   -42.700 1.00 35.93  ? 861  GLU C CB    1 
ATOM   7790  C CG    . GLU E 4 61  ? -8.976  -0.090  -43.843 1.00 35.93  ? 861  GLU C CG    1 
ATOM   7791  C CD    . GLU E 4 61  ? -8.903  -1.541  -44.361 1.00 35.93  ? 861  GLU C CD    1 
ATOM   7792  O OE1   . GLU E 4 61  ? -9.333  -2.520  -43.646 1.00 35.93  ? 861  GLU C OE1   1 
ATOM   7793  O OE2   . GLU E 4 61  ? -8.411  -1.716  -45.510 1.00 35.93  ? 861  GLU C OE2   1 
ATOM   7794  N N     . ILE E 4 62  ? -5.684  1.905   -43.348 1.00 23.14  ? 862  ILE C N     1 
ATOM   7795  C CA    . ILE E 4 62  ? -4.993  2.823   -44.184 1.00 23.14  ? 862  ILE C CA    1 
ATOM   7796  C C     . ILE E 4 62  ? -3.451  2.459   -44.344 1.00 23.14  ? 862  ILE C C     1 
ATOM   7797  O O     . ILE E 4 62  ? -2.816  2.759   -45.410 1.00 23.14  ? 862  ILE C O     1 
ATOM   7798  C CB    . ILE E 4 62  ? -5.259  4.295   -43.693 1.00 27.99  ? 862  ILE C CB    1 
ATOM   7799  C CG1   . ILE E 4 62  ? -4.720  5.281   -44.678 1.00 27.99  ? 862  ILE C CG1   1 
ATOM   7800  C CG2   . ILE E 4 62  ? -4.244  4.774   -42.703 1.00 27.99  ? 862  ILE C CG2   1 
ATOM   7801  C CD1   . ILE E 4 62  ? -4.873  6.663   -44.162 1.00 27.99  ? 862  ILE C CD1   1 
ATOM   7802  N N     . LEU E 4 63  ? -2.837  1.822   -43.329 1.00 25.36  ? 863  LEU C N     1 
ATOM   7803  C CA    . LEU E 4 63  ? -1.426  1.484   -43.514 1.00 25.36  ? 863  LEU C CA    1 
ATOM   7804  C C     . LEU E 4 63  ? -1.395  0.201   -44.320 1.00 25.36  ? 863  LEU C C     1 
ATOM   7805  O O     . LEU E 4 63  ? -0.518  -0.041  -45.127 1.00 25.36  ? 863  LEU C O     1 
ATOM   7806  C CB    . LEU E 4 63  ? -0.663  1.311   -42.218 1.00 10.05  ? 863  LEU C CB    1 
ATOM   7807  C CG    . LEU E 4 63  ? -0.627  2.408   -41.159 1.00 10.05  ? 863  LEU C CG    1 
ATOM   7808  C CD1   . LEU E 4 63  ? 0.014   1.833   -39.994 1.00 10.05  ? 863  LEU C CD1   1 
ATOM   7809  C CD2   . LEU E 4 63  ? 0.157   3.624   -41.541 1.00 10.05  ? 863  LEU C CD2   1 
ATOM   7810  N N     . GLU E 4 64  ? -2.379  -0.649  -44.126 1.00 25.44  ? 864  GLU C N     1 
ATOM   7811  C CA    . GLU E 4 64  ? -2.393  -1.795  -44.990 1.00 25.44  ? 864  GLU C CA    1 
ATOM   7812  C C     . GLU E 4 64  ? -2.434  -1.300  -46.442 1.00 25.44  ? 864  GLU C C     1 
ATOM   7813  O O     . GLU E 4 64  ? -1.624  -1.682  -47.230 1.00 25.44  ? 864  GLU C O     1 
ATOM   7814  C CB    . GLU E 4 64  ? -3.564  -2.684  -44.713 1.00 28.29  ? 864  GLU C CB    1 
ATOM   7815  C CG    . GLU E 4 64  ? -3.666  -3.792  -45.737 1.00 28.29  ? 864  GLU C CG    1 
ATOM   7816  C CD    . GLU E 4 64  ? -2.566  -4.907  -45.766 1.00 28.29  ? 864  GLU C CD    1 
ATOM   7817  O OE1   . GLU E 4 64  ? -2.695  -5.785  -46.648 1.00 28.29  ? 864  GLU C OE1   1 
ATOM   7818  O OE2   . GLU E 4 64  ? -1.604  -4.947  -44.978 1.00 28.29  ? 864  GLU C OE2   1 
ATOM   7819  N N     . LEU E 4 65  ? -3.341  -0.399  -46.783 1.00 33.39  ? 865  LEU C N     1 
ATOM   7820  C CA    . LEU E 4 65  ? -3.384  0.088   -48.154 1.00 33.39  ? 865  LEU C CA    1 
ATOM   7821  C C     . LEU E 4 65  ? -2.245  0.984   -48.537 1.00 33.39  ? 865  LEU C C     1 
ATOM   7822  O O     . LEU E 4 65  ? -1.828  0.920   -49.684 1.00 33.39  ? 865  LEU C O     1 
ATOM   7823  C CB    . LEU E 4 65  ? -4.645  0.819   -48.423 1.00 22.90  ? 865  LEU C CB    1 
ATOM   7824  C CG    . LEU E 4 65  ? -6.004  0.151   -48.332 1.00 22.90  ? 865  LEU C CG    1 
ATOM   7825  C CD1   . LEU E 4 65  ? -7.065  1.209   -48.655 1.00 22.90  ? 865  LEU C CD1   1 
ATOM   7826  C CD2   . LEU E 4 65  ? -6.052  -0.903  -49.259 1.00 22.90  ? 865  LEU C CD2   1 
ATOM   7827  N N     . ALA E 4 66  ? -1.754  1.853   -47.638 1.00 24.23  ? 866  ALA C N     1 
ATOM   7828  C CA    . ALA E 4 66  ? -0.563  2.696   -47.976 1.00 24.23  ? 866  ALA C CA    1 
ATOM   7829  C C     . ALA E 4 66  ? 0.612   1.793   -48.252 1.00 24.23  ? 866  ALA C C     1 
ATOM   7830  O O     . ALA E 4 66  ? 1.288   1.904   -49.267 1.00 24.23  ? 866  ALA C O     1 
ATOM   7831  C CB    . ALA E 4 66  ? -0.204  3.535   -46.877 1.00 12.59  ? 866  ALA C CB    1 
ATOM   7832  N N     . GLY E 4 67  ? 0.838   0.882   -47.330 1.00 16.43  ? 867  GLY C N     1 
ATOM   7833  C CA    . GLY E 4 67  ? 1.890   -0.034  -47.534 1.00 16.43  ? 867  GLY C CA    1 
ATOM   7834  C C     . GLY E 4 67  ? 1.882   -0.613  -48.948 1.00 16.43  ? 867  GLY C C     1 
ATOM   7835  O O     . GLY E 4 67  ? 2.983   -0.693  -49.575 1.00 16.43  ? 867  GLY C O     1 
ATOM   7836  N N     . ASN E 4 68  ? 0.735   -1.020  -49.513 1.00 25.64  ? 868  ASN C N     1 
ATOM   7837  C CA    . ASN E 4 68  ? 0.890   -1.573  -50.862 1.00 25.64  ? 868  ASN C CA    1 
ATOM   7838  C C     . ASN E 4 68  ? 1.304   -0.475  -51.877 1.00 25.64  ? 868  ASN C C     1 
ATOM   7839  O O     . ASN E 4 68  ? 2.097   -0.713  -52.795 1.00 25.64  ? 868  ASN C O     1 
ATOM   7840  C CB    . ASN E 4 68  ? -0.358  -2.241  -51.447 1.00 21.71  ? 868  ASN C CB    1 
ATOM   7841  C CG    . ASN E 4 68  ? -1.179  -3.090  -50.464 1.00 21.71  ? 868  ASN C CG    1 
ATOM   7842  O OD1   . ASN E 4 68  ? -0.694  -4.019  -49.821 1.00 21.71  ? 868  ASN C OD1   1 
ATOM   7843  N ND2   . ASN E 4 68  ? -2.490  -2.807  -50.431 1.00 21.71  ? 868  ASN C ND2   1 
ATOM   7844  N N     . ALA E 4 69  ? 0.749   0.724   -51.726 1.00 26.08  ? 869  ALA C N     1 
ATOM   7845  C CA    . ALA E 4 69  ? 1.109   1.757   -52.659 1.00 26.08  ? 869  ALA C CA    1 
ATOM   7846  C C     . ALA E 4 69  ? 2.621   1.921   -52.582 1.00 26.08  ? 869  ALA C C     1 
ATOM   7847  O O     . ALA E 4 69  ? 3.303   2.100   -53.615 1.00 26.08  ? 869  ALA C O     1 
ATOM   7848  C CB    . ALA E 4 69  ? 0.451   3.010   -52.299 1.00 25.14  ? 869  ALA C CB    1 
ATOM   7849  N N     . ALA E 4 70  ? 3.184   1.867   -51.393 1.00 27.54  ? 870  ALA C N     1 
ATOM   7850  C CA    . ALA E 4 70  ? 4.589   2.014   -51.445 1.00 27.54  ? 870  ALA C CA    1 
ATOM   7851  C C     . ALA E 4 70  ? 5.166   0.852   -52.230 1.00 27.54  ? 870  ALA C C     1 
ATOM   7852  O O     . ALA E 4 70  ? 6.055   0.995   -53.028 1.00 27.54  ? 870  ALA C O     1 
ATOM   7853  C CB    . ALA E 4 70  ? 5.100   2.010   -50.167 1.00 30.83  ? 870  ALA C CB    1 
ATOM   7854  N N     . ARG E 4 71  ? 4.662   -0.338  -52.005 1.00 15.34  ? 871  ARG C N     1 
ATOM   7855  C CA    . ARG E 4 71  ? 5.202   -1.474  -52.744 1.00 15.34  ? 871  ARG C CA    1 
ATOM   7856  C C     . ARG E 4 71  ? 4.977   -1.281  -54.228 1.00 15.34  ? 871  ARG C C     1 
ATOM   7857  O O     . ARG E 4 71  ? 5.903   -1.510  -55.009 1.00 15.34  ? 871  ARG C O     1 
ATOM   7858  C CB    . ARG E 4 71  ? 4.599   -2.808  -52.318 1.00 84.74  ? 871  ARG C CB    1 
ATOM   7859  C CG    . ARG E 4 71  ? 5.000   -3.906  -53.250 1.00 84.74  ? 871  ARG C CG    1 
ATOM   7860  C CD    . ARG E 4 71  ? 4.676   -5.264  -52.702 1.00 84.74  ? 871  ARG C CD    1 
ATOM   7861  N NE    . ARG E 4 71  ? 5.287   -5.449  -51.391 1.00 84.74  ? 871  ARG C NE    1 
ATOM   7862  C CZ    . ARG E 4 71  ? 5.272   -6.580  -50.688 1.00 84.74  ? 871  ARG C CZ    1 
ATOM   7863  N NH1   . ARG E 4 71  ? 4.674   -7.680  -51.187 1.00 84.74  ? 871  ARG C NH1   1 
ATOM   7864  N NH2   . ARG E 4 71  ? 5.817   -6.569  -49.458 1.00 84.74  ? 871  ARG C NH2   1 
ATOM   7865  N N     . ASP E 4 72  ? 3.789   -0.843  -54.643 1.00 43.62  ? 872  ASP C N     1 
ATOM   7866  C CA    . ASP E 4 72  ? 3.590   -0.695  -56.061 1.00 43.62  ? 872  ASP C CA    1 
ATOM   7867  C C     . ASP E 4 72  ? 4.529   0.352   -56.596 1.00 43.62  ? 872  ASP C C     1 
ATOM   7868  O O     . ASP E 4 72  ? 4.671   0.482   -57.788 1.00 43.62  ? 872  ASP C O     1 
ATOM   7869  C CB    . ASP E 4 72  ? 2.152   -0.356  -56.402 1.00 49.65  ? 872  ASP C CB    1 
ATOM   7870  C CG    . ASP E 4 72  ? 1.184   -1.493  -56.059 1.00 49.65  ? 872  ASP C CG    1 
ATOM   7871  O OD1   . ASP E 4 72  ? 1.546   -2.714  -56.120 1.00 49.65  ? 872  ASP C OD1   1 
ATOM   7872  O OD2   . ASP E 4 72  ? 0.015   -1.176  -55.729 1.00 49.65  ? 872  ASP C OD2   1 
ATOM   7873  N N     . ASN E 4 73  ? 5.215   1.098   -55.751 1.00 39.03  ? 873  ASN C N     1 
ATOM   7874  C CA    . ASN E 4 73  ? 6.117   2.084   -56.328 1.00 39.03  ? 873  ASN C CA    1 
ATOM   7875  C C     . ASN E 4 73  ? 7.581   1.810   -56.093 1.00 39.03  ? 873  ASN C C     1 
ATOM   7876  O O     . ASN E 4 73  ? 8.400   2.761   -56.014 1.00 39.03  ? 873  ASN C O     1 
ATOM   7877  C CB    . ASN E 4 73  ? 5.795   3.487   -55.815 1.00 79.05  ? 873  ASN C CB    1 
ATOM   7878  C CG    . ASN E 4 73  ? 4.503   4.018   -56.366 1.00 79.05  ? 873  ASN C CG    1 
ATOM   7879  O OD1   . ASN E 4 73  ? 4.347   4.186   -57.577 1.00 79.05  ? 873  ASN C OD1   1 
ATOM   7880  N ND2   . ASN E 4 73  ? 3.562   4.275   -55.492 1.00 79.05  ? 873  ASN C ND2   1 
ATOM   7881  N N     . LYS E 4 74  ? 7.917   0.526   -55.992 1.00 36.26  ? 874  LYS C N     1 
ATOM   7882  C CA    . LYS E 4 74  ? 9.309   0.111   -55.732 1.00 36.26  ? 874  LYS C CA    1 
ATOM   7883  C C     . LYS E 4 74  ? 9.921   0.768   -54.491 1.00 36.26  ? 874  LYS C C     1 
ATOM   7884  O O     . LYS E 4 74  ? 11.145  0.875   -54.386 1.00 36.26  ? 874  LYS C O     1 
ATOM   7885  C CB    . LYS E 4 74  ? 10.207  0.362   -56.949 1.00 93.38  ? 874  LYS C CB    1 
ATOM   7886  C CG    . LYS E 4 74  ? 10.233  -0.799  -57.959 1.00 93.38  ? 874  LYS C CG    1 
ATOM   7887  C CD    . LYS E 4 74  ? 8.903   -0.914  -58.722 1.00 93.38  ? 874  LYS C CD    1 
ATOM   7888  C CE    . LYS E 4 74  ? 8.964   -1.874  -59.936 1.00 93.38  ? 874  LYS C CE    1 
ATOM   7889  N NZ    . LYS E 4 74  ? 7.744   -1.828  -60.819 1.00 93.38  ? 874  LYS C NZ    1 
ATOM   7890  N N     . LYS E 4 75  ? 9.038   1.134   -53.545 1.00 30.23  ? 875  LYS C N     1 
ATOM   7891  C CA    . LYS E 4 75  ? 9.382   1.789   -52.262 1.00 30.23  ? 875  LYS C CA    1 
ATOM   7892  C C     . LYS E 4 75  ? 9.165   0.993   -51.000 1.00 30.23  ? 875  LYS C C     1 
ATOM   7893  O O     . LYS E 4 75  ? 8.237   0.150   -50.882 1.00 30.23  ? 875  LYS C O     1 
ATOM   7894  C CB    . LYS E 4 75  ? 8.580   3.012   -52.073 1.00 34.01  ? 875  LYS C CB    1 
ATOM   7895  C CG    . LYS E 4 75  ? 8.802   3.822   -53.072 1.00 34.01  ? 875  LYS C CG    1 
ATOM   7896  C CD    . LYS E 4 75  ? 10.002  4.454   -52.785 1.00 34.01  ? 875  LYS C CD    1 
ATOM   7897  C CE    . LYS E 4 75  ? 9.980   5.602   -53.782 1.00 34.01  ? 875  LYS C CE    1 
ATOM   7898  N NZ    . LYS E 4 75  ? 9.774   5.048   -55.179 1.00 34.01  ? 875  LYS C NZ    1 
ATOM   7899  N N     . THR E 4 76  ? 9.978   1.383   -50.031 1.00 31.06  ? 876  THR C N     1 
ATOM   7900  C CA    . THR E 4 76  ? 10.020  0.733   -48.785 1.00 31.06  ? 876  THR C CA    1 
ATOM   7901  C C     . THR E 4 76  ? 9.532   1.554   -47.707 1.00 31.06  ? 876  THR C C     1 
ATOM   7902  O O     . THR E 4 76  ? 9.036   1.029   -46.720 1.00 31.06  ? 876  THR C O     1 
ATOM   7903  C CB    . THR E 4 76  ? 11.419  0.288   -48.569 1.00 30.95  ? 876  THR C CB    1 
ATOM   7904  O OG1   . THR E 4 76  ? 11.385  -1.091  -48.865 1.00 30.95  ? 876  THR C OG1   1 
ATOM   7905  C CG2   . THR E 4 76  ? 12.013  0.536   -47.138 1.00 30.95  ? 876  THR C CG2   1 
ATOM   7906  N N     . ARG E 4 77  ? 9.664   2.856   -47.870 1.00 32.65  ? 877  ARG C N     1 
ATOM   7907  C CA    . ARG E 4 77  ? 9.183   3.716   -46.844 1.00 32.65  ? 877  ARG C CA    1 
ATOM   7908  C C     . ARG E 4 77  ? 8.002   4.484   -47.345 1.00 32.65  ? 877  ARG C C     1 
ATOM   7909  O O     . ARG E 4 77  ? 8.106   5.213   -48.394 1.00 32.65  ? 877  ARG C O     1 
ATOM   7910  C CB    . ARG E 4 77  ? 10.256  4.677   -46.472 1.00 37.58  ? 877  ARG C CB    1 
ATOM   7911  C CG    . ARG E 4 77  ? 9.882   5.416   -45.291 1.00 37.58  ? 877  ARG C CG    1 
ATOM   7912  C CD    . ARG E 4 77  ? 10.903  6.427   -44.959 1.00 37.58  ? 877  ARG C CD    1 
ATOM   7913  N NE    . ARG E 4 77  ? 12.256  5.901   -45.021 1.00 37.58  ? 877  ARG C NE    1 
ATOM   7914  C CZ    . ARG E 4 77  ? 13.216  6.499   -45.723 1.00 37.58  ? 877  ARG C CZ    1 
ATOM   7915  N NH1   . ARG E 4 77  ? 12.959  7.634   -46.384 1.00 37.58  ? 877  ARG C NH1   1 
ATOM   7916  N NH2   . ARG E 4 77  ? 14.414  5.933   -45.849 1.00 37.58  ? 877  ARG C NH2   1 
ATOM   7917  N N     . ILE E 4 78  ? 6.896   4.347   -46.616 1.00 29.95  ? 878  ILE C N     1 
ATOM   7918  C CA    . ILE E 4 78  ? 5.675   5.068   -46.942 1.00 29.95  ? 878  ILE C CA    1 
ATOM   7919  C C     . ILE E 4 78  ? 5.928   6.585   -46.732 1.00 29.95  ? 878  ILE C C     1 
ATOM   7920  O O     . ILE E 4 78  ? 6.549   7.010   -45.754 1.00 29.95  ? 878  ILE C O     1 
ATOM   7921  C CB    . ILE E 4 78  ? 4.582   4.753   -45.973 1.00 10.17  ? 878  ILE C CB    1 
ATOM   7922  C CG1   . ILE E 4 78  ? 4.199   3.289   -46.037 1.00 10.17  ? 878  ILE C CG1   1 
ATOM   7923  C CG2   . ILE E 4 78  ? 3.409   5.659   -46.244 1.00 10.17  ? 878  ILE C CG2   1 
ATOM   7924  C CD1   . ILE E 4 78  ? 3.373   2.803   -44.850 1.00 10.17  ? 878  ILE C CD1   1 
ATOM   7925  N N     . ILE E 4 79  ? 5.415   7.393   -47.648 1.00 20.06  ? 879  ILE C N     1 
ATOM   7926  C CA    . ILE E 4 79  ? 5.540   8.838   -47.577 1.00 20.06  ? 879  ILE C CA    1 
ATOM   7927  C C     . ILE E 4 79  ? 4.083   9.309   -47.828 1.00 20.06  ? 879  ILE C C     1 
ATOM   7928  O O     . ILE E 4 79  ? 3.241   8.538   -48.197 1.00 20.06  ? 879  ILE C O     1 
ATOM   7929  C CB    . ILE E 4 79  ? 6.541   9.337   -48.647 1.00 16.62  ? 879  ILE C CB    1 
ATOM   7930  C CG1   . ILE E 4 79  ? 5.916   9.156   -50.060 1.00 16.62  ? 879  ILE C CG1   1 
ATOM   7931  C CG2   . ILE E 4 79  ? 7.859   8.575   -48.490 1.00 16.62  ? 879  ILE C CG2   1 
ATOM   7932  C CD1   . ILE E 4 79  ? 6.693   9.716   -51.117 1.00 16.62  ? 879  ILE C CD1   1 
ATOM   7933  N N     . PRO E 4 80  ? 3.805   10.592  -47.669 1.00 21.29  ? 880  PRO C N     1 
ATOM   7934  C CA    . PRO E 4 80  ? 2.445   11.081  -47.864 1.00 21.29  ? 880  PRO C CA    1 
ATOM   7935  C C     . PRO E 4 80  ? 1.793   10.678  -49.141 1.00 21.29  ? 880  PRO C C     1 
ATOM   7936  O O     . PRO E 4 80  ? 0.645   10.267  -49.129 1.00 21.29  ? 880  PRO C O     1 
ATOM   7937  C CB    . PRO E 4 80  ? 2.613   12.562  -47.686 1.00 23.39  ? 880  PRO C CB    1 
ATOM   7938  C CG    . PRO E 4 80  ? 3.740   12.589  -46.649 1.00 23.39  ? 880  PRO C CG    1 
ATOM   7939  C CD    . PRO E 4 80  ? 4.712   11.668  -47.270 1.00 23.39  ? 880  PRO C CD    1 
ATOM   7940  N N     . ARG E 4 81  ? 2.508   10.753  -50.261 1.00 18.01  ? 881  ARG C N     1 
ATOM   7941  C CA    . ARG E 4 81  ? 1.924   10.340  -51.551 1.00 18.01  ? 881  ARG C CA    1 
ATOM   7942  C C     . ARG E 4 81  ? 1.261   8.969   -51.449 1.00 18.01  ? 881  ARG C C     1 
ATOM   7943  O O     . ARG E 4 81  ? 0.183   8.767   -52.010 1.00 18.01  ? 881  ARG C O     1 
ATOM   7944  C CB    . ARG E 4 81  ? 2.926   10.303  -52.701 1.00 21.70  ? 881  ARG C CB    1 
ATOM   7945  C CG    . ARG E 4 81  ? 2.350   9.447   -53.729 1.00 21.70  ? 881  ARG C CG    1 
ATOM   7946  C CD    . ARG E 4 81  ? 2.212   9.974   -55.159 1.00 21.70  ? 881  ARG C CD    1 
ATOM   7947  N NE    . ARG E 4 81  ? 1.131   10.913  -55.345 1.00 21.70  ? 881  ARG C NE    1 
ATOM   7948  C CZ    . ARG E 4 81  ? 0.355   11.014  -56.428 1.00 21.70  ? 881  ARG C CZ    1 
ATOM   7949  N NH1   . ARG E 4 81  ? 0.503   10.219  -57.481 1.00 21.70  ? 881  ARG C NH1   1 
ATOM   7950  N NH2   . ARG E 4 81  ? -0.581  11.961  -56.473 1.00 21.70  ? 881  ARG C NH2   1 
ATOM   7951  N N     . HIS E 4 82  ? 1.874   8.026   -50.728 1.00 34.70  ? 882  HIS C N     1 
ATOM   7952  C CA    . HIS E 4 82  ? 1.269   6.709   -50.582 1.00 34.70  ? 882  HIS C CA    1 
ATOM   7953  C C     . HIS E 4 82  ? 0.064   6.799   -49.738 1.00 34.70  ? 882  HIS C C     1 
ATOM   7954  O O     . HIS E 4 82  ? -0.846  6.052   -49.966 1.00 34.70  ? 882  HIS C O     1 
ATOM   7955  C CB    . HIS E 4 82  ? 2.182   5.689   -49.948 1.00 26.47  ? 882  HIS C CB    1 
ATOM   7956  C CG    . HIS E 4 82  ? 3.549   5.608   -50.568 1.00 26.47  ? 882  HIS C CG    1 
ATOM   7957  N ND1   . HIS E 4 82  ? 4.707   5.670   -49.816 1.00 26.47  ? 882  HIS C ND1   1 
ATOM   7958  C CD2   . HIS E 4 82  ? 3.941   5.600   -51.863 1.00 26.47  ? 882  HIS C CD2   1 
ATOM   7959  C CE1   . HIS E 4 82  ? 5.739   5.723   -50.635 1.00 26.47  ? 882  HIS C CE1   1 
ATOM   7960  N NE2   . HIS E 4 82  ? 5.300   5.682   -51.878 1.00 26.47  ? 882  HIS C NE2   1 
ATOM   7961  N N     . LEU E 4 83  ? 0.014   7.681   -48.754 1.00 24.54  ? 883  LEU C N     1 
ATOM   7962  C CA    . LEU E 4 83  ? -1.192  7.781   -47.938 1.00 24.54  ? 883  LEU C CA    1 
ATOM   7963  C C     . LEU E 4 83  ? -2.337  8.306   -48.796 1.00 24.54  ? 883  LEU C C     1 
ATOM   7964  O O     . LEU E 4 83  ? -3.459  7.822   -48.781 1.00 24.54  ? 883  LEU C O     1 
ATOM   7965  C CB    . LEU E 4 83  ? -0.961  8.703   -46.743 1.00 11.57  ? 883  LEU C CB    1 
ATOM   7966  C CG    . LEU E 4 83  ? 0.017   8.188   -45.650 1.00 11.57  ? 883  LEU C CG    1 
ATOM   7967  C CD1   . LEU E 4 83  ? 0.176   9.170   -44.478 1.00 11.57  ? 883  LEU C CD1   1 
ATOM   7968  C CD2   . LEU E 4 83  ? -0.434  6.867   -45.108 1.00 11.57  ? 883  LEU C CD2   1 
ATOM   7969  N N     . GLN E 4 84  ? -2.025  9.312   -49.571 1.00 24.71  ? 884  GLN C N     1 
ATOM   7970  C CA    . GLN E 4 84  ? -2.992  9.870   -50.455 1.00 24.71  ? 884  GLN C CA    1 
ATOM   7971  C C     . GLN E 4 84  ? -3.537  8.815   -51.456 1.00 24.71  ? 884  GLN C C     1 
ATOM   7972  O O     . GLN E 4 84  ? -4.758  8.687   -51.680 1.00 24.71  ? 884  GLN C O     1 
ATOM   7973  C CB    . GLN E 4 84  ? -2.331  10.994  -51.200 1.00 23.26  ? 884  GLN C CB    1 
ATOM   7974  C CG    . GLN E 4 84  ? -3.219  11.513  -52.314 1.00 23.26  ? 884  GLN C CG    1 
ATOM   7975  C CD    . GLN E 4 84  ? -4.302  12.502  -51.886 1.00 23.26  ? 884  GLN C CD    1 
ATOM   7976  O OE1   . GLN E 4 84  ? -4.986  12.391  -50.828 1.00 23.26  ? 884  GLN C OE1   1 
ATOM   7977  N NE2   . GLN E 4 84  ? -4.473  13.482  -52.736 1.00 23.26  ? 884  GLN C NE2   1 
ATOM   7978  N N     . LEU E 4 85  ? -2.615  8.064   -52.072 1.00 14.06  ? 885  LEU C N     1 
ATOM   7979  C CA    . LEU E 4 85  ? -2.995  7.041   -53.023 1.00 14.06  ? 885  LEU C CA    1 
ATOM   7980  C C     . LEU E 4 85  ? -3.925  6.095   -52.322 1.00 14.06  ? 885  LEU C C     1 
ATOM   7981  O O     . LEU E 4 85  ? -5.033  5.820   -52.766 1.00 14.06  ? 885  LEU C O     1 
ATOM   7982  C CB    . LEU E 4 85  ? -1.748  6.337   -53.511 1.00 22.11  ? 885  LEU C CB    1 
ATOM   7983  C CG    . LEU E 4 85  ? -0.906  7.281   -54.376 1.00 22.11  ? 885  LEU C CG    1 
ATOM   7984  C CD1   . LEU E 4 85  ? 0.335   6.627   -54.697 1.00 22.11  ? 885  LEU C CD1   1 
ATOM   7985  C CD2   . LEU E 4 85  ? -1.627  7.688   -55.642 1.00 22.11  ? 885  LEU C CD2   1 
ATOM   7986  N N     . ALA E 4 86  ? -3.466  5.613   -51.173 1.00 16.10  ? 886  ALA C N     1 
ATOM   7987  C CA    . ALA E 4 86  ? -4.303  4.741   -50.390 1.00 16.10  ? 886  ALA C CA    1 
ATOM   7988  C C     . ALA E 4 86  ? -5.711  5.311   -50.153 1.00 16.10  ? 886  ALA C C     1 
ATOM   7989  O O     . ALA E 4 86  ? -6.689  4.669   -50.406 1.00 16.10  ? 886  ALA C O     1 
ATOM   7990  C CB    . ALA E 4 86  ? -3.638  4.460   -49.101 1.00 56.15  ? 886  ALA C CB    1 
ATOM   7991  N N     . VAL E 4 87  ? -5.823  6.519   -49.654 1.00 19.75  ? 887  VAL C N     1 
ATOM   7992  C CA    . VAL E 4 87  ? -7.105  7.082   -49.397 1.00 19.75  ? 887  VAL C CA    1 
ATOM   7993  C C     . VAL E 4 87  ? -7.978  7.271   -50.692 1.00 19.75  ? 887  VAL C C     1 
ATOM   7994  O O     . VAL E 4 87  ? -9.009  6.706   -50.864 1.00 19.75  ? 887  VAL C O     1 
ATOM   7995  C CB    . VAL E 4 87  ? -6.741  8.369   -48.653 1.00 25.29  ? 887  VAL C CB    1 
ATOM   7996  C CG1   . VAL E 4 87  ? -7.842  9.325   -48.533 1.00 25.29  ? 887  VAL C CG1   1 
ATOM   7997  C CG2   . VAL E 4 87  ? -6.215  7.962   -47.309 1.00 25.29  ? 887  VAL C CG2   1 
ATOM   7998  N N     . ARG E 4 88  ? -7.496  8.030   -51.641 1.00 24.52  ? 888  ARG C N     1 
ATOM   7999  C CA    . ARG E 4 88  ? -8.274  8.319   -52.781 1.00 24.52  ? 888  ARG C CA    1 
ATOM   8000  C C     . ARG E 4 88  ? -8.567  7.153   -53.565 1.00 24.52  ? 888  ARG C C     1 
ATOM   8001  O O     . ARG E 4 88  ? -9.410  7.187   -54.361 1.00 24.52  ? 888  ARG C O     1 
ATOM   8002  C CB    . ARG E 4 88  ? -7.568  9.352   -53.659 1.00 13.95  ? 888  ARG C CB    1 
ATOM   8003  C CG    . ARG E 4 88  ? -7.297  10.700  -52.968 1.00 13.95  ? 888  ARG C CG    1 
ATOM   8004  C CD    . ARG E 4 88  ? -8.409  11.041  -52.032 1.00 13.95  ? 888  ARG C CD    1 
ATOM   8005  N NE    . ARG E 4 88  ? -7.998  11.915  -50.973 1.00 13.95  ? 888  ARG C NE    1 
ATOM   8006  C CZ    . ARG E 4 88  ? -8.822  12.398  -50.031 1.00 13.95  ? 888  ARG C CZ    1 
ATOM   8007  N NH1   . ARG E 4 88  ? -10.130 12.081  -49.998 1.00 13.95  ? 888  ARG C NH1   1 
ATOM   8008  N NH2   . ARG E 4 88  ? -8.348  13.263  -49.119 1.00 13.95  ? 888  ARG C NH2   1 
ATOM   8009  N N     . ASN E 4 89  ? -7.871  6.081   -53.399 1.00 24.42  ? 889  ASN C N     1 
ATOM   8010  C CA    . ASN E 4 89  ? -8.215  4.961   -54.243 1.00 24.42  ? 889  ASN C CA    1 
ATOM   8011  C C     . ASN E 4 89  ? -9.191  4.038   -53.635 1.00 24.42  ? 889  ASN C C     1 
ATOM   8012  O O     . ASN E 4 89  ? -9.541  3.078   -54.317 1.00 24.42  ? 889  ASN C O     1 
ATOM   8013  C CB    . ASN E 4 89  ? -7.030  4.121   -54.613 1.00 28.25  ? 889  ASN C CB    1 
ATOM   8014  C CG    . ASN E 4 89  ? -6.308  4.649   -55.840 1.00 28.25  ? 889  ASN C CG    1 
ATOM   8015  O OD1   . ASN E 4 89  ? -6.913  4.914   -56.855 1.00 28.25  ? 889  ASN C OD1   1 
ATOM   8016  N ND2   . ASN E 4 89  ? -5.007  4.793   -55.749 1.00 28.25  ? 889  ASN C ND2   1 
ATOM   8017  N N     . ASP E 4 90  ? -9.602  4.280   -52.374 1.00 39.48  ? 890  ASP C N     1 
ATOM   8018  C CA    . ASP E 4 90  ? -10.561 3.451   -51.684 1.00 39.48  ? 890  ASP C CA    1 
ATOM   8019  C C     . ASP E 4 90  ? -11.864 4.229   -51.447 1.00 39.48  ? 890  ASP C C     1 
ATOM   8020  O O     . ASP E 4 90  ? -11.900 5.245   -50.769 1.00 39.48  ? 890  ASP C O     1 
ATOM   8021  C CB    . ASP E 4 90  ? -9.971  2.944   -50.375 1.00 45.96  ? 890  ASP C CB    1 
ATOM   8022  C CG    . ASP E 4 90  ? -11.025 2.333   -49.470 1.00 45.96  ? 890  ASP C CG    1 
ATOM   8023  O OD1   . ASP E 4 90  ? -11.374 1.143   -49.579 1.00 45.96  ? 890  ASP C OD1   1 
ATOM   8024  O OD2   . ASP E 4 90  ? -11.562 3.076   -48.627 1.00 45.96  ? 890  ASP C OD2   1 
ATOM   8025  N N     . GLU E 4 91  ? -12.966 3.760   -52.013 1.00 26.35  ? 891  GLU C N     1 
ATOM   8026  C CA    . GLU E 4 91  ? -14.210 4.476   -51.802 1.00 26.35  ? 891  GLU C CA    1 
ATOM   8027  C C     . GLU E 4 91  ? -14.509 4.873   -50.419 1.00 26.35  ? 891  GLU C C     1 
ATOM   8028  O O     . GLU E 4 91  ? -14.887 6.010   -50.210 1.00 26.35  ? 891  GLU C O     1 
ATOM   8029  C CB    . GLU E 4 91  ? -15.368 3.709   -52.308 1.00 72.45  ? 891  GLU C CB    1 
ATOM   8030  C CG    . GLU E 4 91  ? -15.676 4.152   -53.620 1.00 72.45  ? 891  GLU C CG    1 
ATOM   8031  C CD    . GLU E 4 91  ? -16.623 3.248   -54.225 1.00 72.45  ? 891  GLU C CD    1 
ATOM   8032  O OE1   . GLU E 4 91  ? -17.558 2.863   -53.473 1.00 72.45  ? 891  GLU C OE1   1 
ATOM   8033  O OE2   . GLU E 4 91  ? -16.416 2.941   -55.434 1.00 72.45  ? 891  GLU C OE2   1 
ATOM   8034  N N     . GLU E 4 92  ? -14.373 3.971   -49.451 1.00 26.92  ? 892  GLU C N     1 
ATOM   8035  C CA    . GLU E 4 92  ? -14.735 4.401   -48.092 1.00 26.92  ? 892  GLU C CA    1 
ATOM   8036  C C     . GLU E 4 92  ? -13.766 5.452   -47.461 1.00 26.92  ? 892  GLU C C     1 
ATOM   8037  O O     . GLU E 4 92  ? -14.185 6.530   -46.964 1.00 26.92  ? 892  GLU C O     1 
ATOM   8038  C CB    . GLU E 4 92  ? -14.891 3.174   -47.196 1.00 45.06  ? 892  GLU C CB    1 
ATOM   8039  C CG    . GLU E 4 92  ? -15.596 2.082   -47.882 1.00 45.06  ? 892  GLU C CG    1 
ATOM   8040  C CD    . GLU E 4 92  ? -16.763 1.513   -47.095 1.00 45.06  ? 892  GLU C CD    1 
ATOM   8041  O OE1   . GLU E 4 92  ? -16.561 1.258   -45.909 1.00 45.06  ? 892  GLU C OE1   1 
ATOM   8042  O OE2   . GLU E 4 92  ? -17.879 1.286   -47.646 1.00 45.06  ? 892  GLU C OE2   1 
ATOM   8043  N N     . LEU E 4 93  ? -12.468 5.154   -47.490 1.00 17.57  ? 893  LEU C N     1 
ATOM   8044  C CA    . LEU E 4 93  ? -11.580 6.121   -46.904 1.00 17.57  ? 893  LEU C CA    1 
ATOM   8045  C C     . LEU E 4 93  ? -11.688 7.448   -47.645 1.00 17.57  ? 893  LEU C C     1 
ATOM   8046  O O     . LEU E 4 93  ? -11.606 8.569   -47.069 1.00 17.57  ? 893  LEU C O     1 
ATOM   8047  C CB    . LEU E 4 93  ? -10.143 5.628   -46.907 1.00 8.53   ? 893  LEU C CB    1 
ATOM   8048  C CG    . LEU E 4 93  ? -9.882  4.649   -45.754 1.00 8.53   ? 893  LEU C CG    1 
ATOM   8049  C CD1   . LEU E 4 93  ? -8.699  3.812   -46.132 1.00 8.53   ? 893  LEU C CD1   1 
ATOM   8050  C CD2   . LEU E 4 93  ? -9.550  5.272   -44.458 1.00 8.53   ? 893  LEU C CD2   1 
ATOM   8051  N N     . ASN E 4 94  ? -11.906 7.353   -48.939 1.00 24.27  ? 894  ASN C N     1 
ATOM   8052  C CA    . ASN E 4 94  ? -11.968 8.592   -49.648 1.00 24.27  ? 894  ASN C CA    1 
ATOM   8053  C C     . ASN E 4 94  ? -13.164 9.403   -49.230 1.00 24.27  ? 894  ASN C C     1 
ATOM   8054  O O     . ASN E 4 94  ? -13.100 10.615  -49.197 1.00 24.27  ? 894  ASN C O     1 
ATOM   8055  C CB    . ASN E 4 94  ? -11.926 8.355   -51.133 1.00 24.07  ? 894  ASN C CB    1 
ATOM   8056  C CG    . ASN E 4 94  ? -12.135 9.613   -51.882 1.00 24.07  ? 894  ASN C CG    1 
ATOM   8057  O OD1   . ASN E 4 94  ? -11.313 10.552  -51.849 1.00 24.07  ? 894  ASN C OD1   1 
ATOM   8058  N ND2   . ASN E 4 94  ? -13.267 9.677   -52.542 1.00 24.07  ? 894  ASN C ND2   1 
ATOM   8059  N N     . LYS E 4 95  ? -14.244 8.734   -48.882 1.00 27.30  ? 895  LYS C N     1 
ATOM   8060  C CA    . LYS E 4 95  ? -15.399 9.441   -48.423 1.00 27.30  ? 895  LYS C CA    1 
ATOM   8061  C C     . LYS E 4 95  ? -15.136 9.919   -46.955 1.00 27.30  ? 895  LYS C C     1 
ATOM   8062  O O     . LYS E 4 95  ? -15.313 11.066  -46.603 1.00 27.30  ? 895  LYS C O     1 
ATOM   8063  C CB    . LYS E 4 95  ? -16.552 8.487   -48.518 1.00 29.21  ? 895  LYS C CB    1 
ATOM   8064  C CG    . LYS E 4 95  ? -17.654 8.776   -47.650 1.00 29.21  ? 895  LYS C CG    1 
ATOM   8065  C CD    . LYS E 4 95  ? -18.350 10.032  -47.991 1.00 29.21  ? 895  LYS C CD    1 
ATOM   8066  C CE    . LYS E 4 95  ? -19.587 10.314  -47.004 1.00 29.21  ? 895  LYS C CE    1 
ATOM   8067  N NZ    . LYS E 4 95  ? -20.408 11.547  -47.456 1.00 29.21  ? 895  LYS C NZ    1 
ATOM   8068  N N     . LEU E 4 96  ? -14.617 9.046   -46.102 1.00 21.35  ? 896  LEU C N     1 
ATOM   8069  C CA    . LEU E 4 96  ? -14.423 9.411   -44.714 1.00 21.35  ? 896  LEU C CA    1 
ATOM   8070  C C     . LEU E 4 96  ? -13.554 10.544  -44.617 1.00 21.35  ? 896  LEU C C     1 
ATOM   8071  O O     . LEU E 4 96  ? -13.601 11.232  -43.617 1.00 21.35  ? 896  LEU C O     1 
ATOM   8072  C CB    . LEU E 4 96  ? -13.777 8.253   -43.962 1.00 11.08  ? 896  LEU C CB    1 
ATOM   8073  C CG    . LEU E 4 96  ? -13.262 8.452   -42.525 1.00 11.08  ? 896  LEU C CG    1 
ATOM   8074  C CD1   . LEU E 4 96  ? -14.341 9.051   -41.695 1.00 11.08  ? 896  LEU C CD1   1 
ATOM   8075  C CD2   . LEU E 4 96  ? -12.744 7.070   -41.925 1.00 11.08  ? 896  LEU C CD2   1 
ATOM   8076  N N     . LEU E 4 97  ? -12.711 10.674  -45.643 1.00 20.88  ? 897  LEU C N     1 
ATOM   8077  C CA    . LEU E 4 97  ? -11.668 11.700  -45.701 1.00 20.88  ? 897  LEU C CA    1 
ATOM   8078  C C     . LEU E 4 97  ? -11.852 12.739  -46.798 1.00 20.88  ? 897  LEU C C     1 
ATOM   8079  O O     . LEU E 4 97  ? -10.901 13.380  -47.267 1.00 20.88  ? 897  LEU C O     1 
ATOM   8080  C CB    . LEU E 4 97  ? -10.333 11.029  -45.862 1.00 12.58  ? 897  LEU C CB    1 
ATOM   8081  C CG    . LEU E 4 97  ? -9.708  10.373  -44.642 1.00 12.58  ? 897  LEU C CG    1 
ATOM   8082  C CD1   . LEU E 4 97  ? -8.314  10.074  -45.032 1.00 12.58  ? 897  LEU C CD1   1 
ATOM   8083  C CD2   . LEU E 4 97  ? -9.657  11.228  -43.446 1.00 12.58  ? 897  LEU C CD2   1 
ATOM   8084  N N     . GLY E 4 98  ? -13.118 12.914  -47.140 1.00 11.74  ? 898  GLY C N     1 
ATOM   8085  C CA    . GLY E 4 98  ? -13.468 13.751  -48.239 1.00 11.74  ? 898  GLY C CA    1 
ATOM   8086  C C     . GLY E 4 98  ? -13.257 15.218  -48.125 1.00 11.74  ? 898  GLY C C     1 
ATOM   8087  O O     . GLY E 4 98  ? -13.334 15.893  -49.101 1.00 11.74  ? 898  GLY C O     1 
ATOM   8088  N N     . ARG E 4 99  ? -13.036 15.733  -46.939 1.00 25.66  ? 899  ARG C N     1 
ATOM   8089  C CA    . ARG E 4 99  ? -12.822 17.113  -46.832 1.00 25.66  ? 899  ARG C CA    1 
ATOM   8090  C C     . ARG E 4 99  ? -11.480 17.219  -46.151 1.00 25.66  ? 899  ARG C C     1 
ATOM   8091  O O     . ARG E 4 99  ? -11.227 18.135  -45.393 1.00 25.66  ? 899  ARG C O     1 
ATOM   8092  C CB    . ARG E 4 99  ? -13.970 17.715  -46.091 1.00 75.05  ? 899  ARG C CB    1 
ATOM   8093  C CG    . ARG E 4 99  ? -15.123 17.666  -46.981 1.00 75.05  ? 899  ARG C CG    1 
ATOM   8094  C CD    . ARG E 4 99  ? -16.185 18.650  -46.595 1.00 75.05  ? 899  ARG C CD    1 
ATOM   8095  N NE    . ARG E 4 99  ? -17.380 18.471  -47.434 1.00 75.05  ? 899  ARG C NE    1 
ATOM   8096  C CZ    . ARG E 4 99  ? -18.557 19.093  -47.293 1.00 75.05  ? 899  ARG C CZ    1 
ATOM   8097  N NH1   . ARG E 4 99  ? -18.766 19.995  -46.321 1.00 75.05  ? 899  ARG C NH1   1 
ATOM   8098  N NH2   . ARG E 4 99  ? -19.536 18.771  -48.144 1.00 75.05  ? 899  ARG C NH2   1 
ATOM   8099  N N     . VAL E 4 100 ? -10.565 16.304  -46.421 1.00 19.35  ? 900  VAL C N     1 
ATOM   8100  C CA    . VAL E 4 100 ? -9.337  16.422  -45.692 1.00 19.35  ? 900  VAL C CA    1 
ATOM   8101  C C     . VAL E 4 100 ? -8.228  16.589  -46.627 1.00 19.35  ? 900  VAL C C     1 
ATOM   8102  O O     . VAL E 4 100 ? -8.279  15.978  -47.661 1.00 19.35  ? 900  VAL C O     1 
ATOM   8103  C CB    . VAL E 4 100 ? -9.095  15.189  -44.860 1.00 29.84  ? 900  VAL C CB    1 
ATOM   8104  C CG1   . VAL E 4 100 ? -7.663  15.130  -44.304 1.00 29.84  ? 900  VAL C CG1   1 
ATOM   8105  C CG2   . VAL E 4 100 ? -10.035 15.214  -43.740 1.00 29.84  ? 900  VAL C CG2   1 
ATOM   8106  N N     . THR E 4 101 ? -7.235  17.421  -46.310 1.00 22.30  ? 901  THR C N     1 
ATOM   8107  C CA    . THR E 4 101 ? -6.100  17.554  -47.213 1.00 22.30  ? 901  THR C CA    1 
ATOM   8108  C C     . THR E 4 101 ? -4.888  16.952  -46.605 1.00 22.30  ? 901  THR C C     1 
ATOM   8109  O O     . THR E 4 101 ? -4.557  17.336  -45.513 1.00 22.30  ? 901  THR C O     1 
ATOM   8110  C CB    . THR E 4 101 ? -5.814  18.982  -47.521 1.00 30.90  ? 901  THR C CB    1 
ATOM   8111  O OG1   . THR E 4 101 ? -7.021  19.583  -48.026 1.00 30.90  ? 901  THR C OG1   1 
ATOM   8112  C CG2   . THR E 4 101 ? -4.706  19.086  -48.543 1.00 30.90  ? 901  THR C CG2   1 
ATOM   8113  N N     . ILE E 4 102 ? -4.260  16.008  -47.308 1.00 19.46  ? 902  ILE C N     1 
ATOM   8114  C CA    . ILE E 4 102 ? -3.068  15.304  -46.855 1.00 19.46  ? 902  ILE C CA    1 
ATOM   8115  C C     . ILE E 4 102 ? -1.966  16.051  -47.606 1.00 19.46  ? 902  ILE C C     1 
ATOM   8116  O O     . ILE E 4 102 ? -1.802  15.914  -48.816 1.00 19.46  ? 902  ILE C O     1 
ATOM   8117  C CB    . ILE E 4 102 ? -3.086  13.799  -47.324 1.00 8.69   ? 902  ILE C CB    1 
ATOM   8118  C CG1   . ILE E 4 102 ? -4.190  13.002  -46.601 1.00 8.69   ? 902  ILE C CG1   1 
ATOM   8119  C CG2   . ILE E 4 102 ? -1.734  13.171  -47.206 1.00 8.69   ? 902  ILE C CG2   1 
ATOM   8120  C CD1   . ILE E 4 102 ? -4.533  11.792  -47.316 1.00 8.69   ? 902  ILE C CD1   1 
ATOM   8121  N N     . ALA E 4 103 ? -1.258  16.891  -46.860 1.00 19.34  ? 903  ALA C N     1 
ATOM   8122  C CA    . ALA E 4 103 ? -0.197  17.706  -47.348 1.00 19.34  ? 903  ALA C CA    1 
ATOM   8123  C C     . ALA E 4 103 ? 0.692   16.807  -48.169 1.00 19.34  ? 903  ALA C C     1 
ATOM   8124  O O     . ALA E 4 103 ? 0.617   15.614  -48.022 1.00 19.34  ? 903  ALA C O     1 
ATOM   8125  C CB    . ALA E 4 103 ? 0.508   18.216  -46.223 1.00 18.03  ? 903  ALA C CB    1 
ATOM   8126  N N     . GLN E 4 104 ? 1.516   17.373  -49.049 1.00 21.56  ? 904  GLN C N     1 
ATOM   8127  C CA    . GLN E 4 104 ? 2.418   16.590  -49.867 1.00 21.56  ? 904  GLN C CA    1 
ATOM   8128  C C     . GLN E 4 104 ? 1.870   15.290  -50.547 1.00 21.56  ? 904  GLN C C     1 
ATOM   8129  O O     . GLN E 4 104 ? 2.613   14.385  -50.900 1.00 21.56  ? 904  GLN C O     1 
ATOM   8130  C CB    . GLN E 4 104 ? 3.685   16.337  -49.041 1.00 36.81  ? 904  GLN C CB    1 
ATOM   8131  C CG    . GLN E 4 104 ? 4.660   17.524  -49.117 1.00 36.81  ? 904  GLN C CG    1 
ATOM   8132  C CD    . GLN E 4 104 ? 4.873   18.023  -50.590 1.00 36.81  ? 904  GLN C CD    1 
ATOM   8133  O OE1   . GLN E 4 104 ? 5.590   17.371  -51.471 1.00 36.81  ? 904  GLN C OE1   1 
ATOM   8134  N NE2   . GLN E 4 104 ? 4.227   19.175  -50.883 1.00 36.81  ? 904  GLN C NE2   1 
ATOM   8135  N N     . GLY E 4 105 ? 0.574   15.247  -50.799 1.00 19.71  ? 905  GLY C N     1 
ATOM   8136  C CA    . GLY E 4 105 ? 0.008   14.081  -51.415 1.00 19.71  ? 905  GLY C CA    1 
ATOM   8137  C C     . GLY E 4 105 ? -0.221  14.033  -52.922 1.00 19.71  ? 905  GLY C C     1 
ATOM   8138  O O     . GLY E 4 105 ? -0.372  12.902  -53.465 1.00 19.71  ? 905  GLY C O     1 
ATOM   8139  N N     . GLY E 4 106 ? -0.277  15.180  -53.619 1.00 13.61  ? 906  GLY C N     1 
ATOM   8140  C CA    . GLY E 4 106 ? -0.470  15.098  -55.048 1.00 13.61  ? 906  GLY C CA    1 
ATOM   8141  C C     . GLY E 4 106 ? -1.913  14.812  -55.302 1.00 13.61  ? 906  GLY C C     1 
ATOM   8142  O O     . GLY E 4 106 ? -2.757  15.053  -54.426 1.00 13.61  ? 906  GLY C O     1 
ATOM   8143  N N     . VAL E 4 107 ? -2.217  14.250  -56.460 1.00 23.76  ? 907  VAL C N     1 
ATOM   8144  C CA    . VAL E 4 107 ? -3.591  13.979  -56.827 1.00 23.76  ? 907  VAL C CA    1 
ATOM   8145  C C     . VAL E 4 107 ? -3.573  12.682  -57.523 1.00 23.76  ? 907  VAL C C     1 
ATOM   8146  O O     . VAL E 4 107 ? -2.532  12.248  -57.896 1.00 23.76  ? 907  VAL C O     1 
ATOM   8147  C CB    . VAL E 4 107 ? -4.127  15.059  -57.851 1.00 24.71  ? 907  VAL C CB    1 
ATOM   8148  C CG1   . VAL E 4 107 ? -4.231  16.453  -57.192 1.00 24.71  ? 907  VAL C CG1   1 
ATOM   8149  C CG2   . VAL E 4 107 ? -3.279  15.083  -59.125 1.00 24.71  ? 907  VAL C CG2   1 
ATOM   8150  N N     . LEU E 4 108 ? -4.697  12.027  -57.705 1.00 18.78  ? 908  LEU C N     1 
ATOM   8151  C CA    . LEU E 4 108 ? -4.651  10.766  -58.491 1.00 18.78  ? 908  LEU C CA    1 
ATOM   8152  C C     . LEU E 4 108 ? -4.442  11.065  -60.016 1.00 18.78  ? 908  LEU C C     1 
ATOM   8153  O O     . LEU E 4 108 ? -5.000  12.047  -60.552 1.00 18.78  ? 908  LEU C O     1 
ATOM   8154  C CB    . LEU E 4 108 ? -5.973  10.072  -58.368 1.00 17.71  ? 908  LEU C CB    1 
ATOM   8155  C CG    . LEU E 4 108 ? -6.330  9.396   -57.095 1.00 17.71  ? 908  LEU C CG    1 
ATOM   8156  C CD1   . LEU E 4 108 ? -7.455  8.467   -57.227 1.00 17.71  ? 908  LEU C CD1   1 
ATOM   8157  C CD2   . LEU E 4 108 ? -5.087  8.574   -56.688 1.00 17.71  ? 908  LEU C CD2   1 
ATOM   8158  N N     . PRO E 4 109 ? -3.595  10.301  -60.732 1.00 25.28  ? 909  PRO C N     1 
ATOM   8159  C CA    . PRO E 4 109 ? -3.452  10.607  -62.168 1.00 25.28  ? 909  PRO C CA    1 
ATOM   8160  C C     . PRO E 4 109 ? -4.826  10.424  -62.768 1.00 25.28  ? 909  PRO C C     1 
ATOM   8161  O O     . PRO E 4 109 ? -5.465  9.441   -62.467 1.00 25.28  ? 909  PRO C O     1 
ATOM   8162  C CB    . PRO E 4 109 ? -2.471  9.559   -62.619 1.00 27.25  ? 909  PRO C CB    1 
ATOM   8163  C CG    . PRO E 4 109 ? -1.503  9.626   -61.609 1.00 27.25  ? 909  PRO C CG    1 
ATOM   8164  C CD    . PRO E 4 109 ? -2.303  9.778   -60.262 1.00 27.25  ? 909  PRO C CD    1 
ATOM   8165  N N     . ASN E 4 110 ? -5.307  11.368  -63.557 1.00 26.04  ? 910  ASN C N     1 
ATOM   8166  C CA    . ASN E 4 110 ? -6.636  11.263  -64.127 1.00 26.04  ? 910  ASN C CA    1 
ATOM   8167  C C     . ASN E 4 110 ? -6.828  12.403  -65.128 1.00 26.04  ? 910  ASN C C     1 
ATOM   8168  O O     . ASN E 4 110 ? -6.812  13.572  -64.738 1.00 26.04  ? 910  ASN C O     1 
ATOM   8169  C CB    . ASN E 4 110 ? -7.696  11.401  -63.039 1.00 42.84  ? 910  ASN C CB    1 
ATOM   8170  C CG    . ASN E 4 110 ? -9.133  11.296  -63.586 1.00 42.84  ? 910  ASN C CG    1 
ATOM   8171  O OD1   . ASN E 4 110 ? -9.354  11.161  -64.801 1.00 42.84  ? 910  ASN C OD1   1 
ATOM   8172  N ND2   . ASN E 4 110 ? -10.107 11.364  -62.692 1.00 42.84  ? 910  ASN C ND2   1 
ATOM   8173  N N     . ILE E 4 111 ? -7.064  12.065  -66.394 1.00 32.03  ? 911  ILE C N     1 
ATOM   8174  C CA    . ILE E 4 111 ? -7.205  13.040  -67.448 1.00 32.03  ? 911  ILE C CA    1 
ATOM   8175  C C     . ILE E 4 111 ? -8.509  12.797  -68.167 1.00 32.03  ? 911  ILE C C     1 
ATOM   8176  O O     . ILE E 4 111 ? -8.771  11.678  -68.608 1.00 32.03  ? 911  ILE C O     1 
ATOM   8177  C CB    . ILE E 4 111 ? -6.147  12.836  -68.526 1.00 13.58  ? 911  ILE C CB    1 
ATOM   8178  C CG1   . ILE E 4 111 ? -4.743  12.833  -67.951 1.00 13.58  ? 911  ILE C CG1   1 
ATOM   8179  C CG2   . ILE E 4 111 ? -6.368  13.838  -69.606 1.00 13.58  ? 911  ILE C CG2   1 
ATOM   8180  C CD1   . ILE E 4 111 ? -3.708  12.809  -68.972 1.00 13.58  ? 911  ILE C CD1   1 
ATOM   8181  N N     . GLN E 4 112 ? -9.318  13.829  -68.367 1.00 31.11  ? 912  GLN C N     1 
ATOM   8182  C CA    . GLN E 4 112 ? -10.585 13.632  -69.065 1.00 31.11  ? 912  GLN C CA    1 
ATOM   8183  C C     . GLN E 4 112 ? -10.328 13.234  -70.478 1.00 31.11  ? 912  GLN C C     1 
ATOM   8184  O O     . GLN E 4 112 ? -9.431  13.783  -71.093 1.00 31.11  ? 912  GLN C O     1 
ATOM   8185  C CB    . GLN E 4 112 ? -11.330 14.920  -69.104 1.00 34.19  ? 912  GLN C CB    1 
ATOM   8186  C CG    . GLN E 4 112 ? -11.560 15.478  -67.819 1.00 34.19  ? 912  GLN C CG    1 
ATOM   8187  C CD    . GLN E 4 112 ? -12.399 14.597  -66.997 1.00 34.19  ? 912  GLN C CD    1 
ATOM   8188  O OE1   . GLN E 4 112 ? -13.556 14.406  -67.285 1.00 34.19  ? 912  GLN C OE1   1 
ATOM   8189  N NE2   . GLN E 4 112 ? -11.827 14.053  -65.945 1.00 34.19  ? 912  GLN C NE2   1 
ATOM   8190  N N     . SER E 4 113 ? -11.159 12.319  -70.985 1.00 30.19  ? 913  SER C N     1 
ATOM   8191  C CA    . SER E 4 113 ? -11.169 11.785  -72.375 1.00 30.19  ? 913  SER C CA    1 
ATOM   8192  C C     . SER E 4 113 ? -11.200 12.758  -73.520 1.00 30.19  ? 913  SER C C     1 
ATOM   8193  O O     . SER E 4 113 ? -10.348 12.709  -74.381 1.00 30.19  ? 913  SER C O     1 
ATOM   8194  C CB    . SER E 4 113 ? -12.344 10.886  -72.546 1.00 28.11  ? 913  SER C CB    1 
ATOM   8195  O OG    . SER E 4 113 ? -11.952 9.679   -71.997 1.00 28.11  ? 913  SER C OG    1 
ATOM   8196  N N     . VAL E 4 114 ? -12.185 13.627  -73.567 1.00 35.49  ? 914  VAL C N     1 
ATOM   8197  C CA    . VAL E 4 114 ? -12.240 14.621  -74.636 1.00 35.49  ? 914  VAL C CA    1 
ATOM   8198  C C     . VAL E 4 114 ? -10.860 15.250  -74.920 1.00 35.49  ? 914  VAL C C     1 
ATOM   8199  O O     . VAL E 4 114 ? -10.560 15.668  -76.014 1.00 35.49  ? 914  VAL C O     1 
ATOM   8200  C CB    . VAL E 4 114 ? -13.196 15.696  -74.199 1.00 35.78  ? 914  VAL C CB    1 
ATOM   8201  C CG1   . VAL E 4 114 ? -14.081 15.082  -73.130 1.00 35.78  ? 914  VAL C CG1   1 
ATOM   8202  C CG2   . VAL E 4 114 ? -12.476 16.845  -73.523 1.00 35.78  ? 914  VAL C CG2   1 
ATOM   8203  N N     . LEU E 4 115 ? -10.028 15.314  -73.893 1.00 15.19  ? 915  LEU C N     1 
ATOM   8204  C CA    . LEU E 4 115 ? -8.699  15.878  -73.932 1.00 15.19  ? 915  LEU C CA    1 
ATOM   8205  C C     . LEU E 4 115 ? -7.597  15.093  -74.615 1.00 15.19  ? 915  LEU C C     1 
ATOM   8206  O O     . LEU E 4 115 ? -6.555  15.728  -74.937 1.00 15.19  ? 915  LEU C O     1 
ATOM   8207  C CB    . LEU E 4 115 ? -8.232  16.188  -72.489 1.00 20.03  ? 915  LEU C CB    1 
ATOM   8208  C CG    . LEU E 4 115 ? -9.120  17.112  -71.669 1.00 20.03  ? 915  LEU C CG    1 
ATOM   8209  C CD1   . LEU E 4 115 ? -8.399  17.525  -70.469 1.00 20.03  ? 915  LEU C CD1   1 
ATOM   8210  C CD2   . LEU E 4 115 ? -9.509  18.348  -72.525 1.00 20.03  ? 915  LEU C CD2   1 
ATOM   8211  N N     . LEU E 4 116 ? -7.766  13.771  -74.815 1.00 24.21  ? 916  LEU C N     1 
ATOM   8212  C CA    . LEU E 4 116 ? -6.707  12.996  -75.483 1.00 24.21  ? 916  LEU C CA    1 
ATOM   8213  C C     . LEU E 4 116 ? -6.649  13.179  -77.002 1.00 24.21  ? 916  LEU C C     1 
ATOM   8214  O O     . LEU E 4 116 ? -7.616  13.657  -77.616 1.00 24.21  ? 916  LEU C O     1 
ATOM   8215  C CB    . LEU E 4 116 ? -6.816  11.539  -75.172 1.00 34.19  ? 916  LEU C CB    1 
ATOM   8216  C CG    . LEU E 4 116 ? -6.901  11.287  -73.685 1.00 34.19  ? 916  LEU C CG    1 
ATOM   8217  C CD1   . LEU E 4 116 ? -7.578  9.984   -73.571 1.00 34.19  ? 916  LEU C CD1   1 
ATOM   8218  C CD2   . LEU E 4 116 ? -5.549  11.287  -72.913 1.00 34.19  ? 916  LEU C CD2   1 
ATOM   8219  N N     . PRO E 4 117 ? -5.514  12.826  -77.643 1.00 58.10  ? 917  PRO C N     1 
ATOM   8220  C CA    . PRO E 4 117 ? -5.276  12.932  -79.082 1.00 58.10  ? 917  PRO C CA    1 
ATOM   8221  C C     . PRO E 4 117 ? -6.461  12.317  -79.785 1.00 58.10  ? 917  PRO C C     1 
ATOM   8222  O O     . PRO E 4 117 ? -7.242  11.666  -79.110 1.00 58.10  ? 917  PRO C O     1 
ATOM   8223  C CB    . PRO E 4 117 ? -4.030  12.120  -79.247 1.00 71.34  ? 917  PRO C CB    1 
ATOM   8224  C CG    . PRO E 4 117 ? -3.329  12.424  -78.059 1.00 71.34  ? 917  PRO C CG    1 
ATOM   8225  C CD    . PRO E 4 117 ? -4.354  12.194  -77.015 1.00 71.34  ? 917  PRO C CD    1 
ATOM   8226  N N     . LYS E 4 118 ? -6.598  12.464  -81.112 1.00 116.62 ? 918  LYS C N     1 
ATOM   8227  C CA    . LYS E 4 118 ? -7.785  11.930  -81.793 1.00 116.62 ? 918  LYS C CA    1 
ATOM   8228  C C     . LYS E 4 118 ? -7.754  10.680  -82.659 1.00 116.62 ? 918  LYS C C     1 
ATOM   8229  O O     . LYS E 4 118 ? -6.782  10.447  -83.425 1.00 116.62 ? 918  LYS C O     1 
ATOM   8230  C CB    . LYS E 4 118 ? -8.469  13.038  -82.592 1.00 114.51 ? 918  LYS C CB    1 
ATOM   8231  C CG    . LYS E 4 118 ? -9.914  13.315  -82.141 1.00 114.51 ? 918  LYS C CG    1 
ATOM   8232  C CD    . LYS E 4 118 ? -9.948  14.170  -80.894 1.00 114.51 ? 918  LYS C CD    1 
ATOM   8233  C CE    . LYS E 4 118 ? -11.353 14.353  -80.344 1.00 114.51 ? 918  LYS C CE    1 
ATOM   8234  N NZ    . LYS E 4 118 ? -11.397 14.968  -78.971 1.00 114.51 ? 918  LYS C NZ    1 
ATOM   8235  N N     . GLU F 5 35  ? 3.334   14.695  -26.675 1.00 52.33  ? 1232 GLU D N     1 
ATOM   8236  C CA    . GLU F 5 35  ? 2.501   13.413  -26.819 1.00 52.33  ? 1232 GLU D CA    1 
ATOM   8237  C C     . GLU F 5 35  ? 2.004   13.005  -28.226 1.00 52.33  ? 1232 GLU D C     1 
ATOM   8238  O O     . GLU F 5 35  ? 1.598   13.884  -28.966 1.00 52.33  ? 1232 GLU D O     1 
ATOM   8239  C CB    . GLU F 5 35  ? 1.274   13.455  -25.954 1.00 68.14  ? 1232 GLU D CB    1 
ATOM   8240  C CG    . GLU F 5 35  ? 1.450   12.605  -24.764 1.00 68.14  ? 1232 GLU D CG    1 
ATOM   8241  C CD    . GLU F 5 35  ? 0.138   12.271  -24.118 1.00 68.14  ? 1232 GLU D CD    1 
ATOM   8242  O OE1   . GLU F 5 35  ? -0.924  12.798  -24.596 1.00 68.14  ? 1232 GLU D OE1   1 
ATOM   8243  O OE2   . GLU F 5 35  ? 0.186   11.488  -23.126 1.00 68.14  ? 1232 GLU D OE2   1 
ATOM   8244  N N     . SER F 5 36  ? 1.924   11.700  -28.592 1.00 29.49  ? 1233 SER D N     1 
ATOM   8245  C CA    . SER F 5 36  ? 1.539   11.337  -29.998 1.00 29.49  ? 1233 SER D CA    1 
ATOM   8246  C C     . SER F 5 36  ? 1.132   9.879   -30.201 1.00 29.49  ? 1233 SER D C     1 
ATOM   8247  O O     . SER F 5 36  ? 1.311   9.124   -29.347 1.00 29.49  ? 1233 SER D O     1 
ATOM   8248  C CB    . SER F 5 36  ? 2.743   11.659  -30.870 1.00 33.03  ? 1233 SER D CB    1 
ATOM   8249  O OG    . SER F 5 36  ? 2.717   10.889  -32.003 1.00 33.03  ? 1233 SER D OG    1 
ATOM   8250  N N     . TYR F 5 37  ? 0.567   9.466   -31.315 1.00 23.12  ? 1234 TYR D N     1 
ATOM   8251  C CA    . TYR F 5 37  ? 0.218   8.051   -31.480 1.00 23.12  ? 1234 TYR D CA    1 
ATOM   8252  C C     . TYR F 5 37  ? 1.305   7.284   -32.218 1.00 23.12  ? 1234 TYR D C     1 
ATOM   8253  O O     . TYR F 5 37  ? 1.200   6.046   -32.422 1.00 23.12  ? 1234 TYR D O     1 
ATOM   8254  C CB    . TYR F 5 37  ? -1.025  7.898   -32.275 1.00 19.77  ? 1234 TYR D CB    1 
ATOM   8255  C CG    . TYR F 5 37  ? -2.180  8.428   -31.550 1.00 19.77  ? 1234 TYR D CG    1 
ATOM   8256  C CD1   . TYR F 5 37  ? -2.574  9.705   -31.718 1.00 19.77  ? 1234 TYR D CD1   1 
ATOM   8257  C CD2   . TYR F 5 37  ? -2.894  7.641   -30.632 1.00 19.77  ? 1234 TYR D CD2   1 
ATOM   8258  C CE1   . TYR F 5 37  ? -3.649  10.210  -30.991 1.00 19.77  ? 1234 TYR D CE1   1 
ATOM   8259  C CE2   . TYR F 5 37  ? -3.984  8.120   -29.898 1.00 19.77  ? 1234 TYR D CE2   1 
ATOM   8260  C CZ    . TYR F 5 37  ? -4.347  9.407   -30.094 1.00 19.77  ? 1234 TYR D CZ    1 
ATOM   8261  O OH    . TYR F 5 37  ? -5.469  9.950   -29.481 1.00 19.77  ? 1234 TYR D OH    1 
ATOM   8262  N N     . ALA F 5 38  ? 2.371   7.999   -32.589 1.00 25.62  ? 1235 ALA D N     1 
ATOM   8263  C CA    . ALA F 5 38  ? 3.438   7.391   -33.382 1.00 25.62  ? 1235 ALA D CA    1 
ATOM   8264  C C     . ALA F 5 38  ? 3.993   5.963   -33.044 1.00 25.62  ? 1235 ALA D C     1 
ATOM   8265  O O     . ALA F 5 38  ? 4.148   5.110   -33.940 1.00 25.62  ? 1235 ALA D O     1 
ATOM   8266  C CB    . ALA F 5 38  ? 4.566   8.374   -33.570 1.00 15.49  ? 1235 ALA D CB    1 
ATOM   8267  N N     . ILE F 5 39  ? 4.239   5.660   -31.788 1.00 35.17  ? 1236 ILE D N     1 
ATOM   8268  C CA    . ILE F 5 39  ? 4.762   4.351   -31.523 1.00 35.17  ? 1236 ILE D CA    1 
ATOM   8269  C C     . ILE F 5 39  ? 3.630   3.374   -31.776 1.00 35.17  ? 1236 ILE D C     1 
ATOM   8270  O O     . ILE F 5 39  ? 3.863   2.246   -32.237 1.00 35.17  ? 1236 ILE D O     1 
ATOM   8271  C CB    . ILE F 5 39  ? 5.258   4.262   -30.076 1.00 32.89  ? 1236 ILE D CB    1 
ATOM   8272  C CG1   . ILE F 5 39  ? 4.073   4.316   -29.118 1.00 32.89  ? 1236 ILE D CG1   1 
ATOM   8273  C CG2   . ILE F 5 39  ? 6.296   5.369   -29.791 1.00 32.89  ? 1236 ILE D CG2   1 
ATOM   8274  C CD1   . ILE F 5 39  ? 4.479   4.457   -27.789 1.00 32.89  ? 1236 ILE D CD1   1 
ATOM   8275  N N     . TYR F 5 40  ? 2.400   3.808   -31.511 1.00 24.49  ? 1237 TYR D N     1 
ATOM   8276  C CA    . TYR F 5 40  ? 1.319   2.888   -31.733 1.00 24.49  ? 1237 TYR D CA    1 
ATOM   8277  C C     . TYR F 5 40  ? 1.109   2.688   -33.197 1.00 24.49  ? 1237 TYR D C     1 
ATOM   8278  O O     . TYR F 5 40  ? 0.924   1.569   -33.633 1.00 24.49  ? 1237 TYR D O     1 
ATOM   8279  C CB    . TYR F 5 40  ? 0.024   3.360   -31.092 1.00 24.59  ? 1237 TYR D CB    1 
ATOM   8280  C CG    . TYR F 5 40  ? 0.165   3.654   -29.613 1.00 24.59  ? 1237 TYR D CG    1 
ATOM   8281  C CD1   . TYR F 5 40  ? 0.535   4.956   -29.178 1.00 24.59  ? 1237 TYR D CD1   1 
ATOM   8282  C CD2   . TYR F 5 40  ? 0.098   2.625   -28.676 1.00 24.59  ? 1237 TYR D CD2   1 
ATOM   8283  C CE1   . TYR F 5 40  ? 0.856   5.229   -27.817 1.00 24.59  ? 1237 TYR D CE1   1 
ATOM   8284  C CE2   . TYR F 5 40  ? 0.428   2.846   -27.369 1.00 24.59  ? 1237 TYR D CE2   1 
ATOM   8285  C CZ    . TYR F 5 40  ? 0.829   4.154   -26.907 1.00 24.59  ? 1237 TYR D CZ    1 
ATOM   8286  O OH    . TYR F 5 40  ? 1.348   4.350   -25.593 1.00 24.59  ? 1237 TYR D OH    1 
ATOM   8287  N N     . VAL F 5 41  ? 1.117   3.754   -33.986 1.00 28.78  ? 1238 VAL D N     1 
ATOM   8288  C CA    . VAL F 5 41  ? 0.975   3.582   -35.437 1.00 28.78  ? 1238 VAL D CA    1 
ATOM   8289  C C     . VAL F 5 41  ? 2.031   2.621   -35.894 1.00 28.78  ? 1238 VAL D C     1 
ATOM   8290  O O     . VAL F 5 41  ? 1.781   1.687   -36.620 1.00 28.78  ? 1238 VAL D O     1 
ATOM   8291  C CB    . VAL F 5 41  ? 1.173   4.901   -36.137 1.00 15.94  ? 1238 VAL D CB    1 
ATOM   8292  C CG1   . VAL F 5 41  ? 1.550   4.722   -37.608 1.00 15.94  ? 1238 VAL D CG1   1 
ATOM   8293  C CG2   . VAL F 5 41  ? -0.115  5.653   -35.998 1.00 15.94  ? 1238 VAL D CG2   1 
ATOM   8294  N N     . TYR F 5 42  ? 3.228   2.865   -35.420 1.00 26.13  ? 1239 TYR D N     1 
ATOM   8295  C CA    . TYR F 5 42  ? 4.345   2.038   -35.759 1.00 26.13  ? 1239 TYR D CA    1 
ATOM   8296  C C     . TYR F 5 42  ? 4.141   0.530   -35.419 1.00 26.13  ? 1239 TYR D C     1 
ATOM   8297  O O     . TYR F 5 42  ? 4.488   -0.363  -36.262 1.00 26.13  ? 1239 TYR D O     1 
ATOM   8298  C CB    . TYR F 5 42  ? 5.553   2.607   -35.083 1.00 47.47  ? 1239 TYR D CB    1 
ATOM   8299  C CG    . TYR F 5 42  ? 6.765   2.217   -35.770 1.00 47.47  ? 1239 TYR D CG    1 
ATOM   8300  C CD1   . TYR F 5 42  ? 7.177   2.882   -36.874 1.00 47.47  ? 1239 TYR D CD1   1 
ATOM   8301  C CD2   . TYR F 5 42  ? 7.406   1.047   -35.417 1.00 47.47  ? 1239 TYR D CD2   1 
ATOM   8302  C CE1   . TYR F 5 42  ? 8.221   2.389   -37.692 1.00 47.47  ? 1239 TYR D CE1   1 
ATOM   8303  C CE2   . TYR F 5 42  ? 8.471   0.500   -36.196 1.00 47.47  ? 1239 TYR D CE2   1 
ATOM   8304  C CZ    . TYR F 5 42  ? 8.872   1.173   -37.367 1.00 47.47  ? 1239 TYR D CZ    1 
ATOM   8305  O OH    . TYR F 5 42  ? 9.806   0.558   -38.226 1.00 47.47  ? 1239 TYR D OH    1 
ATOM   8306  N N     . LYS F 5 43  ? 3.576   0.201   -34.248 1.00 25.66  ? 1240 LYS D N     1 
ATOM   8307  C CA    . LYS F 5 43  ? 3.383   -1.219  -34.004 1.00 25.66  ? 1240 LYS D CA    1 
ATOM   8308  C C     . LYS F 5 43  ? 2.461   -1.759  -35.095 1.00 25.66  ? 1240 LYS D C     1 
ATOM   8309  O O     . LYS F 5 43  ? 2.799   -2.681  -35.874 1.00 25.66  ? 1240 LYS D O     1 
ATOM   8310  C CB    . LYS F 5 43  ? 2.779   -1.484  -32.653 1.00 37.08  ? 1240 LYS D CB    1 
ATOM   8311  C CG    . LYS F 5 43  ? 3.621   -1.064  -31.533 1.00 37.08  ? 1240 LYS D CG    1 
ATOM   8312  C CD    . LYS F 5 43  ? 2.935   -1.272  -30.195 1.00 37.08  ? 1240 LYS D CD    1 
ATOM   8313  C CE    . LYS F 5 43  ? 3.728   -0.696  -28.969 1.00 37.08  ? 1240 LYS D CE    1 
ATOM   8314  N NZ    . LYS F 5 43  ? 2.969   -0.747  -27.580 1.00 37.08  ? 1240 LYS D NZ    1 
ATOM   8315  N N     . VAL F 5 44  ? 1.308   -1.123  -35.188 1.00 40.78  ? 1241 VAL D N     1 
ATOM   8316  C CA    . VAL F 5 44  ? 0.315   -1.535  -36.141 1.00 40.78  ? 1241 VAL D CA    1 
ATOM   8317  C C     . VAL F 5 44  ? 0.929   -1.652  -37.514 1.00 40.78  ? 1241 VAL D C     1 
ATOM   8318  O O     . VAL F 5 44  ? 0.680   -2.606  -38.297 1.00 40.78  ? 1241 VAL D O     1 
ATOM   8319  C CB    . VAL F 5 44  ? -0.818  -0.537  -36.184 1.00 75.95  ? 1241 VAL D CB    1 
ATOM   8320  C CG1   . VAL F 5 44  ? -1.933  -1.083  -36.997 1.00 75.95  ? 1241 VAL D CG1   1 
ATOM   8321  C CG2   . VAL F 5 44  ? -1.287  -0.255  -34.817 1.00 75.95  ? 1241 VAL D CG2   1 
ATOM   8322  N N     . LEU F 5 45  ? 1.728   -0.654  -37.822 1.00 28.37  ? 1242 LEU D N     1 
ATOM   8323  C CA    . LEU F 5 45  ? 2.343   -0.672  -39.128 1.00 28.37  ? 1242 LEU D CA    1 
ATOM   8324  C C     . LEU F 5 45  ? 3.147   -1.967  -39.289 1.00 28.37  ? 1242 LEU D C     1 
ATOM   8325  O O     . LEU F 5 45  ? 2.984   -2.688  -40.288 1.00 28.37  ? 1242 LEU D O     1 
ATOM   8326  C CB    . LEU F 5 45  ? 3.233   0.579   -39.359 1.00 13.29  ? 1242 LEU D CB    1 
ATOM   8327  C CG    . LEU F 5 45  ? 4.238   0.409   -40.530 1.00 13.29  ? 1242 LEU D CG    1 
ATOM   8328  C CD1   . LEU F 5 45  ? 3.392   0.270   -41.845 1.00 13.29  ? 1242 LEU D CD1   1 
ATOM   8329  C CD2   . LEU F 5 45  ? 5.268   1.587   -40.699 1.00 13.29  ? 1242 LEU D CD2   1 
ATOM   8330  N N     . LYS F 5 46  ? 3.956   -2.308  -38.277 1.00 25.86  ? 1243 LYS D N     1 
ATOM   8331  C CA    . LYS F 5 46  ? 4.771   -3.497  -38.462 1.00 25.86  ? 1243 LYS D CA    1 
ATOM   8332  C C     . LYS F 5 46  ? 3.937   -4.741  -38.548 1.00 25.86  ? 1243 LYS D C     1 
ATOM   8333  O O     . LYS F 5 46  ? 4.403   -5.741  -39.059 1.00 25.86  ? 1243 LYS D O     1 
ATOM   8334  C CB    . LYS F 5 46  ? 5.860   -3.634  -37.397 1.00 33.34  ? 1243 LYS D CB    1 
ATOM   8335  C CG    . LYS F 5 46  ? 6.663   -2.341  -37.122 1.00 33.34  ? 1243 LYS D CG    1 
ATOM   8336  C CD    . LYS F 5 46  ? 7.801   -2.136  -38.061 1.00 33.34  ? 1243 LYS D CD    1 
ATOM   8337  C CE    . LYS F 5 46  ? 7.384   -2.366  -39.514 1.00 33.34  ? 1243 LYS D CE    1 
ATOM   8338  N NZ    . LYS F 5 46  ? 8.503   -2.298  -40.540 1.00 33.34  ? 1243 LYS D NZ    1 
ATOM   8339  N N     . GLN F 5 47  ? 2.707   -4.698  -38.074 1.00 24.81  ? 1244 GLN D N     1 
ATOM   8340  C CA    . GLN F 5 47  ? 1.924   -5.877  -38.186 1.00 24.81  ? 1244 GLN D CA    1 
ATOM   8341  C C     . GLN F 5 47  ? 1.398   -6.074  -39.610 1.00 24.81  ? 1244 GLN D C     1 
ATOM   8342  O O     . GLN F 5 47  ? 1.252   -7.238  -40.071 1.00 24.81  ? 1244 GLN D O     1 
ATOM   8343  C CB    . GLN F 5 47  ? 0.735   -5.863  -37.231 1.00 31.80  ? 1244 GLN D CB    1 
ATOM   8344  C CG    . GLN F 5 47  ? 0.998   -5.682  -35.790 1.00 31.80  ? 1244 GLN D CG    1 
ATOM   8345  C CD    . GLN F 5 47  ? -0.327  -5.794  -35.010 1.00 31.80  ? 1244 GLN D CD    1 
ATOM   8346  O OE1   . GLN F 5 47  ? -1.369  -5.150  -35.368 1.00 31.80  ? 1244 GLN D OE1   1 
ATOM   8347  N NE2   . GLN F 5 47  ? -0.304  -6.605  -33.927 1.00 31.80  ? 1244 GLN D NE2   1 
ATOM   8348  N N     . VAL F 5 48  ? 1.096   -5.002  -40.346 1.00 25.69  ? 1245 VAL D N     1 
ATOM   8349  C CA    . VAL F 5 48  ? 0.524   -5.257  -41.684 1.00 25.69  ? 1245 VAL D CA    1 
ATOM   8350  C C     . VAL F 5 48  ? 1.510   -5.441  -42.781 1.00 25.69  ? 1245 VAL D C     1 
ATOM   8351  O O     . VAL F 5 48  ? 1.371   -6.312  -43.663 1.00 25.69  ? 1245 VAL D O     1 
ATOM   8352  C CB    . VAL F 5 48  ? -0.491  -4.208  -42.002 1.00 18.26  ? 1245 VAL D CB    1 
ATOM   8353  C CG1   . VAL F 5 48  ? -1.509  -4.239  -40.935 1.00 18.26  ? 1245 VAL D CG1   1 
ATOM   8354  C CG2   . VAL F 5 48  ? 0.085   -2.894  -41.944 1.00 18.26  ? 1245 VAL D CG2   1 
ATOM   8355  N N     . HIS F 5 49  ? 2.558   -4.662  -42.596 1.00 39.52  ? 1246 HIS D N     1 
ATOM   8356  C CA    . HIS F 5 49  ? 3.715   -4.612  -43.455 1.00 39.52  ? 1246 HIS D CA    1 
ATOM   8357  C C     . HIS F 5 49  ? 5.015   -4.654  -42.713 1.00 39.52  ? 1246 HIS D C     1 
ATOM   8358  O O     . HIS F 5 49  ? 5.740   -3.653  -42.621 1.00 39.52  ? 1246 HIS D O     1 
ATOM   8359  C CB    . HIS F 5 49  ? 3.639   -3.368  -44.274 1.00 28.24  ? 1246 HIS D CB    1 
ATOM   8360  C CG    . HIS F 5 49  ? 2.505   -3.417  -45.224 1.00 28.24  ? 1246 HIS D CG    1 
ATOM   8361  N ND1   . HIS F 5 49  ? 2.288   -4.510  -46.032 1.00 28.24  ? 1246 HIS D ND1   1 
ATOM   8362  C CD2   . HIS F 5 49  ? 1.487   -2.568  -45.459 1.00 28.24  ? 1246 HIS D CD2   1 
ATOM   8363  C CE1   . HIS F 5 49  ? 1.176   -4.324  -46.728 1.00 28.24  ? 1246 HIS D CE1   1 
ATOM   8364  N NE2   . HIS F 5 49  ? 0.673   -3.156  -46.401 1.00 28.24  ? 1246 HIS D NE2   1 
ATOM   8365  N N     . PRO F 5 50  ? 5.356   -5.849  -42.218 1.00 25.13  ? 1247 PRO D N     1 
ATOM   8366  C CA    . PRO F 5 50  ? 6.555   -6.137  -41.449 1.00 25.13  ? 1247 PRO D CA    1 
ATOM   8367  C C     . PRO F 5 50  ? 7.808   -5.498  -41.942 1.00 25.13  ? 1247 PRO D C     1 
ATOM   8368  O O     . PRO F 5 50  ? 8.613   -5.041  -41.160 1.00 25.13  ? 1247 PRO D O     1 
ATOM   8369  C CB    . PRO F 5 50  ? 6.591   -7.621  -41.477 1.00 37.06  ? 1247 PRO D CB    1 
ATOM   8370  C CG    . PRO F 5 50  ? 5.187   -7.913  -41.327 1.00 37.06  ? 1247 PRO D CG    1 
ATOM   8371  C CD    . PRO F 5 50  ? 4.584   -7.092  -42.402 1.00 37.06  ? 1247 PRO D CD    1 
ATOM   8372  N N     . ASP F 5 51  ? 7.999   -5.433  -43.240 1.00 34.12  ? 1248 ASP D N     1 
ATOM   8373  C CA    . ASP F 5 51  ? 9.227   -4.828  -43.675 1.00 34.12  ? 1248 ASP D CA    1 
ATOM   8374  C C     . ASP F 5 51  ? 9.102   -3.403  -44.207 1.00 34.12  ? 1248 ASP D C     1 
ATOM   8375  O O     . ASP F 5 51  ? 9.983   -2.900  -44.885 1.00 34.12  ? 1248 ASP D O     1 
ATOM   8376  C CB    . ASP F 5 51  ? 9.874   -5.686  -44.736 1.00 45.32  ? 1248 ASP D CB    1 
ATOM   8377  C CG    . ASP F 5 51  ? 10.215  -7.101  -44.267 1.00 45.32  ? 1248 ASP D CG    1 
ATOM   8378  O OD1   . ASP F 5 51  ? 10.547  -7.405  -43.069 1.00 45.32  ? 1248 ASP D OD1   1 
ATOM   8379  O OD2   . ASP F 5 51  ? 10.178  -7.924  -45.199 1.00 45.32  ? 1248 ASP D OD2   1 
ATOM   8380  N N     . THR F 5 52  ? 8.052   -2.700  -43.850 1.00 17.21  ? 1249 THR D N     1 
ATOM   8381  C CA    . THR F 5 52  ? 7.878   -1.363  -44.399 1.00 17.21  ? 1249 THR D CA    1 
ATOM   8382  C C     . THR F 5 52  ? 8.071   -0.227  -43.350 1.00 17.21  ? 1249 THR D C     1 
ATOM   8383  O O     . THR F 5 52  ? 7.723   -0.362  -42.214 1.00 17.21  ? 1249 THR D O     1 
ATOM   8384  C CB    . THR F 5 52  ? 6.460   -1.355  -44.984 1.00 17.17  ? 1249 THR D CB    1 
ATOM   8385  O OG1   . THR F 5 52  ? 6.250   -2.531  -45.820 1.00 17.17  ? 1249 THR D OG1   1 
ATOM   8386  C CG2   . THR F 5 52  ? 6.217   -0.089  -45.749 1.00 17.17  ? 1249 THR D CG2   1 
ATOM   8387  N N     . GLY F 5 53  ? 8.638   0.893   -43.733 1.00 20.63  ? 1250 GLY D N     1 
ATOM   8388  C CA    . GLY F 5 53  ? 8.798   1.970   -42.793 1.00 20.63  ? 1250 GLY D CA    1 
ATOM   8389  C C     . GLY F 5 53  ? 7.913   3.156   -43.143 1.00 20.63  ? 1250 GLY D C     1 
ATOM   8390  O O     . GLY F 5 53  ? 7.250   3.232   -44.170 1.00 20.63  ? 1250 GLY D O     1 
ATOM   8391  N N     . ILE F 5 54  ? 7.926   4.153   -42.281 1.00 29.48  ? 1251 ILE D N     1 
ATOM   8392  C CA    . ILE F 5 54  ? 7.107   5.335   -42.538 1.00 29.48  ? 1251 ILE D CA    1 
ATOM   8393  C C     . ILE F 5 54  ? 7.939   6.601   -42.311 1.00 29.48  ? 1251 ILE D C     1 
ATOM   8394  O O     . ILE F 5 54  ? 8.678   6.698   -41.362 1.00 29.48  ? 1251 ILE D O     1 
ATOM   8395  C CB    . ILE F 5 54  ? 5.854   5.263   -41.639 1.00 28.38  ? 1251 ILE D CB    1 
ATOM   8396  C CG1   . ILE F 5 54  ? 4.833   6.307   -42.141 1.00 28.38  ? 1251 ILE D CG1   1 
ATOM   8397  C CG2   . ILE F 5 54  ? 6.275   5.155   -40.162 1.00 28.38  ? 1251 ILE D CG2   1 
ATOM   8398  C CD1   . ILE F 5 54  ? 3.503   6.359   -41.360 1.00 28.38  ? 1251 ILE D CD1   1 
ATOM   8399  N N     . SER F 5 55  ? 7.875   7.554   -43.216 1.00 26.64  ? 1252 SER D N     1 
ATOM   8400  C CA    . SER F 5 55  ? 8.669   8.764   -43.050 1.00 26.64  ? 1252 SER D CA    1 
ATOM   8401  C C     . SER F 5 55  ? 7.939   9.703   -42.073 1.00 26.64  ? 1252 SER D C     1 
ATOM   8402  O O     . SER F 5 55  ? 6.734   9.679   -41.996 1.00 26.64  ? 1252 SER D O     1 
ATOM   8403  C CB    . SER F 5 55  ? 8.834   9.445   -44.362 1.00 25.83  ? 1252 SER D CB    1 
ATOM   8404  O OG    . SER F 5 55  ? 7.648   10.193  -44.626 1.00 25.83  ? 1252 SER D OG    1 
ATOM   8405  N N     . SER F 5 56  ? 8.650   10.558  -41.360 1.00 48.22  ? 1253 SER D N     1 
ATOM   8406  C CA    . SER F 5 56  ? 7.984   11.371  -40.382 1.00 48.22  ? 1253 SER D CA    1 
ATOM   8407  C C     . SER F 5 56  ? 6.881   12.179  -40.976 1.00 48.22  ? 1253 SER D C     1 
ATOM   8408  O O     . SER F 5 56  ? 5.805   12.356  -40.372 1.00 48.22  ? 1253 SER D O     1 
ATOM   8409  C CB    . SER F 5 56  ? 8.978   12.289  -39.740 1.00 39.76  ? 1253 SER D CB    1 
ATOM   8410  O OG    . SER F 5 56  ? 9.660   12.881  -40.794 1.00 39.76  ? 1253 SER D OG    1 
ATOM   8411  N N     . LYS F 5 57  ? 7.138   12.696  -42.162 1.00 35.82  ? 1254 LYS D N     1 
ATOM   8412  C CA    . LYS F 5 57  ? 6.109   13.486  -42.735 1.00 35.82  ? 1254 LYS D CA    1 
ATOM   8413  C C     . LYS F 5 57  ? 4.798   12.706  -42.804 1.00 35.82  ? 1254 LYS D C     1 
ATOM   8414  O O     . LYS F 5 57  ? 3.744   13.337  -42.584 1.00 35.82  ? 1254 LYS D O     1 
ATOM   8415  C CB    . LYS F 5 57  ? 6.552   14.021  -44.058 1.00 38.53  ? 1254 LYS D CB    1 
ATOM   8416  C CG    . LYS F 5 57  ? 6.898   15.503  -43.921 1.00 38.53  ? 1254 LYS D CG    1 
ATOM   8417  C CD    . LYS F 5 57  ? 7.177   16.234  -45.262 1.00 38.53  ? 1254 LYS D CD    1 
ATOM   8418  C CE    . LYS F 5 57  ? 8.171   17.368  -45.090 1.00 38.53  ? 1254 LYS D CE    1 
ATOM   8419  N NZ    . LYS F 5 57  ? 8.944   17.342  -46.405 1.00 38.53  ? 1254 LYS D NZ    1 
ATOM   8420  N N     . ALA F 5 58  ? 4.858   11.362  -43.050 1.00 26.99  ? 1255 ALA D N     1 
ATOM   8421  C CA    . ALA F 5 58  ? 3.694   10.483  -43.113 1.00 26.99  ? 1255 ALA D CA    1 
ATOM   8422  C C     . ALA F 5 58  ? 3.186   10.245  -41.743 1.00 26.99  ? 1255 ALA D C     1 
ATOM   8423  O O     . ALA F 5 58  ? 2.045   10.415  -41.474 1.00 26.99  ? 1255 ALA D O     1 
ATOM   8424  C CB    . ALA F 5 58  ? 4.017   9.293   -43.673 1.00 23.59  ? 1255 ALA D CB    1 
ATOM   8425  N N     . MET F 5 59  ? 4.031   9.860   -40.838 1.00 25.50  ? 1256 MET D N     1 
ATOM   8426  C CA    . MET F 5 59  ? 3.612   9.648   -39.465 1.00 25.50  ? 1256 MET D CA    1 
ATOM   8427  C C     . MET F 5 59  ? 2.942   10.901  -39.032 1.00 25.50  ? 1256 MET D C     1 
ATOM   8428  O O     . MET F 5 59  ? 1.952   10.883  -38.319 1.00 25.50  ? 1256 MET D O     1 
ATOM   8429  C CB    . MET F 5 59  ? 4.830   9.365   -38.587 1.00 24.75  ? 1256 MET D CB    1 
ATOM   8430  C CG    . MET F 5 59  ? 4.552   9.005   -37.209 1.00 24.75  ? 1256 MET D CG    1 
ATOM   8431  S SD    . MET F 5 59  ? 3.414   7.622   -37.058 1.00 24.75  ? 1256 MET D SD    1 
ATOM   8432  C CE    . MET F 5 59  ? 4.472   6.165   -37.144 1.00 24.75  ? 1256 MET D CE    1 
ATOM   8433  N N     . SER F 5 60  ? 3.432   12.033  -39.501 1.00 24.17  ? 1257 SER D N     1 
ATOM   8434  C CA    . SER F 5 60  ? 2.747   13.210  -39.026 1.00 24.17  ? 1257 SER D CA    1 
ATOM   8435  C C     . SER F 5 60  ? 1.309   13.206  -39.463 1.00 24.17  ? 1257 SER D C     1 
ATOM   8436  O O     . SER F 5 60  ? 0.405   13.348  -38.661 1.00 24.17  ? 1257 SER D O     1 
ATOM   8437  C CB    . SER F 5 60  ? 3.390   14.427  -39.472 1.00 29.16  ? 1257 SER D CB    1 
ATOM   8438  O OG    . SER F 5 60  ? 2.480   15.359  -39.011 1.00 29.16  ? 1257 SER D OG    1 
ATOM   8439  N N     . ILE F 5 61  ? 1.100   13.019  -40.750 1.00 25.34  ? 1258 ILE D N     1 
ATOM   8440  C CA    . ILE F 5 61  ? -0.262  12.832  -41.280 1.00 25.34  ? 1258 ILE D CA    1 
ATOM   8441  C C     . ILE F 5 61  ? -1.018  11.685  -40.585 1.00 25.34  ? 1258 ILE D C     1 
ATOM   8442  O O     . ILE F 5 61  ? -2.196  11.776  -40.379 1.00 25.34  ? 1258 ILE D O     1 
ATOM   8443  C CB    . ILE F 5 61  ? -0.227  12.484  -42.743 1.00 22.59  ? 1258 ILE D CB    1 
ATOM   8444  C CG1   . ILE F 5 61  ? 0.175   13.757  -43.479 1.00 22.59  ? 1258 ILE D CG1   1 
ATOM   8445  C CG2   . ILE F 5 61  ? -1.546  11.886  -43.161 1.00 22.59  ? 1258 ILE D CG2   1 
ATOM   8446  C CD1   . ILE F 5 61  ? 0.447   13.541  -44.865 1.00 22.59  ? 1258 ILE D CD1   1 
ATOM   8447  N N     . MET F 5 62  ? -0.330  10.599  -40.251 1.00 28.38  ? 1259 MET D N     1 
ATOM   8448  C CA    . MET F 5 62  ? -0.984  9.547   -39.540 1.00 28.38  ? 1259 MET D CA    1 
ATOM   8449  C C     . MET F 5 62  ? -1.437  10.073  -38.200 1.00 28.38  ? 1259 MET D C     1 
ATOM   8450  O O     . MET F 5 62  ? -2.536  9.789   -37.681 1.00 28.38  ? 1259 MET D O     1 
ATOM   8451  C CB    . MET F 5 62  ? -0.044  8.412   -39.296 1.00 20.16  ? 1259 MET D CB    1 
ATOM   8452  C CG    . MET F 5 62  ? -0.039  7.377   -40.421 1.00 20.16  ? 1259 MET D CG    1 
ATOM   8453  S SD    . MET F 5 62  ? -1.566  7.128   -41.233 1.00 20.16  ? 1259 MET D SD    1 
ATOM   8454  C CE    . MET F 5 62  ? -2.369  6.030   -40.274 1.00 20.16  ? 1259 MET D CE    1 
ATOM   8455  N N     . ASN F 5 63  ? -0.570  10.884  -37.625 1.00 21.90  ? 1260 ASN D N     1 
ATOM   8456  C CA    . ASN F 5 63  ? -0.944  11.371  -36.374 1.00 21.90  ? 1260 ASN D CA    1 
ATOM   8457  C C     . ASN F 5 63  ? -2.192  12.265  -36.429 1.00 21.90  ? 1260 ASN D C     1 
ATOM   8458  O O     . ASN F 5 63  ? -3.128  12.088  -35.568 1.00 21.90  ? 1260 ASN D O     1 
ATOM   8459  C CB    . ASN F 5 63  ? 0.204   12.022  -35.727 1.00 25.84  ? 1260 ASN D CB    1 
ATOM   8460  C CG    . ASN F 5 63  ? -0.038  12.151  -34.240 1.00 25.84  ? 1260 ASN D CG    1 
ATOM   8461  O OD1   . ASN F 5 63  ? -0.303  11.178  -33.529 1.00 25.84  ? 1260 ASN D OD1   1 
ATOM   8462  N ND2   . ASN F 5 63  ? -0.016  13.392  -33.767 1.00 25.84  ? 1260 ASN D ND2   1 
ATOM   8463  N N     . SER F 5 64  ? -2.244  13.141  -37.448 1.00 29.40  ? 1261 SER D N     1 
ATOM   8464  C CA    . SER F 5 64  ? -3.372  14.007  -37.647 1.00 29.40  ? 1261 SER D CA    1 
ATOM   8465  C C     . SER F 5 64  ? -4.602  13.218  -37.833 1.00 29.40  ? 1261 SER D C     1 
ATOM   8466  O O     . SER F 5 64  ? -5.601  13.498  -37.182 1.00 29.40  ? 1261 SER D O     1 
ATOM   8467  C CB    . SER F 5 64  ? -3.209  14.850  -38.862 1.00 41.65  ? 1261 SER D CB    1 
ATOM   8468  O OG    . SER F 5 64  ? -2.073  15.679  -38.731 1.00 41.65  ? 1261 SER D OG    1 
ATOM   8469  N N     . PHE F 5 65  ? -4.528  12.226  -38.717 1.00 28.33  ? 1262 PHE D N     1 
ATOM   8470  C CA    . PHE F 5 65  ? -5.640  11.355  -39.014 1.00 28.33  ? 1262 PHE D CA    1 
ATOM   8471  C C     . PHE F 5 65  ? -6.277  10.781  -37.767 1.00 28.33  ? 1262 PHE D C     1 
ATOM   8472  O O     . PHE F 5 65  ? -7.450  11.024  -37.529 1.00 28.33  ? 1262 PHE D O     1 
ATOM   8473  C CB    . PHE F 5 65  ? -5.188  10.264  -39.899 1.00 6.62   ? 1262 PHE D CB    1 
ATOM   8474  C CG    . PHE F 5 65  ? -6.187  9.162   -40.060 1.00 6.62   ? 1262 PHE D CG    1 
ATOM   8475  C CD1   . PHE F 5 65  ? -7.501  9.405   -40.553 1.00 6.62   ? 1262 PHE D CD1   1 
ATOM   8476  C CD2   . PHE F 5 65  ? -5.848  7.840   -39.737 1.00 6.62   ? 1262 PHE D CD2   1 
ATOM   8477  C CE1   . PHE F 5 65  ? -8.463  8.276   -40.678 1.00 6.62   ? 1262 PHE D CE1   1 
ATOM   8478  C CE2   . PHE F 5 65  ? -6.765  6.741   -39.864 1.00 6.62   ? 1262 PHE D CE2   1 
ATOM   8479  C CZ    . PHE F 5 65  ? -8.049  6.938   -40.313 1.00 6.62   ? 1262 PHE D CZ    1 
ATOM   8480  N N     . VAL F 5 66  ? -5.529  10.021  -36.961 1.00 18.80  ? 1263 VAL D N     1 
ATOM   8481  C CA    . VAL F 5 66  ? -6.035  9.446   -35.674 1.00 18.80  ? 1263 VAL D CA    1 
ATOM   8482  C C     . VAL F 5 66  ? -6.792  10.473  -34.801 1.00 18.80  ? 1263 VAL D C     1 
ATOM   8483  O O     . VAL F 5 66  ? -7.895  10.233  -34.351 1.00 18.80  ? 1263 VAL D O     1 
ATOM   8484  C CB    . VAL F 5 66  ? -4.849  8.862   -34.827 1.00 24.91  ? 1263 VAL D CB    1 
ATOM   8485  C CG1   . VAL F 5 66  ? -5.315  8.371   -33.550 1.00 24.91  ? 1263 VAL D CG1   1 
ATOM   8486  C CG2   . VAL F 5 66  ? -4.248  7.687   -35.503 1.00 24.91  ? 1263 VAL D CG2   1 
ATOM   8487  N N     . ASN F 5 67  ? -6.192  11.630  -34.574 1.00 13.07  ? 1264 ASN D N     1 
ATOM   8488  C CA    . ASN F 5 67  ? -6.828  12.670  -33.797 1.00 13.07  ? 1264 ASN D CA    1 
ATOM   8489  C C     . ASN F 5 67  ? -8.095  13.167  -34.404 1.00 13.07  ? 1264 ASN D C     1 
ATOM   8490  O O     . ASN F 5 67  ? -9.042  13.478  -33.733 1.00 13.07  ? 1264 ASN D O     1 
ATOM   8491  C CB    . ASN F 5 67  ? -5.874  13.832  -33.568 1.00 67.49  ? 1264 ASN D CB    1 
ATOM   8492  C CG    . ASN F 5 67  ? -4.901  13.526  -32.463 1.00 67.49  ? 1264 ASN D CG    1 
ATOM   8493  O OD1   . ASN F 5 67  ? -5.294  13.328  -31.302 1.00 67.49  ? 1264 ASN D OD1   1 
ATOM   8494  N ND2   . ASN F 5 67  ? -3.619  13.420  -32.811 1.00 67.49  ? 1264 ASN D ND2   1 
ATOM   8495  N N     . ASP F 5 68  ? -8.122  13.245  -35.718 1.00 22.59  ? 1265 ASP D N     1 
ATOM   8496  C CA    . ASP F 5 68  ? -9.316  13.698  -36.342 1.00 22.59  ? 1265 ASP D CA    1 
ATOM   8497  C C     . ASP F 5 68  ? -10.474 12.709  -36.035 1.00 22.59  ? 1265 ASP D C     1 
ATOM   8498  O O     . ASP F 5 68  ? -11.492 13.022  -35.451 1.00 22.59  ? 1265 ASP D O     1 
ATOM   8499  C CB    . ASP F 5 68  ? -9.047  13.823  -37.809 1.00 41.59  ? 1265 ASP D CB    1 
ATOM   8500  C CG    . ASP F 5 68  ? -10.207 14.378  -38.499 1.00 41.59  ? 1265 ASP D CG    1 
ATOM   8501  O OD1   . ASP F 5 68  ? -10.876 15.184  -37.800 1.00 41.59  ? 1265 ASP D OD1   1 
ATOM   8502  O OD2   . ASP F 5 68  ? -10.476 14.019  -39.671 1.00 41.59  ? 1265 ASP D OD2   1 
ATOM   8503  N N     . VAL F 5 69  ? -10.254 11.470  -36.392 1.00 24.96  ? 1266 VAL D N     1 
ATOM   8504  C CA    . VAL F 5 69  ? -11.224 10.437  -36.179 1.00 24.96  ? 1266 VAL D CA    1 
ATOM   8505  C C     . VAL F 5 69  ? -11.691 10.453  -34.715 1.00 24.96  ? 1266 VAL D C     1 
ATOM   8506  O O     . VAL F 5 69  ? -12.900 10.290  -34.447 1.00 24.96  ? 1266 VAL D O     1 
ATOM   8507  C CB    . VAL F 5 69  ? -10.601 9.068   -36.561 1.00 16.26  ? 1266 VAL D CB    1 
ATOM   8508  C CG1   . VAL F 5 69  ? -11.506 7.999   -36.263 1.00 16.26  ? 1266 VAL D CG1   1 
ATOM   8509  C CG2   . VAL F 5 69  ? -10.304 9.010   -38.024 1.00 16.26  ? 1266 VAL D CG2   1 
ATOM   8510  N N     . PHE F 5 70  ? -10.729 10.601  -33.799 1.00 25.94  ? 1267 PHE D N     1 
ATOM   8511  C CA    . PHE F 5 70  ? -11.003 10.639  -32.401 1.00 25.94  ? 1267 PHE D CA    1 
ATOM   8512  C C     . PHE F 5 70  ? -12.007 11.722  -32.083 1.00 25.94  ? 1267 PHE D C     1 
ATOM   8513  O O     . PHE F 5 70  ? -12.995 11.491  -31.430 1.00 25.94  ? 1267 PHE D O     1 
ATOM   8514  C CB    . PHE F 5 70  ? -9.727  10.898  -31.646 1.00 29.92  ? 1267 PHE D CB    1 
ATOM   8515  C CG    . PHE F 5 70  ? -9.917  10.971  -30.172 1.00 29.92  ? 1267 PHE D CG    1 
ATOM   8516  C CD1   . PHE F 5 70  ? -9.646  9.878   -29.365 1.00 29.92  ? 1267 PHE D CD1   1 
ATOM   8517  C CD2   . PHE F 5 70  ? -10.377 12.127  -29.551 1.00 29.92  ? 1267 PHE D CD2   1 
ATOM   8518  C CE1   . PHE F 5 70  ? -9.834  9.931   -27.984 1.00 29.92  ? 1267 PHE D CE1   1 
ATOM   8519  C CE2   . PHE F 5 70  ? -10.566 12.158  -28.134 1.00 29.92  ? 1267 PHE D CE2   1 
ATOM   8520  C CZ    . PHE F 5 70  ? -10.287 11.062  -27.396 1.00 29.92  ? 1267 PHE D CZ    1 
ATOM   8521  N N     . GLU F 5 71  ? -11.777 12.934  -32.548 1.00 18.55  ? 1268 GLU D N     1 
ATOM   8522  C CA    . GLU F 5 71  ? -12.654 14.062  -32.209 1.00 18.55  ? 1268 GLU D CA    1 
ATOM   8523  C C     . GLU F 5 71  ? -13.975 13.808  -32.870 1.00 18.55  ? 1268 GLU D C     1 
ATOM   8524  O O     . GLU F 5 71  ? -14.993 14.147  -32.347 1.00 18.55  ? 1268 GLU D O     1 
ATOM   8525  C CB    . GLU F 5 71  ? -12.103 15.407  -32.731 1.00 80.40  ? 1268 GLU D CB    1 
ATOM   8526  C CG    . GLU F 5 71  ? -10.855 16.031  -32.086 1.00 80.40  ? 1268 GLU D CG    1 
ATOM   8527  C CD    . GLU F 5 71  ? -9.901  16.716  -33.102 1.00 80.40  ? 1268 GLU D CD    1 
ATOM   8528  O OE1   . GLU F 5 71  ? -10.338 17.289  -34.140 1.00 80.40  ? 1268 GLU D OE1   1 
ATOM   8529  O OE2   . GLU F 5 71  ? -8.682  16.683  -32.834 1.00 80.40  ? 1268 GLU D OE2   1 
ATOM   8530  N N     . ARG F 5 72  ? -14.010 13.211  -34.045 1.00 26.90  ? 1269 ARG D N     1 
ATOM   8531  C CA    . ARG F 5 72  ? -15.301 13.039  -34.657 1.00 26.90  ? 1269 ARG D CA    1 
ATOM   8532  C C     . ARG F 5 72  ? -16.145 12.039  -33.872 1.00 26.90  ? 1269 ARG D C     1 
ATOM   8533  O O     . ARG F 5 72  ? -17.355 12.282  -33.595 1.00 26.90  ? 1269 ARG D O     1 
ATOM   8534  C CB    . ARG F 5 72  ? -15.102 12.564  -36.048 1.00 26.28  ? 1269 ARG D CB    1 
ATOM   8535  C CG    . ARG F 5 72  ? -14.148 13.434  -36.844 1.00 26.28  ? 1269 ARG D CG    1 
ATOM   8536  C CD    . ARG F 5 72  ? -14.608 13.562  -38.245 1.00 26.28  ? 1269 ARG D CD    1 
ATOM   8537  N NE    . ARG F 5 72  ? -13.549 13.420  -39.199 1.00 26.28  ? 1269 ARG D NE    1 
ATOM   8538  C CZ    . ARG F 5 72  ? -13.781 13.040  -40.441 1.00 26.28  ? 1269 ARG D CZ    1 
ATOM   8539  N NH1   . ARG F 5 72  ? -15.011 12.780  -40.801 1.00 26.28  ? 1269 ARG D NH1   1 
ATOM   8540  N NH2   . ARG F 5 72  ? -12.820 12.936  -41.343 1.00 26.28  ? 1269 ARG D NH2   1 
ATOM   8541  N N     . ILE F 5 73  ? -15.505 10.932  -33.470 1.00 17.01  ? 1270 ILE D N     1 
ATOM   8542  C CA    . ILE F 5 73  ? -16.239 9.948   -32.772 1.00 17.01  ? 1270 ILE D CA    1 
ATOM   8543  C C     . ILE F 5 73  ? -16.658 10.475  -31.488 1.00 17.01  ? 1270 ILE D C     1 
ATOM   8544  O O     . ILE F 5 73  ? -17.869 10.366  -31.144 1.00 17.01  ? 1270 ILE D O     1 
ATOM   8545  C CB    . ILE F 5 73  ? -15.487 8.697   -32.598 1.00 9.66   ? 1270 ILE D CB    1 
ATOM   8546  C CG1   . ILE F 5 73  ? -15.439 7.999   -33.963 1.00 9.66   ? 1270 ILE D CG1   1 
ATOM   8547  C CG2   . ILE F 5 73  ? -16.257 7.781   -31.734 1.00 9.66   ? 1270 ILE D CG2   1 
ATOM   8548  C CD1   . ILE F 5 73  ? -14.541 6.734   -34.116 1.00 9.66   ? 1270 ILE D CD1   1 
ATOM   8549  N N     . ALA F 5 74  ? -15.708 11.096  -30.796 1.00 24.08  ? 1271 ALA D N     1 
ATOM   8550  C CA    . ALA F 5 74  ? -16.013 11.660  -29.479 1.00 24.08  ? 1271 ALA D CA    1 
ATOM   8551  C C     . ALA F 5 74  ? -17.158 12.685  -29.581 1.00 24.08  ? 1271 ALA D C     1 
ATOM   8552  O O     . ALA F 5 74  ? -18.050 12.750  -28.733 1.00 24.08  ? 1271 ALA D O     1 
ATOM   8553  C CB    . ALA F 5 74  ? -14.752 12.297  -28.873 1.00 27.85  ? 1271 ALA D CB    1 
ATOM   8554  N N     . GLY F 5 75  ? -17.148 13.407  -30.689 1.00 21.83  ? 1272 GLY D N     1 
ATOM   8555  C CA    . GLY F 5 75  ? -18.136 14.413  -30.888 1.00 21.83  ? 1272 GLY D CA    1 
ATOM   8556  C C     . GLY F 5 75  ? -19.540 13.903  -31.086 1.00 21.83  ? 1272 GLY D C     1 
ATOM   8557  O O     . GLY F 5 75  ? -20.521 14.429  -30.516 1.00 21.83  ? 1272 GLY D O     1 
ATOM   8558  N N     . GLU F 5 76  ? -19.646 12.888  -31.935 1.00 35.11  ? 1273 GLU D N     1 
ATOM   8559  C CA    . GLU F 5 76  ? -20.929 12.351  -32.191 1.00 35.11  ? 1273 GLU D CA    1 
ATOM   8560  C C     . GLU F 5 76  ? -21.326 11.735  -30.880 1.00 35.11  ? 1273 GLU D C     1 
ATOM   8561  O O     . GLU F 5 76  ? -22.503 11.736  -30.482 1.00 35.11  ? 1273 GLU D O     1 
ATOM   8562  C CB    . GLU F 5 76  ? -20.815 11.330  -33.269 1.00 48.63  ? 1273 GLU D CB    1 
ATOM   8563  C CG    . GLU F 5 76  ? -20.934 11.893  -34.586 1.00 48.63  ? 1273 GLU D CG    1 
ATOM   8564  C CD    . GLU F 5 76  ? -22.323 12.370  -34.846 1.00 48.63  ? 1273 GLU D CD    1 
ATOM   8565  O OE1   . GLU F 5 76  ? -23.293 11.808  -34.258 1.00 48.63  ? 1273 GLU D OE1   1 
ATOM   8566  O OE2   . GLU F 5 76  ? -22.432 13.318  -35.668 1.00 48.63  ? 1273 GLU D OE2   1 
ATOM   8567  N N     . ALA F 5 77  ? -20.362 11.171  -30.174 1.00 19.73  ? 1274 ALA D N     1 
ATOM   8568  C CA    . ALA F 5 77  ? -20.758 10.601  -28.886 1.00 19.73  ? 1274 ALA D CA    1 
ATOM   8569  C C     . ALA F 5 77  ? -21.323 11.698  -27.938 1.00 19.73  ? 1274 ALA D C     1 
ATOM   8570  O O     . ALA F 5 77  ? -22.450 11.599  -27.394 1.00 19.73  ? 1274 ALA D O     1 
ATOM   8571  C CB    . ALA F 5 77  ? -19.600 9.931   -28.256 1.00 23.90  ? 1274 ALA D CB    1 
ATOM   8572  N N     . SER F 5 78  ? -20.520 12.746  -27.765 1.00 22.09  ? 1275 SER D N     1 
ATOM   8573  C CA    . SER F 5 78  ? -20.956 13.828  -26.959 1.00 22.09  ? 1275 SER D CA    1 
ATOM   8574  C C     . SER F 5 78  ? -22.460 14.105  -27.246 1.00 22.09  ? 1275 SER D C     1 
ATOM   8575  O O     . SER F 5 78  ? -23.315 13.925  -26.375 1.00 22.09  ? 1275 SER D O     1 
ATOM   8576  C CB    . SER F 5 78  ? -20.120 15.033  -27.276 1.00 41.66  ? 1275 SER D CB    1 
ATOM   8577  O OG    . SER F 5 78  ? -20.303 15.961  -26.244 1.00 41.66  ? 1275 SER D OG    1 
ATOM   8578  N N     . ARG F 5 79  ? -22.791 14.507  -28.464 1.00 32.17  ? 1276 ARG D N     1 
ATOM   8579  C CA    . ARG F 5 79  ? -24.163 14.824  -28.808 1.00 32.17  ? 1276 ARG D CA    1 
ATOM   8580  C C     . ARG F 5 79  ? -25.208 13.761  -28.534 1.00 32.17  ? 1276 ARG D C     1 
ATOM   8581  O O     . ARG F 5 79  ? -26.252 13.985  -27.914 1.00 32.17  ? 1276 ARG D O     1 
ATOM   8582  C CB    . ARG F 5 79  ? -24.197 15.217  -30.254 1.00 24.95  ? 1276 ARG D CB    1 
ATOM   8583  C CG    . ARG F 5 79  ? -23.677 16.596  -30.432 1.00 24.95  ? 1276 ARG D CG    1 
ATOM   8584  C CD    . ARG F 5 79  ? -23.530 16.949  -31.938 1.00 24.95  ? 1276 ARG D CD    1 
ATOM   8585  N NE    . ARG F 5 79  ? -22.127 17.296  -32.180 1.00 24.95  ? 1276 ARG D NE    1 
ATOM   8586  C CZ    . ARG F 5 79  ? -21.397 16.664  -33.075 1.00 24.95  ? 1276 ARG D CZ    1 
ATOM   8587  N NH1   . ARG F 5 79  ? -21.997 15.706  -33.771 1.00 24.95  ? 1276 ARG D NH1   1 
ATOM   8588  N NH2   . ARG F 5 79  ? -20.105 16.965  -33.251 1.00 24.95  ? 1276 ARG D NH2   1 
ATOM   8589  N N     . LEU F 5 80  ? -24.901 12.587  -29.021 1.00 30.13  ? 1277 LEU D N     1 
ATOM   8590  C CA    . LEU F 5 80  ? -25.744 11.429  -28.831 1.00 30.13  ? 1277 LEU D CA    1 
ATOM   8591  C C     . LEU F 5 80  ? -26.162 11.374  -27.316 1.00 30.13  ? 1277 LEU D C     1 
ATOM   8592  O O     . LEU F 5 80  ? -27.323 11.432  -26.939 1.00 30.13  ? 1277 LEU D O     1 
ATOM   8593  C CB    . LEU F 5 80  ? -24.897 10.212  -29.297 1.00 35.41  ? 1277 LEU D CB    1 
ATOM   8594  C CG    . LEU F 5 80  ? -25.730 9.020   -29.741 1.00 35.41  ? 1277 LEU D CG    1 
ATOM   8595  C CD1   . LEU F 5 80  ? -26.888 9.580   -30.560 1.00 35.41  ? 1277 LEU D CD1   1 
ATOM   8596  C CD2   . LEU F 5 80  ? -24.924 8.015   -30.586 1.00 35.41  ? 1277 LEU D CD2   1 
ATOM   8597  N N     . ALA F 5 81  ? -25.145 11.333  -26.472 1.00 29.22  ? 1278 ALA D N     1 
ATOM   8598  C CA    . ALA F 5 81  ? -25.304 11.276  -25.056 1.00 29.22  ? 1278 ALA D CA    1 
ATOM   8599  C C     . ALA F 5 81  ? -26.165 12.388  -24.618 1.00 29.22  ? 1278 ALA D C     1 
ATOM   8600  O O     . ALA F 5 81  ? -27.131 12.237  -23.838 1.00 29.22  ? 1278 ALA D O     1 
ATOM   8601  C CB    . ALA F 5 81  ? -23.957 11.366  -24.386 1.00 69.59  ? 1278 ALA D CB    1 
ATOM   8602  N N     . HIS F 5 82  ? -25.883 13.591  -25.065 1.00 24.42  ? 1279 HIS D N     1 
ATOM   8603  C CA    . HIS F 5 82  ? -26.895 14.370  -24.497 1.00 24.42  ? 1279 HIS D CA    1 
ATOM   8604  C C     . HIS F 5 82  ? -28.156 14.702  -25.232 1.00 24.42  ? 1279 HIS D C     1 
ATOM   8605  O O     . HIS F 5 82  ? -29.050 15.297  -24.649 1.00 24.42  ? 1279 HIS D O     1 
ATOM   8606  C CB    . HIS F 5 82  ? -26.395 15.429  -23.519 1.00 75.10  ? 1279 HIS D CB    1 
ATOM   8607  C CG    . HIS F 5 82  ? -25.118 16.119  -23.881 1.00 75.10  ? 1279 HIS D CG    1 
ATOM   8608  N ND1   . HIS F 5 82  ? -25.095 17.493  -23.834 1.00 75.10  ? 1279 HIS D ND1   1 
ATOM   8609  C CD2   . HIS F 5 82  ? -23.805 15.732  -23.870 1.00 75.10  ? 1279 HIS D CD2   1 
ATOM   8610  C CE1   . HIS F 5 82  ? -23.852 17.928  -23.751 1.00 75.10  ? 1279 HIS D CE1   1 
ATOM   8611  N NE2   . HIS F 5 82  ? -23.044 16.881  -23.772 1.00 75.10  ? 1279 HIS D NE2   1 
ATOM   8612  N N     . TYR F 5 83  ? -28.338 14.193  -26.445 1.00 42.14  ? 1280 TYR D N     1 
ATOM   8613  C CA    . TYR F 5 83  ? -29.673 14.389  -26.995 1.00 42.14  ? 1280 TYR D CA    1 
ATOM   8614  C C     . TYR F 5 83  ? -30.506 13.464  -26.164 1.00 42.14  ? 1280 TYR D C     1 
ATOM   8615  O O     . TYR F 5 83  ? -31.702 13.448  -26.301 1.00 42.14  ? 1280 TYR D O     1 
ATOM   8616  C CB    . TYR F 5 83  ? -29.866 13.841  -28.387 1.00 34.29  ? 1280 TYR D CB    1 
ATOM   8617  C CG    . TYR F 5 83  ? -28.986 14.504  -29.373 1.00 34.29  ? 1280 TYR D CG    1 
ATOM   8618  C CD1   . TYR F 5 83  ? -28.445 13.784  -30.466 1.00 34.29  ? 1280 TYR D CD1   1 
ATOM   8619  C CD2   . TYR F 5 83  ? -28.734 15.876  -29.277 1.00 34.29  ? 1280 TYR D CD2   1 
ATOM   8620  C CE1   . TYR F 5 83  ? -27.703 14.410  -31.437 1.00 34.29  ? 1280 TYR D CE1   1 
ATOM   8621  C CE2   . TYR F 5 83  ? -27.979 16.497  -30.251 1.00 34.29  ? 1280 TYR D CE2   1 
ATOM   8622  C CZ    . TYR F 5 83  ? -27.476 15.757  -31.324 1.00 34.29  ? 1280 TYR D CZ    1 
ATOM   8623  O OH    . TYR F 5 83  ? -26.744 16.500  -32.240 1.00 34.29  ? 1280 TYR D OH    1 
ATOM   8624  N N     . ASN F 5 84  ? -29.896 12.661  -25.322 1.00 32.82  ? 1281 ASN D N     1 
ATOM   8625  C CA    . ASN F 5 84  ? -30.709 11.699  -24.579 1.00 32.82  ? 1281 ASN D CA    1 
ATOM   8626  C C     . ASN F 5 84  ? -30.698 11.923  -23.094 1.00 32.82  ? 1281 ASN D C     1 
ATOM   8627  O O     . ASN F 5 84  ? -30.986 11.037  -22.310 1.00 32.82  ? 1281 ASN D O     1 
ATOM   8628  C CB    . ASN F 5 84  ? -30.262 10.284  -24.884 1.00 32.47  ? 1281 ASN D CB    1 
ATOM   8629  C CG    . ASN F 5 84  ? -30.637 9.881   -26.213 1.00 32.47  ? 1281 ASN D CG    1 
ATOM   8630  O OD1   . ASN F 5 84  ? -31.714 9.380   -26.441 1.00 32.47  ? 1281 ASN D OD1   1 
ATOM   8631  N ND2   . ASN F 5 84  ? -29.769 10.109  -27.127 1.00 32.47  ? 1281 ASN D ND2   1 
ATOM   8632  N N     . LYS F 5 85  ? -30.315 13.119  -22.701 1.00 37.15  ? 1282 LYS D N     1 
ATOM   8633  C CA    . LYS F 5 85  ? -30.312 13.422  -21.300 1.00 37.15  ? 1282 LYS D CA    1 
ATOM   8634  C C     . LYS F 5 85  ? -29.575 12.325  -20.548 1.00 37.15  ? 1282 LYS D C     1 
ATOM   8635  O O     . LYS F 5 85  ? -30.070 11.819  -19.554 1.00 37.15  ? 1282 LYS D O     1 
ATOM   8636  C CB    . LYS F 5 85  ? -31.752 13.574  -20.823 1.00 61.97  ? 1282 LYS D CB    1 
ATOM   8637  C CG    . LYS F 5 85  ? -32.561 14.536  -21.633 1.00 61.97  ? 1282 LYS D CG    1 
ATOM   8638  C CD    . LYS F 5 85  ? -33.827 14.806  -20.938 1.00 61.97  ? 1282 LYS D CD    1 
ATOM   8639  C CE    . LYS F 5 85  ? -34.704 15.768  -21.719 1.00 61.97  ? 1282 LYS D CE    1 
ATOM   8640  N NZ    . LYS F 5 85  ? -35.839 16.398  -20.893 1.00 61.97  ? 1282 LYS D NZ    1 
ATOM   8641  N N     . ARG F 5 86  ? -28.409 11.965  -21.082 1.00 23.28  ? 1283 ARG D N     1 
ATOM   8642  C CA    . ARG F 5 86  ? -27.501 10.991  -20.508 1.00 23.28  ? 1283 ARG D CA    1 
ATOM   8643  C C     . ARG F 5 86  ? -26.252 11.760  -20.128 1.00 23.28  ? 1283 ARG D C     1 
ATOM   8644  O O     . ARG F 5 86  ? -25.815 12.648  -20.860 1.00 23.28  ? 1283 ARG D O     1 
ATOM   8645  C CB    . ARG F 5 86  ? -27.127 9.932   -21.498 1.00 61.12  ? 1283 ARG D CB    1 
ATOM   8646  C CG    . ARG F 5 86  ? -28.246 9.099   -21.789 1.00 61.12  ? 1283 ARG D CG    1 
ATOM   8647  C CD    . ARG F 5 86  ? -28.488 8.260   -20.621 1.00 61.12  ? 1283 ARG D CD    1 
ATOM   8648  N NE    . ARG F 5 86  ? -29.508 7.274   -20.937 1.00 61.12  ? 1283 ARG D NE    1 
ATOM   8649  C CZ    . ARG F 5 86  ? -30.813 7.456   -20.766 1.00 61.12  ? 1283 ARG D CZ    1 
ATOM   8650  N NH1   . ARG F 5 86  ? -31.269 8.607   -20.258 1.00 61.12  ? 1283 ARG D NH1   1 
ATOM   8651  N NH2   . ARG F 5 86  ? -31.663 6.495   -21.135 1.00 61.12  ? 1283 ARG D NH2   1 
ATOM   8652  N N     . SER F 5 87  ? -25.657 11.453  -18.990 1.00 30.61  ? 1284 SER D N     1 
ATOM   8653  C CA    . SER F 5 87  ? -24.475 12.193  -18.631 1.00 30.61  ? 1284 SER D CA    1 
ATOM   8654  C C     . SER F 5 87  ? -23.241 11.376  -18.957 1.00 30.61  ? 1284 SER D C     1 
ATOM   8655  O O     . SER F 5 87  ? -22.117 11.838  -18.830 1.00 30.61  ? 1284 SER D O     1 
ATOM   8656  C CB    . SER F 5 87  ? -24.562 12.523  -17.162 1.00 65.27  ? 1284 SER D CB    1 
ATOM   8657  O OG    . SER F 5 87  ? -25.221 11.470  -16.520 1.00 65.27  ? 1284 SER D OG    1 
ATOM   8658  N N     . THR F 5 88  ? -23.461 10.171  -19.449 1.00 50.55  ? 1285 THR D N     1 
ATOM   8659  C CA    . THR F 5 88  ? -22.328 9.342   -19.729 1.00 50.55  ? 1285 THR D CA    1 
ATOM   8660  C C     . THR F 5 88  ? -22.151 8.857   -21.126 1.00 50.55  ? 1285 THR D C     1 
ATOM   8661  O O     . THR F 5 88  ? -23.119 8.443   -21.766 1.00 50.55  ? 1285 THR D O     1 
ATOM   8662  C CB    . THR F 5 88  ? -22.375 8.123   -18.956 1.00 59.31  ? 1285 THR D CB    1 
ATOM   8663  O OG1   . THR F 5 88  ? -23.270 8.293   -17.867 1.00 59.31  ? 1285 THR D OG1   1 
ATOM   8664  C CG2   . THR F 5 88  ? -21.003 7.813   -18.489 1.00 59.31  ? 1285 THR D CG2   1 
ATOM   8665  N N     . ILE F 5 89  ? -20.902 8.845   -21.569 1.00 35.59  ? 1286 ILE D N     1 
ATOM   8666  C CA    . ILE F 5 89  ? -20.609 8.336   -22.866 1.00 35.59  ? 1286 ILE D CA    1 
ATOM   8667  C C     . ILE F 5 89  ? -20.185 6.952   -22.606 1.00 35.59  ? 1286 ILE D C     1 
ATOM   8668  O O     . ILE F 5 89  ? -19.153 6.751   -21.996 1.00 35.59  ? 1286 ILE D O     1 
ATOM   8669  C CB    . ILE F 5 89  ? -19.437 9.018   -23.471 1.00 26.39  ? 1286 ILE D CB    1 
ATOM   8670  C CG1   . ILE F 5 89  ? -19.809 10.434  -23.771 1.00 26.39  ? 1286 ILE D CG1   1 
ATOM   8671  C CG2   . ILE F 5 89  ? -19.049 8.385   -24.739 1.00 26.39  ? 1286 ILE D CG2   1 
ATOM   8672  C CD1   . ILE F 5 89  ? -18.614 11.276  -23.995 1.00 26.39  ? 1286 ILE D CD1   1 
ATOM   8673  N N     . THR F 5 90  ? -20.953 5.970   -23.009 1.00 29.08  ? 1287 THR D N     1 
ATOM   8674  C CA    . THR F 5 90  ? -20.457 4.612   -22.788 1.00 29.08  ? 1287 THR D CA    1 
ATOM   8675  C C     . THR F 5 90  ? -19.959 4.004   -24.097 1.00 29.08  ? 1287 THR D C     1 
ATOM   8676  O O     . THR F 5 90  ? -19.789 4.684   -25.137 1.00 29.08  ? 1287 THR D O     1 
ATOM   8677  C CB    . THR F 5 90  ? -21.522 3.703   -22.296 1.00 37.00  ? 1287 THR D CB    1 
ATOM   8678  O OG1   . THR F 5 90  ? -22.350 3.269   -23.382 1.00 37.00  ? 1287 THR D OG1   1 
ATOM   8679  C CG2   . THR F 5 90  ? -22.372 4.444   -21.391 1.00 37.00  ? 1287 THR D CG2   1 
ATOM   8680  N N     . SER F 5 91  ? -19.737 2.706   -24.064 1.00 34.58  ? 1288 SER D N     1 
ATOM   8681  C CA    . SER F 5 91  ? -19.263 2.053   -25.250 1.00 34.58  ? 1288 SER D CA    1 
ATOM   8682  C C     . SER F 5 91  ? -20.407 2.112   -26.240 1.00 34.58  ? 1288 SER D C     1 
ATOM   8683  O O     . SER F 5 91  ? -20.214 2.162   -27.448 1.00 34.58  ? 1288 SER D O     1 
ATOM   8684  C CB    . SER F 5 91  ? -18.855 0.609   -24.918 1.00 33.04  ? 1288 SER D CB    1 
ATOM   8685  O OG    . SER F 5 91  ? -20.014 -0.181  -24.670 1.00 33.04  ? 1288 SER D OG    1 
ATOM   8686  N N     . ARG F 5 92  ? -21.611 2.147   -25.726 1.00 29.39  ? 1289 ARG D N     1 
ATOM   8687  C CA    . ARG F 5 92  ? -22.771 2.193   -26.611 1.00 29.39  ? 1289 ARG D CA    1 
ATOM   8688  C C     . ARG F 5 92  ? -22.880 3.504   -27.457 1.00 29.39  ? 1289 ARG D C     1 
ATOM   8689  O O     . ARG F 5 92  ? -23.235 3.480   -28.651 1.00 29.39  ? 1289 ARG D O     1 
ATOM   8690  C CB    . ARG F 5 92  ? -24.021 1.931   -25.791 1.00 43.31  ? 1289 ARG D CB    1 
ATOM   8691  C CG    . ARG F 5 92  ? -25.199 1.798   -26.594 1.00 43.31  ? 1289 ARG D CG    1 
ATOM   8692  C CD    . ARG F 5 92  ? -26.318 1.441   -25.709 1.00 43.31  ? 1289 ARG D CD    1 
ATOM   8693  N NE    . ARG F 5 92  ? -27.454 0.970   -26.492 1.00 43.31  ? 1289 ARG D NE    1 
ATOM   8694  C CZ    . ARG F 5 92  ? -28.409 1.758   -26.931 1.00 43.31  ? 1289 ARG D CZ    1 
ATOM   8695  N NH1   . ARG F 5 92  ? -28.407 3.046   -26.678 1.00 43.31  ? 1289 ARG D NH1   1 
ATOM   8696  N NH2   . ARG F 5 92  ? -29.367 1.238   -27.634 1.00 43.31  ? 1289 ARG D NH2   1 
ATOM   8697  N N     . GLU F 5 93  ? -22.524 4.631   -26.860 1.00 30.88  ? 1290 GLU D N     1 
ATOM   8698  C CA    . GLU F 5 93  ? -22.576 5.854   -27.596 1.00 30.88  ? 1290 GLU D CA    1 
ATOM   8699  C C     . GLU F 5 93  ? -21.459 5.751   -28.675 1.00 30.88  ? 1290 GLU D C     1 
ATOM   8700  O O     . GLU F 5 93  ? -21.717 5.866   -29.870 1.00 30.88  ? 1290 GLU D O     1 
ATOM   8701  C CB    . GLU F 5 93  ? -22.375 7.042   -26.657 1.00 35.77  ? 1290 GLU D CB    1 
ATOM   8702  C CG    . GLU F 5 93  ? -22.853 6.869   -25.206 1.00 35.77  ? 1290 GLU D CG    1 
ATOM   8703  C CD    . GLU F 5 93  ? -24.294 6.356   -25.008 1.00 35.77  ? 1290 GLU D CD    1 
ATOM   8704  O OE1   . GLU F 5 93  ? -25.281 7.003   -25.422 1.00 35.77  ? 1290 GLU D OE1   1 
ATOM   8705  O OE2   . GLU F 5 93  ? -24.471 5.280   -24.395 1.00 35.77  ? 1290 GLU D OE2   1 
ATOM   8706  N N     . ILE F 5 94  ? -20.228 5.503   -28.277 1.00 26.18  ? 1291 ILE D N     1 
ATOM   8707  C CA    . ILE F 5 94  ? -19.151 5.353   -29.268 1.00 26.18  ? 1291 ILE D CA    1 
ATOM   8708  C C     . ILE F 5 94  ? -19.556 4.486   -30.432 1.00 26.18  ? 1291 ILE D C     1 
ATOM   8709  O O     . ILE F 5 94  ? -19.151 4.700   -31.582 1.00 26.18  ? 1291 ILE D O     1 
ATOM   8710  C CB    . ILE F 5 94  ? -17.901 4.623   -28.684 1.00 31.58  ? 1291 ILE D CB    1 
ATOM   8711  C CG1   . ILE F 5 94  ? -17.330 5.415   -27.495 1.00 31.58  ? 1291 ILE D CG1   1 
ATOM   8712  C CG2   . ILE F 5 94  ? -16.857 4.398   -29.800 1.00 31.58  ? 1291 ILE D CG2   1 
ATOM   8713  C CD1   . ILE F 5 94  ? -16.794 6.762   -27.896 1.00 31.58  ? 1291 ILE D CD1   1 
ATOM   8714  N N     . GLN F 5 95  ? -20.339 3.462   -30.128 1.00 20.75  ? 1292 GLN D N     1 
ATOM   8715  C CA    . GLN F 5 95  ? -20.668 2.588   -31.189 1.00 20.75  ? 1292 GLN D CA    1 
ATOM   8716  C C     . GLN F 5 95  ? -21.713 3.210   -32.086 1.00 20.75  ? 1292 GLN D C     1 
ATOM   8717  O O     . GLN F 5 95  ? -21.616 3.123   -33.311 1.00 20.75  ? 1292 GLN D O     1 
ATOM   8718  C CB    . GLN F 5 95  ? -21.059 1.254   -30.655 1.00 27.43  ? 1292 GLN D CB    1 
ATOM   8719  C CG    . GLN F 5 95  ? -20.943 0.172   -31.699 1.00 27.43  ? 1292 GLN D CG    1 
ATOM   8720  C CD    . GLN F 5 95  ? -21.575 -1.164  -31.272 1.00 27.43  ? 1292 GLN D CD    1 
ATOM   8721  O OE1   . GLN F 5 95  ? -22.783 -1.300  -31.262 1.00 27.43  ? 1292 GLN D OE1   1 
ATOM   8722  N NE2   . GLN F 5 95  ? -20.765 -2.120  -30.901 1.00 27.43  ? 1292 GLN D NE2   1 
ATOM   8723  N N     . THR F 5 96  ? -22.718 3.857   -31.534 1.00 17.55  ? 1293 THR D N     1 
ATOM   8724  C CA    . THR F 5 96  ? -23.656 4.456   -32.457 1.00 17.55  ? 1293 THR D CA    1 
ATOM   8725  C C     . THR F 5 96  ? -22.805 5.475   -33.219 1.00 17.55  ? 1293 THR D C     1 
ATOM   8726  O O     . THR F 5 96  ? -22.884 5.585   -34.410 1.00 17.55  ? 1293 THR D O     1 
ATOM   8727  C CB    . THR F 5 96  ? -24.735 5.209   -31.712 1.00 28.19  ? 1293 THR D CB    1 
ATOM   8728  O OG1   . THR F 5 96  ? -25.221 4.387   -30.659 1.00 28.19  ? 1293 THR D OG1   1 
ATOM   8729  C CG2   . THR F 5 96  ? -25.864 5.619   -32.633 1.00 28.19  ? 1293 THR D CG2   1 
ATOM   8730  N N     . ALA F 5 97  ? -21.953 6.211   -32.545 1.00 25.07  ? 1294 ALA D N     1 
ATOM   8731  C CA    . ALA F 5 97  ? -21.202 7.225   -33.252 1.00 25.07  ? 1294 ALA D CA    1 
ATOM   8732  C C     . ALA F 5 97  ? -20.401 6.715   -34.418 1.00 25.07  ? 1294 ALA D C     1 
ATOM   8733  O O     . ALA F 5 97  ? -20.232 7.395   -35.440 1.00 25.07  ? 1294 ALA D O     1 
ATOM   8734  C CB    . ALA F 5 97  ? -20.271 7.926   -32.302 1.00 38.45  ? 1294 ALA D CB    1 
ATOM   8735  N N     . VAL F 5 98  ? -19.854 5.526   -34.253 1.00 16.95  ? 1295 VAL D N     1 
ATOM   8736  C CA    . VAL F 5 98  ? -19.007 4.956   -35.279 1.00 16.95  ? 1295 VAL D CA    1 
ATOM   8737  C C     . VAL F 5 98  ? -19.854 4.699   -36.473 1.00 16.95  ? 1295 VAL D C     1 
ATOM   8738  O O     . VAL F 5 98  ? -19.411 4.813   -37.604 1.00 16.95  ? 1295 VAL D O     1 
ATOM   8739  C CB    . VAL F 5 98  ? -18.438 3.715   -34.712 1.00 9.08   ? 1295 VAL D CB    1 
ATOM   8740  C CG1   . VAL F 5 98  ? -18.371 2.592   -35.715 1.00 9.08   ? 1295 VAL D CG1   1 
ATOM   8741  C CG2   . VAL F 5 98  ? -17.140 4.090   -34.067 1.00 9.08   ? 1295 VAL D CG2   1 
ATOM   8742  N N     . ARG F 5 99  ? -21.105 4.392   -36.203 1.00 18.96  ? 1296 ARG D N     1 
ATOM   8743  C CA    . ARG F 5 99  ? -22.014 4.108   -37.263 1.00 18.96  ? 1296 ARG D CA    1 
ATOM   8744  C C     . ARG F 5 99  ? -22.474 5.338   -37.887 1.00 18.96  ? 1296 ARG D C     1 
ATOM   8745  O O     . ARG F 5 99  ? -22.612 5.360   -39.140 1.00 18.96  ? 1296 ARG D O     1 
ATOM   8746  C CB    . ARG F 5 99  ? -23.220 3.331   -36.808 1.00 35.80  ? 1296 ARG D CB    1 
ATOM   8747  C CG    . ARG F 5 99  ? -23.067 1.905   -37.062 1.00 35.80  ? 1296 ARG D CG    1 
ATOM   8748  C CD    . ARG F 5 99  ? -23.871 1.166   -36.076 1.00 35.80  ? 1296 ARG D CD    1 
ATOM   8749  N NE    . ARG F 5 99  ? -23.735 -0.272  -36.241 1.00 35.80  ? 1296 ARG D NE    1 
ATOM   8750  C CZ    . ARG F 5 99  ? -24.161 -1.169  -35.345 1.00 35.80  ? 1296 ARG D CZ    1 
ATOM   8751  N NH1   . ARG F 5 99  ? -24.789 -0.792  -34.195 1.00 35.80  ? 1296 ARG D NH1   1 
ATOM   8752  N NH2   . ARG F 5 99  ? -23.866 -2.457  -35.556 1.00 35.80  ? 1296 ARG D NH2   1 
ATOM   8753  N N     . LEU F 5 100 ? -22.735 6.364   -37.079 1.00 21.45  ? 1297 LEU D N     1 
ATOM   8754  C CA    . LEU F 5 100 ? -23.207 7.590   -37.694 1.00 21.45  ? 1297 LEU D CA    1 
ATOM   8755  C C     . LEU F 5 100 ? -22.157 8.199   -38.497 1.00 21.45  ? 1297 LEU D C     1 
ATOM   8756  O O     . LEU F 5 100 ? -22.522 8.871   -39.466 1.00 21.45  ? 1297 LEU D O     1 
ATOM   8757  C CB    . LEU F 5 100 ? -23.629 8.661   -36.742 1.00 14.36  ? 1297 LEU D CB    1 
ATOM   8758  C CG    . LEU F 5 100 ? -24.955 8.203   -36.235 1.00 14.36  ? 1297 LEU D CG    1 
ATOM   8759  C CD1   . LEU F 5 100 ? -25.287 9.126   -35.118 1.00 14.36  ? 1297 LEU D CD1   1 
ATOM   8760  C CD2   . LEU F 5 100 ? -25.971 8.196   -37.402 1.00 14.36  ? 1297 LEU D CD2   1 
ATOM   8761  N N     . LEU F 5 101 ? -20.880 7.984   -38.141 1.00 20.38  ? 1298 LEU D N     1 
ATOM   8762  C CA    . LEU F 5 101 ? -19.807 8.575   -38.873 1.00 20.38  ? 1298 LEU D CA    1 
ATOM   8763  C C     . LEU F 5 101 ? -19.088 7.779   -39.998 1.00 20.38  ? 1298 LEU D C     1 
ATOM   8764  O O     . LEU F 5 101 ? -18.753 8.320   -41.097 1.00 20.38  ? 1298 LEU D O     1 
ATOM   8765  C CB    . LEU F 5 101 ? -18.853 9.118   -37.850 1.00 50.96  ? 1298 LEU D CB    1 
ATOM   8766  C CG    . LEU F 5 101 ? -17.551 9.672   -38.363 1.00 50.96  ? 1298 LEU D CG    1 
ATOM   8767  C CD1   . LEU F 5 101 ? -17.689 10.785  -39.371 1.00 50.96  ? 1298 LEU D CD1   1 
ATOM   8768  C CD2   . LEU F 5 101 ? -16.946 10.237  -37.164 1.00 50.96  ? 1298 LEU D CD2   1 
ATOM   8769  N N     . LEU F 5 102 ? -18.896 6.483   -39.853 1.00 11.58  ? 1299 LEU D N     1 
ATOM   8770  C CA    . LEU F 5 102 ? -18.127 5.838   -40.939 1.00 11.58  ? 1299 LEU D CA    1 
ATOM   8771  C C     . LEU F 5 102 ? -18.854 5.255   -42.100 1.00 11.58  ? 1299 LEU D C     1 
ATOM   8772  O O     . LEU F 5 102 ? -20.005 4.908   -41.995 1.00 11.58  ? 1299 LEU D O     1 
ATOM   8773  C CB    . LEU F 5 102 ? -17.247 4.720   -40.360 1.00 19.79  ? 1299 LEU D CB    1 
ATOM   8774  C CG    . LEU F 5 102 ? -16.407 5.053   -39.123 1.00 19.79  ? 1299 LEU D CG    1 
ATOM   8775  C CD1   . LEU F 5 102 ? -15.787 3.819   -38.621 1.00 19.79  ? 1299 LEU D CD1   1 
ATOM   8776  C CD2   . LEU F 5 102 ? -15.378 6.007   -39.453 1.00 19.79  ? 1299 LEU D CD2   1 
ATOM   8777  N N     . PRO F 5 103 ? -18.198 5.079   -43.232 1.00 38.43  ? 1300 PRO D N     1 
ATOM   8778  C CA    . PRO F 5 103 ? -18.877 4.490   -44.384 1.00 38.43  ? 1300 PRO D CA    1 
ATOM   8779  C C     . PRO F 5 103 ? -19.316 3.078   -44.052 1.00 38.43  ? 1300 PRO D C     1 
ATOM   8780  O O     . PRO F 5 103 ? -18.953 2.573   -42.999 1.00 38.43  ? 1300 PRO D O     1 
ATOM   8781  C CB    . PRO F 5 103 ? -17.814 4.525   -45.430 1.00 30.83  ? 1300 PRO D CB    1 
ATOM   8782  C CG    . PRO F 5 103 ? -17.126 5.763   -45.195 1.00 30.83  ? 1300 PRO D CG    1 
ATOM   8783  C CD    . PRO F 5 103 ? -17.141 5.984   -43.687 1.00 30.83  ? 1300 PRO D CD    1 
ATOM   8784  N N     . GLY F 5 104 ? -20.078 2.467   -44.948 1.00 23.90  ? 1301 GLY D N     1 
ATOM   8785  C CA    . GLY F 5 104 ? -20.587 1.147   -44.771 1.00 23.90  ? 1301 GLY D CA    1 
ATOM   8786  C C     . GLY F 5 104 ? -19.649 0.018   -44.407 1.00 23.90  ? 1301 GLY D C     1 
ATOM   8787  O O     . GLY F 5 104 ? -19.697 -0.553  -43.288 1.00 23.90  ? 1301 GLY D O     1 
ATOM   8788  N N     . GLU F 5 105 ? -18.763 -0.369  -45.282 1.00 30.49  ? 1302 GLU D N     1 
ATOM   8789  C CA    . GLU F 5 105 ? -17.998 -1.496  -44.824 1.00 30.49  ? 1302 GLU D CA    1 
ATOM   8790  C C     . GLU F 5 105 ? -17.095 -1.157  -43.620 1.00 30.49  ? 1302 GLU D C     1 
ATOM   8791  O O     . GLU F 5 105 ? -16.975 -1.957  -42.717 1.00 30.49  ? 1302 GLU D O     1 
ATOM   8792  C CB    . GLU F 5 105 ? -17.209 -2.083  -45.971 1.00 63.47  ? 1302 GLU D CB    1 
ATOM   8793  C CG    . GLU F 5 105 ? -16.723 -3.474  -45.685 1.00 63.47  ? 1302 GLU D CG    1 
ATOM   8794  C CD    . GLU F 5 105 ? -17.850 -4.475  -45.625 1.00 63.47  ? 1302 GLU D CD    1 
ATOM   8795  O OE1   . GLU F 5 105 ? -18.982 -4.064  -45.973 1.00 63.47  ? 1302 GLU D OE1   1 
ATOM   8796  O OE2   . GLU F 5 105 ? -17.611 -5.670  -45.236 1.00 63.47  ? 1302 GLU D OE2   1 
ATOM   8797  N N     . LEU F 5 106 ? -16.516 0.037   -43.562 1.00 48.59  ? 1303 LEU D N     1 
ATOM   8798  C CA    . LEU F 5 106 ? -15.583 0.364   -42.509 1.00 48.59  ? 1303 LEU D CA    1 
ATOM   8799  C C     . LEU F 5 106 ? -16.209 0.307   -41.138 1.00 48.59  ? 1303 LEU D C     1 
ATOM   8800  O O     . LEU F 5 106 ? -15.585 -0.007  -40.094 1.00 48.59  ? 1303 LEU D O     1 
ATOM   8801  C CB    . LEU F 5 106 ? -15.014 1.757   -42.778 1.00 8.95   ? 1303 LEU D CB    1 
ATOM   8802  C CG    . LEU F 5 106 ? -13.675 2.012   -43.512 1.00 8.95   ? 1303 LEU D CG    1 
ATOM   8803  C CD1   . LEU F 5 106 ? -13.328 3.431   -43.727 1.00 8.95   ? 1303 LEU D CD1   1 
ATOM   8804  C CD2   . LEU F 5 106 ? -12.701 1.388   -42.696 1.00 8.95   ? 1303 LEU D CD2   1 
ATOM   8805  N N     . ALA F 5 107 ? -17.484 0.612   -41.137 1.00 39.66  ? 1304 ALA D N     1 
ATOM   8806  C CA    . ALA F 5 107 ? -18.206 0.642   -39.886 1.00 39.66  ? 1304 ALA D CA    1 
ATOM   8807  C C     . ALA F 5 107 ? -18.580 -0.781  -39.475 1.00 39.66  ? 1304 ALA D C     1 
ATOM   8808  O O     . ALA F 5 107 ? -18.373 -1.180  -38.326 1.00 39.66  ? 1304 ALA D O     1 
ATOM   8809  C CB    . ALA F 5 107 ? -19.362 1.514   -40.053 1.00 10.50  ? 1304 ALA D CB    1 
ATOM   8810  N N     . LYS F 5 108 ? -19.101 -1.547  -40.438 1.00 26.58  ? 1305 LYS D N     1 
ATOM   8811  C CA    . LYS F 5 108 ? -19.404 -2.961  -40.235 1.00 26.58  ? 1305 LYS D CA    1 
ATOM   8812  C C     . LYS F 5 108 ? -18.107 -3.495  -39.580 1.00 26.58  ? 1305 LYS D C     1 
ATOM   8813  O O     . LYS F 5 108 ? -18.145 -4.210  -38.581 1.00 26.58  ? 1305 LYS D O     1 
ATOM   8814  C CB    . LYS F 5 108 ? -19.650 -3.615  -41.581 1.00 81.36  ? 1305 LYS D CB    1 
ATOM   8815  C CG    . LYS F 5 108 ? -19.801 -5.122  -41.537 1.00 81.36  ? 1305 LYS D CG    1 
ATOM   8816  C CD    . LYS F 5 108 ? -19.575 -5.852  -42.904 1.00 81.36  ? 1305 LYS D CD    1 
ATOM   8817  C CE    . LYS F 5 108 ? -20.709 -5.519  -43.946 1.00 81.36  ? 1305 LYS D CE    1 
ATOM   8818  N NZ    . LYS F 5 108 ? -20.552 -6.037  -45.376 1.00 81.36  ? 1305 LYS D NZ    1 
ATOM   8819  N N     . HIS F 5 109 ? -16.946 -3.091  -40.062 1.00 34.92  ? 1306 HIS D N     1 
ATOM   8820  C CA    . HIS F 5 109 ? -15.756 -3.622  -39.443 1.00 34.92  ? 1306 HIS D CA    1 
ATOM   8821  C C     . HIS F 5 109 ? -15.285 -2.993  -38.140 1.00 34.92  ? 1306 HIS D C     1 
ATOM   8822  O O     . HIS F 5 109 ? -14.742 -3.700  -37.268 1.00 34.92  ? 1306 HIS D O     1 
ATOM   8823  C CB    . HIS F 5 109 ? -14.635 -3.709  -40.482 1.00 51.09  ? 1306 HIS D CB    1 
ATOM   8824  C CG    . HIS F 5 109 ? -14.809 -4.880  -41.409 1.00 51.09  ? 1306 HIS D CG    1 
ATOM   8825  N ND1   . HIS F 5 109 ? -15.069 -4.749  -42.756 1.00 51.09  ? 1306 HIS D ND1   1 
ATOM   8826  C CD2   . HIS F 5 109 ? -14.866 -6.210  -41.151 1.00 51.09  ? 1306 HIS D CD2   1 
ATOM   8827  C CE1   . HIS F 5 109 ? -15.278 -5.944  -43.288 1.00 51.09  ? 1306 HIS D CE1   1 
ATOM   8828  N NE2   . HIS F 5 109 ? -15.164 -6.850  -42.332 1.00 51.09  ? 1306 HIS D NE2   1 
ATOM   8829  N N     . ALA F 5 110 ? -15.498 -1.685  -37.978 1.00 27.77  ? 1307 ALA D N     1 
ATOM   8830  C CA    . ALA F 5 110 ? -15.063 -1.069  -36.719 1.00 27.77  ? 1307 ALA D CA    1 
ATOM   8831  C C     . ALA F 5 110 ? -15.899 -1.648  -35.587 1.00 27.77  ? 1307 ALA D C     1 
ATOM   8832  O O     . ALA F 5 110 ? -15.340 -2.101  -34.610 1.00 27.77  ? 1307 ALA D O     1 
ATOM   8833  C CB    . ALA F 5 110 ? -15.196 0.451   -36.780 1.00 31.42  ? 1307 ALA D CB    1 
ATOM   8834  N N     . VAL F 5 111 ? -17.231 -1.711  -35.770 1.00 30.88  ? 1308 VAL D N     1 
ATOM   8835  C CA    . VAL F 5 111 ? -18.173 -2.195  -34.734 1.00 30.88  ? 1308 VAL D CA    1 
ATOM   8836  C C     . VAL F 5 111 ? -17.700 -3.499  -34.249 1.00 30.88  ? 1308 VAL D C     1 
ATOM   8837  O O     . VAL F 5 111 ? -17.694 -3.791  -33.048 1.00 30.88  ? 1308 VAL D O     1 
ATOM   8838  C CB    . VAL F 5 111 ? -19.605 -2.487  -35.231 1.00 30.64  ? 1308 VAL D CB    1 
ATOM   8839  C CG1   . VAL F 5 111 ? -20.485 -2.859  -34.062 1.00 30.64  ? 1308 VAL D CG1   1 
ATOM   8840  C CG2   . VAL F 5 111 ? -20.193 -1.286  -35.918 1.00 30.64  ? 1308 VAL D CG2   1 
ATOM   8841  N N     . SER F 5 112 ? -17.363 -4.313  -35.241 1.00 32.32  ? 1309 SER D N     1 
ATOM   8842  C CA    . SER F 5 112 ? -16.815 -5.622  -34.968 1.00 32.32  ? 1309 SER D CA    1 
ATOM   8843  C C     . SER F 5 112 ? -15.610 -5.521  -34.055 1.00 32.32  ? 1309 SER D C     1 
ATOM   8844  O O     . SER F 5 112 ? -15.639 -5.969  -32.926 1.00 32.32  ? 1309 SER D O     1 
ATOM   8845  C CB    . SER F 5 112 ? -16.390 -6.291  -36.238 1.00 44.38  ? 1309 SER D CB    1 
ATOM   8846  O OG    . SER F 5 112 ? -16.512 -7.680  -36.036 1.00 44.38  ? 1309 SER D OG    1 
ATOM   8847  N N     . GLU F 5 113 ? -14.552 -4.911  -34.522 1.00 30.09  ? 1310 GLU D N     1 
ATOM   8848  C CA    . GLU F 5 113 ? -13.407 -4.852  -33.663 1.00 30.09  ? 1310 GLU D CA    1 
ATOM   8849  C C     . GLU F 5 113 ? -13.677 -4.266  -32.285 1.00 30.09  ? 1310 GLU D C     1 
ATOM   8850  O O     . GLU F 5 113 ? -13.118 -4.709  -31.261 1.00 30.09  ? 1310 GLU D O     1 
ATOM   8851  C CB    . GLU F 5 113 ? -12.290 -4.082  -34.356 1.00 34.84  ? 1310 GLU D CB    1 
ATOM   8852  C CG    . GLU F 5 113 ? -11.819 -4.773  -35.650 1.00 34.84  ? 1310 GLU D CG    1 
ATOM   8853  C CD    . GLU F 5 113 ? -10.491 -5.509  -35.515 1.00 34.84  ? 1310 GLU D CD    1 
ATOM   8854  O OE1   . GLU F 5 113 ? -10.462 -6.534  -34.780 1.00 34.84  ? 1310 GLU D OE1   1 
ATOM   8855  O OE2   . GLU F 5 113 ? -9.474  -5.067  -36.132 1.00 34.84  ? 1310 GLU D OE2   1 
ATOM   8856  N N     . GLY F 5 114 ? -14.557 -3.273  -32.274 1.00 32.71  ? 1311 GLY D N     1 
ATOM   8857  C CA    . GLY F 5 114 ? -14.851 -2.564  -31.039 1.00 32.71  ? 1311 GLY D CA    1 
ATOM   8858  C C     . GLY F 5 114 ? -15.572 -3.435  -30.064 1.00 32.71  ? 1311 GLY D C     1 
ATOM   8859  O O     . GLY F 5 114 ? -15.245 -3.507  -28.916 1.00 32.71  ? 1311 GLY D O     1 
ATOM   8860  N N     . THR F 5 115 ? -16.607 -4.078  -30.527 1.00 31.76  ? 1312 THR D N     1 
ATOM   8861  C CA    . THR F 5 115 ? -17.276 -4.952  -29.632 1.00 31.76  ? 1312 THR D CA    1 
ATOM   8862  C C     . THR F 5 115 ? -16.292 -6.031  -29.139 1.00 31.76  ? 1312 THR D C     1 
ATOM   8863  O O     . THR F 5 115 ? -16.281 -6.396  -27.996 1.00 31.76  ? 1312 THR D O     1 
ATOM   8864  C CB    . THR F 5 115 ? -18.343 -5.730  -30.307 1.00 24.29  ? 1312 THR D CB    1 
ATOM   8865  O OG1   . THR F 5 115 ? -19.216 -4.861  -31.022 1.00 24.29  ? 1312 THR D OG1   1 
ATOM   8866  C CG2   . THR F 5 115 ? -19.011 -6.599  -29.227 1.00 24.29  ? 1312 THR D CG2   1 
ATOM   8867  N N     . LYS F 5 116 ? -15.545 -6.596  -30.068 1.00 38.16  ? 1313 LYS D N     1 
ATOM   8868  C CA    . LYS F 5 116 ? -14.587 -7.633  -29.744 1.00 38.16  ? 1313 LYS D CA    1 
ATOM   8869  C C     . LYS F 5 116 ? -13.727 -7.172  -28.546 1.00 38.16  ? 1313 LYS D C     1 
ATOM   8870  O O     . LYS F 5 116 ? -13.631 -7.839  -27.533 1.00 38.16  ? 1313 LYS D O     1 
ATOM   8871  C CB    . LYS F 5 116 ? -13.701 -7.889  -30.971 1.00 85.22  ? 1313 LYS D CB    1 
ATOM   8872  C CG    . LYS F 5 116 ? -12.710 -8.975  -30.797 1.00 85.22  ? 1313 LYS D CG    1 
ATOM   8873  C CD    . LYS F 5 116 ? -11.996 -9.253  -32.083 1.00 85.22  ? 1313 LYS D CD    1 
ATOM   8874  C CE    . LYS F 5 116 ? -11.511 -10.729 -32.135 1.00 85.22  ? 1313 LYS D CE    1 
ATOM   8875  N NZ    . LYS F 5 116 ? -10.526 -11.169 -31.071 1.00 85.22  ? 1313 LYS D NZ    1 
ATOM   8876  N N     . ALA F 5 117 ? -13.136 -6.003  -28.671 1.00 35.40  ? 1314 ALA D N     1 
ATOM   8877  C CA    . ALA F 5 117 ? -12.299 -5.545  -27.647 1.00 35.40  ? 1314 ALA D CA    1 
ATOM   8878  C C     . ALA F 5 117 ? -13.023 -5.392  -26.310 1.00 35.40  ? 1314 ALA D C     1 
ATOM   8879  O O     . ALA F 5 117 ? -12.569 -5.853  -25.263 1.00 35.40  ? 1314 ALA D O     1 
ATOM   8880  C CB    . ALA F 5 117 ? -11.713 -4.277  -28.076 1.00 18.78  ? 1314 ALA D CB    1 
ATOM   8881  N N     . VAL F 5 118 ? -14.164 -4.753  -26.316 1.00 57.89  ? 1315 VAL D N     1 
ATOM   8882  C CA    . VAL F 5 118 ? -14.837 -4.571  -25.062 1.00 57.89  ? 1315 VAL D CA    1 
ATOM   8883  C C     . VAL F 5 118 ? -15.044 -5.898  -24.363 1.00 57.89  ? 1315 VAL D C     1 
ATOM   8884  O O     . VAL F 5 118 ? -14.564 -6.096  -23.214 1.00 57.89  ? 1315 VAL D O     1 
ATOM   8885  C CB    . VAL F 5 118 ? -16.104 -3.807  -25.298 1.00 51.83  ? 1315 VAL D CB    1 
ATOM   8886  C CG1   . VAL F 5 118 ? -17.002 -3.824  -24.080 1.00 51.83  ? 1315 VAL D CG1   1 
ATOM   8887  C CG2   . VAL F 5 118 ? -15.676 -2.362  -25.633 1.00 51.83  ? 1315 VAL D CG2   1 
ATOM   8888  N N     . THR F 5 119 ? -15.756 -6.797  -25.043 1.00 19.52  ? 1316 THR D N     1 
ATOM   8889  C CA    . THR F 5 119 ? -15.964 -8.149  -24.540 1.00 19.52  ? 1316 THR D CA    1 
ATOM   8890  C C     . THR F 5 119 ? -14.627 -8.734  -24.022 1.00 19.52  ? 1316 THR D C     1 
ATOM   8891  O O     . THR F 5 119 ? -14.561 -9.187  -22.914 1.00 19.52  ? 1316 THR D O     1 
ATOM   8892  C CB    . THR F 5 119 ? -16.481 -9.083  -25.602 1.00 35.13  ? 1316 THR D CB    1 
ATOM   8893  O OG1   . THR F 5 119 ? -17.652 -8.538  -26.214 1.00 35.13  ? 1316 THR D OG1   1 
ATOM   8894  C CG2   . THR F 5 119 ? -16.859 -10.378 -24.957 1.00 35.13  ? 1316 THR D CG2   1 
ATOM   8895  N N     . LYS F 5 120 ? -13.556 -8.753  -24.796 1.00 41.69  ? 1317 LYS D N     1 
ATOM   8896  C CA    . LYS F 5 120 ? -12.324 -9.257  -24.209 1.00 41.69  ? 1317 LYS D CA    1 
ATOM   8897  C C     . LYS F 5 120 ? -11.874 -8.486  -22.953 1.00 41.69  ? 1317 LYS D C     1 
ATOM   8898  O O     . LYS F 5 120 ? -11.396 -9.067  -22.006 1.00 41.69  ? 1317 LYS D O     1 
ATOM   8899  C CB    . LYS F 5 120 ? -11.198 -9.271  -25.249 1.00 52.12  ? 1317 LYS D CB    1 
ATOM   8900  C CG    . LYS F 5 120 ? -9.786  -9.203  -24.693 1.00 52.12  ? 1317 LYS D CG    1 
ATOM   8901  C CD    . LYS F 5 120 ? -8.849  -10.189 -25.378 1.00 52.12  ? 1317 LYS D CD    1 
ATOM   8902  C CE    . LYS F 5 120 ? -7.437  -10.081 -24.759 1.00 52.12  ? 1317 LYS D CE    1 
ATOM   8903  N NZ    . LYS F 5 120 ? -6.418  -11.156 -25.137 1.00 52.12  ? 1317 LYS D NZ    1 
ATOM   8904  N N     . TYR F 5 121 ? -12.030 -7.181  -22.924 1.00 31.82  ? 1318 TYR D N     1 
ATOM   8905  C CA    . TYR F 5 121 ? -11.594 -6.382  -21.762 1.00 31.82  ? 1318 TYR D CA    1 
ATOM   8906  C C     . TYR F 5 121 ? -12.403 -6.744  -20.537 1.00 31.82  ? 1318 TYR D C     1 
ATOM   8907  O O     . TYR F 5 121 ? -11.916 -6.814  -19.434 1.00 31.82  ? 1318 TYR D O     1 
ATOM   8908  C CB    . TYR F 5 121 ? -11.845 -4.926  -22.057 1.00 40.27  ? 1318 TYR D CB    1 
ATOM   8909  C CG    . TYR F 5 121 ? -11.580 -4.032  -20.902 1.00 40.27  ? 1318 TYR D CG    1 
ATOM   8910  C CD1   . TYR F 5 121 ? -10.285 -3.656  -20.618 1.00 40.27  ? 1318 TYR D CD1   1 
ATOM   8911  C CD2   . TYR F 5 121 ? -12.627 -3.546  -20.089 1.00 40.27  ? 1318 TYR D CD2   1 
ATOM   8912  C CE1   . TYR F 5 121 ? -10.007 -2.810  -19.547 1.00 40.27  ? 1318 TYR D CE1   1 
ATOM   8913  C CE2   . TYR F 5 121 ? -12.391 -2.717  -19.030 1.00 40.27  ? 1318 TYR D CE2   1 
ATOM   8914  C CZ    . TYR F 5 121 ? -11.063 -2.346  -18.751 1.00 40.27  ? 1318 TYR D CZ    1 
ATOM   8915  O OH    . TYR F 5 121 ? -10.704 -1.556  -17.660 1.00 40.27  ? 1318 TYR D OH    1 
ATOM   8916  N N     . THR F 5 122 ? -13.684 -6.927  -20.756 1.00 53.72  ? 1319 THR D N     1 
ATOM   8917  C CA    . THR F 5 122 ? -14.562 -7.286  -19.683 1.00 53.72  ? 1319 THR D CA    1 
ATOM   8918  C C     . THR F 5 122 ? -14.331 -8.667  -19.129 1.00 53.72  ? 1319 THR D C     1 
ATOM   8919  O O     . THR F 5 122 ? -14.267 -8.805  -17.937 1.00 53.72  ? 1319 THR D O     1 
ATOM   8920  C CB    . THR F 5 122 ? -15.980 -7.224  -20.135 1.00 75.80  ? 1319 THR D CB    1 
ATOM   8921  O OG1   . THR F 5 122 ? -16.309 -5.862  -20.361 1.00 75.80  ? 1319 THR D OG1   1 
ATOM   8922  C CG2   . THR F 5 122 ? -16.889 -7.795  -19.095 1.00 75.80  ? 1319 THR D CG2   1 
ATOM   8923  N N     . SER F 5 123 ? -14.227 -9.676  -20.005 1.00 52.10  ? 1320 SER D N     1 
ATOM   8924  C CA    . SER F 5 123 ? -14.060 -11.082 -19.636 1.00 52.10  ? 1320 SER D CA    1 
ATOM   8925  C C     . SER F 5 123 ? -12.774 -11.346 -18.895 1.00 52.10  ? 1320 SER D C     1 
ATOM   8926  O O     . SER F 5 123 ? -12.464 -12.493 -18.595 1.00 52.10  ? 1320 SER D O     1 
ATOM   8927  C CB    . SER F 5 123 ? -14.161 -12.004 -20.862 1.00 64.49  ? 1320 SER D CB    1 
ATOM   8928  O OG    . SER F 5 123 ? -12.938 -12.090 -21.577 1.00 64.49  ? 1320 SER D OG    1 
ATOM   8929  N N     . ALA F 5 124 ? -12.032 -10.291 -18.573 1.00 77.79  ? 1321 ALA D N     1 
ATOM   8930  C CA    . ALA F 5 124 ? -10.785 -10.437 -17.815 1.00 77.79  ? 1321 ALA D CA    1 
ATOM   8931  C C     . ALA F 5 124 ? -10.852 -9.691  -16.433 1.00 77.79  ? 1321 ALA D C     1 
ATOM   8932  O O     . ALA F 5 124 ? -11.659 -8.781  -16.267 1.00 77.79  ? 1321 ALA D O     1 
ATOM   8933  C CB    . ALA F 5 124 ? -9.599  -9.938  -18.679 1.00 48.88  ? 1321 ALA D CB    1 
ATOM   8934  N N     . LYS F 5 125 ? -10.038 -10.087 -15.444 1.00 135.80 ? 1322 LYS D N     1 
ATOM   8935  C CA    . LYS F 5 125 ? -10.011 -9.456  -14.088 1.00 135.80 ? 1322 LYS D CA    1 
ATOM   8936  C C     . LYS F 5 125 ? -11.249 -9.787  -13.243 1.00 135.80 ? 1322 LYS D C     1 
ATOM   8937  O O     . LYS F 5 125 ? -11.990 -8.812  -12.921 1.00 135.80 ? 1322 LYS D O     1 
ATOM   8938  C CB    . LYS F 5 125 ? -9.853  -7.916  -14.193 1.00 83.07  ? 1322 LYS D CB    1 
ATOM   8939  C CG    . LYS F 5 125 ? -9.557  -7.094  -12.905 1.00 83.07  ? 1322 LYS D CG    1 
ATOM   8940  C CD    . LYS F 5 125 ? -9.201  -5.661  -13.303 1.00 83.07  ? 1322 LYS D CD    1 
ATOM   8941  C CE    . LYS F 5 125 ? -8.470  -4.973  -12.210 1.00 83.07  ? 1322 LYS D CE    1 
ATOM   8942  N NZ    . LYS F 5 125 ? -7.881  -3.647  -12.554 1.00 83.07  ? 1322 LYS D NZ    1 
ATOM   8943  O OXT   . LYS F 5 125 ? -11.447 -11.005 -12.919 1.00 83.07  ? 1322 LYS D OXT   1 
ATOM   8944  N N     . LYS G 2 37  ? 11.517  22.408  -91.241 1.00 80.18  ? 637  LYS E N     1 
ATOM   8945  C CA    . LYS G 2 37  ? 12.380  21.242  -90.842 1.00 80.18  ? 637  LYS E CA    1 
ATOM   8946  C C     . LYS G 2 37  ? 12.408  21.018  -89.288 1.00 80.18  ? 637  LYS E C     1 
ATOM   8947  O O     . LYS G 2 37  ? 12.036  19.930  -88.829 1.00 80.18  ? 637  LYS E O     1 
ATOM   8948  C CB    . LYS G 2 37  ? 13.809  21.401  -91.452 1.00 87.95  ? 637  LYS E CB    1 
ATOM   8949  C CG    . LYS G 2 37  ? 14.505  20.100  -91.901 1.00 87.95  ? 637  LYS E CG    1 
ATOM   8950  C CD    . LYS G 2 37  ? 14.891  19.243  -90.678 1.00 87.95  ? 637  LYS E CD    1 
ATOM   8951  C CE    . LYS G 2 37  ? 15.248  17.742  -90.985 1.00 87.95  ? 637  LYS E CE    1 
ATOM   8952  N NZ    . LYS G 2 37  ? 15.644  16.880  -89.770 1.00 87.95  ? 637  LYS E NZ    1 
ATOM   8953  N N     . PRO G 2 38  ? 12.803  22.042  -88.463 1.00 88.13  ? 638  PRO E N     1 
ATOM   8954  C CA    . PRO G 2 38  ? 12.852  21.898  -86.989 1.00 88.13  ? 638  PRO E CA    1 
ATOM   8955  C C     . PRO G 2 38  ? 11.632  21.212  -86.370 1.00 88.13  ? 638  PRO E C     1 
ATOM   8956  O O     . PRO G 2 38  ? 10.470  21.520  -86.685 1.00 88.13  ? 638  PRO E O     1 
ATOM   8957  C CB    . PRO G 2 38  ? 12.954  23.337  -86.491 1.00 57.81  ? 638  PRO E CB    1 
ATOM   8958  C CG    . PRO G 2 38  ? 13.716  24.014  -87.578 1.00 57.81  ? 638  PRO E CG    1 
ATOM   8959  C CD    . PRO G 2 38  ? 13.032  23.457  -88.826 1.00 57.81  ? 638  PRO E CD    1 
ATOM   8960  N N     . HIS G 2 39  ? 11.916  20.286  -85.464 1.00 82.50  ? 639  HIS E N     1 
ATOM   8961  C CA    . HIS G 2 39  ? 10.868  19.535  -84.768 1.00 82.50  ? 639  HIS E CA    1 
ATOM   8962  C C     . HIS G 2 39  ? 9.958   20.538  -84.082 1.00 82.50  ? 639  HIS E C     1 
ATOM   8963  O O     . HIS G 2 39  ? 10.412  21.599  -83.589 1.00 82.50  ? 639  HIS E O     1 
ATOM   8964  C CB    . HIS G 2 39  ? 11.490  18.601  -83.711 1.00 91.41  ? 639  HIS E CB    1 
ATOM   8965  C CG    . HIS G 2 39  ? 10.553  17.565  -83.162 1.00 91.41  ? 639  HIS E CG    1 
ATOM   8966  N ND1   . HIS G 2 39  ? 9.403   17.885  -82.477 1.00 91.41  ? 639  HIS E ND1   1 
ATOM   8967  C CD2   . HIS G 2 39  ? 10.630  16.208  -83.148 1.00 91.41  ? 639  HIS E CD2   1 
ATOM   8968  C CE1   . HIS G 2 39  ? 8.816   16.775  -82.064 1.00 91.41  ? 639  HIS E CE1   1 
ATOM   8969  N NE2   . HIS G 2 39  ? 9.540   15.742  -82.457 1.00 91.41  ? 639  HIS E NE2   1 
ATOM   8970  N N     . ARG G 2 40  ? 8.667   20.201  -84.073 1.00 47.46  ? 640  ARG E N     1 
ATOM   8971  C CA    . ARG G 2 40  ? 7.648   21.037  -83.427 1.00 47.46  ? 640  ARG E CA    1 
ATOM   8972  C C     . ARG G 2 40  ? 6.430   20.183  -83.074 1.00 47.46  ? 640  ARG E C     1 
ATOM   8973  O O     . ARG G 2 40  ? 5.773   19.653  -83.975 1.00 47.46  ? 640  ARG E O     1 
ATOM   8974  C CB    . ARG G 2 40  ? 7.299   22.249  -84.335 1.00 36.38  ? 640  ARG E CB    1 
ATOM   8975  C CG    . ARG G 2 40  ? 6.208   23.129  -83.838 1.00 36.38  ? 640  ARG E CG    1 
ATOM   8976  C CD    . ARG G 2 40  ? 6.136   24.481  -84.492 1.00 36.38  ? 640  ARG E CD    1 
ATOM   8977  N NE    . ARG G 2 40  ? 6.929   25.457  -83.756 1.00 36.38  ? 640  ARG E NE    1 
ATOM   8978  C CZ    . ARG G 2 40  ? 6.483   26.301  -82.799 1.00 36.38  ? 640  ARG E CZ    1 
ATOM   8979  N NH1   . ARG G 2 40  ? 5.179   26.369  -82.411 1.00 36.38  ? 640  ARG E NH1   1 
ATOM   8980  N NH2   . ARG G 2 40  ? 7.394   27.020  -82.134 1.00 36.38  ? 640  ARG E NH2   1 
ATOM   8981  N N     . TYR G 2 41  ? 6.198   20.005  -81.758 1.00 28.22  ? 641  TYR E N     1 
ATOM   8982  C CA    . TYR G 2 41  ? 5.045   19.258  -81.228 1.00 28.22  ? 641  TYR E CA    1 
ATOM   8983  C C     . TYR G 2 41  ? 3.749   20.036  -81.467 1.00 28.22  ? 641  TYR E C     1 
ATOM   8984  O O     . TYR G 2 41  ? 3.712   21.269  -81.355 1.00 28.22  ? 641  TYR E O     1 
ATOM   8985  C CB    . TYR G 2 41  ? 5.177   19.070  -79.750 1.00 23.47  ? 641  TYR E CB    1 
ATOM   8986  C CG    . TYR G 2 41  ? 6.173   18.022  -79.404 1.00 23.47  ? 641  TYR E CG    1 
ATOM   8987  C CD1   . TYR G 2 41  ? 7.381   18.365  -78.878 1.00 23.47  ? 641  TYR E CD1   1 
ATOM   8988  C CD2   . TYR G 2 41  ? 5.907   16.647  -79.597 1.00 23.47  ? 641  TYR E CD2   1 
ATOM   8989  C CE1   . TYR G 2 41  ? 8.297   17.409  -78.560 1.00 23.47  ? 641  TYR E CE1   1 
ATOM   8990  C CE2   . TYR G 2 41  ? 6.814   15.717  -79.269 1.00 23.47  ? 641  TYR E CE2   1 
ATOM   8991  C CZ    . TYR G 2 41  ? 8.024   16.121  -78.759 1.00 23.47  ? 641  TYR E CZ    1 
ATOM   8992  O OH    . TYR G 2 41  ? 9.075   15.265  -78.549 1.00 23.47  ? 641  TYR E OH    1 
ATOM   8993  N N     . ARG G 2 42  ? 2.676   19.332  -81.802 1.00 21.48  ? 642  ARG E N     1 
ATOM   8994  C CA    . ARG G 2 42  ? 1.433   19.999  -82.075 1.00 21.48  ? 642  ARG E CA    1 
ATOM   8995  C C     . ARG G 2 42  ? 0.811   20.646  -80.799 1.00 21.48  ? 642  ARG E C     1 
ATOM   8996  O O     . ARG G 2 42  ? 0.885   20.118  -79.652 1.00 21.48  ? 642  ARG E O     1 
ATOM   8997  C CB    . ARG G 2 42  ? 0.554   18.957  -82.707 1.00 65.42  ? 642  ARG E CB    1 
ATOM   8998  C CG    . ARG G 2 42  ? 1.276   18.302  -83.830 1.00 65.42  ? 642  ARG E CG    1 
ATOM   8999  C CD    . ARG G 2 42  ? 0.432   17.236  -84.432 1.00 65.42  ? 642  ARG E CD    1 
ATOM   9000  N NE    . ARG G 2 42  ? -0.861  17.769  -84.872 1.00 65.42  ? 642  ARG E NE    1 
ATOM   9001  C CZ    . ARG G 2 42  ? -2.028  17.109  -84.824 1.00 65.42  ? 642  ARG E CZ    1 
ATOM   9002  N NH1   . ARG G 2 42  ? -2.088  15.856  -84.354 1.00 65.42  ? 642  ARG E NH1   1 
ATOM   9003  N NH2   . ARG G 2 42  ? -3.140  17.724  -85.224 1.00 65.42  ? 642  ARG E NH2   1 
ATOM   9004  N N     . PRO G 2 43  ? 0.218   21.812  -80.953 1.00 34.84  ? 643  PRO E N     1 
ATOM   9005  C CA    . PRO G 2 43  ? -0.368  22.370  -79.757 1.00 34.84  ? 643  PRO E CA    1 
ATOM   9006  C C     . PRO G 2 43  ? -1.207  21.342  -78.938 1.00 34.84  ? 643  PRO E C     1 
ATOM   9007  O O     . PRO G 2 43  ? -2.193  20.763  -79.450 1.00 34.84  ? 643  PRO E O     1 
ATOM   9008  C CB    . PRO G 2 43  ? -1.236  23.457  -80.326 1.00 38.77  ? 643  PRO E CB    1 
ATOM   9009  C CG    . PRO G 2 43  ? -1.681  22.877  -81.538 1.00 38.77  ? 643  PRO E CG    1 
ATOM   9010  C CD    . PRO G 2 43  ? -0.424  22.391  -82.116 1.00 38.77  ? 643  PRO E CD    1 
ATOM   9011  N N     . GLY G 2 44  ? -0.793  21.133  -77.681 1.00 19.31  ? 644  GLY E N     1 
ATOM   9012  C CA    . GLY G 2 44  ? -1.476  20.232  -76.766 1.00 19.31  ? 644  GLY E CA    1 
ATOM   9013  C C     . GLY G 2 44  ? -0.680  18.978  -76.398 1.00 19.31  ? 644  GLY E C     1 
ATOM   9014  O O     . GLY G 2 44  ? -0.973  18.286  -75.405 1.00 19.31  ? 644  GLY E O     1 
ATOM   9015  N N     . THR G 2 45  ? 0.322   18.646  -77.190 1.00 25.00  ? 645  THR E N     1 
ATOM   9016  C CA    . THR G 2 45  ? 1.060   17.469  -76.910 1.00 25.00  ? 645  THR E CA    1 
ATOM   9017  C C     . THR G 2 45  ? 1.803   17.770  -75.621 1.00 25.00  ? 645  THR E C     1 
ATOM   9018  O O     . THR G 2 45  ? 1.754   16.983  -74.681 1.00 25.00  ? 645  THR E O     1 
ATOM   9019  C CB    . THR G 2 45  ? 1.991   17.160  -78.135 1.00 32.35  ? 645  THR E CB    1 
ATOM   9020  O OG1   . THR G 2 45  ? 1.220   17.171  -79.332 1.00 32.35  ? 645  THR E OG1   1 
ATOM   9021  C CG2   . THR G 2 45  ? 2.586   15.883  -78.038 1.00 32.35  ? 645  THR E CG2   1 
ATOM   9022  N N     . VAL G 2 46  ? 2.475   18.902  -75.551 1.00 31.07  ? 646  VAL E N     1 
ATOM   9023  C CA    . VAL G 2 46  ? 3.214   19.240  -74.364 1.00 31.07  ? 646  VAL E CA    1 
ATOM   9024  C C     . VAL G 2 46  ? 2.273   19.396  -73.175 1.00 31.07  ? 646  VAL E C     1 
ATOM   9025  O O     . VAL G 2 46  ? 2.591   18.985  -72.072 1.00 31.07  ? 646  VAL E O     1 
ATOM   9026  C CB    . VAL G 2 46  ? 3.994   20.571  -74.527 1.00 27.39  ? 646  VAL E CB    1 
ATOM   9027  C CG1   . VAL G 2 46  ? 5.084   20.702  -73.490 1.00 27.39  ? 646  VAL E CG1   1 
ATOM   9028  C CG2   . VAL G 2 46  ? 4.606   20.635  -75.849 1.00 27.39  ? 646  VAL E CG2   1 
ATOM   9029  N N     . ALA G 2 47  ? 1.113   20.008  -73.383 1.00 30.69  ? 647  ALA E N     1 
ATOM   9030  C CA    . ALA G 2 47  ? 0.137   20.199  -72.310 1.00 30.69  ? 647  ALA E CA    1 
ATOM   9031  C C     . ALA G 2 47  ? -0.195  18.889  -71.634 1.00 30.69  ? 647  ALA E C     1 
ATOM   9032  O O     . ALA G 2 47  ? -0.183  18.816  -70.389 1.00 30.69  ? 647  ALA E O     1 
ATOM   9033  C CB    . ALA G 2 47  ? -1.131  20.830  -72.837 1.00 47.86  ? 647  ALA E CB    1 
ATOM   9034  N N     . LEU G 2 48  ? -0.500  17.857  -72.432 1.00 27.66  ? 648  LEU E N     1 
ATOM   9035  C CA    . LEU G 2 48  ? -0.878  16.558  -71.891 1.00 27.66  ? 648  LEU E CA    1 
ATOM   9036  C C     . LEU G 2 48  ? 0.340   16.030  -71.236 1.00 27.66  ? 648  LEU E C     1 
ATOM   9037  O O     . LEU G 2 48  ? 0.242   15.371  -70.243 1.00 27.66  ? 648  LEU E O     1 
ATOM   9038  C CB    . LEU G 2 48  ? -1.350  15.597  -72.977 1.00 28.99  ? 648  LEU E CB    1 
ATOM   9039  C CG    . LEU G 2 48  ? -2.789  15.893  -73.443 1.00 28.99  ? 648  LEU E CG    1 
ATOM   9040  C CD1   . LEU G 2 48  ? -3.101  15.157  -74.692 1.00 28.99  ? 648  LEU E CD1   1 
ATOM   9041  C CD2   . LEU G 2 48  ? -3.795  15.448  -72.363 1.00 28.99  ? 648  LEU E CD2   1 
ATOM   9042  N N     . ARG G 2 49  ? 1.493   16.351  -71.773 1.00 28.74  ? 649  ARG E N     1 
ATOM   9043  C CA    . ARG G 2 49  ? 2.694   15.881  -71.195 1.00 28.74  ? 649  ARG E CA    1 
ATOM   9044  C C     . ARG G 2 49  ? 2.820   16.489  -69.779 1.00 28.74  ? 649  ARG E C     1 
ATOM   9045  O O     . ARG G 2 49  ? 3.286   15.859  -68.797 1.00 28.74  ? 649  ARG E O     1 
ATOM   9046  C CB    . ARG G 2 49  ? 3.839   16.336  -72.105 1.00 48.52  ? 649  ARG E CB    1 
ATOM   9047  C CG    . ARG G 2 49  ? 4.951   15.350  -72.307 1.00 48.52  ? 649  ARG E CG    1 
ATOM   9048  C CD    . ARG G 2 49  ? 6.313   15.982  -72.334 1.00 48.52  ? 649  ARG E CD    1 
ATOM   9049  N NE    . ARG G 2 49  ? 6.645   16.811  -73.516 1.00 48.52  ? 649  ARG E NE    1 
ATOM   9050  C CZ    . ARG G 2 49  ? 6.619   16.421  -74.792 1.00 48.52  ? 649  ARG E CZ    1 
ATOM   9051  N NH1   . ARG G 2 49  ? 6.267   15.164  -75.148 1.00 48.52  ? 649  ARG E NH1   1 
ATOM   9052  N NH2   . ARG G 2 49  ? 6.944   17.306  -75.719 1.00 48.52  ? 649  ARG E NH2   1 
ATOM   9053  N N     . GLU G 2 50  ? 2.387   17.735  -69.647 1.00 30.73  ? 650  GLU E N     1 
ATOM   9054  C CA    . GLU G 2 50  ? 2.514   18.364  -68.350 1.00 30.73  ? 650  GLU E CA    1 
ATOM   9055  C C     . GLU G 2 50  ? 1.481   17.858  -67.392 1.00 30.73  ? 650  GLU E C     1 
ATOM   9056  O O     . GLU G 2 50  ? 1.765   17.712  -66.230 1.00 30.73  ? 650  GLU E O     1 
ATOM   9057  C CB    . GLU G 2 50  ? 2.493   19.872  -68.492 1.00 34.22  ? 650  GLU E CB    1 
ATOM   9058  C CG    . GLU G 2 50  ? 3.636   20.452  -69.295 1.00 34.22  ? 650  GLU E CG    1 
ATOM   9059  C CD    . GLU G 2 50  ? 3.528   21.994  -69.583 1.00 34.22  ? 650  GLU E CD    1 
ATOM   9060  O OE1   . GLU G 2 50  ? 4.343   22.466  -70.424 1.00 34.22  ? 650  GLU E OE1   1 
ATOM   9061  O OE2   . GLU G 2 50  ? 2.670   22.761  -69.003 1.00 34.22  ? 650  GLU E OE2   1 
ATOM   9062  N N     . ILE G 2 51  ? 0.278   17.582  -67.843 1.00 25.21  ? 651  ILE E N     1 
ATOM   9063  C CA    . ILE G 2 51  ? -0.627  16.995  -66.894 1.00 25.21  ? 651  ILE E CA    1 
ATOM   9064  C C     . ILE G 2 51  ? -0.017  15.699  -66.380 1.00 25.21  ? 651  ILE E C     1 
ATOM   9065  O O     . ILE G 2 51  ? 0.097   15.474  -65.189 1.00 25.21  ? 651  ILE E O     1 
ATOM   9066  C CB    . ILE G 2 51  ? -1.929  16.674  -67.492 1.00 12.00  ? 651  ILE E CB    1 
ATOM   9067  C CG1   . ILE G 2 51  ? -2.529  17.985  -68.049 1.00 12.00  ? 651  ILE E CG1   1 
ATOM   9068  C CG2   . ILE G 2 51  ? -2.807  15.992  -66.461 1.00 12.00  ? 651  ILE E CG2   1 
ATOM   9069  C CD1   . ILE G 2 51  ? -3.643  17.847  -69.098 1.00 12.00  ? 651  ILE E CD1   1 
ATOM   9070  N N     . ARG G 2 52  ? 0.442   14.843  -67.261 1.00 29.50  ? 652  ARG E N     1 
ATOM   9071  C CA    . ARG G 2 52  ? 1.024   13.584  -66.793 1.00 29.50  ? 652  ARG E CA    1 
ATOM   9072  C C     . ARG G 2 52  ? 2.125   13.786  -65.784 1.00 29.50  ? 652  ARG E C     1 
ATOM   9073  O O     . ARG G 2 52  ? 2.228   13.104  -64.821 1.00 29.50  ? 652  ARG E O     1 
ATOM   9074  C CB    . ARG G 2 52  ? 1.506   12.756  -67.998 1.00 39.00  ? 652  ARG E CB    1 
ATOM   9075  C CG    . ARG G 2 52  ? 0.324   12.266  -68.911 1.00 39.00  ? 652  ARG E CG    1 
ATOM   9076  C CD    . ARG G 2 52  ? 0.698   11.302  -70.034 1.00 39.00  ? 652  ARG E CD    1 
ATOM   9077  N NE    . ARG G 2 52  ? 0.106   11.644  -71.327 1.00 39.00  ? 652  ARG E NE    1 
ATOM   9078  C CZ    . ARG G 2 52  ? -1.104  11.259  -71.719 1.00 39.00  ? 652  ARG E CZ    1 
ATOM   9079  N NH1   . ARG G 2 52  ? -1.876  10.508  -70.886 1.00 39.00  ? 652  ARG E NH1   1 
ATOM   9080  N NH2   . ARG G 2 52  ? -1.513  11.585  -72.959 1.00 39.00  ? 652  ARG E NH2   1 
ATOM   9081  N N     . ARG G 2 53  ? 2.922   14.782  -66.010 1.00 34.98  ? 653  ARG E N     1 
ATOM   9082  C CA    . ARG G 2 53  ? 3.994   15.045  -65.150 1.00 34.98  ? 653  ARG E CA    1 
ATOM   9083  C C     . ARG G 2 53  ? 3.588   15.545  -63.814 1.00 34.98  ? 653  ARG E C     1 
ATOM   9084  O O     . ARG G 2 53  ? 4.010   15.081  -62.743 1.00 34.98  ? 653  ARG E O     1 
ATOM   9085  C CB    . ARG G 2 53  ? 4.815   16.104  -65.759 1.00 42.84  ? 653  ARG E CB    1 
ATOM   9086  C CG    . ARG G 2 53  ? 5.927   16.371  -64.899 1.00 42.84  ? 653  ARG E CG    1 
ATOM   9087  C CD    . ARG G 2 53  ? 6.679   17.536  -65.320 1.00 42.84  ? 653  ARG E CD    1 
ATOM   9088  N NE    . ARG G 2 53  ? 7.604   17.956  -64.280 1.00 42.84  ? 653  ARG E NE    1 
ATOM   9089  C CZ    . ARG G 2 53  ? 8.442   18.973  -64.450 1.00 42.84  ? 653  ARG E CZ    1 
ATOM   9090  N NH1   . ARG G 2 53  ? 8.410   19.635  -65.594 1.00 42.84  ? 653  ARG E NH1   1 
ATOM   9091  N NH2   . ARG G 2 53  ? 9.366   19.280  -63.536 1.00 42.84  ? 653  ARG E NH2   1 
ATOM   9092  N N     . TYR G 2 54  ? 2.786   16.571  -63.852 1.00 31.11  ? 654  TYR E N     1 
ATOM   9093  C CA    . TYR G 2 54  ? 2.440   17.159  -62.611 1.00 31.11  ? 654  TYR E CA    1 
ATOM   9094  C C     . TYR G 2 54  ? 1.575   16.313  -61.744 1.00 31.11  ? 654  TYR E C     1 
ATOM   9095  O O     . TYR G 2 54  ? 1.717   16.359  -60.521 1.00 31.11  ? 654  TYR E O     1 
ATOM   9096  C CB    . TYR G 2 54  ? 1.860   18.535  -62.889 1.00 21.63  ? 654  TYR E CB    1 
ATOM   9097  C CG    . TYR G 2 54  ? 2.955   19.528  -63.151 1.00 21.63  ? 654  TYR E CG    1 
ATOM   9098  C CD1   . TYR G 2 54  ? 3.021   20.250  -64.371 1.00 21.63  ? 654  TYR E CD1   1 
ATOM   9099  C CD2   . TYR G 2 54  ? 4.028   19.611  -62.269 1.00 21.63  ? 654  TYR E CD2   1 
ATOM   9100  C CE1   . TYR G 2 54  ? 4.153   20.995  -64.695 1.00 21.63  ? 654  TYR E CE1   1 
ATOM   9101  C CE2   . TYR G 2 54  ? 5.139   20.329  -62.580 1.00 21.63  ? 654  TYR E CE2   1 
ATOM   9102  C CZ    . TYR G 2 54  ? 5.193   21.008  -63.787 1.00 21.63  ? 654  TYR E CZ    1 
ATOM   9103  O OH    . TYR G 2 54  ? 6.290   21.681  -64.058 1.00 21.63  ? 654  TYR E OH    1 
ATOM   9104  N N     . GLN G 2 55  ? 0.690   15.552  -62.385 1.00 35.43  ? 655  GLN E N     1 
ATOM   9105  C CA    . GLN G 2 55  ? -0.201  14.688  -61.673 1.00 35.43  ? 655  GLN E CA    1 
ATOM   9106  C C     . GLN G 2 55  ? 0.560   13.525  -61.103 1.00 35.43  ? 655  GLN E C     1 
ATOM   9107  O O     . GLN G 2 55  ? 0.082   12.791  -60.246 1.00 35.43  ? 655  GLN E O     1 
ATOM   9108  C CB    . GLN G 2 55  ? -1.268  14.164  -62.574 1.00 14.46  ? 655  GLN E CB    1 
ATOM   9109  C CG    . GLN G 2 55  ? -2.285  15.195  -62.945 1.00 14.46  ? 655  GLN E CG    1 
ATOM   9110  C CD    . GLN G 2 55  ? -3.569  14.624  -63.584 1.00 14.46  ? 655  GLN E CD    1 
ATOM   9111  O OE1   . GLN G 2 55  ? -3.608  13.512  -64.062 1.00 14.46  ? 655  GLN E OE1   1 
ATOM   9112  N NE2   . GLN G 2 55  ? -4.608  15.414  -63.595 1.00 14.46  ? 655  GLN E NE2   1 
ATOM   9113  N N     . LYS G 2 56  ? 1.774   13.343  -61.556 1.00 27.17  ? 656  LYS E N     1 
ATOM   9114  C CA    . LYS G 2 56  ? 2.518   12.223  -61.094 1.00 27.17  ? 656  LYS E CA    1 
ATOM   9115  C C     . LYS G 2 56  ? 3.331   12.610  -59.887 1.00 27.17  ? 656  LYS E C     1 
ATOM   9116  O O     . LYS G 2 56  ? 3.848   11.747  -59.228 1.00 27.17  ? 656  LYS E O     1 
ATOM   9117  C CB    . LYS G 2 56  ? 3.382   11.747  -62.238 1.00 57.19  ? 656  LYS E CB    1 
ATOM   9118  C CG    . LYS G 2 56  ? 4.224   10.607  -61.919 1.00 57.19  ? 656  LYS E CG    1 
ATOM   9119  C CD    . LYS G 2 56  ? 4.966   9.956   -63.161 1.00 57.19  ? 656  LYS E CD    1 
ATOM   9120  C CE    . LYS G 2 56  ? 6.205   9.117   -62.567 1.00 57.19  ? 656  LYS E CE    1 
ATOM   9121  N NZ    . LYS G 2 56  ? 7.208   8.368   -63.397 1.00 57.19  ? 656  LYS E NZ    1 
ATOM   9122  N N     . SER G 2 57  ? 3.395   13.884  -59.518 1.00 22.08  ? 657  SER E N     1 
ATOM   9123  C CA    . SER G 2 57  ? 4.260   14.273  -58.437 1.00 22.08  ? 657  SER E CA    1 
ATOM   9124  C C     . SER G 2 57  ? 3.601   15.143  -57.364 1.00 22.08  ? 657  SER E C     1 
ATOM   9125  O O     . SER G 2 57  ? 2.408   15.486  -57.490 1.00 22.08  ? 657  SER E O     1 
ATOM   9126  C CB    . SER G 2 57  ? 5.381   15.044  -59.029 1.00 29.92  ? 657  SER E CB    1 
ATOM   9127  O OG    . SER G 2 57  ? 4.939   16.352  -59.311 1.00 29.92  ? 657  SER E OG    1 
ATOM   9128  N N     . THR G 2 58  ? 4.365   15.575  -56.349 1.00 21.75  ? 658  THR E N     1 
ATOM   9129  C CA    . THR G 2 58  ? 3.697   16.322  -55.319 1.00 21.75  ? 658  THR E CA    1 
ATOM   9130  C C     . THR G 2 58  ? 4.416   17.560  -54.833 1.00 21.75  ? 658  THR E C     1 
ATOM   9131  O O     . THR G 2 58  ? 4.118   18.023  -53.773 1.00 21.75  ? 658  THR E O     1 
ATOM   9132  C CB    . THR G 2 58  ? 3.302   15.335  -54.062 1.00 20.95  ? 658  THR E CB    1 
ATOM   9133  O OG1   . THR G 2 58  ? 4.377   15.069  -53.176 1.00 20.95  ? 658  THR E OG1   1 
ATOM   9134  C CG2   . THR G 2 58  ? 2.974   14.011  -54.509 1.00 20.95  ? 658  THR E CG2   1 
ATOM   9135  N N     . GLU G 2 59  ? 5.375   18.096  -55.580 1.00 19.52  ? 659  GLU E N     1 
ATOM   9136  C CA    . GLU G 2 59  ? 6.053   19.276  -55.060 1.00 19.52  ? 659  GLU E CA    1 
ATOM   9137  C C     . GLU G 2 59  ? 5.090   20.389  -55.188 1.00 19.52  ? 659  GLU E C     1 
ATOM   9138  O O     . GLU G 2 59  ? 4.127   20.286  -55.987 1.00 19.52  ? 659  GLU E O     1 
ATOM   9139  C CB    . GLU G 2 59  ? 7.282   19.733  -55.819 1.00 48.79  ? 659  GLU E CB    1 
ATOM   9140  C CG    . GLU G 2 59  ? 7.660   18.920  -56.967 1.00 48.79  ? 659  GLU E CG    1 
ATOM   9141  C CD    . GLU G 2 59  ? 6.839   19.188  -58.203 1.00 48.79  ? 659  GLU E CD    1 
ATOM   9142  O OE1   . GLU G 2 59  ? 6.961   20.306  -58.779 1.00 48.79  ? 659  GLU E OE1   1 
ATOM   9143  O OE2   . GLU G 2 59  ? 6.087   18.248  -58.590 1.00 48.79  ? 659  GLU E OE2   1 
ATOM   9144  N N     . LEU G 2 60  ? 5.335   21.444  -54.399 1.00 29.08  ? 660  LEU E N     1 
ATOM   9145  C CA    . LEU G 2 60  ? 4.492   22.591  -54.492 1.00 29.08  ? 660  LEU E CA    1 
ATOM   9146  C C     . LEU G 2 60  ? 4.806   23.265  -55.819 1.00 29.08  ? 660  LEU E C     1 
ATOM   9147  O O     . LEU G 2 60  ? 5.836   23.066  -56.372 1.00 29.08  ? 660  LEU E O     1 
ATOM   9148  C CB    . LEU G 2 60  ? 4.730   23.504  -53.340 1.00 15.77  ? 660  LEU E CB    1 
ATOM   9149  C CG    . LEU G 2 60  ? 4.128   22.949  -52.079 1.00 15.77  ? 660  LEU E CG    1 
ATOM   9150  C CD1   . LEU G 2 60  ? 4.647   23.755  -50.939 1.00 15.77  ? 660  LEU E CD1   1 
ATOM   9151  C CD2   . LEU G 2 60  ? 2.597   22.957  -52.109 1.00 15.77  ? 660  LEU E CD2   1 
ATOM   9152  N N     . LEU G 2 61  ? 3.936   24.100  -56.317 1.00 20.27  ? 661  LEU E N     1 
ATOM   9153  C CA    . LEU G 2 61  ? 4.162   24.640  -57.601 1.00 20.27  ? 661  LEU E CA    1 
ATOM   9154  C C     . LEU G 2 61  ? 4.253   26.115  -57.563 1.00 20.27  ? 661  LEU E C     1 
ATOM   9155  O O     . LEU G 2 61  ? 4.580   26.763  -58.587 1.00 20.27  ? 661  LEU E O     1 
ATOM   9156  C CB    . LEU G 2 61  ? 3.000   24.234  -58.471 1.00 25.97  ? 661  LEU E CB    1 
ATOM   9157  C CG    . LEU G 2 61  ? 2.810   22.714  -58.521 1.00 25.97  ? 661  LEU E CG    1 
ATOM   9158  C CD1   . LEU G 2 61  ? 1.688   22.243  -59.400 1.00 25.97  ? 661  LEU E CD1   1 
ATOM   9159  C CD2   . LEU G 2 61  ? 4.063   22.212  -59.047 1.00 25.97  ? 661  LEU E CD2   1 
ATOM   9160  N N     . ILE G 2 62  ? 3.950   26.709  -56.407 1.00 16.27  ? 662  ILE E N     1 
ATOM   9161  C CA    . ILE G 2 62  ? 4.046   28.160  -56.390 1.00 16.27  ? 662  ILE E CA    1 
ATOM   9162  C C     . ILE G 2 62  ? 5.407   28.465  -55.796 1.00 16.27  ? 662  ILE E C     1 
ATOM   9163  O O     . ILE G 2 62  ? 5.841   27.756  -54.879 1.00 16.27  ? 662  ILE E O     1 
ATOM   9164  C CB    . ILE G 2 62  ? 2.884   28.789  -55.586 1.00 24.63  ? 662  ILE E CB    1 
ATOM   9165  C CG1   . ILE G 2 62  ? 1.567   28.617  -56.355 1.00 24.63  ? 662  ILE E CG1   1 
ATOM   9166  C CG2   . ILE G 2 62  ? 3.095   30.285  -55.342 1.00 24.63  ? 662  ILE E CG2   1 
ATOM   9167  C CD1   . ILE G 2 62  ? 0.352   29.085  -55.511 1.00 24.63  ? 662  ILE E CD1   1 
ATOM   9168  N N     . ARG G 2 63  ? 6.099   29.480  -56.351 1.00 28.07  ? 663  ARG E N     1 
ATOM   9169  C CA    . ARG G 2 63  ? 7.439   29.822  -55.848 1.00 28.07  ? 663  ARG E CA    1 
ATOM   9170  C C     . ARG G 2 63  ? 7.342   29.991  -54.323 1.00 28.07  ? 663  ARG E C     1 
ATOM   9171  O O     . ARG G 2 63  ? 6.440   30.640  -53.826 1.00 28.07  ? 663  ARG E O     1 
ATOM   9172  C CB    . ARG G 2 63  ? 7.914   31.120  -56.464 1.00 55.79  ? 663  ARG E CB    1 
ATOM   9173  C CG    . ARG G 2 63  ? 8.010   31.153  -57.962 1.00 55.79  ? 663  ARG E CG    1 
ATOM   9174  C CD    . ARG G 2 63  ? 9.281   30.521  -58.389 1.00 55.79  ? 663  ARG E CD    1 
ATOM   9175  N NE    . ARG G 2 63  ? 9.404   29.246  -57.691 1.00 55.79  ? 663  ARG E NE    1 
ATOM   9176  C CZ    . ARG G 2 63  ? 10.537  28.558  -57.545 1.00 55.79  ? 663  ARG E CZ    1 
ATOM   9177  N NH1   . ARG G 2 63  ? 11.677  29.061  -58.057 1.00 55.79  ? 663  ARG E NH1   1 
ATOM   9178  N NH2   . ARG G 2 63  ? 10.513  27.353  -56.928 1.00 55.79  ? 663  ARG E NH2   1 
ATOM   9179  N N     . LYS G 2 64  ? 8.292   29.446  -53.569 1.00 23.01  ? 664  LYS E N     1 
ATOM   9180  C CA    . LYS G 2 64  ? 8.190   29.541  -52.110 1.00 23.01  ? 664  LYS E CA    1 
ATOM   9181  C C     . LYS G 2 64  ? 8.229   30.923  -51.577 1.00 23.01  ? 664  LYS E C     1 
ATOM   9182  O O     . LYS G 2 64  ? 7.327   31.399  -50.909 1.00 23.01  ? 664  LYS E O     1 
ATOM   9183  C CB    . LYS G 2 64  ? 9.206   28.683  -51.423 1.00 53.55  ? 664  LYS E CB    1 
ATOM   9184  C CG    . LYS G 2 64  ? 8.738   27.244  -51.459 1.00 53.55  ? 664  LYS E CG    1 
ATOM   9185  C CD    . LYS G 2 64  ? 9.688   26.313  -50.656 1.00 53.55  ? 664  LYS E CD    1 
ATOM   9186  C CE    . LYS G 2 64  ? 9.173   24.873  -50.555 1.00 53.55  ? 664  LYS E CE    1 
ATOM   9187  N NZ    . LYS G 2 64  ? 7.746   24.938  -50.076 1.00 53.55  ? 664  LYS E NZ    1 
ATOM   9188  N N     . LEU G 2 65  ? 9.260   31.602  -51.858 1.00 21.18  ? 665  LEU E N     1 
ATOM   9189  C CA    . LEU G 2 65  ? 9.281   32.868  -51.356 1.00 21.18  ? 665  LEU E CA    1 
ATOM   9190  C C     . LEU G 2 65  ? 8.212   33.770  -51.913 1.00 21.18  ? 665  LEU E C     1 
ATOM   9191  O O     . LEU G 2 65  ? 7.682   34.654  -51.231 1.00 21.18  ? 665  LEU E O     1 
ATOM   9192  C CB    . LEU G 2 65  ? 10.625  33.461  -51.703 1.00 18.32  ? 665  LEU E CB    1 
ATOM   9193  C CG    . LEU G 2 65  ? 10.830  34.968  -51.708 1.00 18.32  ? 665  LEU E CG    1 
ATOM   9194  C CD1   . LEU G 2 65  ? 10.717  35.482  -50.351 1.00 18.32  ? 665  LEU E CD1   1 
ATOM   9195  C CD2   . LEU G 2 65  ? 12.177  35.230  -52.210 1.00 18.32  ? 665  LEU E CD2   1 
ATOM   9196  N N     . PRO G 2 66  ? 7.996   33.685  -53.216 1.00 25.60  ? 666  PRO E N     1 
ATOM   9197  C CA    . PRO G 2 66  ? 6.981   34.672  -53.601 1.00 25.60  ? 666  PRO E CA    1 
ATOM   9198  C C     . PRO G 2 66  ? 5.772   34.567  -52.800 1.00 25.60  ? 666  PRO E C     1 
ATOM   9199  O O     . PRO G 2 66  ? 5.332   35.552  -52.208 1.00 25.60  ? 666  PRO E O     1 
ATOM   9200  C CB    . PRO G 2 66  ? 6.819   34.467  -55.114 1.00 38.82  ? 666  PRO E CB    1 
ATOM   9201  C CG    . PRO G 2 66  ? 8.217   34.239  -55.451 1.00 38.82  ? 666  PRO E CG    1 
ATOM   9202  C CD    . PRO G 2 66  ? 8.811   33.312  -54.368 1.00 38.82  ? 666  PRO E CD    1 
ATOM   9203  N N     . PHE G 2 67  ? 5.230   33.368  -52.684 1.00 31.84  ? 667  PHE E N     1 
ATOM   9204  C CA    . PHE G 2 67  ? 4.026   33.122  -51.894 1.00 31.84  ? 667  PHE E CA    1 
ATOM   9205  C C     . PHE G 2 67  ? 4.094   33.668  -50.417 1.00 31.84  ? 667  PHE E C     1 
ATOM   9206  O O     . PHE G 2 67  ? 3.116   34.236  -49.908 1.00 31.84  ? 667  PHE E O     1 
ATOM   9207  C CB    . PHE G 2 67  ? 3.766   31.656  -51.867 1.00 15.29  ? 667  PHE E CB    1 
ATOM   9208  C CG    . PHE G 2 67  ? 2.528   31.190  -51.156 1.00 15.29  ? 667  PHE E CG    1 
ATOM   9209  C CD1   . PHE G 2 67  ? 1.320   31.095  -51.811 1.00 15.29  ? 667  PHE E CD1   1 
ATOM   9210  C CD2   . PHE G 2 67  ? 2.555   30.901  -49.819 1.00 15.29  ? 667  PHE E CD2   1 
ATOM   9211  C CE1   . PHE G 2 67  ? 0.167   30.709  -51.108 1.00 15.29  ? 667  PHE E CE1   1 
ATOM   9212  C CE2   . PHE G 2 67  ? 1.351   30.484  -49.114 1.00 15.29  ? 667  PHE E CE2   1 
ATOM   9213  C CZ    . PHE G 2 67  ? 0.201   30.421  -49.741 1.00 15.29  ? 667  PHE E CZ    1 
ATOM   9214  N N     . GLN G 2 68  ? 5.250   33.503  -49.769 1.00 21.88  ? 668  GLN E N     1 
ATOM   9215  C CA    . GLN G 2 68  ? 5.394   33.993  -48.421 1.00 21.88  ? 668  GLN E CA    1 
ATOM   9216  C C     . GLN G 2 68  ? 5.135   35.504  -48.290 1.00 21.88  ? 668  GLN E C     1 
ATOM   9217  O O     . GLN G 2 68  ? 4.608   35.988  -47.246 1.00 21.88  ? 668  GLN E O     1 
ATOM   9218  C CB    . GLN G 2 68  ? 6.784   33.715  -47.937 1.00 40.48  ? 668  GLN E CB    1 
ATOM   9219  C CG    . GLN G 2 68  ? 6.779   33.498  -46.505 1.00 40.48  ? 668  GLN E CG    1 
ATOM   9220  C CD    . GLN G 2 68  ? 8.138   33.433  -45.928 1.00 40.48  ? 668  GLN E CD    1 
ATOM   9221  O OE1   . GLN G 2 68  ? 8.917   34.322  -46.168 1.00 40.48  ? 668  GLN E OE1   1 
ATOM   9222  N NE2   . GLN G 2 68  ? 8.437   32.397  -45.137 1.00 40.48  ? 668  GLN E NE2   1 
ATOM   9223  N N     . ARG G 2 69  ? 5.504   36.259  -49.336 1.00 28.96  ? 669  ARG E N     1 
ATOM   9224  C CA    . ARG G 2 69  ? 5.353   37.682  -49.273 1.00 28.96  ? 669  ARG E CA    1 
ATOM   9225  C C     . ARG G 2 69  ? 3.953   37.992  -49.419 1.00 28.96  ? 669  ARG E C     1 
ATOM   9226  O O     . ARG G 2 69  ? 3.494   38.976  -48.868 1.00 28.96  ? 669  ARG E O     1 
ATOM   9227  C CB    . ARG G 2 69  ? 6.046   38.403  -50.369 1.00 29.03  ? 669  ARG E CB    1 
ATOM   9228  C CG    . ARG G 2 69  ? 7.441   38.561  -50.193 1.00 29.03  ? 669  ARG E CG    1 
ATOM   9229  C CD    . ARG G 2 69  ? 7.870   39.430  -51.291 1.00 29.03  ? 669  ARG E CD    1 
ATOM   9230  N NE    . ARG G 2 69  ? 9.042   38.954  -51.990 1.00 29.03  ? 669  ARG E NE    1 
ATOM   9231  C CZ    . ARG G 2 69  ? 9.009   38.644  -53.276 1.00 29.03  ? 669  ARG E CZ    1 
ATOM   9232  N NH1   . ARG G 2 69  ? 7.869   38.744  -53.968 1.00 29.03  ? 669  ARG E NH1   1 
ATOM   9233  N NH2   . ARG G 2 69  ? 10.127  38.296  -53.895 1.00 29.03  ? 669  ARG E NH2   1 
ATOM   9234  N N     . LEU G 2 70  ? 3.243   37.178  -50.182 1.00 26.86  ? 670  LEU E N     1 
ATOM   9235  C CA    . LEU G 2 70  ? 1.847   37.474  -50.357 1.00 26.86  ? 670  LEU E CA    1 
ATOM   9236  C C     . LEU G 2 70  ? 1.197   37.255  -49.021 1.00 26.86  ? 670  LEU E C     1 
ATOM   9237  O O     . LEU G 2 70  ? 0.287   37.969  -48.648 1.00 26.86  ? 670  LEU E O     1 
ATOM   9238  C CB    . LEU G 2 70  ? 1.229   36.558  -51.416 1.00 7.32   ? 670  LEU E CB    1 
ATOM   9239  C CG    . LEU G 2 70  ? -0.330  36.600  -51.655 1.00 7.32   ? 670  LEU E CG    1 
ATOM   9240  C CD1   . LEU G 2 70  ? -0.900  37.992  -51.950 1.00 7.32   ? 670  LEU E CD1   1 
ATOM   9241  C CD2   . LEU G 2 70  ? -0.614  35.613  -52.720 1.00 7.32   ? 670  LEU E CD2   1 
ATOM   9242  N N     . VAL G 2 71  ? 1.685   36.251  -48.295 1.00 8.86   ? 671  VAL E N     1 
ATOM   9243  C CA    . VAL G 2 71  ? 1.140   35.919  -47.017 1.00 8.86   ? 671  VAL E CA    1 
ATOM   9244  C C     . VAL G 2 71  ? 1.375   37.031  -46.117 1.00 8.86   ? 671  VAL E C     1 
ATOM   9245  O O     . VAL G 2 71  ? 0.429   37.559  -45.491 1.00 8.86   ? 671  VAL E O     1 
ATOM   9246  C CB    . VAL G 2 71  ? 1.723   34.674  -46.498 1.00 9.75   ? 671  VAL E CB    1 
ATOM   9247  C CG1   . VAL G 2 71  ? 1.386   34.439  -45.080 1.00 9.75   ? 671  VAL E CG1   1 
ATOM   9248  C CG2   . VAL G 2 71  ? 1.066   33.577  -47.261 1.00 9.75   ? 671  VAL E CG2   1 
ATOM   9249  N N     . ARG G 2 72  ? 2.610   37.484  -46.085 1.00 30.33  ? 672  ARG E N     1 
ATOM   9250  C CA    . ARG G 2 72  ? 2.904   38.617  -45.220 1.00 30.33  ? 672  ARG E CA    1 
ATOM   9251  C C     . ARG G 2 72  ? 2.210   39.893  -45.654 1.00 30.33  ? 672  ARG E C     1 
ATOM   9252  O O     . ARG G 2 72  ? 1.979   40.775  -44.849 1.00 30.33  ? 672  ARG E O     1 
ATOM   9253  C CB    . ARG G 2 72  ? 4.398   38.829  -45.128 1.00 35.44  ? 672  ARG E CB    1 
ATOM   9254  C CG    . ARG G 2 72  ? 5.029   37.916  -44.106 1.00 35.44  ? 672  ARG E CG    1 
ATOM   9255  C CD    . ARG G 2 72  ? 6.396   37.876  -44.514 1.00 35.44  ? 672  ARG E CD    1 
ATOM   9256  N NE    . ARG G 2 72  ? 7.025   36.604  -44.267 1.00 35.44  ? 672  ARG E NE    1 
ATOM   9257  C CZ    . ARG G 2 72  ? 7.243   36.135  -43.051 1.00 35.44  ? 672  ARG E CZ    1 
ATOM   9258  N NH1   . ARG G 2 72  ? 6.836   36.852  -41.987 1.00 35.44  ? 672  ARG E NH1   1 
ATOM   9259  N NH2   . ARG G 2 72  ? 7.943   35.001  -42.913 1.00 35.44  ? 672  ARG E NH2   1 
ATOM   9260  N N     . GLU G 2 73  ? 1.852   39.982  -46.913 1.00 23.86  ? 673  GLU E N     1 
ATOM   9261  C CA    . GLU G 2 73  ? 1.188   41.158  -47.300 1.00 23.86  ? 673  GLU E CA    1 
ATOM   9262  C C     . GLU G 2 73  ? -0.239  41.055  -46.871 1.00 23.86  ? 673  GLU E C     1 
ATOM   9263  O O     . GLU G 2 73  ? -0.724  41.922  -46.182 1.00 23.86  ? 673  GLU E O     1 
ATOM   9264  C CB    . GLU G 2 73  ? 1.254   41.342  -48.778 1.00 34.62  ? 673  GLU E CB    1 
ATOM   9265  C CG    . GLU G 2 73  ? 0.475   42.525  -49.276 1.00 34.62  ? 673  GLU E CG    1 
ATOM   9266  C CD    . GLU G 2 73  ? 0.506   42.656  -50.821 1.00 34.62  ? 673  GLU E CD    1 
ATOM   9267  O OE1   . GLU G 2 73  ? 1.587   42.954  -51.407 1.00 34.62  ? 673  GLU E OE1   1 
ATOM   9268  O OE2   . GLU G 2 73  ? -0.564  42.461  -51.452 1.00 34.62  ? 673  GLU E OE2   1 
ATOM   9269  N N     . ILE G 2 74  ? -0.935  40.000  -47.232 1.00 21.89  ? 674  ILE E N     1 
ATOM   9270  C CA    . ILE G 2 74  ? -2.318  39.933  -46.841 1.00 21.89  ? 674  ILE E CA    1 
ATOM   9271  C C     . ILE G 2 74  ? -2.437  40.035  -45.316 1.00 21.89  ? 674  ILE E C     1 
ATOM   9272  O O     . ILE G 2 74  ? -3.277  40.760  -44.806 1.00 21.89  ? 674  ILE E O     1 
ATOM   9273  C CB    . ILE G 2 74  ? -2.968  38.620  -47.313 1.00 20.14  ? 674  ILE E CB    1 
ATOM   9274  C CG1   . ILE G 2 74  ? -3.082  38.653  -48.800 1.00 20.14  ? 674  ILE E CG1   1 
ATOM   9275  C CG2   . ILE G 2 74  ? -4.391  38.484  -46.906 1.00 20.14  ? 674  ILE E CG2   1 
ATOM   9276  C CD1   . ILE G 2 74  ? -3.007  37.210  -49.516 1.00 20.14  ? 674  ILE E CD1   1 
ATOM   9277  N N     . ALA G 2 75  ? -1.592  39.321  -44.591 1.00 34.95  ? 675  ALA E N     1 
ATOM   9278  C CA    . ALA G 2 75  ? -1.732  39.308  -43.152 1.00 34.95  ? 675  ALA E CA    1 
ATOM   9279  C C     . ALA G 2 75  ? -1.596  40.649  -42.533 1.00 34.95  ? 675  ALA E C     1 
ATOM   9280  O O     . ALA G 2 75  ? -2.342  41.022  -41.614 1.00 34.95  ? 675  ALA E O     1 
ATOM   9281  C CB    . ALA G 2 75  ? -0.703  38.393  -42.545 1.00 6.62   ? 675  ALA E CB    1 
ATOM   9282  N N     . GLN G 2 76  ? -0.615  41.368  -43.042 1.00 25.63  ? 676  GLN E N     1 
ATOM   9283  C CA    . GLN G 2 76  ? -0.308  42.650  -42.494 1.00 25.63  ? 676  GLN E CA    1 
ATOM   9284  C C     . GLN G 2 76  ? -1.278  43.703  -42.907 1.00 25.63  ? 676  GLN E C     1 
ATOM   9285  O O     . GLN G 2 76  ? -1.537  44.565  -42.049 1.00 25.63  ? 676  GLN E O     1 
ATOM   9286  C CB    . GLN G 2 76  ? 1.135   43.018  -42.828 1.00 34.45  ? 676  GLN E CB    1 
ATOM   9287  C CG    . GLN G 2 76  ? 1.640   44.428  -42.642 1.00 34.45  ? 676  GLN E CG    1 
ATOM   9288  C CD    . GLN G 2 76  ? 2.426   44.827  -43.866 1.00 34.45  ? 676  GLN E CD    1 
ATOM   9289  O OE1   . GLN G 2 76  ? 1.940   44.747  -45.024 1.00 34.45  ? 676  GLN E OE1   1 
ATOM   9290  N NE2   . GLN G 2 76  ? 3.641   45.242  -43.649 1.00 34.45  ? 676  GLN E NE2   1 
ATOM   9291  N N     . ASP G 2 77  ? -1.801  43.731  -44.144 1.00 81.61  ? 677  ASP E N     1 
ATOM   9292  C CA    . ASP G 2 77  ? -2.748  44.798  -44.441 1.00 81.61  ? 677  ASP E CA    1 
ATOM   9293  C C     . ASP G 2 77  ? -4.031  43.999  -43.870 1.00 81.61  ? 677  ASP E C     1 
ATOM   9294  O O     . ASP G 2 77  ? -4.942  43.706  -44.573 1.00 81.61  ? 677  ASP E O     1 
ATOM   9295  C CB    . ASP G 2 77  ? -2.622  45.339  -46.022 1.00 9.11   ? 677  ASP E CB    1 
ATOM   9296  C CG    . ASP G 2 77  ? -1.097  46.244  -46.378 1.00 9.11   ? 677  ASP E CG    1 
ATOM   9297  O OD1   . ASP G 2 77  ? -0.395  46.963  -45.600 1.00 9.11   ? 677  ASP E OD1   1 
ATOM   9298  O OD2   . ASP G 2 77  ? -0.601  46.280  -47.489 1.00 9.11   ? 677  ASP E OD2   1 
ATOM   9299  N N     . PHE G 2 78  ? -4.020  43.652  -42.555 1.00 33.93  ? 678  PHE E N     1 
ATOM   9300  C CA    . PHE G 2 78  ? -5.013  42.832  -41.665 1.00 33.93  ? 678  PHE E CA    1 
ATOM   9301  C C     . PHE G 2 78  ? -4.622  42.886  -40.160 1.00 33.93  ? 678  PHE E C     1 
ATOM   9302  O O     . PHE G 2 78  ? -5.410  42.645  -39.278 1.00 33.93  ? 678  PHE E O     1 
ATOM   9303  C CB    . PHE G 2 78  ? -4.987  41.312  -41.888 1.00 111.11 ? 678  PHE E CB    1 
ATOM   9304  C CG    . PHE G 2 78  ? -6.185  40.736  -42.602 1.00 111.11 ? 678  PHE E CG    1 
ATOM   9305  C CD1   . PHE G 2 78  ? -6.515  41.150  -43.882 1.00 111.11 ? 678  PHE E CD1   1 
ATOM   9306  C CD2   . PHE G 2 78  ? -6.881  39.686  -42.070 1.00 111.11 ? 678  PHE E CD2   1 
ATOM   9307  C CE1   . PHE G 2 78  ? -7.510  40.515  -44.625 1.00 111.11 ? 678  PHE E CE1   1 
ATOM   9308  C CE2   . PHE G 2 78  ? -7.887  39.031  -42.804 1.00 111.11 ? 678  PHE E CE2   1 
ATOM   9309  C CZ    . PHE G 2 78  ? -8.202  39.435  -44.067 1.00 111.11 ? 678  PHE E CZ    1 
ATOM   9310  N N     . LYS G 2 79  ? -3.372  43.113  -39.858 1.00 42.63  ? 679  LYS E N     1 
ATOM   9311  C CA    . LYS G 2 79  ? -2.974  43.202  -38.478 1.00 42.63  ? 679  LYS E CA    1 
ATOM   9312  C C     . LYS G 2 79  ? -1.478  43.349  -38.564 1.00 42.63  ? 679  LYS E C     1 
ATOM   9313  O O     . LYS G 2 79  ? -0.775  42.552  -39.169 1.00 42.63  ? 679  LYS E O     1 
ATOM   9314  C CB    . LYS G 2 79  ? -3.356  41.950  -37.735 1.00 43.67  ? 679  LYS E CB    1 
ATOM   9315  C CG    . LYS G 2 79  ? -3.611  42.157  -36.302 1.00 43.67  ? 679  LYS E CG    1 
ATOM   9316  C CD    . LYS G 2 79  ? -2.390  42.704  -35.664 1.00 43.67  ? 679  LYS E CD    1 
ATOM   9317  C CE    . LYS G 2 79  ? -2.442  42.472  -34.155 1.00 43.67  ? 679  LYS E CE    1 
ATOM   9318  N NZ    . LYS G 2 79  ? -1.293  43.247  -33.559 1.00 43.67  ? 679  LYS E NZ    1 
ATOM   9319  N N     . THR G 2 80  ? -0.960  44.397  -37.985 1.00 36.45  ? 680  THR E N     1 
ATOM   9320  C CA    . THR G 2 80  ? 0.464   44.608  -38.108 1.00 36.45  ? 680  THR E CA    1 
ATOM   9321  C C     . THR G 2 80  ? 1.344   43.858  -37.118 1.00 36.45  ? 680  THR E C     1 
ATOM   9322  O O     . THR G 2 80  ? 0.885   43.232  -36.156 1.00 36.45  ? 680  THR E O     1 
ATOM   9323  C CB    . THR G 2 80  ? 0.795   46.059  -37.897 1.00 44.75  ? 680  THR E CB    1 
ATOM   9324  O OG1   . THR G 2 80  ? -0.122  46.582  -36.922 1.00 44.75  ? 680  THR E OG1   1 
ATOM   9325  C CG2   . THR G 2 80  ? 0.734   46.845  -39.172 1.00 44.75  ? 680  THR E CG2   1 
ATOM   9326  N N     . ASP G 2 81  ? 2.640   43.972  -37.353 1.00 40.98  ? 681  ASP E N     1 
ATOM   9327  C CA    . ASP G 2 81  ? 3.585   43.393  -36.442 1.00 40.98  ? 681  ASP E CA    1 
ATOM   9328  C C     . ASP G 2 81  ? 3.206   41.969  -36.145 1.00 40.98  ? 681  ASP E C     1 
ATOM   9329  O O     . ASP G 2 81  ? 3.072   41.607  -35.006 1.00 40.98  ? 681  ASP E O     1 
ATOM   9330  C CB    . ASP G 2 81  ? 3.599   44.184  -35.125 1.00 108.60 ? 681  ASP E CB    1 
ATOM   9331  C CG    . ASP G 2 81  ? 4.332   45.526  -35.217 1.00 108.60 ? 681  ASP E CG    1 
ATOM   9332  O OD1   . ASP G 2 81  ? 3.726   46.542  -35.662 1.00 108.60 ? 681  ASP E OD1   1 
ATOM   9333  O OD2   . ASP G 2 81  ? 5.525   45.548  -34.820 1.00 108.60 ? 681  ASP E OD2   1 
ATOM   9334  N N     . LEU G 2 82  ? 2.979   41.161  -37.168 1.00 31.73  ? 682  LEU E N     1 
ATOM   9335  C CA    . LEU G 2 82  ? 2.667   39.748  -36.970 1.00 31.73  ? 682  LEU E CA    1 
ATOM   9336  C C     . LEU G 2 82  ? 3.910   38.936  -37.320 1.00 31.73  ? 682  LEU E C     1 
ATOM   9337  O O     . LEU G 2 82  ? 4.828   39.424  -37.969 1.00 31.73  ? 682  LEU E O     1 
ATOM   9338  C CB    . LEU G 2 82  ? 1.530   39.322  -37.882 1.00 33.49  ? 682  LEU E CB    1 
ATOM   9339  C CG    . LEU G 2 82  ? 0.181   39.664  -37.305 1.00 33.49  ? 682  LEU E CG    1 
ATOM   9340  C CD1   . LEU G 2 82  ? -0.892  39.536  -38.319 1.00 33.49  ? 682  LEU E CD1   1 
ATOM   9341  C CD2   . LEU G 2 82  ? -0.016  38.761  -36.127 1.00 33.49  ? 682  LEU E CD2   1 
ATOM   9342  N N     . ARG G 2 83  ? 3.934   37.681  -36.902 1.00 52.39  ? 683  ARG E N     1 
ATOM   9343  C CA    . ARG G 2 83  ? 5.035   36.824  -37.222 1.00 52.39  ? 683  ARG E CA    1 
ATOM   9344  C C     . ARG G 2 83  ? 4.564   35.461  -37.650 1.00 52.39  ? 683  ARG E C     1 
ATOM   9345  O O     . ARG G 2 83  ? 3.429   35.082  -37.421 1.00 52.39  ? 683  ARG E O     1 
ATOM   9346  C CB    . ARG G 2 83  ? 5.893   36.737  -36.048 1.00 45.58  ? 683  ARG E CB    1 
ATOM   9347  C CG    . ARG G 2 83  ? 6.658   37.961  -35.872 1.00 45.58  ? 683  ARG E CG    1 
ATOM   9348  C CD    . ARG G 2 83  ? 7.733   37.712  -34.781 1.00 45.58  ? 683  ARG E CD    1 
ATOM   9349  N NE    . ARG G 2 83  ? 8.993   38.399  -35.070 1.00 45.58  ? 683  ARG E NE    1 
ATOM   9350  C CZ    . ARG G 2 83  ? 10.128  38.122  -34.439 1.00 45.58  ? 683  ARG E CZ    1 
ATOM   9351  N NH1   . ARG G 2 83  ? 10.106  37.154  -33.504 1.00 45.58  ? 683  ARG E NH1   1 
ATOM   9352  N NH2   . ARG G 2 83  ? 11.251  38.831  -34.687 1.00 45.58  ? 683  ARG E NH2   1 
ATOM   9353  N N     . PHE G 2 84  ? 5.439   34.699  -38.277 1.00 35.65  ? 684  PHE E N     1 
ATOM   9354  C CA    . PHE G 2 84  ? 5.029   33.400  -38.773 1.00 35.65  ? 684  PHE E CA    1 
ATOM   9355  C C     . PHE G 2 84  ? 6.020   32.314  -38.517 1.00 35.65  ? 684  PHE E C     1 
ATOM   9356  O O     . PHE G 2 84  ? 7.189   32.521  -38.768 1.00 35.65  ? 684  PHE E O     1 
ATOM   9357  C CB    . PHE G 2 84  ? 4.849   33.464  -40.297 1.00 29.16  ? 684  PHE E CB    1 
ATOM   9358  C CG    . PHE G 2 84  ? 3.592   34.140  -40.720 1.00 29.16  ? 684  PHE E CG    1 
ATOM   9359  C CD1   . PHE G 2 84  ? 3.543   35.512  -40.853 1.00 29.16  ? 684  PHE E CD1   1 
ATOM   9360  C CD2   . PHE G 2 84  ? 2.382   33.397  -40.874 1.00 29.16  ? 684  PHE E CD2   1 
ATOM   9361  C CE1   . PHE G 2 84  ? 2.285   36.116  -41.087 1.00 29.16  ? 684  PHE E CE1   1 
ATOM   9362  C CE2   . PHE G 2 84  ? 1.177   34.013  -41.092 1.00 29.16  ? 684  PHE E CE2   1 
ATOM   9363  C CZ    . PHE G 2 84  ? 1.133   35.346  -41.214 1.00 29.16  ? 684  PHE E CZ    1 
ATOM   9364  N N     . GLN G 2 85  ? 5.577   31.151  -38.033 1.00 25.16  ? 685  GLN E N     1 
ATOM   9365  C CA    . GLN G 2 85  ? 6.461   29.975  -37.903 1.00 25.16  ? 685  GLN E CA    1 
ATOM   9366  C C     . GLN G 2 85  ? 6.569   29.601  -39.390 1.00 25.16  ? 685  GLN E C     1 
ATOM   9367  O O     . GLN G 2 85  ? 5.614   29.744  -40.162 1.00 25.16  ? 685  GLN E O     1 
ATOM   9368  C CB    . GLN G 2 85  ? 5.771   28.833  -37.167 1.00 37.89  ? 685  GLN E CB    1 
ATOM   9369  C CG    . GLN G 2 85  ? 5.213   29.203  -35.866 1.00 37.89  ? 685  GLN E CG    1 
ATOM   9370  C CD    . GLN G 2 85  ? 4.711   27.996  -35.101 1.00 37.89  ? 685  GLN E CD    1 
ATOM   9371  O OE1   . GLN G 2 85  ? 3.903   27.199  -35.602 1.00 37.89  ? 685  GLN E OE1   1 
ATOM   9372  N NE2   . GLN G 2 85  ? 5.167   27.856  -33.867 1.00 37.89  ? 685  GLN E NE2   1 
ATOM   9373  N N     . SER G 2 86  ? 7.706   29.158  -39.836 1.00 43.53  ? 686  SER E N     1 
ATOM   9374  C CA    . SER G 2 86  ? 7.722   28.875  -41.237 1.00 43.53  ? 686  SER E CA    1 
ATOM   9375  C C     . SER G 2 86  ? 6.678   27.847  -41.562 1.00 43.53  ? 686  SER E C     1 
ATOM   9376  O O     . SER G 2 86  ? 6.154   27.878  -42.615 1.00 43.53  ? 686  SER E O     1 
ATOM   9377  C CB    . SER G 2 86  ? 9.061   28.386  -41.629 1.00 29.09  ? 686  SER E CB    1 
ATOM   9378  O OG    . SER G 2 86  ? 9.444   27.504  -40.607 1.00 29.09  ? 686  SER E OG    1 
ATOM   9379  N N     . SER G 2 87  ? 6.333   26.960  -40.650 1.00 32.11  ? 687  SER E N     1 
ATOM   9380  C CA    . SER G 2 87  ? 5.335   25.927  -40.939 1.00 32.11  ? 687  SER E CA    1 
ATOM   9381  C C     . SER G 2 87  ? 3.967   26.485  -41.162 1.00 32.11  ? 687  SER E C     1 
ATOM   9382  O O     . SER G 2 87  ? 3.135   25.892  -41.811 1.00 32.11  ? 687  SER E O     1 
ATOM   9383  C CB    . SER G 2 87  ? 5.263   24.885  -39.835 1.00 67.38  ? 687  SER E CB    1 
ATOM   9384  O OG    . SER G 2 87  ? 5.201   25.516  -38.589 1.00 67.38  ? 687  SER E OG    1 
ATOM   9385  N N     . ALA G 2 88  ? 3.714   27.642  -40.615 1.00 20.04  ? 688  ALA E N     1 
ATOM   9386  C CA    . ALA G 2 88  ? 2.432   28.223  -40.811 1.00 20.04  ? 688  ALA E CA    1 
ATOM   9387  C C     . ALA G 2 88  ? 2.382   28.732  -42.255 1.00 20.04  ? 688  ALA E C     1 
ATOM   9388  O O     . ALA G 2 88  ? 1.354   28.643  -42.947 1.00 20.04  ? 688  ALA E O     1 
ATOM   9389  C CB    . ALA G 2 88  ? 2.231   29.278  -39.838 1.00 46.38  ? 688  ALA E CB    1 
ATOM   9390  N N     . VAL G 2 89  ? 3.486   29.238  -42.769 1.00 20.86  ? 689  VAL E N     1 
ATOM   9391  C CA    . VAL G 2 89  ? 3.400   29.672  -44.168 1.00 20.86  ? 689  VAL E CA    1 
ATOM   9392  C C     . VAL G 2 89  ? 3.259   28.481  -45.027 1.00 20.86  ? 689  VAL E C     1 
ATOM   9393  O O     . VAL G 2 89  ? 2.577   28.509  -46.033 1.00 20.86  ? 689  VAL E O     1 
ATOM   9394  C CB    . VAL G 2 89  ? 4.632   30.381  -44.724 1.00 24.21  ? 689  VAL E CB    1 
ATOM   9395  C CG1   . VAL G 2 89  ? 4.298   31.005  -46.062 1.00 24.21  ? 689  VAL E CG1   1 
ATOM   9396  C CG2   . VAL G 2 89  ? 5.091   31.361  -43.785 1.00 24.21  ? 689  VAL E CG2   1 
ATOM   9397  N N     . MET G 2 90  ? 3.933   27.411  -44.623 1.00 24.10  ? 690  MET E N     1 
ATOM   9398  C CA    . MET G 2 90  ? 3.881   26.187  -45.401 1.00 24.10  ? 690  MET E CA    1 
ATOM   9399  C C     . MET G 2 90  ? 2.522   25.560  -45.386 1.00 24.10  ? 690  MET E C     1 
ATOM   9400  O O     . MET G 2 90  ? 2.122   25.037  -46.385 1.00 24.10  ? 690  MET E O     1 
ATOM   9401  C CB    . MET G 2 90  ? 4.949   25.198  -44.971 1.00 36.60  ? 690  MET E CB    1 
ATOM   9402  C CG    . MET G 2 90  ? 6.343   25.590  -45.398 1.00 36.60  ? 690  MET E CG    1 
ATOM   9403  S SD    . MET G 2 90  ? 6.441   25.672  -47.195 1.00 36.60  ? 690  MET E SD    1 
ATOM   9404  C CE    . MET G 2 90  ? 6.591   23.963  -47.455 1.00 36.60  ? 690  MET E CE    1 
ATOM   9405  N N     . ALA G 2 91  ? 1.778   25.678  -44.288 1.00 28.99  ? 691  ALA E N     1 
ATOM   9406  C CA    . ALA G 2 91  ? 0.447   25.074  -44.211 1.00 28.99  ? 691  ALA E CA    1 
ATOM   9407  C C     . ALA G 2 91  ? -0.482  25.852  -45.077 1.00 28.99  ? 691  ALA E C     1 
ATOM   9408  O O     . ALA G 2 91  ? -1.308  25.276  -45.777 1.00 28.99  ? 691  ALA E O     1 
ATOM   9409  C CB    . ALA G 2 91  ? -0.030  25.070  -42.824 1.00 9.11   ? 691  ALA E CB    1 
ATOM   9410  N N     . LEU G 2 92  ? -0.339  27.178  -45.036 1.00 13.84  ? 692  LEU E N     1 
ATOM   9411  C CA    . LEU G 2 92  ? -1.168  28.077  -45.876 1.00 13.84  ? 692  LEU E CA    1 
ATOM   9412  C C     . LEU G 2 92  ? -0.958  27.657  -47.385 1.00 13.84  ? 692  LEU E C     1 
ATOM   9413  O O     . LEU G 2 92  ? -1.930  27.425  -48.176 1.00 13.84  ? 692  LEU E O     1 
ATOM   9414  C CB    . LEU G 2 92  ? -0.761  29.556  -45.616 1.00 14.96  ? 692  LEU E CB    1 
ATOM   9415  C CG    . LEU G 2 92  ? -1.209  30.126  -44.276 1.00 14.96  ? 692  LEU E CG    1 
ATOM   9416  C CD1   . LEU G 2 92  ? -0.468  31.353  -44.108 1.00 14.96  ? 692  LEU E CD1   1 
ATOM   9417  C CD2   . LEU G 2 92  ? -2.724  30.403  -44.238 1.00 14.96  ? 692  LEU E CD2   1 
ATOM   9418  N N     . GLN G 2 93  ? 0.315   27.492  -47.734 1.00 25.84  ? 693  GLN E N     1 
ATOM   9419  C CA    . GLN G 2 93  ? 0.625   27.095  -49.072 1.00 25.84  ? 693  GLN E CA    1 
ATOM   9420  C C     . GLN G 2 93  ? 0.151   25.702  -49.443 1.00 25.84  ? 693  GLN E C     1 
ATOM   9421  O O     . GLN G 2 93  ? -0.196  25.528  -50.587 1.00 25.84  ? 693  GLN E O     1 
ATOM   9422  C CB    . GLN G 2 93  ? 2.115   27.182  -49.345 1.00 40.89  ? 693  GLN E CB    1 
ATOM   9423  C CG    . GLN G 2 93  ? 2.417   27.138  -50.824 1.00 40.89  ? 693  GLN E CG    1 
ATOM   9424  C CD    . GLN G 2 93  ? 3.854   27.448  -51.130 1.00 40.89  ? 693  GLN E CD    1 
ATOM   9425  O OE1   . GLN G 2 93  ? 4.670   27.491  -50.232 1.00 40.89  ? 693  GLN E OE1   1 
ATOM   9426  N NE2   . GLN G 2 93  ? 4.174   27.647  -52.400 1.00 40.89  ? 693  GLN E NE2   1 
ATOM   9427  N N     . GLU G 2 94  ? 0.119   24.717  -48.540 1.00 25.52  ? 694  GLU E N     1 
ATOM   9428  C CA    . GLU G 2 94  ? -0.323  23.427  -48.976 1.00 25.52  ? 694  GLU E CA    1 
ATOM   9429  C C     . GLU G 2 94  ? -1.788  23.444  -49.129 1.00 25.52  ? 694  GLU E C     1 
ATOM   9430  O O     . GLU G 2 94  ? -2.361  22.804  -50.006 1.00 25.52  ? 694  GLU E O     1 
ATOM   9431  C CB    . GLU G 2 94  ? 0.050   22.374  -48.009 1.00 28.91  ? 694  GLU E CB    1 
ATOM   9432  C CG    . GLU G 2 94  ? 1.505   22.125  -47.880 1.00 28.91  ? 694  GLU E CG    1 
ATOM   9433  C CD    . GLU G 2 94  ? 2.038   20.976  -48.742 1.00 28.91  ? 694  GLU E CD    1 
ATOM   9434  O OE1   . GLU G 2 94  ? 1.269   20.131  -49.234 1.00 28.91  ? 694  GLU E OE1   1 
ATOM   9435  O OE2   . GLU G 2 94  ? 3.278   20.924  -48.902 1.00 28.91  ? 694  GLU E OE2   1 
ATOM   9436  N N     . ALA G 2 95  ? -2.402  24.243  -48.295 1.00 31.58  ? 695  ALA E N     1 
ATOM   9437  C CA    . ALA G 2 95  ? -3.833  24.357  -48.320 1.00 31.58  ? 695  ALA E CA    1 
ATOM   9438  C C     . ALA G 2 95  ? -4.358  24.961  -49.574 1.00 31.58  ? 695  ALA E C     1 
ATOM   9439  O O     . ALA G 2 95  ? -5.393  24.551  -50.073 1.00 31.58  ? 695  ALA E O     1 
ATOM   9440  C CB    . ALA G 2 95  ? -4.282  25.195  -47.184 1.00 6.62   ? 695  ALA E CB    1 
ATOM   9441  N N     . SER G 2 96  ? -3.670  26.028  -49.990 1.00 21.91  ? 696  SER E N     1 
ATOM   9442  C CA    . SER G 2 96  ? -3.974  26.848  -51.161 1.00 21.91  ? 696  SER E CA    1 
ATOM   9443  C C     . SER G 2 96  ? -3.837  26.134  -52.479 1.00 21.91  ? 696  SER E C     1 
ATOM   9444  O O     . SER G 2 96  ? -4.680  26.231  -53.373 1.00 21.91  ? 696  SER E O     1 
ATOM   9445  C CB    . SER G 2 96  ? -3.045  28.080  -51.188 1.00 35.13  ? 696  SER E CB    1 
ATOM   9446  O OG    . SER G 2 96  ? -3.228  28.964  -50.084 1.00 35.13  ? 696  SER E OG    1 
ATOM   9447  N N     . GLU G 2 97  ? -2.726  25.434  -52.613 1.00 12.57  ? 697  GLU E N     1 
ATOM   9448  C CA    . GLU G 2 97  ? -2.488  24.726  -53.847 1.00 12.57  ? 697  GLU E CA    1 
ATOM   9449  C C     . GLU G 2 97  ? -3.523  23.602  -53.875 1.00 12.57  ? 697  GLU E C     1 
ATOM   9450  O O     . GLU G 2 97  ? -4.097  23.315  -54.892 1.00 12.57  ? 697  GLU E O     1 
ATOM   9451  C CB    . GLU G 2 97  ? -1.031  24.241  -53.919 1.00 23.08  ? 697  GLU E CB    1 
ATOM   9452  C CG    . GLU G 2 97  ? -0.051  25.367  -54.302 1.00 23.08  ? 697  GLU E CG    1 
ATOM   9453  C CD    . GLU G 2 97  ? 1.394   24.932  -54.714 1.00 23.08  ? 697  GLU E CD    1 
ATOM   9454  O OE1   . GLU G 2 97  ? 1.536   23.808  -55.285 1.00 23.08  ? 697  GLU E OE1   1 
ATOM   9455  O OE2   . GLU G 2 97  ? 2.381   25.719  -54.512 1.00 23.08  ? 697  GLU E OE2   1 
ATOM   9456  N N     . ALA G 2 98  ? -3.818  23.004  -52.734 1.00 23.66  ? 698  ALA E N     1 
ATOM   9457  C CA    . ALA G 2 98  ? -4.770  21.948  -52.799 1.00 23.66  ? 698  ALA E CA    1 
ATOM   9458  C C     . ALA G 2 98  ? -6.134  22.445  -53.096 1.00 23.66  ? 698  ALA E C     1 
ATOM   9459  O O     . ALA G 2 98  ? -6.897  21.709  -53.601 1.00 23.66  ? 698  ALA E O     1 
ATOM   9460  C CB    . ALA G 2 98  ? -4.751  21.180  -51.600 1.00 9.23   ? 698  ALA E CB    1 
ATOM   9461  N N     . TYR G 2 99  ? -6.438  23.679  -52.790 1.00 22.80  ? 699  TYR E N     1 
ATOM   9462  C CA    . TYR G 2 99  ? -7.719  24.250  -53.105 1.00 22.80  ? 699  TYR E CA    1 
ATOM   9463  C C     . TYR G 2 99  ? -7.719  24.659  -54.578 1.00 22.80  ? 699  TYR E C     1 
ATOM   9464  O O     . TYR G 2 99  ? -8.593  24.356  -55.373 1.00 22.80  ? 699  TYR E O     1 
ATOM   9465  C CB    . TYR G 2 99  ? -7.938  25.491  -52.257 1.00 17.97  ? 699  TYR E CB    1 
ATOM   9466  C CG    . TYR G 2 99  ? -9.071  26.392  -52.643 1.00 17.97  ? 699  TYR E CG    1 
ATOM   9467  C CD1   . TYR G 2 99  ? -10.367 26.071  -52.346 1.00 17.97  ? 699  TYR E CD1   1 
ATOM   9468  C CD2   . TYR G 2 99  ? -8.833  27.539  -53.395 1.00 17.97  ? 699  TYR E CD2   1 
ATOM   9469  C CE1   . TYR G 2 99  ? -11.470 26.900  -52.830 1.00 17.97  ? 699  TYR E CE1   1 
ATOM   9470  C CE2   . TYR G 2 99  ? -9.878  28.369  -53.890 1.00 17.97  ? 699  TYR E CE2   1 
ATOM   9471  C CZ    . TYR G 2 99  ? -11.180 28.051  -53.624 1.00 17.97  ? 699  TYR E CZ    1 
ATOM   9472  O OH    . TYR G 2 99  ? -12.117 28.827  -54.270 1.00 17.97  ? 699  TYR E OH    1 
ATOM   9473  N N     . LEU G 2 100 ? -6.718  25.412  -54.938 1.00 23.60  ? 700  LEU E N     1 
ATOM   9474  C CA    . LEU G 2 100 ? -6.629  25.812  -56.288 1.00 23.60  ? 700  LEU E CA    1 
ATOM   9475  C C     . LEU G 2 100 ? -6.639  24.584  -57.252 1.00 23.60  ? 700  LEU E C     1 
ATOM   9476  O O     . LEU G 2 100 ? -7.306  24.556  -58.260 1.00 23.60  ? 700  LEU E O     1 
ATOM   9477  C CB    . LEU G 2 100 ? -5.356  26.689  -56.418 1.00 16.02  ? 700  LEU E CB    1 
ATOM   9478  C CG    . LEU G 2 100 ? -5.345  28.194  -56.026 1.00 16.02  ? 700  LEU E CG    1 
ATOM   9479  C CD1   . LEU G 2 100 ? -4.140  28.748  -56.646 1.00 16.02  ? 700  LEU E CD1   1 
ATOM   9480  C CD2   . LEU G 2 100 ? -6.612  28.996  -56.479 1.00 16.02  ? 700  LEU E CD2   1 
ATOM   9481  N N     . VAL G 2 101 ? -5.903  23.557  -56.977 1.00 21.67  ? 701  VAL E N     1 
ATOM   9482  C CA    . VAL G 2 101 ? -5.893  22.479  -57.915 1.00 21.67  ? 701  VAL E CA    1 
ATOM   9483  C C     . VAL G 2 101 ? -7.255  21.807  -58.043 1.00 21.67  ? 701  VAL E C     1 
ATOM   9484  O O     . VAL G 2 101 ? -7.734  21.437  -59.137 1.00 21.67  ? 701  VAL E O     1 
ATOM   9485  C CB    . VAL G 2 101 ? -4.796  21.531  -57.458 1.00 11.19  ? 701  VAL E CB    1 
ATOM   9486  C CG1   . VAL G 2 101 ? -4.773  20.174  -58.183 1.00 11.19  ? 701  VAL E CG1   1 
ATOM   9487  C CG2   . VAL G 2 101 ? -3.486  22.233  -57.704 1.00 11.19  ? 701  VAL E CG2   1 
ATOM   9488  N N     . ALA G 2 102 ? -7.883  21.653  -56.889 1.00 34.53  ? 702  ALA E N     1 
ATOM   9489  C CA    . ALA G 2 102 ? -9.159  20.998  -56.798 1.00 34.53  ? 702  ALA E CA    1 
ATOM   9490  C C     . ALA G 2 102 ? -10.160 21.880  -57.470 1.00 34.53  ? 702  ALA E C     1 
ATOM   9491  O O     . ALA G 2 102 ? -11.198 21.410  -57.927 1.00 34.53  ? 702  ALA E O     1 
ATOM   9492  C CB    . ALA G 2 102 ? -9.480  20.837  -55.406 1.00 45.46  ? 702  ALA E CB    1 
ATOM   9493  N N     . LEU G 2 103 ? -9.854  23.172  -57.562 1.00 22.74  ? 703  LEU E N     1 
ATOM   9494  C CA    . LEU G 2 103 ? -10.776 24.096  -58.188 1.00 22.74  ? 703  LEU E CA    1 
ATOM   9495  C C     . LEU G 2 103 ? -10.681 23.954  -59.670 1.00 22.74  ? 703  LEU E C     1 
ATOM   9496  O O     . LEU G 2 103 ? -11.669 23.791  -60.295 1.00 22.74  ? 703  LEU E O     1 
ATOM   9497  C CB    . LEU G 2 103 ? -10.462 25.498  -57.790 1.00 7.94   ? 703  LEU E CB    1 
ATOM   9498  C CG    . LEU G 2 103 ? -11.519 26.571  -57.585 1.00 7.94   ? 703  LEU E CG    1 
ATOM   9499  C CD1   . LEU G 2 103 ? -11.071 27.925  -58.178 1.00 7.94   ? 703  LEU E CD1   1 
ATOM   9500  C CD2   . LEU G 2 103 ? -12.864 26.102  -58.183 1.00 7.94   ? 703  LEU E CD2   1 
ATOM   9501  N N     . PHE G 2 104 ? -9.479  23.967  -60.236 1.00 42.33  ? 704  PHE E N     1 
ATOM   9502  C CA    . PHE G 2 104 ? -9.320  23.772  -61.669 1.00 42.33  ? 704  PHE E CA    1 
ATOM   9503  C C     . PHE G 2 104 ? -10.002 22.480  -62.226 1.00 42.33  ? 704  PHE E C     1 
ATOM   9504  O O     . PHE G 2 104 ? -10.517 22.502  -63.331 1.00 42.33  ? 704  PHE E O     1 
ATOM   9505  C CB    . PHE G 2 104 ? -7.861  23.746  -61.980 1.00 17.84  ? 704  PHE E CB    1 
ATOM   9506  C CG    . PHE G 2 104 ? -7.213  25.067  -62.024 1.00 17.84  ? 704  PHE E CG    1 
ATOM   9507  C CD1   . PHE G 2 104 ? -6.096  25.336  -61.266 1.00 17.84  ? 704  PHE E CD1   1 
ATOM   9508  C CD2   . PHE G 2 104 ? -7.731  26.077  -62.822 1.00 17.84  ? 704  PHE E CD2   1 
ATOM   9509  C CE1   . PHE G 2 104 ? -5.469  26.593  -61.350 1.00 17.84  ? 704  PHE E CE1   1 
ATOM   9510  C CE2   . PHE G 2 104 ? -7.116  27.314  -62.910 1.00 17.84  ? 704  PHE E CE2   1 
ATOM   9511  C CZ    . PHE G 2 104 ? -5.995  27.593  -62.168 1.00 17.84  ? 704  PHE E CZ    1 
ATOM   9512  N N     . GLU G 2 105 ? -9.969  21.358  -61.491 1.00 21.04  ? 705  GLU E N     1 
ATOM   9513  C CA    . GLU G 2 105 ? -10.668 20.135  -61.869 1.00 21.04  ? 705  GLU E CA    1 
ATOM   9514  C C     . GLU G 2 105 ? -12.125 20.566  -62.095 1.00 21.04  ? 705  GLU E C     1 
ATOM   9515  O O     . GLU G 2 105 ? -12.695 20.335  -63.168 1.00 21.04  ? 705  GLU E O     1 
ATOM   9516  C CB    . GLU G 2 105 ? -10.714 19.190  -60.717 1.00 42.07  ? 705  GLU E CB    1 
ATOM   9517  C CG    . GLU G 2 105 ? -9.915  17.963  -60.743 1.00 42.07  ? 705  GLU E CG    1 
ATOM   9518  C CD    . GLU G 2 105 ? -9.357  17.607  -59.321 1.00 42.07  ? 705  GLU E CD    1 
ATOM   9519  O OE1   . GLU G 2 105 ? -10.134 17.306  -58.372 1.00 42.07  ? 705  GLU E OE1   1 
ATOM   9520  O OE2   . GLU G 2 105 ? -8.111  17.628  -59.163 1.00 42.07  ? 705  GLU E OE2   1 
ATOM   9521  N N     . ASP G 2 106 ? -12.756 21.220  -61.104 1.00 20.92  ? 706  ASP E N     1 
ATOM   9522  C CA    . ASP G 2 106 ? -14.159 21.554  -61.319 1.00 20.92  ? 706  ASP E CA    1 
ATOM   9523  C C     . ASP G 2 106 ? -14.412 22.458  -62.529 1.00 20.92  ? 706  ASP E C     1 
ATOM   9524  O O     . ASP G 2 106 ? -15.357 22.289  -63.276 1.00 20.92  ? 706  ASP E O     1 
ATOM   9525  C CB    . ASP G 2 106 ? -14.701 22.162  -60.064 1.00 24.92  ? 706  ASP E CB    1 
ATOM   9526  C CG    . ASP G 2 106 ? -14.784 21.173  -58.927 1.00 24.92  ? 706  ASP E CG    1 
ATOM   9527  O OD1   . ASP G 2 106 ? -14.741 19.923  -59.176 1.00 24.92  ? 706  ASP E OD1   1 
ATOM   9528  O OD2   . ASP G 2 106 ? -14.922 21.653  -57.746 1.00 24.92  ? 706  ASP E OD2   1 
ATOM   9529  N N     . THR G 2 107 ? -13.530 23.417  -62.708 1.00 13.60  ? 707  THR E N     1 
ATOM   9530  C CA    . THR G 2 107 ? -13.529 24.379  -63.788 1.00 13.60  ? 707  THR E CA    1 
ATOM   9531  C C     . THR G 2 107 ? -13.387 23.628  -65.087 1.00 13.60  ? 707  THR E C     1 
ATOM   9532  O O     . THR G 2 107 ? -14.139 23.888  -66.028 1.00 13.60  ? 707  THR E O     1 
ATOM   9533  C CB    . THR G 2 107 ? -12.350 25.302  -63.659 1.00 29.75  ? 707  THR E CB    1 
ATOM   9534  O OG1   . THR G 2 107 ? -12.317 25.807  -62.322 1.00 29.75  ? 707  THR E OG1   1 
ATOM   9535  C CG2   . THR G 2 107 ? -12.443 26.423  -64.586 1.00 29.75  ? 707  THR E CG2   1 
ATOM   9536  N N     . ASN G 2 108 ? -12.459 22.665  -65.112 1.00 28.40  ? 708  ASN E N     1 
ATOM   9537  C CA    . ASN G 2 108 ? -12.171 21.884  -66.284 1.00 28.40  ? 708  ASN E CA    1 
ATOM   9538  C C     . ASN G 2 108 ? -13.380 21.118  -66.619 1.00 28.40  ? 708  ASN E C     1 
ATOM   9539  O O     . ASN G 2 108 ? -13.675 20.921  -67.777 1.00 28.40  ? 708  ASN E O     1 
ATOM   9540  C CB    . ASN G 2 108 ? -11.029 20.974  -65.966 1.00 14.04  ? 708  ASN E CB    1 
ATOM   9541  C CG    . ASN G 2 108 ? -10.460 20.313  -67.166 1.00 14.04  ? 708  ASN E CG    1 
ATOM   9542  O OD1   . ASN G 2 108 ? -10.668 20.802  -68.238 1.00 14.04  ? 708  ASN E OD1   1 
ATOM   9543  N ND2   . ASN G 2 108 ? -9.734  19.177  -66.990 1.00 14.04  ? 708  ASN E ND2   1 
ATOM   9544  N N     . LEU G 2 109 ? -14.091 20.659  -65.594 1.00 23.49  ? 709  LEU E N     1 
ATOM   9545  C CA    . LEU G 2 109 ? -15.326 19.926  -65.824 1.00 23.49  ? 709  LEU E CA    1 
ATOM   9546  C C     . LEU G 2 109 ? -16.349 20.826  -66.336 1.00 23.49  ? 709  LEU E C     1 
ATOM   9547  O O     . LEU G 2 109 ? -17.053 20.439  -67.232 1.00 23.49  ? 709  LEU E O     1 
ATOM   9548  C CB    . LEU G 2 109 ? -15.911 19.336  -64.623 1.00 10.37  ? 709  LEU E CB    1 
ATOM   9549  C CG    . LEU G 2 109 ? -15.276 18.019  -64.272 1.00 10.37  ? 709  LEU E CG    1 
ATOM   9550  C CD1   . LEU G 2 109 ? -16.099 17.326  -63.179 1.00 10.37  ? 709  LEU E CD1   1 
ATOM   9551  C CD2   . LEU G 2 109 ? -15.175 17.228  -65.493 1.00 10.37  ? 709  LEU E CD2   1 
ATOM   9552  N N     . CYS G 2 110 ? -16.492 22.005  -65.764 1.00 34.91  ? 710  CYS E N     1 
ATOM   9553  C CA    . CYS G 2 110 ? -17.427 22.947  -66.355 1.00 34.91  ? 710  CYS E CA    1 
ATOM   9554  C C     . CYS G 2 110 ? -17.194 23.299  -67.866 1.00 34.91  ? 710  CYS E C     1 
ATOM   9555  O O     . CYS G 2 110 ? -18.132 23.362  -68.629 1.00 34.91  ? 710  CYS E O     1 
ATOM   9556  C CB    . CYS G 2 110 ? -17.415 24.245  -65.560 1.00 25.81  ? 710  CYS E CB    1 
ATOM   9557  S SG    . CYS G 2 110 ? -18.227 24.193  -63.986 1.00 25.81  ? 710  CYS E SG    1 
ATOM   9558  N N     . ALA G 2 111 ? -15.965 23.590  -68.276 1.00 21.23  ? 711  ALA E N     1 
ATOM   9559  C CA    . ALA G 2 111 ? -15.710 23.888  -69.666 1.00 21.23  ? 711  ALA E CA    1 
ATOM   9560  C C     . ALA G 2 111 ? -16.208 22.730  -70.533 1.00 21.23  ? 711  ALA E C     1 
ATOM   9561  O O     . ALA G 2 111 ? -17.010 22.934  -71.467 1.00 21.23  ? 711  ALA E O     1 
ATOM   9562  C CB    . ALA G 2 111 ? -14.291 24.060  -69.901 1.00 35.27  ? 711  ALA E CB    1 
ATOM   9563  N N     . ILE G 2 112 ? -15.751 21.516  -70.249 1.00 18.65  ? 712  ILE E N     1 
ATOM   9564  C CA    . ILE G 2 112 ? -16.143 20.366  -71.002 1.00 18.65  ? 712  ILE E CA    1 
ATOM   9565  C C     . ILE G 2 112 ? -17.656 20.274  -71.081 1.00 18.65  ? 712  ILE E C     1 
ATOM   9566  O O     . ILE G 2 112 ? -18.228 19.852  -72.038 1.00 18.65  ? 712  ILE E O     1 
ATOM   9567  C CB    . ILE G 2 112 ? -15.578 19.212  -70.298 1.00 13.05  ? 712  ILE E CB    1 
ATOM   9568  C CG1   . ILE G 2 112 ? -14.075 19.366  -70.257 1.00 13.05  ? 712  ILE E CG1   1 
ATOM   9569  C CG2   . ILE G 2 112 ? -15.827 17.978  -70.980 1.00 13.05  ? 712  ILE E CG2   1 
ATOM   9570  C CD1   . ILE G 2 112 ? -13.395 18.255  -69.625 1.00 13.05  ? 712  ILE E CD1   1 
ATOM   9571  N N     . HIS G 2 113 ? -18.352 20.688  -70.061 1.00 30.12  ? 713  HIS E N     1 
ATOM   9572  C CA    . HIS G 2 113 ? -19.807 20.599  -70.088 1.00 30.12  ? 713  HIS E CA    1 
ATOM   9573  C C     . HIS G 2 113 ? -20.382 21.451  -71.183 1.00 30.12  ? 713  HIS E C     1 
ATOM   9574  O O     . HIS G 2 113 ? -21.475 21.199  -71.690 1.00 30.12  ? 713  HIS E O     1 
ATOM   9575  C CB    . HIS G 2 113 ? -20.308 21.085  -68.744 1.00 17.93  ? 713  HIS E CB    1 
ATOM   9576  C CG    . HIS G 2 113 ? -21.782 21.058  -68.578 1.00 17.93  ? 713  HIS E CG    1 
ATOM   9577  N ND1   . HIS G 2 113 ? -22.515 19.883  -68.583 1.00 17.93  ? 713  HIS E ND1   1 
ATOM   9578  C CD2   . HIS G 2 113 ? -22.671 22.065  -68.363 1.00 17.93  ? 713  HIS E CD2   1 
ATOM   9579  C CE1   . HIS G 2 113 ? -23.795 20.164  -68.383 1.00 17.93  ? 713  HIS E CE1   1 
ATOM   9580  N NE2   . HIS G 2 113 ? -23.923 21.482  -68.244 1.00 17.93  ? 713  HIS E NE2   1 
ATOM   9581  N N     . ALA G 2 114 ? -19.621 22.498  -71.482 1.00 27.52  ? 714  ALA E N     1 
ATOM   9582  C CA    . ALA G 2 114 ? -19.924 23.509  -72.463 1.00 27.52  ? 714  ALA E CA    1 
ATOM   9583  C C     . ALA G 2 114 ? -19.302 23.141  -73.781 1.00 27.52  ? 714  ALA E C     1 
ATOM   9584  O O     . ALA G 2 114 ? -19.118 24.001  -74.696 1.00 27.52  ? 714  ALA E O     1 
ATOM   9585  C CB    . ALA G 2 114 ? -19.339 24.796  -72.041 1.00 25.89  ? 714  ALA E CB    1 
ATOM   9586  N N     . LYS G 2 115 ? -18.907 21.897  -73.889 1.00 35.92  ? 715  LYS E N     1 
ATOM   9587  C CA    . LYS G 2 115 ? -18.291 21.469  -75.108 1.00 35.92  ? 715  LYS E CA    1 
ATOM   9588  C C     . LYS G 2 115 ? -16.988 22.174  -75.498 1.00 35.92  ? 715  LYS E C     1 
ATOM   9589  O O     . LYS G 2 115 ? -16.663 22.244  -76.634 1.00 35.92  ? 715  LYS E O     1 
ATOM   9590  C CB    . LYS G 2 115 ? -19.344 21.496  -76.233 1.00 52.08  ? 715  LYS E CB    1 
ATOM   9591  C CG    . LYS G 2 115 ? -20.510 20.588  -75.855 1.00 52.08  ? 715  LYS E CG    1 
ATOM   9592  C CD    . LYS G 2 115 ? -21.535 20.312  -76.907 1.00 52.08  ? 715  LYS E CD    1 
ATOM   9593  C CE    . LYS G 2 115 ? -22.138 18.958  -76.599 1.00 52.08  ? 715  LYS E CE    1 
ATOM   9594  N NZ    . LYS G 2 115 ? -23.026 18.504  -77.724 1.00 52.08  ? 715  LYS E NZ    1 
ATOM   9595  N N     . ARG G 2 116 ? -16.231 22.671  -74.543 1.00 27.18  ? 716  ARG E N     1 
ATOM   9596  C CA    . ARG G 2 116 ? -14.938 23.290  -74.820 1.00 27.18  ? 716  ARG E CA    1 
ATOM   9597  C C     . ARG G 2 116 ? -13.783 22.518  -74.128 1.00 27.18  ? 716  ARG E C     1 
ATOM   9598  O O     . ARG G 2 116 ? -13.983 21.647  -73.295 1.00 27.18  ? 716  ARG E O     1 
ATOM   9599  C CB    . ARG G 2 116 ? -14.911 24.716  -74.301 1.00 24.10  ? 716  ARG E CB    1 
ATOM   9600  C CG    . ARG G 2 116 ? -16.042 25.509  -74.767 1.00 24.10  ? 716  ARG E CG    1 
ATOM   9601  C CD    . ARG G 2 116 ? -16.005 26.989  -74.317 1.00 24.10  ? 716  ARG E CD    1 
ATOM   9602  N NE    . ARG G 2 116 ? -16.765 27.278  -73.066 1.00 24.10  ? 716  ARG E NE    1 
ATOM   9603  C CZ    . ARG G 2 116 ? -16.236 27.362  -71.826 1.00 24.10  ? 716  ARG E CZ    1 
ATOM   9604  N NH1   . ARG G 2 116 ? -14.949 27.174  -71.602 1.00 24.10  ? 716  ARG E NH1   1 
ATOM   9605  N NH2   . ARG G 2 116 ? -16.988 27.670  -70.791 1.00 24.10  ? 716  ARG E NH2   1 
ATOM   9606  N N     . VAL G 2 117 ? -12.551 22.842  -74.441 1.00 25.82  ? 717  VAL E N     1 
ATOM   9607  C CA    . VAL G 2 117 ? -11.499 22.146  -73.741 1.00 25.82  ? 717  VAL E CA    1 
ATOM   9608  C C     . VAL G 2 117 ? -10.653 23.241  -73.112 1.00 25.82  ? 717  VAL E C     1 
ATOM   9609  O O     . VAL G 2 117 ? -9.659  22.990  -72.485 1.00 25.82  ? 717  VAL E O     1 
ATOM   9610  C CB    . VAL G 2 117 ? -10.706 21.404  -74.722 1.00 6.87   ? 717  VAL E CB    1 
ATOM   9611  C CG1   . VAL G 2 117 ? -11.610 20.480  -75.548 1.00 6.87   ? 717  VAL E CG1   1 
ATOM   9612  C CG2   . VAL G 2 117 ? -10.131 22.384  -75.640 1.00 6.87   ? 717  VAL E CG2   1 
ATOM   9613  N N     . THR G 2 118 ? -11.058 24.485  -73.291 1.00 18.09  ? 718  THR E N     1 
ATOM   9614  C CA    . THR G 2 118 ? -10.305 25.592  -72.736 1.00 18.09  ? 718  THR E CA    1 
ATOM   9615  C C     . THR G 2 118 ? -11.010 26.219  -71.556 1.00 18.09  ? 718  THR E C     1 
ATOM   9616  O O     . THR G 2 118 ? -12.034 26.887  -71.760 1.00 18.09  ? 718  THR E O     1 
ATOM   9617  C CB    . THR G 2 118 ? -10.215 26.721  -73.754 1.00 40.93  ? 718  THR E CB    1 
ATOM   9618  O OG1   . THR G 2 118 ? -9.682  26.221  -74.979 1.00 40.93  ? 718  THR E OG1   1 
ATOM   9619  C CG2   . THR G 2 118 ? -9.394  27.885  -73.202 1.00 40.93  ? 718  THR E CG2   1 
ATOM   9620  N N     . ILE G 2 119 ? -10.486 26.093  -70.359 1.00 16.54  ? 719  ILE E N     1 
ATOM   9621  C CA    . ILE G 2 119 ? -11.195 26.751  -69.272 1.00 16.54  ? 719  ILE E CA    1 
ATOM   9622  C C     . ILE G 2 119 ? -11.243 28.300  -69.418 1.00 16.54  ? 719  ILE E C     1 
ATOM   9623  O O     . ILE G 2 119 ? -10.342 28.948  -69.976 1.00 16.54  ? 719  ILE E O     1 
ATOM   9624  C CB    . ILE G 2 119 ? -10.559 26.407  -67.933 1.00 21.22  ? 719  ILE E CB    1 
ATOM   9625  C CG1   . ILE G 2 119 ? -9.161  27.012  -67.817 1.00 21.22  ? 719  ILE E CG1   1 
ATOM   9626  C CG2   . ILE G 2 119 ? -10.461 24.903  -67.795 1.00 21.22  ? 719  ILE E CG2   1 
ATOM   9627  C CD1   . ILE G 2 119 ? -8.486  26.673  -66.582 1.00 21.22  ? 719  ILE E CD1   1 
ATOM   9628  N N     . MET G 2 120 ? -12.309 28.904  -68.925 1.00 24.66  ? 720  MET E N     1 
ATOM   9629  C CA    . MET G 2 120 ? -12.446 30.346  -68.980 1.00 24.66  ? 720  MET E CA    1 
ATOM   9630  C C     . MET G 2 120 ? -12.971 30.930  -67.652 1.00 24.66  ? 720  MET E C     1 
ATOM   9631  O O     . MET G 2 120 ? -13.422 30.215  -66.757 1.00 24.66  ? 720  MET E O     1 
ATOM   9632  C CB    . MET G 2 120 ? -13.351 30.727  -70.104 1.00 45.91  ? 720  MET E CB    1 
ATOM   9633  C CG    . MET G 2 120 ? -13.056 30.087  -71.412 1.00 45.91  ? 720  MET E CG    1 
ATOM   9634  S SD    . MET G 2 120 ? -14.309 30.735  -72.595 1.00 45.91  ? 720  MET E SD    1 
ATOM   9635  C CE    . MET G 2 120 ? -13.415 30.567  -74.116 1.00 45.91  ? 720  MET E CE    1 
ATOM   9636  N N     . PRO G 2 121 ? -12.902 32.264  -67.507 1.00 24.52  ? 721  PRO E N     1 
ATOM   9637  C CA    . PRO G 2 121 ? -13.378 32.833  -66.269 1.00 24.52  ? 721  PRO E CA    1 
ATOM   9638  C C     . PRO G 2 121 ? -14.734 32.410  -65.811 1.00 24.52  ? 721  PRO E C     1 
ATOM   9639  O O     . PRO G 2 121 ? -14.913 32.061  -64.648 1.00 24.52  ? 721  PRO E O     1 
ATOM   9640  C CB    . PRO G 2 121 ? -13.201 34.305  -66.538 1.00 33.17  ? 721  PRO E CB    1 
ATOM   9641  C CG    . PRO G 2 121 ? -11.863 34.297  -67.082 1.00 33.17  ? 721  PRO E CG    1 
ATOM   9642  C CD    . PRO G 2 121 ? -12.062 33.279  -68.180 1.00 33.17  ? 721  PRO E CD    1 
ATOM   9643  N N     . LYS G 2 122 ? -15.681 32.401  -66.705 1.00 28.28  ? 722  LYS E N     1 
ATOM   9644  C CA    . LYS G 2 122 ? -16.978 31.987  -66.283 1.00 28.28  ? 722  LYS E CA    1 
ATOM   9645  C C     . LYS G 2 122 ? -16.989 30.523  -65.826 1.00 28.28  ? 722  LYS E C     1 
ATOM   9646  O O     . LYS G 2 122 ? -17.872 30.140  -65.106 1.00 28.28  ? 722  LYS E O     1 
ATOM   9647  C CB    . LYS G 2 122 ? -17.972 32.188  -67.422 1.00 31.36  ? 722  LYS E CB    1 
ATOM   9648  C CG    . LYS G 2 122 ? -17.878 31.178  -68.523 1.00 31.36  ? 722  LYS E CG    1 
ATOM   9649  C CD    . LYS G 2 122 ? -18.195 31.882  -69.767 1.00 31.36  ? 722  LYS E CD    1 
ATOM   9650  C CE    . LYS G 2 122 ? -17.943 31.070  -70.996 1.00 31.36  ? 722  LYS E CE    1 
ATOM   9651  N NZ    . LYS G 2 122 ? -18.386 31.933  -72.124 1.00 31.36  ? 722  LYS E NZ    1 
ATOM   9652  N N     . ASP G 2 123 ? -16.056 29.679  -66.251 1.00 22.06  ? 723  ASP E N     1 
ATOM   9653  C CA    . ASP G 2 123 ? -16.099 28.312  -65.770 1.00 22.06  ? 723  ASP E CA    1 
ATOM   9654  C C     . ASP G 2 123 ? -15.795 28.322  -64.257 1.00 22.06  ? 723  ASP E C     1 
ATOM   9655  O O     . ASP G 2 123 ? -16.568 27.804  -63.448 1.00 22.06  ? 723  ASP E O     1 
ATOM   9656  C CB    . ASP G 2 123 ? -15.083 27.439  -66.487 1.00 38.10  ? 723  ASP E CB    1 
ATOM   9657  C CG    . ASP G 2 123 ? -15.448 27.145  -67.939 1.00 38.10  ? 723  ASP E CG    1 
ATOM   9658  O OD1   . ASP G 2 123 ? -16.549 26.611  -68.245 1.00 38.10  ? 723  ASP E OD1   1 
ATOM   9659  O OD2   . ASP G 2 123 ? -14.581 27.419  -68.777 1.00 38.10  ? 723  ASP E OD2   1 
ATOM   9660  N N     . ILE G 2 124 ? -14.661 28.927  -63.882 1.00 34.54  ? 724  ILE E N     1 
ATOM   9661  C CA    . ILE G 2 124 ? -14.246 29.042  -62.484 1.00 34.54  ? 724  ILE E CA    1 
ATOM   9662  C C     . ILE G 2 124 ? -15.368 29.597  -61.731 1.00 34.54  ? 724  ILE E C     1 
ATOM   9663  O O     . ILE G 2 124 ? -15.671 29.150  -60.675 1.00 34.54  ? 724  ILE E O     1 
ATOM   9664  C CB    . ILE G 2 124 ? -13.121 29.979  -62.341 1.00 22.21  ? 724  ILE E CB    1 
ATOM   9665  C CG1   . ILE G 2 124 ? -11.926 29.380  -63.086 1.00 22.21  ? 724  ILE E CG1   1 
ATOM   9666  C CG2   . ILE G 2 124 ? -12.859 30.223  -60.949 1.00 22.21  ? 724  ILE E CG2   1 
ATOM   9667  C CD1   . ILE G 2 124 ? -10.520 30.019  -62.807 1.00 22.21  ? 724  ILE E CD1   1 
ATOM   9668  N N     . GLN G 2 125 ? -16.012 30.578  -62.315 1.00 25.85  ? 725  GLN E N     1 
ATOM   9669  C CA    . GLN G 2 125 ? -17.121 31.204  -61.664 1.00 25.85  ? 725  GLN E CA    1 
ATOM   9670  C C     . GLN G 2 125 ? -18.353 30.370  -61.503 1.00 25.85  ? 725  GLN E C     1 
ATOM   9671  O O     . GLN G 2 125 ? -19.149 30.655  -60.684 1.00 25.85  ? 725  GLN E O     1 
ATOM   9672  C CB    . GLN G 2 125 ? -17.511 32.439  -62.414 1.00 31.94  ? 725  GLN E CB    1 
ATOM   9673  C CG    . GLN G 2 125 ? -16.693 33.606  -62.040 1.00 31.94  ? 725  GLN E CG    1 
ATOM   9674  C CD    . GLN G 2 125 ? -16.566 34.623  -63.165 1.00 31.94  ? 725  GLN E CD    1 
ATOM   9675  O OE1   . GLN G 2 125 ? -17.457 34.747  -64.044 1.00 31.94  ? 725  GLN E OE1   1 
ATOM   9676  N NE2   . GLN G 2 125 ? -15.451 35.373  -63.141 1.00 31.94  ? 725  GLN E NE2   1 
ATOM   9677  N N     . LEU G 2 126 ? -18.524 29.332  -62.300 1.00 14.34  ? 726  LEU E N     1 
ATOM   9678  C CA    . LEU G 2 126 ? -19.763 28.577  -62.255 1.00 14.34  ? 726  LEU E CA    1 
ATOM   9679  C C     . LEU G 2 126 ? -19.467 27.579  -61.216 1.00 14.34  ? 726  LEU E C     1 
ATOM   9680  O O     . LEU G 2 126 ? -20.278 27.323  -60.360 1.00 14.34  ? 726  LEU E O     1 
ATOM   9681  C CB    . LEU G 2 126 ? -20.112 27.979  -63.654 1.00 9.25   ? 726  LEU E CB    1 
ATOM   9682  C CG    . LEU G 2 126 ? -21.264 26.981  -63.489 1.00 9.25   ? 726  LEU E CG    1 
ATOM   9683  C CD1   . LEU G 2 126 ? -22.471 27.745  -63.056 1.00 9.25   ? 726  LEU E CD1   1 
ATOM   9684  C CD2   . LEU G 2 126 ? -21.583 26.188  -64.725 1.00 9.25   ? 726  LEU E CD2   1 
ATOM   9685  N N     . ALA G 2 127 ? -18.260 27.046  -61.259 1.00 19.40  ? 727  ALA E N     1 
ATOM   9686  C CA    . ALA G 2 127 ? -17.911 26.127  -60.215 1.00 19.40  ? 727  ALA E CA    1 
ATOM   9687  C C     . ALA G 2 127 ? -18.004 26.684  -58.768 1.00 19.40  ? 727  ALA E C     1 
ATOM   9688  O O     . ALA G 2 127 ? -18.409 25.943  -57.855 1.00 19.40  ? 727  ALA E O     1 
ATOM   9689  C CB    . ALA G 2 127 ? -16.533 25.550  -60.433 1.00 6.62   ? 727  ALA E CB    1 
ATOM   9690  N N     . ARG G 2 128 ? -17.590 27.930  -58.541 1.00 19.62  ? 728  ARG E N     1 
ATOM   9691  C CA    . ARG G 2 128 ? -17.662 28.459  -57.195 1.00 19.62  ? 728  ARG E CA    1 
ATOM   9692  C C     . ARG G 2 128 ? -19.099 28.773  -57.002 1.00 19.62  ? 728  ARG E C     1 
ATOM   9693  O O     . ARG G 2 128 ? -19.615 28.594  -55.891 1.00 19.62  ? 728  ARG E O     1 
ATOM   9694  C CB    . ARG G 2 128 ? -16.803 29.652  -57.065 1.00 20.63  ? 728  ARG E CB    1 
ATOM   9695  C CG    . ARG G 2 128 ? -15.438 29.338  -57.615 1.00 20.63  ? 728  ARG E CG    1 
ATOM   9696  C CD    . ARG G 2 128 ? -14.301 30.047  -56.877 1.00 20.63  ? 728  ARG E CD    1 
ATOM   9697  N NE    . ARG G 2 128 ? -14.586 31.473  -56.792 1.00 20.63  ? 728  ARG E NE    1 
ATOM   9698  C CZ    . ARG G 2 128 ? -14.748 32.170  -55.662 1.00 20.63  ? 728  ARG E CZ    1 
ATOM   9699  N NH1   . ARG G 2 128 ? -14.615 31.613  -54.436 1.00 20.63  ? 728  ARG E NH1   1 
ATOM   9700  N NH2   . ARG G 2 128 ? -15.185 33.426  -55.823 1.00 20.63  ? 728  ARG E NH2   1 
ATOM   9701  N N     . ARG G 2 129 ? -19.810 29.205  -58.041 1.00 27.65  ? 729  ARG E N     1 
ATOM   9702  C CA    . ARG G 2 129 ? -21.219 29.399  -57.740 1.00 27.65  ? 729  ARG E CA    1 
ATOM   9703  C C     . ARG G 2 129 ? -21.768 28.049  -57.217 1.00 27.65  ? 729  ARG E C     1 
ATOM   9704  O O     . ARG G 2 129 ? -22.196 27.904  -56.055 1.00 27.65  ? 729  ARG E O     1 
ATOM   9705  C CB    . ARG G 2 129 ? -22.065 29.896  -58.932 1.00 75.05  ? 729  ARG E CB    1 
ATOM   9706  C CG    . ARG G 2 129 ? -23.550 30.290  -58.612 1.00 75.05  ? 729  ARG E CG    1 
ATOM   9707  C CD    . ARG G 2 129 ? -24.048 31.414  -59.513 1.00 75.05  ? 729  ARG E CD    1 
ATOM   9708  N NE    . ARG G 2 129 ? -25.435 31.685  -59.203 1.00 75.05  ? 729  ARG E NE    1 
ATOM   9709  C CZ    . ARG G 2 129 ? -26.233 32.373  -60.007 1.00 75.05  ? 729  ARG E CZ    1 
ATOM   9710  N NH1   . ARG G 2 129 ? -25.778 32.861  -61.181 1.00 75.05  ? 729  ARG E NH1   1 
ATOM   9711  N NH2   . ARG G 2 129 ? -27.480 32.577  -59.623 1.00 75.05  ? 729  ARG E NH2   1 
ATOM   9712  N N     . ILE G 2 130 ? -21.705 27.024  -58.027 1.00 30.09  ? 730  ILE E N     1 
ATOM   9713  C CA    . ILE G 2 130 ? -22.325 25.842  -57.520 1.00 30.09  ? 730  ILE E CA    1 
ATOM   9714  C C     . ILE G 2 130 ? -21.757 25.388  -56.254 1.00 30.09  ? 730  ILE E C     1 
ATOM   9715  O O     . ILE G 2 130 ? -22.517 24.863  -55.444 1.00 30.09  ? 730  ILE E O     1 
ATOM   9716  C CB    . ILE G 2 130 ? -22.325 24.724  -58.518 1.00 18.39  ? 730  ILE E CB    1 
ATOM   9717  C CG1   . ILE G 2 130 ? -23.247 25.154  -59.645 1.00 18.39  ? 730  ILE E CG1   1 
ATOM   9718  C CG2   . ILE G 2 130 ? -22.575 23.316  -57.819 1.00 18.39  ? 730  ILE E CG2   1 
ATOM   9719  C CD1   . ILE G 2 130 ? -22.836 24.461  -60.898 1.00 18.39  ? 730  ILE E CD1   1 
ATOM   9720  N N     . ARG G 2 131 ? -20.456 25.609  -56.010 1.00 37.55  ? 731  ARG E N     1 
ATOM   9721  C CA    . ARG G 2 131 ? -19.846 25.166  -54.773 1.00 37.55  ? 731  ARG E CA    1 
ATOM   9722  C C     . ARG G 2 131 ? -20.361 25.899  -53.523 1.00 37.55  ? 731  ARG E C     1 
ATOM   9723  O O     . ARG G 2 131 ? -20.139 25.363  -52.458 1.00 37.55  ? 731  ARG E O     1 
ATOM   9724  C CB    . ARG G 2 131 ? -18.282 25.319  -54.734 1.00 22.42  ? 731  ARG E CB    1 
ATOM   9725  C CG    . ARG G 2 131 ? -17.395 24.416  -55.532 1.00 22.42  ? 731  ARG E CG    1 
ATOM   9726  C CD    . ARG G 2 131 ? -16.058 25.020  -55.531 1.00 22.42  ? 731  ARG E CD    1 
ATOM   9727  N NE    . ARG G 2 131 ? -15.126 24.007  -55.997 1.00 22.42  ? 731  ARG E NE    1 
ATOM   9728  C CZ    . ARG G 2 131 ? -13.902 24.011  -55.549 1.00 22.42  ? 731  ARG E CZ    1 
ATOM   9729  N NH1   . ARG G 2 131 ? -13.589 24.987  -54.676 1.00 22.42  ? 731  ARG E NH1   1 
ATOM   9730  N NH2   . ARG G 2 131 ? -13.049 23.073  -55.898 1.00 22.42  ? 731  ARG E NH2   1 
ATOM   9731  N N     . GLY G 2 132 ? -20.929 27.121  -53.638 1.00 19.83  ? 732  GLY E N     1 
ATOM   9732  C CA    . GLY G 2 132 ? -21.484 27.926  -52.522 1.00 19.83  ? 732  GLY E CA    1 
ATOM   9733  C C     . GLY G 2 132 ? -20.418 28.921  -52.237 1.00 19.83  ? 732  GLY E C     1 
ATOM   9734  O O     . GLY G 2 132 ? -19.707 28.545  -51.518 1.00 19.83  ? 732  GLY E O     1 
ATOM   9735  N N     . GLU G 2 133 ? -20.284 30.154  -52.660 1.00 48.08  ? 733  GLU E N     1 
ATOM   9736  C CA    . GLU G 2 133 ? -18.980 30.814  -52.339 1.00 48.08  ? 733  GLU E CA    1 
ATOM   9737  C C     . GLU G 2 133 ? -19.413 32.187  -52.862 1.00 48.08  ? 733  GLU E C     1 
ATOM   9738  O O     . GLU G 2 133 ? -18.807 33.320  -52.757 1.00 48.08  ? 733  GLU E O     1 
ATOM   9739  C CB    . GLU G 2 133 ? -17.829 30.067  -53.207 1.00 21.76  ? 733  GLU E CB    1 
ATOM   9740  C CG    . GLU G 2 133 ? -16.993 28.861  -52.514 1.00 21.76  ? 733  GLU E CG    1 
ATOM   9741  C CD    . GLU G 2 133 ? -15.470 28.383  -53.094 1.00 21.76  ? 733  GLU E CD    1 
ATOM   9742  O OE1   . GLU G 2 133 ? -14.512 29.105  -53.631 1.00 21.76  ? 733  GLU E OE1   1 
ATOM   9743  O OE2   . GLU G 2 133 ? -15.199 27.130  -52.922 1.00 21.76  ? 733  GLU E OE2   1 
ATOM   9744  N N     . ARG G 2 134 ? -20.533 31.904  -53.467 1.00 112.55 ? 734  ARG E N     1 
ATOM   9745  C CA    . ARG G 2 134 ? -21.390 32.738  -54.140 1.00 112.55 ? 734  ARG E CA    1 
ATOM   9746  C C     . ARG G 2 134 ? -22.639 31.984  -54.161 1.00 112.55 ? 734  ARG E C     1 
ATOM   9747  O O     . ARG G 2 134 ? -23.086 31.368  -53.199 1.00 112.55 ? 734  ARG E O     1 
ATOM   9748  C CB    . ARG G 2 134 ? -20.920 33.074  -55.583 1.00 99.98  ? 734  ARG E CB    1 
ATOM   9749  C CG    . ARG G 2 134 ? -19.656 32.374  -56.014 1.00 99.98  ? 734  ARG E CG    1 
ATOM   9750  C CD    . ARG G 2 134 ? -19.248 32.951  -57.332 1.00 99.98  ? 734  ARG E CD    1 
ATOM   9751  N NE    . ARG G 2 134 ? -18.945 34.350  -57.112 1.00 99.98  ? 734  ARG E NE    1 
ATOM   9752  C CZ    . ARG G 2 134 ? -18.166 35.091  -57.887 1.00 99.98  ? 734  ARG E CZ    1 
ATOM   9753  N NH1   . ARG G 2 134 ? -17.606 34.550  -58.985 1.00 99.98  ? 734  ARG E NH1   1 
ATOM   9754  N NH2   . ARG G 2 134 ? -17.885 36.342  -57.489 1.00 99.98  ? 734  ARG E NH2   1 
ATOM   9755  N N     . ALA G 2 135 ? -23.128 31.834  -55.355 1.00 76.50  ? 735  ALA E N     1 
ATOM   9756  C CA    . ALA G 2 135 ? -24.475 31.414  -55.563 1.00 76.50  ? 735  ALA E CA    1 
ATOM   9757  C C     . ALA G 2 135 ? -25.489 32.517  -55.775 1.00 76.50  ? 735  ALA E C     1 
ATOM   9758  O O     . ALA G 2 135 ? -24.759 33.730  -56.348 1.00 76.50  ? 735  ALA E O     1 
ATOM   9759  C CB    . ALA G 2 135 ? -24.866 30.122  -54.310 1.00 60.24  ? 735  ALA E CB    1 
ATOM   9760  O OXT   . ALA G 2 135 ? -26.561 31.751  -55.279 1.00 60.24  ? 735  ALA E OXT   1 
ATOM   9761  N N     . VAL H 3 21  ? 8.356   47.262  -47.248 1.00 29.94  ? 221  VAL F N     1 
ATOM   9762  C CA    . VAL H 3 21  ? 6.927   47.721  -47.598 1.00 29.94  ? 221  VAL F CA    1 
ATOM   9763  C C     . VAL H 3 21  ? 6.453   46.720  -48.564 1.00 29.94  ? 221  VAL F C     1 
ATOM   9764  O O     . VAL H 3 21  ? 7.058   46.574  -49.575 1.00 29.94  ? 221  VAL F O     1 
ATOM   9765  C CB    . VAL H 3 21  ? 6.725   49.077  -48.462 1.00 13.15  ? 221  VAL F CB    1 
ATOM   9766  C CG1   . VAL H 3 21  ? 5.284   49.269  -48.904 1.00 13.15  ? 221  VAL F CG1   1 
ATOM   9767  C CG2   . VAL H 3 21  ? 6.990   50.293  -47.667 1.00 13.15  ? 221  VAL F CG2   1 
ATOM   9768  N N     . LEU H 3 22  ? 5.323   46.092  -48.306 1.00 42.41  ? 222  LEU F N     1 
ATOM   9769  C CA    . LEU H 3 22  ? 4.840   45.095  -49.195 1.00 42.41  ? 222  LEU F CA    1 
ATOM   9770  C C     . LEU H 3 22  ? 3.766   45.632  -50.080 1.00 42.41  ? 222  LEU F C     1 
ATOM   9771  O O     . LEU H 3 22  ? 2.860   46.263  -49.584 1.00 42.41  ? 222  LEU F O     1 
ATOM   9772  C CB    . LEU H 3 22  ? 4.312   44.011  -48.347 1.00 26.41  ? 222  LEU F CB    1 
ATOM   9773  C CG    . LEU H 3 22  ? 5.436   43.418  -47.514 1.00 26.41  ? 222  LEU F CG    1 
ATOM   9774  C CD1   . LEU H 3 22  ? 4.898   42.531  -46.419 1.00 26.41  ? 222  LEU F CD1   1 
ATOM   9775  C CD2   . LEU H 3 22  ? 6.343   42.627  -48.363 1.00 26.41  ? 222  LEU F CD2   1 
ATOM   9776  N N     . ARG H 3 23  ? 3.858   45.374  -51.386 1.00 24.68  ? 223  ARG F N     1 
ATOM   9777  C CA    . ARG H 3 23  ? 2.873   45.826  -52.415 1.00 24.68  ? 223  ARG F CA    1 
ATOM   9778  C C     . ARG H 3 23  ? 2.739   44.789  -53.573 1.00 24.68  ? 223  ARG F C     1 
ATOM   9779  O O     . ARG H 3 23  ? 3.612   44.004  -53.755 1.00 24.68  ? 223  ARG F O     1 
ATOM   9780  C CB    . ARG H 3 23  ? 3.333   47.124  -53.079 1.00 16.51  ? 223  ARG F CB    1 
ATOM   9781  C CG    . ARG H 3 23  ? 3.347   48.273  -52.254 1.00 16.51  ? 223  ARG F CG    1 
ATOM   9782  C CD    . ARG H 3 23  ? 4.374   49.209  -52.755 1.00 16.51  ? 223  ARG F CD    1 
ATOM   9783  N NE    . ARG H 3 23  ? 4.017   49.833  -54.050 1.00 16.51  ? 223  ARG F NE    1 
ATOM   9784  C CZ    . ARG H 3 23  ? 4.962   50.259  -54.906 1.00 16.51  ? 223  ARG F CZ    1 
ATOM   9785  N NH1   . ARG H 3 23  ? 6.291   50.095  -54.543 1.00 16.51  ? 223  ARG F NH1   1 
ATOM   9786  N NH2   . ARG H 3 23  ? 4.591   50.812  -56.067 1.00 16.51  ? 223  ARG F NH2   1 
ATOM   9787  N N     . ASP H 3 24  ? 1.647   44.768  -54.339 1.00 31.17  ? 224  ASP F N     1 
ATOM   9788  C CA    . ASP H 3 24  ? 1.547   43.869  -55.500 1.00 31.17  ? 224  ASP F CA    1 
ATOM   9789  C C     . ASP H 3 24  ? 2.116   42.428  -55.446 1.00 31.17  ? 224  ASP F C     1 
ATOM   9790  O O     . ASP H 3 24  ? 2.287   41.776  -56.449 1.00 31.17  ? 224  ASP F O     1 
ATOM   9791  C CB    . ASP H 3 24  ? 2.146   44.564  -56.665 1.00 55.23  ? 224  ASP F CB    1 
ATOM   9792  C CG    . ASP H 3 24  ? 1.341   44.405  -57.853 1.00 55.23  ? 224  ASP F CG    1 
ATOM   9793  O OD1   . ASP H 3 24  ? 0.130   44.190  -57.683 1.00 55.23  ? 224  ASP F OD1   1 
ATOM   9794  O OD2   . ASP H 3 24  ? 1.912   44.508  -58.962 1.00 55.23  ? 224  ASP F OD2   1 
ATOM   9795  N N     . ASN H 3 25  ? 2.422   41.918  -54.284 1.00 16.26  ? 225  ASN F N     1 
ATOM   9796  C CA    . ASN H 3 25  ? 2.858   40.613  -54.211 1.00 16.26  ? 225  ASN F CA    1 
ATOM   9797  C C     . ASN H 3 25  ? 1.883   39.661  -54.828 1.00 16.26  ? 225  ASN F C     1 
ATOM   9798  O O     . ASN H 3 25  ? 2.231   38.501  -54.943 1.00 16.26  ? 225  ASN F O     1 
ATOM   9799  C CB    . ASN H 3 25  ? 2.996   40.276  -52.810 1.00 20.83  ? 225  ASN F CB    1 
ATOM   9800  C CG    . ASN H 3 25  ? 4.113   40.952  -52.251 1.00 20.83  ? 225  ASN F CG    1 
ATOM   9801  O OD1   . ASN H 3 25  ? 5.290   40.553  -52.515 1.00 20.83  ? 225  ASN F OD1   1 
ATOM   9802  N ND2   . ASN H 3 25  ? 3.838   42.043  -51.503 1.00 20.83  ? 225  ASN F ND2   1 
ATOM   9803  N N     . ILE H 3 26  ? 0.671   40.040  -55.218 1.00 29.59  ? 226  ILE F N     1 
ATOM   9804  C CA    . ILE H 3 26  ? -0.224  39.012  -55.773 1.00 29.59  ? 226  ILE F CA    1 
ATOM   9805  C C     . ILE H 3 26  ? 0.364   38.661  -57.135 1.00 29.59  ? 226  ILE F C     1 
ATOM   9806  O O     . ILE H 3 26  ? 0.053   37.619  -57.706 1.00 29.59  ? 226  ILE F O     1 
ATOM   9807  C CB    . ILE H 3 26  ? -1.662  39.588  -55.959 1.00 17.54  ? 226  ILE F CB    1 
ATOM   9808  C CG1   . ILE H 3 26  ? -2.740  38.537  -56.320 1.00 17.54  ? 226  ILE F CG1   1 
ATOM   9809  C CG2   . ILE H 3 26  ? -1.619  40.499  -57.142 1.00 17.54  ? 226  ILE F CG2   1 
ATOM   9810  C CD1   . ILE H 3 26  ? -2.994  37.373  -55.435 1.00 17.54  ? 226  ILE F CD1   1 
ATOM   9811  N N     . GLN H 3 27  ? 1.230   39.523  -57.664 1.00 29.33  ? 227  GLN F N     1 
ATOM   9812  C CA    . GLN H 3 27  ? 1.791   39.253  -58.964 1.00 29.33  ? 227  GLN F CA    1 
ATOM   9813  C C     . GLN H 3 27  ? 2.926   38.230  -58.879 1.00 29.33  ? 227  GLN F C     1 
ATOM   9814  O O     . GLN H 3 27  ? 3.558   37.894  -59.890 1.00 29.33  ? 227  GLN F O     1 
ATOM   9815  C CB    . GLN H 3 27  ? 2.221   40.573  -59.622 1.00 37.70  ? 227  GLN F CB    1 
ATOM   9816  C CG    . GLN H 3 27  ? 1.061   41.566  -59.951 1.00 37.70  ? 227  GLN F CG    1 
ATOM   9817  C CD    . GLN H 3 27  ? -0.002  40.968  -60.931 1.00 37.70  ? 227  GLN F CD    1 
ATOM   9818  O OE1   . GLN H 3 27  ? 0.366   40.184  -61.813 1.00 37.70  ? 227  GLN F OE1   1 
ATOM   9819  N NE2   . GLN H 3 27  ? -1.297  41.341  -60.794 1.00 37.70  ? 227  GLN F NE2   1 
ATOM   9820  N N     . GLY H 3 28  ? 3.176   37.714  -57.676 1.00 29.18  ? 228  GLY F N     1 
ATOM   9821  C CA    . GLY H 3 28  ? 4.209   36.727  -57.459 1.00 29.18  ? 228  GLY F CA    1 
ATOM   9822  C C     . GLY H 3 28  ? 3.577   35.417  -57.834 1.00 29.18  ? 228  GLY F C     1 
ATOM   9823  O O     . GLY H 3 28  ? 4.177   34.372  -58.007 1.00 29.18  ? 228  GLY F O     1 
ATOM   9824  N N     . ILE H 3 29  ? 2.285   35.424  -57.945 1.00 35.95  ? 229  ILE F N     1 
ATOM   9825  C CA    . ILE H 3 29  ? 1.687   34.201  -58.356 1.00 35.95  ? 229  ILE F CA    1 
ATOM   9826  C C     . ILE H 3 29  ? 1.740   34.334  -59.859 1.00 35.95  ? 229  ILE F C     1 
ATOM   9827  O O     . ILE H 3 29  ? 0.841   34.847  -60.475 1.00 35.95  ? 229  ILE F O     1 
ATOM   9828  C CB    . ILE H 3 29  ? 0.223   34.118  -57.865 1.00 25.48  ? 229  ILE F CB    1 
ATOM   9829  C CG1   . ILE H 3 29  ? 0.168   34.151  -56.299 1.00 25.48  ? 229  ILE F CG1   1 
ATOM   9830  C CG2   . ILE H 3 29  ? -0.462  32.908  -58.544 1.00 25.48  ? 229  ILE F CG2   1 
ATOM   9831  C CD1   . ILE H 3 29  ? 1.396   33.703  -55.715 1.00 25.48  ? 229  ILE F CD1   1 
ATOM   9832  N N     . THR H 3 30  ? 2.825   33.862  -60.432 1.00 20.50  ? 230  THR F N     1 
ATOM   9833  C CA    . THR H 3 30  ? 3.087   33.925  -61.876 1.00 20.50  ? 230  THR F CA    1 
ATOM   9834  C C     . THR H 3 30  ? 2.360   32.994  -62.799 1.00 20.50  ? 230  THR F C     1 
ATOM   9835  O O     . THR H 3 30  ? 2.083   31.875  -62.452 1.00 20.50  ? 230  THR F O     1 
ATOM   9836  C CB    . THR H 3 30  ? 4.560   33.636  -62.194 1.00 23.53  ? 230  THR F CB    1 
ATOM   9837  O OG1   . THR H 3 30  ? 4.786   32.223  -62.059 1.00 23.53  ? 230  THR F OG1   1 
ATOM   9838  C CG2   . THR H 3 30  ? 5.490   34.404  -61.248 1.00 23.53  ? 230  THR F CG2   1 
ATOM   9839  N N     . LYS H 3 31  ? 2.105   33.456  -64.010 1.00 31.97  ? 231  LYS F N     1 
ATOM   9840  C CA    . LYS H 3 31  ? 1.468   32.627  -65.017 1.00 31.97  ? 231  LYS F CA    1 
ATOM   9841  C C     . LYS H 3 31  ? 1.904   31.137  -64.948 1.00 31.97  ? 231  LYS F C     1 
ATOM   9842  O O     . LYS H 3 31  ? 1.106   30.255  -64.727 1.00 31.97  ? 231  LYS F O     1 
ATOM   9843  C CB    . LYS H 3 31  ? 1.784   33.213  -66.367 1.00 24.10  ? 231  LYS F CB    1 
ATOM   9844  C CG    . LYS H 3 31  ? 0.820   32.873  -67.449 1.00 24.10  ? 231  LYS F CG    1 
ATOM   9845  C CD    . LYS H 3 31  ? 1.227   33.543  -68.699 1.00 24.10  ? 231  LYS F CD    1 
ATOM   9846  C CE    . LYS H 3 31  ? 0.721   32.757  -69.910 1.00 24.10  ? 231  LYS F CE    1 
ATOM   9847  N NZ    . LYS H 3 31  ? 0.836   33.789  -71.047 1.00 24.10  ? 231  LYS F NZ    1 
ATOM   9848  N N     . PRO H 3 32  ? 3.192   30.851  -65.141 1.00 29.01  ? 232  PRO F N     1 
ATOM   9849  C CA    . PRO H 3 32  ? 3.746   29.510  -65.103 1.00 29.01  ? 232  PRO F CA    1 
ATOM   9850  C C     . PRO H 3 32  ? 3.322   28.746  -63.885 1.00 29.01  ? 232  PRO F C     1 
ATOM   9851  O O     . PRO H 3 32  ? 2.977   27.545  -63.960 1.00 29.01  ? 232  PRO F O     1 
ATOM   9852  C CB    . PRO H 3 32  ? 5.228   29.794  -65.075 1.00 13.29  ? 232  PRO F CB    1 
ATOM   9853  C CG    . PRO H 3 32  ? 5.321   30.863  -65.947 1.00 13.29  ? 232  PRO F CG    1 
ATOM   9854  C CD    . PRO H 3 32  ? 4.271   31.798  -65.455 1.00 13.29  ? 232  PRO F CD    1 
ATOM   9855  N N     . ALA H 3 33  ? 3.380   29.394  -62.734 1.00 21.74  ? 233  ALA F N     1 
ATOM   9856  C CA    . ALA H 3 33  ? 2.929   28.699  -61.565 1.00 21.74  ? 233  ALA F CA    1 
ATOM   9857  C C     . ALA H 3 33  ? 1.421   28.440  -61.663 1.00 21.74  ? 233  ALA F C     1 
ATOM   9858  O O     . ALA H 3 33  ? 0.963   27.336  -61.407 1.00 21.74  ? 233  ALA F O     1 
ATOM   9859  C CB    . ALA H 3 33  ? 3.243   29.465  -60.370 1.00 31.77  ? 233  ALA F CB    1 
ATOM   9860  N N     . ILE H 3 34  ? 0.650   29.426  -62.070 1.00 18.21  ? 234  ILE F N     1 
ATOM   9861  C CA    . ILE H 3 34  ? -0.761  29.164  -62.142 1.00 18.21  ? 234  ILE F CA    1 
ATOM   9862  C C     . ILE H 3 34  ? -1.056  28.128  -63.209 1.00 18.21  ? 234  ILE F C     1 
ATOM   9863  O O     . ILE H 3 34  ? -2.143  27.572  -63.187 1.00 18.21  ? 234  ILE F O     1 
ATOM   9864  C CB    . ILE H 3 34  ? -1.620  30.401  -62.608 1.00 8.10   ? 234  ILE F CB    1 
ATOM   9865  C CG1   . ILE H 3 34  ? -1.375  31.580  -61.650 1.00 8.10   ? 234  ILE F CG1   1 
ATOM   9866  C CG2   . ILE H 3 34  ? -3.226  29.937  -62.972 1.00 8.10   ? 234  ILE F CG2   1 
ATOM   9867  C CD1   . ILE H 3 34  ? -2.365  32.728  -61.982 1.00 8.10   ? 234  ILE F CD1   1 
ATOM   9868  N N     . ARG H 3 35  ? -0.143  27.920  -64.179 1.00 19.61  ? 235  ARG F N     1 
ATOM   9869  C CA    . ARG H 3 35  ? -0.380  26.962  -65.292 1.00 19.61  ? 235  ARG F CA    1 
ATOM   9870  C C     . ARG H 3 35  ? -0.061  25.561  -64.775 1.00 19.61  ? 235  ARG F C     1 
ATOM   9871  O O     . ARG H 3 35  ? -0.753  24.610  -65.089 1.00 19.61  ? 235  ARG F O     1 
ATOM   9872  C CB    . ARG H 3 35  ? 0.447   27.343  -66.529 1.00 51.18  ? 235  ARG F CB    1 
ATOM   9873  C CG    . ARG H 3 35  ? 0.364   26.329  -67.684 1.00 51.18  ? 235  ARG F CG    1 
ATOM   9874  C CD    . ARG H 3 35  ? 1.575   26.437  -68.646 1.00 51.18  ? 235  ARG F CD    1 
ATOM   9875  N NE    . ARG H 3 35  ? 1.667   27.848  -68.956 1.00 51.18  ? 235  ARG F NE    1 
ATOM   9876  C CZ    . ARG H 3 35  ? 0.820   28.463  -69.766 1.00 51.18  ? 235  ARG F CZ    1 
ATOM   9877  N NH1   . ARG H 3 35  ? -0.143  27.757  -70.381 1.00 51.18  ? 235  ARG F NH1   1 
ATOM   9878  N NH2   . ARG H 3 35  ? 0.860   29.803  -69.851 1.00 51.18  ? 235  ARG F NH2   1 
ATOM   9879  N N     . ARG H 3 36  ? 0.963   25.436  -63.946 1.00 17.04  ? 236  ARG F N     1 
ATOM   9880  C CA    . ARG H 3 36  ? 1.251   24.134  -63.388 1.00 17.04  ? 236  ARG F CA    1 
ATOM   9881  C C     . ARG H 3 36  ? 0.087   23.636  -62.513 1.00 17.04  ? 236  ARG F C     1 
ATOM   9882  O O     . ARG H 3 36  ? -0.261  22.451  -62.529 1.00 17.04  ? 236  ARG F O     1 
ATOM   9883  C CB    . ARG H 3 36  ? 2.520   24.184  -62.534 1.00 28.45  ? 236  ARG F CB    1 
ATOM   9884  C CG    . ARG H 3 36  ? 3.716   24.656  -63.260 1.00 28.45  ? 236  ARG F CG    1 
ATOM   9885  C CD    . ARG H 3 36  ? 4.926   24.326  -62.491 1.00 28.45  ? 236  ARG F CD    1 
ATOM   9886  N NE    . ARG H 3 36  ? 5.316   25.456  -61.678 1.00 28.45  ? 236  ARG F NE    1 
ATOM   9887  C CZ    . ARG H 3 36  ? 5.759   26.620  -62.150 1.00 28.45  ? 236  ARG F CZ    1 
ATOM   9888  N NH1   . ARG H 3 36  ? 5.882   26.766  -63.430 1.00 28.45  ? 236  ARG F NH1   1 
ATOM   9889  N NH2   . ARG H 3 36  ? 6.006   27.657  -61.360 1.00 28.45  ? 236  ARG F NH2   1 
ATOM   9890  N N     . LEU H 3 37  ? -0.499  24.524  -61.733 1.00 26.86  ? 237  LEU F N     1 
ATOM   9891  C CA    . LEU H 3 37  ? -1.581  24.137  -60.872 1.00 26.86  ? 237  LEU F CA    1 
ATOM   9892  C C     . LEU H 3 37  ? -2.737  23.689  -61.760 1.00 26.86  ? 237  LEU F C     1 
ATOM   9893  O O     . LEU H 3 37  ? -3.447  22.722  -61.481 1.00 26.86  ? 237  LEU F O     1 
ATOM   9894  C CB    . LEU H 3 37  ? -1.984  25.316  -60.036 1.00 6.62   ? 237  LEU F CB    1 
ATOM   9895  C CG    . LEU H 3 37  ? -1.088  25.731  -58.918 1.00 6.62   ? 237  LEU F CG    1 
ATOM   9896  C CD1   . LEU H 3 37  ? -1.386  27.164  -58.385 1.00 6.62   ? 237  LEU F CD1   1 
ATOM   9897  C CD2   . LEU H 3 37  ? -1.185  24.628  -58.007 1.00 6.62   ? 237  LEU F CD2   1 
ATOM   9898  N N     . ALA H 3 38  ? -2.970  24.405  -62.829 1.00 14.56  ? 238  ALA F N     1 
ATOM   9899  C CA    . ALA H 3 38  ? -3.991  23.888  -63.712 1.00 14.56  ? 238  ALA F CA    1 
ATOM   9900  C C     . ALA H 3 38  ? -3.623  22.499  -64.277 1.00 14.56  ? 238  ALA F C     1 
ATOM   9901  O O     . ALA H 3 38  ? -4.472  21.692  -64.526 1.00 14.56  ? 238  ALA F O     1 
ATOM   9902  C CB    . ALA H 3 38  ? -4.209  24.823  -64.855 1.00 6.62   ? 238  ALA F CB    1 
ATOM   9903  N N     . ARG H 3 39  ? -2.360  22.207  -64.490 1.00 25.35  ? 239  ARG F N     1 
ATOM   9904  C CA    . ARG H 3 39  ? -2.015  20.915  -65.042 1.00 25.35  ? 239  ARG F CA    1 
ATOM   9905  C C     . ARG H 3 39  ? -2.259  19.872  -64.049 1.00 25.35  ? 239  ARG F C     1 
ATOM   9906  O O     . ARG H 3 39  ? -2.824  18.846  -64.404 1.00 25.35  ? 239  ARG F O     1 
ATOM   9907  C CB    . ARG H 3 39  ? -0.566  20.843  -65.413 1.00 28.84  ? 239  ARG F CB    1 
ATOM   9908  C CG    . ARG H 3 39  ? -0.173  21.791  -66.478 1.00 28.84  ? 239  ARG F CG    1 
ATOM   9909  C CD    . ARG H 3 39  ? -0.653  21.405  -67.815 1.00 28.84  ? 239  ARG F CD    1 
ATOM   9910  N NE    . ARG H 3 39  ? -0.086  22.315  -68.772 1.00 28.84  ? 239  ARG F NE    1 
ATOM   9911  C CZ    . ARG H 3 39  ? -0.772  23.046  -69.612 1.00 28.84  ? 239  ARG F CZ    1 
ATOM   9912  N NH1   . ARG H 3 39  ? -2.071  23.015  -69.707 1.00 28.84  ? 239  ARG F NH1   1 
ATOM   9913  N NH2   . ARG H 3 39  ? -0.108  23.911  -70.282 1.00 28.84  ? 239  ARG F NH2   1 
ATOM   9914  N N     . ARG H 3 40  ? -1.812  20.104  -62.811 1.00 21.81  ? 240  ARG F N     1 
ATOM   9915  C CA    . ARG H 3 40  ? -2.064  19.113  -61.786 1.00 21.81  ? 240  ARG F CA    1 
ATOM   9916  C C     . ARG H 3 40  ? -3.546  18.927  -61.799 1.00 21.81  ? 240  ARG F C     1 
ATOM   9917  O O     . ARG H 3 40  ? -4.044  17.873  -61.722 1.00 21.81  ? 240  ARG F O     1 
ATOM   9918  C CB    . ARG H 3 40  ? -1.623  19.575  -60.432 1.00 20.43  ? 240  ARG F CB    1 
ATOM   9919  C CG    . ARG H 3 40  ? -1.598  18.445  -59.451 1.00 20.43  ? 240  ARG F CG    1 
ATOM   9920  C CD    . ARG H 3 40  ? -0.707  18.869  -58.382 1.00 20.43  ? 240  ARG F CD    1 
ATOM   9921  N NE    . ARG H 3 40  ? 0.663   18.416  -58.596 1.00 20.43  ? 240  ARG F NE    1 
ATOM   9922  C CZ    . ARG H 3 40  ? 1.708   18.758  -57.835 1.00 20.43  ? 240  ARG F CZ    1 
ATOM   9923  N NH1   . ARG H 3 40  ? 1.557   19.600  -56.820 1.00 20.43  ? 240  ARG F NH1   1 
ATOM   9924  N NH2   . ARG H 3 40  ? 2.883   18.171  -58.027 1.00 20.43  ? 240  ARG F NH2   1 
ATOM   9925  N N     . GLY H 3 41  ? -4.271  19.978  -61.942 1.00 24.82  ? 241  GLY F N     1 
ATOM   9926  C CA    . GLY H 3 41  ? -5.681  19.795  -62.024 1.00 24.82  ? 241  GLY F CA    1 
ATOM   9927  C C     . GLY H 3 41  ? -6.211  19.203  -63.301 1.00 24.82  ? 241  GLY F C     1 
ATOM   9928  O O     . GLY H 3 41  ? -7.399  19.210  -63.424 1.00 24.82  ? 241  GLY F O     1 
ATOM   9929  N N     . GLY H 3 42  ? -5.412  18.728  -64.248 1.00 24.98  ? 242  GLY F N     1 
ATOM   9930  C CA    . GLY H 3 42  ? -5.986  18.083  -65.440 1.00 24.98  ? 242  GLY F CA    1 
ATOM   9931  C C     . GLY H 3 42  ? -6.445  18.908  -66.659 1.00 24.98  ? 242  GLY F C     1 
ATOM   9932  O O     . GLY H 3 42  ? -6.974  18.409  -67.635 1.00 24.98  ? 242  GLY F O     1 
ATOM   9933  N N     . VAL H 3 43  ? -6.275  20.208  -66.561 1.00 15.64  ? 243  VAL F N     1 
ATOM   9934  C CA    . VAL H 3 43  ? -6.565  21.159  -67.584 1.00 15.64  ? 243  VAL F CA    1 
ATOM   9935  C C     . VAL H 3 43  ? -5.504  21.240  -68.726 1.00 15.64  ? 243  VAL F C     1 
ATOM   9936  O O     . VAL H 3 43  ? -4.321  21.582  -68.467 1.00 15.64  ? 243  VAL F O     1 
ATOM   9937  C CB    . VAL H 3 43  ? -6.574  22.455  -66.946 1.00 17.97  ? 243  VAL F CB    1 
ATOM   9938  C CG1   . VAL H 3 43  ? -6.819  23.539  -67.933 1.00 17.97  ? 243  VAL F CG1   1 
ATOM   9939  C CG2   . VAL H 3 43  ? -7.493  22.428  -65.987 1.00 17.97  ? 243  VAL F CG2   1 
ATOM   9940  N N     . LYS H 3 44  ? -5.965  20.984  -69.969 1.00 27.54  ? 244  LYS F N     1 
ATOM   9941  C CA    . LYS H 3 44  ? -5.178  21.042  -71.218 1.00 27.54  ? 244  LYS F CA    1 
ATOM   9942  C C     . LYS H 3 44  ? -5.210  22.462  -71.834 1.00 27.54  ? 244  LYS F C     1 
ATOM   9943  O O     . LYS H 3 44  ? -4.192  22.990  -72.236 1.00 27.54  ? 244  LYS F O     1 
ATOM   9944  C CB    . LYS H 3 44  ? -5.678  19.955  -72.187 1.00 30.53  ? 244  LYS F CB    1 
ATOM   9945  C CG    . LYS H 3 44  ? -5.177  19.941  -73.658 1.00 30.53  ? 244  LYS F CG    1 
ATOM   9946  C CD    . LYS H 3 44  ? -5.285  18.490  -74.353 1.00 30.53  ? 244  LYS F CD    1 
ATOM   9947  C CE    . LYS H 3 44  ? -5.496  18.474  -75.932 1.00 30.53  ? 244  LYS F CE    1 
ATOM   9948  N NZ    . LYS H 3 44  ? -6.811  19.025  -76.539 1.00 30.53  ? 244  LYS F NZ    1 
ATOM   9949  N N     . CYS H 3 45  ? -6.312  23.158  -71.847 1.00 28.30  ? 245  CYS F N     1 
ATOM   9950  C CA    . CYS H 3 45  ? -6.228  24.463  -72.442 1.00 28.30  ? 245  CYS F CA    1 
ATOM   9951  C C     . CYS H 3 45  ? -6.602  25.651  -71.549 1.00 28.30  ? 245  CYS F C     1 
ATOM   9952  O O     . CYS H 3 45  ? -7.671  25.675  -70.889 1.00 28.30  ? 245  CYS F O     1 
ATOM   9953  C CB    . CYS H 3 45  ? -7.011  24.435  -73.768 1.00 38.41  ? 245  CYS F CB    1 
ATOM   9954  S SG    . CYS H 3 45  ? -6.073  23.504  -75.109 1.00 38.41  ? 245  CYS F SG    1 
ATOM   9955  N N     . ILE H 3 46  ? -5.753  26.667  -71.474 1.00 23.67  ? 246  ILE F N     1 
ATOM   9956  C CA    . ILE H 3 46  ? -6.122  27.839  -70.612 1.00 23.67  ? 246  ILE F CA    1 
ATOM   9957  C C     . ILE H 3 46  ? -6.332  29.256  -71.286 1.00 23.67  ? 246  ILE F C     1 
ATOM   9958  O O     . ILE H 3 46  ? -5.391  29.773  -71.945 1.00 23.67  ? 246  ILE F O     1 
ATOM   9959  C CB    . ILE H 3 46  ? -5.061  28.049  -69.625 1.00 10.37  ? 246  ILE F CB    1 
ATOM   9960  C CG1   . ILE H 3 46  ? -4.706  26.762  -68.986 1.00 10.37  ? 246  ILE F CG1   1 
ATOM   9961  C CG2   . ILE H 3 46  ? -5.471  29.097  -68.654 1.00 10.37  ? 246  ILE F CG2   1 
ATOM   9962  C CD1   . ILE H 3 46  ? -3.738  26.971  -68.078 1.00 10.37  ? 246  ILE F CD1   1 
ATOM   9963  N N     . SER H 3 47  ? -7.518  29.884  -71.122 1.00 23.95  ? 247  SER F N     1 
ATOM   9964  C CA    . SER H 3 47  ? -7.769  31.234  -71.710 1.00 23.95  ? 247  SER F CA    1 
ATOM   9965  C C     . SER H 3 47  ? -6.881  32.284  -71.107 1.00 23.95  ? 247  SER F C     1 
ATOM   9966  O O     . SER H 3 47  ? -6.590  32.206  -69.945 1.00 23.95  ? 247  SER F O     1 
ATOM   9967  C CB    . SER H 3 47  ? -9.212  31.707  -71.494 1.00 21.82  ? 247  SER F CB    1 
ATOM   9968  O OG    . SER H 3 47  ? -9.294  33.139  -71.286 1.00 21.82  ? 247  SER F OG    1 
ATOM   9969  N N     . GLY H 3 48  ? -6.478  33.307  -71.843 1.00 37.00  ? 248  GLY F N     1 
ATOM   9970  C CA    . GLY H 3 48  ? -5.605  34.324  -71.247 1.00 37.00  ? 248  GLY F CA    1 
ATOM   9971  C C     . GLY H 3 48  ? -6.112  34.984  -69.979 1.00 37.00  ? 248  GLY F C     1 
ATOM   9972  O O     . GLY H 3 48  ? -5.343  35.330  -69.065 1.00 37.00  ? 248  GLY F O     1 
ATOM   9973  N N     . LEU H 3 49  ? -7.426  35.107  -69.933 1.00 27.21  ? 249  LEU F N     1 
ATOM   9974  C CA    . LEU H 3 49  ? -8.134  35.692  -68.828 1.00 27.21  ? 249  LEU F CA    1 
ATOM   9975  C C     . LEU H 3 49  ? -8.176  34.920  -67.441 1.00 27.21  ? 249  LEU F C     1 
ATOM   9976  O O     . LEU H 3 49  ? -8.664  35.451  -66.425 1.00 27.21  ? 249  LEU F O     1 
ATOM   9977  C CB    . LEU H 3 49  ? -9.562  35.995  -69.357 1.00 22.79  ? 249  LEU F CB    1 
ATOM   9978  C CG    . LEU H 3 49  ? -9.428  37.403  -69.968 1.00 22.79  ? 249  LEU F CG    1 
ATOM   9979  C CD1   . LEU H 3 49  ? -10.706 38.000  -70.327 1.00 22.79  ? 249  LEU F CD1   1 
ATOM   9980  C CD2   . LEU H 3 49  ? -8.573  38.334  -68.923 1.00 22.79  ? 249  LEU F CD2   1 
ATOM   9981  N N     . ILE H 3 50  ? -7.686  33.666  -67.430 1.00 25.70  ? 250  ILE F N     1 
ATOM   9982  C CA    . ILE H 3 50  ? -7.713  32.803  -66.267 1.00 25.70  ? 250  ILE F CA    1 
ATOM   9983  C C     . ILE H 3 50  ? -6.782  33.266  -65.177 1.00 25.70  ? 250  ILE F C     1 
ATOM   9984  O O     . ILE H 3 50  ? -7.071  33.113  -63.992 1.00 25.70  ? 250  ILE F O     1 
ATOM   9985  C CB    . ILE H 3 50  ? -7.356  31.314  -66.709 1.00 33.09  ? 250  ILE F CB    1 
ATOM   9986  C CG1   . ILE H 3 50  ? -8.557  30.688  -67.477 1.00 33.09  ? 250  ILE F CG1   1 
ATOM   9987  C CG2   . ILE H 3 50  ? -6.965  30.434  -65.545 1.00 33.09  ? 250  ILE F CG2   1 
ATOM   9988  C CD1   . ILE H 3 50  ? -9.694  29.984  -66.667 1.00 33.09  ? 250  ILE F CD1   1 
ATOM   9989  N N     . TYR H 3 51  ? -5.658  33.866  -65.540 1.00 35.77  ? 251  TYR F N     1 
ATOM   9990  C CA    . TYR H 3 51  ? -4.738  34.213  -64.501 1.00 35.77  ? 251  TYR F CA    1 
ATOM   9991  C C     . TYR H 3 51  ? -5.128  35.271  -63.678 1.00 35.77  ? 251  TYR F C     1 
ATOM   9992  O O     . TYR H 3 51  ? -4.955  35.105  -62.514 1.00 35.77  ? 251  TYR F O     1 
ATOM   9993  C CB    . TYR H 3 51  ? -3.363  34.457  -64.981 1.00 22.55  ? 251  TYR F CB    1 
ATOM   9994  C CG    . TYR H 3 51  ? -2.987  33.468  -66.012 1.00 22.55  ? 251  TYR F CG    1 
ATOM   9995  C CD1   . TYR H 3 51  ? -3.337  33.702  -67.354 1.00 22.55  ? 251  TYR F CD1   1 
ATOM   9996  C CD2   . TYR H 3 51  ? -2.329  32.281  -65.699 1.00 22.55  ? 251  TYR F CD2   1 
ATOM   9997  C CE1   . TYR H 3 51  ? -3.035  32.793  -68.375 1.00 22.55  ? 251  TYR F CE1   1 
ATOM   9998  C CE2   . TYR H 3 51  ? -2.044  31.328  -66.725 1.00 22.55  ? 251  TYR F CE2   1 
ATOM   9999  C CZ    . TYR H 3 51  ? -2.401  31.616  -68.046 1.00 22.55  ? 251  TYR F CZ    1 
ATOM   10000 O OH    . TYR H 3 51  ? -2.182  30.805  -69.126 1.00 22.55  ? 251  TYR F OH    1 
ATOM   10001 N N     . GLU H 3 52  ? -5.671  36.348  -64.222 1.00 34.71  ? 252  GLU F N     1 
ATOM   10002 C CA    . GLU H 3 52  ? -6.075  37.395  -63.323 1.00 34.71  ? 252  GLU F CA    1 
ATOM   10003 C C     . GLU H 3 52  ? -7.223  36.880  -62.432 1.00 34.71  ? 252  GLU F C     1 
ATOM   10004 O O     . GLU H 3 52  ? -7.326  37.225  -61.276 1.00 34.71  ? 252  GLU F O     1 
ATOM   10005 C CB    . GLU H 3 52  ? -6.458  38.684  -64.054 1.00 65.18  ? 252  GLU F CB    1 
ATOM   10006 C CG    . GLU H 3 52  ? -5.318  39.758  -64.054 1.00 65.18  ? 252  GLU F CG    1 
ATOM   10007 C CD    . GLU H 3 52  ? -4.469  39.838  -62.716 1.00 65.18  ? 252  GLU F CD    1 
ATOM   10008 O OE1   . GLU H 3 52  ? -5.107  39.829  -61.627 1.00 65.18  ? 252  GLU F OE1   1 
ATOM   10009 O OE2   . GLU H 3 52  ? -3.182  39.933  -62.729 1.00 65.18  ? 252  GLU F OE2   1 
ATOM   10010 N N     . GLU H 3 53  ? -8.015  35.969  -62.945 1.00 26.88  ? 253  GLU F N     1 
ATOM   10011 C CA    . GLU H 3 53  ? -9.125  35.496  -62.218 1.00 26.88  ? 253  GLU F CA    1 
ATOM   10012 C C     . GLU H 3 53  ? -8.679  34.624  -61.144 1.00 26.88  ? 253  GLU F C     1 
ATOM   10013 O O     . GLU H 3 53  ? -9.289  34.599  -60.072 1.00 26.88  ? 253  GLU F O     1 
ATOM   10014 C CB    . GLU H 3 53  ? -10.044 34.733  -63.115 1.00 34.05  ? 253  GLU F CB    1 
ATOM   10015 C CG    . GLU H 3 53  ? -11.336 34.331  -62.518 1.00 34.05  ? 253  GLU F CG    1 
ATOM   10016 C CD    . GLU H 3 53  ? -12.409 35.396  -62.581 1.00 34.05  ? 253  GLU F CD    1 
ATOM   10017 O OE1   . GLU H 3 53  ? -12.452 36.225  -63.532 1.00 34.05  ? 253  GLU F OE1   1 
ATOM   10018 O OE2   . GLU H 3 53  ? -13.240 35.388  -61.642 1.00 34.05  ? 253  GLU F OE2   1 
ATOM   10019 N N     . THR H 3 54  ? -7.625  33.889  -61.388 1.00 26.19  ? 254  THR F N     1 
ATOM   10020 C CA    . THR H 3 54  ? -7.166  32.997  -60.372 1.00 26.19  ? 254  THR F CA    1 
ATOM   10021 C C     . THR H 3 54  ? -6.534  33.731  -59.176 1.00 26.19  ? 254  THR F C     1 
ATOM   10022 O O     . THR H 3 54  ? -6.725  33.366  -58.024 1.00 26.19  ? 254  THR F O     1 
ATOM   10023 C CB    . THR H 3 54  ? -6.197  32.044  -61.000 1.00 23.25  ? 254  THR F CB    1 
ATOM   10024 O OG1   . THR H 3 54  ? -6.849  31.410  -62.068 1.00 23.25  ? 254  THR F OG1   1 
ATOM   10025 C CG2   . THR H 3 54  ? -5.732  31.004  -60.003 1.00 23.25  ? 254  THR F CG2   1 
ATOM   10026 N N     . ARG H 3 55  ? -5.742  34.754  -59.445 1.00 15.05  ? 255  ARG F N     1 
ATOM   10027 C CA    . ARG H 3 55  ? -5.173  35.498  -58.352 1.00 15.05  ? 255  ARG F CA    1 
ATOM   10028 C C     . ARG H 3 55  ? -6.377  36.098  -57.547 1.00 15.05  ? 255  ARG F C     1 
ATOM   10029 O O     . ARG H 3 55  ? -6.407  36.124  -56.372 1.00 15.05  ? 255  ARG F O     1 
ATOM   10030 C CB    . ARG H 3 55  ? -4.290  36.575  -58.932 1.00 24.00  ? 255  ARG F CB    1 
ATOM   10031 C CG    . ARG H 3 55  ? -3.226  36.024  -59.813 1.00 24.00  ? 255  ARG F CG    1 
ATOM   10032 C CD    . ARG H 3 55  ? -2.162  37.088  -60.152 1.00 24.00  ? 255  ARG F CD    1 
ATOM   10033 N NE    . ARG H 3 55  ? -1.157  36.639  -61.109 1.00 24.00  ? 255  ARG F NE    1 
ATOM   10034 C CZ    . ARG H 3 55  ? -1.240  36.841  -62.398 1.00 24.00  ? 255  ARG F CZ    1 
ATOM   10035 N NH1   . ARG H 3 55  ? -2.287  37.477  -62.859 1.00 24.00  ? 255  ARG F NH1   1 
ATOM   10036 N NH2   . ARG H 3 55  ? -0.269  36.439  -63.198 1.00 24.00  ? 255  ARG F NH2   1 
ATOM   10037 N N     . GLY H 3 56  ? -7.398  36.549  -58.218 1.00 16.77  ? 256  GLY F N     1 
ATOM   10038 C CA    . GLY H 3 56  ? -8.494  37.078  -57.505 1.00 16.77  ? 256  GLY F CA    1 
ATOM   10039 C C     . GLY H 3 56  ? -9.040  36.068  -56.524 1.00 16.77  ? 256  GLY F C     1 
ATOM   10040 O O     . GLY H 3 56  ? -9.321  36.405  -55.333 1.00 16.77  ? 256  GLY F O     1 
ATOM   10041 N N     . VAL H 3 57  ? -9.233  34.856  -57.021 1.00 18.65  ? 257  VAL F N     1 
ATOM   10042 C CA    . VAL H 3 57  ? -9.778  33.788  -56.231 1.00 18.65  ? 257  VAL F CA    1 
ATOM   10043 C C     . VAL H 3 57  ? -8.773  33.387  -55.163 1.00 18.65  ? 257  VAL F C     1 
ATOM   10044 O O     . VAL H 3 57  ? -9.216  33.012  -54.085 1.00 18.65  ? 257  VAL F O     1 
ATOM   10045 C CB    . VAL H 3 57  ? -10.171 32.574  -57.141 1.00 30.50  ? 257  VAL F CB    1 
ATOM   10046 C CG1   . VAL H 3 57  ? -10.033 31.290  -56.451 1.00 30.50  ? 257  VAL F CG1   1 
ATOM   10047 C CG2   . VAL H 3 57  ? -11.554 32.711  -57.564 1.00 30.50  ? 257  VAL F CG2   1 
ATOM   10048 N N     . LEU H 3 58  ? -7.460  33.478  -55.399 1.00 17.03  ? 258  LEU F N     1 
ATOM   10049 C CA    . LEU H 3 58  ? -6.550  33.038  -54.345 1.00 17.03  ? 258  LEU F CA    1 
ATOM   10050 C C     . LEU H 3 58  ? -6.482  34.022  -53.205 1.00 17.03  ? 258  LEU F C     1 
ATOM   10051 O O     . LEU H 3 58  ? -6.339  33.625  -52.055 1.00 17.03  ? 258  LEU F O     1 
ATOM   10052 C CB    . LEU H 3 58  ? -5.107  32.793  -54.854 1.00 23.18  ? 258  LEU F CB    1 
ATOM   10053 C CG    . LEU H 3 58  ? -3.891  32.404  -53.971 1.00 23.18  ? 258  LEU F CG    1 
ATOM   10054 C CD1   . LEU H 3 58  ? -4.061  31.055  -53.554 1.00 23.18  ? 258  LEU F CD1   1 
ATOM   10055 C CD2   . LEU H 3 58  ? -2.547  32.459  -54.737 1.00 23.18  ? 258  LEU F CD2   1 
ATOM   10056 N N     . LYS H 3 59  ? -6.593  35.304  -53.540 1.00 15.86  ? 259  LYS F N     1 
ATOM   10057 C CA    . LYS H 3 59  ? -6.485  36.383  -52.579 1.00 15.86  ? 259  LYS F CA    1 
ATOM   10058 C C     . LYS H 3 59  ? -7.602  36.307  -51.591 1.00 15.86  ? 259  LYS F C     1 
ATOM   10059 O O     . LYS H 3 59  ? -7.425  36.641  -50.427 1.00 15.86  ? 259  LYS F O     1 
ATOM   10060 C CB    . LYS H 3 59  ? -6.531  37.743  -53.261 1.00 21.73  ? 259  LYS F CB    1 
ATOM   10061 C CG    . LYS H 3 59  ? -6.262  38.857  -52.330 1.00 21.73  ? 259  LYS F CG    1 
ATOM   10062 C CD    . LYS H 3 59  ? -5.593  39.963  -53.032 1.00 21.73  ? 259  LYS F CD    1 
ATOM   10063 C CE    . LYS H 3 59  ? -6.184  41.308  -52.565 1.00 21.73  ? 259  LYS F CE    1 
ATOM   10064 N NZ    . LYS H 3 59  ? -7.720  41.382  -52.614 1.00 21.73  ? 259  LYS F NZ    1 
ATOM   10065 N N     . VAL H 3 60  ? -8.750  35.842  -52.063 1.00 15.16  ? 260  VAL F N     1 
ATOM   10066 C CA    . VAL H 3 60  ? -9.877  35.734  -51.185 1.00 15.16  ? 260  VAL F CA    1 
ATOM   10067 C C     . VAL H 3 60  ? -9.720  34.515  -50.320 1.00 15.16  ? 260  VAL F C     1 
ATOM   10068 O O     . VAL H 3 60  ? -10.143 34.492  -49.191 1.00 15.16  ? 260  VAL F O     1 
ATOM   10069 C CB    . VAL H 3 60  ? -11.191 35.585  -51.957 1.00 9.86   ? 260  VAL F CB    1 
ATOM   10070 C CG1   . VAL H 3 60  ? -12.264 35.305  -51.024 1.00 9.86   ? 260  VAL F CG1   1 
ATOM   10071 C CG2   . VAL H 3 60  ? -11.536 36.773  -52.607 1.00 9.86   ? 260  VAL F CG2   1 
ATOM   10072 N N     . PHE H 3 61  ? -9.147  33.479  -50.879 1.00 18.13  ? 261  PHE F N     1 
ATOM   10073 C CA    . PHE H 3 61  ? -9.003  32.299  -50.101 1.00 18.13  ? 261  PHE F CA    1 
ATOM   10074 C C     . PHE H 3 61  ? -7.994  32.575  -49.012 1.00 18.13  ? 261  PHE F C     1 
ATOM   10075 O O     . PHE H 3 61  ? -8.154  32.137  -47.897 1.00 18.13  ? 261  PHE F O     1 
ATOM   10076 C CB    . PHE H 3 61  ? -8.536  31.154  -50.973 1.00 9.59   ? 261  PHE F CB    1 
ATOM   10077 C CG    . PHE H 3 61  ? -8.257  29.875  -50.213 1.00 9.59   ? 261  PHE F CG    1 
ATOM   10078 C CD1   . PHE H 3 61  ? -9.259  28.955  -50.005 1.00 9.59   ? 261  PHE F CD1   1 
ATOM   10079 C CD2   . PHE H 3 61  ? -6.914  29.594  -49.711 1.00 9.59   ? 261  PHE F CD2   1 
ATOM   10080 C CE1   . PHE H 3 61  ? -8.949  27.769  -49.339 1.00 9.59   ? 261  PHE F CE1   1 
ATOM   10081 C CE2   . PHE H 3 61  ? -6.611  28.421  -49.055 1.00 9.59   ? 261  PHE F CE2   1 
ATOM   10082 C CZ    . PHE H 3 61  ? -7.612  27.515  -48.863 1.00 9.59   ? 261  PHE F CZ    1 
ATOM   10083 N N     . LEU H 3 62  ? -6.946  33.301  -49.328 1.00 17.42  ? 262  LEU F N     1 
ATOM   10084 C CA    . LEU H 3 62  ? -5.989  33.592  -48.308 1.00 17.42  ? 262  LEU F CA    1 
ATOM   10085 C C     . LEU H 3 62  ? -6.580  34.484  -47.240 1.00 17.42  ? 262  LEU F C     1 
ATOM   10086 O O     . LEU H 3 62  ? -6.470  34.173  -46.064 1.00 17.42  ? 262  LEU F O     1 
ATOM   10087 C CB    . LEU H 3 62  ? -4.739  34.215  -48.905 1.00 27.06  ? 262  LEU F CB    1 
ATOM   10088 C CG    . LEU H 3 62  ? -3.835  33.165  -49.550 1.00 27.06  ? 262  LEU F CG    1 
ATOM   10089 C CD1   . LEU H 3 62  ? -2.503  33.787  -49.899 1.00 27.06  ? 262  LEU F CD1   1 
ATOM   10090 C CD2   . LEU H 3 62  ? -3.599  31.994  -48.612 1.00 27.06  ? 262  LEU F CD2   1 
ATOM   10091 N N     . GLU H 3 63  ? -7.189  35.602  -47.622 1.00 17.99  ? 263  GLU F N     1 
ATOM   10092 C CA    . GLU H 3 63  ? -7.771  36.463  -46.617 1.00 17.99  ? 263  GLU F CA    1 
ATOM   10093 C C     . GLU H 3 63  ? -8.694  35.654  -45.673 1.00 17.99  ? 263  GLU F C     1 
ATOM   10094 O O     . GLU H 3 63  ? -8.648  35.849  -44.438 1.00 17.99  ? 263  GLU F O     1 
ATOM   10095 C CB    . GLU H 3 63  ? -8.632  37.552  -47.224 1.00 40.96  ? 263  GLU F CB    1 
ATOM   10096 C CG    . GLU H 3 63  ? -7.950  38.363  -48.242 1.00 40.96  ? 263  GLU F CG    1 
ATOM   10097 C CD    . GLU H 3 63  ? -8.890  39.304  -48.930 1.00 40.96  ? 263  GLU F CD    1 
ATOM   10098 O OE1   . GLU H 3 63  ? -10.103 39.049  -48.785 1.00 40.96  ? 263  GLU F OE1   1 
ATOM   10099 O OE2   . GLU H 3 63  ? -8.387  40.248  -49.586 1.00 40.96  ? 263  GLU F OE2   1 
ATOM   10100 N N     . ASN H 3 64  ? -9.508  34.753  -46.227 1.00 19.01  ? 264  ASN F N     1 
ATOM   10101 C CA    . ASN H 3 64  ? -10.378 34.064  -45.372 1.00 19.01  ? 264  ASN F CA    1 
ATOM   10102 C C     . ASN H 3 64  ? -9.636  33.179  -44.398 1.00 19.01  ? 264  ASN F C     1 
ATOM   10103 O O     . ASN H 3 64  ? -9.977  33.178  -43.194 1.00 19.01  ? 264  ASN F O     1 
ATOM   10104 C CB    . ASN H 3 64  ? -11.465 33.373  -46.159 1.00 33.19  ? 264  ASN F CB    1 
ATOM   10105 C CG    . ASN H 3 64  ? -12.391 34.384  -46.881 1.00 33.19  ? 264  ASN F CG    1 
ATOM   10106 O OD1   . ASN H 3 64  ? -12.418 35.555  -46.544 1.00 33.19  ? 264  ASN F OD1   1 
ATOM   10107 N ND2   . ASN H 3 64  ? -13.137 33.923  -47.890 1.00 33.19  ? 264  ASN F ND2   1 
ATOM   10108 N N     . VAL H 3 65  ? -8.568  32.524  -44.826 1.00 26.27  ? 265  VAL F N     1 
ATOM   10109 C CA    . VAL H 3 65  ? -7.905  31.645  -43.907 1.00 26.27  ? 265  VAL F CA    1 
ATOM   10110 C C     . VAL H 3 65  ? -7.110  32.423  -42.938 1.00 26.27  ? 265  VAL F C     1 
ATOM   10111 O O     . VAL H 3 65  ? -6.987  32.075  -41.762 1.00 26.27  ? 265  VAL F O     1 
ATOM   10112 C CB    . VAL H 3 65  ? -6.927  30.663  -44.577 1.00 34.47  ? 265  VAL F CB    1 
ATOM   10113 C CG1   . VAL H 3 65  ? -6.529  29.574  -43.575 1.00 34.47  ? 265  VAL F CG1   1 
ATOM   10114 C CG2   . VAL H 3 65  ? -7.564  30.012  -45.752 1.00 34.47  ? 265  VAL F CG2   1 
ATOM   10115 N N     . ILE H 3 66  ? -6.516  33.493  -43.396 1.00 24.18  ? 266  ILE F N     1 
ATOM   10116 C CA    . ILE H 3 66  ? -5.702  34.265  -42.467 1.00 24.18  ? 266  ILE F CA    1 
ATOM   10117 C C     . ILE H 3 66  ? -6.514  35.131  -41.422 1.00 24.18  ? 266  ILE F C     1 
ATOM   10118 O O     . ILE H 3 66  ? -6.087  35.313  -40.290 1.00 24.18  ? 266  ILE F O     1 
ATOM   10119 C CB    . ILE H 3 66  ? -4.748  35.117  -43.267 1.00 8.01   ? 266  ILE F CB    1 
ATOM   10120 C CG1   . ILE H 3 66  ? -3.744  34.273  -44.011 1.00 8.01   ? 266  ILE F CG1   1 
ATOM   10121 C CG2   . ILE H 3 66  ? -3.966  36.009  -42.314 1.00 8.01   ? 266  ILE F CG2   1 
ATOM   10122 C CD1   . ILE H 3 66  ? -2.949  35.116  -44.911 1.00 8.01   ? 266  ILE F CD1   1 
ATOM   10123 N N     . ARG H 3 67  ? -7.667  35.674  -41.793 1.00 21.80  ? 267  ARG F N     1 
ATOM   10124 C CA    . ARG H 3 67  ? -8.407  36.435  -40.821 1.00 21.80  ? 267  ARG F CA    1 
ATOM   10125 C C     . ARG H 3 67  ? -8.656  35.522  -39.607 1.00 21.80  ? 267  ARG F C     1 
ATOM   10126 O O     . ARG H 3 67  ? -8.480  35.902  -38.425 1.00 21.80  ? 267  ARG F O     1 
ATOM   10127 C CB    . ARG H 3 67  ? -9.713  36.867  -41.443 1.00 44.54  ? 267  ARG F CB    1 
ATOM   10128 C CG    . ARG H 3 67  ? -10.606 37.652  -40.538 1.00 44.54  ? 267  ARG F CG    1 
ATOM   10129 C CD    . ARG H 3 67  ? -11.892 38.034  -41.284 1.00 44.54  ? 267  ARG F CD    1 
ATOM   10130 N NE    . ARG H 3 67  ? -11.590 39.010  -42.356 1.00 44.54  ? 267  ARG F NE    1 
ATOM   10131 C CZ    . ARG H 3 67  ? -11.840 38.856  -43.674 1.00 44.54  ? 267  ARG F CZ    1 
ATOM   10132 N NH1   . ARG H 3 67  ? -12.429 37.731  -44.114 1.00 44.54  ? 267  ARG F NH1   1 
ATOM   10133 N NH2   . ARG H 3 67  ? -11.464 39.816  -44.560 1.00 44.54  ? 267  ARG F NH2   1 
ATOM   10134 N N     . ASP H 3 68  ? -9.076  34.296  -39.896 1.00 29.69  ? 268  ASP F N     1 
ATOM   10135 C CA    . ASP H 3 68  ? -9.340  33.426  -38.783 1.00 29.69  ? 268  ASP F CA    1 
ATOM   10136 C C     . ASP H 3 68  ? -8.077  33.111  -38.087 1.00 29.69  ? 268  ASP F C     1 
ATOM   10137 O O     . ASP H 3 68  ? -7.972  33.301  -36.907 1.00 29.69  ? 268  ASP F O     1 
ATOM   10138 C CB    . ASP H 3 68  ? -10.030 32.146  -39.216 1.00 26.26  ? 268  ASP F CB    1 
ATOM   10139 C CG    . ASP H 3 68  ? -11.405 32.417  -39.753 1.00 26.26  ? 268  ASP F CG    1 
ATOM   10140 O OD1   . ASP H 3 68  ? -11.878 33.595  -39.617 1.00 26.26  ? 268  ASP F OD1   1 
ATOM   10141 O OD2   . ASP H 3 68  ? -12.005 31.471  -40.331 1.00 26.26  ? 268  ASP F OD2   1 
ATOM   10142 N N     . ALA H 3 69  ? -7.109  32.645  -38.846 1.00 32.99  ? 269  ALA F N     1 
ATOM   10143 C CA    . ALA H 3 69  ? -5.831  32.310  -38.270 1.00 32.99  ? 269  ALA F CA    1 
ATOM   10144 C C     . ALA H 3 69  ? -5.366  33.410  -37.338 1.00 32.99  ? 269  ALA F C     1 
ATOM   10145 O O     . ALA H 3 69  ? -5.126  33.201  -36.140 1.00 32.99  ? 269  ALA F O     1 
ATOM   10146 C CB    . ALA H 3 69  ? -4.821  32.077  -39.362 1.00 25.60  ? 269  ALA F CB    1 
ATOM   10147 N N     . VAL H 3 70  ? -5.263  34.609  -37.853 1.00 22.23  ? 270  VAL F N     1 
ATOM   10148 C CA    . VAL H 3 70  ? -4.816  35.629  -36.959 1.00 22.23  ? 270  VAL F CA    1 
ATOM   10149 C C     . VAL H 3 70  ? -5.803  35.877  -35.846 1.00 22.23  ? 270  VAL F C     1 
ATOM   10150 O O     . VAL H 3 70  ? -5.421  36.277  -34.770 1.00 22.23  ? 270  VAL F O     1 
ATOM   10151 C CB    . VAL H 3 70  ? -4.437  36.861  -37.732 1.00 8.39   ? 270  VAL F CB    1 
ATOM   10152 C CG1   . VAL H 3 70  ? -4.237  38.046  -36.823 1.00 8.39   ? 270  VAL F CG1   1 
ATOM   10153 C CG2   . VAL H 3 70  ? -3.194  36.519  -38.529 1.00 8.39   ? 270  VAL F CG2   1 
ATOM   10154 N N     . THR H 3 71  ? -7.074  35.620  -36.062 1.00 27.64  ? 271  THR F N     1 
ATOM   10155 C CA    . THR H 3 71  ? -7.917  35.767  -34.918 1.00 27.64  ? 271  THR F CA    1 
ATOM   10156 C C     . THR H 3 71  ? -7.530  34.760  -33.851 1.00 27.64  ? 271  THR F C     1 
ATOM   10157 O O     . THR H 3 71  ? -7.611  35.094  -32.698 1.00 27.64  ? 271  THR F O     1 
ATOM   10158 C CB    . THR H 3 71  ? -9.296  35.583  -35.267 1.00 18.24  ? 271  THR F CB    1 
ATOM   10159 O OG1   . THR H 3 71  ? -9.658  36.686  -36.077 1.00 18.24  ? 271  THR F OG1   1 
ATOM   10160 C CG2   . THR H 3 71  ? -10.190 35.515  -34.026 1.00 18.24  ? 271  THR F CG2   1 
ATOM   10161 N N     . TYR H 3 72  ? -7.079  33.559  -34.201 1.00 33.00  ? 272  TYR F N     1 
ATOM   10162 C CA    . TYR H 3 72  ? -6.700  32.627  -33.189 1.00 33.00  ? 272  TYR F CA    1 
ATOM   10163 C C     . TYR H 3 72  ? -5.455  33.158  -32.474 1.00 33.00  ? 272  TYR F C     1 
ATOM   10164 O O     . TYR H 3 72  ? -5.324  33.078  -31.241 1.00 33.00  ? 272  TYR F O     1 
ATOM   10165 C CB    . TYR H 3 72  ? -6.415  31.272  -33.791 1.00 23.07  ? 272  TYR F CB    1 
ATOM   10166 C CG    . TYR H 3 72  ? -7.680  30.412  -33.968 1.00 23.07  ? 272  TYR F CG    1 
ATOM   10167 C CD1   . TYR H 3 72  ? -8.323  30.258  -35.226 1.00 23.07  ? 272  TYR F CD1   1 
ATOM   10168 C CD2   . TYR H 3 72  ? -8.335  29.870  -32.880 1.00 23.07  ? 272  TYR F CD2   1 
ATOM   10169 C CE1   . TYR H 3 72  ? -9.591  29.606  -35.348 1.00 23.07  ? 272  TYR F CE1   1 
ATOM   10170 C CE2   . TYR H 3 72  ? -9.589  29.219  -33.025 1.00 23.07  ? 272  TYR F CE2   1 
ATOM   10171 C CZ    . TYR H 3 72  ? -10.195 29.108  -34.255 1.00 23.07  ? 272  TYR F CZ    1 
ATOM   10172 O OH    . TYR H 3 72  ? -11.410 28.533  -34.328 1.00 23.07  ? 272  TYR F OH    1 
ATOM   10173 N N     . THR H 3 73  ? -4.532  33.714  -33.247 1.00 35.46  ? 273  THR F N     1 
ATOM   10174 C CA    . THR H 3 73  ? -3.302  34.234  -32.680 1.00 35.46  ? 273  THR F CA    1 
ATOM   10175 C C     . THR H 3 73  ? -3.602  35.257  -31.586 1.00 35.46  ? 273  THR F C     1 
ATOM   10176 O O     . THR H 3 73  ? -3.151  35.052  -30.467 1.00 35.46  ? 273  THR F O     1 
ATOM   10177 C CB    . THR H 3 73  ? -2.520  34.924  -33.710 1.00 34.80  ? 273  THR F CB    1 
ATOM   10178 O OG1   . THR H 3 73  ? -2.596  34.200  -34.898 1.00 34.80  ? 273  THR F OG1   1 
ATOM   10179 C CG2   . THR H 3 73  ? -1.137  34.972  -33.349 1.00 34.80  ? 273  THR F CG2   1 
ATOM   10180 N N     . GLU H 3 74  ? -4.312  36.360  -31.932 1.00 36.10  ? 274  GLU F N     1 
ATOM   10181 C CA    . GLU H 3 74  ? -4.696  37.404  -31.002 1.00 36.10  ? 274  GLU F CA    1 
ATOM   10182 C C     . GLU H 3 74  ? -5.344  36.740  -29.815 1.00 36.10  ? 274  GLU F C     1 
ATOM   10183 O O     . GLU H 3 74  ? -5.011  36.990  -28.647 1.00 36.10  ? 274  GLU F O     1 
ATOM   10184 C CB    . GLU H 3 74  ? -5.689  38.372  -31.669 1.00 77.96  ? 274  GLU F CB    1 
ATOM   10185 C CG    . GLU H 3 74  ? -5.203  39.000  -32.968 1.00 77.96  ? 274  GLU F CG    1 
ATOM   10186 C CD    . GLU H 3 74  ? -5.862  40.332  -33.297 1.00 77.96  ? 274  GLU F CD    1 
ATOM   10187 O OE1   . GLU H 3 74  ? -7.113  40.433  -33.196 1.00 77.96  ? 274  GLU F OE1   1 
ATOM   10188 O OE2   . GLU H 3 74  ? -5.105  41.265  -33.669 1.00 77.96  ? 274  GLU F OE2   1 
ATOM   10189 N N     . HIS H 3 75  ? -6.242  35.825  -30.102 1.00 33.57  ? 275  HIS F N     1 
ATOM   10190 C CA    . HIS H 3 75  ? -6.851  35.337  -28.956 1.00 33.57  ? 275  HIS F CA    1 
ATOM   10191 C C     . HIS H 3 75