data_1P3K
# 
_entry.id   1P3K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P3K         
NDB   PD0419       
RCSB  RCSB018963   
WWPDB D_1000018963 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'X-ray structure of the Nucleosome Core Particle at 2.8 A' unspecified 
PDB 1F66 '2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2A.Z' unspecified 
PDB 1ID3 
;Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental 
Differences In Inter-Nucleosome Interactions
;
unspecified 
PDB 1KX3 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution' unspecified 
PDB 1KX4 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146B, At 2.6 A Resolution' unspecified 
PDB 1KX5 'X-Ray Structure Of The Nucleosome Core Particle, Ncp147, At 1.9 A Resolution' unspecified 
PDB 1P34 . unspecified 
PDB 1P3A . unspecified 
PDB 1P3B . unspecified 
PDB 1P3F . unspecified 
PDB 1P3G . unspecified 
PDB 1P3I . unspecified 
PDB 1P3L . unspecified 
PDB 1P3M . unspecified 
PDB 1P3O . unspecified 
PDB 1P3P . unspecified 
# 
_pdbx_database_status.entry_id                        1P3K 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muthurajan, U.M.'       1 
'Bao, Y.'                2 
'Forsberg, L.J.'         3 
'Edayathumangalam, R.S.' 4 
'Dyer, P.N.'             5 
'White, C.L.'            6 
'Luger, K.'              7 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            23 
_citation.page_first                260 
_citation.page_last                 271 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14739929 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muthurajan, U.M.'       1 
primary 'Bao, Y.'                2 
primary 'Forsberg, L.J.'         3 
primary 'Edayathumangalam, R.S.' 4 
primary 'Dyer, P.N.'             5 
primary 'White, C.L.'            6 
primary 'Luger, K.'              7 
# 
_cell.entry_id           1P3K 
_cell.length_a           104.992 
_cell.length_b           109.681 
_cell.length_c           180.721 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P3K 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Palindromic 146bp Human Alpha-Satellite DNA fragment' 45054.844 2   ? ? ? ? 
2 polymer man 'Histone H3'                                           15333.912 2   ? ? ? ? 
3 polymer man 'Histone H4'                                           11263.231 2   ? ? ? ? 
4 polymer man 'Histone H2A'                                          13962.241 2   ? ? ? ? 
5 polymer man 'Histone H2B'                                          13834.070 2   ? ? ? ? 
6 water   nat water                                                  18.015    162 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVAIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVAIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLU n 
2 35  SER n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 ALA n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 ALA n 
4 124 LYS n 
4 125 SER n 
4 126 ALA n 
4 127 LYS n 
4 128 SER n 
4 129 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'HB 101'         ? ? ? ? ? ? Plasmid ? ? ? pUC ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q7ZT64_9ZZZZ Q7ZT64 2 2 ? ? 
2 UNP H4_XENLA     P62799 3 1 ? ? 
3 UNP Q7ZT66_9ZZZZ Q7ZT66 4 2 ? ? 
4 UNP H2B1_XENLA   P02281 5 1 ? ? 
5 PDB 1P3K         1P3K   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1P3K A 1 ? 135 ? Q7ZT64 2   ? 136 ? 401  535  
2  2 1P3K B 1 ? 102 ? P62799 1   ? 102 ? 1    102  
3  3 1P3K C 1 ? 129 ? Q7ZT66 2   ? 130 ? 801  929  
4  4 1P3K D 1 ? 125 ? P02281 1   ? 125 ? 1198 1322 
5  1 1P3K E 1 ? 135 ? Q7ZT64 2   ? 136 ? 601  735  
6  2 1P3K F 1 ? 102 ? P62799 1   ? 102 ? 201  302  
7  3 1P3K G 1 ? 129 ? Q7ZT66 2   ? 130 ? 1001 1129 
8  4 1P3K H 1 ? 125 ? P02281 1   ? 125 ? 1398 1522 
9  5 1P3K I 1 ? 146 ? 1P3K   1   ? 146 ? 1    146  
10 5 1P3K J 1 ? 146 ? 1P3K   147 ? 292 ? 147  292  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P3K GLU A 34  ? UNP Q7ZT64 GLY 35  CONFLICT 434  1  
1 1P3K SER A 35  ? UNP Q7ZT64 VAL 36  CONFLICT 435  2  
1 1P3K ALA A 102 ? UNP Q7ZT64 GLY 103 CONFLICT 502  3  
1 1P3K ALA A 118 ? UNP Q7ZT64 THR 119 CONFLICT 518  4  
5 1P3K GLU E 34  ? UNP Q7ZT64 GLY 35  CONFLICT 634  5  
5 1P3K SER E 35  ? UNP Q7ZT64 VAL 36  CONFLICT 635  6  
5 1P3K ALA E 102 ? UNP Q7ZT64 GLY 103 CONFLICT 702  7  
5 1P3K ALA E 118 ? UNP Q7ZT64 THR 119 CONFLICT 718  8  
3 1P3K ALA C 14  ? UNP Q7ZT66 SER 15  CONFLICT 814  9  
3 1P3K GLY C 67  ? UNP Q7ZT66 TRP 68  CONFLICT 867  10 
3 1P3K ASN C 68  ? UNP Q7ZT66 GLU 69  CONFLICT 868  11 
3 1P3K ALA C 69  ? UNP Q7ZT66 ARG 70  CONFLICT 869  12 
3 1P3K ALA C 70  ? UNP Q7ZT66 LEU 71  CONFLICT 870  13 
3 1P3K ARG C 71  ? UNP Q7ZT66 PRO 72  CONFLICT 871  14 
3 1P3K ASP C 72  ? UNP Q7ZT66 GLU 73  CONFLICT 872  15 
3 1P3K ASN C 73  ? UNP Q7ZT66 ILE 74  CONFLICT 873  16 
3 1P3K LYS C 74  ? UNP Q7ZT66 TRP 75  CONFLICT 874  17 
3 1P3K THR C 76  ? UNP Q7ZT66 ARG 77  CONFLICT 876  18 
3 1P3K ARG C 77  ? UNP Q7ZT66 PRO 78  CONFLICT 877  19 
3 1P3K ILE C 78  ? UNP Q7ZT66 VAL 79  CONFLICT 878  20 
3 1P3K ILE C 79  ? UNP Q7ZT66 LEU 80  CONFLICT 879  21 
3 1P3K PRO C 80  ? UNP Q7ZT66 SER 81  CONFLICT 880  22 
3 1P3K ARG C 81  ? UNP Q7ZT66 PRO 82  CONFLICT 881  23 
3 1P3K HIS C 82  ? UNP Q7ZT66 GLY 83  CONFLICT 882  24 
3 1P3K LEU C 83  ? UNP Q7ZT66 TRP 84  CONFLICT 883  25 
3 1P3K GLN C 84  ? UNP Q7ZT66 CYS 85  CONFLICT 884  26 
3 1P3K LEU C 85  ? UNP Q7ZT66 ASN 86  CONFLICT 885  27 
3 1P3K ALA C 86  ? UNP Q7ZT66 SER 87  CONFLICT 886  28 
3 1P3K VAL C 87  ? UNP Q7ZT66 LEU 88  CONFLICT 887  29 
3 1P3K ARG C 88  ? UNP Q7ZT66 CYS 89  CONFLICT 888  30 
3 1P3K ALA C 123 ? UNP Q7ZT66 SER 124 CONFLICT 923  31 
3 1P3K ALA C 126 ? UNP Q7ZT66 THR 127 CONFLICT 926  32 
7 1P3K ALA G 14  ? UNP Q7ZT66 SER 15  CONFLICT 1014 33 
7 1P3K GLY G 67  ? UNP Q7ZT66 TRP 68  CONFLICT 1067 34 
7 1P3K ASN G 68  ? UNP Q7ZT66 GLU 69  CONFLICT 1068 35 
7 1P3K ALA G 69  ? UNP Q7ZT66 ARG 70  CONFLICT 1069 36 
7 1P3K ALA G 70  ? UNP Q7ZT66 LEU 71  CONFLICT 1070 37 
7 1P3K ARG G 71  ? UNP Q7ZT66 PRO 72  CONFLICT 1071 38 
7 1P3K ASP G 72  ? UNP Q7ZT66 GLU 73  CONFLICT 1072 39 
7 1P3K ASN G 73  ? UNP Q7ZT66 ILE 74  CONFLICT 1073 40 
7 1P3K LYS G 74  ? UNP Q7ZT66 TRP 75  CONFLICT 1074 41 
7 1P3K THR G 76  ? UNP Q7ZT66 ARG 77  CONFLICT 1076 42 
7 1P3K ARG G 77  ? UNP Q7ZT66 PRO 78  CONFLICT 1077 43 
7 1P3K ILE G 78  ? UNP Q7ZT66 VAL 79  CONFLICT 1078 44 
7 1P3K ILE G 79  ? UNP Q7ZT66 LEU 80  CONFLICT 1079 45 
7 1P3K PRO G 80  ? UNP Q7ZT66 SER 81  CONFLICT 1080 46 
7 1P3K ARG G 81  ? UNP Q7ZT66 PRO 82  CONFLICT 1081 47 
7 1P3K HIS G 82  ? UNP Q7ZT66 GLY 83  CONFLICT 1082 48 
7 1P3K LEU G 83  ? UNP Q7ZT66 TRP 84  CONFLICT 1083 49 
7 1P3K GLN G 84  ? UNP Q7ZT66 CYS 85  CONFLICT 1084 50 
7 1P3K LEU G 85  ? UNP Q7ZT66 ASN 86  CONFLICT 1085 51 
7 1P3K ALA G 86  ? UNP Q7ZT66 SER 87  CONFLICT 1086 52 
7 1P3K VAL G 87  ? UNP Q7ZT66 LEU 88  CONFLICT 1087 53 
7 1P3K ARG G 88  ? UNP Q7ZT66 CYS 89  CONFLICT 1088 54 
7 1P3K ALA G 123 ? UNP Q7ZT66 SER 124 CONFLICT 1123 55 
7 1P3K ALA G 126 ? UNP Q7ZT66 THR 127 CONFLICT 1126 56 
4 1P3K GLN D 22  ? UNP P02281 PRO 23  CONFLICT 1219 57 
4 1P3K LEU D 45  ? UNP P02281 MET 46  CONFLICT 1242 58 
4 1P3K SER D 60  ? UNP P02281 GLY 61  CONFLICT 1257 59 
4 1P3K VAL D 69  ? UNP P02281 ILE 70  CONFLICT 1266 60 
8 1P3K GLN H 22  ? UNP P02281 PRO 23  CONFLICT 1419 61 
8 1P3K LEU H 45  ? UNP P02281 MET 46  CONFLICT 1442 62 
8 1P3K SER H 60  ? UNP P02281 GLY 61  CONFLICT 1457 63 
8 1P3K VAL H 69  ? UNP P02281 ILE 70  CONFLICT 1466 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1P3K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.19 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'MnCl2, KCl, Potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'Potassium cacodylate' ? ? ? 
1 4 2 MnCl2                  ? ? ? 
1 5 2 KCl                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-02-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
# 
_reflns.entry_id                     1P3K 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3. 
_reflns.d_resolution_high            2.90 
_reflns.d_resolution_low             50. 
_reflns.number_all                   ? 
_reflns.number_obs                   46940 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.124 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.385 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P3K 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             50. 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     46005 
_refine.ls_number_reflns_obs                     44172 
_refine.ls_number_reflns_R_free                  1833 
_refine.ls_percent_reflns_obs                    97.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.291 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 4.1 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5978 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             162 
_refine_hist.number_atoms_total               12120 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d   1.53  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.53  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P3K 
_struct.title                     
;Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
;
_struct.pdbx_descriptor           'Nucleosome Core Particle/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P3K 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
'Sin mutants, Nucleosome Core Particle, chromatin, protein/DNA interaction, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? GLN C 76  ? ARG A 463  GLN A 476  1 ? 14 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 520  ARG A 531  1 ? 12 
HELX_P HELX_P5  5  THR D 30  ? GLY D 41  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P6  6  LEU D 49  ? ALA D 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P7  7  THR D 82  ? GLN D 93  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P8  8  THR E 16  ? GLY E 22  ? THR C 816  GLY C 822  1 ? 7  
HELX_P HELX_P9  9  PRO E 26  ? GLY E 37  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P10 10 ALA E 45  ? ASN E 73  ? ALA C 845  ASN C 873  1 ? 29 
HELX_P HELX_P11 11 ILE E 79  ? ASP E 90  ? ILE C 879  ASP C 890  1 ? 12 
HELX_P HELX_P12 12 ASP E 90  ? LEU E 97  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P13 13 GLN E 112 ? LEU E 116 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P14 14 TYR F 37  ? HIS F 49  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P15 15 SER F 55  ? ASN F 84  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P16 16 THR F 90  ? LEU F 102 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P17 17 PRO F 103 ? ALA F 124 ? PRO D 1300 ALA D 1321 1 ? 22 
HELX_P HELX_P18 18 GLY G 44  ? GLN G 55  ? GLY E 644  GLN E 655  1 ? 12 
HELX_P HELX_P19 19 ARG G 63  ? ASP G 77  ? ARG E 663  ASP E 677  1 ? 15 
HELX_P HELX_P20 20 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P21 21 MET G 120 ? ARG G 131 ? MET E 720  ARG E 731  1 ? 12 
HELX_P HELX_P22 22 ASP H 24  ? ILE H 29  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P23 23 THR H 30  ? GLY H 41  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P24 24 LEU H 49  ? ALA H 76  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P25 25 THR H 82  ? GLN H 93  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P26 26 THR I 16  ? GLY I 22  ? THR G 1016 GLY G 1022 1 ? 7  
HELX_P HELX_P27 27 PRO I 26  ? GLY I 37  ? PRO G 1026 GLY G 1037 1 ? 12 
HELX_P HELX_P28 28 GLY I 46  ? ASP I 72  ? GLY G 1046 ASP G 1072 1 ? 27 
HELX_P HELX_P29 29 ILE I 79  ? ASN I 89  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P30 30 ASP I 90  ? LEU I 97  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P31 31 GLN I 112 ? LEU I 116 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P32 32 TYR J 37  ? HIS J 49  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P33 33 SER J 55  ? ASN J 84  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P34 34 THR J 90  ? LEU J 102 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P35 35 PRO J 103 ? SER J 123 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B DA 145 N6 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B DT 142 O4 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B DA 139 N1 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B DA 139 N6 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog19  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 137 N1 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B DG 137 O6 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT 136 N3 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog25  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog26  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? A DG 15  O6 ? ? ? 1_555 B DG 131 N1 ? ? I DG 15  J DG 277 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog29  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog30  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DT 130 O4 ? ? I DC 16  J DT 276 1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog31  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DG 131 N1 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B DG 131 N2 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DC 129 N4 ? ? I DA 17  J DC 275 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog35  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog38  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? A DC 22  N3 ? ? ? 1_555 B DG 125 N1 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 125 N2 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA 124 N6 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog44  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog45  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 25  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog46  hydrog ? ? A DC 26  N3 ? ? ? 1_555 B DG 121 N1 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? A DC 26  N4 ? ? ? 1_555 B DG 121 O6 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT 120 N3 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 120 O4 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 28  J DT 265 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog52  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 116 N4 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B DA 115 N1 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B DA 115 N6 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DG 33  N2 ? ? ? 1_555 B DC 114 O2 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? A DG 33  O6 ? ? ? 1_555 B DC 114 N4 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 37  J DA 255 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog71  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DC 108 N4 ? ? I DT 38  J DC 254 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog74  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 108 N4 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DA 41  N6 ? ? ? 1_555 B DT 106 O4 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog89  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog90  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B DC 101 O2 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B DC 101 N4 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DG 100 N1 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DC 47  N4 ? ? ? 1_555 B DG 100 O6 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DC 49  N3 ? ? ? 1_555 B DG 98  N1 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DC 49  N4 ? ? ? 1_555 B DG 98  O6 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DC 50  N3 ? ? ? 1_555 B DG 97  N1 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DC 50  N4 ? ? ? 1_555 B DG 97  O6 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DC 53  N3 ? ? ? 1_555 B DG 94  N1 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DC 53  O2 ? ? ? 1_555 B DG 94  N2 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog116 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DG 58  N1 ? ? ? 1_555 B DC 89  N3 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DG 58  N2 ? ? ? 1_555 B DC 89  O2 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DG 58  O6 ? ? ? 1_555 B DC 89  N4 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog125 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog126 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog127 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DC 69  N3 ? ? ? 1_555 B DG 78  N1 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B DG 78  O6 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog146 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG 71  N1 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N2 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 70  N1 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 70  N2 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 58  N1 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 58  O6 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 90  J DA 202 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog195 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B DA 55  N6 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog224 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 45  O4 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 44  O2 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DG 103 O6 ? ? ? 1_555 B DC 44  N4 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog232 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N2 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog235 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B DG 33  N1 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B DG 33  N2 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog254 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog255 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 119 J DA 173 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog258 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog261 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 25  O2 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog262 hydrog ? ? A DT 123 N3 ? ? ? 1_555 B DA 24  N1 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DT 123 O4 ? ? ? 1_555 B DA 24  N6 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DA 126 N1 ? ? ? 1_555 B DT 21  N3 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog269 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DC 16  N3 ? ? I DT 130 J DC 162 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog270 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DC 16  N4 ? ? I DT 130 J DC 162 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog271 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog282 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog283 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog291 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog292 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog293 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog294 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog295 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog296 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog297 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog298 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog299 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog300 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog301 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog302 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC 3   O2 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog303 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC 3   N4 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog304 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog305 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog306 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog307 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 80  ? VAL D 81  ? THR B 80   VAL B 81   
B 1 ALA C 118 ? ILE C 119 ? ALA A 518  ILE A 519  
B 2 ARG D 45  ? ILE D 46  ? ARG B 45   ILE B 46   
C 1 LEU D 97  ? TYR D 98  ? LEU B 97   TYR B 98   
C 2 THR I 101 ? ILE I 102 ? THR G 1101 ILE G 1102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 842  VAL C 843  
D 2 THR F 88  ? ILE F 89  ? THR D 1285 ILE D 1286 
E 1 ARG E 77  ? ILE E 78  ? ARG C 877  ILE C 878  
E 2 GLY F 53  ? ILE F 54  ? GLY D 1250 ILE D 1251 
F 1 VAL E 100 ? ILE E 102 ? VAL C 900  ILE C 902  
F 2 THR H 96  ? TYR H 98  ? THR F 296  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 80  ? VAL H 81  ? THR F 280  VAL F 281  
H 1 ALA G 118 ? ILE G 119 ? ALA E 718  ILE E 719  
H 2 ARG H 45  ? ILE H 46  ? ARG F 245  ILE F 246  
I 1 ARG I 42  ? VAL I 43  ? ARG G 1042 VAL G 1043 
I 2 THR J 88  ? ILE J 89  ? THR H 1485 ILE H 1486 
J 1 ARG I 77  ? ILE I 78  ? ARG G 1077 ILE G 1078 
J 2 GLY J 53  ? ILE J 54  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 81  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O ARG D 45  ? O ARG B 45   
C 1 2 N TYR D 98  ? N TYR B 98   O THR I 101 ? O THR G 1101 
D 1 2 N ARG E 42  ? N ARG C 842  O ILE F 89  ? O ILE D 1286 
E 1 2 N ILE E 78  ? N ILE C 878  O GLY F 53  ? O GLY D 1250 
F 1 2 N THR E 101 ? N THR C 901  O TYR H 98  ? O TYR F 298  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 81  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O ARG H 45  ? O ARG F 245  
I 1 2 N ARG I 42  ? N ARG G 1042 O ILE J 89  ? O ILE H 1486 
J 1 2 N ILE I 78  ? N ILE G 1078 O GLY J 53  ? O GLY H 1450 
# 
_atom_sites.entry_id                    1P3K 
_atom_sites.fract_transf_matrix[1][1]   0.009525 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009117 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005533 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? 50.923  54.196 -91.180 1.00 125.67 ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? 51.078  54.794 -92.470 1.00 124.87 ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? 49.991  54.323 -93.408 1.00 123.84 ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? 50.261  52.950 -93.783 1.00 123.36 ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? 48.603  54.329 -92.766 1.00 123.26 ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? 47.574  54.760 -93.655 1.00 122.59 ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? 48.364  52.879 -92.404 1.00 123.11 ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? 49.154  52.125 -93.450 1.00 122.14 ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? 49.673  50.865 -92.925 1.00 119.86 ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? 50.828  50.652 -92.215 1.00 119.18 ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? 50.996  49.407 -91.842 1.00 118.49 ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? 49.879  48.757 -92.348 1.00 118.21 ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? 49.461  47.425 -92.287 1.00 117.28 ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? 50.144  46.474 -91.662 1.00 116.71 ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? 48.303  47.100 -92.896 1.00 116.92 ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? 47.619  48.064 -93.523 1.00 117.38 ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? 47.907  49.356 -93.646 1.00 117.95 ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? 49.063  49.641 -93.027 1.00 118.67 ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? 46.068  54.869 -93.106 1.00 156.87 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? 45.284  55.836 -93.918 1.00 132.27 ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? 46.181  55.064 -91.638 1.00 131.89 ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? 45.476  53.414 -93.339 1.00 154.77 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? 44.972  53.034 -94.608 1.00 151.55 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? 43.845  52.049 -94.428 1.00 149.57 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? 44.380  50.795 -93.940 1.00 148.82 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? 42.804  52.495 -93.403 1.00 148.30 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? 41.504  52.117 -93.853 1.00 147.49 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? 43.204  51.750 -92.142 1.00 147.98 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? 43.796  50.458 -92.687 1.00 147.23 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? 44.855  49.857 -91.840 1.00 120.51 ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? 44.822  48.496 -91.596 1.00 119.24 ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? 43.961  47.753 -92.040 1.00 118.89 ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? 45.843  48.036 -90.801 1.00 118.02 ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? 46.863  48.780 -90.236 1.00 117.46 ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? 47.710  48.233 -89.536 1.00 116.36 ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? 46.835  50.188 -90.531 1.00 118.09 ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? 47.899  51.061 -89.955 1.00 117.45 ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? 45.850  50.652 -91.308 1.00 119.18 ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? 40.295  52.031 -92.808 1.00 150.93 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? 39.033  52.267 -93.552 1.00 124.39 ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? 40.656  52.909 -91.660 1.00 124.97 ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? 40.299  50.496 -92.384 1.00 149.42 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? 40.276  49.479 -93.391 1.00 145.93 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? 39.991  48.122 -92.785 1.00 142.98 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? 41.124  47.633 -92.029 1.00 141.67 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? 38.801  48.075 -91.832 1.00 141.15 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? 38.120  46.833 -91.990 1.00 138.70 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? 39.449  48.141 -90.461 1.00 140.51 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? 40.737  47.366 -90.688 1.00 139.65 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? 41.877  47.727 -89.830 1.00 110.58 ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? 42.564  46.703 -89.184 1.00 108.62 ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? 42.137  45.540 -89.290 1.00 107.64 ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? 43.667  47.002 -88.462 1.00 107.43 ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? 44.073  48.269 -88.361 1.00 107.04 ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? 45.188  48.516 -87.671 1.00 106.07 ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? 43.362  49.340 -88.972 1.00 107.57 ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? 42.279  49.028 -89.690 1.00 109.22 ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? 36.940  46.452 -90.977 1.00 127.20 ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? 35.870  45.716 -91.714 1.00 94.19  ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? 36.619  47.689 -90.214 1.00 93.31  ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? 37.612  45.431 -89.965 1.00 122.90 ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? 37.897  44.099 -90.365 1.00 116.14 ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? 38.089  43.237 -89.146 1.00 111.44 ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? 39.142  43.816 -88.359 1.00 109.48 ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? 36.899  43.145 -88.205 1.00 109.03 ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? 37.061  41.922 -87.542 1.00 106.02 ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? 37.139  44.276 -87.217 1.00 108.44 ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? 38.652  44.224 -87.086 1.00 108.00 ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? 39.367  45.454 -86.728 1.00 72.27  ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? 39.031  46.767 -86.977 1.00 71.60  ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? 39.970  47.628 -86.640 1.00 71.16  ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? 40.982  46.832 -86.104 1.00 70.67  ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? 42.259  47.135 -85.570 1.00 70.24  ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? 42.761  48.367 -85.486 1.00 69.88  ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? 43.009  46.105 -85.118 1.00 69.81  ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? 42.510  44.868 -85.180 1.00 69.68  ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? 41.335  44.454 -85.647 1.00 69.33  ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? 40.608  45.495 -86.114 1.00 71.14  ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? 35.786  41.053 -87.166 1.00 100.85 ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? 35.593  40.046 -88.244 1.00 88.92  ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? 34.659  41.941 -86.738 1.00 88.76  ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? 36.387  40.266 -85.929 1.00 100.05 ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? 37.682  39.656 -86.078 1.00 97.23  ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? 38.408  39.549 -84.760 1.00 95.59  ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? 39.182  40.728 -84.450 1.00 92.41  ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? 37.522  39.266 -83.564 1.00 95.47  ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? 38.191  38.269 -82.829 1.00 97.14  ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? 37.477  40.603 -82.837 1.00 92.13  ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? 38.820  41.245 -83.189 1.00 91.43  ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? 38.867  42.706 -83.315 1.00 77.40  ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? 38.038  43.524 -84.041 1.00 77.78  ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? 38.384  44.795 -84.010 1.00 76.15  ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? 39.499  44.817 -83.194 1.00 74.99  ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? 40.332  45.865 -82.764 1.00 73.81  ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? 40.156  47.136 -83.113 1.00 72.36  ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? 41.367  45.557 -81.957 1.00 74.67  ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? 41.549  44.275 -81.614 1.00 74.56  ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? 40.834  43.197 -81.953 1.00 75.14  ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? 39.811  43.540 -82.752 1.00 76.21  ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? 37.484  37.582 -81.589 1.00 93.13  ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? 37.528  36.101 -81.748 1.00 84.47  ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? 36.190  38.272 -81.305 1.00 84.07  ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? 38.537  38.022 -80.498 1.00 92.15  ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? 39.197  39.269 -80.675 1.00 88.77  ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? 40.115  39.547 -79.517 1.00 84.85  ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? 40.473  40.943 -79.576 1.00 84.42  ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? 39.431  39.359 -78.169 1.00 84.11  ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? 40.412  39.005 -77.195 1.00 84.99  ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? 38.857  40.729 -77.884 1.00 82.37  ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? 39.912  41.637 -78.474 1.00 82.23  ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? 39.392  42.908 -78.977 1.00 70.58  ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? 40.115  44.048 -78.719 1.00 68.53  ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? 41.205  44.034 -78.158 1.00 68.62  ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? 39.540  45.205 -79.167 1.00 68.56  ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? 38.381  45.327 -79.883 1.00 70.40  ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? 37.997  46.433 -80.222 1.00 70.35  ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? 37.704  44.082 -80.180 1.00 70.72  ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? 36.486  44.107 -81.045 1.00 72.05  ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? 38.221  42.952 -79.688 1.00 70.97  ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? 39.961  38.648 -75.699 1.00 70.15  ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? 40.154  37.195 -75.493 1.00 90.51  ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? 38.627  39.250 -75.476 1.00 93.27  ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? 41.026  39.429 -74.820 1.00 68.89  ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? 42.356  39.559 -75.286 1.00 68.66  ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? 42.975  40.828 -74.753 1.00 68.26  ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? 42.339  41.984 -75.334 1.00 67.56  ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? 42.848  41.009 -73.249 1.00 68.51  ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? 43.985  41.743 -72.792 1.00 71.74  ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? 41.586  41.841 -73.130 1.00 66.98  ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? 41.739  42.765 -74.319 1.00 66.80  ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? 40.493  43.308 -74.857 1.00 86.04  ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? 39.343  42.634 -75.201 1.00 85.51  ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? 38.406  43.408 -75.698 1.00 85.54  ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? 38.971  44.679 -75.672 1.00 82.93  ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? 38.488  45.938 -76.073 1.00 82.24  ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? 37.290  46.133 -76.620 1.00 80.17  ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? 39.297  47.004 -75.896 1.00 80.12  ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? 40.513  46.807 -75.368 1.00 82.13  ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? 41.087  45.674 -74.971 1.00 81.24  ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? 40.251  44.632 -75.149 1.00 82.93  ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? 44.092  42.146 -71.249 1.00 100.14 ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? 45.503  41.945 -70.839 1.00 77.83  ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? 42.998  41.454 -70.511 1.00 75.19  ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? 43.823  43.708 -71.295 1.00 102.11 ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? 44.662  44.527 -72.097 1.00 104.46 ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? 44.591  45.957 -71.628 1.00 106.01 ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? 43.436  46.603 -72.210 1.00 105.80 ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? 44.442  46.081 -70.115 1.00 107.36 ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? 45.285  47.133 -69.627 1.00 109.98 ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? 42.956  46.346 -69.929 1.00 105.30 ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? 42.595  47.109 -71.189 1.00 103.82 ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? 41.202  46.940 -71.637 1.00 76.35  ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? 40.460  48.073 -71.922 1.00 74.84  ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? 40.892  49.214 -71.809 1.00 73.78  ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? 39.187  47.821 -72.356 1.00 72.62  ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? 38.594  46.586 -72.533 1.00 73.87  ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? 37.442  46.510 -72.960 1.00 71.22  ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? 39.418  45.456 -72.200 1.00 73.65  ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? 38.843  44.083 -72.345 1.00 74.18  ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? 40.665  45.684 -71.773 1.00 74.49  ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? 45.021  47.761 -68.176 1.00 119.99 ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? 46.296  48.291 -67.632 1.00 81.26  ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? 44.190  46.846 -67.350 1.00 80.09  ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? 44.121  49.000 -68.554 1.00 120.64 ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? 44.422  49.782 -69.696 1.00 121.21 ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? 43.632  51.056 -69.608 1.00 121.37 ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? 42.268  50.812 -70.035 1.00 119.83 ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? 43.553  51.451 -68.140 1.00 122.44 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? 43.633  52.856 -67.960 1.00 125.79 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? 42.197  50.937 -67.696 1.00 119.69 ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? 41.364  51.009 -68.958 1.00 117.33 ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? 40.375  49.928 -69.007 1.00 74.60  ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? 39.103  50.182 -69.523 1.00 72.60  ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? 38.836  51.327 -69.924 1.00 73.80  ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? 38.196  49.172 -69.572 1.00 70.67  ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? 38.528  47.959 -69.129 1.00 70.19  ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? 37.624  46.990 -69.211 1.00 68.58  ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? 39.810  47.682 -68.588 1.00 69.71  ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? 40.696  48.682 -68.550 1.00 72.71  ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? 43.448  53.462 -66.487 1.00 129.58 ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? 43.986  54.846 -66.488 1.00 119.51 ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? 43.978  52.465 -65.514 1.00 118.42 ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? 41.865  53.513 -66.323 1.00 129.11 ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? 41.077  54.370 -67.139 1.00 129.79 ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? 39.796  54.712 -66.419 1.00 130.47 ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? 38.728  53.801 -66.755 1.00 129.22 ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? 39.924  54.628 -64.899 1.00 131.24 ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? 39.002  55.532 -64.309 1.00 134.39 ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? 39.429  53.227 -64.610 1.00 129.68 ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? 38.247  53.224 -65.553 1.00 128.32 ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? 37.629  51.932 -65.871 1.00 116.42 ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? 36.429  51.936 -66.581 1.00 116.59 ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? 35.952  53.022 -66.939 1.00 117.95 ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? 35.823  50.762 -66.861 1.00 116.01 ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? 36.383  49.618 -66.466 1.00 115.40 ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? 35.766  48.490 -66.754 1.00 115.13 ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? 37.608  49.585 -65.754 1.00 115.14 ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? 38.195  50.752 -65.481 1.00 115.52 ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? 39.542  56.789 -63.474 1.00 106.36 ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? 40.537  57.537 -64.296 1.00 108.23 ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? 39.909  56.352 -62.099 1.00 108.99 ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? 38.213  57.658 -63.355 1.00 103.98 ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? 37.495  58.100 -64.517 1.00 101.44 ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? 36.019  57.826 -64.358 1.00 100.81 ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? 35.741  56.438 -64.666 1.00 99.67  ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? 35.495  58.057 -62.939 1.00 100.57 ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? 34.194  58.651 -62.976 1.00 100.43 ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? 35.385  56.649 -62.392 1.00 100.64 ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? 34.938  55.911 -63.632 1.00 100.35 ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? 35.123  54.462 -63.585 1.00 102.99 ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? 36.245  53.774 -63.195 1.00 102.98 ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? 36.111  52.470 -63.250 1.00 102.77 ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? 34.810  52.284 -63.708 1.00 102.29 ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? 34.062  51.127 -63.980 1.00 102.09 ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? 34.543  49.894 -63.838 1.00 101.52 ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? 32.790  51.282 -64.413 1.00 101.82 ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? 32.319  52.518 -64.570 1.00 101.49 ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? 32.927  53.687 -64.357 1.00 101.36 ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? 34.189  53.499 -63.919 1.00 102.21 ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? 33.368  58.856 -61.612 1.00 119.51 ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? 32.820  60.230 -61.669 1.00 93.68  ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? 34.219  58.453 -60.463 1.00 92.52  ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? 32.153  57.823 -61.713 1.00 121.38 ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? 31.181  57.913 -62.759 1.00 121.99 ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? 30.076  56.903 -62.541 1.00 123.15 ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? 30.584  55.553 -62.718 1.00 123.03 ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? 29.415  56.926 -61.158 1.00 123.57 ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? 27.994  56.759 -61.283 1.00 124.93 ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? 30.017  55.719 -60.462 1.00 123.24 ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? 30.189  54.745 -61.615 1.00 122.30 ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? 31.227  53.716 -61.387 1.00 90.99  ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? 30.898  52.358 -61.536 1.00 88.98  ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? 29.765  52.055 -61.916 1.00 89.68  ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? 31.833  51.417 -61.260 1.00 86.84  ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? 33.057  51.787 -60.852 1.00 86.93  ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? 33.937  50.835 -60.536 1.00 84.48  ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? 33.430  53.156 -60.736 1.00 87.83  ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? 32.492  54.079 -61.009 1.00 90.11  ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? 27.101  56.477 -59.971 1.00 116.87 ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? 25.691  56.829 -60.245 1.00 108.89 ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? 27.790  57.082 -58.806 1.00 108.02 ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? 27.138  54.896 -59.830 1.00 117.49 ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? 26.342  54.076 -60.668 1.00 120.42 ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? 25.964  52.820 -59.925 1.00 122.61 ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? 27.123  51.966 -59.762 1.00 122.95 ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? 25.454  53.112 -58.517 1.00 124.55 ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? 24.366  52.240 -58.208 1.00 128.58 ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? 26.648  52.806 -57.631 1.00 123.62 ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? 27.346  51.692 -58.387 1.00 122.54 ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? 28.804  51.629 -58.163 1.00 113.07 ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? 29.402  50.384 -57.940 1.00 112.77 ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? 28.689  49.369 -57.938 1.00 113.22 ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? 30.741  50.320 -57.733 1.00 111.66 ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? 31.474  51.440 -57.749 1.00 111.45 ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? 32.791  51.333 -57.560 1.00 110.60 ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? 30.889  52.718 -57.967 1.00 111.97 ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? 29.564  52.767 -58.169 1.00 112.54 ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? 23.691  52.276 -56.744 1.00 171.43 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? 22.236  52.169 -56.913 1.00 94.03  ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? 24.236  53.445 -55.995 1.00 94.98  ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? 24.167  50.908 -56.067 1.00 172.75 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? 24.119  49.684 -56.811 1.00 174.96 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? 24.673  48.543 -55.986 1.00 176.95 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? 26.094  48.723 -55.880 1.00 177.27 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? 24.201  48.579 -54.533 1.00 178.65 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? 24.093  47.274 -53.961 1.00 180.78 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? 25.211  49.468 -53.834 1.00 178.05 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? 26.420  48.887 -54.485 1.00 177.23 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? 27.621  49.700 -54.367 1.00 99.50  ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? 28.826  49.090 -54.156 1.00 99.09  ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? 28.942  47.895 -53.999 1.00 99.19  ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? 29.890  49.946 -54.128 1.00 98.21  ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? 29.847  51.324 -54.300 1.00 97.94  ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? 30.884  51.974 -54.314 1.00 97.88  ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? 28.543  51.882 -54.482 1.00 97.86  ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? 28.401  53.362 -54.682 1.00 97.40  ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? 27.505  51.055 -54.494 1.00 98.33  ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? 23.519  47.117 -52.465 1.00 175.45 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? 22.095  47.541 -52.580 1.00 120.30 ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? 24.411  47.824 -51.444 1.00 120.77 ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? 23.523  45.520 -52.276 1.00 174.59 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? 24.080  44.650 -53.324 1.00 174.12 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? 25.065  43.639 -52.793 1.00 173.82 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? 26.309  44.336 -52.645 1.00 174.17 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? 24.656  43.182 -51.423 1.00 173.38 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? 24.748  41.785 -51.408 1.00 172.51 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? 25.469  44.042 -50.456 1.00 173.60 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? 26.698  44.382 -51.281 1.00 173.61 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? 27.368  45.667 -51.031 1.00 118.80 ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? 26.790  46.909 -50.865 1.00 118.54 ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? 27.663  47.873 -50.723 1.00 118.57 ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? 28.891  47.233 -50.777 1.00 117.87 ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? 30.173  47.760 -50.691 1.00 117.30 ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? 30.492  48.942 -50.569 1.00 116.81 ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? 31.147  46.758 -50.764 1.00 116.99 ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? 30.887  45.403 -50.909 1.00 117.28 ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? 31.935  44.567 -50.951 1.00 117.04 ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? 29.675  44.905 -51.005 1.00 117.85 ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? 28.728  45.865 -50.938 1.00 118.29 ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? 24.609  41.018 -50.020 1.00 150.14 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? 24.672  39.611 -50.415 1.00 118.24 ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? 23.442  41.511 -49.233 1.00 118.53 ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? 25.974  41.343 -49.254 1.00 148.21 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? 27.220  41.069 -49.926 1.00 143.67 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? 28.409  41.215 -49.012 1.00 140.43 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? 28.740  42.609 -48.870 1.00 139.36 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? 28.164  40.714 -47.602 1.00 138.73 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? 29.376  40.125 -47.183 1.00 136.28 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? 27.866  41.973 -46.798 1.00 138.74 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? 28.780  42.958 -47.487 1.00 138.61 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? 28.433  44.382 -47.378 1.00 106.19 ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? 29.457  45.303 -47.290 1.00 105.89 ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? 30.618  44.887 -47.254 1.00 106.57 ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? 29.166  46.621 -47.257 1.00 104.87 ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? 27.900  47.020 -47.305 1.00 104.25 ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? 27.672  48.337 -47.301 1.00 102.96 ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? 26.823  46.089 -47.366 1.00 104.23 ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? 27.135  44.793 -47.395 1.00 105.29 ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? 29.349  38.890 -46.179 1.00 98.80  ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? 28.876  37.716 -46.945 1.00 113.81 ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? 28.687  39.271 -44.894 1.00 113.30 ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? 30.883  38.607 -45.870 1.00 97.33  ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? 31.886  38.728 -46.883 1.00 93.38  ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? 32.981  39.647 -46.400 1.00 90.82  ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? 32.501  41.003 -46.242 1.00 89.56  ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? 33.554  39.250 -45.049 1.00 89.08  ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? 34.948  39.432 -45.162 1.00 87.97  ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? 32.907  40.223 -44.073 1.00 88.49  ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? 32.724  41.467 -44.920 1.00 88.20  ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? 31.588  42.316 -44.568 1.00 101.64 ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? 30.295  41.926 -44.322 1.00 101.29 ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? 29.476  42.922 -44.089 1.00 101.30 ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? 30.286  44.047 -44.177 1.00 102.09 ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? 30.012  45.417 -44.052 1.00 102.25 ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? 28.793  45.910 -43.818 1.00 102.03 ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? 31.043  46.278 -44.192 1.00 102.38 ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? 32.256  45.783 -44.456 1.00 102.99 ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? 32.636  44.518 -44.608 1.00 102.59 ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? 31.590  43.687 -44.455 1.00 102.12 ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? 35.918  38.828 -44.062 1.00 90.83  ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? 36.844  37.938 -44.809 1.00 117.01 ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? 35.149  38.308 -42.891 1.00 117.34 ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? 36.700  40.142 -43.672 1.00 85.74  ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? 36.977  41.081 -44.692 1.00 77.78  ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? 37.093  42.461 -44.103 1.00 73.71  ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? 35.798  42.959 -43.698 1.00 73.86  ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? 37.981  42.512 -42.864 1.00 70.80  ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? 38.838  43.647 -42.971 1.00 65.85  ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? 36.988  42.661 -41.725 1.00 71.52  ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? 35.869  43.448 -42.374 1.00 73.43  ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? 34.552  43.276 -41.776 1.00 101.15 ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? 33.977  42.098 -41.357 1.00 102.04 ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? 32.767  42.253 -40.900 1.00 102.20 ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? 32.525  43.613 -41.023 1.00 102.81 ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? 31.379  44.354 -40.707 1.00 103.68 ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? 30.306  43.942 -40.256 1.00 105.22 ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? 31.557  45.713 -40.972 1.00 103.63 ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? 32.700  46.273 -41.488 1.00 103.02 ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? 32.687  47.599 -41.667 1.00 102.94 ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? 33.778  45.579 -41.804 1.00 102.60 ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? 33.621  44.260 -41.545 1.00 102.05 ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? 39.810  44.037 -41.762 1.00 64.85  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? 41.110  44.284 -42.436 1.00 78.13  ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? 39.710  43.035 -40.671 1.00 78.14  ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? 39.217  45.422 -41.254 1.00 66.73  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? 38.926  46.454 -42.195 1.00 73.29  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? 38.408  47.690 -41.498 1.00 78.19  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? 37.046  47.481 -41.082 1.00 78.00  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? 39.169  48.144 -40.261 1.00 81.06  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? 39.189  49.563 -40.282 1.00 86.70  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? 38.310  47.626 -39.121 1.00 80.04  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? 36.906  47.728 -39.700 1.00 80.48  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? 35.898  46.789 -39.204 1.00 95.64  ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? 35.966  45.417 -39.110 1.00 96.62  ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? 34.870  44.861 -38.648 1.00 97.23  ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? 34.022  45.938 -38.419 1.00 98.54  ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? 32.698  46.021 -37.920 1.00 100.02 ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? 31.962  44.962 -37.564 1.00 99.75  ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? 32.148  47.250 -37.805 1.00 99.79  ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? 32.876  48.314 -38.174 1.00 100.37 ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? 34.121  48.364 -38.658 1.00 99.14  ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? 34.644  47.127 -38.755 1.00 97.70  ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? 40.029  50.360 -39.185 1.00 97.91  ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? 40.874  51.365 -39.873 1.00 106.65 ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? 40.667  49.350 -38.309 1.00 107.67 ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? 38.879  51.139 -38.408 1.00 101.75 ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? 37.867  51.823 -39.150 1.00 106.35 ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? 36.705  52.218 -38.264 1.00 110.47 ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? 35.839  51.088 -37.986 1.00 110.18 ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? 37.074  52.826 -36.907 1.00 112.90 ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? 36.244  53.966 -36.634 1.00 116.56 ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? 36.756  51.707 -35.933 1.00 111.90 ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? 35.558  51.062 -36.596 1.00 110.45 ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? 35.318  49.665 -36.191 1.00 118.16 ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? 34.128  49.388 -35.563 1.00 117.34 ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? 33.284  50.239 -35.345 1.00 117.77 ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? 33.956  48.073 -35.201 1.00 116.90 ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? 34.835  47.032 -35.406 1.00 116.79 ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? 34.535  45.904 -35.043 1.00 116.29 ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? 36.072  47.390 -36.068 1.00 116.67 ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? 37.090  46.325 -36.327 1.00 115.48 ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? 36.250  48.674 -36.423 1.00 117.53 ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? 36.349  54.713 -35.211 1.00 124.91 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? 36.204  56.167 -35.453 1.00 134.25 ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? 37.551  54.217 -34.493 1.00 134.33 ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? 35.052  54.193 -34.442 1.00 126.49 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? 33.747  54.452 -34.960 1.00 129.29 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? 32.710  54.251 -33.881 1.00 131.01 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? 32.506  52.834 -33.658 1.00 131.13 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? 33.117  54.838 -32.528 1.00 132.33 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? 31.983  55.398 -31.846 1.00 134.34 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? 33.650  53.630 -31.782 1.00 131.91 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? 32.748  52.524 -32.291 1.00 130.99 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? 33.340  51.167 -32.212 1.00 139.50 ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? 32.581  50.159 -31.656 1.00 138.80 ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? 31.463  50.338 -31.206 1.00 138.11 ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? 33.187  48.926 -31.641 1.00 138.43 ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? 34.449  48.609 -32.105 1.00 138.02 ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? 34.854  47.452 -32.032 1.00 137.54 ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? 35.199  49.716 -32.657 1.00 137.84 ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? 36.581  49.471 -33.176 1.00 137.28 ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? 34.615  50.923 -32.683 1.00 138.43 ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? 32.195  56.224 -30.475 1.00 153.31 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? 30.953  56.044 -29.680 1.00 105.17 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? 32.674  57.596 -30.781 1.00 104.87 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? 33.385  55.458 -29.743 1.00 154.19 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? 33.396  55.315 -28.331 1.00 156.27 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? 32.224  54.467 -27.896 1.00 157.44 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? 32.326  53.145 -28.487 1.00 157.59 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? 32.142  54.261 -26.386 1.00 158.56 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? 30.798  54.336 -25.926 1.00 160.67 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? 32.644  52.851 -26.199 1.00 158.04 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? 32.209  52.159 -27.475 1.00 157.62 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? 33.037  50.985 -27.845 1.00 109.74 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? 32.450  49.692 -27.794 1.00 109.52 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? 31.248  49.580 -27.496 1.00 109.50 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? 33.212  48.603 -28.075 1.00 109.13 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? 34.497  48.754 -28.409 1.00 108.82 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? 35.207  47.645 -28.659 1.00 108.37 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? 35.112  50.049 -28.496 1.00 108.59 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? 34.351  51.125 -28.211 1.00 109.01 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? 30.509  54.413 -24.352 1.00 165.46 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? 29.357  55.323 -24.155 1.00 123.07 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? 31.790  54.682 -23.653 1.00 122.22 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? 30.053  52.939 -23.982 1.00 167.20 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? 28.678  52.573 -23.995 1.00 170.08 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? 28.440  51.501 -22.962 1.00 172.05 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? 29.210  50.335 -23.350 1.00 172.61 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? 28.960  51.904 -21.582 1.00 173.39 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? 28.162  51.335 -20.543 1.00 174.63 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? 30.360  51.325 -21.553 1.00 173.49 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? 30.198  50.054 -22.364 1.00 173.32 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? 31.441  49.618 -23.045 1.00 130.77 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? 31.802  48.291 -22.921 1.00 130.94 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? 31.163  47.476 -22.271 1.00 130.90 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? 32.956  47.951 -23.577 1.00 131.20 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? 33.779  48.782 -24.302 1.00 131.05 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? 34.780  48.329 -24.850 1.00 131.12 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? 33.375  50.155 -24.357 1.00 130.68 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? 34.277  51.120 -25.050 1.00 130.15 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? 32.223  50.505 -23.760 1.00 130.41 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? 28.752  51.255 -19.052 1.00 175.23 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? 27.630  51.035 -18.104 1.00 187.22 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? 29.662  52.413 -18.863 1.00 186.42 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? 29.642  49.940 -19.077 1.00 175.43 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? 29.030  48.658 -19.071 1.00 176.00 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? 29.917  47.673 -18.352 1.00 176.56 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? 31.063  47.363 -19.180 1.00 176.63 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? 30.478  48.201 -17.032 1.00 176.88 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? 30.501  47.149 -16.061 1.00 176.91 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? 31.874  48.667 -17.406 1.00 176.88 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? 32.265  47.688 -18.496 1.00 176.60 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? 33.210  48.229 -19.476 1.00 188.02 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? 33.425  49.547 -19.803 1.00 188.01 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? 34.347  49.719 -20.720 1.00 187.65 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? 34.768  48.431 -21.017 1.00 187.45 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? 35.732  47.930 -21.914 1.00 187.10 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? 36.482  48.705 -22.703 1.00 186.54 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? 35.903  46.590 -21.971 1.00 186.78 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? 35.154  45.814 -21.176 1.00 186.77 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? 34.221  46.164 -20.292 1.00 187.12 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? 34.074  47.499 -20.261 1.00 187.59 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? 31.482  47.246 -14.791 1.00 150.09 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? 30.789  46.610 -13.637 1.00 143.51 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? 32.001  48.635 -14.664 1.00 143.78 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? 32.676  46.290 -15.214 1.00 149.03 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? 32.393  45.043 -15.830 1.00 147.22 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? 33.646  44.207 -15.901 1.00 145.59 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? 34.528  44.709 -16.930 1.00 145.29 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? 34.461  44.200 -14.610 1.00 144.55 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? 35.016  42.899 -14.424 1.00 143.21 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? 35.562  45.204 -14.893 1.00 144.49 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? 35.804  44.973 -16.373 1.00 144.63 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? 36.387  46.114 -17.095 1.00 137.79 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? 37.457  45.882 -17.958 1.00 137.27 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? 37.878  44.724 -18.089 1.00 136.73 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? 38.006  46.921 -18.628 1.00 137.28 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? 37.521  48.152 -18.462 1.00 137.59 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? 38.094  49.146 -19.146 1.00 137.31 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? 36.427  48.418 -17.589 1.00 137.67 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? 35.895  47.379 -16.931 1.00 137.73 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? 35.719  42.526 -13.033 1.00 120.70 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? 35.020  41.343 -12.461 1.00 138.52 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? 35.811  43.789 -12.248 1.00 137.90 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? 37.189  42.087 -13.465 1.00 118.79 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? 37.889  42.818 -14.459 1.00 115.89 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? 39.348  42.445 -14.452 1.00 113.16 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? 40.012  43.269 -15.440 1.00 112.80 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? 40.023  42.764 -13.126 1.00 111.49 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? 41.143  41.887 -12.962 1.00 108.63 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? 40.456  44.203 -13.334 1.00 111.84 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? 40.883  44.189 -14.799 1.00 112.19 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? 40.823  45.480 -15.531 1.00 129.15 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? 41.529  45.610 -16.738 1.00 128.57 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? 42.199  44.646 -17.157 1.00 128.86 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? 41.461  46.786 -17.416 1.00 127.62 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? 40.727  47.799 -16.938 1.00 126.73 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? 40.664  48.929 -17.649 1.00 125.30 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? 40.018  47.697 -15.715 1.00 127.36 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? 40.092  46.533 -15.049 1.00 128.37 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? 41.164  40.806 -11.762 1.00 108.43 ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? 40.008  39.887 -11.935 1.00 113.71 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? 41.375  41.498 -10.444 1.00 113.66 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? 42.459  39.940 -12.092 1.00 106.29 ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? 42.565  39.231 -13.326 1.00 101.46 ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? 43.734  39.760 -14.125 1.00 98.56  ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? 43.515  41.132 -14.521 1.00 98.25  ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? 45.034  39.792 -13.335 1.00 97.41  ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? 46.116  39.599 -14.218 1.00 96.65  ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? 45.108  41.214 -12.836 1.00 97.72  ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? 44.602  41.931 -14.050 1.00 98.99  ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? 44.103  43.277 -13.774 1.00 105.19 ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? 43.357  43.692 -12.704 1.00 105.62 ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? 43.000  44.951 -12.766 1.00 106.31 ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? 43.563  45.400 -13.949 1.00 106.25 ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? 43.534  46.640 -14.592 1.00 106.72 ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? 42.858  47.694 -14.140 1.00 106.65 ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? 44.222  46.763 -15.745 1.00 107.35 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? 44.875  45.696 -16.218 1.00 107.38 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? 44.958  44.471 -15.714 1.00 107.00 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? 44.268  44.387 -14.566 1.00 106.33 ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? 47.267  38.574 -13.799 1.00 120.73 ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? 46.894  37.251 -14.366 1.00 107.23 ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? 47.425  38.732 -12.330 1.00 107.18 ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? 48.572  39.102 -14.545 1.00 119.50 ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? 48.539  39.405 -15.934 1.00 116.34 ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? 48.992  40.826 -16.177 1.00 113.89 ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? 48.105  41.828 -15.621 1.00 112.39 ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? 50.361  41.203 -15.641 1.00 112.40 ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? 50.791  42.200 -16.543 1.00 110.92 ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? 50.025  41.861 -14.320 1.00 111.94 ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? 48.909  42.716 -14.854 1.00 111.94 ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? 48.070  43.423 -13.898 1.00 98.01  ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? 47.478  42.937 -12.772 1.00 97.70  ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? 46.749  43.820 -12.133 1.00 97.05  ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? 46.884  44.974 -12.889 1.00 96.96  ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? 46.348  46.270 -12.746 1.00 96.84  ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? 45.516  46.626 -11.775 1.00 96.36  ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? 46.691  47.196 -13.660 1.00 97.19  ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? 47.502  46.834 -14.658 1.00 97.74  ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? 48.058  45.645 -14.910 1.00 97.96  ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? 47.704  44.746 -13.973 1.00 97.43  ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? 51.893  41.867 -17.625 1.00 90.11  ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? 51.043  41.288 -18.686 1.00 107.05 ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? 53.032  41.085 -17.053 1.00 107.23 ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? 52.356  43.305 -18.070 1.00 87.09  ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? 51.392  44.206 -18.587 1.00 82.44  ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? 51.646  45.599 -18.076 1.00 79.10  ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? 50.880  45.927 -16.896 1.00 78.05  ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? 53.101  45.832 -17.706 1.00 77.59  ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? 53.430  47.172 -18.035 1.00 76.32  ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? 53.069  45.719 -16.197 1.00 78.05  ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? 51.783  46.461 -15.946 1.00 78.38  ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? 51.203  46.353 -14.607 1.00 94.34  ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? 51.114  45.270 -13.767 1.00 93.52  ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? 50.523  45.535 -12.626 1.00 92.89  ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? 50.206  46.882 -12.720 1.00 94.18  ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? 49.567  47.762 -11.844 1.00 94.29  ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? 49.104  47.410 -10.645 1.00 95.11  ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? 49.410  49.039 -12.245 1.00 94.89  ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? 49.859  49.391 -13.448 1.00 94.67  ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? 50.473  48.656 -14.363 1.00 94.90  ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? 50.619  47.394 -13.931 1.00 93.95  ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? 54.394  47.467 -19.272 1.00 82.42  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? 53.627  47.161 -20.513 1.00 87.94  ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? 55.711  46.794 -19.008 1.00 87.30  ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? 54.556  49.034 -19.172 1.00 77.40  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? 53.411  49.846 -19.143 1.00 74.80  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? 53.535  50.861 -18.037 1.00 72.73  ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? 53.074  50.308 -16.789 1.00 72.89  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? 54.956  51.358 -17.783 1.00 70.99  ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? 54.947  52.775 -17.770 1.00 68.30  ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? 55.318  50.792 -16.416 1.00 72.73  ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? 53.966  50.676 -15.749 1.00 72.98  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? 53.851  49.671 -14.684 1.00 80.11  ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? 54.341  48.391 -14.674 1.00 81.43  ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? 54.069  47.730 -13.573 1.00 80.96  ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? 53.355  48.636 -12.804 1.00 79.85  ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? 52.778  48.544 -11.524 1.00 78.60  ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? 52.840  47.457 -10.765 1.00 77.18  ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? 52.126  49.622 -11.045 1.00 78.67  ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? 52.062  50.719 -11.805 1.00 79.83  ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? 52.562  50.931 -13.023 1.00 80.44  ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? 53.207  49.836 -13.473 1.00 80.54  ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? 56.227  53.565 -17.250 1.00 66.98  ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? 56.375  54.792 -18.069 1.00 73.45  ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? 57.366  52.615 -17.138 1.00 72.16  ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? 55.742  53.988 -15.801 1.00 71.99  ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? 54.451  54.579 -15.641 1.00 76.53  ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? 54.325  55.202 -14.274 1.00 79.98  ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? 54.050  54.175 -13.302 1.00 80.18  ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? 55.598  55.902 -13.813 1.00 81.86  ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? 55.271  57.076 -13.087 1.00 84.34  ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? 56.252  54.876 -12.914 1.00 81.95  ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? 55.054  54.170 -12.314 1.00 82.19  ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? 55.301  52.787 -11.960 1.00 89.55  ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? 55.901  51.821 -12.731 1.00 90.76  ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? 55.992  50.668 -12.129 1.00 90.63  ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? 55.410  50.886 -10.887 1.00 91.28  ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? 55.219  50.006 -9.799  1.00 91.33  ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? 55.529  48.816 -9.712  1.00 89.38  ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? 54.591  50.646 -8.733  1.00 92.43  ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? 54.193  51.965 -8.721  1.00 93.15  ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? 53.594  52.405 -7.603  1.00 94.05  ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? 54.367  52.792 -9.733  1.00 92.14  ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? 54.978  52.190 -10.776 1.00 91.20  ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? 56.443  57.959 -12.455 1.00 84.19  ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? 56.108  59.376 -12.718 1.00 76.38  ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? 57.753  57.417 -12.913 1.00 76.13  ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? 56.267  57.695 -10.892 1.00 90.83  ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? 55.024  57.974 -10.240 1.00 96.23  ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? 55.175  57.853 -8.742  1.00 100.48 ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? 55.178  56.462 -8.349  1.00 100.87 ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? 56.472  58.452 -8.204  1.00 102.73 ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? 56.251  59.166 -6.992  1.00 107.48 ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? 57.348  57.242 -7.945  1.00 101.45 ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? 56.334  56.182 -7.578  1.00 100.89 ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? 56.763  54.811 -7.887  1.00 91.82  ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? 56.634  53.884 -6.894  1.00 91.90  ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? 56.208  54.164 -5.788  1.00 92.51  ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? 57.028  52.615 -7.238  1.00 91.84  ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? 57.552  52.204 -8.452  1.00 91.60  ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? 57.850  51.022 -8.627  1.00 91.52  ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? 57.697  53.242 -9.440  1.00 91.74  ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? 58.318  52.904 -10.759 1.00 91.26  ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? 57.283  54.475 -9.119  1.00 91.90  ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? 57.488  59.893 -6.273  1.00 137.09 ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? 56.962  61.073 -5.552  1.00 118.62 ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? 58.582  60.074 -7.260  1.00 117.35 ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? 57.968  58.802 -5.220  1.00 139.28 ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? 57.087  58.345 -4.197  1.00 141.73 ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? 57.845  57.499 -3.202  1.00 143.60 ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? 58.022  56.163 -3.734  1.00 143.06 ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? 59.246  58.031 -2.893  1.00 145.27 ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? 59.549  57.904 -1.502  1.00 148.95 ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? 60.153  57.138 -3.720  1.00 143.99 ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? 59.399  55.818 -3.716  1.00 142.71 ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? 59.668  54.953 -4.865  1.00 122.32 ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? 59.664  55.308 -6.194  1.00 122.21 ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? 59.955  54.314 -6.991  1.00 122.16 ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? 60.160  53.235 -6.139  1.00 122.32 ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? 60.502  51.876 -6.423  1.00 122.40 ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? 60.693  51.338 -7.522  1.00 122.79 ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? 60.617  51.125 -5.260  1.00 122.99 ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? 60.429  51.603 -3.989  1.00 122.72 ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? 60.599  50.720 -2.999  1.00 122.84 ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? 60.103  52.854 -3.709  1.00 122.30 ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? 59.987  53.610 -4.822  1.00 122.29 ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? 60.726  58.794 -0.865  1.00 161.58 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? 60.626  58.682 0.610   1.00 126.41 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? 60.688  60.135 -1.506  1.00 126.18 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? 62.057  58.062 -1.340  1.00 162.10 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? 63.117  57.806 -0.426  1.00 162.04 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? 62.837  56.544 0.358   1.00 162.10 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? 62.332  55.513 -0.526  1.00 161.41 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? 64.090  55.962 1.008   1.00 162.56 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? 63.806  55.326 2.254   1.00 163.25 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? 64.539  54.920 0.008   1.00 162.25 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? 63.219  54.404 -0.535  1.00 161.54 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? 63.306  53.905 -1.920  1.00 124.84 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? 63.500  52.558 -2.112  1.00 124.45 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? 63.616  51.764 -1.190  1.00 124.35 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? 63.557  52.171 -3.427  1.00 123.89 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? 63.450  52.981 -4.542  1.00 123.86 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? 63.519  52.489 -5.660  1.00 123.79 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? 63.257  54.388 -4.267  1.00 124.06 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? 63.136  55.345 -5.411  1.00 123.76 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? 63.195  54.773 -2.987  1.00 124.31 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? 65.025  54.820 3.164   1.00 144.61 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? 64.505  54.444 4.500   1.00 104.59 ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? 66.098  55.837 3.045   1.00 104.32 ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? 65.509  53.486 2.452   1.00 144.54 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? 65.019  52.225 2.869   1.00 143.66 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? 66.032  51.152 2.547   1.00 143.44 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? 66.045  50.894 1.124   1.00 143.15 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? 67.476  51.448 2.943   1.00 143.11 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? 68.026  50.236 3.463   1.00 142.63 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? 68.122  51.857 1.626   1.00 142.98 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? 67.350  51.045 0.591   1.00 142.69 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? 67.202  51.659 -0.736  1.00 101.20 ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? 66.795  52.943 -1.037  1.00 101.15 ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? 66.703  53.183 -2.324  1.00 100.37 ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? 67.083  51.986 -2.912  1.00 100.32 ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? 67.186  51.594 -4.249  1.00 100.22 ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? 66.900  52.401 -5.271  1.00 100.59 ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? 67.594  50.335 -4.507  1.00 99.80  ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? 67.878  49.533 -3.477  1.00 99.82  ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? 67.818  49.783 -2.170  1.00 100.29 ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? 67.406  51.042 -1.949  1.00 100.54 ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? 69.611  50.064 3.613   1.00 157.36 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? 69.784  49.104 4.720   1.00 120.66 ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? 70.296  51.383 3.656   1.00 120.85 ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? 70.012  49.307 2.275   1.00 155.74 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? 69.313  48.121 1.881   1.00 152.61 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? 70.097  47.381 0.823   1.00 150.16 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? 69.935  48.024 -0.464  1.00 149.54 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? 71.597  47.369 1.108   1.00 147.99 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? 72.151  46.099 0.769   1.00 144.68 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? 72.132  48.485 0.228   1.00 148.17 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? 71.203  48.424 -0.971  1.00 148.27 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? 71.027  49.705 -1.695  1.00 110.13 ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? 71.116  49.690 -3.074  1.00 109.14 ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? 71.364  48.683 -3.724  1.00 107.92 ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? 70.905  50.907 -3.671  1.00 108.62 ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? 70.627  52.108 -3.049  1.00 109.01 ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? 70.444  53.117 -3.722  1.00 107.41 ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? 70.573  52.058 -1.609  1.00 109.42 ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? 70.299  53.320 -0.854  1.00 109.08 ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? 70.770  50.875 -1.009  1.00 109.56 ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? 73.720  45.972 0.475   1.00 138.53 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? 74.135  44.597 0.847   1.00 108.56 ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? 74.435  47.141 1.058   1.00 109.22 ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? 73.765  46.084 -1.109  1.00 136.08 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? 72.845  45.340 -1.905  1.00 132.02 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? 73.392  45.165 -3.300  1.00 128.76 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? 73.295  46.412 -4.030  1.00 128.29 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? 74.867  44.775 -3.315  1.00 126.32 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? 75.112  43.830 -4.346  1.00 122.44 ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? 75.583  46.083 -3.596  1.00 126.29 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? 74.583  46.835 -4.457  1.00 127.43 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? 74.647  48.301 -4.304  1.00 98.50  ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? 74.763  49.073 -5.439  1.00 98.69  ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? 74.827  48.602 -6.569  1.00 99.67  ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? 74.806  50.429 -5.200  1.00 98.07  ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? 74.747  51.066 -3.973  1.00 97.39  ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? 74.790  52.292 -3.913  1.00 96.00  ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? 74.634  50.191 -2.834  1.00 97.81  ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? 74.571  50.790 -1.466  1.00 97.68  ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? 74.588  48.873 -3.053  1.00 98.24  ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? 76.617  43.431 -4.699  1.00 90.01  ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? 76.595  42.023 -5.193  1.00 92.22  ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? 77.477  43.798 -3.555  1.00 94.03  ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? 76.981  44.412 -5.902  1.00 88.89  ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? 76.120  44.518 -7.042  1.00 84.14  ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? 76.735  45.403 -8.102  1.00 79.98  ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? 76.602  46.804 -7.757  1.00 79.38  ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? 78.217  45.165 -8.408  1.00 77.48  ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? 78.418  45.236 -9.822  1.00 72.71  ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? 78.901  46.355 -7.753  1.00 78.28  ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? 77.854  47.443 -7.942  1.00 79.68  ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? 77.928  48.582 -7.009  1.00 83.93  ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? 77.863  49.848 -7.544  1.00 84.47  ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? 77.711  50.057 -8.736  1.00 83.67  ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? 77.972  50.865 -6.630  1.00 84.58  ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? 78.117  50.745 -5.262  1.00 85.14  ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? 78.214  51.752 -4.570  1.00 85.18  ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? 78.144  49.384 -4.761  1.00 85.52  ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? 78.247  49.152 -3.288  1.00 86.26  ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? 78.064  48.385 -5.651  1.00 84.54  ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? 78.772  43.912 -10.651 1.00 58.27  ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? 77.746  42.891 -10.355 1.00 85.92  ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? 80.196  43.610 -10.414 1.00 86.70  ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? 78.638  44.375 -12.163 1.00 58.76  ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? 77.388  44.794 -12.682 1.00 55.06  ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? 77.554  46.084 -13.448 1.00 53.30  ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? 77.875  47.170 -12.551 1.00 54.15  ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? 78.660  46.070 -14.503 1.00 51.27  ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? 78.218  46.755 -15.687 1.00 44.90  ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? 79.819  46.787 -13.832 1.00 52.65  ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? 79.141  47.741 -12.867 1.00 56.47  ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? 79.881  47.885 -11.615 1.00 89.61  ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? 80.509  46.882 -10.900 1.00 90.23  ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? 81.094  47.313 -9.815  1.00 92.07  ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? 80.842  48.682 -9.809  1.00 92.16  ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? 81.233  49.676 -8.891  1.00 93.26  ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? 81.895  49.546 -7.857  1.00 94.75  ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? 80.770  50.932 -9.271  1.00 92.56  ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? 80.021  51.192 -10.387 1.00 92.14  ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? 79.657  52.463 -10.576 1.00 91.80  ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? 79.650  50.276 -11.255 1.00 90.43  ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? 80.093  49.049 -10.910 1.00 91.13  ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? 79.042  46.597 -17.042 1.00 53.07  ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? 78.079  46.847 -18.133 1.00 70.17  ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? 79.822  45.331 -17.012 1.00 67.06  ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? 80.055  47.821 -16.960 1.00 55.39  ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? 79.560  49.150 -16.908 1.00 57.15  ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? 80.692  50.127 -16.709 1.00 61.58  ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? 81.203  50.038 -15.362 1.00 62.60  ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? 81.899  49.944 -17.622 1.00 63.48  ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? 82.433  51.224 -17.886 1.00 65.02  ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? 82.899  49.235 -16.737 1.00 64.66  ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? 82.620  49.929 -15.419 1.00 65.19  ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? 83.076  49.230 -14.217 1.00 80.60  ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? 83.406  47.900 -14.094 1.00 80.14  ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? 83.796  47.578 -12.891 1.00 79.49  ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? 83.713  48.765 -12.176 1.00 82.88  ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? 84.010  49.046 -10.808 1.00 82.99  ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? 84.443  48.276 -9.931  1.00 82.54  ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? 83.768  50.384 -10.502 1.00 82.71  ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? 83.321  51.330 -11.390 1.00 85.07  ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? 83.167  52.561 -10.906 1.00 84.96  ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? 83.050  51.086 -12.659 1.00 83.39  ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? 83.264  49.794 -12.981 1.00 82.03  ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? 82.366  51.817 -19.359 1.00 74.63  ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? 80.968  51.635 -19.840 1.00 84.27  ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? 83.497  51.244 -20.130 1.00 85.49  ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? 82.643  53.366 -19.135 1.00 76.03  ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? 81.743  54.165 -18.368 1.00 79.68  ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? 82.509  55.084 -17.446 1.00 82.37  ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? 83.087  54.344 -16.347 1.00 82.05  ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? 83.665  55.845 -18.087 1.00 84.15  ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? 83.715  57.147 -17.513 1.00 89.05  ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? 84.882  55.048 -17.656 1.00 82.06  ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? 84.478  54.602 -16.268 1.00 80.71  ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? 85.121  53.381 -15.788 1.00 91.23  ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? 85.267  52.187 -16.454 1.00 90.63  ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? 85.852  51.254 -15.743 1.00 90.39  ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? 86.120  51.880 -14.533 1.00 91.97  ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? 86.730  51.430 -13.368 1.00 91.35  ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? 87.191  50.198 -13.223 1.00 91.61  ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? 86.853  52.296 -12.346 1.00 90.42  ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? 86.385  53.533 -12.498 1.00 90.97  ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? 85.787  54.079 -13.547 1.00 91.31  ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? 85.684  53.188 -14.548 1.00 91.53  ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? 84.299  58.375 -18.359 1.00 78.02  ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? 83.268  59.443 -18.379 1.00 96.02  ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? 84.885  57.887 -19.637 1.00 94.83  ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? 85.497  58.854 -17.444 1.00 79.49  ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? 85.288  59.078 -16.065 1.00 81.88  ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? 86.602  58.967 -15.334 1.00 83.21  ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? 86.865  57.597 -14.940 1.00 81.02  ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? 87.811  59.422 -16.157 1.00 84.19  ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? 88.685  60.225 -15.352 1.00 87.63  ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? 88.499  58.116 -16.503 1.00 82.95  ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? 88.202  57.292 -15.267 1.00 80.77  ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? 88.308  55.850 -15.454 1.00 95.56  ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? 87.920  55.105 -16.536 1.00 93.96  ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? 88.172  53.825 -16.412 1.00 92.68  ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? 88.764  53.721 -15.162 1.00 91.75  ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? 89.262  52.623 -14.439 1.00 90.14  ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? 89.247  51.373 -14.895 1.00 87.39  ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? 89.779  52.855 -13.216 1.00 89.90  ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? 89.791  54.111 -12.759 1.00 91.26  ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? 89.354  55.229 -13.345 1.00 92.41  ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? 88.847  54.960 -14.557 1.00 93.21  ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? 89.763  61.191 -16.051 1.00 123.96 ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? 89.442  62.595 -15.674 1.00 111.78 ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? 89.894  60.821 -17.489 1.00 112.44 ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? 91.113  60.775 -15.331 1.00 123.64 ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? 91.138  60.592 -13.927 1.00 122.42 ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? 92.280  59.684 -13.548 1.00 121.03 ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? 91.952  58.291 -13.778 1.00 119.86 ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? 93.563  59.954 -14.331 1.00 120.59 ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? 94.667  59.882 -13.439 1.00 120.27 ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? 93.630  58.788 -15.301 1.00 119.32 ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? 93.052  57.687 -14.437 1.00 119.14 ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? 92.589  56.472 -15.118 1.00 105.68 ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? 91.783  56.357 -16.222 1.00 105.75 ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? 91.555  55.116 -16.581 1.00 104.58 ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? 92.260  54.364 -15.651 1.00 104.09 ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? 92.426  52.976 -15.483 1.00 103.75 ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? 91.869  52.064 -16.284 1.00 103.48 ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? 93.195  52.551 -14.452 1.00 103.12 ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? 93.752  53.464 -13.657 1.00 103.54 ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? 93.672  54.791 -13.713 1.00 104.13 ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? 92.901  55.183 -14.745 1.00 104.75 ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? 96.071  60.500 -13.877 1.00 108.80 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? 96.349  61.661 -12.986 1.00 90.21  ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? 96.033  60.697 -15.346 1.00 88.27  ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? 97.093  59.326 -13.560 1.00 108.06 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? 97.145  58.743 -12.268 1.00 109.12 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? 98.014  57.510 -12.299 1.00 110.64 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? 97.274  56.382 -12.835 1.00 110.18 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? 99.261  57.656 -13.175 1.00 111.36 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? 100.389 57.058 -12.531 1.00 114.04 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? 98.898  56.878 -14.427 1.00 110.45 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? 98.054  55.763 -13.844 1.00 109.12 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? 97.150  55.114 -14.806 1.00 89.16  ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? 97.104  53.710 -14.856 1.00 88.20  ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? 97.784  53.057 -14.049 1.00 88.11  ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? 96.317  53.108 -15.779 1.00 87.93  ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? 95.592  53.852 -16.626 1.00 88.44  ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? 94.856  53.226 -17.545 1.00 88.27  ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? 95.595  55.276 -16.573 1.00 88.68  ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? 96.382  55.860 -15.657 1.00 88.75  ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? 101.627 56.541 -13.411 1.00 132.62 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? 102.737 56.230 -12.487 1.00 88.72  ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? 101.846 57.489 -14.531 1.00 88.60  ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? 101.097 55.175 -14.028 1.00 133.33 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? 100.927 54.021 -13.209 1.00 134.20 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? 101.435 52.803 -13.939 1.00 133.55 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? 100.501 52.400 -14.969 1.00 132.95 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? 102.755 53.065 -14.654 1.00 133.48 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? 103.551 51.892 -14.611 1.00 132.94 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? 102.329 53.361 -16.082 1.00 133.20 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? 101.133 52.440 -16.246 1.00 132.64 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? 100.125 52.876 -17.236 1.00 86.85  ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? 99.395  51.899 -17.872 1.00 86.08  ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? 99.575  50.705 -17.676 1.00 85.29  ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? 98.434  52.372 -18.737 1.00 85.61  ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? 98.135  53.697 -19.010 1.00 85.35  ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? 97.208  53.983 -19.777 1.00 84.88  ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? 98.961  54.663 -18.328 1.00 85.34  ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? 98.723  56.117 -18.579 1.00 84.75  ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? 99.907  54.211 -17.493 1.00 86.05  ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? 105.094 51.977 -15.009 1.00 111.52 ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? 105.796 52.433 -13.785 1.00 111.32 ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? 105.209 52.767 -16.265 1.00 110.49 ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? 105.481 50.461 -15.316 1.00 111.39 ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? 104.844 49.393 -14.615 1.00 110.91 ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? 104.496 48.264 -15.562 1.00 111.45 ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? 103.473 48.657 -16.509 1.00 111.62 ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? 105.648 47.723 -16.403 1.00 111.43 ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? 105.483 46.315 -16.513 1.00 111.42 ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? 105.441 48.383 -17.753 1.00 111.40 ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? 103.929 48.441 -17.842 1.00 111.01 ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? 103.403 49.526 -18.665 1.00 109.27 ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? 103.733 50.858 -18.585 1.00 109.53 ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? 103.032 51.609 -19.389 1.00 109.27 ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? 102.201 50.717 -20.052 1.00 109.11 ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? 101.197 50.952 -21.017 1.00 108.93 ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? 100.815 52.037 -21.478 1.00 108.63 ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? 100.604 49.765 -21.436 1.00 109.06 ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? 100.929 48.513 -20.976 1.00 109.43 ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? 100.256 47.490 -21.512 1.00 109.08 ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? 101.852 48.283 -20.058 1.00 109.49 ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? 102.441 49.423 -19.641 1.00 109.19 ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? 106.623 45.436 -17.201 1.00 103.44 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? 106.655 44.116 -16.519 1.00 104.89 ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? 107.861 46.257 -17.300 1.00 104.57 ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? 106.062 45.216 -18.668 1.00 102.12 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? 104.903 44.419 -18.894 1.00 100.31 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? 104.616 44.375 -20.370 1.00 97.39  ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? 104.162 45.679 -20.825 1.00 96.62  ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? 105.908 44.105 -21.122 1.00 95.52  ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? 105.614 43.373 -22.303 1.00 94.02  ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? 106.382 45.503 -21.459 1.00 94.46  ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? 105.065 46.157 -21.806 1.00 93.93  ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? 105.066 47.631 -21.792 1.00 92.80  ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? 104.218 48.330 -22.671 1.00 92.03  ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? 103.448 47.693 -23.403 1.00 91.79  ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? 104.262 49.681 -22.697 1.00 91.49  ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? 105.097 50.334 -21.891 1.00 91.07  ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? 105.127 51.665 -21.967 1.00 89.62  ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? 105.945 49.653 -20.974 1.00 91.10  ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? 105.898 48.315 -20.958 1.00 91.92  ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? 106.144 41.871 -22.460 1.00 97.51  ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? 106.443 41.345 -21.116 1.00 105.13 ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? 107.178 41.805 -23.542 1.00 105.09 ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? 104.865 41.094 -22.963 1.00 94.77  ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? 104.679 40.895 -24.344 1.00 89.15  ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? 103.467 41.657 -24.820 1.00 85.30  ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? 103.560 43.065 -24.481 1.00 84.65  ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? 103.335 41.596 -26.333 1.00 82.71  ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? 101.977 41.420 -26.704 1.00 79.73  ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? 103.887 42.929 -26.797 1.00 83.25  ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? 103.517 43.854 -25.665 1.00 84.41  ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? 104.462 44.973 -25.518 1.00 93.71  ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? 104.107 46.181 -26.062 1.00 94.60  ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? 103.100 46.342 -26.721 1.00 96.04  ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? 104.984 47.200 -25.813 1.00 94.10  ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? 106.161 47.133 -25.107 1.00 94.28  ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? 106.807 48.151 -24.912 1.00 95.35  ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? 106.517 45.822 -24.626 1.00 94.25  ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? 107.822 45.640 -23.916 1.00 93.48  ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? 105.655 44.818 -24.846 1.00 93.82  ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? 101.643 40.573 -28.013 1.00 68.01  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? 100.228 40.113 -27.913 1.00 77.95  ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? 102.737 39.575 -28.128 1.00 79.31  ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? 101.783 41.648 -29.183 1.00 66.16  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? 100.899 42.765 -29.243 1.00 63.84  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? 101.273 43.663 -30.392 1.00 61.43  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? 102.368 44.527 -30.035 1.00 63.75  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? 101.737 42.899 -31.626 1.00 58.93  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? 101.430 43.691 -32.774 1.00 55.07  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? 103.243 42.876 -31.446 1.00 63.14  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? 103.460 44.281 -30.918 1.00 65.63  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? 104.710 44.517 -30.180 1.00 78.93  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? 105.129 45.836 -29.990 1.00 79.58  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? 104.492 46.752 -30.541 1.00 79.26  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? 106.223 46.075 -29.225 1.00 83.02  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? 106.894 45.057 -28.677 1.00 83.66  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? 107.922 45.343 -27.884 1.00 85.10  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? 106.526 43.701 -28.907 1.00 83.48  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? 105.435 43.477 -29.657 1.00 81.07  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? 99.959  43.654 -33.396 1.00 51.25  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? 98.941  43.739 -32.298 1.00 53.59  ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? 99.955  42.497 -34.329 1.00 58.20  ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? 99.897  45.008 -34.214 1.00 49.55  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? 99.406  46.186 -33.597 1.00 50.67  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? 100.184 47.386 -34.078 1.00 52.04  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? 101.479 47.439 -33.435 1.00 56.72  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? 100.453 47.387 -35.580 1.00 53.06  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? 100.318 48.701 -36.088 1.00 48.82  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? 101.907 46.971 -35.678 1.00 56.07  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? 102.483 47.606 -34.423 1.00 57.87  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? 103.748 47.022 -33.912 1.00 69.77  ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? 104.780 47.884 -33.535 1.00 70.93  ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? 104.613 49.098 -33.658 1.00 69.64  ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? 105.928 47.373 -33.055 1.00 71.00  ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? 106.080 46.051 -32.956 1.00 73.25  ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? 107.237 45.581 -32.471 1.00 73.87  ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? 105.055 45.144 -33.345 1.00 72.74  ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? 103.912 45.666 -33.809 1.00 70.63  ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? 100.017 48.911 -37.643 1.00 44.07  ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? 98.572  49.217 -37.780 1.00 57.79  ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? 100.615 47.775 -38.393 1.00 54.54  ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? 100.804 50.238 -38.015 1.00 49.59  ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? 100.887 51.336 -37.100 1.00 55.93  ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? 102.167 52.113 -37.330 1.00 62.84  ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? 103.311 51.460 -36.715 1.00 63.17  ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? 102.536 52.343 -38.799 1.00 65.60  ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? 103.022 53.674 -38.951 1.00 71.79  ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? 103.632 51.327 -39.052 1.00 65.16  ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? 104.307 51.199 -37.690 1.00 66.45  ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? 104.833 49.867 -37.420 1.00 80.11  ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? 104.259 48.661 -37.733 1.00 82.85  ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? 104.972 47.624 -37.370 1.00 83.89  ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? 106.092 48.185 -36.769 1.00 83.11  ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? 107.234 47.616 -36.175 1.00 84.56  ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? 107.455 46.300 -36.105 1.00 83.45  ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? 108.159 48.457 -35.658 1.00 85.12  ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? 107.954 49.776 -35.756 1.00 84.92  ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? 106.931 50.432 -36.303 1.00 84.25  ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? 106.019 49.567 -36.793 1.00 83.00  ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? 103.538 54.184 -40.377 1.00 78.08  ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? 103.232 55.635 -40.422 1.00 71.21  ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? 103.043 53.293 -41.459 1.00 71.02  ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? 105.111 53.990 -40.269 1.00 81.11  ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? 105.840 54.602 -39.208 1.00 85.34  ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? 107.321 54.398 -39.409 1.00 88.71  ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? 107.739 53.088 -38.958 1.00 89.68  ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? 107.785 54.522 -40.860 1.00 91.04  ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? 108.975 55.315 -40.889 1.00 96.00  ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? 108.054 53.082 -41.268 1.00 90.13  ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? 108.502 52.453 -39.965 1.00 89.91  ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? 108.269 51.006 -39.860 1.00 82.83  ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? 109.297 50.203 -39.420 1.00 83.65  ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? 110.401 50.625 -39.144 1.00 83.71  ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? 108.986 48.871 -39.323 1.00 83.96  ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? 107.779 48.269 -39.633 1.00 84.68  ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? 107.639 47.050 -39.491 1.00 85.02  ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? 106.757 49.164 -40.109 1.00 84.45  ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? 105.430 48.595 -40.497 1.00 84.11  ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? 107.046 50.472 -40.191 1.00 83.97  ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? 109.620 55.763 -42.289 1.00 104.29 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? 110.132 57.133 -42.056 1.00 92.70  ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? 108.678 55.515 -43.410 1.00 93.13  ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? 110.866 54.780 -42.408 1.00 107.92 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? 111.804 54.680 -41.336 1.00 114.17 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? 112.842 53.627 -41.643 1.00 118.82 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? 112.369 52.293 -41.319 1.00 119.83 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? 113.266 53.584 -43.114 1.00 121.56 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? 114.676 53.365 -43.224 1.00 124.41 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? 112.532 52.365 -43.633 1.00 121.48 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? 112.629 51.453 -42.428 1.00 121.21 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? 111.690 50.315 -42.404 1.00 110.36 ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? 112.171 49.061 -41.998 1.00 110.69 ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? 113.350 48.962 -41.623 1.00 111.18 ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? 111.343 47.992 -42.023 1.00 110.85 ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? 110.082 48.137 -42.427 1.00 110.88 ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? 109.310 47.049 -42.458 1.00 110.65 ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? 109.558 49.405 -42.822 1.00 110.83 ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? 110.388 50.459 -42.791 1.00 110.67 ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? 115.568 54.356 -44.117 1.00 125.27 ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? 116.066 55.411 -43.196 1.00 104.73 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? 114.762 54.748 -45.303 1.00 103.49 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? 116.775 53.423 -44.590 1.00 126.26 ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? 117.704 52.884 -43.642 1.00 128.19 ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? 117.933 51.409 -43.888 1.00 129.80 ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? 116.669 50.716 -43.832 1.00 130.55 ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? 118.547 51.010 -45.234 1.00 130.67 ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? 119.239 49.768 -45.060 1.00 131.52 ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? 117.319 50.707 -46.069 1.00 130.98 ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? 116.508 49.967 -45.023 1.00 131.76 ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? 115.074 49.780 -45.247 1.00 111.59 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? 114.102 50.690 -45.596 1.00 112.06 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? 112.894 50.172 -45.660 1.00 112.20 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? 113.088 48.834 -45.341 1.00 112.50 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? 112.209 47.744 -45.247 1.00 112.62 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? 110.893 47.838 -45.449 1.00 113.08 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? 112.736 46.536 -44.935 1.00 112.54 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? 114.056 46.442 -44.731 1.00 112.56 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? 114.981 47.391 -44.786 1.00 112.61 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? 114.427 48.576 -45.099 1.00 112.21 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? 120.789 49.637 -45.463 1.00 156.44 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? 121.522 49.435 -44.179 1.00 101.19 ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? 121.158 50.769 -46.358 1.00 100.99 ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? 120.845 48.270 -46.290 1.00 157.35 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? 120.968 47.016 -45.615 1.00 158.97 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? 120.290 45.919 -46.401 1.00 160.68 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? 118.858 46.128 -46.442 1.00 162.03 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? 120.737 45.801 -47.856 1.00 161.15 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? 120.760 44.422 -48.207 1.00 160.49 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? 119.626 46.501 -48.615 1.00 161.91 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? 118.419 46.093 -47.787 1.00 162.54 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? 117.227 46.933 -47.896 1.00 107.31 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? 117.142 48.291 -48.055 1.00 107.43 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? 115.911 48.740 -48.138 1.00 107.45 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? 115.131 47.598 -48.027 1.00 107.13 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? 113.731 47.390 -48.043 1.00 106.54 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? 112.828 48.370 -48.194 1.00 106.30 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? 113.285 46.124 -47.890 1.00 106.44 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? 114.183 45.141 -47.731 1.00 106.87 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? 115.515 45.208 -47.703 1.00 107.14 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? 115.929 46.478 -47.861 1.00 107.32 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? 122.155 43.650 -48.276 1.00 151.58 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? 122.709 43.706 -46.900 1.00 112.82 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? 122.926 44.227 -49.423 1.00 112.93 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? 121.734 42.144 -48.557 1.00 151.24 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? 121.263 41.323 -47.488 1.00 150.56 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? 120.075 40.505 -47.938 1.00 150.35 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? 118.896 41.333 -48.094 1.00 150.11 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? 120.266 39.797 -49.275 1.00 150.20 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? 119.656 38.508 -49.194 1.00 150.00 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? 119.537 40.702 -50.256 1.00 149.99 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? 118.378 41.210 -49.413 1.00 149.72 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? 117.835 42.517 -49.798 1.00 111.29 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? 118.521 43.697 -49.937 1.00 111.21 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? 117.762 44.720 -50.244 1.00 110.90 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? 116.489 44.178 -50.325 1.00 110.91 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? 115.235 44.750 -50.616 1.00 110.73 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? 115.053 46.053 -50.852 1.00 110.25 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? 114.160 43.931 -50.641 1.00 110.94 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? 114.341 42.632 -50.374 1.00 111.19 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? 115.468 41.979 -50.073 1.00 111.24 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? 116.520 42.819 -50.066 1.00 111.11 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? 119.369 37.670 -50.532 1.00 147.01 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? 119.316 36.239 -50.133 1.00 112.88 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? 120.330 38.115 -51.577 1.00 113.45 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? 117.907 38.132 -50.959 1.00 145.66 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? 116.805 38.002 -50.056 1.00 141.29 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? 115.514 37.950 -50.833 1.00 138.13 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? 115.100 39.274 -51.235 1.00 137.27 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? 115.632 37.144 -52.122 1.00 136.27 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? 114.392 36.504 -52.341 1.00 133.77 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? 115.847 38.214 -53.177 1.00 135.95 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? 114.953 39.314 -52.643 1.00 135.94 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? 115.254 40.675 -53.075 1.00 100.77 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? 116.460 41.329 -53.058 1.00 100.53 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? 116.391 42.579 -53.460 1.00 100.22 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? 115.048 42.756 -53.774 1.00 100.14 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? 114.315 43.871 -54.246 1.00 99.77  ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? 114.854 45.067 -54.488 1.00 99.22  ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? 112.989 43.708 -54.456 1.00 99.54  ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? 112.442 42.511 -54.201 1.00 99.61  ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? 113.020 41.395 -53.756 1.00 100.36 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? 114.339 41.585 -53.558 1.00 100.51 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? 114.358 35.006 -52.884 1.00 113.26 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? 114.189 34.101 -51.722 1.00 108.78 ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? 115.506 34.821 -53.817 1.00 109.12 ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? 112.996 35.018 -53.692 1.00 111.34 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? 111.870 35.699 -53.149 1.00 107.03 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? 111.129 36.437 -54.236 1.00 103.83 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? 111.789 37.671 -54.603 1.00 103.33 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? 110.952 35.647 -55.528 1.00 100.99 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? 109.629 35.860 -55.991 1.00 95.65  ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? 111.955 36.284 -56.474 1.00 101.07 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? 111.934 37.729 -56.013 1.00 102.09 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? 113.140 38.504 -56.300 1.00 98.39  ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? 114.445 38.069 -56.265 1.00 98.94  ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? 115.305 39.017 -56.526 1.00 97.99  ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? 114.522 40.139 -56.756 1.00 97.38  ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? 114.892 41.472 -57.076 1.00 96.47  ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? 116.019 41.944 -57.225 1.00 95.06  ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? 113.783 42.290 -57.223 1.00 96.74  ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? 112.480 41.888 -57.082 1.00 96.80  ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? 111.550 42.843 -57.254 1.00 96.12  ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? 112.117 40.649 -56.788 1.00 97.30  ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? 113.182 39.836 -56.636 1.00 97.95  ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? 108.775 34.627 -56.531 1.00 88.15  ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? 107.521 34.513 -55.742 1.00 96.31  ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? 109.676 33.465 -56.660 1.00 94.93  ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? 108.394 35.108 -57.990 1.00 84.18  ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? 107.050 35.375 -58.340 1.00 78.35  ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? 106.650 36.749 -57.869 1.00 74.49  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? 107.816 37.594 -57.780 1.00 76.53  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? 105.708 37.408 -58.863 1.00 71.35  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? 104.623 38.058 -58.231 1.00 62.76  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? 106.581 38.379 -59.636 1.00 73.77  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? 107.785 38.634 -58.753 1.00 78.55  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? 109.031 38.561 -59.511 1.00 89.24  ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? 109.725 37.420 -59.829 1.00 91.12  ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? 110.808 37.652 -60.517 1.00 93.25  ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? 110.835 39.029 -60.662 1.00 94.56  ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? 111.776 39.860 -61.312 1.00 96.17  ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? 112.806 39.535 -61.914 1.00 98.56  ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? 111.423 41.201 -61.217 1.00 96.53  ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? 110.305 41.679 -60.584 1.00 96.07  ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? 110.141 43.010 -60.600 1.00 95.92  ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? 109.416 40.911 -59.977 1.00 94.42  ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? 109.743 39.606 -60.052 1.00 92.13  ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? 103.263 38.244 -59.040 1.00 56.95  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? 102.198 38.589 -58.067 1.00 90.67  ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? 103.099 37.066 -59.925 1.00 87.26  ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? 103.559 39.501 -59.964 1.00 58.89  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? 103.802 40.780 -59.399 1.00 62.47  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? 104.272 41.740 -60.465 1.00 63.44  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? 105.554 41.306 -60.975 1.00 64.20  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? 103.354 41.855 -61.683 1.00 63.74  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? 103.408 43.181 -62.170 1.00 62.04  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? 103.999 40.936 -62.703 1.00 63.41  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? 105.476 41.130 -62.389 1.00 66.14  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? 106.361 40.012 -62.752 1.00 96.63  ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? 107.615 40.305 -63.284 1.00 98.26  ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? 107.899 41.486 -63.508 1.00 95.04  ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? 108.478 39.297 -63.550 1.00 98.73  ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? 108.110 38.034 -63.328 1.00 100.97 ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? 108.995 37.064 -63.588 1.00 102.57 ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? 106.817 37.705 -62.825 1.00 98.13  ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? 105.981 38.716 -62.555 1.00 96.17  ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? 102.084 43.863 -62.728 1.00 70.29  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? 101.467 44.694 -61.660 1.00 84.66  ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? 101.300 42.804 -63.396 1.00 86.36  ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? 102.622 44.839 -63.856 1.00 70.03  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? 103.596 45.825 -63.557 1.00 71.02  ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? 104.336 46.208 -64.813 1.00 72.06  ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? 105.269 45.174 -65.183 1.00 71.28  ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? 103.445 46.422 -66.025 1.00 73.67  ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? 103.922 47.552 -66.738 1.00 78.55  ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? 103.592 45.134 -66.820 1.00 73.07  ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? 104.992 44.666 -66.474 1.00 71.39  ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? 105.162 43.219 -66.391 1.00 87.78  ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? 104.361 42.323 -65.731 1.00 86.30  ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? 104.782 41.083 -65.805 1.00 86.89  ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? 105.941 41.171 -66.560 1.00 89.09  ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? 106.863 40.203 -66.998 1.00 90.96  ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? 106.774 38.907 -66.702 1.00 90.82  ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? 107.895 40.618 -67.758 1.00 92.68  ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? 107.993 41.919 -68.042 1.00 90.76  ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? 107.199 42.925 -67.681 1.00 89.73  ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? 106.181 42.480 -66.935 1.00 89.93  ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? 103.181 48.001 -68.071 1.00 85.80  ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? 103.323 49.471 -68.218 1.00 85.75  ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? 101.829 47.387 -68.064 1.00 84.51  ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? 104.061 47.274 -69.170 1.00 86.65  ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? 105.473 47.465 -69.194 1.00 88.52  ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? 106.057 46.797 -70.412 1.00 89.87  ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? 106.357 45.414 -70.117 1.00 88.85  ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? 105.112 46.790 -71.616 1.00 91.47  ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? 105.802 47.172 -72.798 1.00 95.61  ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? 104.684 45.339 -71.728 1.00 90.28  ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? 105.883 44.605 -71.173 1.00 88.56  ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? 105.563 43.277 -70.627 1.00 89.19  ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? 106.297 42.204 -71.077 1.00 89.12  ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? 107.172 42.302 -71.915 1.00 89.07  ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? 105.948 41.003 -70.526 1.00 88.88  ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? 104.929 40.768 -69.631 1.00 87.26  ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? 104.712 39.635 -69.238 1.00 85.90  ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? 104.186 41.924 -69.224 1.00 87.84  ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? 103.039 41.740 -68.289 1.00 87.66  ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? 104.547 43.114 -69.715 1.00 87.94  ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? 105.000 47.890 -73.987 1.00 120.06 ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? 105.684 49.174 -74.257 1.00 92.53  ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? 103.556 47.884 -73.653 1.00 93.32  ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? 105.266 46.934 -75.228 1.00 119.85 ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? 106.598 46.713 -75.675 1.00 121.29 ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? 106.646 45.563 -76.651 1.00 121.48 ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? 106.444 44.309 -75.958 1.00 121.59 ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? 105.607 45.613 -77.771 1.00 122.09 ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? 106.246 45.259 -79.005 1.00 121.74 ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? 104.568 44.596 -77.330 1.00 121.59 ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? 105.393 43.574 -76.562 1.00 121.58 ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? 104.668 42.876 -75.499 1.00 94.48  ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? 103.756 43.421 -74.627 1.00 93.61  ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? 103.279 42.553 -73.778 1.00 92.55  ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? 103.914 41.365 -74.106 1.00 93.49  ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? 103.808 40.071 -73.521 1.00 93.59  ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? 103.122 39.711 -72.557 1.00 94.86  ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? 104.618 39.152 -74.171 1.00 94.21  ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? 105.432 39.435 -75.231 1.00 94.11  ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? 106.121 38.406 -75.713 1.00 93.80  ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? 105.555 40.633 -75.777 1.00 93.60  ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? 104.771 41.543 -75.170 1.00 93.90  ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? 105.373 44.876 -80.300 1.00 112.28 ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? 106.045 45.494 -81.464 1.00 97.97  ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? 103.923 45.134 -80.073 1.00 97.36  ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? 105.606 43.306 -80.376 1.00 111.47 ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? 106.901 42.771 -80.138 1.00 109.30 ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? 106.939 41.317 -80.537 1.00 108.79 ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? 106.356 40.501 -79.498 1.00 107.37 ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? 106.160 41.010 -81.812 1.00 108.31 ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? 106.871 40.062 -82.605 1.00 107.60 ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? 104.846 40.444 -81.298 1.00 107.76 ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? 105.253 39.762 -80.005 1.00 106.85 ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? 104.217 39.747 -78.956 1.00 91.00  ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? 103.895 38.540 -78.396 1.00 90.15  ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? 104.394 37.482 -78.757 1.00 89.21  ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? 102.964 38.610 -77.388 1.00 89.58  ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? 102.332 39.739 -76.911 1.00 89.51  ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? 101.516 39.648 -75.992 1.00 88.89  ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? 102.705 40.965 -77.559 1.00 89.66  ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? 102.072 42.239 -77.106 1.00 87.43  ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? 103.610 40.909 -78.542 1.00 90.26  ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? 106.239 39.558 -83.984 1.00 118.25 ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? 107.345 39.122 -84.874 1.00 93.51  ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? 105.283 40.601 -84.442 1.00 91.11  ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? 105.422 38.269 -83.541 1.00 115.28 ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? 106.106 37.153 -82.982 1.00 110.60 ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? 105.163 35.986 -82.809 1.00 107.72 ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? 104.298 36.196 -81.667 1.00 105.74 ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? 104.241 35.708 -83.999 1.00 106.50 ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? 104.148 34.300 -84.220 1.00 105.55 ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? 102.898 36.242 -83.535 1.00 105.42 ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? 102.957 35.948 -82.048 1.00 103.34 ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? 102.092 36.793 -81.223 1.00 73.88  ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? 101.347 36.185 -80.242 1.00 71.00  ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? 101.428 34.991 -79.979 1.00 66.33  ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? 100.510 37.032 -79.561 1.00 70.08  ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? 100.377 38.397 -79.734 1.00 71.17  ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? 99.568  39.029 -79.052 1.00 67.61  ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? 101.233 38.971 -80.741 1.00 72.76  ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? 101.215 40.451 -80.950 1.00 72.65  ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? 102.024 38.150 -81.438 1.00 72.44  ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? 103.507 33.758 -85.585 1.00 82.90  ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? 104.423 32.736 -86.173 1.00 72.57  ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? 103.091 34.940 -86.384 1.00 72.52  ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? 102.172 33.033 -85.122 1.00 82.81  ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? 102.208 31.986 -84.160 1.00 80.49  ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? 100.808 31.668 -83.697 1.00 79.43  ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? 100.289 32.779 -82.926 1.00 78.57  ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? 99.805  31.431 -84.827 1.00 77.92  ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? 98.921  30.396 -84.436 1.00 77.75  ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? 99.015  32.726 -84.863 1.00 77.02  ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? 98.990  33.079 -83.391 1.00 78.07  ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? 98.699  34.478 -83.067 1.00 66.89  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? 98.123  34.786 -81.812 1.00 66.52  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? 97.906  33.871 -81.001 1.00 65.30  ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? 97.822  36.071 -81.523 1.00 65.80  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? 98.071  37.027 -82.420 1.00 65.65  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? 97.740  38.274 -82.107 1.00 64.72  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? 98.667  36.743 -83.685 1.00 65.20  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? 98.965  35.469 -83.962 1.00 65.44  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? 99.331  28.872 -84.679 1.00 68.19  ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? 100.790 28.707 -84.429 1.00 69.10  ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? 98.757  28.496 -85.989 1.00 70.98  ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? 98.538  28.076 -83.550 1.00 68.57  ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? 98.945  28.123 -82.179 1.00 63.68  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? 97.732  28.142 -81.275 1.00 59.90  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? 97.150  29.462 -81.192 1.00 59.20  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? 96.608  27.228 -81.737 1.00 56.74  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? 95.984  26.673 -80.599 1.00 56.04  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? 95.665  28.166 -82.464 1.00 56.11  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? 95.816  29.448 -81.675 1.00 56.78  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? 95.623  30.667 -82.454 1.00 56.74  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? 95.895  30.874 -83.780 1.00 57.26  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? 95.645  32.097 -84.184 1.00 56.41  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? 95.174  32.737 -83.049 1.00 55.07  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? 94.747  34.059 -82.809 1.00 55.76  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? 94.741  35.017 -83.729 1.00 56.72  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? 94.325  34.368 -81.567 1.00 55.32  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? 94.343  33.416 -80.635 1.00 53.74  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? 94.730  32.143 -80.733 1.00 56.04  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? 95.141  31.865 -81.981 1.00 55.85  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? 94.949  25.483 -80.786 1.00 78.82  ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? 95.313  24.366 -79.897 1.00 62.23  ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? 94.874  25.267 -82.238 1.00 63.81  ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? 93.581  26.107 -80.283 1.00 79.87  ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? 93.525  26.821 -79.059 1.00 76.75  ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? 92.347  27.758 -79.079 1.00 77.25  ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? 92.590  28.894 -79.946 1.00 76.35  ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? 91.085  27.085 -79.614 1.00 78.53  ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? 89.967  27.622 -78.929 1.00 78.31  ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? 91.025  27.574 -81.045 1.00 77.89  ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? 91.506  28.992 -80.851 1.00 79.38  ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? 91.967  29.630 -82.072 1.00 67.13  ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? 92.609  29.027 -83.123 1.00 66.70  ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? 92.851  29.845 -84.110 1.00 69.30  ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? 92.350  31.065 -83.673 1.00 69.99  ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? 92.326  32.321 -84.316 1.00 71.76  ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? 92.772  32.623 -85.432 1.00 74.44  ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? 91.709  33.284 -83.526 1.00 70.98  ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? 91.183  33.058 -82.273 1.00 69.84  ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? 90.597  34.110 -81.671 1.00 70.12  ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? 91.220  31.889 -81.659 1.00 68.32  ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? 91.810  30.946 -82.414 1.00 68.19  ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? 89.150  26.717 -77.898 1.00 72.33  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? 90.091  26.018 -76.978 1.00 68.87  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? 88.179  25.929 -78.718 1.00 69.60  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? 88.406  27.837 -77.060 1.00 74.43  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? 89.127  28.967 -76.596 1.00 68.36  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? 88.343  30.226 -76.872 1.00 67.67  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? 88.670  30.796 -78.160 1.00 65.15  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? 86.828  30.031 -76.863 1.00 66.02  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? 86.208  31.114 -76.183 1.00 64.53  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? 86.463  30.098 -78.329 1.00 66.27  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? 87.451  31.134 -78.799 1.00 66.52  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? 87.674  31.175 -80.252 1.00 62.90  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? 87.294  32.321 -80.944 1.00 61.91  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? 86.701  33.226 -80.325 1.00 61.55  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? 87.554  32.411 -82.255 1.00 64.20  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? 88.131  31.390 -82.887 1.00 63.22  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? 88.381  31.518 -84.197 1.00 66.46  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? 88.484  30.190 -82.214 1.00 62.25  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? 88.245  30.127 -80.912 1.00 62.48  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? 84.780  30.898 -75.497 1.00 56.81  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? 84.933  31.211 -74.063 1.00 64.19  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? 84.212  29.595 -75.898 1.00 63.55  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? 83.921  32.036 -76.186 1.00 55.71  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? 84.463  33.333 -76.362 1.00 56.67  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? 83.698  34.070 -77.433 1.00 57.41  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? 84.089  33.600 -78.752 1.00 54.68  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? 82.188  33.875 -77.331 1.00 60.23  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? 81.526  35.111 -77.583 1.00 64.66  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? 81.882  32.850 -78.413 1.00 56.92  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? 82.964  33.102 -79.468 1.00 55.34  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? 83.378  31.866 -80.116 1.00 61.99  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? 83.365  30.636 -79.514 1.00 61.43  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? 83.793  29.677 -80.283 1.00 62.39  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? 84.110  30.301 -81.478 1.00 63.41  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? 84.635  29.752 -82.675 1.00 62.58  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? 84.944  28.575 -82.915 1.00 67.21  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? 84.801  30.725 -83.644 1.00 63.78  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? 84.512  32.050 -83.480 1.00 63.58  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? 84.741  32.776 -84.530 1.00 68.97  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? 84.035  32.594 -82.366 1.00 63.63  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? 83.855  31.661 -81.402 1.00 62.22  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? 79.960  35.255 -77.267 1.00 84.50  ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? 79.874  36.120 -76.057 1.00 58.89  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? 79.282  33.921 -77.305 1.00 58.25  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? 79.448  36.120 -78.488 1.00 83.40  ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? 80.283  37.129 -79.036 1.00 84.36  ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? 79.964  37.305 -80.498 1.00 85.10  ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? 80.476  36.192 -81.262 1.00 82.37  ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? 78.463  37.317 -80.751 1.00 87.92  ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? 78.194  38.220 -81.800 1.00 92.35  ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? 78.164  35.891 -81.179 1.00 84.61  ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? 79.414  35.560 -81.953 1.00 83.03  ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? 79.750  34.148 -82.080 1.00 56.69  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? 79.580  33.144 -81.164 1.00 56.13  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? 80.034  31.992 -81.576 1.00 57.09  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? 80.521  32.257 -82.847 1.00 58.11  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? 81.153  31.405 -83.800 1.00 57.28  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? 81.445  30.197 -83.691 1.00 61.91  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? 81.468  32.092 -84.967 1.00 58.48  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? 81.238  33.422 -85.185 1.00 58.28  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? 81.608  33.897 -86.363 1.00 63.67  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? 80.681  34.228 -84.310 1.00 58.33  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? 80.343  33.582 -83.173 1.00 56.92  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? 76.695  38.417 -82.288 1.00 74.42  ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? 76.342  39.840 -82.066 1.00 60.56  ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? 75.853  37.329 -81.726 1.00 62.40  ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? 76.775  38.115 -83.840 1.00 73.30  ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? 77.793  38.687 -84.638 1.00 74.94  ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? 77.692  38.136 -86.035 1.00 77.50  ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? 78.187  36.781 -86.063 1.00 74.58  ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? 76.256  38.073 -86.537 1.00 79.04  ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? 76.241  38.435 -87.912 1.00 84.16  ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? 75.859  36.623 -86.313 1.00 75.82  ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? 77.175  35.886 -86.491 1.00 74.14  ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? 77.327  34.674 -85.690 1.00 63.44  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? 77.164  34.538 -84.334 1.00 62.14  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? 77.454  33.339 -83.886 1.00 59.70  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? 77.806  32.632 -85.025 1.00 59.00  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? 78.204  31.305 -85.225 1.00 57.50  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? 78.280  30.410 -84.253 1.00 53.48  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? 78.505  30.916 -86.479 1.00 57.45  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? 78.370  31.800 -87.464 1.00 60.24  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? 77.979  33.077 -87.410 1.00 61.31  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? 77.719  33.436 -86.146 1.00 61.15  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? 74.848  38.628 -88.655 1.00 99.25  ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? 75.017  39.740 -89.615 1.00 93.64  ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? 73.772  38.682 -87.638 1.00 92.94  ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? 74.736  37.278 -89.466 1.00 97.47  ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? 75.787  36.916 -90.342 1.00 97.11  ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? 75.384  35.722 -91.168 1.00 96.62  ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? 75.632  34.506 -90.431 1.00 95.38  ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? 73.907  35.717 -91.537 1.00 96.74  ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? 73.766  35.289 -92.894 1.00 97.82  ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? 73.288  34.774 -90.516 1.00 95.90  ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? 74.424  33.812 -90.183 1.00 95.55  ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? 74.471  33.371 -88.788 1.00 87.35  ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? 74.171  34.099 -87.663 1.00 87.09  ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? 74.335  33.431 -86.545 1.00 86.39  ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? 74.766  32.181 -86.963 1.00 85.33  ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? 75.112  31.017 -86.261 1.00 85.75  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? 75.075  30.919 -84.936 1.00 84.03  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? 75.502  29.943 -86.974 1.00 87.01  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? 75.539  30.040 -88.302 1.00 87.59  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? 75.236  31.077 -89.080 1.00 86.91  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? 74.853  32.127 -88.341 1.00 86.04  ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 74  ? 72.325  34.883 -93.455 1.00 83.82  ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 74  ? 72.388  34.931 -94.940 1.00 83.82  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 74  ? 71.297  35.671 -92.721 1.00 81.87  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 74  ? 72.237  33.366 -93.017 1.00 82.09  ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 74  ? 73.318  32.511 -93.307 1.00 79.01  ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 74  ? 72.840  31.089 -93.303 1.00 79.17  ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 74  ? 73.005  30.484 -92.004 1.00 77.87  ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 74  ? 71.363  30.966 -93.645 1.00 80.40  ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 74  ? 71.227  29.871 -94.543 1.00 83.64  ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 74  ? 70.713  30.678 -92.301 1.00 78.67  ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 74  ? 71.793  29.867 -91.614 1.00 76.58  ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 74  ? 71.763  29.854 -90.136 1.00 70.12  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 74  ? 72.084  28.677 -89.480 1.00 69.22  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 74  ? 72.340  27.630 -90.057 1.00 67.36  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 74  ? 72.089  28.776 -88.113 1.00 68.61  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 74  ? 71.806  29.897 -87.352 1.00 68.00  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 74  ? 71.875  29.834 -86.125 1.00 70.43  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 74  ? 71.453  31.083 -88.103 1.00 67.98  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 74  ? 71.122  32.343 -87.367 1.00 64.29  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 74  ? 71.445  31.000 -89.436 1.00 68.02  ? 74   DT  I C6    1 
ATOM   1512  P P     . DT  A 1 75  ? 69.779  29.423 -95.040 1.00 96.84  ? 75   DT  I P     1 
ATOM   1513  O OP1   . DT  A 1 75  ? 69.921  29.076 -96.475 1.00 83.15  ? 75   DT  I OP1   1 
ATOM   1514  O OP2   . DT  A 1 75  ? 68.763  30.432 -94.612 1.00 81.24  ? 75   DT  I OP2   1 
ATOM   1515  O "O5'" . DT  A 1 75  ? 69.553  28.088 -94.215 1.00 93.66  ? 75   DT  I "O5'" 1 
ATOM   1516  C "C5'" . DT  A 1 75  ? 70.537  27.065 -94.236 1.00 93.41  ? 75   DT  I "C5'" 1 
ATOM   1517  C "C4'" . DT  A 1 75  ? 70.025  25.867 -93.482 1.00 92.57  ? 75   DT  I "C4'" 1 
ATOM   1518  O "O4'" . DT  A 1 75  ? 70.194  26.059 -92.054 1.00 90.82  ? 75   DT  I "O4'" 1 
ATOM   1519  C "C3'" . DT  A 1 75  ? 68.531  25.675 -93.712 1.00 91.95  ? 75   DT  I "C3'" 1 
ATOM   1520  O "O3'" . DT  A 1 75  ? 68.244  24.296 -93.830 1.00 94.59  ? 75   DT  I "O3'" 1 
ATOM   1521  C "C2'" . DT  A 1 75  ? 67.907  26.244 -92.450 1.00 90.01  ? 75   DT  I "C2'" 1 
ATOM   1522  C "C1'" . DT  A 1 75  ? 68.947  25.889 -91.407 1.00 88.54  ? 75   DT  I "C1'" 1 
ATOM   1523  N N1    . DT  A 1 75  ? 68.938  26.720 -90.182 1.00 70.24  ? 75   DT  I N1    1 
ATOM   1524  C C2    . DT  A 1 75  ? 69.185  26.091 -88.980 1.00 68.43  ? 75   DT  I C2    1 
ATOM   1525  O O2    . DT  A 1 75  ? 69.441  24.910 -88.889 1.00 68.64  ? 75   DT  I O2    1 
ATOM   1526  N N3    . DT  A 1 75  ? 69.121  26.904 -87.884 1.00 65.27  ? 75   DT  I N3    1 
ATOM   1527  C C4    . DT  A 1 75  ? 68.848  28.255 -87.867 1.00 63.94  ? 75   DT  I C4    1 
ATOM   1528  O O4    . DT  A 1 75  ? 68.806  28.861 -86.801 1.00 61.56  ? 75   DT  I O4    1 
ATOM   1529  C C5    . DT  A 1 75  ? 68.626  28.857 -89.155 1.00 64.48  ? 75   DT  I C5    1 
ATOM   1530  C C7    . DT  A 1 75  ? 68.356  30.324 -89.216 1.00 62.62  ? 75   DT  I C7    1 
ATOM   1531  C C6    . DT  A 1 75  ? 68.676  28.072 -90.240 1.00 67.29  ? 75   DT  I C6    1 
ATOM   1532  P P     . DC  A 1 76  ? 67.051  23.817 -94.776 1.00 98.81  ? 76   DC  I P     1 
ATOM   1533  O OP1   . DC  A 1 76  ? 67.656  23.364 -96.037 1.00 92.80  ? 76   DC  I OP1   1 
ATOM   1534  O OP2   . DC  A 1 76  ? 65.986  24.853 -94.804 1.00 91.61  ? 76   DC  I OP2   1 
ATOM   1535  O "O5'" . DC  A 1 76  ? 66.503  22.547 -94.000 1.00 97.28  ? 76   DC  I "O5'" 1 
ATOM   1536  C "C5'" . DC  A 1 76  ? 67.402  21.646 -93.356 1.00 93.95  ? 76   DC  I "C5'" 1 
ATOM   1537  C "C4'" . DC  A 1 76  ? 66.869  21.248 -91.996 1.00 91.70  ? 76   DC  I "C4'" 1 
ATOM   1538  O "O4'" . DC  A 1 76  ? 66.987  22.332 -91.036 1.00 87.30  ? 76   DC  I "O4'" 1 
ATOM   1539  C "C3'" . DC  A 1 76  ? 65.399  20.831 -91.971 1.00 90.13  ? 76   DC  I "C3'" 1 
ATOM   1540  O "O3'" . DC  A 1 76  ? 65.252  19.683 -91.138 1.00 91.66  ? 76   DC  I "O3'" 1 
ATOM   1541  C "C2'" . DC  A 1 76  ? 64.701  22.022 -91.333 1.00 88.31  ? 76   DC  I "C2'" 1 
ATOM   1542  C "C1'" . DC  A 1 76  ? 65.758  22.457 -90.337 1.00 84.77  ? 76   DC  I "C1'" 1 
ATOM   1543  N N1    . DC  A 1 76  ? 65.652  23.834 -89.827 1.00 73.57  ? 76   DC  I N1    1 
ATOM   1544  C C2    . DC  A 1 76  ? 65.643  24.040 -88.430 1.00 71.28  ? 76   DC  I C2    1 
ATOM   1545  O O2    . DC  A 1 76  ? 65.747  23.060 -87.677 1.00 67.86  ? 76   DC  I O2    1 
ATOM   1546  N N3    . DC  A 1 76  ? 65.527  25.300 -87.948 1.00 68.76  ? 76   DC  I N3    1 
ATOM   1547  C C4    . DC  A 1 76  ? 65.434  26.333 -88.798 1.00 67.62  ? 76   DC  I C4    1 
ATOM   1548  N N4    . DC  A 1 76  ? 65.325  27.567 -88.282 1.00 60.94  ? 76   DC  I N4    1 
ATOM   1549  C C5    . DC  A 1 76  ? 65.451  26.149 -90.221 1.00 68.29  ? 76   DC  I C5    1 
ATOM   1550  C C6    . DC  A 1 76  ? 65.560  24.896 -90.684 1.00 70.21  ? 76   DC  I C6    1 
ATOM   1551  P P     . DC  A 1 77  ? 63.962  18.749 -91.310 1.00 87.50  ? 77   DC  I P     1 
ATOM   1552  O OP1   . DC  A 1 77  ? 64.280  17.676 -92.285 1.00 76.18  ? 77   DC  I OP1   1 
ATOM   1553  O OP2   . DC  A 1 77  ? 62.782  19.637 -91.525 1.00 77.27  ? 77   DC  I OP2   1 
ATOM   1554  O "O5'" . DC  A 1 77  ? 63.772  18.068 -89.894 1.00 85.16  ? 77   DC  I "O5'" 1 
ATOM   1555  C "C5'" . DC  A 1 77  ? 64.857  17.931 -89.001 1.00 79.03  ? 77   DC  I "C5'" 1 
ATOM   1556  C "C4'" . DC  A 1 77  ? 64.375  18.192 -87.596 1.00 78.76  ? 77   DC  I "C4'" 1 
ATOM   1557  O "O4'" . DC  A 1 77  ? 64.227  19.611 -87.355 1.00 77.31  ? 77   DC  I "O4'" 1 
ATOM   1558  C "C3'" . DC  A 1 77  ? 63.010  17.576 -87.309 1.00 74.45  ? 77   DC  I "C3'" 1 
ATOM   1559  O "O3'" . DC  A 1 77  ? 63.040  17.048 -86.000 1.00 77.98  ? 77   DC  I "O3'" 1 
ATOM   1560  C "C2'" . DC  A 1 77  ? 62.063  18.765 -87.372 1.00 77.49  ? 77   DC  I "C2'" 1 
ATOM   1561  C "C1'" . DC  A 1 77  ? 62.941  19.858 -86.818 1.00 76.32  ? 77   DC  I "C1'" 1 
ATOM   1562  N N1    . DC  A 1 77  ? 62.580  21.242 -87.145 1.00 65.74  ? 77   DC  I N1    1 
ATOM   1563  C C2    . DC  A 1 77  ? 62.598  22.196 -86.116 1.00 66.66  ? 77   DC  I C2    1 
ATOM   1564  O O2    . DC  A 1 77  ? 62.901  21.834 -84.959 1.00 68.06  ? 77   DC  I O2    1 
ATOM   1565  N N3    . DC  A 1 77  ? 62.302  23.484 -86.402 1.00 67.89  ? 77   DC  I N3    1 
ATOM   1566  C C4    . DC  A 1 77  ? 62.018  23.838 -87.653 1.00 68.69  ? 77   DC  I C4    1 
ATOM   1567  N N4    . DC  A 1 77  ? 61.765  25.127 -87.891 1.00 69.17  ? 77   DC  I N4    1 
ATOM   1568  C C5    . DC  A 1 77  ? 61.987  22.888 -88.716 1.00 68.73  ? 77   DC  I C5    1 
ATOM   1569  C C6    . DC  A 1 77  ? 62.263  21.611 -88.418 1.00 67.44  ? 77   DC  I C6    1 
ATOM   1570  P P     . DG  A 1 78  ? 62.243  15.709 -85.667 1.00 91.29  ? 78   DG  I P     1 
ATOM   1571  O OP1   . DG  A 1 78  ? 63.280  14.653 -85.534 1.00 75.60  ? 78   DG  I OP1   1 
ATOM   1572  O OP2   . DG  A 1 78  ? 61.125  15.546 -86.631 1.00 73.62  ? 78   DG  I OP2   1 
ATOM   1573  O "O5'" . DG  A 1 78  ? 61.606  16.017 -84.244 1.00 90.14  ? 78   DG  I "O5'" 1 
ATOM   1574  C "C5'" . DG  A 1 78  ? 62.352  16.713 -83.248 1.00 86.53  ? 78   DG  I "C5'" 1 
ATOM   1575  C "C4'" . DG  A 1 78  ? 61.473  17.728 -82.561 1.00 85.85  ? 78   DG  I "C4'" 1 
ATOM   1576  O "O4'" . DG  A 1 78  ? 61.259  18.902 -83.383 1.00 83.94  ? 78   DG  I "O4'" 1 
ATOM   1577  C "C3'" . DG  A 1 78  ? 60.079  17.209 -82.212 1.00 85.49  ? 78   DG  I "C3'" 1 
ATOM   1578  O "O3'" . DG  A 1 78  ? 59.730  17.740 -80.951 1.00 83.82  ? 78   DG  I "O3'" 1 
ATOM   1579  C "C2'" . DG  A 1 78  ? 59.192  17.875 -83.246 1.00 85.34  ? 78   DG  I "C2'" 1 
ATOM   1580  C "C1'" . DG  A 1 78  ? 59.879  19.216 -83.330 1.00 84.40  ? 78   DG  I "C1'" 1 
ATOM   1581  N N9    . DG  A 1 78  ? 59.542  20.031 -84.486 1.00 67.93  ? 78   DG  I N9    1 
ATOM   1582  C C8    . DG  A 1 78  ? 59.240  19.592 -85.745 1.00 67.19  ? 78   DG  I C8    1 
ATOM   1583  N N7    . DG  A 1 78  ? 58.966  20.560 -86.574 1.00 68.37  ? 78   DG  I N7    1 
ATOM   1584  C C5    . DG  A 1 78  ? 59.090  21.711 -85.813 1.00 68.95  ? 78   DG  I C5    1 
ATOM   1585  C C6    . DG  A 1 78  ? 58.907  23.075 -86.172 1.00 69.89  ? 78   DG  I C6    1 
ATOM   1586  O O6    . DG  A 1 78  ? 58.564  23.544 -87.268 1.00 69.37  ? 78   DG  I O6    1 
ATOM   1587  N N1    . DG  A 1 78  ? 59.159  23.924 -85.097 1.00 71.05  ? 78   DG  I N1    1 
ATOM   1588  C C2    . DG  A 1 78  ? 59.529  23.512 -83.837 1.00 71.76  ? 78   DG  I C2    1 
ATOM   1589  N N2    . DG  A 1 78  ? 59.743  24.480 -82.931 1.00 70.06  ? 78   DG  I N2    1 
ATOM   1590  N N3    . DG  A 1 78  ? 59.684  22.242 -83.488 1.00 68.85  ? 78   DG  I N3    1 
ATOM   1591  C C4    . DG  A 1 78  ? 59.453  21.402 -84.522 1.00 69.23  ? 78   DG  I C4    1 
ATOM   1592  P P     . DC  A 1 79  ? 59.683  16.782 -79.680 1.00 69.96  ? 79   DC  I P     1 
ATOM   1593  O OP1   . DC  A 1 79  ? 60.850  15.871 -79.793 1.00 63.70  ? 79   DC  I OP1   1 
ATOM   1594  O OP2   . DC  A 1 79  ? 58.297  16.233 -79.578 1.00 62.61  ? 79   DC  I OP2   1 
ATOM   1595  O "O5'" . DC  A 1 79  ? 59.968  17.761 -78.462 1.00 67.62  ? 79   DC  I "O5'" 1 
ATOM   1596  C "C5'" . DC  A 1 79  ? 60.919  18.805 -78.586 1.00 61.49  ? 79   DC  I "C5'" 1 
ATOM   1597  C "C4'" . DC  A 1 79  ? 60.247  20.132 -78.334 1.00 61.22  ? 79   DC  I "C4'" 1 
ATOM   1598  O "O4'" . DC  A 1 79  ? 59.609  20.640 -79.524 1.00 59.77  ? 79   DC  I "O4'" 1 
ATOM   1599  C "C3'" . DC  A 1 79  ? 59.162  20.091 -77.263 1.00 56.91  ? 79   DC  I "C3'" 1 
ATOM   1600  O "O3'" . DC  A 1 79  ? 59.274  21.253 -76.446 1.00 60.44  ? 79   DC  I "O3'" 1 
ATOM   1601  C "C2'" . DC  A 1 79  ? 57.877  20.142 -78.068 1.00 59.95  ? 79   DC  I "C2'" 1 
ATOM   1602  C "C1'" . DC  A 1 79  ? 58.299  21.054 -79.190 1.00 58.78  ? 79   DC  I "C1'" 1 
ATOM   1603  N N1    . DC  A 1 79  ? 57.486  21.014 -80.411 1.00 52.17  ? 79   DC  I N1    1 
ATOM   1604  C C2    . DC  A 1 79  ? 57.159  22.224 -81.027 1.00 53.09  ? 79   DC  I C2    1 
ATOM   1605  O O2    . DC  A 1 79  ? 57.530  23.285 -80.506 1.00 54.49  ? 79   DC  I O2    1 
ATOM   1606  N N3    . DC  A 1 79  ? 56.455  22.207 -82.174 1.00 54.32  ? 79   DC  I N3    1 
ATOM   1607  C C4    . DC  A 1 79  ? 56.082  21.049 -82.709 1.00 55.12  ? 79   DC  I C4    1 
ATOM   1608  N N4    . DC  A 1 79  ? 55.415  21.087 -83.853 1.00 55.60  ? 79   DC  I N4    1 
ATOM   1609  C C5    . DC  A 1 79  ? 56.385  19.801 -82.094 1.00 55.16  ? 79   DC  I C5    1 
ATOM   1610  C C6    . DC  A 1 79  ? 57.075  19.829 -80.953 1.00 53.87  ? 79   DC  I C6    1 
ATOM   1611  P P     . DT  A 1 80  ? 58.700  21.236 -74.949 1.00 53.39  ? 80   DT  I P     1 
ATOM   1612  O OP1   . DT  A 1 80  ? 59.897  21.271 -74.078 1.00 55.93  ? 80   DT  I OP1   1 
ATOM   1613  O OP2   . DT  A 1 80  ? 57.680  20.163 -74.787 1.00 53.82  ? 80   DT  I OP2   1 
ATOM   1614  O "O5'" . DT  A 1 80  ? 57.933  22.627 -74.852 1.00 50.15  ? 80   DT  I "O5'" 1 
ATOM   1615  C "C5'" . DT  A 1 80  ? 58.559  23.841 -75.285 1.00 46.19  ? 80   DT  I "C5'" 1 
ATOM   1616  C "C4'" . DT  A 1 80  ? 57.519  24.843 -75.726 1.00 44.09  ? 80   DT  I "C4'" 1 
ATOM   1617  O "O4'" . DT  A 1 80  ? 56.876  24.395 -76.949 1.00 44.00  ? 80   DT  I "O4'" 1 
ATOM   1618  C "C3'" . DT  A 1 80  ? 56.392  25.091 -74.725 1.00 43.86  ? 80   DT  I "C3'" 1 
ATOM   1619  O "O3'" . DT  A 1 80  ? 56.109  26.498 -74.674 1.00 39.01  ? 80   DT  I "O3'" 1 
ATOM   1620  C "C2'" . DT  A 1 80  ? 55.222  24.301 -75.301 1.00 45.49  ? 80   DT  I "C2'" 1 
ATOM   1621  C "C1'" . DT  A 1 80  ? 55.459  24.438 -76.790 1.00 48.11  ? 80   DT  I "C1'" 1 
ATOM   1622  N N1    . DT  A 1 80  ? 54.860  23.400 -77.673 1.00 52.67  ? 80   DT  I N1    1 
ATOM   1623  C C2    . DT  A 1 80  ? 54.292  23.800 -78.883 1.00 54.15  ? 80   DT  I C2    1 
ATOM   1624  O O2    . DT  A 1 80  ? 54.215  24.965 -79.260 1.00 48.29  ? 80   DT  I O2    1 
ATOM   1625  N N3    . DT  A 1 80  ? 53.828  22.777 -79.653 1.00 57.77  ? 80   DT  I N3    1 
ATOM   1626  C C4    . DT  A 1 80  ? 53.867  21.436 -79.367 1.00 59.50  ? 80   DT  I C4    1 
ATOM   1627  O O4    . DT  A 1 80  ? 53.452  20.630 -80.184 1.00 64.34  ? 80   DT  I O4    1 
ATOM   1628  C C5    . DT  A 1 80  ? 54.430  21.088 -78.098 1.00 58.78  ? 80   DT  I C5    1 
ATOM   1629  C C7    . DT  A 1 80  ? 54.476  19.646 -77.715 1.00 55.56  ? 80   DT  I C7    1 
ATOM   1630  C C6    . DT  A 1 80  ? 54.890  22.072 -77.317 1.00 53.23  ? 80   DT  I C6    1 
ATOM   1631  P P     . DG  A 1 81  ? 55.155  27.092 -73.521 1.00 40.32  ? 81   DG  I P     1 
ATOM   1632  O OP1   . DG  A 1 81  ? 55.969  27.890 -72.574 1.00 53.66  ? 81   DG  I OP1   1 
ATOM   1633  O OP2   . DG  A 1 81  ? 54.278  26.008 -73.003 1.00 53.92  ? 81   DG  I OP2   1 
ATOM   1634  O "O5'" . DG  A 1 81  ? 54.260  28.103 -74.340 1.00 42.16  ? 81   DG  I "O5'" 1 
ATOM   1635  C "C5'" . DG  A 1 81  ? 54.824  28.853 -75.402 1.00 39.85  ? 81   DG  I "C5'" 1 
ATOM   1636  C "C4'" . DG  A 1 81  ? 53.715  29.427 -76.246 1.00 42.59  ? 81   DG  I "C4'" 1 
ATOM   1637  O "O4'" . DG  A 1 81  ? 53.179  28.422 -77.129 1.00 39.83  ? 81   DG  I "O4'" 1 
ATOM   1638  C "C3'" . DG  A 1 81  ? 52.533  29.945 -75.427 1.00 44.39  ? 81   DG  I "C3'" 1 
ATOM   1639  O "O3'" . DG  A 1 81  ? 52.021  31.088 -76.091 1.00 44.20  ? 81   DG  I "O3'" 1 
ATOM   1640  C "C2'" . DG  A 1 81  ? 51.549  28.791 -75.445 1.00 41.09  ? 81   DG  I "C2'" 1 
ATOM   1641  C "C1'" . DG  A 1 81  ? 51.815  28.137 -76.792 1.00 43.68  ? 81   DG  I "C1'" 1 
ATOM   1642  N N9    . DG  A 1 81  ? 51.652  26.681 -76.836 1.00 55.95  ? 81   DG  I N9    1 
ATOM   1643  C C8    . DG  A 1 81  ? 52.005  25.778 -75.865 1.00 59.95  ? 81   DG  I C8    1 
ATOM   1644  N N7    . DG  A 1 81  ? 51.806  24.538 -76.221 1.00 59.22  ? 81   DG  I N7    1 
ATOM   1645  C C5    . DG  A 1 81  ? 51.270  24.626 -77.497 1.00 62.48  ? 81   DG  I C5    1 
ATOM   1646  C C6    . DG  A 1 81  ? 50.851  23.603 -78.397 1.00 62.88  ? 81   DG  I C6    1 
ATOM   1647  O O6    . DG  A 1 81  ? 50.873  22.387 -78.244 1.00 60.60  ? 81   DG  I O6    1 
ATOM   1648  N N1    . DG  A 1 81  ? 50.368  24.128 -79.579 1.00 62.48  ? 81   DG  I N1    1 
ATOM   1649  C C2    . DG  A 1 81  ? 50.295  25.460 -79.882 1.00 62.04  ? 81   DG  I C2    1 
ATOM   1650  N N2    . DG  A 1 81  ? 49.795  25.753 -81.093 1.00 58.26  ? 81   DG  I N2    1 
ATOM   1651  N N3    . DG  A 1 81  ? 50.682  26.432 -79.062 1.00 59.03  ? 81   DG  I N3    1 
ATOM   1652  C C4    . DG  A 1 81  ? 51.154  25.943 -77.892 1.00 59.69  ? 81   DG  I C4    1 
ATOM   1653  P P     . DA  A 1 82  ? 50.838  31.922 -75.438 1.00 42.89  ? 82   DA  I P     1 
ATOM   1654  O OP1   . DA  A 1 82  ? 51.330  33.272 -75.063 1.00 46.08  ? 82   DA  I OP1   1 
ATOM   1655  O OP2   . DA  A 1 82  ? 50.236  31.016 -74.433 1.00 41.55  ? 82   DA  I OP2   1 
ATOM   1656  O "O5'" . DA  A 1 82  ? 49.815  32.087 -76.633 1.00 48.04  ? 82   DA  I "O5'" 1 
ATOM   1657  C "C5'" . DA  A 1 82  ? 49.543  30.959 -77.422 1.00 49.81  ? 82   DA  I "C5'" 1 
ATOM   1658  C "C4'" . DA  A 1 82  ? 48.402  31.211 -78.364 1.00 48.83  ? 82   DA  I "C4'" 1 
ATOM   1659  O "O4'" . DA  A 1 82  ? 48.076  29.903 -78.858 1.00 48.42  ? 82   DA  I "O4'" 1 
ATOM   1660  C "C3'" . DA  A 1 82  ? 47.127  31.714 -77.716 1.00 47.49  ? 82   DA  I "C3'" 1 
ATOM   1661  O "O3'" . DA  A 1 82  ? 46.371  32.319 -78.760 1.00 45.55  ? 82   DA  I "O3'" 1 
ATOM   1662  C "C2'" . DA  A 1 82  ? 46.487  30.444 -77.203 1.00 46.05  ? 82   DA  I "C2'" 1 
ATOM   1663  C "C1'" . DA  A 1 82  ? 46.913  29.407 -78.225 1.00 47.35  ? 82   DA  I "C1'" 1 
ATOM   1664  N N9    . DA  A 1 82  ? 47.263  28.111 -77.661 1.00 49.85  ? 82   DA  I N9    1 
ATOM   1665  C C8    . DA  A 1 82  ? 47.823  27.861 -76.449 1.00 48.91  ? 82   DA  I C8    1 
ATOM   1666  N N7    . DA  A 1 82  ? 48.037  26.593 -76.220 1.00 48.67  ? 82   DA  I N7    1 
ATOM   1667  C C5    . DA  A 1 82  ? 47.583  25.966 -77.365 1.00 50.26  ? 82   DA  I C5    1 
ATOM   1668  C C6    . DA  A 1 82  ? 47.531  24.624 -77.749 1.00 48.88  ? 82   DA  I C6    1 
ATOM   1669  N N6    . DA  A 1 82  ? 47.912  23.618 -76.976 1.00 43.28  ? 82   DA  I N6    1 
ATOM   1670  N N1    . DA  A 1 82  ? 47.047  24.340 -78.969 1.00 46.56  ? 82   DA  I N1    1 
ATOM   1671  C C2    . DA  A 1 82  ? 46.622  25.332 -79.728 1.00 48.02  ? 82   DA  I C2    1 
ATOM   1672  N N3    . DA  A 1 82  ? 46.600  26.631 -79.475 1.00 50.68  ? 82   DA  I N3    1 
ATOM   1673  C C4    . DA  A 1 82  ? 47.105  26.887 -78.260 1.00 48.74  ? 82   DA  I C4    1 
ATOM   1674  P P     . DA  A 1 83  ? 44.867  32.794 -78.505 1.00 42.83  ? 83   DA  I P     1 
ATOM   1675  O OP1   . DA  A 1 83  ? 44.657  33.850 -79.517 1.00 41.43  ? 83   DA  I OP1   1 
ATOM   1676  O OP2   . DA  A 1 83  ? 44.680  33.093 -77.052 1.00 38.35  ? 83   DA  I OP2   1 
ATOM   1677  O "O5'" . DA  A 1 83  ? 43.991  31.509 -78.837 1.00 44.24  ? 83   DA  I "O5'" 1 
ATOM   1678  C "C5'" . DA  A 1 83  ? 43.980  30.954 -80.139 1.00 48.42  ? 83   DA  I "C5'" 1 
ATOM   1679  C "C4'" . DA  A 1 83  ? 42.962  29.842 -80.218 1.00 52.27  ? 83   DA  I "C4'" 1 
ATOM   1680  O "O4'" . DA  A 1 83  ? 43.488  28.623 -79.652 1.00 49.97  ? 83   DA  I "O4'" 1 
ATOM   1681  C "C3'" . DA  A 1 83  ? 41.629  30.088 -79.512 1.00 51.94  ? 83   DA  I "C3'" 1 
ATOM   1682  O "O3'" . DA  A 1 83  ? 40.591  29.572 -80.353 1.00 60.21  ? 83   DA  I "O3'" 1 
ATOM   1683  C "C2'" . DA  A 1 83  ? 41.757  29.265 -78.243 1.00 51.57  ? 83   DA  I "C2'" 1 
ATOM   1684  C "C1'" . DA  A 1 83  ? 42.576  28.086 -78.725 1.00 53.51  ? 83   DA  I "C1'" 1 
ATOM   1685  N N9    . DA  A 1 83  ? 43.359  27.411 -77.700 1.00 48.34  ? 83   DA  I N9    1 
ATOM   1686  C C8    . DA  A 1 83  ? 44.000  27.961 -76.631 1.00 49.16  ? 83   DA  I C8    1 
ATOM   1687  N N7    . DA  A 1 83  ? 44.622  27.086 -75.882 1.00 47.75  ? 83   DA  I N7    1 
ATOM   1688  C C5    . DA  A 1 83  ? 44.367  25.880 -76.508 1.00 47.78  ? 83   DA  I C5    1 
ATOM   1689  C C6    . DA  A 1 83  ? 44.741  24.566 -76.208 1.00 48.03  ? 83   DA  I C6    1 
ATOM   1690  N N6    . DA  A 1 83  ? 45.497  24.231 -75.191 1.00 45.87  ? 83   DA  I N6    1 
ATOM   1691  N N1    . DA  A 1 83  ? 44.316  23.593 -77.018 1.00 49.03  ? 83   DA  I N1    1 
ATOM   1692  C C2    . DA  A 1 83  ? 43.589  23.931 -78.076 1.00 48.00  ? 83   DA  I C2    1 
ATOM   1693  N N3    . DA  A 1 83  ? 43.183  25.135 -78.474 1.00 49.27  ? 83   DA  I N3    1 
ATOM   1694  C C4    . DA  A 1 83  ? 43.603  26.072 -77.630 1.00 47.49  ? 83   DA  I C4    1 
ATOM   1695  P P     . DC  A 1 84  ? 39.047  29.747 -79.942 1.00 68.03  ? 84   DC  I P     1 
ATOM   1696  O OP1   . DC  A 1 84  ? 38.349  30.074 -81.208 1.00 66.79  ? 84   DC  I OP1   1 
ATOM   1697  O OP2   . DC  A 1 84  ? 38.933  30.664 -78.775 1.00 62.03  ? 84   DC  I OP2   1 
ATOM   1698  O "O5'" . DC  A 1 84  ? 38.625  28.277 -79.508 1.00 68.60  ? 84   DC  I "O5'" 1 
ATOM   1699  C "C5'" . DC  A 1 84  ? 38.895  27.180 -80.375 1.00 73.82  ? 84   DC  I "C5'" 1 
ATOM   1700  C "C4'" . DC  A 1 84  ? 38.418  25.892 -79.752 1.00 74.49  ? 84   DC  I "C4'" 1 
ATOM   1701  O "O4'" . DC  A 1 84  ? 39.424  25.312 -78.879 1.00 74.91  ? 84   DC  I "O4'" 1 
ATOM   1702  C "C3'" . DC  A 1 84  ? 37.159  26.075 -78.908 1.00 74.49  ? 84   DC  I "C3'" 1 
ATOM   1703  O "O3'" . DC  A 1 84  ? 36.261  24.989 -79.136 1.00 77.03  ? 84   DC  I "O3'" 1 
ATOM   1704  C "C2'" . DC  A 1 84  ? 37.690  26.016 -77.490 1.00 74.12  ? 84   DC  I "C2'" 1 
ATOM   1705  C "C1'" . DC  A 1 84  ? 38.831  25.022 -77.632 1.00 73.03  ? 84   DC  I "C1'" 1 
ATOM   1706  N N1    . DC  A 1 84  ? 39.855  25.135 -76.581 1.00 64.49  ? 84   DC  I N1    1 
ATOM   1707  C C2    . DC  A 1 84  ? 40.470  23.979 -76.112 1.00 65.41  ? 84   DC  I C2    1 
ATOM   1708  O O2    . DC  A 1 84  ? 40.211  22.910 -76.649 1.00 61.51  ? 84   DC  I O2    1 
ATOM   1709  N N3    . DC  A 1 84  ? 41.333  24.058 -75.082 1.00 64.91  ? 84   DC  I N3    1 
ATOM   1710  C C4    . DC  A 1 84  ? 41.600  25.239 -74.531 1.00 62.90  ? 84   DC  I C4    1 
ATOM   1711  N N4    . DC  A 1 84  ? 42.439  25.270 -73.501 1.00 59.88  ? 84   DC  I N4    1 
ATOM   1712  C C5    . DC  A 1 84  ? 41.018  26.441 -75.012 1.00 61.67  ? 84   DC  I C5    1 
ATOM   1713  C C6    . DC  A 1 84  ? 40.165  26.346 -76.036 1.00 62.26  ? 84   DC  I C6    1 
ATOM   1714  P P     . DA  A 1 85  ? 34.700  25.141 -78.772 1.00 69.22  ? 85   DA  I P     1 
ATOM   1715  O OP1   . DA  A 1 85  ? 33.945  25.347 -80.040 1.00 67.73  ? 85   DA  I OP1   1 
ATOM   1716  O OP2   . DA  A 1 85  ? 34.486  26.062 -77.618 1.00 62.91  ? 85   DA  I OP2   1 
ATOM   1717  O "O5'" . DA  A 1 85  ? 34.380  23.684 -78.268 1.00 68.30  ? 85   DA  I "O5'" 1 
ATOM   1718  C "C5'" . DA  A 1 85  ? 34.911  22.586 -78.959 1.00 63.68  ? 85   DA  I "C5'" 1 
ATOM   1719  C "C4'" . DA  A 1 85  ? 34.915  21.398 -78.044 1.00 65.98  ? 85   DA  I "C4'" 1 
ATOM   1720  O "O4'" . DA  A 1 85  ? 35.984  21.538 -77.086 1.00 65.61  ? 85   DA  I "O4'" 1 
ATOM   1721  C "C3'" . DA  A 1 85  ? 33.629  21.276 -77.237 1.00 66.98  ? 85   DA  I "C3'" 1 
ATOM   1722  O "O3'" . DA  A 1 85  ? 33.329  19.889 -77.152 1.00 69.93  ? 85   DA  I "O3'" 1 
ATOM   1723  C "C2'" . DA  A 1 85  ? 33.988  21.887 -75.890 1.00 64.43  ? 85   DA  I "C2'" 1 
ATOM   1724  C "C1'" . DA  A 1 85  ? 35.471  21.556 -75.759 1.00 65.66  ? 85   DA  I "C1'" 1 
ATOM   1725  N N9    . DA  A 1 85  ? 36.291  22.503 -74.985 1.00 59.83  ? 85   DA  I N9    1 
ATOM   1726  C C8    . DA  A 1 85  ? 36.235  23.880 -74.987 1.00 58.93  ? 85   DA  I C8    1 
ATOM   1727  N N7    . DA  A 1 85  ? 37.115  24.442 -74.197 1.00 57.50  ? 85   DA  I N7    1 
ATOM   1728  C C5    . DA  A 1 85  ? 37.794  23.370 -73.632 1.00 57.67  ? 85   DA  I C5    1 
ATOM   1729  C C6    . DA  A 1 85  ? 38.854  23.298 -72.701 1.00 57.89  ? 85   DA  I C6    1 
ATOM   1730  N N6    . DA  A 1 85  ? 39.429  24.365 -72.171 1.00 50.20  ? 85   DA  I N6    1 
ATOM   1731  N N1    . DA  A 1 85  ? 39.305  22.076 -72.342 1.00 57.95  ? 85   DA  I N1    1 
ATOM   1732  C C2    . DA  A 1 85  ? 38.733  21.005 -72.898 1.00 58.16  ? 85   DA  I C2    1 
ATOM   1733  N N3    . DA  A 1 85  ? 37.737  20.941 -73.784 1.00 56.87  ? 85   DA  I N3    1 
ATOM   1734  C C4    . DA  A 1 85  ? 37.302  22.170 -74.109 1.00 59.35  ? 85   DA  I C4    1 
ATOM   1735  P P     . DT  A 1 86  ? 32.008  19.402 -76.411 1.00 89.54  ? 86   DT  I P     1 
ATOM   1736  O OP1   . DT  A 1 86  ? 31.567  18.259 -77.249 1.00 64.31  ? 86   DT  I OP1   1 
ATOM   1737  O OP2   . DT  A 1 86  ? 31.089  20.542 -76.126 1.00 60.71  ? 86   DT  I OP2   1 
ATOM   1738  O "O5'" . DT  A 1 86  ? 32.561  18.859 -75.025 1.00 89.54  ? 86   DT  I "O5'" 1 
ATOM   1739  C "C5'" . DT  A 1 86  ? 33.659  17.965 -75.002 1.00 85.60  ? 86   DT  I "C5'" 1 
ATOM   1740  C "C4'" . DT  A 1 86  ? 34.018  17.651 -73.576 1.00 85.33  ? 86   DT  I "C4'" 1 
ATOM   1741  O "O4'" . DT  A 1 86  ? 34.857  18.692 -73.017 1.00 85.54  ? 86   DT  I "O4'" 1 
ATOM   1742  C "C3'" . DT  A 1 86  ? 32.785  17.553 -72.682 1.00 84.43  ? 86   DT  I "C3'" 1 
ATOM   1743  O "O3'" . DT  A 1 86  ? 32.952  16.429 -71.824 1.00 84.68  ? 86   DT  I "O3'" 1 
ATOM   1744  C "C2'" . DT  A 1 86  ? 32.824  18.857 -71.895 1.00 83.78  ? 86   DT  I "C2'" 1 
ATOM   1745  C "C1'" . DT  A 1 86  ? 34.318  19.111 -71.777 1.00 85.03  ? 86   DT  I "C1'" 1 
ATOM   1746  N N1    . DT  A 1 86  ? 34.752  20.516 -71.521 1.00 56.58  ? 86   DT  I N1    1 
ATOM   1747  C C2    . DT  A 1 86  ? 35.818  20.728 -70.655 1.00 55.42  ? 86   DT  I C2    1 
ATOM   1748  O O2    . DT  A 1 86  ? 36.445  19.826 -70.130 1.00 53.95  ? 86   DT  I O2    1 
ATOM   1749  N N3    . DT  A 1 86  ? 36.132  22.045 -70.439 1.00 55.91  ? 86   DT  I N3    1 
ATOM   1750  C C4    . DT  A 1 86  ? 35.523  23.154 -70.996 1.00 56.27  ? 86   DT  I C4    1 
ATOM   1751  O O4    . DT  A 1 86  ? 35.913  24.292 -70.703 1.00 54.75  ? 86   DT  I O4    1 
ATOM   1752  C C5    . DT  A 1 86  ? 34.440  22.868 -71.908 1.00 55.73  ? 86   DT  I C5    1 
ATOM   1753  C C7    . DT  A 1 86  ? 33.740  24.012 -72.568 1.00 50.87  ? 86   DT  I C7    1 
ATOM   1754  C C6    . DT  A 1 86  ? 34.109  21.580 -72.119 1.00 55.84  ? 86   DT  I C6    1 
ATOM   1755  P P     . DG  A 1 87  ? 31.694  15.525 -71.403 1.00 52.84  ? 87   DG  I P     1 
ATOM   1756  O OP1   . DG  A 1 87  ? 31.755  14.283 -72.199 1.00 75.13  ? 87   DG  I OP1   1 
ATOM   1757  O OP2   . DG  A 1 87  ? 30.440  16.308 -71.318 1.00 74.14  ? 87   DG  I OP2   1 
ATOM   1758  O "O5'" . DG  A 1 87  ? 32.075  15.179 -69.904 1.00 51.39  ? 87   DG  I "O5'" 1 
ATOM   1759  C "C5'" . DG  A 1 87  ? 33.456  15.042 -69.507 1.00 51.69  ? 87   DG  I "C5'" 1 
ATOM   1760  C "C4'" . DG  A 1 87  ? 33.690  15.700 -68.166 1.00 53.54  ? 87   DG  I "C4'" 1 
ATOM   1761  O "O4'" . DG  A 1 87  ? 34.030  17.091 -68.348 1.00 53.37  ? 87   DG  I "O4'" 1 
ATOM   1762  C "C3'" . DG  A 1 87  ? 32.499  15.679 -67.190 1.00 54.62  ? 87   DG  I "C3'" 1 
ATOM   1763  O "O3'" . DG  A 1 87  ? 32.955  15.509 -65.857 1.00 59.51  ? 87   DG  I "O3'" 1 
ATOM   1764  C "C2'" . DG  A 1 87  ? 31.962  17.091 -67.269 1.00 54.46  ? 87   DG  I "C2'" 1 
ATOM   1765  C "C1'" . DG  A 1 87  ? 33.282  17.822 -67.390 1.00 54.00  ? 87   DG  I "C1'" 1 
ATOM   1766  N N9    . DG  A 1 87  ? 33.228  19.218 -67.796 1.00 78.02  ? 87   DG  I N9    1 
ATOM   1767  C C8    . DG  A 1 87  ? 32.376  19.813 -68.693 1.00 78.28  ? 87   DG  I C8    1 
ATOM   1768  N N7    . DG  A 1 87  ? 32.586  21.094 -68.819 1.00 79.37  ? 87   DG  I N7    1 
ATOM   1769  C C5    . DG  A 1 87  ? 33.641  21.352 -67.956 1.00 79.08  ? 87   DG  I C5    1 
ATOM   1770  C C6    . DG  A 1 87  ? 34.304  22.552 -67.667 1.00 80.07  ? 87   DG  I C6    1 
ATOM   1771  O O6    . DG  A 1 87  ? 34.083  23.675 -68.130 1.00 77.42  ? 87   DG  I O6    1 
ATOM   1772  N N1    . DG  A 1 87  ? 35.324  22.363 -66.732 1.00 80.94  ? 87   DG  I N1    1 
ATOM   1773  C C2    . DG  A 1 87  ? 35.655  21.158 -66.154 1.00 81.32  ? 87   DG  I C2    1 
ATOM   1774  N N2    . DG  A 1 87  ? 36.675  21.153 -65.281 1.00 75.80  ? 87   DG  I N2    1 
ATOM   1775  N N3    . DG  A 1 87  ? 35.032  20.032 -66.418 1.00 79.98  ? 87   DG  I N3    1 
ATOM   1776  C C4    . DG  A 1 87  ? 34.044  20.201 -67.321 1.00 79.35  ? 87   DG  I C4    1 
ATOM   1777  P P     . DC  A 1 88  ? 33.119  14.043 -65.259 1.00 68.08  ? 88   DC  I P     1 
ATOM   1778  O OP1   . DC  A 1 88  ? 33.538  13.114 -66.346 1.00 65.73  ? 88   DC  I OP1   1 
ATOM   1779  O OP2   . DC  A 1 88  ? 31.907  13.761 -64.464 1.00 68.00  ? 88   DC  I OP2   1 
ATOM   1780  O "O5'" . DC  A 1 88  ? 34.354  14.216 -64.275 1.00 73.43  ? 88   DC  I "O5'" 1 
ATOM   1781  C "C5'" . DC  A 1 88  ? 35.677  14.351 -64.802 1.00 68.89  ? 88   DC  I "C5'" 1 
ATOM   1782  C "C4'" . DC  A 1 88  ? 36.527  15.195 -63.884 1.00 69.75  ? 88   DC  I "C4'" 1 
ATOM   1783  O "O4'" . DC  A 1 88  ? 36.192  16.595 -64.005 1.00 69.54  ? 88   DC  I "O4'" 1 
ATOM   1784  C "C3'" . DC  A 1 88  ? 36.385  14.864 -62.403 1.00 68.74  ? 88   DC  I "C3'" 1 
ATOM   1785  O "O3'" . DC  A 1 88  ? 37.684  14.972 -61.817 1.00 67.73  ? 88   DC  I "O3'" 1 
ATOM   1786  C "C2'" . DC  A 1 88  ? 35.446  15.949 -61.899 1.00 69.84  ? 88   DC  I "C2'" 1 
ATOM   1787  C "C1'" . DC  A 1 88  ? 35.930  17.123 -62.719 1.00 71.20  ? 88   DC  I "C1'" 1 
ATOM   1788  N N1    . DC  A 1 88  ? 35.014  18.249 -62.888 1.00 67.72  ? 88   DC  I N1    1 
ATOM   1789  C C2    . DC  A 1 88  ? 35.333  19.486 -62.306 1.00 71.21  ? 88   DC  I C2    1 
ATOM   1790  O O2    . DC  A 1 88  ? 36.338  19.576 -61.582 1.00 73.34  ? 88   DC  I O2    1 
ATOM   1791  N N3    . DC  A 1 88  ? 34.528  20.548 -62.541 1.00 72.02  ? 88   DC  I N3    1 
ATOM   1792  C C4    . DC  A 1 88  ? 33.427  20.396 -63.291 1.00 73.99  ? 88   DC  I C4    1 
ATOM   1793  N N4    . DC  A 1 88  ? 32.649  21.450 -63.493 1.00 75.48  ? 88   DC  I N4    1 
ATOM   1794  C C5    . DC  A 1 88  ? 33.073  19.148 -63.862 1.00 71.62  ? 88   DC  I C5    1 
ATOM   1795  C C6    . DC  A 1 88  ? 33.884  18.109 -63.633 1.00 70.96  ? 88   DC  I C6    1 
ATOM   1796  P P     . DC  A 1 89  ? 38.011  14.184 -60.469 1.00 62.98  ? 89   DC  I P     1 
ATOM   1797  O OP1   . DC  A 1 89  ? 39.168  13.271 -60.688 1.00 74.28  ? 89   DC  I OP1   1 
ATOM   1798  O OP2   . DC  A 1 89  ? 36.735  13.653 -59.933 1.00 73.07  ? 89   DC  I OP2   1 
ATOM   1799  O "O5'" . DC  A 1 89  ? 38.425  15.348 -59.475 1.00 58.76  ? 89   DC  I "O5'" 1 
ATOM   1800  C "C5'" . DC  A 1 89  ? 39.190  16.443 -59.926 1.00 55.83  ? 89   DC  I "C5'" 1 
ATOM   1801  C "C4'" . DC  A 1 89  ? 38.863  17.663 -59.108 1.00 52.98  ? 89   DC  I "C4'" 1 
ATOM   1802  O "O4'" . DC  A 1 89  ? 37.575  18.185 -59.480 1.00 51.87  ? 89   DC  I "O4'" 1 
ATOM   1803  C "C3'" . DC  A 1 89  ? 38.803  17.452 -57.598 1.00 54.05  ? 89   DC  I "C3'" 1 
ATOM   1804  O "O3'" . DC  A 1 89  ? 39.297  18.626 -56.994 1.00 55.94  ? 89   DC  I "O3'" 1 
ATOM   1805  C "C2'" . DC  A 1 89  ? 37.315  17.425 -57.307 1.00 55.00  ? 89   DC  I "C2'" 1 
ATOM   1806  C "C1'" . DC  A 1 89  ? 36.828  18.450 -58.303 1.00 53.12  ? 89   DC  I "C1'" 1 
ATOM   1807  N N1    . DC  A 1 89  ? 35.397  18.395 -58.647 1.00 68.76  ? 89   DC  I N1    1 
ATOM   1808  C C2    . DC  A 1 89  ? 34.709  19.604 -58.854 1.00 71.27  ? 89   DC  I C2    1 
ATOM   1809  O O2    . DC  A 1 89  ? 35.329  20.684 -58.763 1.00 66.48  ? 89   DC  I O2    1 
ATOM   1810  N N3    . DC  A 1 89  ? 33.395  19.566 -59.157 1.00 72.82  ? 89   DC  I N3    1 
ATOM   1811  C C4    . DC  A 1 89  ? 32.771  18.393 -59.270 1.00 72.48  ? 89   DC  I C4    1 
ATOM   1812  N N4    . DC  A 1 89  ? 31.474  18.412 -59.565 1.00 72.96  ? 89   DC  I N4    1 
ATOM   1813  C C5    . DC  A 1 89  ? 33.449  17.153 -59.083 1.00 69.60  ? 89   DC  I C5    1 
ATOM   1814  C C6    . DC  A 1 89  ? 34.745  17.199 -58.770 1.00 70.98  ? 89   DC  I C6    1 
ATOM   1815  P P     . DT  A 1 90  ? 40.340  18.535 -55.798 1.00 57.06  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 90  ? 41.569  17.953 -56.377 1.00 44.70  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 90  ? 39.679  17.882 -54.626 1.00 45.86  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 90  ? 40.580  20.074 -55.521 1.00 52.87  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 90  ? 40.935  20.923 -56.610 1.00 48.50  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 90  ? 40.128  22.197 -56.581 1.00 48.82  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 90  ? 38.730  21.914 -56.849 1.00 49.91  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 90  ? 40.172  22.939 -55.248 1.00 51.44  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 90  ? 40.465  24.319 -55.423 1.00 40.34  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 90  ? 38.775  22.765 -54.673 1.00 49.31  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 90  ? 37.910  22.576 -55.900 1.00 51.24  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 90  ? 36.724  21.732 -55.671 1.00 50.25  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 90  ? 35.468  22.281 -55.877 1.00 54.72  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 90  ? 35.286  23.449 -56.195 1.00 51.62  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 90  ? 34.422  21.406 -55.682 1.00 56.78  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 90  ? 34.497  20.085 -55.292 1.00 56.49  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 90  ? 33.473  19.428 -55.199 1.00 57.08  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 90  ? 35.840  19.587 -55.040 1.00 55.76  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 90  ? 36.021  18.189 -54.536 1.00 52.09  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 90  ? 36.873  20.421 -55.259 1.00 51.93  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 91  ? 40.601  25.243 -54.130 1.00 49.35  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 91  ? 41.636  26.273 -54.396 1.00 55.62  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 91  ? 40.736  24.334 -52.972 1.00 50.47  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 91  ? 39.166  25.913 -54.008 1.00 51.84  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 91  ? 38.595  26.592 -55.115 1.00 54.74  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 91  ? 37.245  27.149 -54.745 1.00 57.23  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 91  ? 36.240  26.105 -54.730 1.00 56.54  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 91  ? 37.188  27.827 -53.381 1.00 62.16  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 91  ? 36.533  29.087 -53.519 1.00 66.86  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 91  ? 36.400  26.849 -52.517 1.00 61.26  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 91  ? 35.504  26.147 -53.519 1.00 59.34  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 91  ? 35.122  24.760 -53.187 1.00 66.07  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 91  ? 33.811  24.391 -53.405 1.00 66.73  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 91  ? 32.978  25.154 -53.844 1.00 67.99  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 91  ? 33.512  23.090 -53.096 1.00 65.17  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 91  ? 34.378  22.132 -52.612 1.00 65.08  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 91  ? 33.971  20.992 -52.385 1.00 62.60  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 91  ? 35.743  22.576 -52.412 1.00 63.32  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 91  ? 36.754  21.586 -51.915 1.00 55.23  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 91  ? 36.041  23.860 -52.694 1.00 63.00  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 92  ? 36.292  30.006 -52.233 1.00 59.55  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 92  ? 36.235  31.393 -52.736 1.00 69.50  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 92  ? 37.234  29.658 -51.143 1.00 67.38  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 92  ? 34.833  29.567 -51.788 1.00 62.28  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 92  ? 33.793  29.486 -52.764 1.00 64.31  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 92  ? 32.465  29.252 -52.090 1.00 65.36  ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 92  ? 32.212  27.844 -51.922 1.00 63.96  ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 92  ? 32.358  29.878 -50.704 1.00 66.75  ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 92  ? 31.085  30.492 -50.580 1.00 70.37  ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 92  ? 32.496  28.696 -49.762 1.00 64.62  ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 92  ? 31.900  27.564 -50.574 1.00 63.71  ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 92  ? 32.429  26.229 -50.279 1.00 71.99  ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 92  ? 31.576  25.162 -50.424 1.00 72.29  ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 92  ? 30.406  25.289 -50.748 1.00 73.35  ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 92  ? 32.141  23.932 -50.168 1.00 71.37  ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 92  ? 33.441  23.679 -49.782 1.00 71.22  ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 92  ? 33.810  22.524 -49.599 1.00 72.49  ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 92  ? 34.274  24.854 -49.627 1.00 70.44  ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 92  ? 35.689  24.685 -49.185 1.00 68.30  ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 92  ? 33.735  26.052 -49.885 1.00 71.48  ? 92   DT  I C6    1 
ATOM   1875  P P     . DT  A 1 93  ? 30.810  31.514 -49.379 1.00 97.72  ? 93   DT  I P     1 
ATOM   1876  O OP1   . DT  A 1 93  ? 30.200  32.746 -49.935 1.00 74.99  ? 93   DT  I OP1   1 
ATOM   1877  O OP2   . DT  A 1 93  ? 32.031  31.617 -48.536 1.00 75.92  ? 93   DT  I OP2   1 
ATOM   1878  O "O5'" . DT  A 1 93  ? 29.683  30.729 -48.589 1.00 100.73 ? 93   DT  I "O5'" 1 
ATOM   1879  C "C5'" . DT  A 1 93  ? 28.581  30.182 -49.301 1.00 106.25 ? 93   DT  I "C5'" 1 
ATOM   1880  C "C4'" . DT  A 1 93  ? 27.753  29.331 -48.377 1.00 109.44 ? 93   DT  I "C4'" 1 
ATOM   1881  O "O4'" . DT  A 1 93  ? 28.231  27.965 -48.362 1.00 108.28 ? 93   DT  I "O4'" 1 
ATOM   1882  C "C3'" . DT  A 1 93  ? 27.814  29.825 -46.933 1.00 112.67 ? 93   DT  I "C3'" 1 
ATOM   1883  O "O3'" . DT  A 1 93  ? 26.520  29.732 -46.346 1.00 119.05 ? 93   DT  I "O3'" 1 
ATOM   1884  C "C2'" . DT  A 1 93  ? 28.783  28.859 -46.279 1.00 110.62 ? 93   DT  I "C2'" 1 
ATOM   1885  C "C1'" . DT  A 1 93  ? 28.461  27.578 -47.021 1.00 108.30 ? 93   DT  I "C1'" 1 
ATOM   1886  N N1    . DT  A 1 93  ? 29.509  26.542 -47.010 1.00 84.54  ? 93   DT  I N1    1 
ATOM   1887  C C2    . DT  A 1 93  ? 29.100  25.230 -47.109 1.00 84.36  ? 93   DT  I C2    1 
ATOM   1888  O O2    . DT  A 1 93  ? 27.934  24.912 -47.225 1.00 86.18  ? 93   DT  I O2    1 
ATOM   1889  N N3    . DT  A 1 93  ? 30.111  24.300 -47.072 1.00 82.69  ? 93   DT  I N3    1 
ATOM   1890  C C4    . DT  A 1 93  ? 31.464  24.552 -46.960 1.00 81.31  ? 93   DT  I C4    1 
ATOM   1891  O O4    . DT  A 1 93  ? 32.263  23.617 -46.945 1.00 78.72  ? 93   DT  I O4    1 
ATOM   1892  C C5    . DT  A 1 93  ? 31.827  25.953 -46.874 1.00 82.28  ? 93   DT  I C5    1 
ATOM   1893  C C7    . DT  A 1 93  ? 33.271  26.317 -46.769 1.00 81.98  ? 93   DT  I C7    1 
ATOM   1894  C C6    . DT  A 1 93  ? 30.844  26.866 -46.898 1.00 83.76  ? 93   DT  I C6    1 
ATOM   1895  P P     . DG  A 1 94  ? 26.295  30.213 -44.833 1.00 131.39 ? 94   DG  I P     1 
ATOM   1896  O OP1   . DG  A 1 94  ? 25.204  31.226 -44.825 1.00 95.81  ? 94   DG  I OP1   1 
ATOM   1897  O OP2   . DG  A 1 94  ? 27.614  30.536 -44.221 1.00 95.44  ? 94   DG  I OP2   1 
ATOM   1898  O "O5'" . DG  A 1 94  ? 25.757  28.895 -44.140 1.00 130.72 ? 94   DG  I "O5'" 1 
ATOM   1899  C "C5'" . DG  A 1 94  ? 26.286  27.637 -44.512 1.00 132.01 ? 94   DG  I "C5'" 1 
ATOM   1900  C "C4'" . DG  A 1 94  ? 25.691  26.567 -43.639 1.00 132.81 ? 94   DG  I "C4'" 1 
ATOM   1901  O "O4'" . DG  A 1 94  ? 26.437  25.348 -43.855 1.00 132.23 ? 94   DG  I "O4'" 1 
ATOM   1902  C "C3'" . DG  A 1 94  ? 25.849  26.919 -42.165 1.00 133.56 ? 94   DG  I "C3'" 1 
ATOM   1903  O "O3'" . DG  A 1 94  ? 24.698  26.498 -41.432 1.00 135.80 ? 94   DG  I "O3'" 1 
ATOM   1904  C "C2'" . DG  A 1 94  ? 27.116  26.196 -41.756 1.00 132.58 ? 94   DG  I "C2'" 1 
ATOM   1905  C "C1'" . DG  A 1 94  ? 27.169  24.996 -42.693 1.00 131.73 ? 94   DG  I "C1'" 1 
ATOM   1906  N N9    . DG  A 1 94  ? 28.537  24.669 -43.098 1.00 94.68  ? 94   DG  I N9    1 
ATOM   1907  C C8    . DG  A 1 94  ? 29.565  25.559 -43.308 1.00 93.67  ? 94   DG  I C8    1 
ATOM   1908  N N7    . DG  A 1 94  ? 30.701  24.975 -43.579 1.00 92.38  ? 94   DG  I N7    1 
ATOM   1909  C C5    . DG  A 1 94  ? 30.401  23.621 -43.566 1.00 92.72  ? 94   DG  I C5    1 
ATOM   1910  C C6    . DG  A 1 94  ? 31.233  22.503 -43.771 1.00 92.14  ? 94   DG  I C6    1 
ATOM   1911  O O6    . DG  A 1 94  ? 32.445  22.484 -43.994 1.00 92.04  ? 94   DG  I O6    1 
ATOM   1912  N N1    . DG  A 1 94  ? 30.526  21.312 -43.681 1.00 92.22  ? 94   DG  I N1    1 
ATOM   1913  C C2    . DG  A 1 94  ? 29.188  21.209 -43.413 1.00 93.03  ? 94   DG  I C2    1 
ATOM   1914  N N2    . DG  A 1 94  ? 28.697  19.964 -43.363 1.00 93.15  ? 94   DG  I N2    1 
ATOM   1915  N N3    . DG  A 1 94  ? 28.395  22.246 -43.207 1.00 92.99  ? 94   DG  I N3    1 
ATOM   1916  C C4    . DG  A 1 94  ? 29.063  23.412 -43.296 1.00 93.35  ? 94   DG  I C4    1 
ATOM   1917  P P     . DA  A 1 95  ? 24.537  26.895 -39.880 1.00 137.35 ? 95   DA  I P     1 
ATOM   1918  O OP1   . DA  A 1 95  ? 23.190  27.495 -39.706 1.00 105.52 ? 95   DA  I OP1   1 
ATOM   1919  O OP2   . DA  A 1 95  ? 25.733  27.636 -39.400 1.00 105.24 ? 95   DA  I OP2   1 
ATOM   1920  O "O5'" . DA  A 1 95  ? 24.534  25.464 -39.197 1.00 135.53 ? 95   DA  I "O5'" 1 
ATOM   1921  C "C5'" . DA  A 1 95  ? 23.984  24.356 -39.897 1.00 134.92 ? 95   DA  I "C5'" 1 
ATOM   1922  C "C4'" . DA  A 1 95  ? 24.662  23.086 -39.455 1.00 135.10 ? 95   DA  I "C4'" 1 
ATOM   1923  O "O4'" . DA  A 1 95  ? 25.950  22.919 -40.102 1.00 134.96 ? 95   DA  I "O4'" 1 
ATOM   1924  C "C3'" . DA  A 1 95  ? 24.936  23.066 -37.952 1.00 135.24 ? 95   DA  I "C3'" 1 
ATOM   1925  O "O3'" . DA  A 1 95  ? 24.661  21.768 -37.443 1.00 135.46 ? 95   DA  I "O3'" 1 
ATOM   1926  C "C2'" . DA  A 1 95  ? 26.426  23.332 -37.871 1.00 134.37 ? 95   DA  I "C2'" 1 
ATOM   1927  C "C1'" . DA  A 1 95  ? 26.899  22.593 -39.104 1.00 133.74 ? 95   DA  I "C1'" 1 
ATOM   1928  N N9    . DA  A 1 95  ? 28.236  22.950 -39.574 1.00 101.35 ? 95   DA  I N9    1 
ATOM   1929  C C8    . DA  A 1 95  ? 28.766  24.198 -39.795 1.00 100.76 ? 95   DA  I C8    1 
ATOM   1930  N N7    . DA  A 1 95  ? 30.026  24.181 -40.155 1.00 99.14  ? 95   DA  I N7    1 
ATOM   1931  C C5    . DA  A 1 95  ? 30.347  22.827 -40.187 1.00 99.95  ? 95   DA  I C5    1 
ATOM   1932  C C6    . DA  A 1 95  ? 31.544  22.138 -40.485 1.00 100.20 ? 95   DA  I C6    1 
ATOM   1933  N N6    . DA  A 1 95  ? 32.687  22.748 -40.820 1.00 99.06  ? 95   DA  I N6    1 
ATOM   1934  N N1    . DA  A 1 95  ? 31.523  20.783 -40.423 1.00 100.51 ? 95   DA  I N1    1 
ATOM   1935  C C2    . DA  A 1 95  ? 30.380  20.175 -40.082 1.00 100.63 ? 95   DA  I C2    1 
ATOM   1936  N N3    . DA  A 1 95  ? 29.197  20.713 -39.776 1.00 100.57 ? 95   DA  I N3    1 
ATOM   1937  C C4    . DA  A 1 95  ? 29.249  22.059 -39.848 1.00 100.41 ? 95   DA  I C4    1 
ATOM   1938  P P     . DT  A 1 96  ? 24.468  21.554 -35.869 1.00 133.13 ? 96   DT  I P     1 
ATOM   1939  O OP1   . DT  A 1 96  ? 23.019  21.307 -35.655 1.00 95.56  ? 96   DT  I OP1   1 
ATOM   1940  O OP2   . DT  A 1 96  ? 25.147  22.658 -35.130 1.00 94.32  ? 96   DT  I OP2   1 
ATOM   1941  O "O5'" . DT  A 1 96  ? 25.266  20.205 -35.617 1.00 131.52 ? 96   DT  I "O5'" 1 
ATOM   1942  C "C5'" . DT  A 1 96  ? 25.126  19.102 -36.506 1.00 129.54 ? 96   DT  I "C5'" 1 
ATOM   1943  C "C4'" . DT  A 1 96  ? 26.235  18.111 -36.250 1.00 128.99 ? 96   DT  I "C4'" 1 
ATOM   1944  O "O4'" . DT  A 1 96  ? 27.473  18.564 -36.854 1.00 127.33 ? 96   DT  I "O4'" 1 
ATOM   1945  C "C3'" . DT  A 1 96  ? 26.530  17.978 -34.755 1.00 129.20 ? 96   DT  I "C3'" 1 
ATOM   1946  O "O3'" . DT  A 1 96  ? 26.787  16.630 -34.370 1.00 129.82 ? 96   DT  I "O3'" 1 
ATOM   1947  C "C2'" . DT  A 1 96  ? 27.783  18.807 -34.562 1.00 127.74 ? 96   DT  I "C2'" 1 
ATOM   1948  C "C1'" . DT  A 1 96  ? 28.492  18.553 -35.870 1.00 126.13 ? 96   DT  I "C1'" 1 
ATOM   1949  N N1    . DT  A 1 96  ? 29.482  19.576 -36.215 1.00 86.25  ? 96   DT  I N1    1 
ATOM   1950  C C2    . DT  A 1 96  ? 30.775  19.162 -36.430 1.00 84.74  ? 96   DT  I C2    1 
ATOM   1951  O O2    . DT  A 1 96  ? 31.110  17.989 -36.386 1.00 84.83  ? 96   DT  I O2    1 
ATOM   1952  N N3    . DT  A 1 96  ? 31.663  20.173 -36.703 1.00 82.78  ? 96   DT  I N3    1 
ATOM   1953  C C4    . DT  A 1 96  ? 31.386  21.526 -36.792 1.00 82.84  ? 96   DT  I C4    1 
ATOM   1954  O O4    . DT  A 1 96  ? 32.293  22.324 -37.036 1.00 80.30  ? 96   DT  I O4    1 
ATOM   1955  C C5    . DT  A 1 96  ? 29.995  21.886 -36.578 1.00 82.74  ? 96   DT  I C5    1 
ATOM   1956  C C7    . DT  A 1 96  ? 29.589  23.322 -36.680 1.00 82.04  ? 96   DT  I C7    1 
ATOM   1957  C C6    . DT  A 1 96  ? 29.128  20.905 -36.301 1.00 84.21  ? 96   DT  I C6    1 
ATOM   1958  P P     . DG  A 1 97  ? 26.455  16.187 -32.865 1.00 118.40 ? 97   DG  I P     1 
ATOM   1959  O OP1   . DG  A 1 97  ? 25.300  15.243 -32.887 1.00 94.13  ? 97   DG  I OP1   1 
ATOM   1960  O OP2   . DG  A 1 97  ? 26.386  17.448 -32.060 1.00 92.45  ? 97   DG  I OP2   1 
ATOM   1961  O "O5'" . DG  A 1 97  ? 27.740  15.382 -32.401 1.00 116.44 ? 97   DG  I "O5'" 1 
ATOM   1962  C "C5'" . DG  A 1 97  ? 28.432  14.530 -33.295 1.00 113.99 ? 97   DG  I "C5'" 1 
ATOM   1963  C "C4'" . DG  A 1 97  ? 29.879  14.472 -32.888 1.00 111.94 ? 97   DG  I "C4'" 1 
ATOM   1964  O "O4'" . DG  A 1 97  ? 30.609  15.631 -33.350 1.00 111.42 ? 97   DG  I "O4'" 1 
ATOM   1965  C "C3'" . DG  A 1 97  ? 30.071  14.449 -31.379 1.00 109.75 ? 97   DG  I "C3'" 1 
ATOM   1966  O "O3'" . DG  A 1 97  ? 31.222  13.677 -31.182 1.00 107.72 ? 97   DG  I "O3'" 1 
ATOM   1967  C "C2'" . DG  A 1 97  ? 30.375  15.901 -31.047 1.00 110.52 ? 97   DG  I "C2'" 1 
ATOM   1968  C "C1'" . DG  A 1 97  ? 31.228  16.269 -32.244 1.00 110.63 ? 97   DG  I "C1'" 1 
ATOM   1969  N N9    . DG  A 1 97  ? 31.393  17.686 -32.569 1.00 84.89  ? 97   DG  I N9    1 
ATOM   1970  C C8    . DG  A 1 97  ? 30.474  18.701 -32.426 1.00 84.75  ? 97   DG  I C8    1 
ATOM   1971  N N7    . DG  A 1 97  ? 30.923  19.861 -32.837 1.00 83.77  ? 97   DG  I N7    1 
ATOM   1972  C C5    . DG  A 1 97  ? 32.220  19.596 -33.275 1.00 83.87  ? 97   DG  I C5    1 
ATOM   1973  C C6    . DG  A 1 97  ? 33.211  20.458 -33.847 1.00 82.69  ? 97   DG  I C6    1 
ATOM   1974  O O6    . DG  A 1 97  ? 33.149  21.666 -34.089 1.00 81.29  ? 97   DG  I O6    1 
ATOM   1975  N N1    . DG  A 1 97  ? 34.371  19.772 -34.145 1.00 81.94  ? 97   DG  I N1    1 
ATOM   1976  C C2    . DG  A 1 97  ? 34.577  18.446 -33.931 1.00 83.65  ? 97   DG  I C2    1 
ATOM   1977  N N2    . DG  A 1 97  ? 35.777  17.986 -34.287 1.00 82.30  ? 97   DG  I N2    1 
ATOM   1978  N N3    . DG  A 1 97  ? 33.681  17.629 -33.407 1.00 84.16  ? 97   DG  I N3    1 
ATOM   1979  C C4    . DG  A 1 97  ? 32.530  18.264 -33.108 1.00 84.46  ? 97   DG  I C4    1 
ATOM   1980  P P     . DG  A 1 98  ? 31.316  12.710 -29.929 1.00 93.56  ? 98   DG  I P     1 
ATOM   1981  O OP1   . DG  A 1 98  ? 30.925  11.332 -30.360 1.00 79.15  ? 98   DG  I OP1   1 
ATOM   1982  O OP2   . DG  A 1 98  ? 30.580  13.401 -28.830 1.00 79.11  ? 98   DG  I OP2   1 
ATOM   1983  O "O5'" . DG  A 1 98  ? 32.893  12.736 -29.700 1.00 92.64  ? 98   DG  I "O5'" 1 
ATOM   1984  C "C5'" . DG  A 1 98  ? 33.758  12.724 -30.845 1.00 89.61  ? 98   DG  I "C5'" 1 
ATOM   1985  C "C4'" . DG  A 1 98  ? 34.912  13.677 -30.662 1.00 88.07  ? 98   DG  I "C4'" 1 
ATOM   1986  O "O4'" . DG  A 1 98  ? 34.589  15.065 -30.923 1.00 87.57  ? 98   DG  I "O4'" 1 
ATOM   1987  C "C3'" . DG  A 1 98  ? 35.473  13.635 -29.257 1.00 87.37  ? 98   DG  I "C3'" 1 
ATOM   1988  O "O3'" . DG  A 1 98  ? 36.867  13.629 -29.370 1.00 88.22  ? 98   DG  I "O3'" 1 
ATOM   1989  C "C2'" . DG  A 1 98  ? 35.016  14.946 -28.656 1.00 87.53  ? 98   DG  I "C2'" 1 
ATOM   1990  C "C1'" . DG  A 1 98  ? 35.114  15.842 -29.866 1.00 88.03  ? 98   DG  I "C1'" 1 
ATOM   1991  N N9    . DG  A 1 98  ? 34.384  17.108 -29.800 1.00 75.68  ? 98   DG  I N9    1 
ATOM   1992  C C8    . DG  A 1 98  ? 33.186  17.358 -29.175 1.00 76.48  ? 98   DG  I C8    1 
ATOM   1993  N N7    . DG  A 1 98  ? 32.791  18.600 -29.295 1.00 76.38  ? 98   DG  I N7    1 
ATOM   1994  C C5    . DG  A 1 98  ? 33.790  19.208 -30.041 1.00 76.60  ? 98   DG  I C5    1 
ATOM   1995  C C6    . DG  A 1 98  ? 33.923  20.564 -30.498 1.00 77.39  ? 98   DG  I C6    1 
ATOM   1996  O O6    . DG  A 1 98  ? 33.159  21.520 -30.335 1.00 78.08  ? 98   DG  I O6    1 
ATOM   1997  N N1    . DG  A 1 98  ? 35.094  20.746 -31.212 1.00 77.12  ? 98   DG  I N1    1 
ATOM   1998  C C2    . DG  A 1 98  ? 36.020  19.771 -31.464 1.00 77.23  ? 98   DG  I C2    1 
ATOM   1999  N N2    . DG  A 1 98  ? 37.085  20.163 -32.157 1.00 76.92  ? 98   DG  I N2    1 
ATOM   2000  N N3    . DG  A 1 98  ? 35.914  18.510 -31.063 1.00 76.65  ? 98   DG  I N3    1 
ATOM   2001  C C4    . DG  A 1 98  ? 34.784  18.302 -30.360 1.00 76.92  ? 98   DG  I C4    1 
ATOM   2002  P P     . DA  A 1 99  ? 37.653  12.307 -28.988 1.00 99.99  ? 99   DA  I P     1 
ATOM   2003  O OP1   . DA  A 1 99  ? 37.275  11.257 -29.976 1.00 84.73  ? 99   DA  I OP1   1 
ATOM   2004  O OP2   . DA  A 1 99  ? 37.396  12.097 -27.556 1.00 84.22  ? 99   DA  I OP2   1 
ATOM   2005  O "O5'" . DA  A 1 99  ? 39.174  12.709 -29.196 1.00 98.40  ? 99   DA  I "O5'" 1 
ATOM   2006  C "C5'" . DA  A 1 99  ? 39.746  12.715 -30.498 1.00 94.24  ? 99   DA  I "C5'" 1 
ATOM   2007  C "C4'" . DA  A 1 99  ? 40.720  13.854 -30.616 1.00 92.74  ? 99   DA  I "C4'" 1 
ATOM   2008  O "O4'" . DA  A 1 99  ? 40.069  15.149 -30.594 1.00 91.37  ? 99   DA  I "O4'" 1 
ATOM   2009  C "C3'" . DA  A 1 99  ? 41.740  13.921 -29.503 1.00 90.96  ? 99   DA  I "C3'" 1 
ATOM   2010  O "O3'" . DA  A 1 99  ? 42.696  14.679 -30.179 1.00 89.94  ? 99   DA  I "O3'" 1 
ATOM   2011  C "C2'" . DA  A 1 99  ? 41.028  14.809 -28.490 1.00 90.53  ? 99   DA  I "C2'" 1 
ATOM   2012  C "C1'" . DA  A 1 99  ? 40.481  15.872 -29.440 1.00 90.29  ? 99   DA  I "C1'" 1 
ATOM   2013  N N9    . DA  A 1 99  ? 39.331  16.639 -28.974 1.00 73.93  ? 99   DA  I N9    1 
ATOM   2014  C C8    . DA  A 1 99  ? 38.208  16.119 -28.388 1.00 73.70  ? 99   DA  I C8    1 
ATOM   2015  N N7    . DA  A 1 99  ? 37.301  17.017 -28.077 1.00 73.24  ? 99   DA  I N7    1 
ATOM   2016  C C5    . DA  A 1 99  ? 37.864  18.215 -28.483 1.00 73.09  ? 99   DA  I C5    1 
ATOM   2017  C C6    . DA  A 1 99  ? 37.388  19.542 -28.436 1.00 72.81  ? 99   DA  I C6    1 
ATOM   2018  N N6    . DA  A 1 99  ? 36.188  19.885 -27.956 1.00 72.24  ? 99   DA  I N6    1 
ATOM   2019  N N1    . DA  A 1 99  ? 38.196  20.514 -28.913 1.00 71.73  ? 99   DA  I N1    1 
ATOM   2020  C C2    . DA  A 1 99  ? 39.392  20.162 -29.410 1.00 72.28  ? 99   DA  I C2    1 
ATOM   2021  N N3    . DA  A 1 99  ? 39.945  18.944 -29.521 1.00 72.74  ? 99   DA  I N3    1 
ATOM   2022  C C4    . DA  A 1 99  ? 39.120  18.000 -29.033 1.00 73.19  ? 99   DA  I C4    1 
ATOM   2023  P P     . DG  A 1 100 ? 44.221  14.235 -30.281 1.00 78.04  ? 100  DG  I P     1 
ATOM   2024  O OP1   . DG  A 1 100 ? 44.352  13.763 -31.683 1.00 73.07  ? 100  DG  I OP1   1 
ATOM   2025  O OP2   . DG  A 1 100 ? 44.667  13.383 -29.148 1.00 71.17  ? 100  DG  I OP2   1 
ATOM   2026  O "O5'" . DG  A 1 100 ? 44.748  15.712 -30.102 1.00 73.61  ? 100  DG  I "O5'" 1 
ATOM   2027  C "C5'" . DG  A 1 100 ? 43.691  16.649 -29.931 1.00 68.61  ? 100  DG  I "C5'" 1 
ATOM   2028  C "C4'" . DG  A 1 100 ? 44.148  18.022 -29.552 1.00 62.66  ? 100  DG  I "C4'" 1 
ATOM   2029  O "O4'" . DG  A 1 100 ? 42.988  18.561 -28.871 1.00 62.00  ? 100  DG  I "O4'" 1 
ATOM   2030  C "C3'" . DG  A 1 100 ? 45.285  18.104 -28.550 1.00 61.73  ? 100  DG  I "C3'" 1 
ATOM   2031  O "O3'" . DG  A 1 100 ? 45.815  19.422 -28.703 1.00 56.79  ? 100  DG  I "O3'" 1 
ATOM   2032  C "C2'" . DG  A 1 100 ? 44.550  17.980 -27.229 1.00 59.16  ? 100  DG  I "C2'" 1 
ATOM   2033  C "C1'" . DG  A 1 100 ? 43.302  18.807 -27.511 1.00 63.34  ? 100  DG  I "C1'" 1 
ATOM   2034  N N9    . DG  A 1 100 ? 42.119  18.530 -26.680 1.00 57.58  ? 100  DG  I N9    1 
ATOM   2035  C C8    . DG  A 1 100 ? 41.755  17.327 -26.121 1.00 57.43  ? 100  DG  I C8    1 
ATOM   2036  N N7    . DG  A 1 100 ? 40.654  17.398 -25.419 1.00 58.66  ? 100  DG  I N7    1 
ATOM   2037  C C5    . DG  A 1 100 ? 40.262  18.719 -25.527 1.00 60.69  ? 100  DG  I C5    1 
ATOM   2038  C C6    . DG  A 1 100 ? 39.142  19.380 -24.988 1.00 61.14  ? 100  DG  I C6    1 
ATOM   2039  O O6    . DG  A 1 100 ? 38.227  18.908 -24.309 1.00 63.29  ? 100  DG  I O6    1 
ATOM   2040  N N1    . DG  A 1 100 ? 39.135  20.733 -25.315 1.00 62.80  ? 100  DG  I N1    1 
ATOM   2041  C C2    . DG  A 1 100 ? 40.088  21.367 -26.074 1.00 62.13  ? 100  DG  I C2    1 
ATOM   2042  N N2    . DG  A 1 100 ? 39.927  22.699 -26.250 1.00 61.45  ? 100  DG  I N2    1 
ATOM   2043  N N3    . DG  A 1 100 ? 41.130  20.747 -26.611 1.00 61.08  ? 100  DG  I N3    1 
ATOM   2044  C C4    . DG  A 1 100 ? 41.157  19.439 -26.295 1.00 59.64  ? 100  DG  I C4    1 
ATOM   2045  P P     . DC  A 1 101 ? 47.391  19.676 -28.714 1.00 51.64  ? 101  DC  I P     1 
ATOM   2046  O OP1   . DC  A 1 101 ? 47.895  19.419 -30.095 1.00 54.81  ? 101  DC  I OP1   1 
ATOM   2047  O OP2   . DC  A 1 101 ? 48.027  18.995 -27.563 1.00 53.10  ? 101  DC  I OP2   1 
ATOM   2048  O "O5'" . DC  A 1 101 ? 47.447  21.232 -28.444 1.00 56.15  ? 101  DC  I "O5'" 1 
ATOM   2049  C "C5'" . DC  A 1 101 ? 46.952  22.114 -29.426 1.00 60.48  ? 101  DC  I "C5'" 1 
ATOM   2050  C "C4'" . DC  A 1 101 ? 46.114  23.190 -28.787 1.00 65.52  ? 101  DC  I "C4'" 1 
ATOM   2051  O "O4'" . DC  A 1 101 ? 45.054  22.587 -28.005 1.00 65.43  ? 101  DC  I "O4'" 1 
ATOM   2052  C "C3'" . DC  A 1 101 ? 46.857  24.136 -27.841 1.00 68.66  ? 101  DC  I "C3'" 1 
ATOM   2053  O "O3'" . DC  A 1 101 ? 46.425  25.473 -28.106 1.00 73.43  ? 101  DC  I "O3'" 1 
ATOM   2054  C "C2'" . DC  A 1 101 ? 46.411  23.684 -26.460 1.00 67.47  ? 101  DC  I "C2'" 1 
ATOM   2055  C "C1'" . DC  A 1 101 ? 45.004  23.204 -26.730 1.00 66.42  ? 101  DC  I "C1'" 1 
ATOM   2056  N N1    . DC  A 1 101 ? 44.464  22.226 -25.776 1.00 68.04  ? 101  DC  I N1    1 
ATOM   2057  C C2    . DC  A 1 101 ? 43.433  22.626 -24.924 1.00 68.33  ? 101  DC  I C2    1 
ATOM   2058  O O2    . DC  A 1 101 ? 43.064  23.810 -24.945 1.00 67.31  ? 101  DC  I O2    1 
ATOM   2059  N N3    . DC  A 1 101 ? 42.866  21.717 -24.100 1.00 67.33  ? 101  DC  I N3    1 
ATOM   2060  C C4    . DC  A 1 101 ? 43.287  20.450 -24.113 1.00 68.07  ? 101  DC  I C4    1 
ATOM   2061  N N4    . DC  A 1 101 ? 42.640  19.565 -23.345 1.00 69.80  ? 101  DC  I N4    1 
ATOM   2062  C C5    . DC  A 1 101 ? 44.373  20.029 -24.929 1.00 67.94  ? 101  DC  I C5    1 
ATOM   2063  C C6    . DC  A 1 101 ? 44.930  20.942 -25.739 1.00 68.97  ? 101  DC  I C6    1 
ATOM   2064  P P     . DA  A 1 102 ? 47.235  26.707 -27.502 1.00 86.67  ? 102  DA  I P     1 
ATOM   2065  O OP1   . DA  A 1 102 ? 46.876  27.890 -28.313 1.00 75.23  ? 102  DA  I OP1   1 
ATOM   2066  O OP2   . DA  A 1 102 ? 48.652  26.323 -27.339 1.00 77.39  ? 102  DA  I OP2   1 
ATOM   2067  O "O5'" . DA  A 1 102 ? 46.584  26.874 -26.065 1.00 86.28  ? 102  DA  I "O5'" 1 
ATOM   2068  C "C5'" . DA  A 1 102 ? 45.272  27.403 -25.935 1.00 86.63  ? 102  DA  I "C5'" 1 
ATOM   2069  C "C4'" . DA  A 1 102 ? 44.942  27.626 -24.480 1.00 86.66  ? 102  DA  I "C4'" 1 
ATOM   2070  O "O4'" . DA  A 1 102 ? 44.578  26.376 -23.860 1.00 84.21  ? 102  DA  I "O4'" 1 
ATOM   2071  C "C3'" . DA  A 1 102 ? 46.061  28.220 -23.623 1.00 86.03  ? 102  DA  I "C3'" 1 
ATOM   2072  O "O3'" . DA  A 1 102 ? 45.459  29.194 -22.774 1.00 88.00  ? 102  DA  I "O3'" 1 
ATOM   2073  C "C2'" . DA  A 1 102 ? 46.576  27.017 -22.840 1.00 84.12  ? 102  DA  I "C2'" 1 
ATOM   2074  C "C1'" . DA  A 1 102 ? 45.309  26.211 -22.661 1.00 82.99  ? 102  DA  I "C1'" 1 
ATOM   2075  N N9    . DA  A 1 102 ? 45.451  24.779 -22.433 1.00 71.37  ? 102  DA  I N9    1 
ATOM   2076  C C8    . DA  A 1 102 ? 46.403  23.896 -22.878 1.00 72.27  ? 102  DA  I C8    1 
ATOM   2077  N N7    . DA  A 1 102 ? 46.180  22.651 -22.517 1.00 69.76  ? 102  DA  I N7    1 
ATOM   2078  C C5    . DA  A 1 102 ? 45.008  22.726 -21.772 1.00 69.09  ? 102  DA  I C5    1 
ATOM   2079  C C6    . DA  A 1 102 ? 44.234  21.752 -21.102 1.00 67.35  ? 102  DA  I C6    1 
ATOM   2080  N N6    . DA  A 1 102 ? 44.533  20.449 -21.070 1.00 65.30  ? 102  DA  I N6    1 
ATOM   2081  N N1    . DA  A 1 102 ? 43.126  22.171 -20.453 1.00 66.35  ? 102  DA  I N1    1 
ATOM   2082  C C2    . DA  A 1 102 ? 42.818  23.469 -20.474 1.00 65.93  ? 102  DA  I C2    1 
ATOM   2083  N N3    . DA  A 1 102 ? 43.457  24.476 -21.063 1.00 67.95  ? 102  DA  I N3    1 
ATOM   2084  C C4    . DA  A 1 102 ? 44.557  24.033 -21.704 1.00 69.56  ? 102  DA  I C4    1 
ATOM   2085  P P     . DG  A 1 103 ? 46.357  30.047 -21.758 1.00 77.93  ? 103  DG  I P     1 
ATOM   2086  O OP1   . DG  A 1 103 ? 46.450  31.410 -22.331 1.00 74.26  ? 103  DG  I OP1   1 
ATOM   2087  O OP2   . DG  A 1 103 ? 47.600  29.318 -21.356 1.00 71.67  ? 103  DG  I OP2   1 
ATOM   2088  O "O5'" . DG  A 1 103 ? 45.401  30.116 -20.489 1.00 79.19  ? 103  DG  I "O5'" 1 
ATOM   2089  C "C5'" . DG  A 1 103 ? 44.003  30.381 -20.650 1.00 79.42  ? 103  DG  I "C5'" 1 
ATOM   2090  C "C4'" . DG  A 1 103 ? 43.249  29.966 -19.412 1.00 81.52  ? 103  DG  I "C4'" 1 
ATOM   2091  O "O4'" . DG  A 1 103 ? 43.254  28.526 -19.335 1.00 81.02  ? 103  DG  I "O4'" 1 
ATOM   2092  C "C3'" . DG  A 1 103 ? 43.881  30.458 -18.113 1.00 83.54  ? 103  DG  I "C3'" 1 
ATOM   2093  O "O3'" . DG  A 1 103 ? 42.880  30.871 -17.185 1.00 88.56  ? 103  DG  I "O3'" 1 
ATOM   2094  C "C2'" . DG  A 1 103 ? 44.626  29.242 -17.595 1.00 82.11  ? 103  DG  I "C2'" 1 
ATOM   2095  C "C1'" . DG  A 1 103 ? 43.760  28.109 -18.087 1.00 81.52  ? 103  DG  I "C1'" 1 
ATOM   2096  N N9    . DG  A 1 103 ? 44.485  26.873 -18.312 1.00 77.89  ? 103  DG  I N9    1 
ATOM   2097  C C8    . DG  A 1 103 ? 45.524  26.674 -19.184 1.00 77.17  ? 103  DG  I C8    1 
ATOM   2098  N N7    . DG  A 1 103 ? 45.968  25.447 -19.179 1.00 77.25  ? 103  DG  I N7    1 
ATOM   2099  C C5    . DG  A 1 103 ? 45.168  24.800 -18.248 1.00 78.14  ? 103  DG  I C5    1 
ATOM   2100  C C6    . DG  A 1 103 ? 45.160  23.439 -17.820 1.00 79.18  ? 103  DG  I C6    1 
ATOM   2101  O O6    . DG  A 1 103 ? 45.859  22.494 -18.225 1.00 79.38  ? 103  DG  I O6    1 
ATOM   2102  N N1    . DG  A 1 103 ? 44.202  23.222 -16.831 1.00 80.62  ? 103  DG  I N1    1 
ATOM   2103  C C2    . DG  A 1 103 ? 43.346  24.180 -16.338 1.00 81.62  ? 103  DG  I C2    1 
ATOM   2104  N N2    . DG  A 1 103 ? 42.512  23.789 -15.371 1.00 82.40  ? 103  DG  I N2    1 
ATOM   2105  N N3    . DG  A 1 103 ? 43.318  25.435 -16.758 1.00 80.34  ? 103  DG  I N3    1 
ATOM   2106  C C4    . DG  A 1 103 ? 44.254  25.674 -17.699 1.00 78.40  ? 103  DG  I C4    1 
ATOM   2107  P P     . DT  A 1 104 ? 43.322  31.483 -15.772 1.00 100.65 ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 104 ? 42.299  32.471 -15.342 1.00 81.01  ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 104 ? 44.746  31.894 -15.883 1.00 81.42  ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 104 ? 43.251  30.225 -14.806 1.00 104.04 ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 104 ? 41.999  29.642 -14.471 1.00 106.68 ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 104 ? 42.140  28.811 -13.220 1.00 108.17 ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 104 ? 42.724  27.523 -13.538 1.00 106.95 ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 104 ? 43.052  29.454 -12.176 1.00 109.44 ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 104 ? 42.500  29.290 -10.867 1.00 112.65 ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 104 ? 44.360  28.698 -12.339 1.00 107.67 ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 104 ? 43.894  27.315 -12.766 1.00 106.40 ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 104 ? 44.862  26.566 -13.596 1.00 83.85  ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 104 ? 44.988  25.207 -13.387 1.00 83.61  ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 104 ? 44.333  24.596 -12.567 1.00 84.26  ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 104 ? 45.913  24.584 -14.186 1.00 83.40  ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 104 ? 46.701  25.165 -15.158 1.00 81.99  ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 104 ? 47.482  24.476 -15.798 1.00 81.75  ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 104 ? 46.515  26.587 -15.334 1.00 81.79  ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 104 ? 47.318  27.297 -16.378 1.00 80.55  ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 104 ? 45.620  27.211 -14.551 1.00 83.00  ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 105 ? 43.330  29.777 -9.578  1.00 108.77 ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 105 ? 42.354  30.457 -8.694  1.00 105.47 ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 105 ? 44.570  30.494 -9.983  1.00 105.82 ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 105 ? 43.743  28.398 -8.907  1.00 108.93 ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 105 ? 42.805  27.337 -8.838  1.00 110.31 ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 105 ? 43.477  26.086 -8.331  1.00 111.27 ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 105 ? 44.331  25.544 -9.365  1.00 110.38 ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 105 ? 44.372  26.318 -7.111  1.00 111.99 ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 105 ? 44.237  25.237 -6.180  1.00 113.89 ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 105 ? 45.769  26.340 -7.705  1.00 110.55 ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 105 ? 45.633  25.346 -8.843  1.00 108.76 ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 105 ? 46.594  25.534 -9.938  1.00 102.31 ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 105 ? 47.304  24.438 -10.370 1.00 101.08 ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 105 ? 47.180  23.328 -9.878  1.00 100.72 ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 105 ? 48.172  24.691 -11.402 1.00 99.24  ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 105 ? 48.396  25.903 -12.029 1.00 98.11  ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 105 ? 49.207  25.974 -12.951 1.00 96.88  ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 105 ? 47.619  27.015 -11.518 1.00 98.31  ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 105 ? 47.797  28.371 -12.126 1.00 97.12  ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 105 ? 46.768  26.775 -10.513 1.00 100.23 ? 105  DT  I C6    1 
ATOM   2147  P P     . DT  A 1 106 ? 44.875  25.365 -4.712  1.00 144.07 ? 106  DT  I P     1 
ATOM   2148  O OP1   . DT  A 1 106 ? 43.785  25.182 -3.726  1.00 106.02 ? 106  DT  I OP1   1 
ATOM   2149  O OP2   . DT  A 1 106 ? 45.716  26.586 -4.657  1.00 105.31 ? 106  DT  I OP2   1 
ATOM   2150  O "O5'" . DT  A 1 106 ? 45.814  24.089 -4.635  1.00 144.10 ? 106  DT  I "O5'" 1 
ATOM   2151  C "C5'" . DT  A 1 106 ? 45.343  22.831 -5.095  1.00 143.61 ? 106  DT  I "C5'" 1 
ATOM   2152  C "C4'" . DT  A 1 106 ? 46.492  21.861 -5.207  1.00 143.24 ? 106  DT  I "C4'" 1 
ATOM   2153  O "O4'" . DT  A 1 106 ? 47.274  22.121 -6.401  1.00 143.27 ? 106  DT  I "O4'" 1 
ATOM   2154  C "C3'" . DT  A 1 106 ? 47.467  21.940 -4.034  1.00 142.88 ? 106  DT  I "C3'" 1 
ATOM   2155  O "O3'" . DT  A 1 106 ? 47.833  20.624 -3.619  1.00 142.54 ? 106  DT  I "O3'" 1 
ATOM   2156  C "C2'" . DT  A 1 106 ? 48.662  22.684 -4.611  1.00 142.70 ? 106  DT  I "C2'" 1 
ATOM   2157  C "C1'" . DT  A 1 106 ? 48.650  22.208 -6.053  1.00 141.85 ? 106  DT  I "C1'" 1 
ATOM   2158  N N1    . DT  A 1 106 ? 49.340  23.081 -7.044  1.00 101.98 ? 106  DT  I N1    1 
ATOM   2159  C C2    . DT  A 1 106 ? 50.207  22.477 -7.944  1.00 100.92 ? 106  DT  I C2    1 
ATOM   2160  O O2    . DT  A 1 106 ? 50.407  21.267 -7.973  1.00 99.93  ? 106  DT  I O2    1 
ATOM   2161  N N3    . DT  A 1 106 ? 50.826  23.346 -8.817  1.00 99.55  ? 106  DT  I N3    1 
ATOM   2162  C C4    . DT  A 1 106 ? 50.658  24.720 -8.894  1.00 99.22  ? 106  DT  I C4    1 
ATOM   2163  O O4    . DT  A 1 106 ? 51.281  25.372 -9.732  1.00 98.58  ? 106  DT  I O4    1 
ATOM   2164  C C5    . DT  A 1 106 ? 49.726  25.282 -7.938  1.00 99.35  ? 106  DT  I C5    1 
ATOM   2165  C C7    . DT  A 1 106 ? 49.467  26.755 -7.966  1.00 98.94  ? 106  DT  I C7    1 
ATOM   2166  C C6    . DT  A 1 106 ? 49.125  24.448 -7.069  1.00 100.38 ? 106  DT  I C6    1 
ATOM   2167  P P     . DC  A 1 107 ? 48.806  20.434 -2.360  1.00 129.74 ? 107  DC  I P     1 
ATOM   2168  O OP1   . DC  A 1 107 ? 48.469  19.132 -1.721  1.00 108.34 ? 107  DC  I OP1   1 
ATOM   2169  O OP2   . DC  A 1 107 ? 48.770  21.686 -1.556  1.00 106.91 ? 107  DC  I OP2   1 
ATOM   2170  O "O5'" . DC  A 1 107 ? 50.239  20.313 -3.037  1.00 128.80 ? 107  DC  I "O5'" 1 
ATOM   2171  C "C5'" . DC  A 1 107 ? 50.530  19.245 -3.931  1.00 128.14 ? 107  DC  I "C5'" 1 
ATOM   2172  C "C4'" . DC  A 1 107 ? 52.005  19.231 -4.245  1.00 127.77 ? 107  DC  I "C4'" 1 
ATOM   2173  O "O4'" . DC  A 1 107 ? 52.327  20.307 -5.157  1.00 127.25 ? 107  DC  I "O4'" 1 
ATOM   2174  C "C3'" . DC  A 1 107 ? 52.879  19.444 -3.012  1.00 126.94 ? 107  DC  I "C3'" 1 
ATOM   2175  O "O3'" . DC  A 1 107 ? 54.060  18.664 -3.124  1.00 125.74 ? 107  DC  I "O3'" 1 
ATOM   2176  C "C2'" . DC  A 1 107 ? 53.233  20.915 -3.088  1.00 127.02 ? 107  DC  I "C2'" 1 
ATOM   2177  C "C1'" . DC  A 1 107 ? 53.344  21.118 -4.589  1.00 125.98 ? 107  DC  I "C1'" 1 
ATOM   2178  N N1    . DC  A 1 107 ? 53.152  22.501 -5.064  1.00 102.30 ? 107  DC  I N1    1 
ATOM   2179  C C2    . DC  A 1 107 ? 53.504  22.804 -6.376  1.00 100.63 ? 107  DC  I C2    1 
ATOM   2180  O O2    . DC  A 1 107 ? 53.966  21.900 -7.086  1.00 99.12  ? 107  DC  I O2    1 
ATOM   2181  N N3    . DC  A 1 107 ? 53.338  24.069 -6.835  1.00 99.12  ? 107  DC  I N3    1 
ATOM   2182  C C4    . DC  A 1 107 ? 52.844  25.011 -6.026  1.00 99.72  ? 107  DC  I C4    1 
ATOM   2183  N N4    . DC  A 1 107 ? 52.694  26.245 -6.512  1.00 98.43  ? 107  DC  I N4    1 
ATOM   2184  C C5    . DC  A 1 107 ? 52.480  24.730 -4.679  1.00 100.76 ? 107  DC  I C5    1 
ATOM   2185  C C6    . DC  A 1 107 ? 52.644  23.472 -4.243  1.00 101.44 ? 107  DC  I C6    1 
ATOM   2186  P P     . DC  A 1 108 ? 54.450  17.670 -1.941  1.00 115.15 ? 108  DC  I P     1 
ATOM   2187  O OP1   . DC  A 1 108 ? 53.411  16.609 -1.902  1.00 97.82  ? 108  DC  I OP1   1 
ATOM   2188  O OP2   . DC  A 1 108 ? 54.698  18.518 -0.752  1.00 96.04  ? 108  DC  I OP2   1 
ATOM   2189  O "O5'" . DC  A 1 108 ? 55.819  17.014 -2.407  1.00 113.29 ? 108  DC  I "O5'" 1 
ATOM   2190  C "C5'" . DC  A 1 108 ? 55.852  16.150 -3.535  1.00 109.54 ? 108  DC  I "C5'" 1 
ATOM   2191  C "C4'" . DC  A 1 108 ? 56.995  16.531 -4.445  1.00 106.74 ? 108  DC  I "C4'" 1 
ATOM   2192  O "O4'" . DC  A 1 108 ? 56.800  17.880 -4.929  1.00 105.25 ? 108  DC  I "O4'" 1 
ATOM   2193  C "C3'" . DC  A 1 108 ? 58.372  16.532 -3.783  1.00 104.79 ? 108  DC  I "C3'" 1 
ATOM   2194  O "O3'" . DC  A 1 108 ? 59.323  16.100 -4.746  1.00 102.22 ? 108  DC  I "O3'" 1 
ATOM   2195  C "C2'" . DC  A 1 108 ? 58.610  17.999 -3.477  1.00 104.49 ? 108  DC  I "C2'" 1 
ATOM   2196  C "C1'" . DC  A 1 108 ? 57.982  18.617 -4.698  1.00 105.50 ? 108  DC  I "C1'" 1 
ATOM   2197  N N1    . DC  A 1 108 ? 57.632  20.036 -4.629  1.00 86.95  ? 108  DC  I N1    1 
ATOM   2198  C C2    . DC  A 1 108 ? 58.039  20.847 -5.677  1.00 86.35  ? 108  DC  I C2    1 
ATOM   2199  O O2    . DC  A 1 108 ? 58.661  20.325 -6.622  1.00 86.07  ? 108  DC  I O2    1 
ATOM   2200  N N3    . DC  A 1 108 ? 57.748  22.168 -5.651  1.00 86.19  ? 108  DC  I N3    1 
ATOM   2201  C C4    . DC  A 1 108 ? 57.068  22.674 -4.630  1.00 86.17  ? 108  DC  I C4    1 
ATOM   2202  N N4    . DC  A 1 108 ? 56.806  23.981 -4.645  1.00 85.43  ? 108  DC  I N4    1 
ATOM   2203  C C5    . DC  A 1 108 ? 56.626  21.863 -3.547  1.00 86.64  ? 108  DC  I C5    1 
ATOM   2204  C C6    . DC  A 1 108 ? 56.932  20.558 -3.584  1.00 86.98  ? 108  DC  I C6    1 
ATOM   2205  P P     . DA  A 1 109 ? 60.053  14.692 -4.558  1.00 95.29  ? 109  DA  I P     1 
ATOM   2206  O OP1   . DA  A 1 109 ? 59.054  13.609 -4.760  1.00 93.47  ? 109  DA  I OP1   1 
ATOM   2207  O OP2   . DA  A 1 109 ? 60.806  14.775 -3.285  1.00 94.31  ? 109  DA  I OP2   1 
ATOM   2208  O "O5'" . DA  A 1 109 ? 61.079  14.653 -5.773  1.00 94.86  ? 109  DA  I "O5'" 1 
ATOM   2209  C "C5'" . DA  A 1 109 ? 60.608  14.549 -7.113  1.00 91.69  ? 109  DA  I "C5'" 1 
ATOM   2210  C "C4'" . DA  A 1 109 ? 61.402  15.461 -8.017  1.00 90.11  ? 109  DA  I "C4'" 1 
ATOM   2211  O "O4'" . DA  A 1 109 ? 61.165  16.842 -7.667  1.00 88.39  ? 109  DA  I "O4'" 1 
ATOM   2212  C "C3'" . DA  A 1 109 ? 62.914  15.279 -7.962  1.00 89.53  ? 109  DA  I "C3'" 1 
ATOM   2213  O "O3'" . DA  A 1 109 ? 63.419  15.500 -9.277  1.00 88.58  ? 109  DA  I "O3'" 1 
ATOM   2214  C "C2'" . DA  A 1 109 ? 63.364  16.363 -6.998  1.00 88.17  ? 109  DA  I "C2'" 1 
ATOM   2215  C "C1'" . DA  A 1 109 ? 62.372  17.478 -7.273  1.00 87.89  ? 109  DA  I "C1'" 1 
ATOM   2216  N N9    . DA  A 1 109 ? 62.045  18.324 -6.130  1.00 85.80  ? 109  DA  I N9    1 
ATOM   2217  C C8    . DA  A 1 109 ? 61.870  17.951 -4.821  1.00 86.38  ? 109  DA  I C8    1 
ATOM   2218  N N7    . DA  A 1 109 ? 61.493  18.933 -4.039  1.00 86.54  ? 109  DA  I N7    1 
ATOM   2219  C C5    . DA  A 1 109 ? 61.432  20.033 -4.888  1.00 85.43  ? 109  DA  I C5    1 
ATOM   2220  C C6    . DA  A 1 109 ? 61.067  21.385 -4.678  1.00 84.86  ? 109  DA  I C6    1 
ATOM   2221  N N6    . DA  A 1 109 ? 60.662  21.876 -3.505  1.00 83.32  ? 109  DA  I N6    1 
ATOM   2222  N N1    . DA  A 1 109 ? 61.121  22.220 -5.736  1.00 84.56  ? 109  DA  I N1    1 
ATOM   2223  C C2    . DA  A 1 109 ? 61.497  21.726 -6.918  1.00 84.69  ? 109  DA  I C2    1 
ATOM   2224  N N3    . DA  A 1 109 ? 61.846  20.479 -7.244  1.00 85.24  ? 109  DA  I N3    1 
ATOM   2225  C C4    . DA  A 1 109 ? 61.791  19.673 -6.171  1.00 85.48  ? 109  DA  I C4    1 
ATOM   2226  P P     . DA  A 1 110 ? 64.993  15.512 -9.529  1.00 101.35 ? 110  DA  I P     1 
ATOM   2227  O OP1   . DA  A 1 110 ? 65.206  14.807 -10.814 1.00 88.15  ? 110  DA  I OP1   1 
ATOM   2228  O OP2   . DA  A 1 110 ? 65.693  15.052 -8.297  1.00 87.87  ? 110  DA  I OP2   1 
ATOM   2229  O "O5'" . DA  A 1 110 ? 65.310  17.049 -9.766  1.00 101.64 ? 110  DA  I "O5'" 1 
ATOM   2230  C "C5'" . DA  A 1 110 ? 64.618  17.777 -10.771 1.00 98.64  ? 110  DA  I "C5'" 1 
ATOM   2231  C "C4'" . DA  A 1 110 ? 65.044  19.225 -10.750 1.00 98.13  ? 110  DA  I "C4'" 1 
ATOM   2232  O "O4'" . DA  A 1 110 ? 64.522  19.899 -9.582  1.00 98.38  ? 110  DA  I "O4'" 1 
ATOM   2233  C "C3'" . DA  A 1 110 ? 66.554  19.447 -10.713 1.00 98.00  ? 110  DA  I "C3'" 1 
ATOM   2234  O "O3'" . DA  A 1 110 ? 66.820  20.639 -11.432 1.00 97.01  ? 110  DA  I "O3'" 1 
ATOM   2235  C "C2'" . DA  A 1 110 ? 66.823  19.700 -9.244  1.00 97.84  ? 110  DA  I "C2'" 1 
ATOM   2236  C "C1'" . DA  A 1 110 ? 65.597  20.506 -8.881  1.00 97.49  ? 110  DA  I "C1'" 1 
ATOM   2237  N N9    . DA  A 1 110 ? 65.260  20.519 -7.462  1.00 82.87  ? 110  DA  I N9    1 
ATOM   2238  C C8    . DA  A 1 110 ? 65.266  19.473 -6.581  1.00 83.21  ? 110  DA  I C8    1 
ATOM   2239  N N7    . DA  A 1 110 ? 64.896  19.803 -5.370  1.00 83.48  ? 110  DA  I N7    1 
ATOM   2240  C C5    . DA  A 1 110 ? 64.638  21.159 -5.461  1.00 83.51  ? 110  DA  I C5    1 
ATOM   2241  C C6    . DA  A 1 110 ? 64.208  22.097 -4.519  1.00 83.43  ? 110  DA  I C6    1 
ATOM   2242  N N6    . DA  A 1 110 ? 63.949  21.783 -3.246  1.00 83.65  ? 110  DA  I N6    1 
ATOM   2243  N N1    . DA  A 1 110 ? 64.043  23.379 -4.930  1.00 82.31  ? 110  DA  I N1    1 
ATOM   2244  C C2    . DA  A 1 110 ? 64.290  23.673 -6.208  1.00 82.09  ? 110  DA  I C2    1 
ATOM   2245  N N3    . DA  A 1 110 ? 64.698  22.873 -7.189  1.00 82.34  ? 110  DA  I N3    1 
ATOM   2246  C C4    . DA  A 1 110 ? 64.857  21.615 -6.742  1.00 82.58  ? 110  DA  I C4    1 
ATOM   2247  P P     . DA  A 1 111 ? 68.279  20.914 -12.028 1.00 85.44  ? 111  DA  I P     1 
ATOM   2248  O OP1   . DA  A 1 111 ? 68.265  20.434 -13.432 1.00 65.67  ? 111  DA  I OP1   1 
ATOM   2249  O OP2   . DA  A 1 111 ? 69.340  20.446 -11.100 1.00 66.63  ? 111  DA  I OP2   1 
ATOM   2250  O "O5'" . DA  A 1 111 ? 68.311  22.501 -12.022 1.00 83.52  ? 111  DA  I "O5'" 1 
ATOM   2251  C "C5'" . DA  A 1 111 ? 67.114  23.243 -12.226 1.00 80.92  ? 111  DA  I "C5'" 1 
ATOM   2252  C "C4'" . DA  A 1 111 ? 67.173  24.536 -11.450 1.00 80.58  ? 111  DA  I "C4'" 1 
ATOM   2253  O "O4'" . DA  A 1 111 ? 66.690  24.334 -10.096 1.00 81.10  ? 111  DA  I "O4'" 1 
ATOM   2254  C "C3'" . DA  A 1 111 ? 68.601  25.071 -11.336 1.00 77.96  ? 111  DA  I "C3'" 1 
ATOM   2255  O "O3'" . DA  A 1 111 ? 68.680  26.469 -11.571 1.00 73.62  ? 111  DA  I "O3'" 1 
ATOM   2256  C "C2'" . DA  A 1 111 ? 68.976  24.767 -9.902  1.00 80.59  ? 111  DA  I "C2'" 1 
ATOM   2257  C "C1'" . DA  A 1 111 ? 67.645  24.807 -9.169  1.00 82.18  ? 111  DA  I "C1'" 1 
ATOM   2258  N N9    . DA  A 1 111 ? 67.636  23.921 -8.002  1.00 65.31  ? 111  DA  I N9    1 
ATOM   2259  C C8    . DA  A 1 111 ? 67.888  22.571 -7.965  1.00 65.42  ? 111  DA  I C8    1 
ATOM   2260  N N7    . DA  A 1 111 ? 67.877  22.062 -6.755  1.00 67.00  ? 111  DA  I N7    1 
ATOM   2261  C C5    . DA  A 1 111 ? 67.580  23.147 -5.941  1.00 66.14  ? 111  DA  I C5    1 
ATOM   2262  C C6    . DA  A 1 111 ? 67.413  23.271 -4.553  1.00 66.27  ? 111  DA  I C6    1 
ATOM   2263  N N6    . DA  A 1 111 ? 67.536  22.261 -3.702  1.00 64.72  ? 111  DA  I N6    1 
ATOM   2264  N N1    . DA  A 1 111 ? 67.110  24.487 -4.061  1.00 66.16  ? 111  DA  I N1    1 
ATOM   2265  C C2    . DA  A 1 111 ? 66.986  25.507 -4.909  1.00 67.07  ? 111  DA  I C2    1 
ATOM   2266  N N3    . DA  A 1 111 ? 67.119  25.521 -6.235  1.00 65.98  ? 111  DA  I N3    1 
ATOM   2267  C C4    . DA  A 1 111 ? 67.419  24.294 -6.696  1.00 65.58  ? 111  DA  I C4    1 
ATOM   2268  P P     . DT  A 1 112 ? 70.102  27.193 -11.498 1.00 64.44  ? 112  DT  I P     1 
ATOM   2269  O OP1   . DT  A 1 112 ? 70.362  27.987 -12.719 1.00 58.06  ? 112  DT  I OP1   1 
ATOM   2270  O OP2   . DT  A 1 112 ? 71.054  26.153 -11.113 1.00 56.14  ? 112  DT  I OP2   1 
ATOM   2271  O "O5'" . DT  A 1 112 ? 69.891  28.208 -10.296 1.00 68.27  ? 112  DT  I "O5'" 1 
ATOM   2272  C "C5'" . DT  A 1 112 ? 68.757  29.081 -10.297 1.00 76.17  ? 112  DT  I "C5'" 1 
ATOM   2273  C "C4'" . DT  A 1 112 ? 68.752  29.968 -9.074  1.00 80.13  ? 112  DT  I "C4'" 1 
ATOM   2274  O "O4'" . DT  A 1 112 ? 68.538  29.179 -7.878  1.00 80.22  ? 112  DT  I "O4'" 1 
ATOM   2275  C "C3'" . DT  A 1 112 ? 70.040  30.751 -8.841  1.00 83.26  ? 112  DT  I "C3'" 1 
ATOM   2276  O "O3'" . DT  A 1 112 ? 69.710  32.050 -8.352  1.00 88.98  ? 112  DT  I "O3'" 1 
ATOM   2277  C "C2'" . DT  A 1 112 ? 70.767  29.932 -7.788  1.00 83.27  ? 112  DT  I "C2'" 1 
ATOM   2278  C "C1'" . DT  A 1 112 ? 69.621  29.351 -6.974  1.00 81.63  ? 112  DT  I "C1'" 1 
ATOM   2279  N N1    . DT  A 1 112 ? 69.903  28.039 -6.369  1.00 71.51  ? 112  DT  I N1    1 
ATOM   2280  C C2    . DT  A 1 112 ? 69.815  27.928 -4.994  1.00 71.56  ? 112  DT  I C2    1 
ATOM   2281  O O2    . DT  A 1 112 ? 69.584  28.879 -4.258  1.00 71.44  ? 112  DT  I O2    1 
ATOM   2282  N N3    . DT  A 1 112 ? 70.023  26.655 -4.510  1.00 70.87  ? 112  DT  I N3    1 
ATOM   2283  C C4    . DT  A 1 112 ? 70.322  25.521 -5.244  1.00 70.29  ? 112  DT  I C4    1 
ATOM   2284  O O4    . DT  A 1 112 ? 70.441  24.440 -4.681  1.00 69.28  ? 112  DT  I O4    1 
ATOM   2285  C C5    . DT  A 1 112 ? 70.456  25.725 -6.668  1.00 70.47  ? 112  DT  I C5    1 
ATOM   2286  C C7    . DT  A 1 112 ? 70.847  24.564 -7.523  1.00 70.55  ? 112  DT  I C7    1 
ATOM   2287  C C6    . DT  A 1 112 ? 70.230  26.953 -7.157  1.00 71.76  ? 112  DT  I C6    1 
ATOM   2288  P P     . DA  A 1 113 ? 70.873  33.024 -7.850  1.00 110.22 ? 113  DA  I P     1 
ATOM   2289  O OP1   . DA  A 1 113 ? 70.272  34.374 -7.764  1.00 75.15  ? 113  DA  I OP1   1 
ATOM   2290  O OP2   . DA  A 1 113 ? 72.072  32.794 -8.697  1.00 73.49  ? 113  DA  I OP2   1 
ATOM   2291  O "O5'" . DA  A 1 113 ? 71.160  32.517 -6.369  1.00 113.32 ? 113  DA  I "O5'" 1 
ATOM   2292  C "C5'" . DA  A 1 113 ? 70.219  32.778 -5.327  1.00 116.82 ? 113  DA  I "C5'" 1 
ATOM   2293  C "C4'" . DA  A 1 113 ? 70.909  32.769 -3.984  1.00 119.29 ? 113  DA  I "C4'" 1 
ATOM   2294  O "O4'" . DA  A 1 113 ? 71.077  31.404 -3.532  1.00 119.64 ? 113  DA  I "O4'" 1 
ATOM   2295  C "C3'" . DA  A 1 113 ? 72.304  33.403 -3.996  1.00 121.11 ? 113  DA  I "C3'" 1 
ATOM   2296  O "O3'" . DA  A 1 113 ? 72.532  34.190 -2.816  1.00 124.89 ? 113  DA  I "O3'" 1 
ATOM   2297  C "C2'" . DA  A 1 113 ? 73.228  32.200 -4.034  1.00 119.95 ? 113  DA  I "C2'" 1 
ATOM   2298  C "C1'" . DA  A 1 113 ? 72.446  31.150 -3.258  1.00 119.36 ? 113  DA  I "C1'" 1 
ATOM   2299  N N9    . DA  A 1 113 ? 72.738  29.777 -3.674  1.00 83.87  ? 113  DA  I N9    1 
ATOM   2300  C C8    . DA  A 1 113 ? 72.932  29.315 -4.958  1.00 83.97  ? 113  DA  I C8    1 
ATOM   2301  N N7    . DA  A 1 113 ? 73.183  28.028 -5.029  1.00 84.21  ? 113  DA  I N7    1 
ATOM   2302  C C5    . DA  A 1 113 ? 73.150  27.612 -3.707  1.00 84.31  ? 113  DA  I C5    1 
ATOM   2303  C C6    . DA  A 1 113 ? 73.337  26.355 -3.115  1.00 84.73  ? 113  DA  I C6    1 
ATOM   2304  N N6    . DA  A 1 113 ? 73.608  25.249 -3.809  1.00 84.71  ? 113  DA  I N6    1 
ATOM   2305  N N1    . DA  A 1 113 ? 73.239  26.274 -1.770  1.00 84.93  ? 113  DA  I N1    1 
ATOM   2306  C C2    . DA  A 1 113 ? 72.976  27.399 -1.075  1.00 84.70  ? 113  DA  I C2    1 
ATOM   2307  N N3    . DA  A 1 113 ? 72.781  28.643 -1.519  1.00 84.44  ? 113  DA  I N3    1 
ATOM   2308  C C4    . DA  A 1 113 ? 72.880  28.681 -2.858  1.00 83.92  ? 113  DA  I C4    1 
ATOM   2309  P P     . DC  A 1 114 ? 73.737  35.263 -2.784  1.00 112.34 ? 114  DC  I P     1 
ATOM   2310  O OP1   . DC  A 1 114 ? 73.854  35.723 -1.381  1.00 85.82  ? 114  DC  I OP1   1 
ATOM   2311  O OP2   . DC  A 1 114 ? 73.544  36.264 -3.870  1.00 85.89  ? 114  DC  I OP2   1 
ATOM   2312  O "O5'" . DC  A 1 114 ? 75.022  34.389 -3.135  1.00 114.74 ? 114  DC  I "O5'" 1 
ATOM   2313  C "C5'" . DC  A 1 114 ? 76.195  34.443 -2.328  1.00 117.92 ? 114  DC  I "C5'" 1 
ATOM   2314  C "C4'" . DC  A 1 114 ? 75.931  33.839 -0.966  1.00 119.98 ? 114  DC  I "C4'" 1 
ATOM   2315  O "O4'" . DC  A 1 114 ? 75.359  32.512 -1.067  1.00 119.62 ? 114  DC  I "O4'" 1 
ATOM   2316  C "C3'" . DC  A 1 114 ? 77.194  33.687 -0.131  1.00 121.67 ? 114  DC  I "C3'" 1 
ATOM   2317  O "O3'" . DC  A 1 114 ? 76.946  34.048 1.220   1.00 125.64 ? 114  DC  I "O3'" 1 
ATOM   2318  C "C2'" . DC  A 1 114 ? 77.540  32.217 -0.252  1.00 120.18 ? 114  DC  I "C2'" 1 
ATOM   2319  C "C1'" . DC  A 1 114 ? 76.189  31.553 -0.423  1.00 118.29 ? 114  DC  I "C1'" 1 
ATOM   2320  N N1    . DC  A 1 114 ? 76.241  30.356 -1.284  1.00 89.60  ? 114  DC  I N1    1 
ATOM   2321  C C2    . DC  A 1 114 ? 76.138  29.066 -0.699  1.00 88.50  ? 114  DC  I C2    1 
ATOM   2322  O O2    . DC  A 1 114 ? 76.038  28.956 0.530   1.00 88.48  ? 114  DC  I O2    1 
ATOM   2323  N N3    . DC  A 1 114 ? 76.156  27.978 -1.500  1.00 86.85  ? 114  DC  I N3    1 
ATOM   2324  C C4    . DC  A 1 114 ? 76.276  28.123 -2.825  1.00 86.28  ? 114  DC  I C4    1 
ATOM   2325  N N4    . DC  A 1 114 ? 76.268  27.020 -3.573  1.00 85.25  ? 114  DC  I N4    1 
ATOM   2326  C C5    . DC  A 1 114 ? 76.404  29.408 -3.440  1.00 86.34  ? 114  DC  I C5    1 
ATOM   2327  C C6    . DC  A 1 114 ? 76.382  30.486 -2.640  1.00 87.87  ? 114  DC  I C6    1 
ATOM   2328  P P     . DA  A 1 115 ? 78.154  34.605 2.107   1.00 188.09 ? 115  DA  I P     1 
ATOM   2329  O OP1   . DA  A 1 115 ? 77.605  35.117 3.386   1.00 107.60 ? 115  DA  I OP1   1 
ATOM   2330  O OP2   . DA  A 1 115 ? 78.962  35.502 1.247   1.00 107.03 ? 115  DA  I OP2   1 
ATOM   2331  O "O5'" . DA  A 1 115 ? 79.015  33.299 2.394   1.00 189.12 ? 115  DA  I "O5'" 1 
ATOM   2332  C "C5'" . DA  A 1 115 ? 78.572  32.333 3.341   1.00 190.33 ? 115  DA  I "C5'" 1 
ATOM   2333  C "C4'" . DA  A 1 115 ? 79.529  31.166 3.377   1.00 191.15 ? 115  DA  I "C4'" 1 
ATOM   2334  O "O4'" . DA  A 1 115 ? 79.281  30.280 2.258   1.00 190.79 ? 115  DA  I "O4'" 1 
ATOM   2335  C "C3'" . DA  A 1 115 ? 81.004  31.568 3.289   1.00 191.95 ? 115  DA  I "C3'" 1 
ATOM   2336  O "O3'" . DA  A 1 115 ? 81.782  30.742 4.156   1.00 193.17 ? 115  DA  I "O3'" 1 
ATOM   2337  C "C2'" . DA  A 1 115 ? 81.357  31.258 1.846   1.00 191.58 ? 115  DA  I "C2'" 1 
ATOM   2338  C "C1'" . DA  A 1 115 ? 80.509  30.025 1.602   1.00 190.79 ? 115  DA  I "C1'" 1 
ATOM   2339  N N9    . DA  A 1 115 ? 80.238  29.705 0.200   1.00 109.04 ? 115  DA  I N9    1 
ATOM   2340  C C8    . DA  A 1 115 ? 80.206  30.549 -0.889  1.00 108.37 ? 115  DA  I C8    1 
ATOM   2341  N N7    . DA  A 1 115 ? 80.004  29.933 -2.029  1.00 108.01 ? 115  DA  I N7    1 
ATOM   2342  C C5    . DA  A 1 115 ? 79.880  28.596 -1.668  1.00 108.01 ? 115  DA  I C5    1 
ATOM   2343  C C6    . DA  A 1 115 ? 79.672  27.430 -2.420  1.00 107.66 ? 115  DA  I C6    1 
ATOM   2344  N N6    . DA  A 1 115 ? 79.537  27.420 -3.744  1.00 107.35 ? 115  DA  I N6    1 
ATOM   2345  N N1    . DA  A 1 115 ? 79.608  26.256 -1.754  1.00 107.40 ? 115  DA  I N1    1 
ATOM   2346  C C2    . DA  A 1 115 ? 79.736  26.268 -0.422  1.00 107.74 ? 115  DA  I C2    1 
ATOM   2347  N N3    . DA  A 1 115 ? 79.930  27.296 0.396   1.00 107.95 ? 115  DA  I N3    1 
ATOM   2348  C C4    . DA  A 1 115 ? 80.000  28.446 -0.298  1.00 108.25 ? 115  DA  I C4    1 
ATOM   2349  P P     . DC  A 1 116 ? 83.232  31.233 4.641   1.00 140.70 ? 116  DC  I P     1 
ATOM   2350  O OP1   . DC  A 1 116 ? 83.051  32.067 5.853   1.00 135.02 ? 116  DC  I OP1   1 
ATOM   2351  O OP2   . DC  A 1 116 ? 83.961  31.785 3.468   1.00 135.03 ? 116  DC  I OP2   1 
ATOM   2352  O "O5'" . DC  A 1 116 ? 83.941  29.872 5.059   1.00 139.86 ? 116  DC  I "O5'" 1 
ATOM   2353  C "C5'" . DC  A 1 116 ? 83.207  28.842 5.715   1.00 138.48 ? 116  DC  I "C5'" 1 
ATOM   2354  C "C4'" . DC  A 1 116 ? 83.672  27.487 5.235   1.00 137.18 ? 116  DC  I "C4'" 1 
ATOM   2355  O "O4'" . DC  A 1 116 ? 83.148  27.192 3.916   1.00 137.05 ? 116  DC  I "O4'" 1 
ATOM   2356  C "C3'" . DC  A 1 116 ? 85.189  27.354 5.117   1.00 136.15 ? 116  DC  I "C3'" 1 
ATOM   2357  O "O3'" . DC  A 1 116 ? 85.582  26.057 5.536   1.00 134.11 ? 116  DC  I "O3'" 1 
ATOM   2358  C "C2'" . DC  A 1 116 ? 85.439  27.482 3.626   1.00 136.17 ? 116  DC  I "C2'" 1 
ATOM   2359  C "C1'" . DC  A 1 116 ? 84.217  26.783 3.069   1.00 136.21 ? 116  DC  I "C1'" 1 
ATOM   2360  N N1    . DC  A 1 116 ? 83.879  27.132 1.672   1.00 129.40 ? 116  DC  I N1    1 
ATOM   2361  C C2    . DC  A 1 116 ? 83.563  26.095 0.764   1.00 128.55 ? 116  DC  I C2    1 
ATOM   2362  O O2    . DC  A 1 116 ? 83.554  24.912 1.164   1.00 128.06 ? 116  DC  I O2    1 
ATOM   2363  N N3    . DC  A 1 116 ? 83.281  26.413 -0.524  1.00 127.81 ? 116  DC  I N3    1 
ATOM   2364  C C4    . DC  A 1 116 ? 83.309  27.692 -0.921  1.00 127.77 ? 116  DC  I C4    1 
ATOM   2365  N N4    . DC  A 1 116 ? 83.046  27.956 -2.207  1.00 126.72 ? 116  DC  I N4    1 
ATOM   2366  C C5    . DC  A 1 116 ? 83.611  28.758 -0.020  1.00 128.00 ? 116  DC  I C5    1 
ATOM   2367  C C6    . DC  A 1 116 ? 83.884  28.436 1.253   1.00 128.80 ? 116  DC  I C6    1 
ATOM   2368  P P     . DT  A 1 117 ? 87.014  25.498 5.106   1.00 156.24 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 117 ? 87.349  24.397 6.039   1.00 103.56 ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 117 ? 87.925  26.662 4.965   1.00 102.68 ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 117 ? 86.763  24.887 3.660   1.00 154.79 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 117 ? 86.052  23.665 3.511   1.00 153.24 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 117 ? 86.725  22.798 2.475   1.00 152.16 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 117 ? 86.438  23.310 1.153   1.00 152.00 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 117 ? 88.248  22.743 2.596   1.00 151.30 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 117 ? 88.703  21.410 2.354   1.00 149.96 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 117 ? 88.725  23.715 1.530   1.00 151.10 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 117 ? 87.642  23.617 0.465   1.00 150.41 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 117 ? 87.415  24.865 -0.291  1.00 95.82  ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 117 ? 87.066  24.773 -1.626  1.00 94.49  ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 117 ? 86.966  23.714 -2.225  1.00 92.82  ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 117 ? 86.839  25.985 -2.238  1.00 93.63  ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 117 ? 86.929  27.248 -1.665  1.00 93.96  ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 117 ? 86.671  28.252 -2.330  1.00 93.05  ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 117 ? 87.325  27.267 -0.279  1.00 94.06  ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 117 ? 87.480  28.587 0.406   1.00 93.54  ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 117 ? 87.541  26.092 0.333   1.00 94.55  ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? 90.272  21.116 2.171   1.00 121.54 ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? 90.560  19.864 2.910   1.00 111.65 ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? 91.063  22.344 2.458   1.00 111.86 ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? 90.380  20.783 0.618   1.00 118.57 ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? 89.425  19.912 0.018   1.00 112.84 ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? 89.672  19.784 -1.466  1.00 108.44 ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? 89.323  21.011 -2.146  1.00 107.96 ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? 91.109  19.462 -1.866  1.00 106.01 ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? 91.082  18.437 -2.863  1.00 103.13 ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? 91.637  20.787 -2.389  1.00 106.03 ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? 90.392  21.430 -2.968  1.00 106.91 ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? 90.392  22.901 -2.972  1.00 97.20  ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? 90.195  23.552 -4.173  1.00 97.24  ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? 90.012  22.969 -5.230  1.00 96.65  ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? 90.218  24.920 -4.093  1.00 97.36  ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? 90.403  25.687 -2.967  1.00 97.60  ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? 90.404  26.909 -3.057  1.00 97.00  ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? 90.585  24.941 -1.738  1.00 97.90  ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? 90.759  25.689 -0.453  1.00 98.31  ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? 90.582  23.602 -1.805  1.00 97.73  ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 119 ? 92.401  18.099 -3.707  1.00 85.21  ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 119 ? 92.426  16.639 -3.974  1.00 109.85 ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 119 ? 93.585  18.763 -3.095  1.00 110.21 ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 119 ? 92.096  18.832 -5.073  1.00 85.80  ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 119 ? 90.767  18.870 -5.563  1.00 85.43  ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 119 ? 90.769  19.370 -6.983  1.00 84.74  ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 119 ? 90.787  20.817 -7.017  1.00 84.96  ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 119 ? 91.983  18.896 -7.775  1.00 84.78  ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 119 ? 91.535  18.474 -9.058  1.00 83.67  ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 119 ? 92.888  20.119 -7.815  1.00 85.43  ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 119 ? 91.907  21.282 -7.752  1.00 85.61  ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 119 ? 92.397  22.496 -7.073  1.00 111.29 ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 119 ? 92.462  23.673 -7.785  1.00 111.93 ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 119 ? 92.198  23.756 -8.975  1.00 112.97 ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 119 ? 92.859  24.761 -7.051  1.00 112.06 ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 119 ? 93.188  24.790 -5.714  1.00 112.01 ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 119 ? 93.500  25.847 -5.187  1.00 111.08 ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 119 ? 93.122  23.523 -5.037  1.00 112.54 ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 119 ? 93.454  23.462 -3.580  1.00 113.04 ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 119 ? 92.748  22.449 -5.744  1.00 112.28 ? 119  DT  I C6    1 
ATOM   2428  P P     . DT  A 1 120 ? 92.581  17.967 -10.147 1.00 82.22  ? 120  DT  I P     1 
ATOM   2429  O OP1   . DT  A 1 120 ? 91.983  16.775 -10.793 1.00 103.37 ? 120  DT  I OP1   1 
ATOM   2430  O OP2   . DT  A 1 120 ? 93.924  17.879 -9.528  1.00 103.60 ? 120  DT  I OP2   1 
ATOM   2431  O "O5'" . DT  A 1 120 ? 92.580  19.170 -11.181 1.00 81.10  ? 120  DT  I "O5'" 1 
ATOM   2432  C "C5'" . DT  A 1 120 ? 91.348  19.761 -11.594 1.00 77.69  ? 120  DT  I "C5'" 1 
ATOM   2433  C "C4'" . DT  A 1 120 ? 91.616  20.993 -12.424 1.00 74.84  ? 120  DT  I "C4'" 1 
ATOM   2434  O "O4'" . DT  A 1 120 ? 92.071  22.081 -11.581 1.00 74.68  ? 120  DT  I "O4'" 1 
ATOM   2435  C "C3'" . DT  A 1 120 ? 92.701  20.794 -13.486 1.00 73.96  ? 120  DT  I "C3'" 1 
ATOM   2436  O "O3'" . DT  A 1 120 ? 92.338  21.463 -14.686 1.00 71.81  ? 120  DT  I "O3'" 1 
ATOM   2437  C "C2'" . DT  A 1 120 ? 93.908  21.487 -12.881 1.00 75.01  ? 120  DT  I "C2'" 1 
ATOM   2438  C "C1'" . DT  A 1 120 ? 93.250  22.636 -12.151 1.00 75.19  ? 120  DT  I "C1'" 1 
ATOM   2439  N N1    . DT  A 1 120 ? 94.055  23.245 -11.072 1.00 96.74  ? 120  DT  I N1    1 
ATOM   2440  C C2    . DT  A 1 120 ? 94.354  24.584 -11.182 1.00 96.61  ? 120  DT  I C2    1 
ATOM   2441  O O2    . DT  A 1 120 ? 94.013  25.261 -12.128 1.00 95.31  ? 120  DT  I O2    1 
ATOM   2442  N N3    . DT  A 1 120 ? 95.083  25.102 -10.146 1.00 97.65  ? 120  DT  I N3    1 
ATOM   2443  C C4    . DT  A 1 120 ? 95.555  24.426 -9.036  1.00 98.31  ? 120  DT  I C4    1 
ATOM   2444  O O4    . DT  A 1 120 ? 96.228  25.029 -8.188  1.00 98.17  ? 120  DT  I O4    1 
ATOM   2445  C C5    . DT  A 1 120 ? 95.204  23.015 -8.985  1.00 97.85  ? 120  DT  I C5    1 
ATOM   2446  C C7    . DT  A 1 120 ? 95.637  22.202 -7.807  1.00 97.54  ? 120  DT  I C7    1 
ATOM   2447  C C6    . DT  A 1 120 ? 94.490  22.502 -9.998  1.00 97.43  ? 120  DT  I C6    1 
ATOM   2448  P P     . DG  A 1 121 ? 92.581  20.755 -16.106 1.00 83.89  ? 121  DG  I P     1 
ATOM   2449  O OP1   . DG  A 1 121 ? 91.435  19.842 -16.388 1.00 121.25 ? 121  DG  I OP1   1 
ATOM   2450  O OP2   . DG  A 1 121 ? 93.968  20.239 -16.172 1.00 121.21 ? 121  DG  I OP2   1 
ATOM   2451  O "O5'" . DG  A 1 121 ? 92.474  22.002 -17.086 1.00 79.66  ? 121  DG  I "O5'" 1 
ATOM   2452  C "C5'" . DG  A 1 121 ? 91.431  22.959 -16.907 1.00 75.37  ? 121  DG  I "C5'" 1 
ATOM   2453  C "C4'" . DG  A 1 121 ? 91.965  24.348 -17.131 1.00 72.19  ? 121  DG  I "C4'" 1 
ATOM   2454  O "O4'" . DG  A 1 121 ? 92.846  24.719 -16.055 1.00 72.73  ? 121  DG  I "O4'" 1 
ATOM   2455  C "C3'" . DG  A 1 121 ? 92.782  24.480 -18.405 1.00 69.99  ? 121  DG  I "C3'" 1 
ATOM   2456  O "O3'" . DG  A 1 121 ? 92.538  25.751 -18.938 1.00 65.23  ? 121  DG  I "O3'" 1 
ATOM   2457  C "C2'" . DG  A 1 121 ? 94.218  24.354 -17.939 1.00 71.58  ? 121  DG  I "C2'" 1 
ATOM   2458  C "C1'" . DG  A 1 121 ? 94.175  24.899 -16.523 1.00 73.59  ? 121  DG  I "C1'" 1 
ATOM   2459  N N9    . DG  A 1 121 ? 95.058  24.199 -15.594 1.00 114.13 ? 121  DG  I N9    1 
ATOM   2460  C C8    . DG  A 1 121 ? 95.279  22.842 -15.520 1.00 113.44 ? 121  DG  I C8    1 
ATOM   2461  N N7    . DG  A 1 121 ? 96.103  22.508 -14.564 1.00 114.15 ? 121  DG  I N7    1 
ATOM   2462  C C5    . DG  A 1 121 ? 96.449  23.715 -13.974 1.00 115.42 ? 121  DG  I C5    1 
ATOM   2463  C C6    . DG  A 1 121 ? 97.299  23.982 -12.883 1.00 116.13 ? 121  DG  I C6    1 
ATOM   2464  O O6    . DG  A 1 121 ? 97.923  23.174 -12.183 1.00 117.58 ? 121  DG  I O6    1 
ATOM   2465  N N1    . DG  A 1 121 ? 97.383  25.350 -12.621 1.00 115.10 ? 121  DG  I N1    1 
ATOM   2466  C C2    . DG  A 1 121 ? 96.719  26.330 -13.319 1.00 114.87 ? 121  DG  I C2    1 
ATOM   2467  N N2    . DG  A 1 121 ? 96.934  27.589 -12.931 1.00 113.82 ? 121  DG  I N2    1 
ATOM   2468  N N3    . DG  A 1 121 ? 95.907  26.089 -14.329 1.00 114.92 ? 121  DG  I N3    1 
ATOM   2469  C C4    . DG  A 1 121 ? 95.820  24.769 -14.603 1.00 115.25 ? 121  DG  I C4    1 
ATOM   2470  P P     . DG  A 1 122 ? 92.995  26.066 -20.415 1.00 53.04  ? 122  DG  I P     1 
ATOM   2471  O OP1   . DG  A 1 122 ? 91.751  26.357 -21.168 1.00 74.57  ? 122  DG  I OP1   1 
ATOM   2472  O OP2   . DG  A 1 122 ? 93.940  25.028 -20.910 1.00 73.63  ? 122  DG  I OP2   1 
ATOM   2473  O "O5'" . DG  A 1 122 ? 93.819  27.403 -20.191 1.00 53.15  ? 122  DG  I "O5'" 1 
ATOM   2474  C "C5'" . DG  A 1 122 ? 93.376  28.367 -19.236 1.00 60.40  ? 122  DG  I "C5'" 1 
ATOM   2475  C "C4'" . DG  A 1 122 ? 94.511  29.291 -18.861 1.00 64.64  ? 122  DG  I "C4'" 1 
ATOM   2476  O "O4'" . DG  A 1 122 ? 95.354  28.696 -17.849 1.00 65.27  ? 122  DG  I "O4'" 1 
ATOM   2477  C "C3'" . DG  A 1 122 ? 95.434  29.655 -20.023 1.00 68.52  ? 122  DG  I "C3'" 1 
ATOM   2478  O "O3'" . DG  A 1 122 ? 95.707  31.051 -20.005 1.00 72.47  ? 122  DG  I "O3'" 1 
ATOM   2479  C "C2'" . DG  A 1 122 ? 96.689  28.842 -19.758 1.00 67.19  ? 122  DG  I "C2'" 1 
ATOM   2480  C "C1'" . DG  A 1 122 ? 96.713  28.797 -18.248 1.00 66.76  ? 122  DG  I "C1'" 1 
ATOM   2481  N N9    . DG  A 1 122 ? 97.428  27.674 -17.658 1.00 88.21  ? 122  DG  I N9    1 
ATOM   2482  C C8    . DG  A 1 122 ? 97.352  26.353 -18.026 1.00 89.54  ? 122  DG  I C8    1 
ATOM   2483  N N7    . DG  A 1 122 ? 98.046  25.563 -17.251 1.00 90.52  ? 122  DG  I N7    1 
ATOM   2484  C C5    . DG  A 1 122 ? 98.632  26.418 -16.326 1.00 89.01  ? 122  DG  I C5    1 
ATOM   2485  C C6    . DG  A 1 122 ? 99.481  26.137 -15.226 1.00 90.32  ? 122  DG  I C6    1 
ATOM   2486  O O6    . DG  A 1 122 ? 99.897  25.038 -14.831 1.00 88.42  ? 122  DG  I O6    1 
ATOM   2487  N N1    . DG  A 1 122 ? 99.843  27.299 -14.552 1.00 89.03  ? 122  DG  I N1    1 
ATOM   2488  C C2    . DG  A 1 122 ? 99.442  28.564 -14.887 1.00 89.50  ? 122  DG  I C2    1 
ATOM   2489  N N2    . DG  A 1 122 ? 99.893  29.553 -14.105 1.00 88.99  ? 122  DG  I N2    1 
ATOM   2490  N N3    . DG  A 1 122 ? 98.653  28.841 -15.912 1.00 89.64  ? 122  DG  I N3    1 
ATOM   2491  C C4    . DG  A 1 122 ? 98.283  27.725 -16.579 1.00 89.43  ? 122  DG  I C4    1 
ATOM   2492  P P     . DT  A 1 123 ? 96.774  31.657 -21.029 1.00 90.17  ? 123  DT  I P     1 
ATOM   2493  O OP1   . DT  A 1 123 ? 96.284  32.986 -21.485 1.00 78.00  ? 123  DT  I OP1   1 
ATOM   2494  O OP2   . DT  A 1 123 ? 97.142  30.622 -22.026 1.00 77.84  ? 123  DT  I OP2   1 
ATOM   2495  O "O5'" . DT  A 1 123 ? 98.040  31.861 -20.100 1.00 95.50  ? 123  DT  I "O5'" 1 
ATOM   2496  C "C5'" . DT  A 1 123 ? 97.915  32.586 -18.888 1.00 100.41 ? 123  DT  I "C5'" 1 
ATOM   2497  C "C4'" . DT  A 1 123 ? 99.280  32.913 -18.345 1.00 103.97 ? 123  DT  I "C4'" 1 
ATOM   2498  O "O4'" . DT  A 1 123 ? 99.818  31.748 -17.681 1.00 103.74 ? 123  DT  I "O4'" 1 
ATOM   2499  C "C3'" . DT  A 1 123 ? 100.279 33.300 -19.437 1.00 106.67 ? 123  DT  I "C3'" 1 
ATOM   2500  O "O3'" . DT  A 1 123 ? 100.997 34.482 -19.050 1.00 111.63 ? 123  DT  I "O3'" 1 
ATOM   2501  C "C2'" . DT  A 1 123 ? 101.156 32.063 -19.579 1.00 104.83 ? 123  DT  I "C2'" 1 
ATOM   2502  C "C1'" . DT  A 1 123 ? 101.103 31.461 -18.189 1.00 102.94 ? 123  DT  I "C1'" 1 
ATOM   2503  N N1    . DT  A 1 123 ? 101.303 30.007 -18.105 1.00 89.44  ? 123  DT  I N1    1 
ATOM   2504  C C2    . DT  A 1 123 ? 102.055 29.554 -17.050 1.00 88.76  ? 123  DT  I C2    1 
ATOM   2505  O O2    . DT  A 1 123 ? 102.529 30.306 -16.216 1.00 88.41  ? 123  DT  I O2    1 
ATOM   2506  N N3    . DT  A 1 123 ? 102.238 28.186 -17.006 1.00 86.73  ? 123  DT  I N3    1 
ATOM   2507  C C4    . DT  A 1 123 ? 101.752 27.254 -17.900 1.00 86.65  ? 123  DT  I C4    1 
ATOM   2508  O O4    . DT  A 1 123 ? 102.019 26.066 -17.752 1.00 84.60  ? 123  DT  I O4    1 
ATOM   2509  C C5    . DT  A 1 123 ? 100.951 27.797 -18.979 1.00 87.08  ? 123  DT  I C5    1 
ATOM   2510  C C7    . DT  A 1 123 ? 100.365 26.856 -19.981 1.00 87.29  ? 123  DT  I C7    1 
ATOM   2511  C C6    . DT  A 1 123 ? 100.769 29.132 -19.030 1.00 88.02  ? 123  DT  I C6    1 
ATOM   2512  P P     . DA  A 1 124 ? 102.154 35.074 -20.000 1.00 114.72 ? 124  DA  I P     1 
ATOM   2513  O OP1   . DA  A 1 124 ? 102.118 36.559 -19.984 1.00 87.61  ? 124  DA  I OP1   1 
ATOM   2514  O OP2   . DA  A 1 124 ? 102.163 34.354 -21.293 1.00 88.40  ? 124  DA  I OP2   1 
ATOM   2515  O "O5'" . DA  A 1 124 ? 103.450 34.631 -19.211 1.00 117.91 ? 124  DA  I "O5'" 1 
ATOM   2516  C "C5'" . DA  A 1 124 ? 103.495 34.749 -17.796 1.00 121.60 ? 124  DA  I "C5'" 1 
ATOM   2517  C "C4'" . DA  A 1 124 ? 104.845 34.302 -17.309 1.00 124.27 ? 124  DA  I "C4'" 1 
ATOM   2518  O "O4'" . DA  A 1 124 ? 104.863 32.865 -17.149 1.00 123.13 ? 124  DA  I "O4'" 1 
ATOM   2519  C "C3'" . DA  A 1 124 ? 105.921 34.635 -18.339 1.00 126.93 ? 124  DA  I "C3'" 1 
ATOM   2520  O "O3'" . DA  A 1 124 ? 107.072 35.170 -17.702 1.00 131.90 ? 124  DA  I "O3'" 1 
ATOM   2521  C "C2'" . DA  A 1 124 ? 106.223 33.300 -18.995 1.00 125.32 ? 124  DA  I "C2'" 1 
ATOM   2522  C "C1'" . DA  A 1 124 ? 105.948 32.322 -17.876 1.00 123.08 ? 124  DA  I "C1'" 1 
ATOM   2523  N N9    . DA  A 1 124 ? 105.562 30.993 -18.341 1.00 94.34  ? 124  DA  I N9    1 
ATOM   2524  C C8    . DA  A 1 124 ? 104.967 30.659 -19.531 1.00 93.53  ? 124  DA  I C8    1 
ATOM   2525  N N7    . DA  A 1 124 ? 104.782 29.369 -19.684 1.00 92.73  ? 124  DA  I N7    1 
ATOM   2526  C C5    . DA  A 1 124 ? 105.276 28.817 -18.506 1.00 92.85  ? 124  DA  I C5    1 
ATOM   2527  C C6    . DA  A 1 124 ? 105.365 27.484 -18.034 1.00 92.62  ? 124  DA  I C6    1 
ATOM   2528  N N6    . DA  A 1 124 ? 104.927 26.426 -18.709 1.00 92.68  ? 124  DA  I N6    1 
ATOM   2529  N N1    . DA  A 1 124 ? 105.919 27.281 -16.822 1.00 92.51  ? 124  DA  I N1    1 
ATOM   2530  C C2    . DA  A 1 124 ? 106.337 28.344 -16.126 1.00 91.76  ? 124  DA  I C2    1 
ATOM   2531  N N3    . DA  A 1 124 ? 106.298 29.637 -16.449 1.00 92.05  ? 124  DA  I N3    1 
ATOM   2532  C C4    . DA  A 1 124 ? 105.754 29.808 -17.667 1.00 93.07  ? 124  DA  I C4    1 
ATOM   2533  P P     . DG  A 1 125 ? 108.258 35.777 -18.593 1.00 190.20 ? 125  DG  I P     1 
ATOM   2534  O OP1   . DG  A 1 125 ? 108.665 37.053 -17.948 1.00 148.82 ? 125  DG  I OP1   1 
ATOM   2535  O OP2   . DG  A 1 125 ? 107.848 35.780 -20.021 1.00 148.12 ? 125  DG  I OP2   1 
ATOM   2536  O "O5'" . DG  A 1 125 ? 109.405 34.691 -18.409 1.00 191.22 ? 125  DG  I "O5'" 1 
ATOM   2537  C "C5'" . DG  A 1 125 ? 109.738 34.199 -17.112 1.00 193.08 ? 125  DG  I "C5'" 1 
ATOM   2538  C "C4'" . DG  A 1 125 ? 110.760 33.096 -17.226 1.00 194.40 ? 125  DG  I "C4'" 1 
ATOM   2539  O "O4'" . DG  A 1 125 ? 110.119 31.840 -17.568 1.00 194.20 ? 125  DG  I "O4'" 1 
ATOM   2540  C "C3'" . DG  A 1 125 ? 111.787 33.361 -18.325 1.00 195.60 ? 125  DG  I "C3'" 1 
ATOM   2541  O "O3'" . DG  A 1 125 ? 113.093 32.941 -17.934 1.00 197.78 ? 125  DG  I "O3'" 1 
ATOM   2542  C "C2'" . DG  A 1 125 ? 111.308 32.478 -19.456 1.00 195.14 ? 125  DG  I "C2'" 1 
ATOM   2543  C "C1'" . DG  A 1 125 ? 110.777 31.288 -18.694 1.00 194.35 ? 125  DG  I "C1'" 1 
ATOM   2544  N N9    . DG  A 1 125 ? 109.808 30.528 -19.477 1.00 152.34 ? 125  DG  I N9    1 
ATOM   2545  C C8    . DG  A 1 125 ? 109.035 31.013 -20.499 1.00 152.25 ? 125  DG  I C8    1 
ATOM   2546  N N7    . DG  A 1 125 ? 108.304 30.093 -21.068 1.00 152.41 ? 125  DG  I N7    1 
ATOM   2547  C C5    . DG  A 1 125 ? 108.604 28.936 -20.370 1.00 152.49 ? 125  DG  I C5    1 
ATOM   2548  C C6    . DG  A 1 125 ? 108.120 27.607 -20.538 1.00 152.44 ? 125  DG  I C6    1 
ATOM   2549  O O6    . DG  A 1 125 ? 107.311 27.183 -21.372 1.00 152.55 ? 125  DG  I O6    1 
ATOM   2550  N N1    . DG  A 1 125 ? 108.680 26.736 -19.611 1.00 151.91 ? 125  DG  I N1    1 
ATOM   2551  C C2    . DG  A 1 125 ? 109.590 27.090 -18.643 1.00 151.54 ? 125  DG  I C2    1 
ATOM   2552  N N2    . DG  A 1 125 ? 110.008 26.098 -17.840 1.00 150.95 ? 125  DG  I N2    1 
ATOM   2553  N N3    . DG  A 1 125 ? 110.054 28.323 -18.476 1.00 151.72 ? 125  DG  I N3    1 
ATOM   2554  C C4    . DG  A 1 125 ? 109.522 29.185 -19.368 1.00 152.26 ? 125  DG  I C4    1 
ATOM   2555  P P     . DA  A 1 126 ? 114.171 32.563 -19.063 1.00 178.89 ? 126  DA  I P     1 
ATOM   2556  O OP1   . DA  A 1 126 ? 115.515 32.800 -18.485 1.00 138.26 ? 126  DA  I OP1   1 
ATOM   2557  O OP2   . DA  A 1 126 ? 113.791 33.229 -20.340 1.00 137.82 ? 126  DA  I OP2   1 
ATOM   2558  O "O5'" . DA  A 1 126 ? 113.991 30.991 -19.224 1.00 179.51 ? 126  DA  I "O5'" 1 
ATOM   2559  C "C5'" . DA  A 1 126 ? 114.249 30.136 -18.117 1.00 180.79 ? 126  DA  I "C5'" 1 
ATOM   2560  C "C4'" . DA  A 1 126 ? 114.928 28.871 -18.579 1.00 181.41 ? 126  DA  I "C4'" 1 
ATOM   2561  O "O4'" . DA  A 1 126 ? 113.951 27.892 -18.997 1.00 181.26 ? 126  DA  I "O4'" 1 
ATOM   2562  C "C3'" . DA  A 1 126 ? 115.899 29.042 -19.747 1.00 182.09 ? 126  DA  I "C3'" 1 
ATOM   2563  O "O3'" . DA  A 1 126 ? 117.073 28.263 -19.503 1.00 183.32 ? 126  DA  I "O3'" 1 
ATOM   2564  C "C2'" . DA  A 1 126 ? 115.112 28.511 -20.932 1.00 181.71 ? 126  DA  I "C2'" 1 
ATOM   2565  C "C1'" . DA  A 1 126 ? 114.262 27.425 -20.297 1.00 181.39 ? 126  DA  I "C1'" 1 
ATOM   2566  N N9    . DA  A 1 126 ? 113.001 27.163 -20.990 1.00 140.63 ? 126  DA  I N9    1 
ATOM   2567  C C8    . DA  A 1 126 ? 112.319 27.998 -21.842 1.00 140.39 ? 126  DA  I C8    1 
ATOM   2568  N N7    . DA  A 1 126 ? 111.211 27.481 -22.313 1.00 140.22 ? 126  DA  I N7    1 
ATOM   2569  C C5    . DA  A 1 126 ? 111.156 26.221 -21.731 1.00 140.34 ? 126  DA  I C5    1 
ATOM   2570  C C6    . DA  A 1 126 ? 110.220 25.172 -21.824 1.00 140.28 ? 126  DA  I C6    1 
ATOM   2571  N N6    . DA  A 1 126 ? 109.114 25.232 -22.569 1.00 140.24 ? 126  DA  I N6    1 
ATOM   2572  N N1    . DA  A 1 126 ? 110.463 24.046 -21.114 1.00 140.26 ? 126  DA  I N1    1 
ATOM   2573  C C2    . DA  A 1 126 ? 111.569 23.989 -20.363 1.00 140.06 ? 126  DA  I C2    1 
ATOM   2574  N N3    . DA  A 1 126 ? 112.521 24.906 -20.192 1.00 140.07 ? 126  DA  I N3    1 
ATOM   2575  C C4    . DA  A 1 126 ? 112.253 26.011 -20.912 1.00 140.40 ? 126  DA  I C4    1 
ATOM   2576  P P     . DA  A 1 127 ? 118.081 27.927 -20.708 1.00 176.64 ? 127  DA  I P     1 
ATOM   2577  O OP1   . DA  A 1 127 ? 119.456 27.910 -20.149 1.00 127.44 ? 127  DA  I OP1   1 
ATOM   2578  O OP2   . DA  A 1 127 ? 117.766 28.833 -21.847 1.00 126.86 ? 127  DA  I OP2   1 
ATOM   2579  O "O5'" . DA  A 1 127 ? 117.675 26.434 -21.090 1.00 176.56 ? 127  DA  I "O5'" 1 
ATOM   2580  C "C5'" . DA  A 1 127 ? 117.449 25.467 -20.064 1.00 175.85 ? 127  DA  I "C5'" 1 
ATOM   2581  C "C4'" . DA  A 1 127 ? 117.210 24.103 -20.667 1.00 175.45 ? 127  DA  I "C4'" 1 
ATOM   2582  O "O4'" . DA  A 1 127 ? 115.858 24.001 -21.176 1.00 175.87 ? 127  DA  I "O4'" 1 
ATOM   2583  C "C3'" . DA  A 1 127 ? 118.139 23.749 -21.827 1.00 175.06 ? 127  DA  I "C3'" 1 
ATOM   2584  O "O3'" . DA  A 1 127 ? 118.564 22.390 -21.700 1.00 173.41 ? 127  DA  I "O3'" 1 
ATOM   2585  C "C2'" . DA  A 1 127 ? 117.263 23.950 -23.052 1.00 175.49 ? 127  DA  I "C2'" 1 
ATOM   2586  C "C1'" . DA  A 1 127 ? 115.879 23.587 -22.533 1.00 176.01 ? 127  DA  I "C1'" 1 
ATOM   2587  N N9    . DA  A 1 127 ? 114.766 24.246 -23.226 1.00 126.55 ? 127  DA  I N9    1 
ATOM   2588  C C8    . DA  A 1 127 ? 114.693 25.551 -23.658 1.00 126.39 ? 127  DA  I C8    1 
ATOM   2589  N N7    . DA  A 1 127 ? 113.580 25.837 -24.294 1.00 126.20 ? 127  DA  I N7    1 
ATOM   2590  C C5    . DA  A 1 127 ? 112.861 24.648 -24.263 1.00 125.95 ? 127  DA  I C5    1 
ATOM   2591  C C6    . DA  A 1 127 ? 111.597 24.284 -24.784 1.00 125.34 ? 127  DA  I C6    1 
ATOM   2592  N N6    . DA  A 1 127 ? 110.809 25.114 -25.469 1.00 124.91 ? 127  DA  I N6    1 
ATOM   2593  N N1    . DA  A 1 127 ? 111.174 23.017 -24.580 1.00 124.91 ? 127  DA  I N1    1 
ATOM   2594  C C2    . DA  A 1 127 ? 111.972 22.177 -23.910 1.00 125.02 ? 127  DA  I C2    1 
ATOM   2595  N N3    . DA  A 1 127 ? 113.180 22.393 -23.383 1.00 125.68 ? 127  DA  I N3    1 
ATOM   2596  C C4    . DA  A 1 127 ? 113.573 23.662 -23.597 1.00 126.20 ? 127  DA  I C4    1 
ATOM   2597  P P     . DT  A 1 128 ? 119.458 21.718 -22.852 1.00 157.18 ? 128  DT  I P     1 
ATOM   2598  O OP1   . DT  A 1 128 ? 120.467 20.864 -22.174 1.00 122.70 ? 128  DT  I OP1   1 
ATOM   2599  O OP2   . DT  A 1 128 ? 119.910 22.783 -23.792 1.00 123.60 ? 128  DT  I OP2   1 
ATOM   2600  O "O5'" . DT  A 1 128 ? 118.411 20.757 -23.576 1.00 155.74 ? 128  DT  I "O5'" 1 
ATOM   2601  C "C5'" . DT  A 1 128 ? 117.598 19.870 -22.801 1.00 153.73 ? 128  DT  I "C5'" 1 
ATOM   2602  C "C4'" . DT  A 1 128 ? 116.655 19.088 -23.688 1.00 151.95 ? 128  DT  I "C4'" 1 
ATOM   2603  O "O4'" . DT  A 1 128 ? 115.532 19.901 -24.111 1.00 151.61 ? 128  DT  I "O4'" 1 
ATOM   2604  C "C3'" . DT  A 1 128 ? 117.284 18.530 -24.967 1.00 150.94 ? 128  DT  I "C3'" 1 
ATOM   2605  O "O3'" . DT  A 1 128 ? 116.841 17.191 -25.205 1.00 149.56 ? 128  DT  I "O3'" 1 
ATOM   2606  C "C2'" . DT  A 1 128 ? 116.746 19.445 -26.050 1.00 150.87 ? 128  DT  I "C2'" 1 
ATOM   2607  C "C1'" . DT  A 1 128 ? 115.367 19.777 -25.515 1.00 151.22 ? 128  DT  I "C1'" 1 
ATOM   2608  N N1    . DT  A 1 128 ? 114.816 21.045 -26.025 1.00 117.42 ? 128  DT  I N1    1 
ATOM   2609  C C2    . DT  A 1 128 ? 113.576 21.032 -26.647 1.00 116.95 ? 128  DT  I C2    1 
ATOM   2610  O O2    . DT  A 1 128 ? 112.917 20.012 -26.824 1.00 116.44 ? 128  DT  I O2    1 
ATOM   2611  N N3    . DT  A 1 128 ? 113.140 22.269 -27.070 1.00 116.64 ? 128  DT  I N3    1 
ATOM   2612  C C4    . DT  A 1 128 ? 113.809 23.478 -26.955 1.00 116.53 ? 128  DT  I C4    1 
ATOM   2613  O O4    . DT  A 1 128 ? 113.291 24.510 -27.373 1.00 115.68 ? 128  DT  I O4    1 
ATOM   2614  C C5    . DT  A 1 128 ? 115.104 23.411 -26.320 1.00 116.67 ? 128  DT  I C5    1 
ATOM   2615  C C7    . DT  A 1 128 ? 115.906 24.667 -26.184 1.00 116.74 ? 128  DT  I C7    1 
ATOM   2616  C C6    . DT  A 1 128 ? 115.532 22.217 -25.882 1.00 117.13 ? 128  DT  I C6    1 
ATOM   2617  P P     . DC  A 1 129 ? 117.241 16.454 -26.578 1.00 134.68 ? 129  DC  I P     1 
ATOM   2618  O OP1   . DC  A 1 129 ? 117.482 15.021 -26.264 1.00 127.22 ? 129  DC  I OP1   1 
ATOM   2619  O OP2   . DC  A 1 129 ? 118.299 17.251 -27.260 1.00 127.96 ? 129  DC  I OP2   1 
ATOM   2620  O "O5'" . DC  A 1 129 ? 115.900 16.540 -27.436 1.00 132.22 ? 129  DC  I "O5'" 1 
ATOM   2621  C "C5'" . DC  A 1 129 ? 114.641 16.193 -26.849 1.00 126.23 ? 129  DC  I "C5'" 1 
ATOM   2622  C "C4'" . DC  A 1 129 ? 113.547 16.181 -27.893 1.00 121.99 ? 129  DC  I "C4'" 1 
ATOM   2623  O "O4'" . DC  A 1 129 ? 113.274 17.520 -28.349 1.00 120.91 ? 129  DC  I "O4'" 1 
ATOM   2624  C "C3'" . DC  A 1 129 ? 113.824 15.369 -29.151 1.00 118.44 ? 129  DC  I "C3'" 1 
ATOM   2625  O "O3'" . DC  A 1 129 ? 112.595 14.824 -29.587 1.00 112.83 ? 129  DC  I "O3'" 1 
ATOM   2626  C "C2'" . DC  A 1 129 ? 114.305 16.409 -30.145 1.00 118.38 ? 129  DC  I "C2'" 1 
ATOM   2627  C "C1'" . DC  A 1 129 ? 113.495 17.632 -29.749 1.00 119.29 ? 129  DC  I "C1'" 1 
ATOM   2628  N N1    . DC  A 1 129 ? 114.140 18.938 -29.975 1.00 111.10 ? 129  DC  I N1    1 
ATOM   2629  C C2    . DC  A 1 129 ? 113.514 19.882 -30.810 1.00 110.57 ? 129  DC  I C2    1 
ATOM   2630  O O2    . DC  A 1 129 ? 112.467 19.571 -31.398 1.00 110.36 ? 129  DC  I O2    1 
ATOM   2631  N N3    . DC  A 1 129 ? 114.070 21.110 -30.951 1.00 109.88 ? 129  DC  I N3    1 
ATOM   2632  C C4    . DC  A 1 129 ? 115.200 21.410 -30.302 1.00 109.64 ? 129  DC  I C4    1 
ATOM   2633  N N4    . DC  A 1 129 ? 115.688 22.649 -30.427 1.00 109.30 ? 129  DC  I N4    1 
ATOM   2634  C C5    . DC  A 1 129 ? 115.875 20.457 -29.481 1.00 109.59 ? 129  DC  I C5    1 
ATOM   2635  C C6    . DC  A 1 129 ? 115.317 19.245 -29.351 1.00 110.46 ? 129  DC  I C6    1 
ATOM   2636  P P     . DT  A 1 130 ? 112.592 13.457 -30.406 1.00 96.59  ? 130  DT  I P     1 
ATOM   2637  O OP1   . DT  A 1 130 ? 111.774 12.456 -29.677 1.00 102.77 ? 130  DT  I OP1   1 
ATOM   2638  O OP2   . DT  A 1 130 ? 113.995 13.140 -30.801 1.00 103.39 ? 130  DT  I OP2   1 
ATOM   2639  O "O5'" . DT  A 1 130 ? 111.781 13.864 -31.707 1.00 93.51  ? 130  DT  I "O5'" 1 
ATOM   2640  C "C5'" . DT  A 1 130 ? 110.444 14.353 -31.595 1.00 86.26  ? 130  DT  I "C5'" 1 
ATOM   2641  C "C4'" . DT  A 1 130 ? 110.032 14.994 -32.892 1.00 81.34  ? 130  DT  I "C4'" 1 
ATOM   2642  O "O4'" . DT  A 1 130 ? 110.674 16.281 -33.010 1.00 80.22  ? 130  DT  I "O4'" 1 
ATOM   2643  C "C3'" . DT  A 1 130 ? 110.483 14.188 -34.105 1.00 77.67  ? 130  DT  I "C3'" 1 
ATOM   2644  O "O3'" . DT  A 1 130 ? 109.497 14.292 -35.103 1.00 72.09  ? 130  DT  I "O3'" 1 
ATOM   2645  C "C2'" . DT  A 1 130 ? 111.714 14.929 -34.574 1.00 78.64  ? 130  DT  I "C2'" 1 
ATOM   2646  C "C1'" . DT  A 1 130 ? 111.315 16.348 -34.261 1.00 81.18  ? 130  DT  I "C1'" 1 
ATOM   2647  N N1    . DT  A 1 130 ? 112.403 17.320 -34.159 1.00 90.15  ? 130  DT  I N1    1 
ATOM   2648  C C2    . DT  A 1 130 ? 112.236 18.510 -34.827 1.00 91.59  ? 130  DT  I C2    1 
ATOM   2649  O O2    . DT  A 1 130 ? 111.252 18.763 -35.501 1.00 91.47  ? 130  DT  I O2    1 
ATOM   2650  N N3    . DT  A 1 130 ? 113.269 19.398 -34.679 1.00 92.95  ? 130  DT  I N3    1 
ATOM   2651  C C4    . DT  A 1 130 ? 114.424 19.216 -33.952 1.00 93.34  ? 130  DT  I C4    1 
ATOM   2652  O O4    . DT  A 1 130 ? 115.259 20.106 -33.904 1.00 93.36  ? 130  DT  I O4    1 
ATOM   2653  C C5    . DT  A 1 130 ? 114.541 17.939 -33.288 1.00 92.83  ? 130  DT  I C5    1 
ATOM   2654  C C7    . DT  A 1 130 ? 115.772 17.655 -32.490 1.00 93.81  ? 130  DT  I C7    1 
ATOM   2655  C C6    . DT  A 1 130 ? 113.536 17.063 -33.422 1.00 91.75  ? 130  DT  I C6    1 
ATOM   2656  P P     . DG  A 1 131 ? 108.553 13.040 -35.413 1.00 70.02  ? 131  DG  I P     1 
ATOM   2657  O OP1   . DG  A 1 131 ? 107.781 12.653 -34.195 1.00 77.54  ? 131  DG  I OP1   1 
ATOM   2658  O OP2   . DG  A 1 131 ? 109.393 12.025 -36.104 1.00 78.85  ? 131  DG  I OP2   1 
ATOM   2659  O "O5'" . DG  A 1 131 ? 107.543 13.633 -36.490 1.00 70.29  ? 131  DG  I "O5'" 1 
ATOM   2660  C "C5'" . DG  A 1 131 ? 106.493 14.508 -36.097 1.00 64.17  ? 131  DG  I "C5'" 1 
ATOM   2661  C "C4'" . DG  A 1 131 ? 106.247 15.552 -37.159 1.00 62.43  ? 131  DG  I "C4'" 1 
ATOM   2662  O "O4'" . DG  A 1 131 ? 107.347 16.475 -37.209 1.00 60.34  ? 131  DG  I "O4'" 1 
ATOM   2663  C "C3'" . DG  A 1 131 ? 106.033 15.063 -38.585 1.00 60.16  ? 131  DG  I "C3'" 1 
ATOM   2664  O "O3'" . DG  A 1 131 ? 104.965 15.839 -39.130 1.00 56.61  ? 131  DG  I "O3'" 1 
ATOM   2665  C "C2'" . DG  A 1 131 ? 107.365 15.339 -39.265 1.00 59.52  ? 131  DG  I "C2'" 1 
ATOM   2666  C "C1'" . DG  A 1 131 ? 107.948 16.506 -38.486 1.00 61.55  ? 131  DG  I "C1'" 1 
ATOM   2667  N N9    . DG  A 1 131 ? 109.379 16.429 -38.252 1.00 72.25  ? 131  DG  I N9    1 
ATOM   2668  C C8    . DG  A 1 131 ? 110.075 15.336 -37.786 1.00 71.95  ? 131  DG  I C8    1 
ATOM   2669  N N7    . DG  A 1 131 ? 111.340 15.578 -37.585 1.00 71.50  ? 131  DG  I N7    1 
ATOM   2670  C C5    . DG  A 1 131 ? 111.502 16.911 -37.960 1.00 73.20  ? 131  DG  I C5    1 
ATOM   2671  C C6    . DG  A 1 131 ? 112.656 17.740 -37.949 1.00 73.53  ? 131  DG  I C6    1 
ATOM   2672  O O6    . DG  A 1 131 ? 113.797 17.467 -37.596 1.00 74.43  ? 131  DG  I O6    1 
ATOM   2673  N N1    . DG  A 1 131 ? 112.373 19.016 -38.402 1.00 73.75  ? 131  DG  I N1    1 
ATOM   2674  C C2    . DG  A 1 131 ? 111.145 19.452 -38.805 1.00 73.94  ? 131  DG  I C2    1 
ATOM   2675  N N2    . DG  A 1 131 ? 111.091 20.727 -39.203 1.00 73.41  ? 131  DG  I N2    1 
ATOM   2676  N N3    . DG  A 1 131 ? 110.053 18.698 -38.818 1.00 72.05  ? 131  DG  I N3    1 
ATOM   2677  C C4    . DG  A 1 131 ? 110.304 17.441 -38.387 1.00 72.57  ? 131  DG  I C4    1 
ATOM   2678  P P     . DC  A 1 132 ? 104.470 15.608 -40.635 1.00 64.01  ? 132  DC  I P     1 
ATOM   2679  O OP1   . DC  A 1 132 ? 103.079 16.140 -40.697 1.00 74.77  ? 132  DC  I OP1   1 
ATOM   2680  O OP2   . DC  A 1 132 ? 104.715 14.186 -40.954 1.00 75.43  ? 132  DC  I OP2   1 
ATOM   2681  O "O5'" . DC  A 1 132 ? 105.462 16.543 -41.476 1.00 63.14  ? 132  DC  I "O5'" 1 
ATOM   2682  C "C5'" . DC  A 1 132 ? 105.669 17.908 -41.086 1.00 64.43  ? 132  DC  I "C5'" 1 
ATOM   2683  C "C4'" . DC  A 1 132 ? 106.661 18.611 -41.989 1.00 67.97  ? 132  DC  I "C4'" 1 
ATOM   2684  O "O4'" . DC  A 1 132 ? 108.030 18.456 -41.552 1.00 67.39  ? 132  DC  I "O4'" 1 
ATOM   2685  C "C3'" . DC  A 1 132 ? 106.645 18.249 -43.468 1.00 67.31  ? 132  DC  I "C3'" 1 
ATOM   2686  O "O3'" . DC  A 1 132 ? 106.798 19.448 -44.209 1.00 69.07  ? 132  DC  I "O3'" 1 
ATOM   2687  C "C2'" . DC  A 1 132 ? 107.904 17.412 -43.630 1.00 67.40  ? 132  DC  I "C2'" 1 
ATOM   2688  C "C1'" . DC  A 1 132 ? 108.843 18.099 -42.656 1.00 68.49  ? 132  DC  I "C1'" 1 
ATOM   2689  N N1    . DC  A 1 132 ? 109.972 17.295 -42.148 1.00 79.14  ? 132  DC  I N1    1 
ATOM   2690  C C2    . DC  A 1 132 ? 111.202 17.934 -41.937 1.00 80.43  ? 132  DC  I C2    1 
ATOM   2691  O O2    . DC  A 1 132 ? 111.307 19.136 -42.216 1.00 78.55  ? 132  DC  I O2    1 
ATOM   2692  N N3    . DC  A 1 132 ? 112.245 17.226 -41.442 1.00 80.30  ? 132  DC  I N3    1 
ATOM   2693  C C4    . DC  A 1 132 ? 112.101 15.927 -41.179 1.00 81.30  ? 132  DC  I C4    1 
ATOM   2694  N N4    . DC  A 1 132 ? 113.159 15.273 -40.707 1.00 81.61  ? 132  DC  I N4    1 
ATOM   2695  C C5    . DC  A 1 132 ? 110.866 15.245 -41.393 1.00 79.83  ? 132  DC  I C5    1 
ATOM   2696  C C6    . DC  A 1 132 ? 109.835 15.962 -41.872 1.00 78.92  ? 132  DC  I C6    1 
ATOM   2697  P P     . DA  A 1 133 ? 105.655 19.898 -45.238 1.00 68.21  ? 133  DA  I P     1 
ATOM   2698  O OP1   . DA  A 1 133 ? 104.404 20.021 -44.459 1.00 68.49  ? 133  DA  I OP1   1 
ATOM   2699  O OP2   . DA  A 1 133 ? 105.675 19.062 -46.465 1.00 68.29  ? 133  DA  I OP2   1 
ATOM   2700  O "O5'" . DA  A 1 133 ? 106.134 21.355 -45.634 1.00 70.02  ? 133  DA  I "O5'" 1 
ATOM   2701  C "C5'" . DA  A 1 133 ? 106.535 22.280 -44.628 1.00 73.49  ? 133  DA  I "C5'" 1 
ATOM   2702  C "C4'" . DA  A 1 133 ? 107.836 22.927 -45.025 1.00 77.95  ? 133  DA  I "C4'" 1 
ATOM   2703  O "O4'" . DA  A 1 133 ? 108.930 22.016 -44.785 1.00 77.80  ? 133  DA  I "O4'" 1 
ATOM   2704  C "C3'" . DA  A 1 133 ? 107.902 23.267 -46.509 1.00 81.39  ? 133  DA  I "C3'" 1 
ATOM   2705  O "O3'" . DA  A 1 133 ? 108.657 24.455 -46.685 1.00 86.84  ? 133  DA  I "O3'" 1 
ATOM   2706  C "C2'" . DA  A 1 133 ? 108.655 22.096 -47.111 1.00 79.08  ? 133  DA  I "C2'" 1 
ATOM   2707  C "C1'" . DA  A 1 133 ? 109.616 21.719 -45.999 1.00 78.05  ? 133  DA  I "C1'" 1 
ATOM   2708  N N9    . DA  A 1 133 ? 109.939 20.297 -45.971 1.00 76.92  ? 133  DA  I N9    1 
ATOM   2709  C C8    . DA  A 1 133 ? 109.130 19.252 -46.354 1.00 76.24  ? 133  DA  I C8    1 
ATOM   2710  N N7    . DA  A 1 133 ? 109.662 18.071 -46.168 1.00 75.88  ? 133  DA  I N7    1 
ATOM   2711  C C5    . DA  A 1 133 ? 110.913 18.355 -45.630 1.00 74.74  ? 133  DA  I C5    1 
ATOM   2712  C C6    . DA  A 1 133 ? 111.958 17.534 -45.193 1.00 73.87  ? 133  DA  I C6    1 
ATOM   2713  N N6    . DA  A 1 133 ? 111.928 16.206 -45.257 1.00 73.85  ? 133  DA  I N6    1 
ATOM   2714  N N1    . DA  A 1 133 ? 113.055 18.133 -44.690 1.00 73.39  ? 133  DA  I N1    1 
ATOM   2715  C C2    . DA  A 1 133 ? 113.102 19.468 -44.655 1.00 73.30  ? 133  DA  I C2    1 
ATOM   2716  N N3    . DA  A 1 133 ? 112.189 20.351 -45.044 1.00 73.34  ? 133  DA  I N3    1 
ATOM   2717  C C4    . DA  A 1 133 ? 111.100 19.724 -45.520 1.00 75.60  ? 133  DA  I C4    1 
ATOM   2718  P P     . DG  A 1 134 ? 108.296 25.449 -47.883 1.00 85.49  ? 134  DG  I P     1 
ATOM   2719  O OP1   . DG  A 1 134 ? 107.403 26.511 -47.345 1.00 95.37  ? 134  DG  I OP1   1 
ATOM   2720  O OP2   . DG  A 1 134 ? 107.861 24.649 -49.056 1.00 93.46  ? 134  DG  I OP2   1 
ATOM   2721  O "O5'" . DG  A 1 134 ? 109.708 26.065 -48.245 1.00 87.21  ? 134  DG  I "O5'" 1 
ATOM   2722  C "C5'" . DG  A 1 134 ? 110.322 25.709 -49.461 1.00 89.18  ? 134  DG  I "C5'" 1 
ATOM   2723  C "C4'" . DG  A 1 134 ? 111.743 25.262 -49.226 1.00 89.51  ? 134  DG  I "C4'" 1 
ATOM   2724  O "O4'" . DG  A 1 134 ? 111.787 23.958 -48.589 1.00 88.21  ? 134  DG  I "O4'" 1 
ATOM   2725  C "C3'" . DG  A 1 134 ? 112.457 25.103 -50.560 1.00 90.36  ? 134  DG  I "C3'" 1 
ATOM   2726  O "O3'" . DG  A 1 134 ? 113.742 25.685 -50.524 1.00 93.11  ? 134  DG  I "O3'" 1 
ATOM   2727  C "C2'" . DG  A 1 134 ? 112.547 23.609 -50.774 1.00 88.11  ? 134  DG  I "C2'" 1 
ATOM   2728  C "C1'" . DG  A 1 134 ? 112.577 23.063 -49.365 1.00 85.46  ? 134  DG  I "C1'" 1 
ATOM   2729  N N9    . DG  A 1 134 ? 111.974 21.732 -49.305 1.00 90.39  ? 134  DG  I N9    1 
ATOM   2730  C C8    . DG  A 1 134 ? 110.707 21.379 -49.714 1.00 88.94  ? 134  DG  I C8    1 
ATOM   2731  N N7    . DG  A 1 134 ? 110.459 20.104 -49.583 1.00 85.62  ? 134  DG  I N7    1 
ATOM   2732  C C5    . DG  A 1 134 ? 111.623 19.582 -49.041 1.00 84.55  ? 134  DG  I C5    1 
ATOM   2733  C C6    . DG  A 1 134 ? 111.948 18.249 -48.676 1.00 81.99  ? 134  DG  I C6    1 
ATOM   2734  O O6    . DG  A 1 134 ? 111.242 17.235 -48.750 1.00 75.31  ? 134  DG  I O6    1 
ATOM   2735  N N1    . DG  A 1 134 ? 113.246 18.158 -48.182 1.00 82.26  ? 134  DG  I N1    1 
ATOM   2736  C C2    . DG  A 1 134 ? 114.121 19.211 -48.052 1.00 83.76  ? 134  DG  I C2    1 
ATOM   2737  N N2    . DG  A 1 134 ? 115.332 18.909 -47.561 1.00 84.10  ? 134  DG  I N2    1 
ATOM   2738  N N3    . DG  A 1 134 ? 113.829 20.462 -48.379 1.00 85.03  ? 134  DG  I N3    1 
ATOM   2739  C C4    . DG  A 1 134 ? 112.573 20.574 -48.862 1.00 87.13  ? 134  DG  I C4    1 
ATOM   2740  P P     . DG  A 1 135 ? 114.574 25.777 -51.878 1.00 104.36 ? 135  DG  I P     1 
ATOM   2741  O OP1   . DG  A 1 135 ? 115.518 26.911 -51.753 1.00 95.11  ? 135  DG  I OP1   1 
ATOM   2742  O OP2   . DG  A 1 135 ? 113.600 25.741 -52.999 1.00 94.39  ? 135  DG  I OP2   1 
ATOM   2743  O "O5'" . DG  A 1 135 ? 115.390 24.417 -51.864 1.00 103.92 ? 135  DG  I "O5'" 1 
ATOM   2744  C "C5'" . DG  A 1 135 ? 116.347 24.165 -50.842 1.00 102.84 ? 135  DG  I "C5'" 1 
ATOM   2745  C "C4'" . DG  A 1 135 ? 117.255 23.043 -51.276 1.00 102.35 ? 135  DG  I "C4'" 1 
ATOM   2746  O "O4'" . DG  A 1 135 ? 116.720 21.766 -50.848 1.00 101.28 ? 135  DG  I "O4'" 1 
ATOM   2747  C "C3'" . DG  A 1 135 ? 117.377 22.982 -52.796 1.00 102.55 ? 135  DG  I "C3'" 1 
ATOM   2748  O "O3'" . DG  A 1 135 ? 118.730 22.807 -53.182 1.00 104.65 ? 135  DG  I "O3'" 1 
ATOM   2749  C "C2'" . DG  A 1 135 ? 116.531 21.781 -53.180 1.00 101.10 ? 135  DG  I "C2'" 1 
ATOM   2750  C "C1'" . DG  A 1 135 ? 116.649 20.887 -51.955 1.00 99.17  ? 135  DG  I "C1'" 1 
ATOM   2751  N N9    . DG  A 1 135 ? 115.496 20.012 -51.764 1.00 86.03  ? 135  DG  I N9    1 
ATOM   2752  C C8    . DG  A 1 135 ? 114.190 20.361 -51.937 1.00 84.45  ? 135  DG  I C8    1 
ATOM   2753  N N7    . DG  A 1 135 ? 113.366 19.366 -51.761 1.00 83.36  ? 135  DG  I N7    1 
ATOM   2754  C C5    . DG  A 1 135 ? 114.180 18.297 -51.436 1.00 83.36  ? 135  DG  I C5    1 
ATOM   2755  C C6    . DG  A 1 135 ? 113.845 16.942 -51.140 1.00 82.95  ? 135  DG  I C6    1 
ATOM   2756  O O6    . DG  A 1 135 ? 112.727 16.408 -51.124 1.00 81.40  ? 135  DG  I O6    1 
ATOM   2757  N N1    . DG  A 1 135 ? 114.975 16.188 -50.848 1.00 83.38  ? 135  DG  I N1    1 
ATOM   2758  C C2    . DG  A 1 135 ? 116.260 16.667 -50.847 1.00 83.49  ? 135  DG  I C2    1 
ATOM   2759  N N2    . DG  A 1 135 ? 117.202 15.774 -50.529 1.00 83.38  ? 135  DG  I N2    1 
ATOM   2760  N N3    . DG  A 1 135 ? 116.590 17.925 -51.134 1.00 83.10  ? 135  DG  I N3    1 
ATOM   2761  C C4    . DG  A 1 135 ? 115.504 18.678 -51.414 1.00 84.57  ? 135  DG  I C4    1 
ATOM   2762  P P     . DT  A 1 136 ? 119.071 22.448 -54.701 1.00 115.35 ? 136  DT  I P     1 
ATOM   2763  O OP1   . DT  A 1 136 ? 120.414 22.984 -55.029 1.00 95.58  ? 136  DT  I OP1   1 
ATOM   2764  O OP2   . DT  A 1 136 ? 117.903 22.831 -55.526 1.00 95.66  ? 136  DT  I OP2   1 
ATOM   2765  O "O5'" . DT  A 1 136 ? 119.163 20.864 -54.653 1.00 114.82 ? 136  DT  I "O5'" 1 
ATOM   2766  C "C5'" . DT  A 1 136 ? 120.027 20.229 -53.719 1.00 114.62 ? 136  DT  I "C5'" 1 
ATOM   2767  C "C4'" . DT  A 1 136 ? 120.431 18.879 -54.247 1.00 115.35 ? 136  DT  I "C4'" 1 
ATOM   2768  O "O4'" . DT  A 1 136 ? 119.429 17.901 -53.880 1.00 113.77 ? 136  DT  I "O4'" 1 
ATOM   2769  C "C3'" . DT  A 1 136 ? 120.513 18.873 -55.772 1.00 115.95 ? 136  DT  I "C3'" 1 
ATOM   2770  O "O3'" . DT  A 1 136 ? 121.646 18.141 -56.240 1.00 118.47 ? 136  DT  I "O3'" 1 
ATOM   2771  C "C2'" . DT  A 1 136 ? 119.223 18.198 -56.191 1.00 115.26 ? 136  DT  I "C2'" 1 
ATOM   2772  C "C1'" . DT  A 1 136 ? 118.938 17.252 -55.038 1.00 113.65 ? 136  DT  I "C1'" 1 
ATOM   2773  N N1    . DT  A 1 136 ? 117.499 17.016 -54.848 1.00 92.35  ? 136  DT  I N1    1 
ATOM   2774  C C2    . DT  A 1 136 ? 117.040 15.734 -54.602 1.00 91.68  ? 136  DT  I C2    1 
ATOM   2775  O O2    . DT  A 1 136 ? 117.772 14.759 -54.501 1.00 91.37  ? 136  DT  I O2    1 
ATOM   2776  N N3    . DT  A 1 136 ? 115.678 15.635 -54.481 1.00 90.56  ? 136  DT  I N3    1 
ATOM   2777  C C4    . DT  A 1 136 ? 114.756 16.661 -54.570 1.00 91.17  ? 136  DT  I C4    1 
ATOM   2778  O O4    . DT  A 1 136 ? 113.561 16.416 -54.443 1.00 91.52  ? 136  DT  I O4    1 
ATOM   2779  C C5    . DT  A 1 136 ? 115.313 17.976 -54.817 1.00 91.15  ? 136  DT  I C5    1 
ATOM   2780  C C7    . DT  A 1 136 ? 114.401 19.152 -54.929 1.00 90.70  ? 136  DT  I C7    1 
ATOM   2781  C C6    . DT  A 1 136 ? 116.634 18.082 -54.934 1.00 91.19  ? 136  DT  I C6    1 
ATOM   2782  P P     . DG  A 1 137 ? 121.673 17.609 -57.753 1.00 118.88 ? 137  DG  I P     1 
ATOM   2783  O OP1   . DG  A 1 137 ? 123.058 17.234 -58.109 1.00 114.96 ? 137  DG  I OP1   1 
ATOM   2784  O OP2   . DG  A 1 137 ? 120.937 18.570 -58.607 1.00 114.71 ? 137  DG  I OP2   1 
ATOM   2785  O "O5'" . DG  A 1 137 ? 120.831 16.276 -57.638 1.00 117.73 ? 137  DG  I "O5'" 1 
ATOM   2786  C "C5'" . DG  A 1 137 ? 121.274 15.229 -56.791 1.00 115.17 ? 137  DG  I "C5'" 1 
ATOM   2787  C "C4'" . DG  A 1 137 ? 120.863 13.914 -57.393 1.00 113.23 ? 137  DG  I "C4'" 1 
ATOM   2788  O "O4'" . DG  A 1 137 ? 119.439 13.735 -57.217 1.00 111.79 ? 137  DG  I "O4'" 1 
ATOM   2789  C "C3'" . DG  A 1 137 ? 121.094 13.911 -58.899 1.00 112.73 ? 137  DG  I "C3'" 1 
ATOM   2790  O "O3'" . DG  A 1 137 ? 121.356 12.585 -59.320 1.00 112.76 ? 137  DG  I "O3'" 1 
ATOM   2791  C "C2'" . DG  A 1 137 ? 119.762 14.376 -59.455 1.00 111.26 ? 137  DG  I "C2'" 1 
ATOM   2792  C "C1'" . DG  A 1 137 ? 118.784 13.743 -58.479 1.00 110.26 ? 137  DG  I "C1'" 1 
ATOM   2793  N N9    . DG  A 1 137 ? 117.510 14.436 -58.308 1.00 103.25 ? 137  DG  I N9    1 
ATOM   2794  C C8    . DG  A 1 137 ? 117.253 15.788 -58.422 1.00 102.72 ? 137  DG  I C8    1 
ATOM   2795  N N7    . DG  A 1 137 ? 116.010 16.098 -58.162 1.00 101.11 ? 137  DG  I N7    1 
ATOM   2796  C C5    . DG  A 1 137 ? 115.408 14.879 -57.867 1.00 100.74 ? 137  DG  I C5    1 
ATOM   2797  C C6    . DG  A 1 137 ? 114.073 14.575 -57.504 1.00 99.24  ? 137  DG  I C6    1 
ATOM   2798  O O6    . DG  A 1 137 ? 113.125 15.343 -57.343 1.00 97.34  ? 137  DG  I O6    1 
ATOM   2799  N N1    . DG  A 1 137 ? 113.895 13.209 -57.317 1.00 99.00  ? 137  DG  I N1    1 
ATOM   2800  C C2    . DG  A 1 137 ? 114.874 12.256 -57.451 1.00 99.25  ? 137  DG  I C2    1 
ATOM   2801  N N2    . DG  A 1 137 ? 114.508 10.988 -57.233 1.00 99.16  ? 137  DG  I N2    1 
ATOM   2802  N N3    . DG  A 1 137 ? 116.120 12.524 -57.775 1.00 99.69  ? 137  DG  I N3    1 
ATOM   2803  C C4    . DG  A 1 137 ? 116.318 13.846 -57.969 1.00 101.49 ? 137  DG  I C4    1 
ATOM   2804  P P     . DG  A 1 138 ? 122.076 12.333 -60.720 1.00 109.21 ? 138  DG  I P     1 
ATOM   2805  O OP1   . DG  A 1 138 ? 123.467 11.908 -60.404 1.00 85.75  ? 138  DG  I OP1   1 
ATOM   2806  O OP2   . DG  A 1 138 ? 121.829 13.523 -61.584 1.00 85.03  ? 138  DG  I OP2   1 
ATOM   2807  O "O5'" . DG  A 1 138 ? 121.278 11.093 -61.308 1.00 107.09 ? 138  DG  I "O5'" 1 
ATOM   2808  C "C5'" . DG  A 1 138 ? 120.740 10.110 -60.434 1.00 103.85 ? 138  DG  I "C5'" 1 
ATOM   2809  C "C4'" . DG  A 1 138 ? 119.384 9.675  -60.930 1.00 102.11 ? 138  DG  I "C4'" 1 
ATOM   2810  O "O4'" . DG  A 1 138 ? 118.366 10.666 -60.648 1.00 101.08 ? 138  DG  I "O4'" 1 
ATOM   2811  C "C3'" . DG  A 1 138 ? 119.335 9.455  -62.436 1.00 101.33 ? 138  DG  I "C3'" 1 
ATOM   2812  O "O3'" . DG  A 1 138 ? 118.484 8.356  -62.685 1.00 101.83 ? 138  DG  I "O3'" 1 
ATOM   2813  C "C2'" . DG  A 1 138 ? 118.665 10.715 -62.951 1.00 100.40 ? 138  DG  I "C2'" 1 
ATOM   2814  C "C1'" . DG  A 1 138 ? 117.661 10.959 -61.848 1.00 98.96  ? 138  DG  I "C1'" 1 
ATOM   2815  N N9    . DG  A 1 138 ? 117.123 12.313 -61.748 1.00 72.72  ? 138  DG  I N9    1 
ATOM   2816  C C8    . DG  A 1 138 ? 117.773 13.503 -62.004 1.00 71.23  ? 138  DG  I C8    1 
ATOM   2817  N N7    . DG  A 1 138 ? 117.026 14.555 -61.791 1.00 69.19  ? 138  DG  I N7    1 
ATOM   2818  C C5    . DG  A 1 138 ? 115.802 14.029 -61.379 1.00 69.17  ? 138  DG  I C5    1 
ATOM   2819  C C6    . DG  A 1 138 ? 114.584 14.682 -61.006 1.00 68.25  ? 138  DG  I C6    1 
ATOM   2820  O O6    . DG  A 1 138 ? 114.337 15.903 -60.955 1.00 65.85  ? 138  DG  I O6    1 
ATOM   2821  N N1    . DG  A 1 138 ? 113.597 13.760 -60.666 1.00 67.44  ? 138  DG  I N1    1 
ATOM   2822  C C2    . DG  A 1 138 ? 113.751 12.401 -60.681 1.00 68.70  ? 138  DG  I C2    1 
ATOM   2823  N N2    . DG  A 1 138 ? 112.694 11.695 -60.326 1.00 68.47  ? 138  DG  I N2    1 
ATOM   2824  N N3    . DG  A 1 138 ? 114.865 11.782 -61.023 1.00 69.86  ? 138  DG  I N3    1 
ATOM   2825  C C4    . DG  A 1 138 ? 115.847 12.649 -61.357 1.00 70.60  ? 138  DG  I C4    1 
ATOM   2826  P P     . DA  A 1 139 ? 118.557 7.622  -64.094 1.00 93.69  ? 139  DA  I P     1 
ATOM   2827  O OP1   . DA  A 1 139 ? 119.661 6.629  -64.008 1.00 93.68  ? 139  DA  I OP1   1 
ATOM   2828  O OP2   . DA  A 1 139 ? 118.568 8.655  -65.166 1.00 94.08  ? 139  DA  I OP2   1 
ATOM   2829  O "O5'" . DA  A 1 139 ? 117.171 6.859  -64.172 1.00 90.43  ? 139  DA  I "O5'" 1 
ATOM   2830  C "C5'" . DA  A 1 139 ? 116.642 6.227  -63.029 1.00 85.62  ? 139  DA  I "C5'" 1 
ATOM   2831  C "C4'" . DA  A 1 139 ? 115.144 6.350  -63.043 1.00 83.38  ? 139  DA  I "C4'" 1 
ATOM   2832  O "O4'" . DA  A 1 139 ? 114.769 7.715  -62.760 1.00 81.46  ? 139  DA  I "O4'" 1 
ATOM   2833  C "C3'" . DA  A 1 139 ? 114.519 6.012  -64.393 1.00 82.88  ? 139  DA  I "C3'" 1 
ATOM   2834  O "O3'" . DA  A 1 139 ? 113.337 5.259  -64.167 1.00 84.23  ? 139  DA  I "O3'" 1 
ATOM   2835  C "C2'" . DA  A 1 139 ? 114.184 7.367  -64.992 1.00 80.83  ? 139  DA  I "C2'" 1 
ATOM   2836  C "C1'" . DA  A 1 139 ? 113.883 8.196  -63.761 1.00 79.15  ? 139  DA  I "C1'" 1 
ATOM   2837  N N9    . DA  A 1 139 ? 114.123 9.634  -63.907 1.00 74.43  ? 139  DA  I N9    1 
ATOM   2838  C C8    . DA  A 1 139 ? 115.336 10.256 -64.088 1.00 74.58  ? 139  DA  I C8    1 
ATOM   2839  N N7    . DA  A 1 139 ? 115.255 11.563 -64.172 1.00 72.18  ? 139  DA  I N7    1 
ATOM   2840  C C5    . DA  A 1 139 ? 113.898 11.823 -64.038 1.00 71.20  ? 139  DA  I C5    1 
ATOM   2841  C C6    . DA  A 1 139 ? 113.165 13.020 -64.036 1.00 68.80  ? 139  DA  I C6    1 
ATOM   2842  N N6    . DA  A 1 139 ? 113.711 14.224 -64.192 1.00 64.68  ? 139  DA  I N6    1 
ATOM   2843  N N1    . DA  A 1 139 ? 111.833 12.936 -63.869 1.00 66.07  ? 139  DA  I N1    1 
ATOM   2844  C C2    . DA  A 1 139 ? 111.281 11.726 -63.722 1.00 68.62  ? 139  DA  I C2    1 
ATOM   2845  N N3    . DA  A 1 139 ? 111.859 10.530 -63.714 1.00 70.79  ? 139  DA  I N3    1 
ATOM   2846  C C4    . DA  A 1 139 ? 113.188 10.646 -63.877 1.00 72.24  ? 139  DA  I C4    1 
ATOM   2847  P P     . DT  A 1 140 ? 112.499 4.710  -65.408 1.00 97.35  ? 140  DT  I P     1 
ATOM   2848  O OP1   . DT  A 1 140 ? 111.784 3.488  -64.957 1.00 81.32  ? 140  DT  I OP1   1 
ATOM   2849  O OP2   . DT  A 1 140 ? 113.376 4.669  -66.616 1.00 79.17  ? 140  DT  I OP2   1 
ATOM   2850  O "O5'" . DT  A 1 140 ? 111.424 5.852  -65.614 1.00 94.94  ? 140  DT  I "O5'" 1 
ATOM   2851  C "C5'" . DT  A 1 140 ? 110.386 6.037  -64.672 1.00 91.09  ? 140  DT  I "C5'" 1 
ATOM   2852  C "C4'" . DT  A 1 140 ? 109.369 6.992  -65.240 1.00 89.38  ? 140  DT  I "C4'" 1 
ATOM   2853  O "O4'" . DT  A 1 140 ? 109.934 8.322  -65.254 1.00 87.43  ? 140  DT  I "O4'" 1 
ATOM   2854  C "C3'" . DT  A 1 140 ? 108.981 6.686  -66.690 1.00 88.63  ? 140  DT  I "C3'" 1 
ATOM   2855  O "O3'" . DT  A 1 140 ? 107.615 7.023  -66.871 1.00 91.03  ? 140  DT  I "O3'" 1 
ATOM   2856  C "C2'" . DT  A 1 140 ? 109.808 7.684  -67.478 1.00 85.78  ? 140  DT  I "C2'" 1 
ATOM   2857  C "C1'" . DT  A 1 140 ? 109.743 8.865  -66.541 1.00 84.35  ? 140  DT  I "C1'" 1 
ATOM   2858  N N1    . DT  A 1 140 ? 110.722 9.940  -66.738 1.00 65.40  ? 140  DT  I N1    1 
ATOM   2859  C C2    . DT  A 1 140 ? 110.254 11.230 -66.575 1.00 63.18  ? 140  DT  I C2    1 
ATOM   2860  O O2    . DT  A 1 140 ? 109.104 11.482 -66.223 1.00 63.30  ? 140  DT  I O2    1 
ATOM   2861  N N3    . DT  A 1 140 ? 111.188 12.212 -66.820 1.00 61.10  ? 140  DT  I N3    1 
ATOM   2862  C C4    . DT  A 1 140 ? 112.511 12.030 -67.187 1.00 60.77  ? 140  DT  I C4    1 
ATOM   2863  O O4    . DT  A 1 140 ? 113.226 13.005 -67.391 1.00 57.56  ? 140  DT  I O4    1 
ATOM   2864  C C5    . DT  A 1 140 ? 112.940 10.652 -67.301 1.00 60.84  ? 140  DT  I C5    1 
ATOM   2865  C C7    . DT  A 1 140 ? 114.364 10.365 -67.654 1.00 60.89  ? 140  DT  I C7    1 
ATOM   2866  C C6    . DT  A 1 140 ? 112.034 9.687  -67.080 1.00 61.40  ? 140  DT  I C6    1 
ATOM   2867  P P     . DA  A 1 141 ? 106.575 5.933  -67.423 1.00 93.17  ? 141  DA  I P     1 
ATOM   2868  O OP1   . DA  A 1 141 ? 106.511 4.818  -66.433 1.00 76.78  ? 141  DA  I OP1   1 
ATOM   2869  O OP2   . DA  A 1 141 ? 106.878 5.639  -68.852 1.00 76.39  ? 141  DA  I OP2   1 
ATOM   2870  O "O5'" . DA  A 1 141 ? 105.210 6.749  -67.326 1.00 92.18  ? 141  DA  I "O5'" 1 
ATOM   2871  C "C5'" . DA  A 1 141 ? 104.908 7.491  -66.133 1.00 87.74  ? 141  DA  I "C5'" 1 
ATOM   2872  C "C4'" . DA  A 1 141 ? 104.405 8.881  -66.466 1.00 85.46  ? 141  DA  I "C4'" 1 
ATOM   2873  O "O4'" . DA  A 1 141 ? 105.461 9.840  -66.726 1.00 82.74  ? 141  DA  I "O4'" 1 
ATOM   2874  C "C3'" . DA  A 1 141 ? 103.477 8.947  -67.668 1.00 83.78  ? 141  DA  I "C3'" 1 
ATOM   2875  O "O3'" . DA  A 1 141 ? 102.380 9.799  -67.367 1.00 83.70  ? 141  DA  I "O3'" 1 
ATOM   2876  C "C2'" . DA  A 1 141 ? 104.352 9.547  -68.754 1.00 81.44  ? 141  DA  I "C2'" 1 
ATOM   2877  C "C1'" . DA  A 1 141 ? 105.239 10.488 -67.968 1.00 79.19  ? 141  DA  I "C1'" 1 
ATOM   2878  N N9    . DA  A 1 141 ? 106.551 10.734 -68.566 1.00 60.97  ? 141  DA  I N9    1 
ATOM   2879  C C8    . DA  A 1 141 ? 107.526 9.801  -68.799 1.00 61.48  ? 141  DA  I C8    1 
ATOM   2880  N N7    . DA  A 1 141 ? 108.647 10.305 -69.255 1.00 60.66  ? 141  DA  I N7    1 
ATOM   2881  C C5    . DA  A 1 141 ? 108.390 11.660 -69.344 1.00 59.05  ? 141  DA  I C5    1 
ATOM   2882  C C6    . DA  A 1 141 ? 109.193 12.735 -69.721 1.00 57.97  ? 141  DA  I C6    1 
ATOM   2883  N N6    . DA  A 1 141 ? 110.473 12.605 -70.057 1.00 57.40  ? 141  DA  I N6    1 
ATOM   2884  N N1    . DA  A 1 141 ? 108.640 13.965 -69.724 1.00 55.80  ? 141  DA  I N1    1 
ATOM   2885  C C2    . DA  A 1 141 ? 107.358 14.087 -69.348 1.00 56.90  ? 141  DA  I C2    1 
ATOM   2886  N N3    . DA  A 1 141 ? 106.504 13.149 -68.947 1.00 58.62  ? 141  DA  I N3    1 
ATOM   2887  C C4    . DA  A 1 141 ? 107.091 11.939 -68.961 1.00 58.88  ? 141  DA  I C4    1 
ATOM   2888  P P     . DT  A 1 142 ? 101.351 10.170 -68.527 1.00 82.14  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 142 ? 100.015 10.434 -67.950 1.00 72.99  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 142 ? 101.502 9.195  -69.626 1.00 71.70  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 142 ? 101.935 11.534 -69.056 1.00 79.45  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 142 ? 101.920 12.656 -68.216 1.00 75.94  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 142 ? 101.975 13.902 -69.054 1.00 75.39  ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 142 ? 103.307 14.130 -69.552 1.00 74.03  ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 142 ? 101.078 13.881 -70.286 1.00 74.15  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 142 ? 100.749 15.248 -70.445 1.00 74.74  ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 142 ? 102.039 13.451 -71.385 1.00 74.41  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 142 ? 103.233 14.270 -70.956 1.00 75.29  ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 142 ? 104.526 13.908 -71.482 1.00 65.21  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 142 ? 105.386 14.944 -71.768 1.00 65.60  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 142 ? 105.100 16.121 -71.593 1.00 65.39  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 142 ? 106.597 14.552 -72.254 1.00 66.49  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 142 ? 107.026 13.258 -72.453 1.00 65.39  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 142 ? 108.143 13.059 -72.897 1.00 66.14  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 142 ? 106.075 12.223 -72.107 1.00 64.66  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 142 ? 106.468 10.791 -72.244 1.00 63.21  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 142 ? 104.883 12.598 -71.660 1.00 63.71  ? 142  DT  I C6    1 
ATOM   2908  P P     . DT  A 1 143 ? 99.506  15.712 -71.303 1.00 74.17  ? 143  DT  I P     1 
ATOM   2909  O OP1   . DT  A 1 143 ? 98.805  16.441 -70.231 1.00 72.45  ? 143  DT  I OP1   1 
ATOM   2910  O OP2   . DT  A 1 143 ? 98.861  14.560 -71.986 1.00 69.52  ? 143  DT  I OP2   1 
ATOM   2911  O "O5'" . DT  A 1 143 ? 100.192 16.753 -72.281 1.00 73.38  ? 143  DT  I "O5'" 1 
ATOM   2912  C "C5'" . DT  A 1 143 ? 101.147 17.640 -71.733 1.00 71.89  ? 143  DT  I "C5'" 1 
ATOM   2913  C "C4'" . DT  A 1 143 ? 101.967 18.263 -72.828 1.00 72.89  ? 143  DT  I "C4'" 1 
ATOM   2914  O "O4'" . DT  A 1 143 ? 103.075 17.419 -73.204 1.00 71.41  ? 143  DT  I "O4'" 1 
ATOM   2915  C "C3'" . DT  A 1 143 ? 101.160 18.499 -74.091 1.00 72.07  ? 143  DT  I "C3'" 1 
ATOM   2916  O "O3'" . DT  A 1 143 ? 101.446 19.804 -74.571 1.00 72.70  ? 143  DT  I "O3'" 1 
ATOM   2917  C "C2'" . DT  A 1 143 ? 101.649 17.406 -75.026 1.00 72.28  ? 143  DT  I "C2'" 1 
ATOM   2918  C "C1'" . DT  A 1 143 ? 103.095 17.275 -74.605 1.00 71.87  ? 143  DT  I "C1'" 1 
ATOM   2919  N N1    . DT  A 1 143 ? 103.760 15.998 -74.911 1.00 62.84  ? 143  DT  I N1    1 
ATOM   2920  C C2    . DT  A 1 143 ? 105.083 16.042 -75.325 1.00 63.13  ? 143  DT  I C2    1 
ATOM   2921  O O2    . DT  A 1 143 ? 105.695 17.076 -75.516 1.00 61.67  ? 143  DT  I O2    1 
ATOM   2922  N N3    . DT  A 1 143 ? 105.663 14.822 -75.515 1.00 62.33  ? 143  DT  I N3    1 
ATOM   2923  C C4    . DT  A 1 143 ? 105.073 13.588 -75.354 1.00 63.98  ? 143  DT  I C4    1 
ATOM   2924  O O4    . DT  A 1 143 ? 105.732 12.574 -75.521 1.00 66.77  ? 143  DT  I O4    1 
ATOM   2925  C C5    . DT  A 1 143 ? 103.682 13.609 -74.972 1.00 63.30  ? 143  DT  I C5    1 
ATOM   2926  C C7    . DT  A 1 143 ? 102.966 12.305 -74.824 1.00 63.96  ? 143  DT  I C7    1 
ATOM   2927  C C6    . DT  A 1 143 ? 103.099 14.800 -74.766 1.00 62.53  ? 143  DT  I C6    1 
ATOM   2928  P P     . DG  A 1 144 ? 100.427 20.510 -75.583 1.00 68.85  ? 144  DG  I P     1 
ATOM   2929  O OP1   . DG  A 1 144 ? 100.047 21.836 -75.053 1.00 59.53  ? 144  DG  I OP1   1 
ATOM   2930  O OP2   . DG  A 1 144 ? 99.370  19.531 -75.951 1.00 57.96  ? 144  DG  I OP2   1 
ATOM   2931  O "O5'" . DG  A 1 144 ? 101.361 20.766 -76.836 1.00 70.62  ? 144  DG  I "O5'" 1 
ATOM   2932  C "C5'" . DG  A 1 144 ? 102.587 21.477 -76.670 1.00 75.71  ? 144  DG  I "C5'" 1 
ATOM   2933  C "C4'" . DG  A 1 144 ? 103.511 21.188 -77.826 1.00 77.79  ? 144  DG  I "C4'" 1 
ATOM   2934  O "O4'" . DG  A 1 144 ? 104.075 19.853 -77.722 1.00 76.50  ? 144  DG  I "O4'" 1 
ATOM   2935  C "C3'" . DG  A 1 144 ? 102.812 21.255 -79.182 1.00 79.63  ? 144  DG  I "C3'" 1 
ATOM   2936  O "O3'" . DG  A 1 144 ? 103.684 21.923 -80.087 1.00 85.64  ? 144  DG  I "O3'" 1 
ATOM   2937  C "C2'" . DG  A 1 144 ? 102.630 19.793 -79.552 1.00 78.09  ? 144  DG  I "C2'" 1 
ATOM   2938  C "C1'" . DG  A 1 144 ? 103.886 19.184 -78.954 1.00 76.76  ? 144  DG  I "C1'" 1 
ATOM   2939  N N9    . DG  A 1 144 ? 103.863 17.737 -78.720 1.00 67.50  ? 144  DG  I N9    1 
ATOM   2940  C C8    . DG  A 1 144 ? 102.799 16.965 -78.316 1.00 67.80  ? 144  DG  I C8    1 
ATOM   2941  N N7    . DG  A 1 144 ? 103.076 15.686 -78.283 1.00 67.26  ? 144  DG  I N7    1 
ATOM   2942  C C5    . DG  A 1 144 ? 104.409 15.609 -78.667 1.00 67.78  ? 144  DG  I C5    1 
ATOM   2943  C C6    . DG  A 1 144 ? 105.269 14.477 -78.827 1.00 67.18  ? 144  DG  I C6    1 
ATOM   2944  O O6    . DG  A 1 144 ? 105.014 13.281 -78.641 1.00 67.42  ? 144  DG  I O6    1 
ATOM   2945  N N1    . DG  A 1 144 ? 106.540 14.853 -79.243 1.00 65.63  ? 144  DG  I N1    1 
ATOM   2946  C C2    . DG  A 1 144 ? 106.944 16.146 -79.471 1.00 67.89  ? 144  DG  I C2    1 
ATOM   2947  N N2    . DG  A 1 144 ? 108.205 16.308 -79.879 1.00 68.45  ? 144  DG  I N2    1 
ATOM   2948  N N3    . DG  A 1 144 ? 106.166 17.205 -79.316 1.00 68.99  ? 144  DG  I N3    1 
ATOM   2949  C C4    . DG  A 1 144 ? 104.919 16.866 -78.922 1.00 67.89  ? 144  DG  I C4    1 
ATOM   2950  P P     . DA  A 1 145 ? 103.209 22.232 -81.589 1.00 104.97 ? 145  DA  I P     1 
ATOM   2951  O OP1   . DA  A 1 145 ? 103.172 23.702 -81.781 1.00 69.63  ? 145  DA  I OP1   1 
ATOM   2952  O OP2   . DA  A 1 145 ? 102.011 21.406 -81.927 1.00 67.56  ? 145  DA  I OP2   1 
ATOM   2953  O "O5'" . DA  A 1 145 ? 104.456 21.706 -82.407 1.00 103.53 ? 145  DA  I "O5'" 1 
ATOM   2954  C "C5'" . DA  A 1 145 ? 105.773 21.897 -81.897 1.00 104.31 ? 145  DA  I "C5'" 1 
ATOM   2955  C "C4'" . DA  A 1 145 ? 106.733 21.094 -82.731 1.00 104.92 ? 145  DA  I "C4'" 1 
ATOM   2956  O "O4'" . DA  A 1 145 ? 106.749 19.717 -82.277 1.00 101.96 ? 145  DA  I "O4'" 1 
ATOM   2957  C "C3'" . DA  A 1 145 ? 106.206 21.066 -84.163 1.00 106.24 ? 145  DA  I "C3'" 1 
ATOM   2958  O "O3'" . DA  A 1 145 ? 107.255 21.137 -85.120 1.00 109.95 ? 145  DA  I "O3'" 1 
ATOM   2959  C "C2'" . DA  A 1 145 ? 105.506 19.731 -84.252 1.00 103.43 ? 145  DA  I "C2'" 1 
ATOM   2960  C "C1'" . DA  A 1 145 ? 106.365 18.878 -83.348 1.00 99.86  ? 145  DA  I "C1'" 1 
ATOM   2961  N N9    . DA  A 1 145 ? 105.588 17.772 -82.812 1.00 61.03  ? 145  DA  I N9    1 
ATOM   2962  C C8    . DA  A 1 145 ? 104.319 17.834 -82.310 1.00 60.12  ? 145  DA  I C8    1 
ATOM   2963  N N7    . DA  A 1 145 ? 103.828 16.671 -81.973 1.00 57.76  ? 145  DA  I N7    1 
ATOM   2964  C C5    . DA  A 1 145 ? 104.849 15.789 -82.250 1.00 57.37  ? 145  DA  I C5    1 
ATOM   2965  C C6    . DA  A 1 145 ? 104.942 14.423 -82.100 1.00 57.87  ? 145  DA  I C6    1 
ATOM   2966  N N6    . DA  A 1 145 ? 103.946 13.688 -81.626 1.00 57.00  ? 145  DA  I N6    1 
ATOM   2967  N N1    . DA  A 1 145 ? 106.100 13.823 -82.455 1.00 57.87  ? 145  DA  I N1    1 
ATOM   2968  C C2    . DA  A 1 145 ? 107.090 14.587 -82.940 1.00 56.27  ? 145  DA  I C2    1 
ATOM   2969  N N3    . DA  A 1 145 ? 107.117 15.901 -83.134 1.00 58.65  ? 145  DA  I N3    1 
ATOM   2970  C C4    . DA  A 1 145 ? 105.949 16.449 -82.760 1.00 59.03  ? 145  DA  I C4    1 
ATOM   2971  P P     . DT  A 1 146 ? 106.915 21.543 -86.642 1.00 120.71 ? 146  DT  I P     1 
ATOM   2972  O OP1   . DT  A 1 146 ? 107.751 22.725 -87.000 1.00 76.87  ? 146  DT  I OP1   1 
ATOM   2973  O OP2   . DT  A 1 146 ? 105.430 21.616 -86.805 1.00 77.90  ? 146  DT  I OP2   1 
ATOM   2974  O "O5'" . DT  A 1 146 ? 107.427 20.272 -87.443 1.00 120.29 ? 146  DT  I "O5'" 1 
ATOM   2975  C "C5'" . DT  A 1 146 ? 108.610 19.598 -87.025 1.00 120.91 ? 146  DT  I "C5'" 1 
ATOM   2976  C "C4'" . DT  A 1 146 ? 108.748 18.289 -87.762 1.00 122.28 ? 146  DT  I "C4'" 1 
ATOM   2977  O "O4'" . DT  A 1 146 ? 108.188 17.181 -87.011 1.00 120.56 ? 146  DT  I "O4'" 1 
ATOM   2978  C "C3'" . DT  A 1 146 ? 108.047 18.289 -89.122 1.00 122.75 ? 146  DT  I "C3'" 1 
ATOM   2979  O "O3'" . DT  A 1 146 ? 108.824 17.605 -90.117 1.00 123.81 ? 146  DT  I "O3'" 1 
ATOM   2980  C "C2'" . DT  A 1 146 ? 106.786 17.490 -88.846 1.00 121.25 ? 146  DT  I "C2'" 1 
ATOM   2981  C "C1'" . DT  A 1 146 ? 107.315 16.465 -87.861 1.00 119.53 ? 146  DT  I "C1'" 1 
ATOM   2982  N N1    . DT  A 1 146 ? 106.306 15.781 -87.034 1.00 77.98  ? 146  DT  I N1    1 
ATOM   2983  C C2    . DT  A 1 146 ? 106.529 14.455 -86.729 1.00 76.46  ? 146  DT  I C2    1 
ATOM   2984  O O2    . DT  A 1 146 ? 107.531 13.844 -87.079 1.00 75.85  ? 146  DT  I O2    1 
ATOM   2985  N N3    . DT  A 1 146 ? 105.530 13.862 -86.003 1.00 74.62  ? 146  DT  I N3    1 
ATOM   2986  C C4    . DT  A 1 146 ? 104.359 14.450 -85.564 1.00 74.33  ? 146  DT  I C4    1 
ATOM   2987  O O4    . DT  A 1 146 ? 103.537 13.794 -84.935 1.00 74.55  ? 146  DT  I O4    1 
ATOM   2988  C C5    . DT  A 1 146 ? 104.197 15.833 -85.904 1.00 75.23  ? 146  DT  I C5    1 
ATOM   2989  C C7    . DT  A 1 146 ? 102.947 16.533 -85.474 1.00 74.24  ? 146  DT  I C7    1 
ATOM   2990  C C6    . DT  A 1 146 ? 105.172 16.432 -86.601 1.00 77.41  ? 146  DT  I C6    1 
ATOM   2991  O "O5'" . DA  B 1 1   ? 102.618 4.725  -84.447 1.00 122.96 ? 147  DA  J "O5'" 1 
ATOM   2992  C "C5'" . DA  B 1 1   ? 103.491 3.740  -85.013 1.00 122.06 ? 147  DA  J "C5'" 1 
ATOM   2993  C "C4'" . DA  B 1 1   ? 104.850 4.305  -85.352 1.00 121.58 ? 147  DA  J "C4'" 1 
ATOM   2994  O "O4'" . DA  B 1 1   ? 104.662 5.611  -85.954 1.00 120.58 ? 147  DA  J "O4'" 1 
ATOM   2995  C "C3'" . DA  B 1 1   ? 105.735 4.526  -84.126 1.00 122.18 ? 147  DA  J "C3'" 1 
ATOM   2996  O "O3'" . DA  B 1 1   ? 107.113 4.279  -84.404 1.00 123.49 ? 147  DA  J "O3'" 1 
ATOM   2997  C "C2'" . DA  B 1 1   ? 105.539 5.990  -83.806 1.00 121.20 ? 147  DA  J "C2'" 1 
ATOM   2998  C "C1'" . DA  B 1 1   ? 105.263 6.620  -85.156 1.00 118.22 ? 147  DA  J "C1'" 1 
ATOM   2999  N N9    . DA  B 1 1   ? 104.309 7.717  -85.019 1.00 84.96  ? 147  DA  J N9    1 
ATOM   3000  C C8    . DA  B 1 1   ? 103.044 7.661  -84.484 1.00 83.35  ? 147  DA  J C8    1 
ATOM   3001  N N7    . DA  B 1 1   ? 102.450 8.824  -84.417 1.00 82.09  ? 147  DA  J N7    1 
ATOM   3002  C C5    . DA  B 1 1   ? 103.376 9.702  -84.960 1.00 80.50  ? 147  DA  J C5    1 
ATOM   3003  C C6    . DA  B 1 1   ? 103.350 11.085 -85.166 1.00 78.56  ? 147  DA  J C6    1 
ATOM   3004  N N6    . DA  B 1 1   ? 102.314 11.864 -84.833 1.00 75.89  ? 147  DA  J N6    1 
ATOM   3005  N N1    . DA  B 1 1   ? 104.437 11.655 -85.733 1.00 78.16  ? 147  DA  J N1    1 
ATOM   3006  C C2    . DA  B 1 1   ? 105.473 10.875 -86.067 1.00 79.63  ? 147  DA  J C2    1 
ATOM   3007  N N3    . DA  B 1 1   ? 105.615 9.558  -85.922 1.00 80.39  ? 147  DA  J N3    1 
ATOM   3008  C C4    . DA  B 1 1   ? 104.519 9.029  -85.353 1.00 82.04  ? 147  DA  J C4    1 
ATOM   3009  P P     . DT  B 1 2   ? 108.231 4.905  -83.435 1.00 125.88 ? 148  DT  J P     1 
ATOM   3010  O OP1   . DT  B 1 2   ? 109.493 4.136  -83.532 1.00 99.69  ? 148  DT  J OP1   1 
ATOM   3011  O OP2   . DT  B 1 2   ? 107.598 5.103  -82.112 1.00 98.09  ? 148  DT  J OP2   1 
ATOM   3012  O "O5'" . DT  B 1 2   ? 108.505 6.329  -84.076 1.00 123.72 ? 148  DT  J "O5'" 1 
ATOM   3013  C "C5'" . DT  B 1 2   ? 109.144 6.434  -85.341 1.00 122.05 ? 148  DT  J "C5'" 1 
ATOM   3014  C "C4'" . DT  B 1 2   ? 110.086 7.610  -85.333 1.00 120.74 ? 148  DT  J "C4'" 1 
ATOM   3015  O "O4'" . DT  B 1 2   ? 109.281 8.800  -85.177 1.00 118.81 ? 148  DT  J "O4'" 1 
ATOM   3016  C "C3'" . DT  B 1 2   ? 111.043 7.590  -84.142 1.00 121.43 ? 148  DT  J "C3'" 1 
ATOM   3017  O "O3'" . DT  B 1 2   ? 112.291 8.208  -84.492 1.00 124.21 ? 148  DT  J "O3'" 1 
ATOM   3018  C "C2'" . DT  B 1 2   ? 110.292 8.380  -83.085 1.00 119.59 ? 148  DT  J "C2'" 1 
ATOM   3019  C "C1'" . DT  B 1 2   ? 109.537 9.408  -83.916 1.00 117.05 ? 148  DT  J "C1'" 1 
ATOM   3020  N N1    . DT  B 1 2   ? 108.238 9.841  -83.356 1.00 86.35  ? 148  DT  J N1    1 
ATOM   3021  C C2    . DT  B 1 2   ? 107.958 11.192 -83.356 1.00 85.27  ? 148  DT  J C2    1 
ATOM   3022  O O2    . DT  B 1 2   ? 108.741 12.036 -83.758 1.00 84.71  ? 148  DT  J O2    1 
ATOM   3023  N N3    . DT  B 1 2   ? 106.721 11.519 -82.863 1.00 84.01  ? 148  DT  J N3    1 
ATOM   3024  C C4    . DT  B 1 2   ? 105.766 10.652 -82.365 1.00 83.19  ? 148  DT  J C4    1 
ATOM   3025  O O4    . DT  B 1 2   ? 104.695 11.085 -81.960 1.00 82.55  ? 148  DT  J O4    1 
ATOM   3026  C C5    . DT  B 1 2   ? 106.132 9.259  -82.371 1.00 83.32  ? 148  DT  J C5    1 
ATOM   3027  C C7    . DT  B 1 2   ? 105.155 8.264  -81.831 1.00 83.46  ? 148  DT  J C7    1 
ATOM   3028  C C6    . DT  B 1 2   ? 107.335 8.922  -82.860 1.00 84.18  ? 148  DT  J C6    1 
ATOM   3029  P P     . DC  B 1 3   ? 113.523 8.159  -83.459 1.00 150.39 ? 149  DC  J P     1 
ATOM   3030  O OP1   . DC  B 1 3   ? 114.645 8.963  -84.022 1.00 93.29  ? 149  DC  J OP1   1 
ATOM   3031  O OP2   . DC  B 1 3   ? 113.749 6.736  -83.090 1.00 93.35  ? 149  DC  J OP2   1 
ATOM   3032  O "O5'" . DC  B 1 3   ? 112.948 8.914  -82.181 1.00 148.82 ? 149  DC  J "O5'" 1 
ATOM   3033  C "C5'" . DC  B 1 3   ? 113.814 9.521  -81.227 1.00 146.44 ? 149  DC  J "C5'" 1 
ATOM   3034  C "C4'" . DC  B 1 3   ? 114.137 10.936 -81.649 1.00 144.47 ? 149  DC  J "C4'" 1 
ATOM   3035  O "O4'" . DC  B 1 3   ? 112.933 11.577 -82.141 1.00 142.52 ? 149  DC  J "O4'" 1 
ATOM   3036  C "C3'" . DC  B 1 3   ? 114.676 11.816 -80.524 1.00 143.37 ? 149  DC  J "C3'" 1 
ATOM   3037  O "O3'" . DC  B 1 3   ? 115.845 12.532 -80.929 1.00 143.98 ? 149  DC  J "O3'" 1 
ATOM   3038  C "C2'" . DC  B 1 3   ? 113.500 12.691 -80.125 1.00 141.92 ? 149  DC  J "C2'" 1 
ATOM   3039  C "C1'" . DC  B 1 3   ? 112.520 12.645 -81.300 1.00 139.50 ? 149  DC  J "C1'" 1 
ATOM   3040  N N1    . DC  B 1 3   ? 111.123 12.370 -80.879 1.00 80.12  ? 149  DC  J N1    1 
ATOM   3041  C C2    . DC  B 1 3   ? 110.240 13.441 -80.685 1.00 78.08  ? 149  DC  J C2    1 
ATOM   3042  O O2    . DC  B 1 3   ? 110.621 14.591 -80.947 1.00 77.82  ? 149  DC  J O2    1 
ATOM   3043  N N3    . DC  B 1 3   ? 108.993 13.189 -80.214 1.00 74.63  ? 149  DC  J N3    1 
ATOM   3044  C C4    . DC  B 1 3   ? 108.618 11.932 -79.950 1.00 73.54  ? 149  DC  J C4    1 
ATOM   3045  N N4    . DC  B 1 3   ? 107.401 11.731 -79.437 1.00 71.27  ? 149  DC  J N4    1 
ATOM   3046  C C5    . DC  B 1 3   ? 109.476 10.826 -80.185 1.00 74.59  ? 149  DC  J C5    1 
ATOM   3047  C C6    . DC  B 1 3   ? 110.704 11.085 -80.649 1.00 76.89  ? 149  DC  J C6    1 
ATOM   3048  P P     . DA  B 1 4   ? 115.706 13.924 -81.699 1.00 113.01 ? 150  DA  J P     1 
ATOM   3049  O OP1   . DA  B 1 4   ? 114.701 13.746 -82.788 1.00 99.80  ? 150  DA  J OP1   1 
ATOM   3050  O OP2   . DA  B 1 4   ? 117.065 14.430 -82.019 1.00 99.36  ? 150  DA  J OP2   1 
ATOM   3051  O "O5'" . DA  B 1 4   ? 115.108 14.961 -80.659 1.00 109.16 ? 150  DA  J "O5'" 1 
ATOM   3052  C "C5'" . DA  B 1 4   ? 114.699 16.220 -81.153 1.00 104.70 ? 150  DA  J "C5'" 1 
ATOM   3053  C "C4'" . DA  B 1 4   ? 114.397 17.177 -80.031 1.00 100.95 ? 150  DA  J "C4'" 1 
ATOM   3054  O "O4'" . DA  B 1 4   ? 113.142 16.855 -79.406 1.00 97.79  ? 150  DA  J "O4'" 1 
ATOM   3055  C "C3'" . DA  B 1 4   ? 115.417 17.347 -78.924 1.00 99.52  ? 150  DA  J "C3'" 1 
ATOM   3056  O "O3'" . DA  B 1 4   ? 115.532 18.764 -78.796 1.00 99.86  ? 150  DA  J "O3'" 1 
ATOM   3057  C "C2'" . DA  B 1 4   ? 114.783 16.603 -77.752 1.00 96.07  ? 150  DA  J "C2'" 1 
ATOM   3058  C "C1'" . DA  B 1 4   ? 113.280 16.704 -78.014 1.00 93.88  ? 150  DA  J "C1'" 1 
ATOM   3059  N N9    . DA  B 1 4   ? 112.427 15.566 -77.654 1.00 76.89  ? 150  DA  J N9    1 
ATOM   3060  C C8    . DA  B 1 4   ? 112.720 14.227 -77.602 1.00 74.82  ? 150  DA  J C8    1 
ATOM   3061  N N7    . DA  B 1 4   ? 111.687 13.468 -77.323 1.00 73.01  ? 150  DA  J N7    1 
ATOM   3062  C C5    . DA  B 1 4   ? 110.643 14.369 -77.160 1.00 70.76  ? 150  DA  J C5    1 
ATOM   3063  C C6    . DA  B 1 4   ? 109.276 14.198 -76.855 1.00 67.76  ? 150  DA  J C6    1 
ATOM   3064  N N6    . DA  B 1 4   ? 108.710 13.009 -76.636 1.00 63.34  ? 150  DA  J N6    1 
ATOM   3065  N N1    . DA  B 1 4   ? 108.503 15.306 -76.778 1.00 66.70  ? 150  DA  J N1    1 
ATOM   3066  C C2    . DA  B 1 4   ? 109.075 16.498 -76.976 1.00 67.93  ? 150  DA  J C2    1 
ATOM   3067  N N3    . DA  B 1 4   ? 110.347 16.791 -77.258 1.00 70.69  ? 150  DA  J N3    1 
ATOM   3068  C C4    . DA  B 1 4   ? 111.088 15.664 -77.345 1.00 73.59  ? 150  DA  J C4    1 
ATOM   3069  P P     . DA  B 1 5   ? 115.880 19.433 -77.395 1.00 103.35 ? 151  DA  J P     1 
ATOM   3070  O OP1   . DA  B 1 5   ? 116.405 20.780 -77.740 1.00 76.84  ? 151  DA  J OP1   1 
ATOM   3071  O OP2   . DA  B 1 5   ? 116.693 18.492 -76.586 1.00 77.05  ? 151  DA  J OP2   1 
ATOM   3072  O "O5'" . DA  B 1 5   ? 114.461 19.651 -76.720 1.00 103.81 ? 151  DA  J "O5'" 1 
ATOM   3073  C "C5'" . DA  B 1 5   ? 113.477 20.443 -77.384 1.00 101.94 ? 151  DA  J "C5'" 1 
ATOM   3074  C "C4'" . DA  B 1 5   ? 112.433 20.916 -76.402 1.00 99.88  ? 151  DA  J "C4'" 1 
ATOM   3075  O "O4'" . DA  B 1 5   ? 111.610 19.802 -75.986 1.00 98.12  ? 151  DA  J "O4'" 1 
ATOM   3076  C "C3'" . DA  B 1 5   ? 113.029 21.501 -75.128 1.00 99.26  ? 151  DA  J "C3'" 1 
ATOM   3077  O "O3'" . DA  B 1 5   ? 112.216 22.600 -74.697 1.00 99.92  ? 151  DA  J "O3'" 1 
ATOM   3078  C "C2'" . DA  B 1 5   ? 112.998 20.318 -74.176 1.00 96.86  ? 151  DA  J "C2'" 1 
ATOM   3079  C "C1'" . DA  B 1 5   ? 111.722 19.612 -74.593 1.00 94.99  ? 151  DA  J "C1'" 1 
ATOM   3080  N N9    . DA  B 1 5   ? 111.683 18.177 -74.355 1.00 65.17  ? 151  DA  J N9    1 
ATOM   3081  C C8    . DA  B 1 5   ? 112.673 17.246 -74.538 1.00 63.93  ? 151  DA  J C8    1 
ATOM   3082  N N7    . DA  B 1 5   ? 112.296 16.012 -74.289 1.00 62.49  ? 151  DA  J N7    1 
ATOM   3083  C C5    . DA  B 1 5   ? 110.968 16.143 -73.910 1.00 60.19  ? 151  DA  J C5    1 
ATOM   3084  C C6    . DA  B 1 5   ? 109.998 15.204 -73.563 1.00 59.49  ? 151  DA  J C6    1 
ATOM   3085  N N6    . DA  B 1 5   ? 110.195 13.894 -73.600 1.00 56.90  ? 151  DA  J N6    1 
ATOM   3086  N N1    . DA  B 1 5   ? 108.780 15.662 -73.202 1.00 59.69  ? 151  DA  J N1    1 
ATOM   3087  C C2    . DA  B 1 5   ? 108.552 16.980 -73.241 1.00 58.85  ? 151  DA  J C2    1 
ATOM   3088  N N3    . DA  B 1 5   ? 109.374 17.964 -73.595 1.00 59.67  ? 151  DA  J N3    1 
ATOM   3089  C C4    . DA  B 1 5   ? 110.588 17.469 -73.920 1.00 62.15  ? 151  DA  J C4    1 
ATOM   3090  P P     . DT  B 1 6   ? 112.749 23.593 -73.555 1.00 90.49  ? 152  DT  J P     1 
ATOM   3091  O OP1   . DT  B 1 6   ? 112.433 24.996 -73.927 1.00 87.95  ? 152  DT  J OP1   1 
ATOM   3092  O OP2   . DT  B 1 6   ? 114.137 23.212 -73.206 1.00 89.21  ? 152  DT  J OP2   1 
ATOM   3093  O "O5'" . DT  B 1 6   ? 111.859 23.188 -72.311 1.00 89.56  ? 152  DT  J "O5'" 1 
ATOM   3094  C "C5'" . DT  B 1 6   ? 111.556 21.822 -72.086 1.00 83.17  ? 152  DT  J "C5'" 1 
ATOM   3095  C "C4'" . DT  B 1 6   ? 110.220 21.684 -71.405 1.00 77.08  ? 152  DT  J "C4'" 1 
ATOM   3096  O "O4'" . DT  B 1 6   ? 109.844 20.292 -71.503 1.00 75.58  ? 152  DT  J "O4'" 1 
ATOM   3097  C "C3'" . DT  B 1 6   ? 110.270 22.020 -69.916 1.00 74.07  ? 152  DT  J "C3'" 1 
ATOM   3098  O "O3'" . DT  B 1 6   ? 109.056 22.672 -69.508 1.00 72.77  ? 152  DT  J "O3'" 1 
ATOM   3099  C "C2'" . DT  B 1 6   ? 110.475 20.663 -69.264 1.00 72.96  ? 152  DT  J "C2'" 1 
ATOM   3100  C "C1'" . DT  B 1 6   ? 109.781 19.698 -70.218 1.00 74.71  ? 152  DT  J "C1'" 1 
ATOM   3101  N N1    . DT  B 1 6   ? 110.410 18.363 -70.306 1.00 69.40  ? 152  DT  J N1    1 
ATOM   3102  C C2    . DT  B 1 6   ? 109.632 17.240 -70.065 1.00 69.14  ? 152  DT  J C2    1 
ATOM   3103  O O2    . DT  B 1 6   ? 108.450 17.294 -69.783 1.00 68.04  ? 152  DT  J O2    1 
ATOM   3104  N N3    . DT  B 1 6   ? 110.295 16.048 -70.168 1.00 69.10  ? 152  DT  J N3    1 
ATOM   3105  C C4    . DT  B 1 6   ? 111.621 15.863 -70.480 1.00 69.40  ? 152  DT  J C4    1 
ATOM   3106  O O4    . DT  B 1 6   ? 112.075 14.726 -70.544 1.00 68.42  ? 152  DT  J O4    1 
ATOM   3107  C C5    . DT  B 1 6   ? 112.380 17.078 -70.713 1.00 70.75  ? 152  DT  J C5    1 
ATOM   3108  C C7    . DT  B 1 6   ? 113.839 16.975 -71.035 1.00 71.98  ? 152  DT  J C7    1 
ATOM   3109  C C6    . DT  B 1 6   ? 111.740 18.249 -70.623 1.00 70.17  ? 152  DT  J C6    1 
ATOM   3110  P P     . DA  B 1 7   ? 108.845 23.125 -67.970 1.00 72.54  ? 153  DA  J P     1 
ATOM   3111  O OP1   . DA  B 1 7   ? 108.072 24.401 -68.008 1.00 59.92  ? 153  DA  J OP1   1 
ATOM   3112  O OP2   . DA  B 1 7   ? 110.126 23.062 -67.214 1.00 57.47  ? 153  DA  J OP2   1 
ATOM   3113  O "O5'" . DA  B 1 7   ? 107.882 21.992 -67.421 1.00 69.72  ? 153  DA  J "O5'" 1 
ATOM   3114  C "C5'" . DA  B 1 7   ? 106.756 21.606 -68.198 1.00 69.18  ? 153  DA  J "C5'" 1 
ATOM   3115  C "C4'" . DA  B 1 7   ? 106.022 20.485 -67.513 1.00 69.54  ? 153  DA  J "C4'" 1 
ATOM   3116  O "O4'" . DA  B 1 7   ? 106.766 19.256 -67.662 1.00 69.51  ? 153  DA  J "O4'" 1 
ATOM   3117  C "C3'" . DA  B 1 7   ? 105.891 20.732 -66.017 1.00 68.75  ? 153  DA  J "C3'" 1 
ATOM   3118  O "O3'" . DA  B 1 7   ? 104.636 20.244 -65.560 1.00 68.34  ? 153  DA  J "O3'" 1 
ATOM   3119  C "C2'" . DA  B 1 7   ? 107.052 19.954 -65.428 1.00 67.08  ? 153  DA  J "C2'" 1 
ATOM   3120  C "C1'" . DA  B 1 7   ? 107.188 18.779 -66.387 1.00 68.06  ? 153  DA  J "C1'" 1 
ATOM   3121  N N9    . DA  B 1 7   ? 108.561 18.291 -66.532 1.00 55.96  ? 153  DA  J N9    1 
ATOM   3122  C C8    . DA  B 1 7   ? 109.704 19.041 -66.689 1.00 54.69  ? 153  DA  J C8    1 
ATOM   3123  N N7    . DA  B 1 7   ? 110.791 18.324 -66.845 1.00 56.51  ? 153  DA  J N7    1 
ATOM   3124  C C5    . DA  B 1 7   ? 110.335 17.019 -66.778 1.00 53.49  ? 153  DA  J C5    1 
ATOM   3125  C C6    . DA  B 1 7   ? 110.996 15.793 -66.893 1.00 53.98  ? 153  DA  J C6    1 
ATOM   3126  N N6    . DA  B 1 7   ? 112.312 15.686 -67.118 1.00 50.02  ? 153  DA  J N6    1 
ATOM   3127  N N1    . DA  B 1 7   ? 110.252 14.664 -66.774 1.00 51.13  ? 153  DA  J N1    1 
ATOM   3128  C C2    . DA  B 1 7   ? 108.933 14.791 -66.557 1.00 53.56  ? 153  DA  J C2    1 
ATOM   3129  N N3    . DA  B 1 7   ? 108.197 15.898 -66.440 1.00 53.30  ? 153  DA  J N3    1 
ATOM   3130  C C4    . DA  B 1 7   ? 108.966 16.984 -66.566 1.00 54.73  ? 153  DA  J C4    1 
ATOM   3131  P P     . DT  B 1 8   ? 104.261 20.362 -64.012 1.00 72.82  ? 154  DT  J P     1 
ATOM   3132  O OP1   . DT  B 1 8   ? 102.863 20.808 -63.940 1.00 74.97  ? 154  DT  J OP1   1 
ATOM   3133  O OP2   . DT  B 1 8   ? 105.319 21.164 -63.350 1.00 69.27  ? 154  DT  J OP2   1 
ATOM   3134  O "O5'" . DT  B 1 8   ? 104.329 18.851 -63.520 1.00 71.35  ? 154  DT  J "O5'" 1 
ATOM   3135  C "C5'" . DT  B 1 8   ? 103.793 17.811 -64.337 1.00 73.08  ? 154  DT  J "C5'" 1 
ATOM   3136  C "C4'" . DT  B 1 8   ? 104.203 16.456 -63.809 1.00 75.73  ? 154  DT  J "C4'" 1 
ATOM   3137  O "O4'" . DT  B 1 8   ? 105.578 16.129 -64.137 1.00 76.16  ? 154  DT  J "O4'" 1 
ATOM   3138  C "C3'" . DT  B 1 8   ? 104.098 16.348 -62.293 1.00 77.15  ? 154  DT  J "C3'" 1 
ATOM   3139  O "O3'" . DT  B 1 8   ? 103.573 15.078 -61.940 1.00 82.39  ? 154  DT  J "O3'" 1 
ATOM   3140  C "C2'" . DT  B 1 8   ? 105.540 16.429 -61.837 1.00 76.24  ? 154  DT  J "C2'" 1 
ATOM   3141  C "C1'" . DT  B 1 8   ? 106.232 15.694 -62.956 1.00 76.37  ? 154  DT  J "C1'" 1 
ATOM   3142  N N1    . DT  B 1 8   ? 107.674 15.970 -63.080 1.00 75.14  ? 154  DT  J N1    1 
ATOM   3143  C C2    . DT  B 1 8   ? 108.523 14.887 -63.133 1.00 75.41  ? 154  DT  J C2    1 
ATOM   3144  O O2    . DT  B 1 8   ? 108.132 13.735 -63.080 1.00 76.75  ? 154  DT  J O2    1 
ATOM   3145  N N3    . DT  B 1 8   ? 109.850 15.202 -63.265 1.00 73.60  ? 154  DT  J N3    1 
ATOM   3146  C C4    . DT  B 1 8   ? 110.398 16.464 -63.372 1.00 74.14  ? 154  DT  J C4    1 
ATOM   3147  O O4    . DT  B 1 8   ? 111.611 16.595 -63.551 1.00 71.38  ? 154  DT  J O4    1 
ATOM   3148  C C5    . DT  B 1 8   ? 109.451 17.555 -63.286 1.00 73.64  ? 154  DT  J C5    1 
ATOM   3149  C C7    . DT  B 1 8   ? 109.958 18.958 -63.369 1.00 70.36  ? 154  DT  J C7    1 
ATOM   3150  C C6    . DT  B 1 8   ? 108.153 17.258 -63.142 1.00 73.81  ? 154  DT  J C6    1 
ATOM   3151  P P     . DC  B 1 9   ? 103.138 14.797 -60.425 1.00 88.35  ? 155  DC  J P     1 
ATOM   3152  O OP1   . DC  B 1 9   ? 101.739 14.277 -60.455 1.00 77.53  ? 155  DC  J OP1   1 
ATOM   3153  O OP2   . DC  B 1 9   ? 103.489 16.000 -59.605 1.00 74.98  ? 155  DC  J OP2   1 
ATOM   3154  O "O5'" . DC  B 1 9   ? 104.060 13.582 -60.027 1.00 88.47  ? 155  DC  J "O5'" 1 
ATOM   3155  C "C5'" . DC  B 1 9   ? 104.055 12.428 -60.835 1.00 87.41  ? 155  DC  J "C5'" 1 
ATOM   3156  C "C4'" . DC  B 1 9   ? 105.072 11.455 -60.311 1.00 87.20  ? 155  DC  J "C4'" 1 
ATOM   3157  O "O4'" . DC  B 1 9   ? 106.394 11.934 -60.648 1.00 86.24  ? 155  DC  J "O4'" 1 
ATOM   3158  C "C3'" . DC  B 1 9   ? 105.015 11.366 -58.789 1.00 86.10  ? 155  DC  J "C3'" 1 
ATOM   3159  O "O3'" . DC  B 1 9   ? 105.173 10.012 -58.378 1.00 86.13  ? 155  DC  J "O3'" 1 
ATOM   3160  C "C2'" . DC  B 1 9   ? 106.179 12.228 -58.341 1.00 86.96  ? 155  DC  J "C2'" 1 
ATOM   3161  C "C1'" . DC  B 1 9   ? 107.168 12.032 -59.475 1.00 84.69  ? 155  DC  J "C1'" 1 
ATOM   3162  N N1    . DC  B 1 9   ? 108.131 13.120 -59.664 1.00 69.37  ? 155  DC  J N1    1 
ATOM   3163  C C2    . DC  B 1 9   ? 109.460 12.788 -59.939 1.00 69.21  ? 155  DC  J C2    1 
ATOM   3164  O O2    . DC  B 1 9   ? 109.763 11.579 -60.048 1.00 72.14  ? 155  DC  J O2    1 
ATOM   3165  N N3    . DC  B 1 9   ? 110.378 13.780 -60.086 1.00 67.63  ? 155  DC  J N3    1 
ATOM   3166  C C4    . DC  B 1 9   ? 110.001 15.052 -59.973 1.00 67.28  ? 155  DC  J C4    1 
ATOM   3167  N N4    . DC  B 1 9   ? 110.935 16.000 -60.108 1.00 65.21  ? 155  DC  J N4    1 
ATOM   3168  C C5    . DC  B 1 9   ? 108.646 15.414 -59.712 1.00 67.00  ? 155  DC  J C5    1 
ATOM   3169  C C6    . DC  B 1 9   ? 107.753 14.425 -59.565 1.00 67.75  ? 155  DC  J C6    1 
ATOM   3170  P P     . DC  B 1 10  ? 104.792 9.592  -56.882 1.00 88.48  ? 156  DC  J P     1 
ATOM   3171  O OP1   . DC  B 1 10  ? 103.625 8.669  -56.916 1.00 74.26  ? 156  DC  J OP1   1 
ATOM   3172  O OP2   . DC  B 1 10  ? 104.736 10.844 -56.076 1.00 73.65  ? 156  DC  J OP2   1 
ATOM   3173  O "O5'" . DC  B 1 10  ? 106.067 8.773  -56.410 1.00 86.87  ? 156  DC  J "O5'" 1 
ATOM   3174  C "C5'" . DC  B 1 10  ? 107.053 8.358  -57.349 1.00 86.58  ? 156  DC  J "C5'" 1 
ATOM   3175  C "C4'" . DC  B 1 10  ? 108.419 8.464  -56.721 1.00 86.80  ? 156  DC  J "C4'" 1 
ATOM   3176  O "O4'" . DC  B 1 10  ? 109.120 9.665  -57.119 1.00 84.89  ? 156  DC  J "O4'" 1 
ATOM   3177  C "C3'" . DC  B 1 10  ? 108.358 8.501  -55.198 1.00 87.83  ? 156  DC  J "C3'" 1 
ATOM   3178  O "O3'" . DC  B 1 10  ? 109.404 7.706  -54.683 1.00 91.20  ? 156  DC  J "O3'" 1 
ATOM   3179  C "C2'" . DC  B 1 10  ? 108.650 9.953  -54.873 1.00 85.89  ? 156  DC  J "C2'" 1 
ATOM   3180  C "C1'" . DC  B 1 10  ? 109.645 10.273 -55.957 1.00 84.26  ? 156  DC  J "C1'" 1 
ATOM   3181  N N1    . DC  B 1 10  ? 109.853 11.697 -56.233 1.00 70.19  ? 156  DC  J N1    1 
ATOM   3182  C C2    . DC  B 1 10  ? 111.123 12.107 -56.590 1.00 69.15  ? 156  DC  J C2    1 
ATOM   3183  O O2    . DC  B 1 10  ? 112.006 11.250 -56.663 1.00 71.23  ? 156  DC  J O2    1 
ATOM   3184  N N3    . DC  B 1 10  ? 111.359 13.421 -56.844 1.00 69.02  ? 156  DC  J N3    1 
ATOM   3185  C C4    . DC  B 1 10  ? 110.363 14.305 -56.743 1.00 67.69  ? 156  DC  J C4    1 
ATOM   3186  N N4    . DC  B 1 10  ? 110.632 15.584 -56.975 1.00 64.94  ? 156  DC  J N4    1 
ATOM   3187  C C5    . DC  B 1 10  ? 109.044 13.911 -56.388 1.00 68.89  ? 156  DC  J C5    1 
ATOM   3188  C C6    . DC  B 1 10  ? 108.834 12.605 -56.141 1.00 69.90  ? 156  DC  J C6    1 
ATOM   3189  P P     . DA  B 1 11  ? 109.065 6.514  -53.680 1.00 85.86  ? 157  DA  J P     1 
ATOM   3190  O OP1   . DA  B 1 11  ? 108.564 5.364  -54.480 1.00 80.87  ? 157  DA  J OP1   1 
ATOM   3191  O OP2   . DA  B 1 11  ? 108.251 7.054  -52.543 1.00 77.69  ? 157  DA  J OP2   1 
ATOM   3192  O "O5'" . DA  B 1 11  ? 110.501 6.129  -53.136 1.00 86.87  ? 157  DA  J "O5'" 1 
ATOM   3193  C "C5'" . DA  B 1 11  ? 111.545 5.808  -54.033 1.00 83.77  ? 157  DA  J "C5'" 1 
ATOM   3194  C "C4'" . DA  B 1 11  ? 112.844 6.326  -53.478 1.00 82.76  ? 157  DA  J "C4'" 1 
ATOM   3195  O "O4'" . DA  B 1 11  ? 113.016 7.712  -53.842 1.00 80.92  ? 157  DA  J "O4'" 1 
ATOM   3196  C "C3'" . DA  B 1 11  ? 112.894 6.270  -51.955 1.00 81.52  ? 157  DA  J "C3'" 1 
ATOM   3197  O "O3'" . DA  B 1 11  ? 114.159 5.769  -51.537 1.00 83.24  ? 157  DA  J "O3'" 1 
ATOM   3198  C "C2'" . DA  B 1 11  ? 112.696 7.716  -51.540 1.00 80.37  ? 157  DA  J "C2'" 1 
ATOM   3199  C "C1'" . DA  B 1 11  ? 113.297 8.486  -52.693 1.00 79.07  ? 157  DA  J "C1'" 1 
ATOM   3200  N N9    . DA  B 1 11  ? 112.719 9.819  -52.901 1.00 70.31  ? 157  DA  J N9    1 
ATOM   3201  C C8    . DA  B 1 11  ? 111.406 10.211 -52.731 1.00 68.55  ? 157  DA  J C8    1 
ATOM   3202  N N7    . DA  B 1 11  ? 111.191 11.476 -53.014 1.00 66.80  ? 157  DA  J N7    1 
ATOM   3203  C C5    . DA  B 1 11  ? 112.440 11.952 -53.393 1.00 68.97  ? 157  DA  J C5    1 
ATOM   3204  C C6    . DA  B 1 11  ? 112.878 13.214 -53.811 1.00 68.69  ? 157  DA  J C6    1 
ATOM   3205  N N6    . DA  B 1 11  ? 112.067 14.264 -53.940 1.00 68.78  ? 157  DA  J N6    1 
ATOM   3206  N N1    . DA  B 1 11  ? 114.187 13.366 -54.102 1.00 67.98  ? 157  DA  J N1    1 
ATOM   3207  C C2    . DA  B 1 11  ? 114.991 12.311 -53.987 1.00 67.65  ? 157  DA  J C2    1 
ATOM   3208  N N3    . DA  B 1 11  ? 114.700 11.064 -53.613 1.00 69.08  ? 157  DA  J N3    1 
ATOM   3209  C C4    . DA  B 1 11  ? 113.392 10.948 -53.324 1.00 69.32  ? 157  DA  J C4    1 
ATOM   3210  P P     . DC  B 1 12  ? 114.486 5.594  -49.975 1.00 76.26  ? 158  DC  J P     1 
ATOM   3211  O OP1   . DC  B 1 12  ? 115.146 4.276  -49.845 1.00 67.44  ? 158  DC  J OP1   1 
ATOM   3212  O OP2   . DC  B 1 12  ? 113.307 5.894  -49.122 1.00 64.57  ? 158  DC  J OP2   1 
ATOM   3213  O "O5'" . DC  B 1 12  ? 115.547 6.762  -49.768 1.00 76.06  ? 158  DC  J "O5'" 1 
ATOM   3214  C "C5'" . DC  B 1 12  ? 116.550 6.976  -50.756 1.00 78.40  ? 158  DC  J "C5'" 1 
ATOM   3215  C "C4'" . DC  B 1 12  ? 117.330 8.231  -50.457 1.00 80.11  ? 158  DC  J "C4'" 1 
ATOM   3216  O "O4'" . DC  B 1 12  ? 116.624 9.388  -50.958 1.00 81.47  ? 158  DC  J "O4'" 1 
ATOM   3217  C "C3'" . DC  B 1 12  ? 117.563 8.482  -48.969 1.00 80.36  ? 158  DC  J "C3'" 1 
ATOM   3218  O "O3'" . DC  B 1 12  ? 118.876 8.991  -48.748 1.00 81.95  ? 158  DC  J "O3'" 1 
ATOM   3219  C "C2'" . DC  B 1 12  ? 116.563 9.573  -48.651 1.00 81.03  ? 158  DC  J "C2'" 1 
ATOM   3220  C "C1'" . DC  B 1 12  ? 116.594 10.364 -49.942 1.00 80.84  ? 158  DC  J "C1'" 1 
ATOM   3221  N N1    . DC  B 1 12  ? 115.434 11.237 -50.158 1.00 68.49  ? 158  DC  J N1    1 
ATOM   3222  C C2    . DC  B 1 12  ? 115.665 12.591 -50.423 1.00 66.93  ? 158  DC  J C2    1 
ATOM   3223  O O2    . DC  B 1 12  ? 116.833 12.978 -50.554 1.00 66.97  ? 158  DC  J O2    1 
ATOM   3224  N N3    . DC  B 1 12  ? 114.612 13.438 -50.525 1.00 65.57  ? 158  DC  J N3    1 
ATOM   3225  C C4    . DC  B 1 12  ? 113.369 12.973 -50.378 1.00 65.32  ? 158  DC  J C4    1 
ATOM   3226  N N4    . DC  B 1 12  ? 112.377 13.846 -50.417 1.00 62.25  ? 158  DC  J N4    1 
ATOM   3227  C C5    . DC  B 1 12  ? 113.099 11.586 -50.164 1.00 65.96  ? 158  DC  J C5    1 
ATOM   3228  C C6    . DC  B 1 12  ? 114.154 10.759 -50.066 1.00 67.33  ? 158  DC  J C6    1 
ATOM   3229  P P     . DC  B 1 13  ? 119.316 9.407  -47.263 1.00 84.95  ? 159  DC  J P     1 
ATOM   3230  O OP1   . DC  B 1 13  ? 120.716 8.967  -47.058 1.00 84.44  ? 159  DC  J OP1   1 
ATOM   3231  O OP2   . DC  B 1 13  ? 118.252 8.957  -46.331 1.00 83.09  ? 159  DC  J OP2   1 
ATOM   3232  O "O5'" . DC  B 1 13  ? 119.292 10.992 -47.293 1.00 86.59  ? 159  DC  J "O5'" 1 
ATOM   3233  C "C5'" . DC  B 1 13  ? 120.130 11.695 -48.192 1.00 88.53  ? 159  DC  J "C5'" 1 
ATOM   3234  C "C4'" . DC  B 1 13  ? 120.376 13.091 -47.676 1.00 91.57  ? 159  DC  J "C4'" 1 
ATOM   3235  O "O4'" . DC  B 1 13  ? 119.237 13.944 -47.938 1.00 92.07  ? 159  DC  J "O4'" 1 
ATOM   3236  C "C3'" . DC  B 1 13  ? 120.615 13.154 -46.175 1.00 92.20  ? 159  DC  J "C3'" 1 
ATOM   3237  O "O3'" . DC  B 1 13  ? 121.569 14.177 -45.928 1.00 95.10  ? 159  DC  J "O3'" 1 
ATOM   3238  C "C2'" . DC  B 1 13  ? 119.249 13.523 -45.626 1.00 92.43  ? 159  DC  J "C2'" 1 
ATOM   3239  C "C1'" . DC  B 1 13  ? 118.678 14.423 -46.723 1.00 91.16  ? 159  DC  J "C1'" 1 
ATOM   3240  N N1    . DC  B 1 13  ? 117.204 14.382 -46.867 1.00 87.22  ? 159  DC  J N1    1 
ATOM   3241  C C2    . DC  B 1 13  ? 116.469 15.592 -46.896 1.00 87.10  ? 159  DC  J C2    1 
ATOM   3242  O O2    . DC  B 1 13  ? 117.070 16.679 -46.754 1.00 85.55  ? 159  DC  J O2    1 
ATOM   3243  N N3    . DC  B 1 13  ? 115.125 15.534 -47.062 1.00 84.01  ? 159  DC  J N3    1 
ATOM   3244  C C4    . DC  B 1 13  ? 114.513 14.349 -47.164 1.00 83.41  ? 159  DC  J C4    1 
ATOM   3245  N N4    . DC  B 1 13  ? 113.189 14.334 -47.303 1.00 78.08  ? 159  DC  J N4    1 
ATOM   3246  C C5    . DC  B 1 13  ? 115.230 13.121 -47.122 1.00 84.21  ? 159  DC  J C5    1 
ATOM   3247  C C6    . DC  B 1 13  ? 116.555 13.180 -46.978 1.00 86.82  ? 159  DC  J C6    1 
ATOM   3248  P P     . DT  B 1 14  ? 122.167 14.365 -44.456 1.00 103.73 ? 160  DT  J P     1 
ATOM   3249  O OP1   . DT  B 1 14  ? 123.593 14.733 -44.622 1.00 76.65  ? 160  DT  J OP1   1 
ATOM   3250  O OP2   . DT  B 1 14  ? 121.796 13.197 -43.603 1.00 75.95  ? 160  DT  J OP2   1 
ATOM   3251  O "O5'" . DT  B 1 14  ? 121.383 15.643 -43.936 1.00 105.62 ? 160  DT  J "O5'" 1 
ATOM   3252  C "C5'" . DT  B 1 14  ? 121.344 16.831 -44.719 1.00 108.08 ? 160  DT  J "C5'" 1 
ATOM   3253  C "C4'" . DT  B 1 14  ? 120.560 17.891 -43.987 1.00 111.10 ? 160  DT  J "C4'" 1 
ATOM   3254  O "O4'" . DT  B 1 14  ? 119.139 17.751 -44.217 1.00 110.97 ? 160  DT  J "O4'" 1 
ATOM   3255  C "C3'" . DT  B 1 14  ? 120.761 17.809 -42.478 1.00 112.77 ? 160  DT  J "C3'" 1 
ATOM   3256  O "O3'" . DT  B 1 14  ? 120.821 19.120 -41.945 1.00 116.90 ? 160  DT  J "O3'" 1 
ATOM   3257  C "C2'" . DT  B 1 14  ? 119.509 17.100 -41.998 1.00 111.56 ? 160  DT  J "C2'" 1 
ATOM   3258  C "C1'" . DT  B 1 14  ? 118.468 17.614 -42.977 1.00 110.11 ? 160  DT  J "C1'" 1 
ATOM   3259  N N1    . DT  B 1 14  ? 117.321 16.723 -43.196 1.00 80.83  ? 160  DT  J N1    1 
ATOM   3260  C C2    . DT  B 1 14  ? 116.101 17.309 -43.425 1.00 79.04  ? 160  DT  J C2    1 
ATOM   3261  O O2    . DT  B 1 14  ? 115.943 18.515 -43.459 1.00 77.84  ? 160  DT  J O2    1 
ATOM   3262  N N3    . DT  B 1 14  ? 115.072 16.428 -43.626 1.00 77.01  ? 160  DT  J N3    1 
ATOM   3263  C C4    . DT  B 1 14  ? 115.146 15.050 -43.636 1.00 77.03  ? 160  DT  J C4    1 
ATOM   3264  O O4    . DT  B 1 14  ? 114.137 14.385 -43.821 1.00 74.51  ? 160  DT  J O4    1 
ATOM   3265  C C5    . DT  B 1 14  ? 116.465 14.500 -43.416 1.00 78.20  ? 160  DT  J C5    1 
ATOM   3266  C C7    . DT  B 1 14  ? 116.650 13.014 -43.479 1.00 76.81  ? 160  DT  J C7    1 
ATOM   3267  C C6    . DT  B 1 14  ? 117.470 15.353 -43.184 1.00 79.22  ? 160  DT  J C6    1 
ATOM   3268  P P     . DG  B 1 15  ? 122.241 19.839 -41.768 1.00 120.05 ? 161  DG  J P     1 
ATOM   3269  O OP1   . DG  B 1 15  ? 122.945 19.784 -43.078 1.00 105.64 ? 161  DG  J OP1   1 
ATOM   3270  O OP2   . DG  B 1 15  ? 122.900 19.289 -40.547 1.00 105.61 ? 161  DG  J OP2   1 
ATOM   3271  O "O5'" . DG  B 1 15  ? 121.816 21.353 -41.533 1.00 120.15 ? 161  DG  J "O5'" 1 
ATOM   3272  C "C5'" . DG  B 1 15  ? 121.182 22.089 -42.583 1.00 120.12 ? 161  DG  J "C5'" 1 
ATOM   3273  C "C4'" . DG  B 1 15  ? 119.960 22.812 -42.063 1.00 119.77 ? 161  DG  J "C4'" 1 
ATOM   3274  O "O4'" . DG  B 1 15  ? 118.821 21.936 -41.904 1.00 119.07 ? 161  DG  J "O4'" 1 
ATOM   3275  C "C3'" . DG  B 1 15  ? 120.152 23.499 -40.721 1.00 120.21 ? 161  DG  J "C3'" 1 
ATOM   3276  O "O3'" . DG  B 1 15  ? 119.487 24.740 -40.794 1.00 120.55 ? 161  DG  J "O3'" 1 
ATOM   3277  C "C2'" . DG  B 1 15  ? 119.471 22.558 -39.740 1.00 120.10 ? 161  DG  J "C2'" 1 
ATOM   3278  C "C1'" . DG  B 1 15  ? 118.344 21.965 -40.566 1.00 118.51 ? 161  DG  J "C1'" 1 
ATOM   3279  N N9    . DG  B 1 15  ? 117.978 20.597 -40.214 1.00 103.22 ? 161  DG  J N9    1 
ATOM   3280  C C8    . DG  B 1 15  ? 118.791 19.640 -39.659 1.00 102.18 ? 161  DG  J C8    1 
ATOM   3281  N N7    . DG  B 1 15  ? 118.209 18.478 -39.543 1.00 101.48 ? 161  DG  J N7    1 
ATOM   3282  C C5    . DG  B 1 15  ? 116.927 18.683 -40.036 1.00 100.76 ? 161  DG  J C5    1 
ATOM   3283  C C6    . DG  B 1 15  ? 115.835 17.770 -40.192 1.00 99.57  ? 161  DG  J C6    1 
ATOM   3284  O O6    . DG  B 1 15  ? 115.797 16.552 -39.946 1.00 96.64  ? 161  DG  J O6    1 
ATOM   3285  N N1    . DG  B 1 15  ? 114.713 18.406 -40.709 1.00 99.91  ? 161  DG  J N1    1 
ATOM   3286  C C2    . DG  B 1 15  ? 114.648 19.734 -41.048 1.00 101.00 ? 161  DG  J C2    1 
ATOM   3287  N N2    . DG  B 1 15  ? 113.467 20.156 -41.518 1.00 101.34 ? 161  DG  J N2    1 
ATOM   3288  N N3    . DG  B 1 15  ? 115.662 20.585 -40.933 1.00 101.62 ? 161  DG  J N3    1 
ATOM   3289  C C4    . DG  B 1 15  ? 116.760 19.996 -40.424 1.00 101.83 ? 161  DG  J C4    1 
ATOM   3290  P P     . DC  B 1 16  ? 119.805 25.878 -39.722 1.00 106.21 ? 162  DC  J P     1 
ATOM   3291  O OP1   . DC  B 1 16  ? 120.186 27.049 -40.551 1.00 124.34 ? 162  DC  J OP1   1 
ATOM   3292  O OP2   . DC  B 1 16  ? 120.719 25.406 -38.637 1.00 123.60 ? 162  DC  J OP2   1 
ATOM   3293  O "O5'" . DC  B 1 16  ? 118.348 26.141 -39.136 1.00 105.58 ? 162  DC  J "O5'" 1 
ATOM   3294  C "C5'" . DC  B 1 16  ? 117.249 26.281 -40.042 1.00 104.98 ? 162  DC  J "C5'" 1 
ATOM   3295  C "C4'" . DC  B 1 16  ? 115.937 26.041 -39.339 1.00 104.43 ? 162  DC  J "C4'" 1 
ATOM   3296  O "O4'" . DC  B 1 16  ? 115.664 24.638 -39.134 1.00 104.20 ? 162  DC  J "O4'" 1 
ATOM   3297  C "C3'" . DC  B 1 16  ? 115.855 26.691 -37.966 1.00 104.44 ? 162  DC  J "C3'" 1 
ATOM   3298  O "O3'" . DC  B 1 16  ? 114.564 27.240 -37.823 1.00 104.74 ? 162  DC  J "O3'" 1 
ATOM   3299  C "C2'" . DC  B 1 16  ? 116.017 25.526 -37.015 1.00 104.45 ? 162  DC  J "C2'" 1 
ATOM   3300  C "C1'" . DC  B 1 16  ? 115.283 24.454 -37.783 1.00 104.86 ? 162  DC  J "C1'" 1 
ATOM   3301  N N1    . DC  B 1 16  ? 115.619 23.086 -37.398 1.00 123.64 ? 162  DC  J N1    1 
ATOM   3302  C C2    . DC  B 1 16  ? 114.628 22.111 -37.491 1.00 123.64 ? 162  DC  J C2    1 
ATOM   3303  O O2    . DC  B 1 16  ? 113.502 22.441 -37.896 1.00 123.70 ? 162  DC  J O2    1 
ATOM   3304  N N3    . DC  B 1 16  ? 114.918 20.841 -37.137 1.00 123.31 ? 162  DC  J N3    1 
ATOM   3305  C C4    . DC  B 1 16  ? 116.143 20.535 -36.701 1.00 123.88 ? 162  DC  J C4    1 
ATOM   3306  N N4    . DC  B 1 16  ? 116.386 19.272 -36.350 1.00 123.21 ? 162  DC  J N4    1 
ATOM   3307  C C5    . DC  B 1 16  ? 117.174 21.514 -36.599 1.00 123.71 ? 162  DC  J C5    1 
ATOM   3308  C C6    . DC  B 1 16  ? 116.871 22.765 -36.955 1.00 123.62 ? 162  DC  J C6    1 
ATOM   3309  P P     . DA  B 1 17  ? 114.356 28.791 -38.103 1.00 100.28 ? 163  DA  J P     1 
ATOM   3310  O OP1   . DA  B 1 17  ? 114.767 29.018 -39.515 1.00 86.07  ? 163  DA  J OP1   1 
ATOM   3311  O OP2   . DA  B 1 17  ? 115.000 29.541 -37.014 1.00 86.41  ? 163  DA  J OP2   1 
ATOM   3312  O "O5'" . DA  B 1 17  ? 112.787 28.991 -38.023 1.00 100.28 ? 163  DA  J "O5'" 1 
ATOM   3313  C "C5'" . DA  B 1 17  ? 111.993 28.759 -39.174 1.00 98.78  ? 163  DA  J "C5'" 1 
ATOM   3314  C "C4'" . DA  B 1 17  ? 110.672 28.152 -38.781 1.00 98.34  ? 163  DA  J "C4'" 1 
ATOM   3315  O "O4'" . DA  B 1 17  ? 110.860 26.862 -38.168 1.00 98.09  ? 163  DA  J "O4'" 1 
ATOM   3316  C "C3'" . DA  B 1 17  ? 109.817 28.955 -37.814 1.00 97.50  ? 163  DA  J "C3'" 1 
ATOM   3317  O "O3'" . DA  B 1 17  ? 108.487 28.684 -38.223 1.00 98.11  ? 163  DA  J "O3'" 1 
ATOM   3318  C "C2'" . DA  B 1 17  ? 110.143 28.339 -36.459 1.00 97.07  ? 163  DA  J "C2'" 1 
ATOM   3319  C "C1'" . DA  B 1 17  ? 110.515 26.889 -36.795 1.00 96.62  ? 163  DA  J "C1'" 1 
ATOM   3320  N N9    . DA  B 1 17  ? 111.638 26.267 -36.077 1.00 82.51  ? 163  DA  J N9    1 
ATOM   3321  C C8    . DA  B 1 17  ? 112.770 26.826 -35.533 1.00 82.02  ? 163  DA  J C8    1 
ATOM   3322  N N7    . DA  B 1 17  ? 113.579 25.946 -34.979 1.00 81.50  ? 163  DA  J N7    1 
ATOM   3323  C C5    . DA  B 1 17  ? 112.937 24.729 -35.169 1.00 82.07  ? 163  DA  J C5    1 
ATOM   3324  C C6    . DA  B 1 17  ? 113.271 23.398 -34.797 1.00 82.19  ? 163  DA  J C6    1 
ATOM   3325  N N6    . DA  B 1 17  ? 114.380 23.051 -34.146 1.00 82.25  ? 163  DA  J N6    1 
ATOM   3326  N N1    . DA  B 1 17  ? 112.405 22.423 -35.128 1.00 81.79  ? 163  DA  J N1    1 
ATOM   3327  C C2    . DA  B 1 17  ? 111.295 22.756 -35.791 1.00 81.60  ? 163  DA  J C2    1 
ATOM   3328  N N3    . DA  B 1 17  ? 110.874 23.959 -36.200 1.00 81.88  ? 163  DA  J N3    1 
ATOM   3329  C C4    . DA  B 1 17  ? 111.747 24.914 -35.846 1.00 82.21  ? 163  DA  J C4    1 
ATOM   3330  P P     . DG  B 1 18  ? 107.254 29.323 -37.456 1.00 98.08  ? 164  DG  J P     1 
ATOM   3331  O OP1   . DG  B 1 18  ? 106.225 29.583 -38.493 1.00 107.26 ? 164  DG  J OP1   1 
ATOM   3332  O OP2   . DG  B 1 18  ? 107.675 30.412 -36.535 1.00 107.33 ? 164  DG  J OP2   1 
ATOM   3333  O "O5'" . DG  B 1 18  ? 106.771 28.069 -36.624 1.00 94.72  ? 164  DG  J "O5'" 1 
ATOM   3334  C "C5'" . DG  B 1 18  ? 106.416 26.901 -37.330 1.00 92.46  ? 164  DG  J "C5'" 1 
ATOM   3335  C "C4'" . DG  B 1 18  ? 106.387 25.721 -36.397 1.00 91.63  ? 164  DG  J "C4'" 1 
ATOM   3336  O "O4'" . DG  B 1 18  ? 107.708 25.466 -35.854 1.00 91.33  ? 164  DG  J "O4'" 1 
ATOM   3337  C "C3'" . DG  B 1 18  ? 105.465 25.859 -35.192 1.00 90.97  ? 164  DG  J "C3'" 1 
ATOM   3338  O "O3'" . DG  B 1 18  ? 104.850 24.606 -34.961 1.00 89.95  ? 164  DG  J "O3'" 1 
ATOM   3339  C "C2'" . DG  B 1 18  ? 106.424 26.101 -34.044 1.00 90.80  ? 164  DG  J "C2'" 1 
ATOM   3340  C "C1'" . DG  B 1 18  ? 107.570 25.209 -34.468 1.00 91.59  ? 164  DG  J "C1'" 1 
ATOM   3341  N N9    . DG  B 1 18  ? 108.862 25.435 -33.817 1.00 101.54 ? 164  DG  J N9    1 
ATOM   3342  C C8    . DG  B 1 18  ? 109.513 26.632 -33.658 1.00 100.95 ? 164  DG  J C8    1 
ATOM   3343  N N7    . DG  B 1 18  ? 110.656 26.515 -33.037 1.00 101.42 ? 164  DG  J N7    1 
ATOM   3344  C C5    . DG  B 1 18  ? 110.767 25.158 -32.770 1.00 101.06 ? 164  DG  J C5    1 
ATOM   3345  C C6    . DG  B 1 18  ? 111.801 24.436 -32.132 1.00 100.81 ? 164  DG  J C6    1 
ATOM   3346  O O6    . DG  B 1 18  ? 112.856 24.864 -31.666 1.00 100.90 ? 164  DG  J O6    1 
ATOM   3347  N N1    . DG  B 1 18  ? 111.518 23.078 -32.069 1.00 100.33 ? 164  DG  J N1    1 
ATOM   3348  C C2    . DG  B 1 18  ? 110.387 22.488 -32.562 1.00 99.53  ? 164  DG  J C2    1 
ATOM   3349  N N2    . DG  B 1 18  ? 110.298 21.165 -32.392 1.00 97.74  ? 164  DG  J N2    1 
ATOM   3350  N N3    . DG  B 1 18  ? 109.414 23.149 -33.173 1.00 100.12 ? 164  DG  J N3    1 
ATOM   3351  C C4    . DG  B 1 18  ? 109.669 24.474 -33.240 1.00 101.05 ? 164  DG  J C4    1 
ATOM   3352  P P     . DA  B 1 19  ? 103.534 24.539 -34.081 1.00 76.66  ? 165  DA  J P     1 
ATOM   3353  O OP1   . DA  B 1 19  ? 102.394 24.521 -35.015 1.00 85.33  ? 165  DA  J OP1   1 
ATOM   3354  O OP2   . DA  B 1 19  ? 103.616 25.574 -33.027 1.00 85.58  ? 165  DA  J OP2   1 
ATOM   3355  O "O5'" . DA  B 1 19  ? 103.623 23.125 -33.381 1.00 78.13  ? 165  DA  J "O5'" 1 
ATOM   3356  C "C5'" . DA  B 1 19  ? 103.794 21.958 -34.161 1.00 81.75  ? 165  DA  J "C5'" 1 
ATOM   3357  C "C4'" . DA  B 1 19  ? 104.408 20.867 -33.317 1.00 84.07  ? 165  DA  J "C4'" 1 
ATOM   3358  O "O4'" . DA  B 1 19  ? 105.748 21.266 -32.937 1.00 83.80  ? 165  DA  J "O4'" 1 
ATOM   3359  C "C3'" . DA  B 1 19  ? 103.654 20.588 -32.018 1.00 86.32  ? 165  DA  J "C3'" 1 
ATOM   3360  O "O3'" . DA  B 1 19  ? 103.605 19.184 -31.773 1.00 90.62  ? 165  DA  J "O3'" 1 
ATOM   3361  C "C2'" . DA  B 1 19  ? 104.478 21.307 -30.967 1.00 85.74  ? 165  DA  J "C2'" 1 
ATOM   3362  C "C1'" . DA  B 1 19  ? 105.891 21.226 -31.529 1.00 84.72  ? 165  DA  J "C1'" 1 
ATOM   3363  N N9    . DA  B 1 19  ? 106.759 22.339 -31.146 1.00 93.03  ? 165  DA  J N9    1 
ATOM   3364  C C8    . DA  B 1 19  ? 106.615 23.657 -31.498 1.00 93.72  ? 165  DA  J C8    1 
ATOM   3365  N N7    . DA  B 1 19  ? 107.528 24.444 -30.984 1.00 93.82  ? 165  DA  J N7    1 
ATOM   3366  C C5    . DA  B 1 19  ? 108.332 23.586 -30.250 1.00 93.74  ? 165  DA  J C5    1 
ATOM   3367  C C6    . DA  B 1 19  ? 109.472 23.807 -29.468 1.00 94.20  ? 165  DA  J C6    1 
ATOM   3368  N N6    . DA  B 1 19  ? 110.008 25.012 -29.287 1.00 94.78  ? 165  DA  J N6    1 
ATOM   3369  N N1    . DA  B 1 19  ? 110.049 22.739 -28.873 1.00 93.54  ? 165  DA  J N1    1 
ATOM   3370  C C2    . DA  B 1 19  ? 109.502 21.531 -29.063 1.00 93.62  ? 165  DA  J C2    1 
ATOM   3371  N N3    . DA  B 1 19  ? 108.423 21.196 -29.775 1.00 93.43  ? 165  DA  J N3    1 
ATOM   3372  C C4    . DA  B 1 19  ? 107.879 22.282 -30.350 1.00 93.49  ? 165  DA  J C4    1 
ATOM   3373  P P     . DT  B 1 20  ? 102.936 18.644 -30.426 1.00 91.10  ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 20  ? 102.394 17.284 -30.660 1.00 101.05 ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 20  ? 102.036 19.711 -29.927 1.00 100.62 ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 20  ? 104.196 18.505 -29.469 1.00 93.73  ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 20  ? 105.335 17.782 -29.915 1.00 97.48  ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 20  ? 106.225 17.418 -28.751 1.00 100.79 ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 20  ? 107.113 18.512 -28.440 1.00 101.18 ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 20  ? 105.500 17.058 -27.454 1.00 102.60 ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 20  ? 106.091 15.888 -26.870 1.00 105.07 ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 20  ? 105.712 18.286 -26.588 1.00 102.10 ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 20  ? 107.063 18.784 -27.055 1.00 101.53 ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 20  ? 107.292 20.227 -26.879 1.00 110.80 ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 20  ? 108.268 20.611 -25.985 1.00 111.58 ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 20  ? 108.955 19.812 -25.355 1.00 112.18 ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 20  ? 108.414 21.975 -25.856 1.00 111.39 ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 20  ? 107.697 22.962 -26.511 1.00 110.60 ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 20  ? 107.921 24.145 -26.274 1.00 110.25 ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 20  ? 106.713 22.485 -27.447 1.00 110.26 ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 20  ? 105.926 23.484 -28.232 1.00 109.46 ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 20  ? 106.549 21.160 -27.575 1.00 110.31 ? 166  DT  J C6    1 
ATOM   3393  P P     . DT  B 1 21  ? 105.710 15.465 -25.368 1.00 115.19 ? 167  DT  J P     1 
ATOM   3394  O OP1   . DT  B 1 21  ? 106.003 14.018 -25.196 1.00 107.06 ? 167  DT  J OP1   1 
ATOM   3395  O OP2   . DT  B 1 21  ? 104.348 15.980 -25.054 1.00 107.21 ? 167  DT  J OP2   1 
ATOM   3396  O "O5'" . DT  B 1 21  ? 106.766 16.289 -24.518 1.00 118.02 ? 167  DT  J "O5'" 1 
ATOM   3397  C "C5'" . DT  B 1 21  ? 108.159 16.074 -24.711 1.00 121.99 ? 167  DT  J "C5'" 1 
ATOM   3398  C "C4'" . DT  B 1 21  ? 108.898 16.373 -23.432 1.00 124.00 ? 167  DT  J "C4'" 1 
ATOM   3399  O "O4'" . DT  B 1 21  ? 109.196 17.786 -23.352 1.00 123.89 ? 167  DT  J "O4'" 1 
ATOM   3400  C "C3'" . DT  B 1 21  ? 108.072 16.034 -22.193 1.00 125.57 ? 167  DT  J "C3'" 1 
ATOM   3401  O "O3'" . DT  B 1 21  ? 108.883 15.429 -21.189 1.00 128.15 ? 167  DT  J "O3'" 1 
ATOM   3402  C "C2'" . DT  B 1 21  ? 107.537 17.382 -21.745 1.00 124.94 ? 167  DT  J "C2'" 1 
ATOM   3403  C "C1'" . DT  B 1 21  ? 108.635 18.340 -22.174 1.00 123.70 ? 167  DT  J "C1'" 1 
ATOM   3404  N N1    . DT  B 1 21  ? 108.168 19.700 -22.505 1.00 114.93 ? 167  DT  J N1    1 
ATOM   3405  C C2    . DT  B 1 21  ? 108.907 20.773 -22.046 1.00 113.99 ? 167  DT  J C2    1 
ATOM   3406  O O2    . DT  B 1 21  ? 109.900 20.652 -21.337 1.00 113.84 ? 167  DT  J O2    1 
ATOM   3407  N N3    . DT  B 1 21  ? 108.427 22.004 -22.441 1.00 113.10 ? 167  DT  J N3    1 
ATOM   3408  C C4    . DT  B 1 21  ? 107.305 22.258 -23.217 1.00 112.56 ? 167  DT  J C4    1 
ATOM   3409  O O4    . DT  B 1 21  ? 106.999 23.412 -23.496 1.00 111.93 ? 167  DT  J O4    1 
ATOM   3410  C C5    . DT  B 1 21  ? 106.578 21.092 -23.650 1.00 112.72 ? 167  DT  J C5    1 
ATOM   3411  C C7    . DT  B 1 21  ? 105.378 21.275 -24.521 1.00 112.33 ? 167  DT  J C7    1 
ATOM   3412  C C6    . DT  B 1 21  ? 107.028 19.888 -23.264 1.00 113.78 ? 167  DT  J C6    1 
ATOM   3413  P P     . DC  B 1 22  ? 108.331 15.323 -19.690 1.00 160.07 ? 168  DC  J P     1 
ATOM   3414  O OP1   . DC  B 1 22  ? 108.965 14.134 -19.074 1.00 106.73 ? 168  DC  J OP1   1 
ATOM   3415  O OP2   . DC  B 1 22  ? 106.849 15.460 -19.682 1.00 105.86 ? 168  DC  J OP2   1 
ATOM   3416  O "O5'" . DC  B 1 22  ? 108.972 16.601 -19.009 1.00 161.61 ? 168  DC  J "O5'" 1 
ATOM   3417  C "C5'" . DC  B 1 22  ? 110.382 16.755 -18.989 1.00 164.04 ? 168  DC  J "C5'" 1 
ATOM   3418  C "C4'" . DC  B 1 22  ? 110.768 17.694 -17.877 1.00 165.64 ? 168  DC  J "C4'" 1 
ATOM   3419  O "O4'" . DC  B 1 22  ? 110.520 19.056 -18.305 1.00 166.01 ? 168  DC  J "O4'" 1 
ATOM   3420  C "C3'" . DC  B 1 22  ? 109.941 17.479 -16.606 1.00 166.49 ? 168  DC  J "C3'" 1 
ATOM   3421  O "O3'" . DC  B 1 22  ? 110.775 17.568 -15.442 1.00 167.57 ? 168  DC  J "O3'" 1 
ATOM   3422  C "C2'" . DC  B 1 22  ? 108.911 18.593 -16.666 1.00 166.54 ? 168  DC  J "C2'" 1 
ATOM   3423  C "C1'" . DC  B 1 22  ? 109.666 19.703 -17.378 1.00 166.23 ? 168  DC  J "C1'" 1 
ATOM   3424  N N1    . DC  B 1 22  ? 108.810 20.643 -18.121 1.00 112.67 ? 168  DC  J N1    1 
ATOM   3425  C C2    . DC  B 1 22  ? 108.970 22.024 -17.902 1.00 112.62 ? 168  DC  J C2    1 
ATOM   3426  O O2    . DC  B 1 22  ? 109.836 22.410 -17.104 1.00 112.65 ? 168  DC  J O2    1 
ATOM   3427  N N3    . DC  B 1 22  ? 108.172 22.900 -18.562 1.00 112.30 ? 168  DC  J N3    1 
ATOM   3428  C C4    . DC  B 1 22  ? 107.241 22.448 -19.406 1.00 112.19 ? 168  DC  J C4    1 
ATOM   3429  N N4    . DC  B 1 22  ? 106.473 23.347 -20.027 1.00 111.95 ? 168  DC  J N4    1 
ATOM   3430  C C5    . DC  B 1 22  ? 107.057 21.051 -19.651 1.00 112.10 ? 168  DC  J C5    1 
ATOM   3431  C C6    . DC  B 1 22  ? 107.863 20.192 -18.999 1.00 112.33 ? 168  DC  J C6    1 
ATOM   3432  P P     . DT  B 1 23  ? 110.126 17.902 -14.007 1.00 135.80 ? 169  DT  J P     1 
ATOM   3433  O OP1   . DT  B 1 23  ? 111.137 17.576 -12.966 1.00 120.80 ? 169  DT  J OP1   1 
ATOM   3434  O OP2   . DT  B 1 23  ? 108.770 17.290 -13.932 1.00 120.47 ? 169  DT  J OP2   1 
ATOM   3435  O "O5'" . DT  B 1 23  ? 109.973 19.483 -14.048 1.00 136.36 ? 169  DT  J "O5'" 1 
ATOM   3436  C "C5'" . DT  B 1 23  ? 111.125 20.317 -14.047 1.00 137.63 ? 169  DT  J "C5'" 1 
ATOM   3437  C "C4'" . DT  B 1 23  ? 110.850 21.546 -13.217 1.00 138.73 ? 169  DT  J "C4'" 1 
ATOM   3438  O "O4'" . DT  B 1 23  ? 109.992 22.431 -13.972 1.00 138.92 ? 169  DT  J "O4'" 1 
ATOM   3439  C "C3'" . DT  B 1 23  ? 110.083 21.210 -11.938 1.00 139.26 ? 169  DT  J "C3'" 1 
ATOM   3440  O "O3'" . DT  B 1 23  ? 110.448 22.082 -10.865 1.00 139.86 ? 169  DT  J "O3'" 1 
ATOM   3441  C "C2'" . DT  B 1 23  ? 108.640 21.442 -12.338 1.00 139.05 ? 169  DT  J "C2'" 1 
ATOM   3442  C "C1'" . DT  B 1 23  ? 108.774 22.625 -13.277 1.00 138.73 ? 169  DT  J "C1'" 1 
ATOM   3443  N N1    . DT  B 1 23  ? 107.707 22.752 -14.277 1.00 123.51 ? 169  DT  J N1    1 
ATOM   3444  C C2    . DT  B 1 23  ? 107.182 24.000 -14.492 1.00 123.67 ? 169  DT  J C2    1 
ATOM   3445  O O2    . DT  B 1 23  ? 107.561 24.989 -13.894 1.00 123.97 ? 169  DT  J O2    1 
ATOM   3446  N N3    . DT  B 1 23  ? 106.189 24.051 -15.435 1.00 123.50 ? 169  DT  J N3    1 
ATOM   3447  C C4    . DT  B 1 23  ? 105.681 22.996 -16.169 1.00 123.21 ? 169  DT  J C4    1 
ATOM   3448  O O4    . DT  B 1 23  ? 104.776 23.192 -16.976 1.00 123.40 ? 169  DT  J O4    1 
ATOM   3449  C C5    . DT  B 1 23  ? 106.289 21.711 -15.902 1.00 123.01 ? 169  DT  J C5    1 
ATOM   3450  C C7    . DT  B 1 23  ? 105.829 20.514 -16.672 1.00 122.59 ? 169  DT  J C7    1 
ATOM   3451  C C6    . DT  B 1 23  ? 107.252 21.654 -14.973 1.00 123.11 ? 169  DT  J C6    1 
ATOM   3452  P P     . DA  B 1 24  ? 109.696 21.946 -9.451  1.00 148.11 ? 170  DA  J P     1 
ATOM   3453  O OP1   . DA  B 1 24  ? 110.735 21.883 -8.404  1.00 142.26 ? 170  DA  J OP1   1 
ATOM   3454  O OP2   . DA  B 1 24  ? 108.648 20.889 -9.527  1.00 142.24 ? 170  DA  J OP2   1 
ATOM   3455  O "O5'" . DA  B 1 24  ? 108.965 23.338 -9.300  1.00 147.49 ? 170  DA  J "O5'" 1 
ATOM   3456  C "C5'" . DA  B 1 24  ? 109.669 24.537 -9.458  1.00 146.57 ? 170  DA  J "C5'" 1 
ATOM   3457  C "C4'" . DA  B 1 24  ? 108.731 25.674 -9.206  1.00 145.65 ? 170  DA  J "C4'" 1 
ATOM   3458  O "O4'" . DA  B 1 24  ? 107.938 25.906 -10.393 1.00 146.01 ? 170  DA  J "O4'" 1 
ATOM   3459  C "C3'" . DA  B 1 24  ? 107.785 25.513 -8.026  1.00 145.00 ? 170  DA  J "C3'" 1 
ATOM   3460  O "O3'" . DA  B 1 24  ? 107.989 26.682 -7.264  1.00 143.41 ? 170  DA  J "O3'" 1 
ATOM   3461  C "C2'" . DA  B 1 24  ? 106.400 25.414 -8.672  1.00 145.24 ? 170  DA  J "C2'" 1 
ATOM   3462  C "C1'" . DA  B 1 24  ? 106.560 25.960 -10.115 1.00 145.91 ? 170  DA  J "C1'" 1 
ATOM   3463  N N9    . DA  B 1 24  ? 105.846 25.306 -11.247 1.00 140.00 ? 170  DA  J N9    1 
ATOM   3464  C C8    . DA  B 1 24  ? 105.736 23.967 -11.598 1.00 140.27 ? 170  DA  J C8    1 
ATOM   3465  N N7    . DA  B 1 24  ? 105.015 23.754 -12.685 1.00 140.12 ? 170  DA  J N7    1 
ATOM   3466  C C5    . DA  B 1 24  ? 104.629 25.027 -13.083 1.00 139.90 ? 170  DA  J C5    1 
ATOM   3467  C C6    . DA  B 1 24  ? 103.864 25.489 -14.175 1.00 139.64 ? 170  DA  J C6    1 
ATOM   3468  N N6    . DA  B 1 24  ? 103.355 24.691 -15.120 1.00 139.03 ? 170  DA  J N6    1 
ATOM   3469  N N1    . DA  B 1 24  ? 103.652 26.820 -14.271 1.00 139.58 ? 170  DA  J N1    1 
ATOM   3470  C C2    . DA  B 1 24  ? 104.196 27.624 -13.353 1.00 139.75 ? 170  DA  J C2    1 
ATOM   3471  N N3    . DA  B 1 24  ? 104.949 27.317 -12.302 1.00 139.87 ? 170  DA  J N3    1 
ATOM   3472  C C4    . DA  B 1 24  ? 105.130 25.988 -12.214 1.00 139.95 ? 170  DA  J C4    1 
ATOM   3473  P P     . DC  B 1 25  ? 106.805 27.396 -6.451  1.00 137.91 ? 171  DC  J P     1 
ATOM   3474  O OP1   . DC  B 1 25  ? 107.493 28.355 -5.571  1.00 120.75 ? 171  DC  J OP1   1 
ATOM   3475  O OP2   . DC  B 1 25  ? 105.752 26.495 -5.819  1.00 120.60 ? 171  DC  J OP2   1 
ATOM   3476  O "O5'" . DC  B 1 25  ? 106.197 28.264 -7.653  1.00 136.70 ? 171  DC  J "O5'" 1 
ATOM   3477  C "C5'" . DC  B 1 25  ? 106.578 29.646 -7.869  1.00 134.64 ? 171  DC  J "C5'" 1 
ATOM   3478  C "C4'" . DC  B 1 25  ? 105.383 30.490 -8.288  1.00 133.34 ? 171  DC  J "C4'" 1 
ATOM   3479  O "O4'" . DC  B 1 25  ? 104.674 29.906 -9.409  1.00 132.88 ? 171  DC  J "O4'" 1 
ATOM   3480  C "C3'" . DC  B 1 25  ? 104.299 30.804 -7.247  1.00 132.53 ? 171  DC  J "C3'" 1 
ATOM   3481  O "O3'" . DC  B 1 25  ? 103.819 32.158 -7.388  1.00 131.13 ? 171  DC  J "O3'" 1 
ATOM   3482  C "C2'" . DC  B 1 25  ? 103.182 29.836 -7.594  1.00 132.25 ? 171  DC  J "C2'" 1 
ATOM   3483  C "C1'" . DC  B 1 25  ? 103.288 29.744 -9.104  1.00 132.09 ? 171  DC  J "C1'" 1 
ATOM   3484  N N1    . DC  B 1 25  ? 102.861 28.451 -9.667  1.00 114.03 ? 171  DC  J N1    1 
ATOM   3485  C C2    . DC  B 1 25  ? 101.931 28.437 -10.718 1.00 113.29 ? 171  DC  J C2    1 
ATOM   3486  O O2    . DC  B 1 25  ? 101.446 29.513 -11.102 1.00 112.64 ? 171  DC  J O2    1 
ATOM   3487  N N3    . DC  B 1 25  ? 101.586 27.252 -11.284 1.00 112.61 ? 171  DC  J N3    1 
ATOM   3488  C C4    . DC  B 1 25  ? 102.126 26.115 -10.833 1.00 112.83 ? 171  DC  J C4    1 
ATOM   3489  N N4    . DC  B 1 25  ? 101.789 24.973 -11.440 1.00 111.99 ? 171  DC  J N4    1 
ATOM   3490  C C5    . DC  B 1 25  ? 103.047 26.100 -9.743  1.00 113.13 ? 171  DC  J C5    1 
ATOM   3491  C C6    . DC  B 1 25  ? 103.381 27.279 -9.194  1.00 113.81 ? 171  DC  J C6    1 
ATOM   3492  P P     . DC  B 1 26  ? 102.716 32.730 -6.357  1.00 106.44 ? 172  DC  J P     1 
ATOM   3493  O OP1   . DC  B 1 26  ? 102.844 34.215 -6.298  1.00 137.14 ? 172  DC  J OP1   1 
ATOM   3494  O OP2   . DC  B 1 26  ? 102.789 31.941 -5.100  1.00 136.88 ? 172  DC  J OP2   1 
ATOM   3495  O "O5'" . DC  B 1 26  ? 101.324 32.387 -7.058  1.00 105.73 ? 172  DC  J "O5'" 1 
ATOM   3496  C "C5'" . DC  B 1 26  ? 100.842 33.174 -8.151  1.00 103.73 ? 172  DC  J "C5'" 1 
ATOM   3497  C "C4'" . DC  B 1 26  ? 99.388  32.869 -8.422  1.00 102.61 ? 172  DC  J "C4'" 1 
ATOM   3498  O "O4'" . DC  B 1 26  ? 99.252  31.583 -9.074  1.00 103.27 ? 172  DC  J "O4'" 1 
ATOM   3499  C "C3'" . DC  B 1 26  ? 98.505  32.810 -7.175  1.00 101.39 ? 172  DC  J "C3'" 1 
ATOM   3500  O "O3'" . DC  B 1 26  ? 97.262  33.464 -7.436  1.00 99.13  ? 172  DC  J "O3'" 1 
ATOM   3501  C "C2'" . DC  B 1 26  ? 98.281  31.321 -6.977  1.00 101.80 ? 172  DC  J "C2'" 1 
ATOM   3502  C "C1'" . DC  B 1 26  ? 98.262  30.830 -8.408  1.00 102.32 ? 172  DC  J "C1'" 1 
ATOM   3503  N N1    . DC  B 1 26  ? 98.564  29.406 -8.608  1.00 132.24 ? 172  DC  J N1    1 
ATOM   3504  C C2    . DC  B 1 26  ? 98.094  28.791 -9.759  1.00 132.12 ? 172  DC  J C2    1 
ATOM   3505  O O2    . DC  B 1 26  ? 97.490  29.477 -10.591 1.00 132.64 ? 172  DC  J O2    1 
ATOM   3506  N N3    . DC  B 1 26  ? 98.312  27.470 -9.945  1.00 131.02 ? 172  DC  J N3    1 
ATOM   3507  C C4    . DC  B 1 26  ? 98.986  26.774 -9.035  1.00 130.56 ? 172  DC  J C4    1 
ATOM   3508  N N4    . DC  B 1 26  ? 99.163  25.473 -9.251  1.00 129.60 ? 172  DC  J N4    1 
ATOM   3509  C C5    . DC  B 1 26  ? 99.507  27.383 -7.861  1.00 131.02 ? 172  DC  J C5    1 
ATOM   3510  C C6    . DC  B 1 26  ? 99.274  28.692 -7.687  1.00 131.64 ? 172  DC  J C6    1 
ATOM   3511  P P     . DA  B 1 27  ? 96.884  34.806 -6.635  1.00 103.85 ? 173  DA  J P     1 
ATOM   3512  O OP1   . DA  B 1 27  ? 98.017  35.757 -6.792  1.00 127.27 ? 173  DA  J OP1   1 
ATOM   3513  O OP2   . DA  B 1 27  ? 96.418  34.425 -5.273  1.00 126.86 ? 173  DA  J OP2   1 
ATOM   3514  O "O5'" . DA  B 1 27  ? 95.641  35.391 -7.437  1.00 101.22 ? 173  DA  J "O5'" 1 
ATOM   3515  C "C5'" . DA  B 1 27  ? 95.801  35.846 -8.777  1.00 96.62  ? 173  DA  J "C5'" 1 
ATOM   3516  C "C4'" . DA  B 1 27  ? 94.820  35.146 -9.687  1.00 93.95  ? 173  DA  J "C4'" 1 
ATOM   3517  O "O4'" . DA  B 1 27  ? 95.077  33.722 -9.689  1.00 92.58  ? 173  DA  J "O4'" 1 
ATOM   3518  C "C3'" . DA  B 1 27  ? 93.358  35.300 -9.284  1.00 92.94  ? 173  DA  J "C3'" 1 
ATOM   3519  O "O3'" . DA  B 1 27  ? 92.566  35.331 -10.473 1.00 91.74  ? 173  DA  J "O3'" 1 
ATOM   3520  C "C2'" . DA  B 1 27  ? 93.086  34.031 -8.499  1.00 92.61  ? 173  DA  J "C2'" 1 
ATOM   3521  C "C1'" . DA  B 1 27  ? 93.918  33.023 -9.264  1.00 92.63  ? 173  DA  J "C1'" 1 
ATOM   3522  N N9    . DA  B 1 27  ? 94.355  31.866 -8.488  1.00 116.28 ? 173  DA  J N9    1 
ATOM   3523  C C8    . DA  B 1 27  ? 94.680  31.815 -7.160  1.00 116.77 ? 173  DA  J C8    1 
ATOM   3524  N N7    . DA  B 1 27  ? 95.057  30.627 -6.753  1.00 117.21 ? 173  DA  J N7    1 
ATOM   3525  C C5    . DA  B 1 27  ? 94.971  29.840 -7.891  1.00 117.03 ? 173  DA  J C5    1 
ATOM   3526  C C6    . DA  B 1 27  ? 95.240  28.479 -8.128  1.00 117.26 ? 173  DA  J C6    1 
ATOM   3527  N N6    . DA  B 1 27  ? 95.678  27.633 -7.200  1.00 116.63 ? 173  DA  J N6    1 
ATOM   3528  N N1    . DA  B 1 27  ? 95.045  28.010 -9.375  1.00 117.04 ? 173  DA  J N1    1 
ATOM   3529  C C2    . DA  B 1 27  ? 94.615  28.856 -10.315 1.00 117.32 ? 173  DA  J C2    1 
ATOM   3530  N N3    . DA  B 1 27  ? 94.331  30.154 -10.218 1.00 117.27 ? 173  DA  J N3    1 
ATOM   3531  C C4    . DA  B 1 27  ? 94.534  30.590 -8.965  1.00 116.85 ? 173  DA  J C4    1 
ATOM   3532  P P     . DA  B 1 28  ? 91.140  36.070 -10.467 1.00 110.85 ? 174  DA  J P     1 
ATOM   3533  O OP1   . DA  B 1 28  ? 91.291  37.444 -11.012 1.00 108.16 ? 174  DA  J OP1   1 
ATOM   3534  O OP2   . DA  B 1 28  ? 90.549  35.863 -9.119  1.00 108.08 ? 174  DA  J OP2   1 
ATOM   3535  O "O5'" . DA  B 1 28  ? 90.285  35.223 -11.501 1.00 109.13 ? 174  DA  J "O5'" 1 
ATOM   3536  C "C5'" . DA  B 1 28  ? 90.894  34.688 -12.670 1.00 106.75 ? 174  DA  J "C5'" 1 
ATOM   3537  C "C4'" . DA  B 1 28  ? 90.444  33.261 -12.881 1.00 105.19 ? 174  DA  J "C4'" 1 
ATOM   3538  O "O4'" . DA  B 1 28  ? 91.043  32.390 -11.886 1.00 104.21 ? 174  DA  J "O4'" 1 
ATOM   3539  C "C3'" . DA  B 1 28  ? 88.933  33.053 -12.769 1.00 104.29 ? 174  DA  J "C3'" 1 
ATOM   3540  O "O3'" . DA  B 1 28  ? 88.492  32.135 -13.774 1.00 103.63 ? 174  DA  J "O3'" 1 
ATOM   3541  C "C2'" . DA  B 1 28  ? 88.766  32.454 -11.383 1.00 103.58 ? 174  DA  J "C2'" 1 
ATOM   3542  C "C1'" . DA  B 1 28  ? 90.026  31.619 -11.268 1.00 103.74 ? 174  DA  J "C1'" 1 
ATOM   3543  N N9    . DA  B 1 28  ? 90.452  31.307 -9.907  1.00 100.94 ? 174  DA  J N9    1 
ATOM   3544  C C8    . DA  B 1 28  ? 90.429  32.126 -8.809  1.00 101.37 ? 174  DA  J C8    1 
ATOM   3545  N N7    . DA  B 1 28  ? 90.871  31.555 -7.713  1.00 101.00 ? 174  DA  J N7    1 
ATOM   3546  C C5    . DA  B 1 28  ? 91.207  30.269 -8.117  1.00 100.82 ? 174  DA  J C5    1 
ATOM   3547  C C6    . DA  B 1 28  ? 91.728  29.164 -7.422  1.00 101.00 ? 174  DA  J C6    1 
ATOM   3548  N N6    . DA  B 1 28  ? 92.019  29.180 -6.131  1.00 101.43 ? 174  DA  J N6    1 
ATOM   3549  N N1    . DA  B 1 28  ? 91.944  28.031 -8.113  1.00 100.53 ? 174  DA  J N1    1 
ATOM   3550  C C2    . DA  B 1 28  ? 91.663  28.017 -9.413  1.00 99.77  ? 174  DA  J C2    1 
ATOM   3551  N N3    . DA  B 1 28  ? 91.175  28.990 -10.184 1.00 100.03 ? 174  DA  J N3    1 
ATOM   3552  C C4    . DA  B 1 28  ? 90.962  30.106 -9.465  1.00 100.42 ? 174  DA  J C4    1 
ATOM   3553  P P     . DA  B 1 29  ? 86.933  32.053 -14.144 1.00 99.78  ? 175  DA  J P     1 
ATOM   3554  O OP1   . DA  B 1 29  ? 86.791  32.022 -15.624 1.00 123.57 ? 175  DA  J OP1   1 
ATOM   3555  O OP2   . DA  B 1 29  ? 86.224  33.088 -13.347 1.00 123.09 ? 175  DA  J OP2   1 
ATOM   3556  O "O5'" . DA  B 1 29  ? 86.496  30.648 -13.567 1.00 96.02  ? 175  DA  J "O5'" 1 
ATOM   3557  C "C5'" . DA  B 1 29  ? 87.336  29.994 -12.657 1.00 92.35  ? 175  DA  J "C5'" 1 
ATOM   3558  C "C4'" . DA  B 1 29  ? 87.720  28.642 -13.192 1.00 89.10  ? 175  DA  J "C4'" 1 
ATOM   3559  O "O4'" . DA  B 1 29  ? 88.601  28.051 -12.228 1.00 88.10  ? 175  DA  J "O4'" 1 
ATOM   3560  C "C3'" . DA  B 1 29  ? 86.513  27.725 -13.243 1.00 87.92  ? 175  DA  J "C3'" 1 
ATOM   3561  O "O3'" . DA  B 1 29  ? 86.732  26.646 -14.146 1.00 86.16  ? 175  DA  J "O3'" 1 
ATOM   3562  C "C2'" . DA  B 1 29  ? 86.415  27.233 -11.820 1.00 87.78  ? 175  DA  J "C2'" 1 
ATOM   3563  C "C1'" . DA  B 1 29  ? 87.862  27.203 -11.356 1.00 88.22  ? 175  DA  J "C1'" 1 
ATOM   3564  N N9    . DA  B 1 29  ? 88.037  27.716 -9.995  1.00 110.59 ? 175  DA  J N9    1 
ATOM   3565  C C8    . DA  B 1 29  ? 87.892  29.015 -9.565  1.00 110.01 ? 175  DA  J C8    1 
ATOM   3566  N N7    . DA  B 1 29  ? 88.161  29.184 -8.297  1.00 109.06 ? 175  DA  J N7    1 
ATOM   3567  C C5    . DA  B 1 29  ? 88.494  27.913 -7.858  1.00 110.28 ? 175  DA  J C5    1 
ATOM   3568  C C6    . DA  B 1 29  ? 88.882  27.431 -6.618  1.00 109.98 ? 175  DA  J C6    1 
ATOM   3569  N N6    . DA  B 1 29  ? 89.027  28.205 -5.545  1.00 111.63 ? 175  DA  J N6    1 
ATOM   3570  N N1    . DA  B 1 29  ? 89.127  26.110 -6.505  1.00 110.21 ? 175  DA  J N1    1 
ATOM   3571  C C2    . DA  B 1 29  ? 88.993  25.337 -7.587  1.00 110.58 ? 175  DA  J C2    1 
ATOM   3572  N N3    . DA  B 1 29  ? 88.645  25.676 -8.817  1.00 109.42 ? 175  DA  J N3    1 
ATOM   3573  C C4    . DA  B 1 29  ? 88.407  26.996 -8.888  1.00 109.94 ? 175  DA  J C4    1 
ATOM   3574  P P     . DA  B 1 30  ? 85.473  25.795 -14.688 1.00 81.88  ? 176  DA  J P     1 
ATOM   3575  O OP1   . DA  B 1 30  ? 85.945  25.063 -15.903 1.00 90.23  ? 176  DA  J OP1   1 
ATOM   3576  O OP2   . DA  B 1 30  ? 84.264  26.669 -14.761 1.00 88.81  ? 176  DA  J OP2   1 
ATOM   3577  O "O5'" . DA  B 1 30  ? 85.232  24.714 -13.549 1.00 80.91  ? 176  DA  J "O5'" 1 
ATOM   3578  C "C5'" . DA  B 1 30  ? 86.170  23.660 -13.390 1.00 79.24  ? 176  DA  J "C5'" 1 
ATOM   3579  C "C4'" . DA  B 1 30  ? 85.878  22.846 -12.149 1.00 78.88  ? 176  DA  J "C4'" 1 
ATOM   3580  O "O4'" . DA  B 1 30  ? 86.199  23.575 -10.942 1.00 78.23  ? 176  DA  J "O4'" 1 
ATOM   3581  C "C3'" . DA  B 1 30  ? 84.424  22.410 -11.987 1.00 78.79  ? 176  DA  J "C3'" 1 
ATOM   3582  O "O3'" . DA  B 1 30  ? 84.242  21.238 -11.210 1.00 79.07  ? 176  DA  J "O3'" 1 
ATOM   3583  C "C2'" . DA  B 1 30  ? 83.870  23.403 -10.991 1.00 78.53  ? 176  DA  J "C2'" 1 
ATOM   3584  C "C1'" . DA  B 1 30  ? 85.078  23.550 -10.077 1.00 79.53  ? 176  DA  J "C1'" 1 
ATOM   3585  N N9    . DA  B 1 30  ? 85.166  24.748 -9.248  1.00 88.73  ? 176  DA  J N9    1 
ATOM   3586  C C8    . DA  B 1 30  ? 84.947  26.052 -9.597  1.00 90.12  ? 176  DA  J C8    1 
ATOM   3587  N N7    . DA  B 1 30  ? 85.167  26.907 -8.626  1.00 89.90  ? 176  DA  J N7    1 
ATOM   3588  C C5    . DA  B 1 30  ? 85.542  26.108 -7.560  1.00 89.71  ? 176  DA  J C5    1 
ATOM   3589  C C6    . DA  B 1 30  ? 85.899  26.408 -6.232  1.00 88.41  ? 176  DA  J C6    1 
ATOM   3590  N N6    . DA  B 1 30  ? 85.925  27.644 -5.729  1.00 86.55  ? 176  DA  J N6    1 
ATOM   3591  N N1    . DA  B 1 30  ? 86.231  25.378 -5.425  1.00 88.32  ? 176  DA  J N1    1 
ATOM   3592  C C2    . DA  B 1 30  ? 86.197  24.137 -5.924  1.00 88.54  ? 176  DA  J C2    1 
ATOM   3593  N N3    . DA  B 1 30  ? 85.867  23.729 -7.150  1.00 89.76  ? 176  DA  J N3    1 
ATOM   3594  C C4    . DA  B 1 30  ? 85.546  24.776 -7.928  1.00 89.50  ? 176  DA  J C4    1 
ATOM   3595  P P     . DG  B 1 31  ? 82.997  20.273 -11.435 1.00 103.13 ? 177  DG  J P     1 
ATOM   3596  O OP1   . DG  B 1 31  ? 82.964  19.342 -12.685 1.00 81.21  ? 177  DG  J OP1   1 
ATOM   3597  O OP2   . DG  B 1 31  ? 81.849  21.145 -11.241 1.00 81.77  ? 177  DG  J OP2   1 
ATOM   3598  O "O5'" . DG  B 1 31  ? 83.064  19.580 -10.027 1.00 107.15 ? 177  DG  J "O5'" 1 
ATOM   3599  C "C5'" . DG  B 1 31  ? 84.311  19.065 -9.537  1.00 111.35 ? 177  DG  J "C5'" 1 
ATOM   3600  C "C4'" . DG  B 1 31  ? 84.255  18.889 -8.036  1.00 114.22 ? 177  DG  J "C4'" 1 
ATOM   3601  O "O4'" . DG  B 1 31  ? 84.538  20.156 -7.388  1.00 114.86 ? 177  DG  J "O4'" 1 
ATOM   3602  C "C3'" . DG  B 1 31  ? 82.889  18.433 -7.506  1.00 116.22 ? 177  DG  J "C3'" 1 
ATOM   3603  O "O3'" . DG  B 1 31  ? 83.043  17.429 -6.477  1.00 119.00 ? 177  DG  J "O3'" 1 
ATOM   3604  C "C2'" . DG  B 1 31  ? 82.280  19.729 -6.997  1.00 115.80 ? 177  DG  J "C2'" 1 
ATOM   3605  C "C1'" . DG  B 1 31  ? 83.506  20.460 -6.472  1.00 116.33 ? 177  DG  J "C1'" 1 
ATOM   3606  N N9    . DG  B 1 31  ? 83.400  21.912 -6.374  1.00 94.89  ? 177  DG  J N9    1 
ATOM   3607  C C8    . DG  B 1 31  ? 83.182  22.807 -7.396  1.00 95.44  ? 177  DG  J C8    1 
ATOM   3608  N N7    . DG  B 1 31  ? 83.089  24.044 -6.987  1.00 94.88  ? 177  DG  J N7    1 
ATOM   3609  C C5    . DG  B 1 31  ? 83.273  23.970 -5.609  1.00 95.48  ? 177  DG  J C5    1 
ATOM   3610  C C6    . DG  B 1 31  ? 83.276  24.996 -4.615  1.00 96.06  ? 177  DG  J C6    1 
ATOM   3611  O O6    . DG  B 1 31  ? 83.139  26.214 -4.756  1.00 96.08  ? 177  DG  J O6    1 
ATOM   3612  N N1    . DG  B 1 31  ? 83.474  24.475 -3.346  1.00 97.14  ? 177  DG  J N1    1 
ATOM   3613  C C2    . DG  B 1 31  ? 83.666  23.148 -3.055  1.00 98.00  ? 177  DG  J C2    1 
ATOM   3614  N N2    . DG  B 1 31  ? 83.832  22.852 -1.753  1.00 99.49  ? 177  DG  J N2    1 
ATOM   3615  N N3    . DG  B 1 31  ? 83.689  22.184 -3.967  1.00 97.56  ? 177  DG  J N3    1 
ATOM   3616  C C4    . DG  B 1 31  ? 83.479  22.664 -5.218  1.00 95.91  ? 177  DG  J C4    1 
ATOM   3617  P P     . DT  B 1 32  ? 81.781  16.963 -5.585  1.00 132.41 ? 178  DT  J P     1 
ATOM   3618  O OP1   . DT  B 1 32  ? 82.138  15.592 -5.160  1.00 97.85  ? 178  DT  J OP1   1 
ATOM   3619  O OP2   . DT  B 1 32  ? 80.461  17.202 -6.241  1.00 96.94  ? 178  DT  J OP2   1 
ATOM   3620  O "O5'" . DT  B 1 32  ? 81.919  17.907 -4.311  1.00 134.70 ? 178  DT  J "O5'" 1 
ATOM   3621  C "C5'" . DT  B 1 32  ? 83.084  17.826 -3.489  1.00 136.09 ? 178  DT  J "C5'" 1 
ATOM   3622  C "C4'" . DT  B 1 32  ? 82.765  18.273 -2.083  1.00 137.12 ? 178  DT  J "C4'" 1 
ATOM   3623  O "O4'" . DT  B 1 32  ? 82.621  19.711 -2.074  1.00 136.96 ? 178  DT  J "O4'" 1 
ATOM   3624  C "C3'" . DT  B 1 32  ? 81.454  17.707 -1.538  1.00 138.33 ? 178  DT  J "C3'" 1 
ATOM   3625  O "O3'" . DT  B 1 32  ? 81.563  17.394 -0.147  1.00 140.73 ? 178  DT  J "O3'" 1 
ATOM   3626  C "C2'" . DT  B 1 32  ? 80.463  18.831 -1.776  1.00 137.34 ? 178  DT  J "C2'" 1 
ATOM   3627  C "C1'" . DT  B 1 32  ? 81.325  20.070 -1.628  1.00 136.99 ? 178  DT  J "C1'" 1 
ATOM   3628  N N1    . DT  B 1 32  ? 80.883  21.238 -2.412  1.00 101.58 ? 178  DT  J N1    1 
ATOM   3629  C C2    . DT  B 1 32  ? 80.513  22.356 -1.705  1.00 102.26 ? 178  DT  J C2    1 
ATOM   3630  O O2    . DT  B 1 32  ? 80.497  22.399 -0.487  1.00 102.97 ? 178  DT  J O2    1 
ATOM   3631  N N3    . DT  B 1 32  ? 80.145  23.427 -2.473  1.00 101.96 ? 178  DT  J N3    1 
ATOM   3632  C C4    . DT  B 1 32  ? 80.086  23.485 -3.842  1.00 102.33 ? 178  DT  J C4    1 
ATOM   3633  O O4    . DT  B 1 32  ? 79.734  24.517 -4.388  1.00 102.65 ? 178  DT  J O4    1 
ATOM   3634  C C5    . DT  B 1 32  ? 80.461  22.276 -4.529  1.00 102.39 ? 178  DT  J C5    1 
ATOM   3635  C C7    . DT  B 1 32  ? 80.406  22.255 -6.025  1.00 101.88 ? 178  DT  J C7    1 
ATOM   3636  C C6    . DT  B 1 32  ? 80.842  21.220 -3.789  1.00 102.13 ? 178  DT  J C6    1 
ATOM   3637  P P     . DG  B 1 33  ? 80.374  16.596 0.577   1.00 144.92 ? 179  DG  J P     1 
ATOM   3638  O OP1   . DG  B 1 33  ? 80.960  15.697 1.597   1.00 105.73 ? 179  DG  J OP1   1 
ATOM   3639  O OP2   . DG  B 1 33  ? 79.499  16.032 -0.476  1.00 106.16 ? 179  DG  J OP2   1 
ATOM   3640  O "O5'" . DG  B 1 33  ? 79.594  17.745 1.344   1.00 146.42 ? 179  DG  J "O5'" 1 
ATOM   3641  C "C5'" . DG  B 1 33  ? 80.239  18.457 2.387   1.00 148.69 ? 179  DG  J "C5'" 1 
ATOM   3642  C "C4'" . DG  B 1 33  ? 79.291  19.467 2.982   1.00 150.48 ? 179  DG  J "C4'" 1 
ATOM   3643  O "O4'" . DG  B 1 33  ? 79.175  20.622 2.114   1.00 150.76 ? 179  DG  J "O4'" 1 
ATOM   3644  C "C3'" . DG  B 1 33  ? 77.874  18.937 3.192   1.00 151.46 ? 179  DG  J "C3'" 1 
ATOM   3645  O "O3'" . DG  B 1 33  ? 77.409  19.364 4.468   1.00 153.33 ? 179  DG  J "O3'" 1 
ATOM   3646  C "C2'" . DG  B 1 33  ? 77.083  19.579 2.063   1.00 151.19 ? 179  DG  J "C2'" 1 
ATOM   3647  C "C1'" . DG  B 1 33  ? 77.808  20.900 1.854   1.00 150.52 ? 179  DG  J "C1'" 1 
ATOM   3648  N N9    . DG  B 1 33  ? 77.705  21.447 0.505   1.00 109.51 ? 179  DG  J N9    1 
ATOM   3649  C C8    . DG  B 1 33  ? 77.834  20.755 -0.678  1.00 108.94 ? 179  DG  J C8    1 
ATOM   3650  N N7    . DG  B 1 33  ? 77.693  21.507 -1.733  1.00 108.38 ? 179  DG  J N7    1 
ATOM   3651  C C5    . DG  B 1 33  ? 77.454  22.778 -1.222  1.00 108.25 ? 179  DG  J C5    1 
ATOM   3652  C C6    . DG  B 1 33  ? 77.225  24.007 -1.894  1.00 108.26 ? 179  DG  J C6    1 
ATOM   3653  O O6    . DG  B 1 33  ? 77.195  24.228 -3.112  1.00 107.60 ? 179  DG  J O6    1 
ATOM   3654  N N1    . DG  B 1 33  ? 77.021  25.050 -0.996  1.00 107.97 ? 179  DG  J N1    1 
ATOM   3655  C C2    . DG  B 1 33  ? 77.038  24.930 0.367   1.00 108.10 ? 179  DG  J C2    1 
ATOM   3656  N N2    . DG  B 1 33  ? 76.802  26.060 1.047   1.00 108.16 ? 179  DG  J N2    1 
ATOM   3657  N N3    . DG  B 1 33  ? 77.264  23.790 1.009   1.00 108.24 ? 179  DG  J N3    1 
ATOM   3658  C C4    . DG  B 1 33  ? 77.460  22.758 0.155   1.00 108.79 ? 179  DG  J C4    1 
ATOM   3659  P P     . DT  B 1 34  ? 75.860  19.206 4.846   1.00 148.43 ? 180  DT  J P     1 
ATOM   3660  O OP1   . DT  B 1 34  ? 75.829  18.830 6.276   1.00 116.21 ? 180  DT  J OP1   1 
ATOM   3661  O OP2   . DT  B 1 34  ? 75.175  18.345 3.846   1.00 115.77 ? 180  DT  J OP2   1 
ATOM   3662  O "O5'" . DT  B 1 34  ? 75.334  20.703 4.734   1.00 147.89 ? 180  DT  J "O5'" 1 
ATOM   3663  C "C5'" . DT  B 1 34  ? 76.100  21.770 5.299   1.00 146.06 ? 180  DT  J "C5'" 1 
ATOM   3664  C "C4'" . DT  B 1 34  ? 75.271  23.029 5.358   1.00 144.63 ? 180  DT  J "C4'" 1 
ATOM   3665  O "O4'" . DT  B 1 34  ? 75.159  23.600 4.033   1.00 144.23 ? 180  DT  J "O4'" 1 
ATOM   3666  C "C3'" . DT  B 1 34  ? 73.843  22.764 5.826   1.00 144.10 ? 180  DT  J "C3'" 1 
ATOM   3667  O "O3'" . DT  B 1 34  ? 73.360  23.861 6.601   1.00 143.48 ? 180  DT  J "O3'" 1 
ATOM   3668  C "C2'" . DT  B 1 34  ? 73.076  22.653 4.524   1.00 144.00 ? 180  DT  J "C2'" 1 
ATOM   3669  C "C1'" . DT  B 1 34  ? 73.793  23.672 3.660   1.00 143.92 ? 180  DT  J "C1'" 1 
ATOM   3670  N N1    . DT  B 1 34  ? 73.703  23.433 2.207   1.00 110.61 ? 180  DT  J N1    1 
ATOM   3671  C C2    . DT  B 1 34  ? 73.213  24.448 1.420   1.00 110.53 ? 180  DT  J C2    1 
ATOM   3672  O O2    . DT  B 1 34  ? 72.887  25.536 1.864   1.00 110.39 ? 180  DT  J O2    1 
ATOM   3673  N N3    . DT  B 1 34  ? 73.123  24.144 0.086   1.00 110.25 ? 180  DT  J N3    1 
ATOM   3674  C C4    . DT  B 1 34  ? 73.484  22.961 -0.527  1.00 109.86 ? 180  DT  J C4    1 
ATOM   3675  O O4    . DT  B 1 34  ? 73.326  22.829 -1.737  1.00 109.55 ? 180  DT  J O4    1 
ATOM   3676  C C5    . DT  B 1 34  ? 74.027  21.952 0.354   1.00 109.88 ? 180  DT  J C5    1 
ATOM   3677  C C7    . DT  B 1 34  ? 74.500  20.657 -0.227  1.00 109.41 ? 180  DT  J C7    1 
ATOM   3678  C C6    . DT  B 1 34  ? 74.094  22.230 1.661   1.00 110.07 ? 180  DT  J C6    1 
ATOM   3679  P P     . DA  B 1 35  ? 71.777  24.055 6.797   1.00 145.75 ? 181  DA  J P     1 
ATOM   3680  O OP1   . DA  B 1 35  ? 71.547  24.788 8.063   1.00 101.19 ? 181  DA  J OP1   1 
ATOM   3681  O OP2   . DA  B 1 35  ? 71.098  22.756 6.568   1.00 101.01 ? 181  DA  J OP2   1 
ATOM   3682  O "O5'" . DA  B 1 35  ? 71.377  25.007 5.590   1.00 145.23 ? 181  DA  J "O5'" 1 
ATOM   3683  C "C5'" . DA  B 1 35  ? 71.671  26.398 5.631   1.00 144.61 ? 181  DA  J "C5'" 1 
ATOM   3684  C "C4'" . DA  B 1 35  ? 70.480  27.185 5.141   1.00 144.11 ? 181  DA  J "C4'" 1 
ATOM   3685  O "O4'" . DA  B 1 35  ? 70.332  27.008 3.711   1.00 143.56 ? 181  DA  J "O4'" 1 
ATOM   3686  C "C3'" . DA  B 1 35  ? 69.158  26.746 5.767   1.00 143.68 ? 181  DA  J "C3'" 1 
ATOM   3687  O "O3'" . DA  B 1 35  ? 68.374  27.908 6.060   1.00 143.84 ? 181  DA  J "O3'" 1 
ATOM   3688  C "C2'" . DA  B 1 35  ? 68.554  25.824 4.719   1.00 142.86 ? 181  DA  J "C2'" 1 
ATOM   3689  C "C1'" . DA  B 1 35  ? 69.095  26.375 3.400   1.00 141.90 ? 181  DA  J "C1'" 1 
ATOM   3690  N N9    . DA  B 1 35  ? 69.360  25.377 2.354   1.00 95.52  ? 181  DA  J N9    1 
ATOM   3691  C C8    . DA  B 1 35  ? 69.487  24.005 2.476   1.00 94.61  ? 181  DA  J C8    1 
ATOM   3692  N N7    . DA  B 1 35  ? 69.787  23.398 1.352   1.00 92.69  ? 181  DA  J N7    1 
ATOM   3693  C C5    . DA  B 1 35  ? 69.854  24.430 0.423   1.00 92.43  ? 181  DA  J C5    1 
ATOM   3694  C C6    . DA  B 1 35  ? 70.152  24.446 -0.946  1.00 91.29  ? 181  DA  J C6    1 
ATOM   3695  N N6    . DA  B 1 35  ? 70.459  23.351 -1.648  1.00 89.72  ? 181  DA  J N6    1 
ATOM   3696  N N1    . DA  B 1 35  ? 70.128  25.643 -1.578  1.00 90.70  ? 181  DA  J N1    1 
ATOM   3697  C C2    . DA  B 1 35  ? 69.821  26.740 -0.870  1.00 91.14  ? 181  DA  J C2    1 
ATOM   3698  N N3    . DA  B 1 35  ? 69.532  26.854 0.418   1.00 92.31  ? 181  DA  J N3    1 
ATOM   3699  C C4    . DA  B 1 35  ? 69.571  25.649 1.020   1.00 93.37  ? 181  DA  J C4    1 
ATOM   3700  P P     . DT  B 1 36  ? 66.784  27.878 5.864   1.00 126.81 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 36  ? 66.238  29.043 6.604   1.00 108.48 ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 36  ? 66.283  26.508 6.167   1.00 108.56 ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 36  ? 66.626  28.193 4.311   1.00 125.55 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 36  ? 67.348  29.281 3.720   1.00 122.83 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 36  ? 66.720  29.690 2.405   1.00 120.75 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 36  ? 67.065  28.763 1.342   1.00 119.14 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 36  ? 65.195  29.783 2.422   1.00 119.06 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 36  ? 64.786  30.999 1.785   1.00 116.55 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 36  ? 64.752  28.533 1.675   1.00 118.51 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 36  ? 65.888  28.310 0.688   1.00 117.56 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 36  ? 66.111  26.901 0.271   1.00 97.59  ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 36  ? 66.318  26.637 -1.076  1.00 96.11  ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 36  ? 66.311  27.498 -1.949  1.00 95.28  ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 36  ? 66.538  25.314 -1.367  1.00 94.69  ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 36  ? 66.574  24.257 -0.484  1.00 94.89  ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 36  ? 66.801  23.121 -0.893  1.00 92.45  ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 36  ? 66.342  24.598 0.894   1.00 96.03  ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 36  ? 66.365  23.506 1.913   1.00 96.63  ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 36  ? 66.118  25.884 1.202   1.00 96.86  ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 37  ? 63.257  31.196 1.338   1.00 106.19 ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 37  ? 62.868  32.625 1.468   1.00 98.25  ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 37  ? 62.427  30.142 1.981   1.00 96.88  ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 37  ? 63.344  30.887 -0.214  1.00 103.02 ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 37  ? 64.417  31.414 -0.983  1.00 98.65  ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 37  ? 64.201  31.107 -2.443  1.00 95.53  ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 37  ? 64.467  29.711 -2.709  1.00 93.84  ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 37  ? 62.769  31.362 -2.896  1.00 94.45  ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 37  ? 62.787  31.977 -4.176  1.00 92.58  ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 37  ? 62.153  29.973 -2.946  1.00 93.57  ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 37  ? 63.339  29.105 -3.316  1.00 93.68  ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 37  ? 63.266  27.715 -2.835  1.00 86.37  ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 37  ? 63.503  26.691 -3.728  1.00 86.76  ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 37  ? 63.772  26.872 -4.899  1.00 86.99  ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 37  ? 63.424  25.437 -3.194  1.00 87.08  ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 37  ? 63.153  25.106 -1.885  1.00 87.32  ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 37  ? 63.135  23.927 -1.541  1.00 87.16  ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 37  ? 62.915  26.223 -1.003  1.00 87.53  ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 37  ? 62.619  25.954 0.439   1.00 87.42  ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 37  ? 62.973  27.457 -1.519  1.00 86.97  ? 183  DT  J C6    1 
ATOM   3740  P P     . DT  B 1 38  ? 61.414  32.435 -4.848  1.00 82.15  ? 184  DT  J P     1 
ATOM   3741  O OP1   . DT  B 1 38  ? 61.647  33.733 -5.539  1.00 83.75  ? 184  DT  J OP1   1 
ATOM   3742  O OP2   . DT  B 1 38  ? 60.339  32.317 -3.830  1.00 84.78  ? 184  DT  J OP2   1 
ATOM   3743  O "O5'" . DT  B 1 38  ? 61.180  31.304 -5.942  1.00 80.71  ? 184  DT  J "O5'" 1 
ATOM   3744  C "C5'" . DT  B 1 38  ? 62.223  30.941 -6.843  1.00 77.41  ? 184  DT  J "C5'" 1 
ATOM   3745  C "C4'" . DT  B 1 38  ? 61.776  29.806 -7.733  1.00 75.94  ? 184  DT  J "C4'" 1 
ATOM   3746  O "O4'" . DT  B 1 38  ? 61.833  28.541 -7.036  1.00 75.34  ? 184  DT  J "O4'" 1 
ATOM   3747  C "C3'" . DT  B 1 38  ? 60.350  29.931 -8.273  1.00 74.39  ? 184  DT  J "C3'" 1 
ATOM   3748  O "O3'" . DT  B 1 38  ? 60.333  29.546 -9.650  1.00 71.11  ? 184  DT  J "O3'" 1 
ATOM   3749  C "C2'" . DT  B 1 38  ? 59.573  28.926 -7.441  1.00 75.02  ? 184  DT  J "C2'" 1 
ATOM   3750  C "C1'" . DT  B 1 38  ? 60.619  27.851 -7.244  1.00 75.75  ? 184  DT  J "C1'" 1 
ATOM   3751  N N1    . DT  B 1 38  ? 60.411  26.950 -6.110  1.00 80.65  ? 184  DT  J N1    1 
ATOM   3752  C C2    . DT  B 1 38  ? 60.553  25.612 -6.357  1.00 82.38  ? 184  DT  J C2    1 
ATOM   3753  O O2    . DT  B 1 38  ? 60.867  25.173 -7.446  1.00 84.43  ? 184  DT  J O2    1 
ATOM   3754  N N3    . DT  B 1 38  ? 60.319  24.799 -5.279  1.00 82.74  ? 184  DT  J N3    1 
ATOM   3755  C C4    . DT  B 1 38  ? 59.967  25.189 -4.006  1.00 83.15  ? 184  DT  J C4    1 
ATOM   3756  O O4    . DT  B 1 38  ? 59.746  24.342 -3.153  1.00 82.82  ? 184  DT  J O4    1 
ATOM   3757  C C5    . DT  B 1 38  ? 59.872  26.617 -3.804  1.00 82.92  ? 184  DT  J C5    1 
ATOM   3758  C C7    . DT  B 1 38  ? 59.551  27.135 -2.439  1.00 84.18  ? 184  DT  J C7    1 
ATOM   3759  C C6    . DT  B 1 38  ? 60.086  27.417 -4.858  1.00 81.90  ? 184  DT  J C6    1 
ATOM   3760  P P     . DG  B 1 39  ? 60.049  30.646 -10.779 1.00 73.86  ? 185  DG  J P     1 
ATOM   3761  O OP1   . DG  B 1 39  ? 61.037  31.749 -10.706 1.00 79.99  ? 185  DG  J OP1   1 
ATOM   3762  O OP2   . DG  B 1 39  ? 58.599  30.943 -10.681 1.00 80.10  ? 185  DG  J OP2   1 
ATOM   3763  O "O5'" . DG  B 1 39  ? 60.361  29.870 -12.123 1.00 72.67  ? 185  DG  J "O5'" 1 
ATOM   3764  C "C5'" . DG  B 1 39  ? 61.647  29.345 -12.360 1.00 68.55  ? 185  DG  J "C5'" 1 
ATOM   3765  C "C4'" . DG  B 1 39  ? 61.530  27.896 -12.762 1.00 66.47  ? 185  DG  J "C4'" 1 
ATOM   3766  O "O4'" . DG  B 1 39  ? 61.049  27.113 -11.647 1.00 66.31  ? 185  DG  J "O4'" 1 
ATOM   3767  C "C3'" . DG  B 1 39  ? 60.552  27.627 -13.903 1.00 64.81  ? 185  DG  J "C3'" 1 
ATOM   3768  O "O3'" . DG  B 1 39  ? 61.064  26.562 -14.701 1.00 58.99  ? 185  DG  J "O3'" 1 
ATOM   3769  C "C2'" . DG  B 1 39  ? 59.296  27.162 -13.190 1.00 65.91  ? 185  DG  J "C2'" 1 
ATOM   3770  C "C1'" . DG  B 1 39  ? 59.867  26.415 -12.009 1.00 66.15  ? 185  DG  J "C1'" 1 
ATOM   3771  N N9    . DG  B 1 39  ? 58.994  26.411 -10.839 1.00 73.83  ? 185  DG  J N9    1 
ATOM   3772  C C8    . DG  B 1 39  ? 58.316  27.481 -10.288 1.00 74.74  ? 185  DG  J C8    1 
ATOM   3773  N N7    . DG  B 1 39  ? 57.658  27.164 -9.203  1.00 77.24  ? 185  DG  J N7    1 
ATOM   3774  C C5    . DG  B 1 39  ? 57.914  25.811 -9.039  1.00 75.53  ? 185  DG  J C5    1 
ATOM   3775  C C6    . DG  B 1 39  ? 57.493  24.931 -8.044  1.00 74.79  ? 185  DG  J C6    1 
ATOM   3776  O O6    . DG  B 1 39  ? 56.805  25.176 -7.059  1.00 75.04  ? 185  DG  J O6    1 
ATOM   3777  N N1    . DG  B 1 39  ? 57.962  23.641 -8.269  1.00 73.98  ? 185  DG  J N1    1 
ATOM   3778  C C2    . DG  B 1 39  ? 58.751  23.256 -9.327  1.00 74.34  ? 185  DG  J C2    1 
ATOM   3779  N N2    . DG  B 1 39  ? 59.097  21.960 -9.389  1.00 72.54  ? 185  DG  J N2    1 
ATOM   3780  N N3    . DG  B 1 39  ? 59.169  24.083 -10.260 1.00 73.74  ? 185  DG  J N3    1 
ATOM   3781  C C4    . DG  B 1 39  ? 58.718  25.330 -10.057 1.00 74.09  ? 185  DG  J C4    1 
ATOM   3782  P P     . DG  B 1 40  ? 60.632  26.436 -16.232 1.00 64.73  ? 186  DG  J P     1 
ATOM   3783  O OP1   . DG  B 1 40  ? 61.853  25.966 -16.900 1.00 54.28  ? 186  DG  J OP1   1 
ATOM   3784  O OP2   . DG  B 1 40  ? 59.964  27.680 -16.678 1.00 52.11  ? 186  DG  J OP2   1 
ATOM   3785  O "O5'" . DG  B 1 40  ? 59.605  25.236 -16.206 1.00 65.18  ? 186  DG  J "O5'" 1 
ATOM   3786  C "C5'" . DG  B 1 40  ? 59.995  24.007 -15.622 1.00 71.48  ? 186  DG  J "C5'" 1 
ATOM   3787  C "C4'" . DG  B 1 40  ? 58.780  23.191 -15.254 1.00 75.11  ? 186  DG  J "C4'" 1 
ATOM   3788  O "O4'" . DG  B 1 40  ? 58.130  23.710 -14.073 1.00 75.00  ? 186  DG  J "O4'" 1 
ATOM   3789  C "C3'" . DG  B 1 40  ? 57.696  23.133 -16.332 1.00 78.41  ? 186  DG  J "C3'" 1 
ATOM   3790  O "O3'" . DG  B 1 40  ? 57.090  21.840 -16.299 1.00 83.81  ? 186  DG  J "O3'" 1 
ATOM   3791  C "C2'" . DG  B 1 40  ? 56.676  24.136 -15.835 1.00 77.18  ? 186  DG  J "C2'" 1 
ATOM   3792  C "C1'" . DG  B 1 40  ? 56.747  23.824 -14.360 1.00 76.18  ? 186  DG  J "C1'" 1 
ATOM   3793  N N9    . DG  B 1 40  ? 56.166  24.806 -13.451 1.00 69.05  ? 186  DG  J N9    1 
ATOM   3794  C C8    . DG  B 1 40  ? 55.862  26.122 -13.695 1.00 68.08  ? 186  DG  J C8    1 
ATOM   3795  N N7    . DG  B 1 40  ? 55.357  26.729 -12.653 1.00 67.57  ? 186  DG  J N7    1 
ATOM   3796  C C5    . DG  B 1 40  ? 55.335  25.747 -11.673 1.00 68.62  ? 186  DG  J C5    1 
ATOM   3797  C C6    . DG  B 1 40  ? 54.908  25.798 -10.312 1.00 69.27  ? 186  DG  J C6    1 
ATOM   3798  O O6    . DG  B 1 40  ? 54.507  26.786 -9.655  1.00 68.38  ? 186  DG  J O6    1 
ATOM   3799  N N1    . DG  B 1 40  ? 55.012  24.548 -9.703  1.00 67.87  ? 186  DG  J N1    1 
ATOM   3800  C C2    . DG  B 1 40  ? 55.503  23.413 -10.306 1.00 68.43  ? 186  DG  J C2    1 
ATOM   3801  N N2    . DG  B 1 40  ? 55.510  22.297 -9.577  1.00 67.12  ? 186  DG  J N2    1 
ATOM   3802  N N3    . DG  B 1 40  ? 55.946  23.372 -11.540 1.00 67.36  ? 186  DG  J N3    1 
ATOM   3803  C C4    . DG  B 1 40  ? 55.822  24.553 -12.160 1.00 68.14  ? 186  DG  J C4    1 
ATOM   3804  P P     . DA  B 1 41  ? 57.535  20.731 -17.362 1.00 80.04  ? 187  DA  J P     1 
ATOM   3805  O OP1   . DA  B 1 41  ? 59.010  20.562 -17.164 1.00 80.86  ? 187  DA  J OP1   1 
ATOM   3806  O OP2   . DA  B 1 41  ? 57.008  21.160 -18.684 1.00 81.90  ? 187  DA  J OP2   1 
ATOM   3807  O "O5'" . DA  B 1 41  ? 56.839  19.400 -16.836 1.00 82.01  ? 187  DA  J "O5'" 1 
ATOM   3808  C "C5'" . DA  B 1 41  ? 57.541  18.530 -15.946 1.00 85.14  ? 187  DA  J "C5'" 1 
ATOM   3809  C "C4'" . DA  B 1 41  ? 56.571  17.787 -15.062 1.00 87.43  ? 187  DA  J "C4'" 1 
ATOM   3810  O "O4'" . DA  B 1 41  ? 55.948  18.686 -14.127 1.00 87.65  ? 187  DA  J "O4'" 1 
ATOM   3811  C "C3'" . DA  B 1 41  ? 55.415  17.100 -15.771 1.00 88.46  ? 187  DA  J "C3'" 1 
ATOM   3812  O "O3'" . DA  B 1 41  ? 55.049  16.056 -14.892 1.00 92.33  ? 187  DA  J "O3'" 1 
ATOM   3813  C "C2'" . DA  B 1 41  ? 54.327  18.161 -15.740 1.00 87.79  ? 187  DA  J "C2'" 1 
ATOM   3814  C "C1'" . DA  B 1 41  ? 54.546  18.714 -14.347 1.00 86.08  ? 187  DA  J "C1'" 1 
ATOM   3815  N N9    . DA  B 1 41  ? 54.114  20.083 -14.107 1.00 83.49  ? 187  DA  J N9    1 
ATOM   3816  C C8    . DA  B 1 41  ? 54.248  21.193 -14.898 1.00 82.04  ? 187  DA  J C8    1 
ATOM   3817  N N7    . DA  B 1 41  ? 53.834  22.296 -14.333 1.00 81.29  ? 187  DA  J N7    1 
ATOM   3818  C C5    . DA  B 1 41  ? 53.382  21.882 -13.088 1.00 81.77  ? 187  DA  J C5    1 
ATOM   3819  C C6    . DA  B 1 41  ? 52.836  22.582 -11.995 1.00 81.29  ? 187  DA  J C6    1 
ATOM   3820  N N6    . DA  B 1 41  ? 52.662  23.905 -11.966 1.00 81.73  ? 187  DA  J N6    1 
ATOM   3821  N N1    . DA  B 1 41  ? 52.478  21.865 -10.910 1.00 81.09  ? 187  DA  J N1    1 
ATOM   3822  C C2    . DA  B 1 41  ? 52.666  20.535 -10.928 1.00 81.03  ? 187  DA  J C2    1 
ATOM   3823  N N3    . DA  B 1 41  ? 53.182  19.766 -11.887 1.00 81.28  ? 187  DA  J N3    1 
ATOM   3824  C C4    . DA  B 1 41  ? 53.524  20.516 -12.952 1.00 82.13  ? 187  DA  J C4    1 
ATOM   3825  P P     . DA  B 1 42  ? 54.486  14.681 -15.461 1.00 92.14  ? 188  DA  J P     1 
ATOM   3826  O OP1   . DA  B 1 42  ? 55.521  13.646 -15.140 1.00 115.85 ? 188  DA  J OP1   1 
ATOM   3827  O OP2   . DA  B 1 42  ? 54.055  14.870 -16.863 1.00 117.03 ? 188  DA  J OP2   1 
ATOM   3828  O "O5'" . DA  B 1 42  ? 53.180  14.564 -14.553 1.00 91.12  ? 188  DA  J "O5'" 1 
ATOM   3829  C "C5'" . DA  B 1 42  ? 53.310  14.694 -13.132 1.00 91.53  ? 188  DA  J "C5'" 1 
ATOM   3830  C "C4'" . DA  B 1 42  ? 51.984  15.006 -12.478 1.00 91.43  ? 188  DA  J "C4'" 1 
ATOM   3831  O "O4'" . DA  B 1 42  ? 51.740  16.420 -12.309 1.00 90.21  ? 188  DA  J "O4'" 1 
ATOM   3832  C "C3'" . DA  B 1 42  ? 50.764  14.447 -13.190 1.00 91.89  ? 188  DA  J "C3'" 1 
ATOM   3833  O "O3'" . DA  B 1 42  ? 49.861  13.991 -12.201 1.00 93.50  ? 188  DA  J "O3'" 1 
ATOM   3834  C "C2'" . DA  B 1 42  ? 50.191  15.668 -13.880 1.00 90.42  ? 188  DA  J "C2'" 1 
ATOM   3835  C "C1'" . DA  B 1 42  ? 50.473  16.745 -12.854 1.00 89.93  ? 188  DA  J "C1'" 1 
ATOM   3836  N N9    . DA  B 1 42  ? 50.552  18.112 -13.374 1.00 114.50 ? 188  DA  J N9    1 
ATOM   3837  C C8    . DA  B 1 42  ? 51.259  18.582 -14.453 1.00 114.20 ? 188  DA  J C8    1 
ATOM   3838  N N7    . DA  B 1 42  ? 51.158  19.877 -14.626 1.00 113.30 ? 188  DA  J N7    1 
ATOM   3839  C C5    . DA  B 1 42  ? 50.316  20.284 -13.602 1.00 113.10 ? 188  DA  J C5    1 
ATOM   3840  C C6    . DA  B 1 42  ? 49.820  21.546 -13.224 1.00 112.95 ? 188  DA  J C6    1 
ATOM   3841  N N6    . DA  B 1 42  ? 50.114  22.684 -13.862 1.00 112.52 ? 188  DA  J N6    1 
ATOM   3842  N N1    . DA  B 1 42  ? 49.003  21.604 -12.152 1.00 112.86 ? 188  DA  J N1    1 
ATOM   3843  C C2    . DA  B 1 42  ? 48.713  20.470 -11.505 1.00 112.63 ? 188  DA  J C2    1 
ATOM   3844  N N3    . DA  B 1 42  ? 49.117  19.229 -11.759 1.00 113.62 ? 188  DA  J N3    1 
ATOM   3845  C C4    . DA  B 1 42  ? 49.925  19.205 -12.829 1.00 113.89 ? 188  DA  J C4    1 
ATOM   3846  P P     . DA  B 1 43  ? 49.131  12.583 -12.386 1.00 118.83 ? 189  DA  J P     1 
ATOM   3847  O OP1   . DA  B 1 43  ? 49.640  11.699 -11.306 1.00 101.12 ? 189  DA  J OP1   1 
ATOM   3848  O OP2   . DA  B 1 43  ? 49.241  12.143 -13.804 1.00 101.53 ? 189  DA  J OP2   1 
ATOM   3849  O "O5'" . DA  B 1 43  ? 47.623  12.977 -12.064 1.00 119.37 ? 189  DA  J "O5'" 1 
ATOM   3850  C "C5'" . DA  B 1 43  ? 47.318  13.639 -10.840 1.00 118.52 ? 189  DA  J "C5'" 1 
ATOM   3851  C "C4'" . DA  B 1 43  ? 46.213  14.649 -11.035 1.00 118.09 ? 189  DA  J "C4'" 1 
ATOM   3852  O "O4'" . DA  B 1 43  ? 46.685  15.892 -11.618 1.00 117.02 ? 189  DA  J "O4'" 1 
ATOM   3853  C "C3'" . DA  B 1 43  ? 45.035  14.191 -11.900 1.00 118.71 ? 189  DA  J "C3'" 1 
ATOM   3854  O "O3'" . DA  B 1 43  ? 43.825  14.573 -11.251 1.00 120.40 ? 189  DA  J "O3'" 1 
ATOM   3855  C "C2'" . DA  B 1 43  ? 45.182  15.034 -13.154 1.00 117.47 ? 189  DA  J "C2'" 1 
ATOM   3856  C "C1'" . DA  B 1 43  ? 45.696  16.317 -12.539 1.00 115.90 ? 189  DA  J "C1'" 1 
ATOM   3857  N N9    . DA  B 1 43  ? 46.284  17.295 -13.450 1.00 97.26  ? 189  DA  J N9    1 
ATOM   3858  C C8    . DA  B 1 43  ? 47.115  17.083 -14.519 1.00 96.26  ? 189  DA  J C8    1 
ATOM   3859  N N7    . DA  B 1 43  ? 47.459  18.182 -15.149 1.00 95.54  ? 189  DA  J N7    1 
ATOM   3860  C C5    . DA  B 1 43  ? 46.811  19.187 -14.446 1.00 95.43  ? 189  DA  J C5    1 
ATOM   3861  C C6    . DA  B 1 43  ? 46.771  20.579 -14.616 1.00 95.06  ? 189  DA  J C6    1 
ATOM   3862  N N6    . DA  B 1 43  ? 47.419  21.221 -15.579 1.00 96.45  ? 189  DA  J N6    1 
ATOM   3863  N N1    . DA  B 1 43  ? 46.030  21.300 -13.745 1.00 95.38  ? 189  DA  J N1    1 
ATOM   3864  C C2    . DA  B 1 43  ? 45.380  20.650 -12.769 1.00 95.63  ? 189  DA  J C2    1 
ATOM   3865  N N3    . DA  B 1 43  ? 45.341  19.341 -12.507 1.00 96.36  ? 189  DA  J N3    1 
ATOM   3866  C C4    . DA  B 1 43  ? 46.088  18.656 -13.396 1.00 96.35  ? 189  DA  J C4    1 
ATOM   3867  P P     . DC  B 1 44  ? 42.452  13.871 -11.660 1.00 112.45 ? 190  DC  J P     1 
ATOM   3868  O OP1   . DC  B 1 44  ? 41.996  13.105 -10.480 1.00 86.76  ? 190  DC  J OP1   1 
ATOM   3869  O OP2   . DC  B 1 44  ? 42.633  13.177 -12.962 1.00 85.79  ? 190  DC  J OP2   1 
ATOM   3870  O "O5'" . DC  B 1 44  ? 41.471  15.106 -11.842 1.00 113.01 ? 190  DC  J "O5'" 1 
ATOM   3871  C "C5'" . DC  B 1 44  ? 41.222  15.992 -10.759 1.00 112.14 ? 190  DC  J "C5'" 1 
ATOM   3872  C "C4'" . DC  B 1 44  ? 40.535  17.241 -11.257 1.00 111.55 ? 190  DC  J "C4'" 1 
ATOM   3873  O "O4'" . DC  B 1 44  ? 41.469  18.066 -11.998 1.00 111.12 ? 190  DC  J "O4'" 1 
ATOM   3874  C "C3'" . DC  B 1 44  ? 39.348  17.000 -12.196 1.00 111.54 ? 190  DC  J "C3'" 1 
ATOM   3875  O "O3'" . DC  B 1 44  ? 38.304  17.925 -11.885 1.00 112.20 ? 190  DC  J "O3'" 1 
ATOM   3876  C "C2'" . DC  B 1 44  ? 39.919  17.315 -13.568 1.00 110.86 ? 190  DC  J "C2'" 1 
ATOM   3877  C "C1'" . DC  B 1 44  ? 40.860  18.451 -13.220 1.00 109.96 ? 190  DC  J "C1'" 1 
ATOM   3878  N N1    . DC  B 1 44  ? 41.919  18.734 -14.198 1.00 80.94  ? 190  DC  J N1    1 
ATOM   3879  C C2    . DC  B 1 44  ? 42.102  20.063 -14.623 1.00 79.63  ? 190  DC  J C2    1 
ATOM   3880  O O2    . DC  B 1 44  ? 41.356  20.950 -14.165 1.00 78.40  ? 190  DC  J O2    1 
ATOM   3881  N N3    . DC  B 1 44  ? 43.079  20.343 -15.517 1.00 79.49  ? 190  DC  J N3    1 
ATOM   3882  C C4    . DC  B 1 44  ? 43.849  19.360 -15.990 1.00 79.79  ? 190  DC  J C4    1 
ATOM   3883  N N4    . DC  B 1 44  ? 44.797  19.679 -16.871 1.00 79.41  ? 190  DC  J N4    1 
ATOM   3884  C C5    . DC  B 1 44  ? 43.680  18.002 -15.578 1.00 79.82  ? 190  DC  J C5    1 
ATOM   3885  C C6    . DC  B 1 44  ? 42.713  17.738 -14.688 1.00 80.25  ? 190  DC  J C6    1 
ATOM   3886  P P     . DT  B 1 45  ? 37.040  18.052 -12.861 1.00 116.55 ? 191  DT  J P     1 
ATOM   3887  O OP1   . DT  B 1 45  ? 35.966  18.781 -12.131 1.00 96.21  ? 191  DT  J OP1   1 
ATOM   3888  O OP2   . DT  B 1 45  ? 36.782  16.692 -13.394 1.00 97.06  ? 191  DT  J OP2   1 
ATOM   3889  O "O5'" . DT  B 1 45  ? 37.557  18.974 -14.057 1.00 116.28 ? 191  DT  J "O5'" 1 
ATOM   3890  C "C5'" . DT  B 1 45  ? 37.779  20.366 -13.851 1.00 114.07 ? 191  DT  J "C5'" 1 
ATOM   3891  C "C4'" . DT  B 1 45  ? 37.776  21.109 -15.166 1.00 112.43 ? 191  DT  J "C4'" 1 
ATOM   3892  O "O4'" . DT  B 1 45  ? 39.037  20.974 -15.862 1.00 110.90 ? 191  DT  J "O4'" 1 
ATOM   3893  C "C3'" . DT  B 1 45  ? 36.694  20.692 -16.164 1.00 111.87 ? 191  DT  J "C3'" 1 
ATOM   3894  O "O3'" . DT  B 1 45  ? 36.172  21.866 -16.793 1.00 113.18 ? 191  DT  J "O3'" 1 
ATOM   3895  C "C2'" . DT  B 1 45  ? 37.477  19.914 -17.206 1.00 110.20 ? 191  DT  J "C2'" 1 
ATOM   3896  C "C1'" . DT  B 1 45  ? 38.750  20.729 -17.226 1.00 109.54 ? 191  DT  J "C1'" 1 
ATOM   3897  N N1    . DT  B 1 45  ? 39.931  20.114 -17.858 1.00 87.97  ? 191  DT  J N1    1 
ATOM   3898  C C2    . DT  B 1 45  ? 40.851  20.965 -18.427 1.00 86.50  ? 191  DT  J C2    1 
ATOM   3899  O O2    . DT  B 1 45  ? 40.731  22.186 -18.421 1.00 86.42  ? 191  DT  J O2    1 
ATOM   3900  N N3    . DT  B 1 45  ? 41.923  20.332 -19.004 1.00 85.86  ? 191  DT  J N3    1 
ATOM   3901  C C4    . DT  B 1 45  ? 42.164  18.974 -19.061 1.00 86.71  ? 191  DT  J C4    1 
ATOM   3902  O O4    . DT  B 1 45  ? 43.179  18.556 -19.596 1.00 85.91  ? 191  DT  J O4    1 
ATOM   3903  C C5    . DT  B 1 45  ? 41.165  18.145 -18.454 1.00 86.63  ? 191  DT  J C5    1 
ATOM   3904  C C7    . DT  B 1 45  ? 41.343  16.663 -18.488 1.00 86.93  ? 191  DT  J C7    1 
ATOM   3905  C C6    . DT  B 1 45  ? 40.110  18.745 -17.885 1.00 87.67  ? 191  DT  J C6    1 
ATOM   3906  P P     . DG  B 1 46  ? 34.584  22.053 -16.961 1.00 87.52  ? 192  DG  J P     1 
ATOM   3907  O OP1   . DG  B 1 46  ? 33.998  22.017 -15.591 1.00 100.45 ? 192  DG  J OP1   1 
ATOM   3908  O OP2   . DG  B 1 46  ? 34.089  21.111 -18.011 1.00 99.31  ? 192  DG  J OP2   1 
ATOM   3909  O "O5'" . DG  B 1 46  ? 34.457  23.536 -17.527 1.00 86.78  ? 192  DG  J "O5'" 1 
ATOM   3910  C "C5'" . DG  B 1 46  ? 35.074  24.628 -16.845 1.00 84.53  ? 192  DG  J "C5'" 1 
ATOM   3911  C "C4'" . DG  B 1 46  ? 35.743  25.553 -17.835 1.00 83.44  ? 192  DG  J "C4'" 1 
ATOM   3912  O "O4'" . DG  B 1 46  ? 36.857  24.871 -18.454 1.00 83.03  ? 192  DG  J "O4'" 1 
ATOM   3913  C "C3'" . DG  B 1 46  ? 34.850  26.020 -18.984 1.00 83.04  ? 192  DG  J "C3'" 1 
ATOM   3914  O "O3'" . DG  B 1 46  ? 35.194  27.370 -19.313 1.00 83.16  ? 192  DG  J "O3'" 1 
ATOM   3915  C "C2'" . DG  B 1 46  ? 35.199  25.062 -20.109 1.00 82.59  ? 192  DG  J "C2'" 1 
ATOM   3916  C "C1'" . DG  B 1 46  ? 36.683  24.845 -19.867 1.00 82.56  ? 192  DG  J "C1'" 1 
ATOM   3917  N N9    . DG  B 1 46  ? 37.244  23.589 -20.359 1.00 93.13  ? 192  DG  J N9    1 
ATOM   3918  C C8    . DG  B 1 46  ? 36.885  22.322 -19.983 1.00 93.45  ? 192  DG  J C8    1 
ATOM   3919  N N7    . DG  B 1 46  ? 37.621  21.395 -20.536 1.00 92.72  ? 192  DG  J N7    1 
ATOM   3920  C C5    . DG  B 1 46  ? 38.510  22.095 -21.337 1.00 92.69  ? 192  DG  J C5    1 
ATOM   3921  C C6    . DG  B 1 46  ? 39.573  21.628 -22.166 1.00 92.34  ? 192  DG  J C6    1 
ATOM   3922  O O6    . DG  B 1 46  ? 39.975  20.461 -22.337 1.00 90.82  ? 192  DG  J O6    1 
ATOM   3923  N N1    . DG  B 1 46  ? 40.201  22.679 -22.822 1.00 91.75  ? 192  DG  J N1    1 
ATOM   3924  C C2    . DG  B 1 46  ? 39.867  24.004 -22.691 1.00 91.40  ? 192  DG  J C2    1 
ATOM   3925  N N2    . DG  B 1 46  ? 40.577  24.864 -23.433 1.00 90.53  ? 192  DG  J N2    1 
ATOM   3926  N N3    . DG  B 1 46  ? 38.906  24.453 -21.901 1.00 92.57  ? 192  DG  J N3    1 
ATOM   3927  C C4    . DG  B 1 46  ? 38.274  23.451 -21.262 1.00 92.72  ? 192  DG  J C4    1 
ATOM   3928  P P     . DC  B 1 47  ? 34.312  28.184 -20.377 1.00 128.22 ? 193  DC  J P     1 
ATOM   3929  O OP1   . DC  B 1 47  ? 34.542  29.640 -20.160 1.00 81.22  ? 193  DC  J OP1   1 
ATOM   3930  O OP2   . DC  B 1 47  ? 32.932  27.631 -20.341 1.00 82.52  ? 193  DC  J OP2   1 
ATOM   3931  O "O5'" . DC  B 1 47  ? 34.938  27.784 -21.783 1.00 127.24 ? 193  DC  J "O5'" 1 
ATOM   3932  C "C5'" . DC  B 1 47  ? 36.126  28.406 -22.260 1.00 124.34 ? 193  DC  J "C5'" 1 
ATOM   3933  C "C4'" . DC  B 1 47  ? 36.408  27.956 -23.672 1.00 121.08 ? 193  DC  J "C4'" 1 
ATOM   3934  O "O4'" . DC  B 1 47  ? 36.793  26.562 -23.682 1.00 120.27 ? 193  DC  J "O4'" 1 
ATOM   3935  C "C3'" . DC  B 1 47  ? 35.208  28.062 -24.614 1.00 119.24 ? 193  DC  J "C3'" 1 
ATOM   3936  O "O3'" . DC  B 1 47  ? 35.689  28.367 -25.913 1.00 118.34 ? 193  DC  J "O3'" 1 
ATOM   3937  C "C2'" . DC  B 1 47  ? 34.690  26.637 -24.661 1.00 119.08 ? 193  DC  J "C2'" 1 
ATOM   3938  C "C1'" . DC  B 1 47  ? 36.004  25.896 -24.649 1.00 119.53 ? 193  DC  J "C1'" 1 
ATOM   3939  N N1    . DC  B 1 47  ? 35.966  24.471 -24.314 1.00 72.72  ? 193  DC  J N1    1 
ATOM   3940  C C2    . DC  B 1 47  ? 36.972  23.647 -24.834 1.00 72.67  ? 193  DC  J C2    1 
ATOM   3941  O O2    . DC  B 1 47  ? 37.865  24.161 -25.541 1.00 71.91  ? 193  DC  J O2    1 
ATOM   3942  N N3    . DC  B 1 47  ? 36.954  22.320 -24.556 1.00 72.31  ? 193  DC  J N3    1 
ATOM   3943  C C4    . DC  B 1 47  ? 35.991  21.817 -23.787 1.00 72.33  ? 193  DC  J C4    1 
ATOM   3944  N N4    . DC  B 1 47  ? 36.013  20.502 -23.543 1.00 71.03  ? 193  DC  J N4    1 
ATOM   3945  C C5    . DC  B 1 47  ? 34.960  22.639 -23.236 1.00 71.84  ? 193  DC  J C5    1 
ATOM   3946  C C6    . DC  B 1 47  ? 34.986  23.948 -23.525 1.00 71.50  ? 193  DC  J C6    1 
ATOM   3947  P P     . DT  B 1 48  ? 35.666  29.874 -26.445 1.00 95.37  ? 194  DT  J P     1 
ATOM   3948  O OP1   . DT  B 1 48  ? 36.032  30.785 -25.322 1.00 88.47  ? 194  DT  J OP1   1 
ATOM   3949  O OP2   . DT  B 1 48  ? 34.385  30.060 -27.173 1.00 89.12  ? 194  DT  J OP2   1 
ATOM   3950  O "O5'" . DT  B 1 48  ? 36.846  29.880 -27.517 1.00 94.79  ? 194  DT  J "O5'" 1 
ATOM   3951  C "C5'" . DT  B 1 48  ? 38.215  29.802 -27.106 1.00 90.13  ? 194  DT  J "C5'" 1 
ATOM   3952  C "C4'" . DT  B 1 48  ? 39.001  28.902 -28.034 1.00 86.26  ? 194  DT  J "C4'" 1 
ATOM   3953  O "O4'" . DT  B 1 48  ? 38.715  27.510 -27.780 1.00 85.36  ? 194  DT  J "O4'" 1 
ATOM   3954  C "C3'" . DT  B 1 48  ? 38.772  29.103 -29.534 1.00 83.41  ? 194  DT  J "C3'" 1 
ATOM   3955  O "O3'" . DT  B 1 48  ? 40.034  29.001 -30.203 1.00 81.12  ? 194  DT  J "O3'" 1 
ATOM   3956  C "C2'" . DT  B 1 48  ? 37.893  27.924 -29.912 1.00 83.40  ? 194  DT  J "C2'" 1 
ATOM   3957  C "C1'" . DT  B 1 48  ? 38.478  26.861 -29.017 1.00 85.05  ? 194  DT  J "C1'" 1 
ATOM   3958  N N1    . DT  B 1 48  ? 37.661  25.670 -28.758 1.00 78.83  ? 194  DT  J N1    1 
ATOM   3959  C C2    . DT  B 1 48  ? 38.276  24.441 -28.888 1.00 80.60  ? 194  DT  J C2    1 
ATOM   3960  O O2    . DT  B 1 48  ? 39.431  24.306 -29.261 1.00 80.20  ? 194  DT  J O2    1 
ATOM   3961  N N3    . DT  B 1 48  ? 37.491  23.369 -28.561 1.00 80.37  ? 194  DT  J N3    1 
ATOM   3962  C C4    . DT  B 1 48  ? 36.187  23.396 -28.115 1.00 80.20  ? 194  DT  J C4    1 
ATOM   3963  O O4    . DT  B 1 48  ? 35.622  22.344 -27.810 1.00 79.78  ? 194  DT  J O4    1 
ATOM   3964  C C5    . DT  B 1 48  ? 35.593  24.716 -28.029 1.00 81.08  ? 194  DT  J C5    1 
ATOM   3965  C C7    . DT  B 1 48  ? 34.180  24.844 -27.551 1.00 82.01  ? 194  DT  J C7    1 
ATOM   3966  C C6    . DT  B 1 48  ? 36.349  25.774 -28.369 1.00 79.34  ? 194  DT  J C6    1 
ATOM   3967  P P     . DC  B 1 49  ? 40.182  29.517 -31.714 1.00 96.78  ? 195  DC  J P     1 
ATOM   3968  O OP1   . DC  B 1 49  ? 41.489  30.218 -31.845 1.00 75.54  ? 195  DC  J OP1   1 
ATOM   3969  O OP2   . DC  B 1 49  ? 38.925  30.220 -32.088 1.00 75.77  ? 195  DC  J OP2   1 
ATOM   3970  O "O5'" . DC  B 1 49  ? 40.233  28.164 -32.548 1.00 92.63  ? 195  DC  J "O5'" 1 
ATOM   3971  C "C5'" . DC  B 1 49  ? 41.208  27.161 -32.277 1.00 86.20  ? 195  DC  J "C5'" 1 
ATOM   3972  C "C4'" . DC  B 1 49  ? 40.901  25.938 -33.101 1.00 83.50  ? 195  DC  J "C4'" 1 
ATOM   3973  O "O4'" . DC  B 1 49  ? 39.779  25.231 -32.520 1.00 83.17  ? 195  DC  J "O4'" 1 
ATOM   3974  C "C3'" . DC  B 1 49  ? 40.477  26.301 -34.526 1.00 83.26  ? 195  DC  J "C3'" 1 
ATOM   3975  O "O3'" . DC  B 1 49  ? 40.894  25.282 -35.434 1.00 79.16  ? 195  DC  J "O3'" 1 
ATOM   3976  C "C2'" . DC  B 1 49  ? 38.963  26.272 -34.444 1.00 85.44  ? 195  DC  J "C2'" 1 
ATOM   3977  C "C1'" . DC  B 1 49  ? 38.762  25.097 -33.506 1.00 87.25  ? 195  DC  J "C1'" 1 
ATOM   3978  N N1    . DC  B 1 49  ? 37.443  24.998 -32.837 1.00 64.77  ? 195  DC  J N1    1 
ATOM   3979  C C2    . DC  B 1 49  ? 37.012  23.738 -32.390 1.00 64.29  ? 195  DC  J C2    1 
ATOM   3980  O O2    . DC  B 1 49  ? 37.736  22.770 -32.568 1.00 58.50  ? 195  DC  J O2    1 
ATOM   3981  N N3    . DC  B 1 49  ? 35.817  23.616 -31.783 1.00 66.36  ? 195  DC  J N3    1 
ATOM   3982  C C4    . DC  B 1 49  ? 35.043  24.688 -31.621 1.00 67.80  ? 195  DC  J C4    1 
ATOM   3983  N N4    . DC  B 1 49  ? 33.868  24.513 -31.019 1.00 71.78  ? 195  DC  J N4    1 
ATOM   3984  C C5    . DC  B 1 49  ? 35.445  25.990 -32.071 1.00 67.85  ? 195  DC  J C5    1 
ATOM   3985  C C6    . DC  B 1 49  ? 36.646  26.099 -32.662 1.00 67.13  ? 195  DC  J C6    1 
ATOM   3986  P P     . DC  B 1 50  ? 42.338  25.363 -36.127 1.00 53.41  ? 196  DC  J P     1 
ATOM   3987  O OP1   . DC  B 1 50  ? 43.288  25.731 -35.038 1.00 44.39  ? 196  DC  J OP1   1 
ATOM   3988  O OP2   . DC  B 1 50  ? 42.249  26.172 -37.381 1.00 48.43  ? 196  DC  J OP2   1 
ATOM   3989  O "O5'" . DC  B 1 50  ? 42.649  23.851 -36.464 1.00 53.62  ? 196  DC  J "O5'" 1 
ATOM   3990  C "C5'" . DC  B 1 50  ? 42.956  22.954 -35.416 1.00 51.07  ? 196  DC  J "C5'" 1 
ATOM   3991  C "C4'" . DC  B 1 50  ? 42.298  21.616 -35.661 1.00 54.17  ? 196  DC  J "C4'" 1 
ATOM   3992  O "O4'" . DC  B 1 50  ? 40.958  21.612 -35.137 1.00 55.03  ? 196  DC  J "O4'" 1 
ATOM   3993  C "C3'" . DC  B 1 50  ? 42.194  21.197 -37.126 1.00 49.23  ? 196  DC  J "C3'" 1 
ATOM   3994  O "O3'" . DC  B 1 50  ? 42.681  19.879 -37.320 1.00 45.53  ? 196  DC  J "O3'" 1 
ATOM   3995  C "C2'" . DC  B 1 50  ? 40.712  21.262 -37.434 1.00 54.05  ? 196  DC  J "C2'" 1 
ATOM   3996  C "C1'" . DC  B 1 50  ? 40.075  21.038 -36.080 1.00 54.59  ? 196  DC  J "C1'" 1 
ATOM   3997  N N1    . DC  B 1 50  ? 38.779  21.709 -35.911 1.00 53.65  ? 196  DC  J N1    1 
ATOM   3998  C C2    . DC  B 1 50  ? 37.688  20.967 -35.457 1.00 52.28  ? 196  DC  J C2    1 
ATOM   3999  O O2    . DC  B 1 50  ? 37.823  19.742 -35.257 1.00 53.77  ? 196  DC  J O2    1 
ATOM   4000  N N3    . DC  B 1 50  ? 36.514  21.606 -35.251 1.00 51.36  ? 196  DC  J N3    1 
ATOM   4001  C C4    . DC  B 1 50  ? 36.410  22.917 -35.489 1.00 55.19  ? 196  DC  J C4    1 
ATOM   4002  N N4    . DC  B 1 50  ? 35.248  23.507 -35.242 1.00 52.91  ? 196  DC  J N4    1 
ATOM   4003  C C5    . DC  B 1 50  ? 37.495  23.678 -35.980 1.00 55.37  ? 196  DC  J C5    1 
ATOM   4004  C C6    . DC  B 1 50  ? 38.649  23.046 -36.174 1.00 53.97  ? 196  DC  J C6    1 
ATOM   4005  P P     . DA  B 1 51  ? 42.900  19.340 -38.809 1.00 45.06  ? 197  DA  J P     1 
ATOM   4006  O OP1   . DA  B 1 51  ? 44.246  18.736 -38.921 1.00 36.71  ? 197  DA  J OP1   1 
ATOM   4007  O OP2   . DA  B 1 51  ? 42.493  20.416 -39.731 1.00 40.51  ? 197  DA  J OP2   1 
ATOM   4008  O "O5'" . DA  B 1 51  ? 41.818  18.186 -38.905 1.00 52.55  ? 197  DA  J "O5'" 1 
ATOM   4009  C "C5'" . DA  B 1 51  ? 41.755  17.189 -37.894 1.00 56.08  ? 197  DA  J "C5'" 1 
ATOM   4010  C "C4'" . DA  B 1 51  ? 40.543  16.319 -38.100 1.00 61.92  ? 197  DA  J "C4'" 1 
ATOM   4011  O "O4'" . DA  B 1 51  ? 39.373  17.111 -37.838 1.00 63.84  ? 197  DA  J "O4'" 1 
ATOM   4012  C "C3'" . DA  B 1 51  ? 40.376  15.766 -39.512 1.00 64.71  ? 197  DA  J "C3'" 1 
ATOM   4013  O "O3'" . DA  B 1 51  ? 39.966  14.392 -39.442 1.00 69.43  ? 197  DA  J "O3'" 1 
ATOM   4014  C "C2'" . DA  B 1 51  ? 39.322  16.674 -40.130 1.00 62.83  ? 197  DA  J "C2'" 1 
ATOM   4015  C "C1'" . DA  B 1 51  ? 38.487  17.071 -38.936 1.00 62.83  ? 197  DA  J "C1'" 1 
ATOM   4016  N N9    . DA  B 1 51  ? 37.848  18.379 -38.992 1.00 57.48  ? 197  DA  J N9    1 
ATOM   4017  C C8    . DA  B 1 51  ? 38.361  19.570 -39.429 1.00 58.12  ? 197  DA  J C8    1 
ATOM   4018  N N7    . DA  B 1 51  ? 37.558  20.591 -39.245 1.00 58.78  ? 197  DA  J N7    1 
ATOM   4019  C C5    . DA  B 1 51  ? 36.429  20.029 -38.663 1.00 56.56  ? 197  DA  J C5    1 
ATOM   4020  C C6    . DA  B 1 51  ? 35.210  20.584 -38.207 1.00 58.18  ? 197  DA  J C6    1 
ATOM   4021  N N6    . DA  B 1 51  ? 34.914  21.878 -38.261 1.00 55.83  ? 197  DA  J N6    1 
ATOM   4022  N N1    . DA  B 1 51  ? 34.298  19.746 -37.681 1.00 59.79  ? 197  DA  J N1    1 
ATOM   4023  C C2    . DA  B 1 51  ? 34.589  18.441 -37.615 1.00 62.19  ? 197  DA  J C2    1 
ATOM   4024  N N3    . DA  B 1 51  ? 35.693  17.797 -38.004 1.00 59.80  ? 197  DA  J N3    1 
ATOM   4025  C C4    . DA  B 1 51  ? 36.586  18.662 -38.525 1.00 58.03  ? 197  DA  J C4    1 
ATOM   4026  P P     . DT  B 1 52  ? 39.662  13.573 -40.796 1.00 59.28  ? 198  DT  J P     1 
ATOM   4027  O OP1   . DT  B 1 52  ? 39.805  12.138 -40.449 1.00 82.27  ? 198  DT  J OP1   1 
ATOM   4028  O OP2   . DT  B 1 52  ? 40.445  14.142 -41.932 1.00 80.81  ? 198  DT  J OP2   1 
ATOM   4029  O "O5'" . DT  B 1 52  ? 38.118  13.868 -41.016 1.00 61.84  ? 198  DT  J "O5'" 1 
ATOM   4030  C "C5'" . DT  B 1 52  ? 37.254  13.985 -39.892 1.00 63.43  ? 198  DT  J "C5'" 1 
ATOM   4031  C "C4'" . DT  B 1 52  ? 35.840  14.177 -40.366 1.00 65.50  ? 198  DT  J "C4'" 1 
ATOM   4032  O "O4'" . DT  B 1 52  ? 35.384  15.541 -40.166 1.00 63.33  ? 198  DT  J "O4'" 1 
ATOM   4033  C "C3'" . DT  B 1 52  ? 35.704  13.884 -41.858 1.00 67.12  ? 198  DT  J "C3'" 1 
ATOM   4034  O "O3'" . DT  B 1 52  ? 34.549  13.086 -42.080 1.00 75.29  ? 198  DT  J "O3'" 1 
ATOM   4035  C "C2'" . DT  B 1 52  ? 35.514  15.261 -42.465 1.00 65.48  ? 198  DT  J "C2'" 1 
ATOM   4036  C "C1'" . DT  B 1 52  ? 34.780  15.994 -41.357 1.00 62.13  ? 198  DT  J "C1'" 1 
ATOM   4037  N N1    . DT  B 1 52  ? 34.911  17.455 -41.414 1.00 79.47  ? 198  DT  J N1    1 
ATOM   4038  C C2    . DT  B 1 52  ? 33.832  18.229 -41.043 1.00 77.78  ? 198  DT  J C2    1 
ATOM   4039  O O2    . DT  B 1 52  ? 32.796  17.763 -40.621 1.00 74.10  ? 198  DT  J O2    1 
ATOM   4040  N N3    . DT  B 1 52  ? 34.015  19.582 -41.190 1.00 76.92  ? 198  DT  J N3    1 
ATOM   4041  C C4    . DT  B 1 52  ? 35.143  20.223 -41.667 1.00 77.08  ? 198  DT  J C4    1 
ATOM   4042  O O4    . DT  B 1 52  ? 35.156  21.447 -41.787 1.00 75.95  ? 198  DT  J O4    1 
ATOM   4043  C C5    . DT  B 1 52  ? 36.249  19.353 -42.003 1.00 76.67  ? 198  DT  J C5    1 
ATOM   4044  C C7    . DT  B 1 52  ? 37.521  19.963 -42.488 1.00 75.07  ? 198  DT  J C7    1 
ATOM   4045  C C6    . DT  B 1 52  ? 36.082  18.029 -41.862 1.00 77.33  ? 198  DT  J C6    1 
ATOM   4046  P P     . DC  B 1 53  ? 34.461  12.146 -43.374 1.00 107.30 ? 199  DC  J P     1 
ATOM   4047  O OP1   . DC  B 1 53  ? 35.151  10.851 -43.106 1.00 90.62  ? 199  DC  J OP1   1 
ATOM   4048  O OP2   . DC  B 1 53  ? 34.830  12.949 -44.577 1.00 91.21  ? 199  DC  J OP2   1 
ATOM   4049  O "O5'" . DC  B 1 53  ? 32.903  11.882 -43.432 1.00 107.50 ? 199  DC  J "O5'" 1 
ATOM   4050  C "C5'" . DC  B 1 53  ? 32.087  12.173 -42.301 1.00 109.13 ? 199  DC  J "C5'" 1 
ATOM   4051  C "C4'" . DC  B 1 53  ? 30.813  12.838 -42.760 1.00 109.59 ? 199  DC  J "C4'" 1 
ATOM   4052  O "O4'" . DC  B 1 53  ? 30.889  14.269 -42.543 1.00 108.44 ? 199  DC  J "O4'" 1 
ATOM   4053  C "C3'" . DC  B 1 53  ? 30.579  12.637 -44.262 1.00 111.22 ? 199  DC  J "C3'" 1 
ATOM   4054  O "O3'" . DC  B 1 53  ? 29.232  12.267 -44.573 1.00 114.41 ? 199  DC  J "O3'" 1 
ATOM   4055  C "C2'" . DC  B 1 53  ? 30.886  13.995 -44.851 1.00 109.50 ? 199  DC  J "C2'" 1 
ATOM   4056  C "C1'" . DC  B 1 53  ? 30.482  14.926 -43.726 1.00 106.90 ? 199  DC  J "C1'" 1 
ATOM   4057  N N1    . DC  B 1 53  ? 31.160  16.227 -43.804 1.00 87.17  ? 199  DC  J N1    1 
ATOM   4058  C C2    . DC  B 1 53  ? 30.410  17.400 -43.633 1.00 85.60  ? 199  DC  J C2    1 
ATOM   4059  O O2    . DC  B 1 53  ? 29.198  17.314 -43.366 1.00 86.16  ? 199  DC  J O2    1 
ATOM   4060  N N3    . DC  B 1 53  ? 31.023  18.595 -43.772 1.00 83.19  ? 199  DC  J N3    1 
ATOM   4061  C C4    . DC  B 1 53  ? 32.323  18.647 -44.066 1.00 81.91  ? 199  DC  J C4    1 
ATOM   4062  N N4    . DC  B 1 53  ? 32.877  19.845 -44.221 1.00 79.69  ? 199  DC  J N4    1 
ATOM   4063  C C5    . DC  B 1 53  ? 33.110  17.474 -44.218 1.00 82.50  ? 199  DC  J C5    1 
ATOM   4064  C C6    . DC  B 1 53  ? 32.498  16.298 -44.073 1.00 84.91  ? 199  DC  J C6    1 
ATOM   4065  P P     . DA  B 1 54  ? 28.777  12.130 -46.116 1.00 96.15  ? 200  DA  J P     1 
ATOM   4066  O OP1   . DA  B 1 54  ? 27.863  10.962 -46.197 1.00 96.44  ? 200  DA  J OP1   1 
ATOM   4067  O OP2   . DA  B 1 54  ? 29.977  12.171 -46.997 1.00 95.05  ? 200  DA  J OP2   1 
ATOM   4068  O "O5'" . DA  B 1 54  ? 27.927  13.459 -46.333 1.00 93.89  ? 200  DA  J "O5'" 1 
ATOM   4069  C "C5'" . DA  B 1 54  ? 27.076  13.946 -45.301 1.00 90.89  ? 200  DA  J "C5'" 1 
ATOM   4070  C "C4'" . DA  B 1 54  ? 26.266  15.102 -45.825 1.00 90.08  ? 200  DA  J "C4'" 1 
ATOM   4071  O "O4'" . DA  B 1 54  ? 26.975  16.362 -45.702 1.00 88.33  ? 200  DA  J "O4'" 1 
ATOM   4072  C "C3'" . DA  B 1 54  ? 25.943  14.937 -47.306 1.00 90.50  ? 200  DA  J "C3'" 1 
ATOM   4073  O "O3'" . DA  B 1 54  ? 24.609  15.385 -47.551 1.00 93.19  ? 200  DA  J "O3'" 1 
ATOM   4074  C "C2'" . DA  B 1 54  ? 26.948  15.852 -47.984 1.00 87.72  ? 200  DA  J "C2'" 1 
ATOM   4075  C "C1'" . DA  B 1 54  ? 27.086  16.984 -46.975 1.00 85.66  ? 200  DA  J "C1'" 1 
ATOM   4076  N N9    . DA  B 1 54  ? 28.360  17.710 -47.009 1.00 81.73  ? 200  DA  J N9    1 
ATOM   4077  C C8    . DA  B 1 54  ? 29.632  17.192 -47.114 1.00 79.34  ? 200  DA  J C8    1 
ATOM   4078  N N7    . DA  B 1 54  ? 30.579  18.100 -47.076 1.00 77.64  ? 200  DA  J N7    1 
ATOM   4079  C C5    . DA  B 1 54  ? 29.887  19.294 -46.941 1.00 76.82  ? 200  DA  J C5    1 
ATOM   4080  C C6    . DA  B 1 54  ? 30.320  20.620 -46.828 1.00 76.40  ? 200  DA  J C6    1 
ATOM   4081  N N6    . DA  B 1 54  ? 31.596  20.973 -46.821 1.00 74.66  ? 200  DA  J N6    1 
ATOM   4082  N N1    . DA  B 1 54  ? 29.383  21.584 -46.717 1.00 78.06  ? 200  DA  J N1    1 
ATOM   4083  C C2    . DA  B 1 54  ? 28.100  21.222 -46.722 1.00 79.20  ? 200  DA  J C2    1 
ATOM   4084  N N3    . DA  B 1 54  ? 27.565  20.004 -46.816 1.00 79.49  ? 200  DA  J N3    1 
ATOM   4085  C C4    . DA  B 1 54  ? 28.524  19.071 -46.918 1.00 78.71  ? 200  DA  J C4    1 
ATOM   4086  P P     . DA  B 1 55  ? 23.968  15.244 -49.015 1.00 121.43 ? 201  DA  J P     1 
ATOM   4087  O OP1   . DA  B 1 55  ? 22.511  15.069 -48.774 1.00 97.50  ? 201  DA  J OP1   1 
ATOM   4088  O OP2   . DA  B 1 55  ? 24.729  14.207 -49.757 1.00 96.68  ? 201  DA  J OP2   1 
ATOM   4089  O "O5'" . DA  B 1 55  ? 24.231  16.660 -49.696 1.00 120.96 ? 201  DA  J "O5'" 1 
ATOM   4090  C "C5'" . DA  B 1 55  ? 23.608  17.844 -49.206 1.00 119.82 ? 201  DA  J "C5'" 1 
ATOM   4091  C "C4'" . DA  B 1 55  ? 23.756  18.944 -50.225 1.00 119.80 ? 201  DA  J "C4'" 1 
ATOM   4092  O "O4'" . DA  B 1 55  ? 25.041  19.581 -50.088 1.00 118.84 ? 201  DA  J "O4'" 1 
ATOM   4093  C "C3'" . DA  B 1 55  ? 23.711  18.419 -51.654 1.00 120.48 ? 201  DA  J "C3'" 1 
ATOM   4094  O "O3'" . DA  B 1 55  ? 23.189  19.431 -52.472 1.00 122.92 ? 201  DA  J "O3'" 1 
ATOM   4095  C "C2'" . DA  B 1 55  ? 25.176  18.236 -52.000 1.00 119.42 ? 201  DA  J "C2'" 1 
ATOM   4096  C "C1'" . DA  B 1 55  ? 25.784  19.431 -51.289 1.00 117.55 ? 201  DA  J "C1'" 1 
ATOM   4097  N N9    . DA  B 1 55  ? 27.199  19.312 -50.930 1.00 90.87  ? 201  DA  J N9    1 
ATOM   4098  C C8    . DA  B 1 55  ? 27.895  18.182 -50.586 1.00 89.11  ? 201  DA  J C8    1 
ATOM   4099  N N7    . DA  B 1 55  ? 29.153  18.408 -50.291 1.00 87.71  ? 201  DA  J N7    1 
ATOM   4100  C C5    . DA  B 1 55  ? 29.295  19.777 -50.457 1.00 87.30  ? 201  DA  J C5    1 
ATOM   4101  C C6    . DA  B 1 55  ? 30.389  20.638 -50.285 1.00 84.78  ? 201  DA  J C6    1 
ATOM   4102  N N6    . DA  B 1 55  ? 31.590  20.226 -49.882 1.00 83.19  ? 201  DA  J N6    1 
ATOM   4103  N N1    . DA  B 1 55  ? 30.202  21.953 -50.535 1.00 84.18  ? 201  DA  J N1    1 
ATOM   4104  C C2    . DA  B 1 55  ? 28.993  22.360 -50.924 1.00 85.47  ? 201  DA  J C2    1 
ATOM   4105  N N3    . DA  B 1 55  ? 27.885  21.649 -51.114 1.00 86.80  ? 201  DA  J N3    1 
ATOM   4106  C C4    . DA  B 1 55  ? 28.104  20.348 -50.859 1.00 88.18  ? 201  DA  J C4    1 
ATOM   4107  P P     . DA  B 1 56  ? 22.199  19.052 -53.663 1.00 122.15 ? 202  DA  J P     1 
ATOM   4108  O OP1   . DA  B 1 56  ? 20.826  18.923 -53.100 1.00 97.35  ? 202  DA  J OP1   1 
ATOM   4109  O OP2   . DA  B 1 56  ? 22.787  17.931 -54.463 1.00 97.53  ? 202  DA  J OP2   1 
ATOM   4110  O "O5'" . DA  B 1 56  ? 22.288  20.423 -54.458 1.00 120.19 ? 202  DA  J "O5'" 1 
ATOM   4111  C "C5'" . DA  B 1 56  ? 22.462  21.640 -53.704 1.00 117.94 ? 202  DA  J "C5'" 1 
ATOM   4112  C "C4'" . DA  B 1 56  ? 23.434  22.580 -54.380 1.00 117.23 ? 202  DA  J "C4'" 1 
ATOM   4113  O "O4'" . DA  B 1 56  ? 24.818  22.361 -54.018 1.00 115.97 ? 202  DA  J "O4'" 1 
ATOM   4114  C "C3'" . DA  B 1 56  ? 23.381  22.538 -55.897 1.00 117.50 ? 202  DA  J "C3'" 1 
ATOM   4115  O "O3'" . DA  B 1 56  ? 23.507  23.847 -56.392 1.00 119.89 ? 202  DA  J "O3'" 1 
ATOM   4116  C "C2'" . DA  B 1 56  ? 24.655  21.808 -56.275 1.00 115.45 ? 202  DA  J "C2'" 1 
ATOM   4117  C "C1'" . DA  B 1 56  ? 25.612  22.289 -55.194 1.00 113.71 ? 202  DA  J "C1'" 1 
ATOM   4118  N N9    . DA  B 1 56  ? 26.774  21.456 -54.868 1.00 84.84  ? 202  DA  J N9    1 
ATOM   4119  C C8    . DA  B 1 56  ? 26.834  20.096 -54.672 1.00 84.48  ? 202  DA  J C8    1 
ATOM   4120  N N7    . DA  B 1 56  ? 27.998  19.675 -54.227 1.00 81.19  ? 202  DA  J N7    1 
ATOM   4121  C C5    . DA  B 1 56  ? 28.768  20.827 -54.161 1.00 79.74  ? 202  DA  J C5    1 
ATOM   4122  C C6    . DA  B 1 56  ? 30.091  21.054 -53.742 1.00 77.37  ? 202  DA  J C6    1 
ATOM   4123  N N6    . DA  B 1 56  ? 30.881  20.103 -53.257 1.00 72.79  ? 202  DA  J N6    1 
ATOM   4124  N N1    . DA  B 1 56  ? 30.569  22.309 -53.825 1.00 76.63  ? 202  DA  J N1    1 
ATOM   4125  C C2    . DA  B 1 56  ? 29.755  23.274 -54.275 1.00 77.94  ? 202  DA  J C2    1 
ATOM   4126  N N3    . DA  B 1 56  ? 28.482  23.193 -54.677 1.00 79.42  ? 202  DA  J N3    1 
ATOM   4127  C C4    . DA  B 1 56  ? 28.041  21.925 -54.594 1.00 81.75  ? 202  DA  J C4    1 
ATOM   4128  P P     . DA  B 1 57  ? 23.169  24.141 -57.911 1.00 118.94 ? 203  DA  J P     1 
ATOM   4129  O OP1   . DA  B 1 57  ? 22.205  25.268 -57.963 1.00 97.99  ? 203  DA  J OP1   1 
ATOM   4130  O OP2   . DA  B 1 57  ? 22.872  22.855 -58.586 1.00 98.57  ? 203  DA  J OP2   1 
ATOM   4131  O "O5'" . DA  B 1 57  ? 24.565  24.638 -58.455 1.00 117.98 ? 203  DA  J "O5'" 1 
ATOM   4132  C "C5'" . DA  B 1 57  ? 25.042  25.941 -58.133 1.00 114.76 ? 203  DA  J "C5'" 1 
ATOM   4133  C "C4'" . DA  B 1 57  ? 26.383  26.169 -58.790 1.00 112.69 ? 203  DA  J "C4'" 1 
ATOM   4134  O "O4'" . DA  B 1 57  ? 27.378  25.294 -58.208 1.00 110.74 ? 203  DA  J "O4'" 1 
ATOM   4135  C "C3'" . DA  B 1 57  ? 26.422  25.896 -60.295 1.00 111.91 ? 203  DA  J "C3'" 1 
ATOM   4136  O "O3'" . DA  B 1 57  ? 27.344  26.800 -60.906 1.00 111.87 ? 203  DA  J "O3'" 1 
ATOM   4137  C "C2'" . DA  B 1 57  ? 26.963  24.480 -60.369 1.00 110.13 ? 203  DA  J "C2'" 1 
ATOM   4138  C "C1'" . DA  B 1 57  ? 27.977  24.524 -59.242 1.00 108.81 ? 203  DA  J "C1'" 1 
ATOM   4139  N N9    . DA  B 1 57  ? 28.412  23.248 -58.670 1.00 85.47  ? 203  DA  J N9    1 
ATOM   4140  C C8    . DA  B 1 57  ? 27.773  22.031 -58.570 1.00 84.60  ? 203  DA  J C8    1 
ATOM   4141  N N7    . DA  B 1 57  ? 28.503  21.098 -57.990 1.00 84.10  ? 203  DA  J N7    1 
ATOM   4142  C C5    . DA  B 1 57  ? 29.697  21.747 -57.693 1.00 82.64  ? 203  DA  J C5    1 
ATOM   4143  C C6    . DA  B 1 57  ? 30.897  21.317 -57.085 1.00 81.20  ? 203  DA  J C6    1 
ATOM   4144  N N6    . DA  B 1 57  ? 31.131  20.074 -56.678 1.00 77.31  ? 203  DA  J N6    1 
ATOM   4145  N N1    . DA  B 1 57  ? 31.871  22.226 -56.924 1.00 80.68  ? 203  DA  J N1    1 
ATOM   4146  C C2    . DA  B 1 57  ? 31.670  23.473 -57.371 1.00 82.50  ? 203  DA  J C2    1 
ATOM   4147  N N3    . DA  B 1 57  ? 30.610  23.993 -57.974 1.00 83.05  ? 203  DA  J N3    1 
ATOM   4148  C C4    . DA  B 1 57  ? 29.647  23.072 -58.101 1.00 83.89  ? 203  DA  J C4    1 
ATOM   4149  P P     . DG  B 1 58  ? 26.807  28.181 -61.508 1.00 88.56  ? 204  DG  J P     1 
ATOM   4150  O OP1   . DG  B 1 58  ? 26.275  28.959 -60.360 1.00 99.87  ? 204  DG  J OP1   1 
ATOM   4151  O OP2   . DG  B 1 58  ? 25.943  27.874 -62.685 1.00 98.51  ? 204  DG  J OP2   1 
ATOM   4152  O "O5'" . DG  B 1 58  ? 28.107  28.929 -62.029 1.00 85.63  ? 204  DG  J "O5'" 1 
ATOM   4153  C "C5'" . DG  B 1 58  ? 29.046  29.481 -61.117 1.00 80.04  ? 204  DG  J "C5'" 1 
ATOM   4154  C "C4'" . DG  B 1 58  ? 30.437  29.004 -61.462 1.00 76.93  ? 204  DG  J "C4'" 1 
ATOM   4155  O "O4'" . DG  B 1 58  ? 30.565  27.609 -61.113 1.00 74.92  ? 204  DG  J "O4'" 1 
ATOM   4156  C "C3'" . DG  B 1 58  ? 30.825  29.113 -62.939 1.00 73.92  ? 204  DG  J "C3'" 1 
ATOM   4157  O "O3'" . DG  B 1 58  ? 32.199  29.499 -63.019 1.00 72.48  ? 204  DG  J "O3'" 1 
ATOM   4158  C "C2'" . DG  B 1 58  ? 30.655  27.686 -63.449 1.00 74.39  ? 204  DG  J "C2'" 1 
ATOM   4159  C "C1'" . DG  B 1 58  ? 31.075  26.890 -62.220 1.00 73.92  ? 204  DG  J "C1'" 1 
ATOM   4160  N N9    . DG  B 1 58  ? 30.650  25.499 -62.079 1.00 85.07  ? 204  DG  J N9    1 
ATOM   4161  C C8    . DG  B 1 58  ? 29.469  24.926 -62.484 1.00 85.08  ? 204  DG  J C8    1 
ATOM   4162  N N7    . DG  B 1 58  ? 29.385  23.656 -62.183 1.00 86.03  ? 204  DG  J N7    1 
ATOM   4163  C C5    . DG  B 1 58  ? 30.590  23.369 -61.551 1.00 86.45  ? 204  DG  J C5    1 
ATOM   4164  C C6    . DG  B 1 58  ? 31.087  22.143 -61.004 1.00 85.83  ? 204  DG  J C6    1 
ATOM   4165  O O6    . DG  B 1 58  ? 30.547  21.026 -60.976 1.00 82.05  ? 204  DG  J O6    1 
ATOM   4166  N N1    . DG  B 1 58  ? 32.349  22.308 -60.447 1.00 86.51  ? 204  DG  J N1    1 
ATOM   4167  C C2    . DG  B 1 58  ? 33.045  23.483 -60.413 1.00 86.42  ? 204  DG  J C2    1 
ATOM   4168  N N2    . DG  B 1 58  ? 34.234  23.429 -59.806 1.00 84.84  ? 204  DG  J N2    1 
ATOM   4169  N N3    . DG  B 1 58  ? 32.608  24.623 -60.927 1.00 86.22  ? 204  DG  J N3    1 
ATOM   4170  C C4    . DG  B 1 58  ? 31.379  24.494 -61.476 1.00 86.40  ? 204  DG  J C4    1 
ATOM   4171  P P     . DG  B 1 59  ? 32.650  30.964 -62.541 1.00 68.45  ? 205  DG  J P     1 
ATOM   4172  O OP1   . DG  B 1 59  ? 31.892  31.330 -61.323 1.00 73.79  ? 205  DG  J OP1   1 
ATOM   4173  O OP2   . DG  B 1 59  ? 32.600  31.841 -63.732 1.00 73.75  ? 205  DG  J OP2   1 
ATOM   4174  O "O5'" . DG  B 1 59  ? 34.196  30.799 -62.163 1.00 66.59  ? 205  DG  J "O5'" 1 
ATOM   4175  C "C5'" . DG  B 1 59  ? 34.683  30.536 -60.817 1.00 62.99  ? 205  DG  J "C5'" 1 
ATOM   4176  C "C4'" . DG  B 1 59  ? 35.999  29.794 -60.905 1.00 59.46  ? 205  DG  J "C4'" 1 
ATOM   4177  O "O4'" . DG  B 1 59  ? 35.661  28.401 -61.163 1.00 59.44  ? 205  DG  J "O4'" 1 
ATOM   4178  C "C3'" . DG  B 1 59  ? 36.743  30.302 -62.148 1.00 57.14  ? 205  DG  J "C3'" 1 
ATOM   4179  O "O3'" . DG  B 1 59  ? 38.184  30.182 -62.254 1.00 57.49  ? 205  DG  J "O3'" 1 
ATOM   4180  C "C2'" . DG  B 1 59  ? 36.242  29.346 -63.210 1.00 57.43  ? 205  DG  J "C2'" 1 
ATOM   4181  C "C1'" . DG  B 1 59  ? 36.116  28.034 -62.448 1.00 58.98  ? 205  DG  J "C1'" 1 
ATOM   4182  N N9    . DG  B 1 59  ? 35.152  27.132 -63.066 1.00 69.40  ? 205  DG  J N9    1 
ATOM   4183  C C8    . DG  B 1 59  ? 34.133  27.500 -63.909 1.00 70.98  ? 205  DG  J C8    1 
ATOM   4184  N N7    . DG  B 1 59  ? 33.471  26.491 -64.395 1.00 72.57  ? 205  DG  J N7    1 
ATOM   4185  C C5    . DG  B 1 59  ? 34.073  25.380 -63.826 1.00 72.55  ? 205  DG  J C5    1 
ATOM   4186  C C6    . DG  B 1 59  ? 33.781  24.012 -63.989 1.00 73.02  ? 205  DG  J C6    1 
ATOM   4187  O O6    . DG  B 1 59  ? 32.906  23.496 -64.682 1.00 73.53  ? 205  DG  J O6    1 
ATOM   4188  N N1    . DG  B 1 59  ? 34.630  23.211 -63.238 1.00 71.51  ? 205  DG  J N1    1 
ATOM   4189  C C2    . DG  B 1 59  ? 35.625  23.668 -62.429 1.00 70.99  ? 205  DG  J C2    1 
ATOM   4190  N N2    . DG  B 1 59  ? 36.326  22.717 -61.792 1.00 69.09  ? 205  DG  J N2    1 
ATOM   4191  N N3    . DG  B 1 59  ? 35.913  24.959 -62.256 1.00 71.29  ? 205  DG  J N3    1 
ATOM   4192  C C4    . DG  B 1 59  ? 35.100  25.755 -62.988 1.00 70.47  ? 205  DG  J C4    1 
ATOM   4193  P P     . DC  B 1 60  ? 39.160  30.260 -60.981 1.00 52.73  ? 206  DC  J P     1 
ATOM   4194  O OP1   . DC  B 1 60  ? 38.444  30.275 -59.677 1.00 63.89  ? 206  DC  J OP1   1 
ATOM   4195  O OP2   . DC  B 1 60  ? 40.143  31.302 -61.293 1.00 60.43  ? 206  DC  J OP2   1 
ATOM   4196  O "O5'" . DC  B 1 60  ? 39.897  28.866 -61.135 1.00 53.38  ? 206  DC  J "O5'" 1 
ATOM   4197  C "C5'" . DC  B 1 60  ? 39.343  27.936 -62.024 1.00 49.44  ? 206  DC  J "C5'" 1 
ATOM   4198  C "C4'" . DC  B 1 60  ? 40.045  26.613 -61.944 1.00 46.58  ? 206  DC  J "C4'" 1 
ATOM   4199  O "O4'" . DC  B 1 60  ? 39.109  25.737 -62.596 1.00 44.97  ? 206  DC  J "O4'" 1 
ATOM   4200  C "C3'" . DC  B 1 60  ? 41.338  26.526 -62.754 1.00 44.37  ? 206  DC  J "C3'" 1 
ATOM   4201  O "O3'" . DC  B 1 60  ? 42.102  25.411 -62.284 1.00 38.38  ? 206  DC  J "O3'" 1 
ATOM   4202  C "C2'" . DC  B 1 60  ? 40.811  26.217 -64.143 1.00 43.23  ? 206  DC  J "C2'" 1 
ATOM   4203  C "C1'" . DC  B 1 60  ? 39.604  25.341 -63.856 1.00 44.97  ? 206  DC  J "C1'" 1 
ATOM   4204  N N1    . DC  B 1 60  ? 38.514  25.494 -64.805 1.00 57.36  ? 206  DC  J N1    1 
ATOM   4205  C C2    . DC  B 1 60  ? 37.777  24.367 -65.179 1.00 57.91  ? 206  DC  J C2    1 
ATOM   4206  O O2    . DC  B 1 60  ? 38.076  23.263 -64.700 1.00 55.60  ? 206  DC  J O2    1 
ATOM   4207  N N3    . DC  B 1 60  ? 36.764  24.512 -66.055 1.00 59.47  ? 206  DC  J N3    1 
ATOM   4208  C C4    . DC  B 1 60  ? 36.485  25.727 -66.556 1.00 59.14  ? 206  DC  J C4    1 
ATOM   4209  N N4    . DC  B 1 60  ? 35.486  25.845 -67.433 1.00 56.02  ? 206  DC  J N4    1 
ATOM   4210  C C5    . DC  B 1 60  ? 37.222  26.879 -66.186 1.00 56.42  ? 206  DC  J C5    1 
ATOM   4211  C C6    . DC  B 1 60  ? 38.217  26.718 -65.318 1.00 56.44  ? 206  DC  J C6    1 
ATOM   4212  P P     . DA  B 1 61  ? 43.676  25.285 -62.598 1.00 43.97  ? 207  DA  J P     1 
ATOM   4213  O OP1   . DA  B 1 61  ? 44.328  25.447 -61.271 1.00 36.92  ? 207  DA  J OP1   1 
ATOM   4214  O OP2   . DA  B 1 61  ? 44.172  26.069 -63.780 1.00 39.48  ? 207  DA  J OP2   1 
ATOM   4215  O "O5'" . DA  B 1 61  ? 43.843  23.756 -62.970 1.00 44.09  ? 207  DA  J "O5'" 1 
ATOM   4216  C "C5'" . DA  B 1 61  ? 43.355  22.763 -62.096 1.00 46.46  ? 207  DA  J "C5'" 1 
ATOM   4217  C "C4'" . DA  B 1 61  ? 43.058  21.494 -62.856 1.00 42.54  ? 207  DA  J "C4'" 1 
ATOM   4218  O "O4'" . DA  B 1 61  ? 41.882  21.636 -63.697 1.00 44.80  ? 207  DA  J "O4'" 1 
ATOM   4219  C "C3'" . DA  B 1 61  ? 44.188  21.009 -63.756 1.00 44.77  ? 207  DA  J "C3'" 1 
ATOM   4220  O "O3'" . DA  B 1 61  ? 44.346  19.619 -63.531 1.00 46.65  ? 207  DA  J "O3'" 1 
ATOM   4221  C "C2'" . DA  B 1 61  ? 43.708  21.335 -65.163 1.00 44.66  ? 207  DA  J "C2'" 1 
ATOM   4222  C "C1'" . DA  B 1 61  ? 42.185  21.301 -65.048 1.00 45.11  ? 207  DA  J "C1'" 1 
ATOM   4223  N N9    . DA  B 1 61  ? 41.483  22.269 -65.898 1.00 48.07  ? 207  DA  J N9    1 
ATOM   4224  C C8    . DA  B 1 61  ? 41.685  23.621 -65.921 1.00 51.56  ? 207  DA  J C8    1 
ATOM   4225  N N7    . DA  B 1 61  ? 40.881  24.265 -66.726 1.00 51.70  ? 207  DA  J N7    1 
ATOM   4226  C C5    . DA  B 1 61  ? 40.099  23.266 -67.281 1.00 55.81  ? 207  DA  J C5    1 
ATOM   4227  C C6    . DA  B 1 61  ? 39.036  23.305 -68.185 1.00 56.04  ? 207  DA  J C6    1 
ATOM   4228  N N6    . DA  B 1 61  ? 38.552  24.435 -68.710 1.00 54.35  ? 207  DA  J N6    1 
ATOM   4229  N N1    . DA  B 1 61  ? 38.472  22.132 -68.533 1.00 55.54  ? 207  DA  J N1    1 
ATOM   4230  C C2    . DA  B 1 61  ? 38.952  21.012 -67.997 1.00 53.32  ? 207  DA  J C2    1 
ATOM   4231  N N3    . DA  B 1 61  ? 39.934  20.850 -67.133 1.00 53.45  ? 207  DA  J N3    1 
ATOM   4232  C C4    . DA  B 1 61  ? 40.474  22.032 -66.802 1.00 53.58  ? 207  DA  J C4    1 
ATOM   4233  P P     . DT  B 1 62  ? 45.466  18.803 -64.314 1.00 42.76  ? 208  DT  J P     1 
ATOM   4234  O OP1   . DT  B 1 62  ? 45.741  17.663 -63.405 1.00 52.94  ? 208  DT  J OP1   1 
ATOM   4235  O OP2   . DT  B 1 62  ? 46.579  19.640 -64.836 1.00 51.79  ? 208  DT  J OP2   1 
ATOM   4236  O "O5'" . DT  B 1 62  ? 44.708  18.259 -65.595 1.00 45.11  ? 208  DT  J "O5'" 1 
ATOM   4237  C "C5'" . DT  B 1 62  ? 43.533  17.489 -65.424 1.00 44.25  ? 208  DT  J "C5'" 1 
ATOM   4238  C "C4'" . DT  B 1 62  ? 42.976  17.054 -66.754 1.00 45.36  ? 208  DT  J "C4'" 1 
ATOM   4239  O "O4'" . DT  B 1 62  ? 42.266  18.122 -67.426 1.00 44.91  ? 208  DT  J "O4'" 1 
ATOM   4240  C "C3'" . DT  B 1 62  ? 43.993  16.498 -67.739 1.00 45.82  ? 208  DT  J "C3'" 1 
ATOM   4241  O "O3'" . DT  B 1 62  ? 43.489  15.248 -68.192 1.00 50.71  ? 208  DT  J "O3'" 1 
ATOM   4242  C "C2'" . DT  B 1 62  ? 44.039  17.545 -68.850 1.00 41.09  ? 208  DT  J "C2'" 1 
ATOM   4243  C "C1'" . DT  B 1 62  ? 42.652  18.177 -68.785 1.00 43.86  ? 208  DT  J "C1'" 1 
ATOM   4244  N N1    . DT  B 1 62  ? 42.537  19.582 -69.198 1.00 57.13  ? 208  DT  J N1    1 
ATOM   4245  C C2    . DT  B 1 62  ? 41.584  19.902 -70.135 1.00 60.79  ? 208  DT  J C2    1 
ATOM   4246  O O2    . DT  B 1 62  ? 40.894  19.073 -70.681 1.00 62.73  ? 208  DT  J O2    1 
ATOM   4247  N N3    . DT  B 1 62  ? 41.466  21.235 -70.406 1.00 61.99  ? 208  DT  J N3    1 
ATOM   4248  C C4    . DT  B 1 62  ? 42.193  22.258 -69.845 1.00 61.35  ? 208  DT  J C4    1 
ATOM   4249  O O4    . DT  B 1 62  ? 41.940  23.411 -70.150 1.00 56.61  ? 208  DT  J O4    1 
ATOM   4250  C C5    . DT  B 1 62  ? 43.213  21.850 -68.899 1.00 57.29  ? 208  DT  J C5    1 
ATOM   4251  C C7    . DT  B 1 62  ? 44.079  22.888 -68.260 1.00 61.19  ? 208  DT  J C7    1 
ATOM   4252  C C6    . DT  B 1 62  ? 43.334  20.547 -68.633 1.00 56.82  ? 208  DT  J C6    1 
ATOM   4253  P P     . DG  B 1 63  ? 44.490  14.154 -68.789 1.00 51.13  ? 209  DG  J P     1 
ATOM   4254  O OP1   . DG  B 1 63  ? 44.006  12.836 -68.291 1.00 70.27  ? 209  DG  J OP1   1 
ATOM   4255  O OP2   . DG  B 1 63  ? 45.885  14.575 -68.543 1.00 66.08  ? 209  DG  J OP2   1 
ATOM   4256  O "O5'" . DG  B 1 63  ? 44.211  14.274 -70.348 1.00 51.79  ? 209  DG  J "O5'" 1 
ATOM   4257  C "C5'" . DG  B 1 63  ? 42.867  14.213 -70.836 1.00 54.75  ? 209  DG  J "C5'" 1 
ATOM   4258  C "C4'" . DG  B 1 63  ? 42.813  14.667 -72.272 1.00 57.51  ? 209  DG  J "C4'" 1 
ATOM   4259  O "O4'" . DG  B 1 63  ? 42.607  16.092 -72.414 1.00 55.22  ? 209  DG  J "O4'" 1 
ATOM   4260  C "C3'" . DG  B 1 63  ? 44.062  14.348 -73.071 1.00 58.06  ? 209  DG  J "C3'" 1 
ATOM   4261  O "O3'" . DG  B 1 63  ? 43.612  13.958 -74.335 1.00 59.60  ? 209  DG  J "O3'" 1 
ATOM   4262  C "C2'" . DG  B 1 63  ? 44.762  15.693 -73.176 1.00 57.85  ? 209  DG  J "C2'" 1 
ATOM   4263  C "C1'" . DG  B 1 63  ? 43.583  16.629 -73.294 1.00 56.74  ? 209  DG  J "C1'" 1 
ATOM   4264  N N9    . DG  B 1 63  ? 43.805  18.027 -72.919 1.00 71.76  ? 209  DG  J N9    1 
ATOM   4265  C C8    . DG  B 1 63  ? 44.667  18.520 -71.960 1.00 70.84  ? 209  DG  J C8    1 
ATOM   4266  N N7    . DG  B 1 63  ? 44.599  19.820 -71.828 1.00 69.16  ? 209  DG  J N7    1 
ATOM   4267  C C5    . DG  B 1 63  ? 43.643  20.211 -72.762 1.00 70.79  ? 209  DG  J C5    1 
ATOM   4268  C C6    . DG  B 1 63  ? 43.126  21.508 -73.081 1.00 72.41  ? 209  DG  J C6    1 
ATOM   4269  O O6    . DG  B 1 63  ? 43.423  22.607 -72.590 1.00 67.18  ? 209  DG  J O6    1 
ATOM   4270  N N1    . DG  B 1 63  ? 42.170  21.440 -74.080 1.00 74.95  ? 209  DG  J N1    1 
ATOM   4271  C C2    . DG  B 1 63  ? 41.760  20.299 -74.697 1.00 74.46  ? 209  DG  J C2    1 
ATOM   4272  N N2    . DG  B 1 63  ? 40.838  20.470 -75.614 1.00 73.82  ? 209  DG  J N2    1 
ATOM   4273  N N3    . DG  B 1 63  ? 42.220  19.092 -74.429 1.00 71.06  ? 209  DG  J N3    1 
ATOM   4274  C C4    . DG  B 1 63  ? 43.151  19.118 -73.453 1.00 72.67  ? 209  DG  J C4    1 
ATOM   4275  P P     . DT  B 1 64  ? 44.644  13.397 -75.391 1.00 58.90  ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 64  ? 44.273  11.981 -75.567 1.00 52.74  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 64  ? 46.024  13.754 -74.990 1.00 49.39  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 64  ? 44.239  14.227 -76.677 1.00 59.14  ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 64  ? 42.870  14.474 -76.931 1.00 62.91  ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 64  ? 42.721  15.469 -78.053 1.00 65.71  ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 64  ? 42.766  16.823 -77.537 1.00 66.32  ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 64  ? 43.800  15.369 -79.130 1.00 66.70  ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 64  ? 43.214  15.392 -80.426 1.00 70.81  ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 64  ? 44.633  16.620 -78.923 1.00 65.78  ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 64  ? 43.644  17.607 -78.315 1.00 65.74  ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 64  ? 44.268  18.596 -77.415 1.00 58.45  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 64  ? 44.035  19.953 -77.609 1.00 58.56  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 64  ? 43.274  20.402 -78.456 1.00 60.26  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 64  ? 44.733  20.771 -76.757 1.00 56.02  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 64  ? 45.591  20.386 -75.752 1.00 56.16  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 64  ? 46.152  21.224 -75.084 1.00 51.15  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 64  ? 45.747  18.969 -75.581 1.00 54.44  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 64  ? 46.621  18.471 -74.484 1.00 52.00  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 64  ? 45.092  18.155 -76.408 1.00 55.83  ? 210  DT  J C6    1 
ATOM   4295  P P     . DT  B 1 65  ? 44.111  15.025 -81.701 1.00 74.88  ? 211  DT  J P     1 
ATOM   4296  O OP1   . DT  B 1 65  ? 43.424  13.983 -82.499 1.00 81.23  ? 211  DT  J OP1   1 
ATOM   4297  O OP2   . DT  B 1 65  ? 45.513  14.817 -81.235 1.00 81.46  ? 211  DT  J OP2   1 
ATOM   4298  O "O5'" . DT  B 1 65  ? 44.085  16.365 -82.538 1.00 74.37  ? 211  DT  J "O5'" 1 
ATOM   4299  C "C5'" . DT  B 1 65  ? 42.927  17.172 -82.556 1.00 71.62  ? 211  DT  J "C5'" 1 
ATOM   4300  C "C4'" . DT  B 1 65  ? 43.277  18.534 -83.097 1.00 70.51  ? 211  DT  J "C4'" 1 
ATOM   4301  O "O4'" . DT  B 1 65  ? 43.859  19.368 -82.071 1.00 69.18  ? 211  DT  J "O4'" 1 
ATOM   4302  C "C3'" . DT  B 1 65  ? 44.291  18.493 -84.236 1.00 71.14  ? 211  DT  J "C3'" 1 
ATOM   4303  O "O3'" . DT  B 1 65  ? 43.890  19.428 -85.227 1.00 73.93  ? 211  DT  J "O3'" 1 
ATOM   4304  C "C2'" . DT  B 1 65  ? 45.592  18.918 -83.575 1.00 67.32  ? 211  DT  J "C2'" 1 
ATOM   4305  C "C1'" . DT  B 1 65  ? 45.104  19.886 -82.518 1.00 65.14  ? 211  DT  J "C1'" 1 
ATOM   4306  N N1    . DT  B 1 65  ? 45.959  20.038 -81.330 1.00 68.43  ? 211  DT  J N1    1 
ATOM   4307  C C2    . DT  B 1 65  ? 46.304  21.307 -80.935 1.00 65.48  ? 211  DT  J C2    1 
ATOM   4308  O O2    . DT  B 1 65  ? 46.027  22.297 -81.577 1.00 63.76  ? 211  DT  J O2    1 
ATOM   4309  N N3    . DT  B 1 65  ? 46.999  21.370 -79.765 1.00 61.72  ? 211  DT  J N3    1 
ATOM   4310  C C4    . DT  B 1 65  ? 47.412  20.314 -78.986 1.00 62.99  ? 211  DT  J C4    1 
ATOM   4311  O O4    . DT  B 1 65  ? 48.014  20.525 -77.952 1.00 56.93  ? 211  DT  J O4    1 
ATOM   4312  C C5    . DT  B 1 65  ? 47.075  19.006 -79.487 1.00 63.20  ? 211  DT  J C5    1 
ATOM   4313  C C7    . DT  B 1 65  ? 47.528  17.796 -78.733 1.00 59.61  ? 211  DT  J C7    1 
ATOM   4314  C C6    . DT  B 1 65  ? 46.370  18.933 -80.619 1.00 64.99  ? 211  DT  J C6    1 
ATOM   4315  P P     . DC  B 1 66  ? 44.426  19.275 -86.721 1.00 66.86  ? 212  DC  J P     1 
ATOM   4316  O OP1   . DC  B 1 66  ? 43.264  19.502 -87.604 1.00 68.85  ? 212  DC  J OP1   1 
ATOM   4317  O OP2   . DC  B 1 66  ? 45.212  18.026 -86.822 1.00 72.00  ? 212  DC  J OP2   1 
ATOM   4318  O "O5'" . DC  B 1 66  ? 45.441  20.479 -86.873 1.00 69.45  ? 212  DC  J "O5'" 1 
ATOM   4319  C "C5'" . DC  B 1 66  ? 45.069  21.792 -86.488 1.00 65.03  ? 212  DC  J "C5'" 1 
ATOM   4320  C "C4'" . DC  B 1 66  ? 46.311  22.620 -86.268 1.00 62.56  ? 212  DC  J "C4'" 1 
ATOM   4321  O "O4'" . DC  B 1 66  ? 46.877  22.460 -84.936 1.00 61.92  ? 212  DC  J "O4'" 1 
ATOM   4322  C "C3'" . DC  B 1 66  ? 47.442  22.301 -87.249 1.00 60.76  ? 212  DC  J "C3'" 1 
ATOM   4323  O "O3'" . DC  B 1 66  ? 48.027  23.528 -87.653 1.00 57.45  ? 212  DC  J "O3'" 1 
ATOM   4324  C "C2'" . DC  B 1 66  ? 48.450  21.562 -86.379 1.00 62.35  ? 212  DC  J "C2'" 1 
ATOM   4325  C "C1'" . DC  B 1 66  ? 48.282  22.333 -85.085 1.00 60.57  ? 212  DC  J "C1'" 1 
ATOM   4326  N N1    . DC  B 1 66  ? 48.834  21.746 -83.854 1.00 61.63  ? 212  DC  J N1    1 
ATOM   4327  C C2    . DC  B 1 66  ? 49.268  22.609 -82.857 1.00 60.30  ? 212  DC  J C2    1 
ATOM   4328  O O2    . DC  B 1 66  ? 49.213  23.814 -83.058 1.00 54.66  ? 212  DC  J O2    1 
ATOM   4329  N N3    . DC  B 1 66  ? 49.738  22.113 -81.699 1.00 57.51  ? 212  DC  J N3    1 
ATOM   4330  C C4    . DC  B 1 66  ? 49.795  20.801 -81.513 1.00 60.58  ? 212  DC  J C4    1 
ATOM   4331  N N4    . DC  B 1 66  ? 50.251  20.363 -80.342 1.00 59.57  ? 212  DC  J N4    1 
ATOM   4332  C C5    . DC  B 1 66  ? 49.381  19.881 -82.521 1.00 60.05  ? 212  DC  J C5    1 
ATOM   4333  C C6    . DC  B 1 66  ? 48.910  20.395 -83.674 1.00 59.72  ? 212  DC  J C6    1 
ATOM   4334  P P     . DA  B 1 67  ? 47.904  24.016 -89.168 1.00 64.03  ? 213  DA  J P     1 
ATOM   4335  O OP1   . DA  B 1 67  ? 46.553  24.600 -89.365 1.00 56.45  ? 213  DA  J OP1   1 
ATOM   4336  O OP2   . DA  B 1 67  ? 48.363  22.881 -90.011 1.00 55.23  ? 213  DA  J OP2   1 
ATOM   4337  O "O5'" . DA  B 1 67  ? 48.956  25.204 -89.213 1.00 63.55  ? 213  DA  J "O5'" 1 
ATOM   4338  C "C5'" . DA  B 1 67  ? 48.718  26.383 -88.445 1.00 60.62  ? 213  DA  J "C5'" 1 
ATOM   4339  C "C4'" . DA  B 1 67  ? 49.946  26.763 -87.653 1.00 61.75  ? 213  DA  J "C4'" 1 
ATOM   4340  O "O4'" . DA  B 1 67  ? 50.221  25.800 -86.613 1.00 58.97  ? 213  DA  J "O4'" 1 
ATOM   4341  C "C3'" . DA  B 1 67  ? 51.229  26.849 -88.478 1.00 61.06  ? 213  DA  J "C3'" 1 
ATOM   4342  O "O3'" . DA  B 1 67  ? 52.019  27.915 -87.974 1.00 62.66  ? 213  DA  J "O3'" 1 
ATOM   4343  C "C2'" . DA  B 1 67  ? 51.928  25.546 -88.153 1.00 60.65  ? 213  DA  J "C2'" 1 
ATOM   4344  C "C1'" . DA  B 1 67  ? 51.593  25.474 -86.694 1.00 59.42  ? 213  DA  J "C1'" 1 
ATOM   4345  N N9    . DA  B 1 67  ? 51.817  24.197 -86.031 1.00 55.87  ? 213  DA  J N9    1 
ATOM   4346  C C8    . DA  B 1 67  ? 51.717  22.904 -86.488 1.00 55.35  ? 213  DA  J C8    1 
ATOM   4347  N N7    . DA  B 1 67  ? 52.008  22.002 -85.580 1.00 58.92  ? 213  DA  J N7    1 
ATOM   4348  C C5    . DA  B 1 67  ? 52.325  22.754 -84.457 1.00 57.40  ? 213  DA  J C5    1 
ATOM   4349  C C6    . DA  B 1 67  ? 52.717  22.398 -83.168 1.00 58.34  ? 213  DA  J C6    1 
ATOM   4350  N N6    . DA  B 1 67  ? 52.907  21.143 -82.781 1.00 56.16  ? 213  DA  J N6    1 
ATOM   4351  N N1    . DA  B 1 67  ? 52.922  23.392 -82.274 1.00 58.16  ? 213  DA  J N1    1 
ATOM   4352  C C2    . DA  B 1 67  ? 52.760  24.662 -82.675 1.00 59.19  ? 213  DA  J C2    1 
ATOM   4353  N N3    . DA  B 1 67  ? 52.417  25.125 -83.870 1.00 54.54  ? 213  DA  J N3    1 
ATOM   4354  C C4    . DA  B 1 67  ? 52.207  24.105 -84.721 1.00 57.25  ? 213  DA  J C4    1 
ATOM   4355  P P     . DG  B 1 68  ? 51.976  29.331 -88.703 1.00 78.26  ? 214  DG  J P     1 
ATOM   4356  O OP1   . DG  B 1 68  ? 50.595  29.885 -88.547 1.00 55.14  ? 214  DG  J OP1   1 
ATOM   4357  O OP2   . DG  B 1 68  ? 52.574  29.109 -90.036 1.00 58.02  ? 214  DG  J OP2   1 
ATOM   4358  O "O5'" . DG  B 1 68  ? 52.965  30.255 -87.876 1.00 79.80  ? 214  DG  J "O5'" 1 
ATOM   4359  C "C5'" . DG  B 1 68  ? 52.560  30.822 -86.631 1.00 76.35  ? 214  DG  J "C5'" 1 
ATOM   4360  C "C4'" . DG  B 1 68  ? 53.687  30.713 -85.636 1.00 75.35  ? 214  DG  J "C4'" 1 
ATOM   4361  O "O4'" . DG  B 1 68  ? 53.918  29.338 -85.245 1.00 74.06  ? 214  DG  J "O4'" 1 
ATOM   4362  C "C3'" . DG  B 1 68  ? 55.015  31.198 -86.200 1.00 72.68  ? 214  DG  J "C3'" 1 
ATOM   4363  O "O3'" . DG  B 1 68  ? 55.733  31.686 -85.093 1.00 72.67  ? 214  DG  J "O3'" 1 
ATOM   4364  C "C2'" . DG  B 1 68  ? 55.667  29.912 -86.684 1.00 72.37  ? 214  DG  J "C2'" 1 
ATOM   4365  C "C1'" . DG  B 1 68  ? 55.258  28.980 -85.569 1.00 73.48  ? 214  DG  J "C1'" 1 
ATOM   4366  N N9    . DG  B 1 68  ? 55.291  27.545 -85.831 1.00 55.08  ? 214  DG  J N9    1 
ATOM   4367  C C8    . DG  B 1 68  ? 54.991  26.882 -86.997 1.00 53.76  ? 214  DG  J C8    1 
ATOM   4368  N N7    . DG  B 1 68  ? 55.052  25.578 -86.877 1.00 54.29  ? 214  DG  J N7    1 
ATOM   4369  C C5    . DG  B 1 68  ? 55.427  25.374 -85.550 1.00 52.57  ? 214  DG  J C5    1 
ATOM   4370  C C6    . DG  B 1 68  ? 55.634  24.175 -84.817 1.00 55.02  ? 214  DG  J C6    1 
ATOM   4371  O O6    . DG  B 1 68  ? 55.502  23.011 -85.180 1.00 53.61  ? 214  DG  J O6    1 
ATOM   4372  N N1    . DG  B 1 68  ? 56.012  24.434 -83.515 1.00 54.27  ? 214  DG  J N1    1 
ATOM   4373  C C2    . DG  B 1 68  ? 56.142  25.666 -82.960 1.00 54.87  ? 214  DG  J C2    1 
ATOM   4374  N N2    . DG  B 1 68  ? 56.463  25.683 -81.661 1.00 53.37  ? 214  DG  J N2    1 
ATOM   4375  N N3    . DG  B 1 68  ? 55.956  26.792 -83.617 1.00 55.72  ? 214  DG  J N3    1 
ATOM   4376  C C4    . DG  B 1 68  ? 55.599  26.573 -84.901 1.00 55.39  ? 214  DG  J C4    1 
ATOM   4377  P P     . DC  B 1 69  ? 56.253  33.189 -85.063 1.00 86.10  ? 215  DC  J P     1 
ATOM   4378  O OP1   . DC  B 1 69  ? 55.162  34.087 -84.629 1.00 45.69  ? 215  DC  J OP1   1 
ATOM   4379  O OP2   . DC  B 1 69  ? 56.989  33.457 -86.332 1.00 47.74  ? 215  DC  J OP2   1 
ATOM   4380  O "O5'" . DC  B 1 69  ? 57.270  33.074 -83.855 1.00 85.72  ? 215  DC  J "O5'" 1 
ATOM   4381  C "C5'" . DC  B 1 69  ? 56.936  32.263 -82.725 1.00 84.23  ? 215  DC  J "C5'" 1 
ATOM   4382  C "C4'" . DC  B 1 69  ? 58.085  31.343 -82.399 1.00 87.21  ? 215  DC  J "C4'" 1 
ATOM   4383  O "O4'" . DC  B 1 69  ? 57.993  30.057 -83.059 1.00 86.00  ? 215  DC  J "O4'" 1 
ATOM   4384  C "C3'" . DC  B 1 69  ? 59.419  31.938 -82.830 1.00 86.86  ? 215  DC  J "C3'" 1 
ATOM   4385  O "O3'" . DC  B 1 69  ? 60.376  31.627 -81.831 1.00 88.19  ? 215  DC  J "O3'" 1 
ATOM   4386  C "C2'" . DC  B 1 69  ? 59.728  31.177 -84.103 1.00 87.31  ? 215  DC  J "C2'" 1 
ATOM   4387  C "C1'" . DC  B 1 69  ? 59.233  29.810 -83.693 1.00 88.96  ? 215  DC  J "C1'" 1 
ATOM   4388  N N1    . DC  B 1 69  ? 59.023  28.857 -84.782 1.00 53.18  ? 215  DC  J N1    1 
ATOM   4389  C C2    . DC  B 1 69  ? 59.192  27.490 -84.523 1.00 53.55  ? 215  DC  J C2    1 
ATOM   4390  O O2    . DC  B 1 69  ? 59.497  27.128 -83.365 1.00 46.96  ? 215  DC  J O2    1 
ATOM   4391  N N3    . DC  B 1 69  ? 59.017  26.603 -85.529 1.00 51.48  ? 215  DC  J N3    1 
ATOM   4392  C C4    . DC  B 1 69  ? 58.681  27.041 -86.754 1.00 53.20  ? 215  DC  J C4    1 
ATOM   4393  N N4    . DC  B 1 69  ? 58.533  26.138 -87.745 1.00 56.15  ? 215  DC  J N4    1 
ATOM   4394  C C5    . DC  B 1 69  ? 58.490  28.425 -87.031 1.00 52.98  ? 215  DC  J C5    1 
ATOM   4395  C C6    . DC  B 1 69  ? 58.673  29.287 -86.025 1.00 53.32  ? 215  DC  J C6    1 
ATOM   4396  P P     . DG  B 1 70  ? 60.890  32.777 -80.845 1.00 50.08  ? 216  DG  J P     1 
ATOM   4397  O OP1   . DG  B 1 70  ? 59.734  33.531 -80.279 1.00 54.18  ? 216  DG  J OP1   1 
ATOM   4398  O OP2   . DG  B 1 70  ? 61.949  33.499 -81.605 1.00 52.86  ? 216  DG  J OP2   1 
ATOM   4399  O "O5'" . DG  B 1 70  ? 61.539  31.945 -79.647 1.00 50.50  ? 216  DG  J "O5'" 1 
ATOM   4400  C "C5'" . DG  B 1 70  ? 60.784  30.952 -78.946 1.00 49.04  ? 216  DG  J "C5'" 1 
ATOM   4401  C "C4'" . DG  B 1 70  ? 61.608  29.697 -78.789 1.00 57.62  ? 216  DG  J "C4'" 1 
ATOM   4402  O "O4'" . DG  B 1 70  ? 61.576  28.875 -79.976 1.00 59.26  ? 216  DG  J "O4'" 1 
ATOM   4403  C "C3'" . DG  B 1 70  ? 63.079  29.986 -78.545 1.00 57.67  ? 216  DG  J "C3'" 1 
ATOM   4404  O "O3'" . DG  B 1 70  ? 63.614  28.969 -77.732 1.00 61.91  ? 216  DG  J "O3'" 1 
ATOM   4405  C "C2'" . DG  B 1 70  ? 63.684  29.861 -79.921 1.00 58.47  ? 216  DG  J "C2'" 1 
ATOM   4406  C "C1'" . DG  B 1 70  ? 62.892  28.705 -80.480 1.00 59.24  ? 216  DG  J "C1'" 1 
ATOM   4407  N N9    . DG  B 1 70  ? 62.813  28.712 -81.932 1.00 61.22  ? 216  DG  J N9    1 
ATOM   4408  C C8    . DG  B 1 70  ? 62.680  29.810 -82.746 1.00 58.50  ? 216  DG  J C8    1 
ATOM   4409  N N7    . DG  B 1 70  ? 62.580  29.500 -84.008 1.00 61.89  ? 216  DG  J N7    1 
ATOM   4410  C C5    . DG  B 1 70  ? 62.657  28.117 -84.025 1.00 65.02  ? 216  DG  J C5    1 
ATOM   4411  C C6    . DG  B 1 70  ? 62.583  27.214 -85.107 1.00 63.34  ? 216  DG  J C6    1 
ATOM   4412  O O6    . DG  B 1 70  ? 62.398  27.460 -86.305 1.00 62.78  ? 216  DG  J O6    1 
ATOM   4413  N N1    . DG  B 1 70  ? 62.737  25.899 -84.682 1.00 63.30  ? 216  DG  J N1    1 
ATOM   4414  C C2    . DG  B 1 70  ? 62.922  25.509 -83.380 1.00 64.72  ? 216  DG  J C2    1 
ATOM   4415  N N2    . DG  B 1 70  ? 63.060  24.196 -83.174 1.00 64.54  ? 216  DG  J N2    1 
ATOM   4416  N N3    . DG  B 1 70  ? 62.970  26.343 -82.359 1.00 63.12  ? 216  DG  J N3    1 
ATOM   4417  C C4    . DG  B 1 70  ? 62.829  27.622 -82.752 1.00 63.67  ? 216  DG  J C4    1 
ATOM   4418  P P     . DG  B 1 71  ? 64.897  29.273 -76.851 1.00 48.06  ? 217  DG  J P     1 
ATOM   4419  O OP1   . DG  B 1 71  ? 64.470  29.210 -75.450 1.00 48.00  ? 217  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 1 71  ? 65.567  30.486 -77.338 1.00 46.68  ? 217  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 1 71  ? 65.779  28.004 -77.147 1.00 48.48  ? 217  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 1 71  ? 65.199  26.706 -77.099 1.00 47.02  ? 217  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 1 71  ? 66.024  25.763 -77.936 1.00 55.60  ? 217  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 1 71  ? 65.766  25.970 -79.351 1.00 57.24  ? 217  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 1 71  ? 67.519  26.010 -77.751 1.00 55.65  ? 217  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 1 71  ? 68.178  24.779 -77.990 1.00 59.89  ? 217  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 1 71  ? 67.847  26.944 -78.903 1.00 56.45  ? 217  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 1 71  ? 66.994  26.304 -79.986 1.00 57.22  ? 217  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 1 71  ? 66.718  27.073 -81.203 1.00 55.04  ? 217  DG  J N9    1 
ATOM   4430  C C8    . DG  B 1 71  ? 66.634  28.435 -81.349 1.00 52.32  ? 217  DG  J C8    1 
ATOM   4431  N N7    . DG  B 1 71  ? 66.399  28.804 -82.581 1.00 55.71  ? 217  DG  J N7    1 
ATOM   4432  C C5    . DG  B 1 71  ? 66.319  27.611 -83.285 1.00 58.84  ? 217  DG  J C5    1 
ATOM   4433  C C6    . DG  B 1 71  ? 66.072  27.372 -84.646 1.00 57.16  ? 217  DG  J C6    1 
ATOM   4434  O O6    . DG  B 1 71  ? 65.876  28.189 -85.537 1.00 56.60  ? 217  DG  J O6    1 
ATOM   4435  N N1    . DG  B 1 71  ? 66.058  26.025 -84.935 1.00 57.12  ? 217  DG  J N1    1 
ATOM   4436  C C2    . DG  B 1 71  ? 66.249  25.027 -84.025 1.00 58.54  ? 217  DG  J C2    1 
ATOM   4437  N N2    . DG  B 1 71  ? 66.160  23.779 -84.488 1.00 58.36  ? 217  DG  J N2    1 
ATOM   4438  N N3    . DG  B 1 71  ? 66.494  25.229 -82.754 1.00 56.94  ? 217  DG  J N3    1 
ATOM   4439  C C4    . DG  B 1 71  ? 66.510  26.537 -82.452 1.00 57.49  ? 217  DG  J C4    1 
ATOM   4440  P P     . DA  B 1 72  ? 69.180  24.171 -76.906 1.00 87.94  ? 218  DA  J P     1 
ATOM   4441  O OP1   . DA  B 1 72  ? 68.292  23.456 -75.928 1.00 53.78  ? 218  DA  J OP1   1 
ATOM   4442  O OP2   . DA  B 1 72  ? 70.180  25.213 -76.463 1.00 58.05  ? 218  DA  J OP2   1 
ATOM   4443  O "O5'" . DA  B 1 72  ? 69.952  23.066 -77.742 1.00 90.83  ? 218  DA  J "O5'" 1 
ATOM   4444  C "C5'" . DA  B 1 72  ? 69.246  21.963 -78.299 1.00 93.24  ? 218  DA  J "C5'" 1 
ATOM   4445  C "C4'" . DA  B 1 72  ? 69.810  21.625 -79.657 1.00 98.06  ? 218  DA  J "C4'" 1 
ATOM   4446  O "O4'" . DA  B 1 72  ? 69.444  22.628 -80.630 1.00 98.50  ? 218  DA  J "O4'" 1 
ATOM   4447  C "C3'" . DA  B 1 72  ? 71.332  21.535 -79.713 1.00 100.13 ? 218  DA  J "C3'" 1 
ATOM   4448  O "O3'" . DA  B 1 72  ? 71.647  20.496 -80.616 1.00 106.21 ? 218  DA  J "O3'" 1 
ATOM   4449  C "C2'" . DA  B 1 72  ? 71.735  22.868 -80.318 1.00 96.49  ? 218  DA  J "C2'" 1 
ATOM   4450  C "C1'" . DA  B 1 72  ? 70.608  23.061 -81.302 1.00 95.36  ? 218  DA  J "C1'" 1 
ATOM   4451  N N9    . DA  B 1 72  ? 70.372  24.421 -81.780 1.00 60.51  ? 218  DA  J N9    1 
ATOM   4452  C C8    . DA  B 1 72  ? 70.334  25.598 -81.067 1.00 61.00  ? 218  DA  J C8    1 
ATOM   4453  N N7    . DA  B 1 72  ? 70.061  26.652 -81.804 1.00 59.15  ? 218  DA  J N7    1 
ATOM   4454  C C5    . DA  B 1 72  ? 69.915  26.135 -83.088 1.00 59.11  ? 218  DA  J C5    1 
ATOM   4455  C C6    . DA  B 1 72  ? 69.609  26.732 -84.319 1.00 58.53  ? 218  DA  J C6    1 
ATOM   4456  N N6    . DA  B 1 72  ? 69.351  28.026 -84.466 1.00 58.65  ? 218  DA  J N6    1 
ATOM   4457  N N1    . DA  B 1 72  ? 69.566  25.939 -85.408 1.00 61.20  ? 218  DA  J N1    1 
ATOM   4458  C C2    . DA  B 1 72  ? 69.800  24.631 -85.261 1.00 61.76  ? 218  DA  J C2    1 
ATOM   4459  N N3    . DA  B 1 72  ? 70.079  23.949 -84.163 1.00 60.16  ? 218  DA  J N3    1 
ATOM   4460  C C4    . DA  B 1 72  ? 70.121  24.766 -83.093 1.00 60.86  ? 218  DA  J C4    1 
ATOM   4461  P P     . DA  B 1 73  ? 72.931  19.586 -80.365 1.00 75.60  ? 219  DA  J P     1 
ATOM   4462  O OP1   . DA  B 1 73  ? 72.432  18.248 -79.963 1.00 61.77  ? 219  DA  J OP1   1 
ATOM   4463  O OP2   . DA  B 1 73  ? 73.949  20.294 -79.537 1.00 62.04  ? 219  DA  J OP2   1 
ATOM   4464  O "O5'" . DA  B 1 73  ? 73.505  19.514 -81.838 1.00 72.98  ? 219  DA  J "O5'" 1 
ATOM   4465  C "C5'" . DA  B 1 73  ? 72.617  19.294 -82.932 1.00 71.98  ? 219  DA  J "C5'" 1 
ATOM   4466  C "C4'" . DA  B 1 73  ? 73.206  19.837 -84.211 1.00 71.20  ? 219  DA  J "C4'" 1 
ATOM   4467  O "O4'" . DA  B 1 73  ? 72.769  21.183 -84.494 1.00 69.14  ? 219  DA  J "O4'" 1 
ATOM   4468  C "C3'" . DA  B 1 73  ? 74.727  19.850 -84.290 1.00 71.46  ? 219  DA  J "C3'" 1 
ATOM   4469  O "O3'" . DA  B 1 73  ? 75.071  19.343 -85.563 1.00 75.53  ? 219  DA  J "O3'" 1 
ATOM   4470  C "C2'" . DA  B 1 73  ? 75.071  21.327 -84.187 1.00 68.83  ? 219  DA  J "C2'" 1 
ATOM   4471  C "C1'" . DA  B 1 73  ? 73.872  21.978 -84.858 1.00 67.30  ? 219  DA  J "C1'" 1 
ATOM   4472  N N9    . DA  B 1 73  ? 73.561  23.357 -84.476 1.00 54.22  ? 219  DA  J N9    1 
ATOM   4473  C C8    . DA  B 1 73  ? 73.507  23.912 -83.224 1.00 54.37  ? 219  DA  J C8    1 
ATOM   4474  N N7    . DA  B 1 73  ? 73.207  25.188 -83.222 1.00 52.37  ? 219  DA  J N7    1 
ATOM   4475  C C5    . DA  B 1 73  ? 73.055  25.500 -84.564 1.00 51.49  ? 219  DA  J C5    1 
ATOM   4476  C C6    . DA  B 1 73  ? 72.755  26.712 -85.232 1.00 51.46  ? 219  DA  J C6    1 
ATOM   4477  N N6    . DA  B 1 73  ? 72.563  27.879 -84.615 1.00 48.52  ? 219  DA  J N6    1 
ATOM   4478  N N1    . DA  B 1 73  ? 72.664  26.680 -86.579 1.00 53.18  ? 219  DA  J N1    1 
ATOM   4479  C C2    . DA  B 1 73  ? 72.869  25.512 -87.206 1.00 51.54  ? 219  DA  J C2    1 
ATOM   4480  N N3    . DA  B 1 73  ? 73.176  24.311 -86.689 1.00 53.30  ? 219  DA  J N3    1 
ATOM   4481  C C4    . DA  B 1 73  ? 73.255  24.378 -85.345 1.00 54.01  ? 219  DA  J C4    1 
ATOM   4482  P P     . DT  B 1 74  ? 76.573  18.938 -85.870 1.00 76.45  ? 220  DT  J P     1 
ATOM   4483  O OP1   . DT  B 1 74  ? 76.502  17.621 -86.508 1.00 81.66  ? 220  DT  J OP1   1 
ATOM   4484  O OP2   . DT  B 1 74  ? 77.437  19.148 -84.688 1.00 79.41  ? 220  DT  J OP2   1 
ATOM   4485  O "O5'" . DT  B 1 74  ? 76.916  19.993 -86.983 1.00 76.75  ? 220  DT  J "O5'" 1 
ATOM   4486  C "C5'" . DT  B 1 74  ? 75.928  20.311 -87.942 1.00 74.73  ? 220  DT  J "C5'" 1 
ATOM   4487  C "C4'" . DT  B 1 74  ? 76.377  21.513 -88.721 1.00 75.01  ? 220  DT  J "C4'" 1 
ATOM   4488  O "O4'" . DT  B 1 74  ? 75.881  22.738 -88.123 1.00 72.64  ? 220  DT  J "O4'" 1 
ATOM   4489  C "C3'" . DT  B 1 74  ? 77.902  21.608 -88.695 1.00 75.87  ? 220  DT  J "C3'" 1 
ATOM   4490  O "O3'" . DT  B 1 74  ? 78.392  21.926 -89.997 1.00 79.88  ? 220  DT  J "O3'" 1 
ATOM   4491  C "C2'" . DT  B 1 74  ? 78.157  22.757 -87.739 1.00 74.08  ? 220  DT  J "C2'" 1 
ATOM   4492  C "C1'" . DT  B 1 74  ? 76.967  23.634 -88.051 1.00 73.07  ? 220  DT  J "C1'" 1 
ATOM   4493  N N1    . DT  B 1 74  ? 76.661  24.694 -87.074 1.00 72.08  ? 220  DT  J N1    1 
ATOM   4494  C C2    . DT  B 1 74  ? 76.406  25.947 -87.567 1.00 71.06  ? 220  DT  J C2    1 
ATOM   4495  O O2    . DT  B 1 74  ? 76.366  26.192 -88.752 1.00 72.07  ? 220  DT  J O2    1 
ATOM   4496  N N3    . DT  B 1 74  ? 76.197  26.905 -86.618 1.00 71.43  ? 220  DT  J N3    1 
ATOM   4497  C C4    . DT  B 1 74  ? 76.218  26.737 -85.252 1.00 71.47  ? 220  DT  J C4    1 
ATOM   4498  O O4    . DT  B 1 74  ? 76.034  27.701 -84.513 1.00 71.62  ? 220  DT  J O4    1 
ATOM   4499  C C5    . DT  B 1 74  ? 76.466  25.391 -84.804 1.00 70.94  ? 220  DT  J C5    1 
ATOM   4500  C C7    . DT  B 1 74  ? 76.491  25.109 -83.338 1.00 68.18  ? 220  DT  J C7    1 
ATOM   4501  C C6    . DT  B 1 74  ? 76.668  24.448 -85.726 1.00 71.41  ? 220  DT  J C6    1 
ATOM   4502  P P     . DT  B 1 75  ? 79.891  21.522 -90.410 1.00 97.16  ? 221  DT  J P     1 
ATOM   4503  O OP1   . DT  B 1 75  ? 79.808  20.310 -91.263 1.00 81.33  ? 221  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 1 75  ? 80.744  21.504 -89.182 1.00 81.26  ? 221  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 1 75  ? 80.302  22.756 -91.324 1.00 94.21  ? 221  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 1 75  ? 79.349  23.328 -92.210 1.00 93.51  ? 221  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 1 75  ? 79.568  24.817 -92.329 1.00 94.74  ? 221  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 1 75  ? 79.130  25.489 -91.125 1.00 92.57  ? 221  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 1 75  ? 81.021  25.248 -92.556 1.00 96.50  ? 221  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 1 75  ? 81.078  26.267 -93.569 1.00 100.73 ? 221  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 1 75  ? 81.425  25.816 -91.206 1.00 93.28  ? 221  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 1 75  ? 80.117  26.434 -90.757 1.00 90.38  ? 221  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 1 75  ? 79.981  26.716 -89.312 1.00 71.90  ? 221  DT  J N1    1 
ATOM   4514  C C2    . DT  B 1 75  ? 79.661  28.009 -88.934 1.00 70.94  ? 221  DT  J C2    1 
ATOM   4515  O O2    . DT  B 1 75  ? 79.533  28.922 -89.728 1.00 69.17  ? 221  DT  J O2    1 
ATOM   4516  N N3    . DT  B 1 75  ? 79.502  28.193 -87.592 1.00 70.73  ? 221  DT  J N3    1 
ATOM   4517  C C4    . DT  B 1 75  ? 79.634  27.243 -86.604 1.00 69.85  ? 221  DT  J C4    1 
ATOM   4518  O O4    . DT  B 1 75  ? 79.426  27.548 -85.432 1.00 70.33  ? 221  DT  J O4    1 
ATOM   4519  C C5    . DT  B 1 75  ? 80.005  25.921 -87.063 1.00 69.36  ? 221  DT  J C5    1 
ATOM   4520  C C7    . DT  B 1 75  ? 80.198  24.837 -86.051 1.00 68.94  ? 221  DT  J C7    1 
ATOM   4521  C C6    . DT  B 1 75  ? 80.156  25.725 -88.378 1.00 71.07  ? 221  DT  J C6    1 
ATOM   4522  P P     . DC  B 1 76  ? 82.469  26.578 -94.315 1.00 109.72 ? 222  DC  J P     1 
ATOM   4523  O OP1   . DC  B 1 76  ? 82.288  26.512 -95.784 1.00 83.55  ? 222  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 1 76  ? 83.499  25.735 -93.655 1.00 80.76  ? 222  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 1 76  ? 82.733  28.093 -93.941 1.00 109.60 ? 222  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 1 76  ? 82.249  28.593 -92.712 1.00 109.28 ? 222  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 1 76  ? 82.294  30.098 -92.709 1.00 108.18 ? 222  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 1 76  ? 81.886  30.563 -91.404 1.00 105.80 ? 222  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 1 76  ? 83.701  30.634 -92.912 1.00 108.28 ? 222  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 1 76  ? 83.624  31.911 -93.533 1.00 110.22 ? 222  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 1 76  ? 84.249  30.722 -91.503 1.00 106.96 ? 222  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 1 76  ? 83.012  30.999 -90.660 1.00 103.43 ? 222  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 1 76  ? 83.003  30.257 -89.397 1.00 71.58  ? 222  DC  J N1    1 
ATOM   4534  C C2    . DC  B 1 76  ? 82.811  30.967 -88.224 1.00 69.18  ? 222  DC  J C2    1 
ATOM   4535  O O2    . DC  B 1 76  ? 82.667  32.208 -88.301 1.00 67.72  ? 222  DC  J O2    1 
ATOM   4536  N N3    . DC  B 1 76  ? 82.786  30.292 -87.040 1.00 65.97  ? 222  DC  J N3    1 
ATOM   4537  C C4    . DC  B 1 76  ? 82.949  28.964 -87.025 1.00 65.85  ? 222  DC  J C4    1 
ATOM   4538  N N4    . DC  B 1 76  ? 82.917  28.336 -85.845 1.00 62.93  ? 222  DC  J N4    1 
ATOM   4539  C C5    . DC  B 1 76  ? 83.152  28.221 -88.219 1.00 66.28  ? 222  DC  J C5    1 
ATOM   4540  C C6    . DC  B 1 76  ? 83.174  28.900 -89.370 1.00 68.58  ? 222  DC  J C6    1 
ATOM   4541  P P     . DC  B 1 77  ? 84.958  32.603 -94.075 1.00 103.12 ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 77  ? 84.571  33.542 -95.173 1.00 80.99  ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 77  ? 85.937  31.502 -94.322 1.00 78.20  ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 77  ? 85.463  33.459 -92.836 1.00 103.00 ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 77  ? 84.697  34.551 -92.362 1.00 102.68 ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 77  ? 85.356  35.128 -91.139 1.00 101.58 ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 77  ? 85.181  34.247 -90.004 1.00 99.20  ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 77  ? 86.860  35.282 -91.321 1.00 101.68 ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 77  ? 87.263  36.459 -90.657 1.00 103.62 ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 77  ? 87.427  34.082 -90.591 1.00 100.36 ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 77  ? 86.453  33.976 -89.441 1.00 96.83  ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 77  ? 86.399  32.667 -88.776 1.00 69.02  ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 77  ? 85.963  32.610 -87.462 1.00 66.62  ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 77  ? 85.601  33.667 -86.909 1.00 65.16  ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 77  ? 85.939  31.418 -86.826 1.00 63.41  ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 77  ? 86.327  30.317 -87.464 1.00 63.29  ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 77  ? 86.301  29.168 -86.803 1.00 60.37  ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 77  ? 86.760  30.344 -88.808 1.00 63.72  ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 77  ? 86.781  31.529 -89.424 1.00 66.02  ? 223  DC  J C6    1 
ATOM   4560  P P     . DG  B 1 78  ? 87.689  37.726 -91.517 1.00 81.35  ? 224  DG  J P     1 
ATOM   4561  O OP1   . DG  B 1 78  ? 86.697  37.893 -92.615 1.00 94.42  ? 224  DG  J OP1   1 
ATOM   4562  O OP2   . DG  B 1 78  ? 89.128  37.541 -91.826 1.00 93.13  ? 224  DG  J OP2   1 
ATOM   4563  O "O5'" . DG  B 1 78  ? 87.536  38.945 -90.513 1.00 80.66  ? 224  DG  J "O5'" 1 
ATOM   4564  C "C5'" . DG  B 1 78  ? 86.279  39.245 -89.920 1.00 78.08  ? 224  DG  J "C5'" 1 
ATOM   4565  C "C4'" . DG  B 1 78  ? 86.454  39.474 -88.437 1.00 76.22  ? 224  DG  J "C4'" 1 
ATOM   4566  O "O4'" . DG  B 1 78  ? 86.701  38.218 -87.770 1.00 75.31  ? 224  DG  J "O4'" 1 
ATOM   4567  C "C3'" . DG  B 1 78  ? 87.626  40.380 -88.075 1.00 75.24  ? 224  DG  J "C3'" 1 
ATOM   4568  O "O3'" . DG  B 1 78  ? 87.233  41.253 -87.024 1.00 76.45  ? 224  DG  J "O3'" 1 
ATOM   4569  C "C2'" . DG  B 1 78  ? 88.712  39.413 -87.633 1.00 73.25  ? 224  DG  J "C2'" 1 
ATOM   4570  C "C1'" . DG  B 1 78  ? 87.918  38.266 -87.042 1.00 73.59  ? 224  DG  J "C1'" 1 
ATOM   4571  N N9    . DG  B 1 78  ? 88.543  36.953 -87.165 1.00 86.13  ? 224  DG  J N9    1 
ATOM   4572  C C8    . DG  B 1 78  ? 89.306  36.495 -88.206 1.00 85.67  ? 224  DG  J C8    1 
ATOM   4573  N N7    . DG  B 1 78  ? 89.701  35.260 -88.048 1.00 85.81  ? 224  DG  J N7    1 
ATOM   4574  C C5    . DG  B 1 78  ? 89.173  34.887 -86.823 1.00 85.90  ? 224  DG  J C5    1 
ATOM   4575  C C6    . DG  B 1 78  ? 89.269  33.663 -86.118 1.00 85.81  ? 224  DG  J C6    1 
ATOM   4576  O O6    . DG  B 1 78  ? 89.852  32.622 -86.457 1.00 86.11  ? 224  DG  J O6    1 
ATOM   4577  N N1    . DG  B 1 78  ? 88.592  33.719 -84.904 1.00 86.24  ? 224  DG  J N1    1 
ATOM   4578  C C2    . DG  B 1 78  ? 87.903  34.806 -84.432 1.00 85.96  ? 224  DG  J C2    1 
ATOM   4579  N N2    . DG  B 1 78  ? 87.309  34.662 -83.237 1.00 87.85  ? 224  DG  J N2    1 
ATOM   4580  N N3    . DG  B 1 78  ? 87.801  35.952 -85.083 1.00 85.95  ? 224  DG  J N3    1 
ATOM   4581  C C4    . DG  B 1 78  ? 88.458  35.923 -86.261 1.00 85.87  ? 224  DG  J C4    1 
ATOM   4582  P P     . DC  B 1 79  ? 88.266  42.340 -86.477 1.00 103.56 ? 225  DC  J P     1 
ATOM   4583  O OP1   . DC  B 1 79  ? 87.533  43.613 -86.240 1.00 77.98  ? 225  DC  J OP1   1 
ATOM   4584  O OP2   . DC  B 1 79  ? 89.438  42.314 -87.387 1.00 79.41  ? 225  DC  J OP2   1 
ATOM   4585  O "O5'" . DC  B 1 79  ? 88.749  41.720 -85.094 1.00 103.87 ? 225  DC  J "O5'" 1 
ATOM   4586  C "C5'" . DC  B 1 79  ? 87.816  41.227 -84.131 1.00 103.36 ? 225  DC  J "C5'" 1 
ATOM   4587  C "C4'" . DC  B 1 79  ? 88.558  40.557 -83.001 1.00 102.77 ? 225  DC  J "C4'" 1 
ATOM   4588  O "O4'" . DC  B 1 79  ? 89.059  39.252 -83.407 1.00 102.58 ? 225  DC  J "O4'" 1 
ATOM   4589  C "C3'" . DC  B 1 79  ? 89.782  41.363 -82.566 1.00 102.96 ? 225  DC  J "C3'" 1 
ATOM   4590  O "O3'" . DC  B 1 79  ? 89.966  41.260 -81.159 1.00 101.10 ? 225  DC  J "O3'" 1 
ATOM   4591  C "C2'" . DC  B 1 79  ? 90.915  40.616 -83.238 1.00 103.71 ? 225  DC  J "C2'" 1 
ATOM   4592  C "C1'" . DC  B 1 79  ? 90.438  39.187 -83.099 1.00 103.98 ? 225  DC  J "C1'" 1 
ATOM   4593  N N1    . DC  B 1 79  ? 91.084  38.207 -83.989 1.00 80.92  ? 225  DC  J N1    1 
ATOM   4594  C C2    . DC  B 1 79  ? 91.240  36.882 -83.544 1.00 81.47  ? 225  DC  J C2    1 
ATOM   4595  O O2    . DC  B 1 79  ? 90.831  36.574 -82.420 1.00 80.23  ? 225  DC  J O2    1 
ATOM   4596  N N3    . DC  B 1 79  ? 91.834  35.975 -84.358 1.00 82.00  ? 225  DC  J N3    1 
ATOM   4597  C C4    . DC  B 1 79  ? 92.260  36.346 -85.574 1.00 82.54  ? 225  DC  J C4    1 
ATOM   4598  N N4    . DC  B 1 79  ? 92.820  35.415 -86.356 1.00 83.42  ? 225  DC  J N4    1 
ATOM   4599  C C5    . DC  B 1 79  ? 92.123  37.686 -86.045 1.00 82.50  ? 225  DC  J C5    1 
ATOM   4600  C C6    . DC  B 1 79  ? 91.534  38.574 -85.229 1.00 81.64  ? 225  DC  J C6    1 
ATOM   4601  P P     . DT  B 1 80  ? 89.416  42.410 -80.188 1.00 78.24  ? 226  DT  J P     1 
ATOM   4602  O OP1   . DT  B 1 80  ? 88.088  42.830 -80.704 1.00 96.46  ? 226  DT  J OP1   1 
ATOM   4603  O OP2   . DT  B 1 80  ? 90.498  43.417 -80.013 1.00 94.36  ? 226  DT  J OP2   1 
ATOM   4604  O "O5'" . DT  B 1 80  ? 89.249  41.621 -78.813 1.00 75.03  ? 226  DT  J "O5'" 1 
ATOM   4605  C "C5'" . DT  B 1 80  ? 88.622  40.334 -78.779 1.00 68.21  ? 226  DT  J "C5'" 1 
ATOM   4606  C "C4'" . DT  B 1 80  ? 89.512  39.313 -78.098 1.00 65.39  ? 226  DT  J "C4'" 1 
ATOM   4607  O "O4'" . DT  B 1 80  ? 90.281  38.493 -79.014 1.00 63.88  ? 226  DT  J "O4'" 1 
ATOM   4608  C "C3'" . DT  B 1 80  ? 90.512  39.853 -77.080 1.00 63.55  ? 226  DT  J "C3'" 1 
ATOM   4609  O "O3'" . DT  B 1 80  ? 90.569  38.937 -75.994 1.00 60.97  ? 226  DT  J "O3'" 1 
ATOM   4610  C "C2'" . DT  B 1 80  ? 91.829  39.754 -77.826 1.00 64.45  ? 226  DT  J "C2'" 1 
ATOM   4611  C "C1'" . DT  B 1 80  ? 91.625  38.452 -78.563 1.00 64.32  ? 226  DT  J "C1'" 1 
ATOM   4612  N N1    . DT  B 1 80  ? 92.506  38.220 -79.724 1.00 82.63  ? 226  DT  J N1    1 
ATOM   4613  C C2    . DT  B 1 80  ? 93.142  37.009 -79.782 1.00 81.51  ? 226  DT  J C2    1 
ATOM   4614  O O2    . DT  B 1 80  ? 93.008  36.151 -78.931 1.00 83.48  ? 226  DT  J O2    1 
ATOM   4615  N N3    . DT  B 1 80  ? 93.944  36.832 -80.878 1.00 83.75  ? 226  DT  J N3    1 
ATOM   4616  C C4    . DT  B 1 80  ? 94.170  37.728 -81.902 1.00 84.48  ? 226  DT  J C4    1 
ATOM   4617  O O4    . DT  B 1 80  ? 94.921  37.430 -82.832 1.00 86.55  ? 226  DT  J O4    1 
ATOM   4618  C C5    . DT  B 1 80  ? 93.474  38.978 -81.784 1.00 84.03  ? 226  DT  J C5    1 
ATOM   4619  C C7    . DT  B 1 80  ? 93.653  39.995 -82.863 1.00 85.24  ? 226  DT  J C7    1 
ATOM   4620  C C6    . DT  B 1 80  ? 92.692  39.168 -80.709 1.00 83.25  ? 226  DT  J C6    1 
ATOM   4621  P P     . DG  B 1 81  ? 90.075  39.385 -74.539 1.00 68.79  ? 227  DG  J P     1 
ATOM   4622  O OP1   . DG  B 1 81  ? 88.694  39.922 -74.594 1.00 70.62  ? 227  DG  J OP1   1 
ATOM   4623  O OP2   . DG  B 1 81  ? 91.187  40.173 -73.933 1.00 65.97  ? 227  DG  J OP2   1 
ATOM   4624  O "O5'" . DG  B 1 81  ? 89.960  38.015 -73.776 1.00 65.24  ? 227  DG  J "O5'" 1 
ATOM   4625  C "C5'" . DG  B 1 81  ? 91.006  37.625 -72.944 1.00 61.98  ? 227  DG  J "C5'" 1 
ATOM   4626  C "C4'" . DG  B 1 81  ? 91.636  36.355 -73.452 1.00 61.91  ? 227  DG  J "C4'" 1 
ATOM   4627  O "O4'" . DG  B 1 81  ? 92.156  36.480 -74.793 1.00 63.63  ? 227  DG  J "O4'" 1 
ATOM   4628  C "C3'" . DG  B 1 81  ? 92.832  36.034 -72.583 1.00 59.19  ? 227  DG  J "C3'" 1 
ATOM   4629  O "O3'" . DG  B 1 81  ? 92.858  34.663 -72.356 1.00 52.09  ? 227  DG  J "O3'" 1 
ATOM   4630  C "C2'" . DG  B 1 81  ? 94.025  36.476 -73.395 1.00 60.23  ? 227  DG  J "C2'" 1 
ATOM   4631  C "C1'" . DG  B 1 81  ? 93.554  36.183 -74.797 1.00 63.30  ? 227  DG  J "C1'" 1 
ATOM   4632  N N9    . DG  B 1 81  ? 94.207  37.014 -75.801 1.00 65.47  ? 227  DG  J N9    1 
ATOM   4633  C C8    . DG  B 1 81  ? 94.173  38.387 -75.892 1.00 66.59  ? 227  DG  J C8    1 
ATOM   4634  N N7    . DG  B 1 81  ? 94.826  38.850 -76.917 1.00 67.19  ? 227  DG  J N7    1 
ATOM   4635  C C5    . DG  B 1 81  ? 95.334  37.714 -77.541 1.00 67.46  ? 227  DG  J C5    1 
ATOM   4636  C C6    . DG  B 1 81  ? 96.112  37.580 -78.737 1.00 68.21  ? 227  DG  J C6    1 
ATOM   4637  O O6    . DG  B 1 81  ? 96.481  38.463 -79.530 1.00 73.41  ? 227  DG  J O6    1 
ATOM   4638  N N1    . DG  B 1 81  ? 96.430  36.250 -78.990 1.00 66.67  ? 227  DG  J N1    1 
ATOM   4639  C C2    . DG  B 1 81  ? 96.024  35.190 -78.227 1.00 67.12  ? 227  DG  J C2    1 
ATOM   4640  N N2    . DG  B 1 81  ? 96.445  33.988 -78.641 1.00 65.76  ? 227  DG  J N2    1 
ATOM   4641  N N3    . DG  B 1 81  ? 95.266  35.296 -77.137 1.00 63.18  ? 227  DG  J N3    1 
ATOM   4642  C C4    . DG  B 1 81  ? 94.970  36.580 -76.853 1.00 65.74  ? 227  DG  J C4    1 
ATOM   4643  P P     . DA  B 1 82  ? 93.606  34.144 -71.074 1.00 44.02  ? 228  DA  J P     1 
ATOM   4644  O OP1   . DA  B 1 82  ? 92.684  33.289 -70.284 1.00 56.95  ? 228  DA  J OP1   1 
ATOM   4645  O OP2   . DA  B 1 82  ? 94.236  35.336 -70.440 1.00 54.93  ? 228  DA  J OP2   1 
ATOM   4646  O "O5'" . DA  B 1 82  ? 94.736  33.268 -71.752 1.00 40.11  ? 228  DA  J "O5'" 1 
ATOM   4647  C "C5'" . DA  B 1 82  ? 94.400  32.138 -72.536 1.00 39.47  ? 228  DA  J "C5'" 1 
ATOM   4648  C "C4'" . DA  B 1 82  ? 95.667  31.452 -72.977 1.00 43.55  ? 228  DA  J "C4'" 1 
ATOM   4649  O "O4'" . DA  B 1 82  ? 96.283  32.264 -73.997 1.00 47.24  ? 228  DA  J "O4'" 1 
ATOM   4650  C "C3'" . DA  B 1 82  ? 96.715  31.273 -71.878 1.00 43.08  ? 228  DA  J "C3'" 1 
ATOM   4651  O "O3'" . DA  B 1 82  ? 97.322  29.999 -72.051 1.00 43.44  ? 228  DA  J "O3'" 1 
ATOM   4652  C "C2'" . DA  B 1 82  ? 97.687  32.420 -72.106 1.00 43.01  ? 228  DA  J "C2'" 1 
ATOM   4653  C "C1'" . DA  B 1 82  ? 97.561  32.707 -73.597 1.00 47.03  ? 228  DA  J "C1'" 1 
ATOM   4654  N N9    . DA  B 1 82  ? 97.665  34.099 -74.026 1.00 67.36  ? 228  DA  J N9    1 
ATOM   4655  C C8    . DA  B 1 82  ? 97.166  35.241 -73.439 1.00 68.50  ? 228  DA  J C8    1 
ATOM   4656  N N7    . DA  B 1 82  ? 97.385  36.337 -74.136 1.00 68.75  ? 228  DA  J N7    1 
ATOM   4657  C C5    . DA  B 1 82  ? 98.090  35.888 -75.247 1.00 68.06  ? 228  DA  J C5    1 
ATOM   4658  C C6    . DA  B 1 82  ? 98.600  36.548 -76.363 1.00 68.03  ? 228  DA  J C6    1 
ATOM   4659  N N6    . DA  B 1 82  ? 98.500  37.851 -76.551 1.00 66.38  ? 228  DA  J N6    1 
ATOM   4660  N N1    . DA  B 1 82  ? 99.231  35.807 -77.296 1.00 69.07  ? 228  DA  J N1    1 
ATOM   4661  C C2    . DA  B 1 82  ? 99.347  34.488 -77.107 1.00 69.79  ? 228  DA  J C2    1 
ATOM   4662  N N3    . DA  B 1 82  ? 98.916  33.747 -76.095 1.00 70.68  ? 228  DA  J N3    1 
ATOM   4663  C C4    . DA  B 1 82  ? 98.280  34.516 -75.184 1.00 69.01  ? 228  DA  J C4    1 
ATOM   4664  P P     . DA  B 1 83  ? 98.500  29.535 -71.084 1.00 54.19  ? 229  DA  J P     1 
ATOM   4665  O OP1   . DA  B 1 83  ? 98.309  28.073 -70.847 1.00 64.33  ? 229  DA  J OP1   1 
ATOM   4666  O OP2   . DA  B 1 83  ? 98.592  30.484 -69.941 1.00 62.91  ? 229  DA  J OP2   1 
ATOM   4667  O "O5'" . DA  B 1 83  ? 99.811  29.791 -71.946 1.00 58.26  ? 229  DA  J "O5'" 1 
ATOM   4668  C "C5'" . DA  B 1 83  ? 99.986  29.139 -73.201 1.00 57.75  ? 229  DA  J "C5'" 1 
ATOM   4669  C "C4'" . DA  B 1 83  ? 101.318 29.502 -73.812 1.00 58.99  ? 229  DA  J "C4'" 1 
ATOM   4670  O "O4'" . DA  B 1 83  ? 101.300 30.860 -74.281 1.00 55.73  ? 229  DA  J "O4'" 1 
ATOM   4671  C "C3'" . DA  B 1 83  ? 102.532 29.376 -72.907 1.00 60.97  ? 229  DA  J "C3'" 1 
ATOM   4672  O "O3'" . DA  B 1 83  ? 103.563 28.727 -73.656 1.00 68.00  ? 229  DA  J "O3'" 1 
ATOM   4673  C "C2'" . DA  B 1 83  ? 102.852 30.821 -72.556 1.00 58.23  ? 229  DA  J "C2'" 1 
ATOM   4674  C "C1'" . DA  B 1 83  ? 102.385 31.582 -73.775 1.00 59.00  ? 229  DA  J "C1'" 1 
ATOM   4675  N N9    . DA  B 1 83  ? 101.897 32.938 -73.552 1.00 71.05  ? 229  DA  J N9    1 
ATOM   4676  C C8    . DA  B 1 83  ? 101.107 33.405 -72.533 1.00 73.79  ? 229  DA  J C8    1 
ATOM   4677  N N7    . DA  B 1 83  ? 100.762 34.665 -72.667 1.00 70.99  ? 229  DA  J N7    1 
ATOM   4678  C C5    . DA  B 1 83  ? 101.380 35.058 -73.845 1.00 71.42  ? 229  DA  J C5    1 
ATOM   4679  C C6    . DA  B 1 83  ? 101.396 36.279 -74.555 1.00 72.48  ? 229  DA  J C6    1 
ATOM   4680  N N6    . DA  B 1 83  ? 100.736 37.378 -74.175 1.00 70.42  ? 229  DA  J N6    1 
ATOM   4681  N N1    . DA  B 1 83  ? 102.120 36.331 -75.693 1.00 72.75  ? 229  DA  J N1    1 
ATOM   4682  C C2    . DA  B 1 83  ? 102.774 35.236 -76.086 1.00 72.97  ? 229  DA  J C2    1 
ATOM   4683  N N3    . DA  B 1 83  ? 102.831 34.035 -75.514 1.00 74.09  ? 229  DA  J N3    1 
ATOM   4684  C C4    . DA  B 1 83  ? 102.102 34.010 -74.386 1.00 72.69  ? 229  DA  J C4    1 
ATOM   4685  P P     . DC  B 1 84  ? 104.900 28.227 -72.926 1.00 56.77  ? 230  DC  J P     1 
ATOM   4686  O OP1   . DC  B 1 84  ? 105.367 27.057 -73.691 1.00 53.13  ? 230  DC  J OP1   1 
ATOM   4687  O OP2   . DC  B 1 84  ? 104.630 28.068 -71.478 1.00 51.27  ? 230  DC  J OP2   1 
ATOM   4688  O "O5'" . DC  B 1 84  ? 105.890 29.455 -73.189 1.00 57.75  ? 230  DC  J "O5'" 1 
ATOM   4689  C "C5'" . DC  B 1 84  ? 106.039 29.981 -74.513 1.00 63.15  ? 230  DC  J "C5'" 1 
ATOM   4690  C "C4'" . DC  B 1 84  ? 106.955 31.186 -74.530 1.00 66.99  ? 230  DC  J "C4'" 1 
ATOM   4691  O "O4'" . DC  B 1 84  ? 106.222 32.437 -74.481 1.00 67.30  ? 230  DC  J "O4'" 1 
ATOM   4692  C "C3'" . DC  B 1 84  ? 107.991 31.243 -73.405 1.00 71.23  ? 230  DC  J "C3'" 1 
ATOM   4693  O "O3'" . DC  B 1 84  ? 109.290 31.588 -73.899 1.00 80.04  ? 230  DC  J "O3'" 1 
ATOM   4694  C "C2'" . DC  B 1 84  ? 107.477 32.367 -72.529 1.00 69.61  ? 230  DC  J "C2'" 1 
ATOM   4695  C "C1'" . DC  B 1 84  ? 106.857 33.289 -73.551 1.00 66.27  ? 230  DC  J "C1'" 1 
ATOM   4696  N N1    . DC  B 1 84  ? 105.864 34.236 -73.022 1.00 61.02  ? 230  DC  J N1    1 
ATOM   4697  C C2    . DC  B 1 84  ? 105.674 35.441 -73.702 1.00 60.21  ? 230  DC  J C2    1 
ATOM   4698  O O2    . DC  B 1 84  ? 106.307 35.645 -74.733 1.00 61.95  ? 230  DC  J O2    1 
ATOM   4699  N N3    . DC  B 1 84  ? 104.810 36.352 -73.225 1.00 59.78  ? 230  DC  J N3    1 
ATOM   4700  C C4    . DC  B 1 84  ? 104.123 36.093 -72.120 1.00 58.61  ? 230  DC  J C4    1 
ATOM   4701  N N4    . DC  B 1 84  ? 103.281 37.027 -71.696 1.00 56.14  ? 230  DC  J N4    1 
ATOM   4702  C C5    . DC  B 1 84  ? 104.272 34.861 -71.407 1.00 59.13  ? 230  DC  J C5    1 
ATOM   4703  C C6    . DC  B 1 84  ? 105.146 33.966 -71.891 1.00 58.95  ? 230  DC  J C6    1 
ATOM   4704  P P     . DA  B 1 85  ? 110.593 30.905 -73.249 1.00 120.12 ? 231  DA  J P     1 
ATOM   4705  O OP1   . DA  B 1 85  ? 110.887 29.678 -74.023 1.00 124.58 ? 231  DA  J OP1   1 
ATOM   4706  O OP2   . DA  B 1 85  ? 110.413 30.820 -71.782 1.00 125.00 ? 231  DA  J OP2   1 
ATOM   4707  O "O5'" . DA  B 1 85  ? 111.743 31.961 -73.550 1.00 125.14 ? 231  DA  J "O5'" 1 
ATOM   4708  C "C5'" . DA  B 1 85  ? 111.867 32.537 -74.845 1.00 134.78 ? 231  DA  J "C5'" 1 
ATOM   4709  C "C4'" . DA  B 1 85  ? 112.022 34.037 -74.747 1.00 141.23 ? 231  DA  J "C4'" 1 
ATOM   4710  O "O4'" . DA  B 1 85  ? 110.838 34.631 -74.165 1.00 143.01 ? 231  DA  J "O4'" 1 
ATOM   4711  C "C3'" . DA  B 1 85  ? 113.200 34.557 -73.928 1.00 144.87 ? 231  DA  J "C3'" 1 
ATOM   4712  O "O3'" . DA  B 1 85  ? 113.689 35.717 -74.588 1.00 149.72 ? 231  DA  J "O3'" 1 
ATOM   4713  C "C2'" . DA  B 1 85  ? 112.559 34.957 -72.612 1.00 144.62 ? 231  DA  J "C2'" 1 
ATOM   4714  C "C1'" . DA  B 1 85  ? 111.187 35.443 -73.059 1.00 144.25 ? 231  DA  J "C1'" 1 
ATOM   4715  N N9    . DA  B 1 85  ? 110.103 35.334 -72.076 1.00 150.48 ? 231  DA  J N9    1 
ATOM   4716  C C8    . DA  B 1 85  ? 109.762 34.258 -71.285 1.00 150.51 ? 231  DA  J C8    1 
ATOM   4717  N N7    . DA  B 1 85  ? 108.726 34.481 -70.507 1.00 150.10 ? 231  DA  J N7    1 
ATOM   4718  C C5    . DA  B 1 85  ? 108.360 35.786 -70.802 1.00 150.44 ? 231  DA  J C5    1 
ATOM   4719  C C6    . DA  B 1 85  ? 107.335 36.619 -70.307 1.00 150.50 ? 231  DA  J C6    1 
ATOM   4720  N N6    . DA  B 1 85  ? 106.452 36.235 -69.379 1.00 149.56 ? 231  DA  J N6    1 
ATOM   4721  N N1    . DA  B 1 85  ? 107.248 37.873 -70.805 1.00 151.26 ? 231  DA  J N1    1 
ATOM   4722  C C2    . DA  B 1 85  ? 108.128 38.253 -71.742 1.00 151.73 ? 231  DA  J C2    1 
ATOM   4723  N N3    . DA  B 1 85  ? 109.130 37.563 -72.292 1.00 151.17 ? 231  DA  J N3    1 
ATOM   4724  C C4    . DA  B 1 85  ? 109.196 36.325 -71.770 1.00 150.79 ? 231  DA  J C4    1 
ATOM   4725  P P     . DT  B 1 86  ? 115.051 36.395 -74.110 1.00 163.66 ? 232  DT  J P     1 
ATOM   4726  O OP1   . DT  B 1 86  ? 115.834 36.639 -75.344 1.00 121.42 ? 232  DT  J OP1   1 
ATOM   4727  O OP2   . DT  B 1 86  ? 115.668 35.667 -72.972 1.00 121.09 ? 232  DT  J OP2   1 
ATOM   4728  O "O5'" . DT  B 1 86  ? 114.537 37.795 -73.578 1.00 166.13 ? 232  DT  J "O5'" 1 
ATOM   4729  C "C5'" . DT  B 1 86  ? 114.067 38.779 -74.492 1.00 171.16 ? 232  DT  J "C5'" 1 
ATOM   4730  C "C4'" . DT  B 1 86  ? 113.942 40.105 -73.786 1.00 174.93 ? 232  DT  J "C4'" 1 
ATOM   4731  O "O4'" . DT  B 1 86  ? 112.771 40.089 -72.933 1.00 175.97 ? 232  DT  J "O4'" 1 
ATOM   4732  C "C3'" . DT  B 1 86  ? 115.129 40.415 -72.872 1.00 177.12 ? 232  DT  J "C3'" 1 
ATOM   4733  O "O3'" . DT  B 1 86  ? 115.423 41.817 -72.899 1.00 179.49 ? 232  DT  J "O3'" 1 
ATOM   4734  C "C2'" . DT  B 1 86  ? 114.627 39.998 -71.502 1.00 177.39 ? 232  DT  J "C2'" 1 
ATOM   4735  C "C1'" . DT  B 1 86  ? 113.154 40.356 -71.592 1.00 177.59 ? 232  DT  J "C1'" 1 
ATOM   4736  N N1    . DT  B 1 86  ? 112.258 39.597 -70.693 1.00 137.13 ? 232  DT  J N1    1 
ATOM   4737  C C2    . DT  B 1 86  ? 111.311 40.313 -69.994 1.00 137.51 ? 232  DT  J C2    1 
ATOM   4738  O O2    . DT  B 1 86  ? 111.209 41.528 -70.069 1.00 137.27 ? 232  DT  J O2    1 
ATOM   4739  N N3    . DT  B 1 86  ? 110.488 39.551 -69.192 1.00 137.97 ? 232  DT  J N3    1 
ATOM   4740  C C4    . DT  B 1 86  ? 110.529 38.180 -69.013 1.00 138.26 ? 232  DT  J C4    1 
ATOM   4741  O O4    . DT  B 1 86  ? 109.721 37.634 -68.261 1.00 138.43 ? 232  DT  J O4    1 
ATOM   4742  C C5    . DT  B 1 86  ? 111.564 37.494 -69.761 1.00 138.26 ? 232  DT  J C5    1 
ATOM   4743  C C7    . DT  B 1 86  ? 111.704 36.011 -69.610 1.00 138.38 ? 232  DT  J C7    1 
ATOM   4744  C C6    . DT  B 1 86  ? 112.362 38.226 -70.558 1.00 138.05 ? 232  DT  J C6    1 
ATOM   4745  P P     . DG  B 1 87  ? 116.667 42.389 -72.057 1.00 182.48 ? 233  DG  J P     1 
ATOM   4746  O OP1   . DG  B 1 87  ? 117.328 43.447 -72.858 1.00 156.99 ? 233  DG  J OP1   1 
ATOM   4747  O OP2   . DG  B 1 87  ? 117.461 41.237 -71.565 1.00 156.31 ? 233  DG  J OP2   1 
ATOM   4748  O "O5'" . DG  B 1 87  ? 115.982 43.099 -70.810 1.00 183.62 ? 233  DG  J "O5'" 1 
ATOM   4749  C "C5'" . DG  B 1 87  ? 115.068 44.179 -70.994 1.00 185.14 ? 233  DG  J "C5'" 1 
ATOM   4750  C "C4'" . DG  B 1 87  ? 114.630 44.719 -69.653 1.00 186.24 ? 233  DG  J "C4'" 1 
ATOM   4751  O "O4'" . DG  B 1 87  ? 113.825 43.726 -68.970 1.00 187.35 ? 233  DG  J "O4'" 1 
ATOM   4752  C "C3'" . DG  B 1 87  ? 115.794 45.034 -68.713 1.00 186.33 ? 233  DG  J "C3'" 1 
ATOM   4753  O "O3'" . DG  B 1 87  ? 115.489 46.181 -67.921 1.00 184.83 ? 233  DG  J "O3'" 1 
ATOM   4754  C "C2'" . DG  B 1 87  ? 115.875 43.801 -67.832 1.00 187.43 ? 233  DG  J "C2'" 1 
ATOM   4755  C "C1'" . DG  B 1 87  ? 114.414 43.405 -67.714 1.00 188.46 ? 233  DG  J "C1'" 1 
ATOM   4756  N N9    . DG  B 1 87  ? 114.186 41.987 -67.450 1.00 164.12 ? 233  DG  J N9    1 
ATOM   4757  C C8    . DG  B 1 87  ? 114.998 40.930 -67.798 1.00 164.65 ? 233  DG  J C8    1 
ATOM   4758  N N7    . DG  B 1 87  ? 114.522 39.772 -67.427 1.00 164.67 ? 233  DG  J N7    1 
ATOM   4759  C C5    . DG  B 1 87  ? 113.325 40.079 -66.792 1.00 164.99 ? 233  DG  J C5    1 
ATOM   4760  C C6    . DG  B 1 87  ? 112.364 39.230 -66.185 1.00 165.18 ? 233  DG  J C6    1 
ATOM   4761  O O6    . DG  B 1 87  ? 112.376 37.998 -66.086 1.00 164.98 ? 233  DG  J O6    1 
ATOM   4762  N N1    . DG  B 1 87  ? 111.299 39.959 -65.663 1.00 165.57 ? 233  DG  J N1    1 
ATOM   4763  C C2    . DG  B 1 87  ? 111.171 41.328 -65.721 1.00 165.38 ? 233  DG  J C2    1 
ATOM   4764  N N2    . DG  B 1 87  ? 110.066 41.846 -65.171 1.00 165.65 ? 233  DG  J N2    1 
ATOM   4765  N N3    . DG  B 1 87  ? 112.061 42.129 -66.282 1.00 164.99 ? 233  DG  J N3    1 
ATOM   4766  C C4    . DG  B 1 87  ? 113.105 41.442 -66.796 1.00 164.76 ? 233  DG  J C4    1 
ATOM   4767  P P     . DC  B 1 88  ? 116.649 46.892 -67.069 1.00 127.43 ? 234  DC  J P     1 
ATOM   4768  O OP1   . DC  B 1 88  ? 117.198 47.987 -67.907 1.00 161.31 ? 234  DC  J OP1   1 
ATOM   4769  O OP2   . DC  B 1 88  ? 117.563 45.851 -66.524 1.00 161.39 ? 234  DC  J OP2   1 
ATOM   4770  O "O5'" . DC  B 1 88  ? 115.864 47.543 -65.844 1.00 126.23 ? 234  DC  J "O5'" 1 
ATOM   4771  C "C5'" . DC  B 1 88  ? 114.571 48.130 -66.026 1.00 122.48 ? 234  DC  J "C5'" 1 
ATOM   4772  C "C4'" . DC  B 1 88  ? 113.731 47.954 -64.779 1.00 119.78 ? 234  DC  J "C4'" 1 
ATOM   4773  O "O4'" . DC  B 1 88  ? 113.365 46.563 -64.609 1.00 120.31 ? 234  DC  J "O4'" 1 
ATOM   4774  C "C3'" . DC  B 1 88  ? 114.406 48.380 -63.473 1.00 117.21 ? 234  DC  J "C3'" 1 
ATOM   4775  O "O3'" . DC  B 1 88  ? 113.438 48.981 -62.617 1.00 112.63 ? 234  DC  J "O3'" 1 
ATOM   4776  C "C2'" . DC  B 1 88  ? 114.849 47.059 -62.863 1.00 118.51 ? 234  DC  J "C2'" 1 
ATOM   4777  C "C1'" . DC  B 1 88  ? 113.731 46.127 -63.305 1.00 120.67 ? 234  DC  J "C1'" 1 
ATOM   4778  N N1    . DC  B 1 88  ? 114.063 44.690 -63.383 1.00 155.90 ? 234  DC  J N1    1 
ATOM   4779  C C2    . DC  B 1 88  ? 113.209 43.769 -62.762 1.00 156.76 ? 234  DC  J C2    1 
ATOM   4780  O O2    . DC  B 1 88  ? 112.227 44.190 -62.135 1.00 157.12 ? 234  DC  J O2    1 
ATOM   4781  N N3    . DC  B 1 88  ? 113.478 42.445 -62.856 1.00 157.28 ? 234  DC  J N3    1 
ATOM   4782  C C4    . DC  B 1 88  ? 114.553 42.029 -63.530 1.00 157.72 ? 234  DC  J C4    1 
ATOM   4783  N N4    . DC  B 1 88  ? 114.774 40.713 -63.605 1.00 158.74 ? 234  DC  J N4    1 
ATOM   4784  C C5    . DC  B 1 88  ? 115.450 42.944 -64.157 1.00 157.36 ? 234  DC  J C5    1 
ATOM   4785  C C6    . DC  B 1 88  ? 115.169 44.254 -64.060 1.00 156.39 ? 234  DC  J C6    1 
ATOM   4786  P P     . DC  B 1 89  ? 112.922 50.473 -62.913 1.00 100.95 ? 235  DC  J P     1 
ATOM   4787  O OP1   . DC  B 1 89  ? 112.545 50.555 -64.343 1.00 143.95 ? 235  DC  J OP1   1 
ATOM   4788  O OP2   . DC  B 1 89  ? 113.895 51.443 -62.351 1.00 143.77 ? 235  DC  J OP2   1 
ATOM   4789  O "O5'" . DC  B 1 89  ? 111.577 50.548 -62.067 1.00 97.70  ? 235  DC  J "O5'" 1 
ATOM   4790  C "C5'" . DC  B 1 89  ? 110.430 49.774 -62.450 1.00 91.64  ? 235  DC  J "C5'" 1 
ATOM   4791  C "C4'" . DC  B 1 89  ? 109.825 49.070 -61.252 1.00 87.56  ? 235  DC  J "C4'" 1 
ATOM   4792  O "O4'" . DC  B 1 89  ? 110.537 47.855 -60.911 1.00 86.16  ? 235  DC  J "O4'" 1 
ATOM   4793  C "C3'" . DC  B 1 89  ? 109.746 49.896 -59.965 1.00 85.51  ? 235  DC  J "C3'" 1 
ATOM   4794  O "O3'" . DC  B 1 89  ? 108.503 49.649 -59.326 1.00 81.84  ? 235  DC  J "O3'" 1 
ATOM   4795  C "C2'" . DC  B 1 89  ? 110.848 49.312 -59.106 1.00 85.67  ? 235  DC  J "C2'" 1 
ATOM   4796  C "C1'" . DC  B 1 89  ? 110.808 47.856 -59.519 1.00 86.40  ? 235  DC  J "C1'" 1 
ATOM   4797  N N1    . DC  B 1 89  ? 112.066 47.144 -59.305 1.00 130.69 ? 235  DC  J N1    1 
ATOM   4798  C C2    . DC  B 1 89  ? 112.007 45.813 -58.929 1.00 131.71 ? 235  DC  J C2    1 
ATOM   4799  O O2    . DC  B 1 89  ? 110.898 45.282 -58.799 1.00 132.71 ? 235  DC  J O2    1 
ATOM   4800  N N3    . DC  B 1 89  ? 113.152 45.135 -58.713 1.00 132.54 ? 235  DC  J N3    1 
ATOM   4801  C C4    . DC  B 1 89  ? 114.326 45.748 -58.863 1.00 133.40 ? 235  DC  J C4    1 
ATOM   4802  N N4    . DC  B 1 89  ? 115.431 45.038 -58.627 1.00 133.94 ? 235  DC  J N4    1 
ATOM   4803  C C5    . DC  B 1 89  ? 114.418 47.116 -59.256 1.00 132.61 ? 235  DC  J C5    1 
ATOM   4804  C C6    . DC  B 1 89  ? 113.272 47.769 -59.466 1.00 131.44 ? 235  DC  J C6    1 
ATOM   4805  P P     . DT  B 1 90  ? 107.980 50.642 -58.195 1.00 89.57  ? 236  DT  J P     1 
ATOM   4806  O OP1   . DT  B 1 90  ? 107.215 51.749 -58.821 1.00 122.53 ? 236  DT  J OP1   1 
ATOM   4807  O OP2   . DT  B 1 90  ? 109.131 50.938 -57.307 1.00 122.20 ? 236  DT  J OP2   1 
ATOM   4808  O "O5'" . DT  B 1 90  ? 106.974 49.734 -57.373 1.00 86.99  ? 236  DT  J "O5'" 1 
ATOM   4809  C "C5'" . DT  B 1 90  ? 106.297 48.655 -58.000 1.00 80.33  ? 236  DT  J "C5'" 1 
ATOM   4810  C "C4'" . DT  B 1 90  ? 106.343 47.431 -57.118 1.00 75.58  ? 236  DT  J "C4'" 1 
ATOM   4811  O "O4'" . DT  B 1 90  ? 107.702 46.928 -57.080 1.00 75.14  ? 236  DT  J "O4'" 1 
ATOM   4812  C "C3'" . DT  B 1 90  ? 105.924 47.666 -55.661 1.00 72.20  ? 236  DT  J "C3'" 1 
ATOM   4813  O "O3'" . DT  B 1 90  ? 105.096 46.597 -55.197 1.00 67.89  ? 236  DT  J "O3'" 1 
ATOM   4814  C "C2'" . DT  B 1 90  ? 107.240 47.644 -54.905 1.00 72.73  ? 236  DT  J "C2'" 1 
ATOM   4815  C "C1'" . DT  B 1 90  ? 108.059 46.667 -55.731 1.00 74.54  ? 236  DT  J "C1'" 1 
ATOM   4816  N N1    . DT  B 1 90  ? 109.524 46.830 -55.595 1.00 107.91 ? 236  DT  J N1    1 
ATOM   4817  C C2    . DT  B 1 90  ? 110.292 45.717 -55.279 1.00 107.99 ? 236  DT  J C2    1 
ATOM   4818  O O2    . DT  B 1 90  ? 109.827 44.600 -55.121 1.00 107.02 ? 236  DT  J O2    1 
ATOM   4819  N N3    . DT  B 1 90  ? 111.636 45.970 -55.151 1.00 108.95 ? 236  DT  J N3    1 
ATOM   4820  C C4    . DT  B 1 90  ? 112.277 47.186 -55.301 1.00 110.57 ? 236  DT  J C4    1 
ATOM   4821  O O4    . DT  B 1 90  ? 113.494 47.255 -55.153 1.00 111.29 ? 236  DT  J O4    1 
ATOM   4822  C C5    . DT  B 1 90  ? 111.413 48.305 -55.633 1.00 109.41 ? 236  DT  J C5    1 
ATOM   4823  C C7    . DT  B 1 90  ? 112.014 49.663 -55.802 1.00 109.50 ? 236  DT  J C7    1 
ATOM   4824  C C6    . DT  B 1 90  ? 110.102 48.072 -55.769 1.00 108.57 ? 236  DT  J C6    1 
ATOM   4825  P P     . DT  B 1 91  ? 104.294 46.750 -53.812 1.00 64.50  ? 237  DT  J P     1 
ATOM   4826  O OP1   . DT  B 1 91  ? 102.857 46.867 -54.146 1.00 82.07  ? 237  DT  J OP1   1 
ATOM   4827  O OP2   . DT  B 1 91  ? 104.944 47.797 -52.991 1.00 82.35  ? 237  DT  J OP2   1 
ATOM   4828  O "O5'" . DT  B 1 91  ? 104.545 45.356 -53.096 1.00 63.26  ? 237  DT  J "O5'" 1 
ATOM   4829  C "C5'" . DT  B 1 91  ? 104.490 44.159 -53.843 1.00 59.62  ? 237  DT  J "C5'" 1 
ATOM   4830  C "C4'" . DT  B 1 91  ? 105.319 43.089 -53.179 1.00 57.75  ? 237  DT  J "C4'" 1 
ATOM   4831  O "O4'" . DT  B 1 91  ? 106.715 43.443 -53.256 1.00 60.05  ? 237  DT  J "O4'" 1 
ATOM   4832  C "C3'" . DT  B 1 91  ? 105.024 42.836 -51.700 1.00 54.97  ? 237  DT  J "C3'" 1 
ATOM   4833  O "O3'" . DT  B 1 91  ? 104.972 41.435 -51.456 1.00 47.65  ? 237  DT  J "O3'" 1 
ATOM   4834  C "C2'" . DT  B 1 91  ? 106.228 43.417 -50.985 1.00 57.68  ? 237  DT  J "C2'" 1 
ATOM   4835  C "C1'" . DT  B 1 91  ? 107.322 43.179 -52.005 1.00 61.54  ? 237  DT  J "C1'" 1 
ATOM   4836  N N1    . DT  B 1 91  ? 108.515 44.037 -51.881 1.00 79.29  ? 237  DT  J N1    1 
ATOM   4837  C C2    . DT  B 1 91  ? 109.716 43.443 -51.535 1.00 80.78  ? 237  DT  J C2    1 
ATOM   4838  O O2    . DT  B 1 91  ? 109.851 42.246 -51.339 1.00 80.48  ? 237  DT  J O2    1 
ATOM   4839  N N3    . DT  B 1 91  ? 110.761 44.309 -51.421 1.00 82.15  ? 237  DT  J N3    1 
ATOM   4840  C C4    . DT  B 1 91  ? 110.738 45.672 -51.606 1.00 83.43  ? 237  DT  J C4    1 
ATOM   4841  O O4    . DT  B 1 91  ? 111.765 46.324 -51.458 1.00 83.15  ? 237  DT  J O4    1 
ATOM   4842  C C5    . DT  B 1 91  ? 109.459 46.225 -51.970 1.00 83.73  ? 237  DT  J C5    1 
ATOM   4843  C C7    . DT  B 1 91  ? 109.347 47.700 -52.186 1.00 84.74  ? 237  DT  J C7    1 
ATOM   4844  C C6    . DT  B 1 91  ? 108.423 45.390 -52.094 1.00 81.84  ? 237  DT  J C6    1 
ATOM   4845  P P     . DT  B 1 92  ? 104.691 40.927 -49.991 1.00 54.03  ? 238  DT  J P     1 
ATOM   4846  O OP1   . DT  B 1 92  ? 103.867 39.695 -50.040 1.00 60.89  ? 238  DT  J OP1   1 
ATOM   4847  O OP2   . DT  B 1 92  ? 104.228 42.111 -49.201 1.00 56.01  ? 238  DT  J OP2   1 
ATOM   4848  O "O5'" . DT  B 1 92  ? 106.139 40.516 -49.518 1.00 60.94  ? 238  DT  J "O5'" 1 
ATOM   4849  C "C5'" . DT  B 1 92  ? 106.848 39.543 -50.245 1.00 64.69  ? 238  DT  J "C5'" 1 
ATOM   4850  C "C4'" . DT  B 1 92  ? 108.205 39.317 -49.627 1.00 71.71  ? 238  DT  J "C4'" 1 
ATOM   4851  O "O4'" . DT  B 1 92  ? 109.012 40.506 -49.771 1.00 72.91  ? 238  DT  J "O4'" 1 
ATOM   4852  C "C3'" . DT  B 1 92  ? 108.215 38.974 -48.140 1.00 73.26  ? 238  DT  J "C3'" 1 
ATOM   4853  O "O3'" . DT  B 1 92  ? 109.118 37.900 -47.934 1.00 77.30  ? 238  DT  J "O3'" 1 
ATOM   4854  C "C2'" . DT  B 1 92  ? 108.735 40.235 -47.474 1.00 75.77  ? 238  DT  J "C2'" 1 
ATOM   4855  C "C1'" . DT  B 1 92  ? 109.634 40.827 -48.538 1.00 75.91  ? 238  DT  J "C1'" 1 
ATOM   4856  N N1    . DT  B 1 92  ? 109.790 42.299 -48.477 1.00 82.79  ? 238  DT  J N1    1 
ATOM   4857  C C2    . DT  B 1 92  ? 111.064 42.825 -48.358 1.00 84.65  ? 238  DT  J C2    1 
ATOM   4858  O O2    . DT  B 1 92  ? 112.068 42.134 -48.260 1.00 83.61  ? 238  DT  J O2    1 
ATOM   4859  N N3    . DT  B 1 92  ? 111.116 44.202 -48.354 1.00 84.48  ? 238  DT  J N3    1 
ATOM   4860  C C4    . DT  B 1 92  ? 110.048 45.084 -48.459 1.00 85.33  ? 238  DT  J C4    1 
ATOM   4861  O O4    . DT  B 1 92  ? 110.245 46.302 -48.480 1.00 84.84  ? 238  DT  J O4    1 
ATOM   4862  C C5    . DT  B 1 92  ? 108.750 44.465 -48.554 1.00 84.45  ? 238  DT  J C5    1 
ATOM   4863  C C7    . DT  B 1 92  ? 107.542 45.342 -48.656 1.00 85.26  ? 238  DT  J C7    1 
ATOM   4864  C C6    . DT  B 1 92  ? 108.684 43.123 -48.556 1.00 84.06  ? 238  DT  J C6    1 
ATOM   4865  P P     . DT  B 1 93  ? 109.067 37.086 -46.560 1.00 84.62  ? 239  DT  J P     1 
ATOM   4866  O OP1   . DT  B 1 93  ? 109.261 35.648 -46.880 1.00 81.13  ? 239  DT  J OP1   1 
ATOM   4867  O OP2   . DT  B 1 93  ? 107.834 37.524 -45.845 1.00 83.71  ? 239  DT  J OP2   1 
ATOM   4868  O "O5'" . DT  B 1 93  ? 110.340 37.640 -45.770 1.00 90.45  ? 239  DT  J "O5'" 1 
ATOM   4869  C "C5'" . DT  B 1 93  ? 111.654 37.559 -46.337 1.00 96.85  ? 239  DT  J "C5'" 1 
ATOM   4870  C "C4'" . DT  B 1 93  ? 112.666 38.235 -45.437 1.00 101.78 ? 239  DT  J "C4'" 1 
ATOM   4871  O "O4'" . DT  B 1 93  ? 112.631 39.670 -45.611 1.00 101.20 ? 239  DT  J "O4'" 1 
ATOM   4872  C "C3'" . DT  B 1 93  ? 112.481 37.982 -43.940 1.00 105.61 ? 239  DT  J "C3'" 1 
ATOM   4873  O "O3'" . DT  B 1 93  ? 113.743 37.780 -43.305 1.00 113.39 ? 239  DT  J "O3'" 1 
ATOM   4874  C "C2'" . DT  B 1 93  ? 111.864 39.274 -43.443 1.00 103.70 ? 239  DT  J "C2'" 1 
ATOM   4875  C "C1'" . DT  B 1 93  ? 112.513 40.299 -44.350 1.00 101.66 ? 239  DT  J "C1'" 1 
ATOM   4876  N N1    . DT  B 1 93  ? 111.737 41.533 -44.539 1.00 99.07  ? 239  DT  J N1    1 
ATOM   4877  C C2    . DT  B 1 93  ? 112.421 42.719 -44.529 1.00 99.40  ? 239  DT  J C2    1 
ATOM   4878  O O2    . DT  B 1 93  ? 113.619 42.788 -44.327 1.00 100.43 ? 239  DT  J O2    1 
ATOM   4879  N N3    . DT  B 1 93  ? 111.650 43.829 -44.759 1.00 98.65  ? 239  DT  J N3    1 
ATOM   4880  C C4    . DT  B 1 93  ? 110.288 43.866 -44.980 1.00 98.40  ? 239  DT  J C4    1 
ATOM   4881  O O4    . DT  B 1 93  ? 109.733 44.936 -45.204 1.00 97.59  ? 239  DT  J O4    1 
ATOM   4882  C C5    . DT  B 1 93  ? 109.624 42.586 -44.937 1.00 98.68  ? 239  DT  J C5    1 
ATOM   4883  C C7    . DT  B 1 93  ? 108.139 42.535 -45.118 1.00 98.37  ? 239  DT  J C7    1 
ATOM   4884  C C6    . DT  B 1 93  ? 110.374 41.495 -44.729 1.00 99.02  ? 239  DT  J C6    1 
ATOM   4885  P P     . DG  B 1 94  ? 113.840 36.831 -42.012 1.00 142.73 ? 240  DG  J P     1 
ATOM   4886  O OP1   . DG  B 1 94  ? 114.620 35.625 -42.397 1.00 118.02 ? 240  DG  J OP1   1 
ATOM   4887  O OP2   . DG  B 1 94  ? 112.494 36.675 -41.407 1.00 117.83 ? 240  DG  J OP2   1 
ATOM   4888  O "O5'" . DG  B 1 94  ? 114.716 37.688 -41.005 1.00 145.20 ? 240  DG  J "O5'" 1 
ATOM   4889  C "C5'" . DG  B 1 94  ? 115.949 38.244 -41.428 1.00 149.14 ? 240  DG  J "C5'" 1 
ATOM   4890  C "C4'" . DG  B 1 94  ? 116.239 39.505 -40.654 1.00 151.46 ? 240  DG  J "C4'" 1 
ATOM   4891  O "O4'" . DG  B 1 94  ? 115.345 40.563 -41.081 1.00 151.45 ? 240  DG  J "O4'" 1 
ATOM   4892  C "C3'" . DG  B 1 94  ? 116.062 39.378 -39.141 1.00 152.97 ? 240  DG  J "C3'" 1 
ATOM   4893  O "O3'" . DG  B 1 94  ? 117.168 40.009 -38.486 1.00 155.22 ? 240  DG  J "O3'" 1 
ATOM   4894  C "C2'" . DG  B 1 94  ? 114.745 40.092 -38.877 1.00 152.12 ? 240  DG  J "C2'" 1 
ATOM   4895  C "C1'" . DG  B 1 94  ? 114.750 41.170 -39.945 1.00 151.80 ? 240  DG  J "C1'" 1 
ATOM   4896  N N9    . DG  B 1 94  ? 113.431 41.677 -40.328 1.00 127.14 ? 240  DG  J N9    1 
ATOM   4897  C C8    . DG  B 1 94  ? 112.267 40.956 -40.442 1.00 126.91 ? 240  DG  J C8    1 
ATOM   4898  N N7    . DG  B 1 94  ? 111.240 41.690 -40.784 1.00 126.74 ? 240  DG  J N7    1 
ATOM   4899  C C5    . DG  B 1 94  ? 111.754 42.974 -40.906 1.00 126.80 ? 240  DG  J C5    1 
ATOM   4900  C C6    . DG  B 1 94  ? 111.111 44.201 -41.250 1.00 126.90 ? 240  DG  J C6    1 
ATOM   4901  O O6    . DG  B 1 94  ? 109.923 44.399 -41.527 1.00 127.06 ? 240  DG  J O6    1 
ATOM   4902  N N1    . DG  B 1 94  ? 112.005 45.265 -41.254 1.00 126.92 ? 240  DG  J N1    1 
ATOM   4903  C C2    . DG  B 1 94  ? 113.344 45.172 -40.970 1.00 126.73 ? 240  DG  J C2    1 
ATOM   4904  N N2    . DG  B 1 94  ? 114.043 46.318 -41.031 1.00 126.20 ? 240  DG  J N2    1 
ATOM   4905  N N3    . DG  B 1 94  ? 113.957 44.039 -40.650 1.00 126.68 ? 240  DG  J N3    1 
ATOM   4906  C C4    . DG  B 1 94  ? 113.107 42.988 -40.635 1.00 126.88 ? 240  DG  J C4    1 
ATOM   4907  P P     . DA  B 1 95  ? 116.976 40.666 -37.035 1.00 136.47 ? 241  DA  J P     1 
ATOM   4908  O OP1   . DA  B 1 95  ? 118.295 40.647 -36.368 1.00 107.44 ? 241  DA  J OP1   1 
ATOM   4909  O OP2   . DA  B 1 95  ? 115.807 40.055 -36.356 1.00 107.04 ? 241  DA  J OP2   1 
ATOM   4910  O "O5'" . DA  B 1 95  ? 116.642 42.180 -37.373 1.00 137.02 ? 241  DA  J "O5'" 1 
ATOM   4911  C "C5'" . DA  B 1 95  ? 117.587 42.985 -38.065 1.00 137.92 ? 241  DA  J "C5'" 1 
ATOM   4912  C "C4'" . DA  B 1 95  ? 117.506 44.400 -37.556 1.00 138.92 ? 241  DA  J "C4'" 1 
ATOM   4913  O "O4'" . DA  B 1 95  ? 116.243 44.968 -37.976 1.00 139.21 ? 241  DA  J "O4'" 1 
ATOM   4914  C "C3'" . DA  B 1 95  ? 117.507 44.468 -36.030 1.00 139.07 ? 241  DA  J "C3'" 1 
ATOM   4915  O "O3'" . DA  B 1 95  ? 118.165 45.659 -35.595 1.00 138.51 ? 241  DA  J "O3'" 1 
ATOM   4916  C "C2'" . DA  B 1 95  ? 116.030 44.515 -35.687 1.00 139.47 ? 241  DA  J "C2'" 1 
ATOM   4917  C "C1'" . DA  B 1 95  ? 115.475 45.330 -36.838 1.00 139.59 ? 241  DA  J "C1'" 1 
ATOM   4918  N N9    . DA  B 1 95  ? 114.069 45.074 -37.140 1.00 110.25 ? 241  DA  J N9    1 
ATOM   4919  C C8    . DA  B 1 95  ? 113.413 43.868 -37.182 1.00 110.27 ? 241  DA  J C8    1 
ATOM   4920  N N7    . DA  B 1 95  ? 112.142 43.970 -37.484 1.00 110.03 ? 241  DA  J N7    1 
ATOM   4921  C C5    . DA  B 1 95  ? 111.946 45.336 -37.652 1.00 109.90 ? 241  DA  J C5    1 
ATOM   4922  C C6    . DA  B 1 95  ? 110.812 46.098 -37.981 1.00 109.57 ? 241  DA  J C6    1 
ATOM   4923  N N6    . DA  B 1 95  ? 109.604 45.576 -38.206 1.00 108.91 ? 241  DA  J N6    1 
ATOM   4924  N N1    . DA  B 1 95  ? 110.962 47.437 -38.069 1.00 109.46 ? 241  DA  J N1    1 
ATOM   4925  C C2    . DA  B 1 95  ? 112.171 47.964 -37.840 1.00 109.74 ? 241  DA  J C2    1 
ATOM   4926  N N3    . DA  B 1 95  ? 113.307 47.357 -37.522 1.00 109.94 ? 241  DA  J N3    1 
ATOM   4927  C C4    . DA  B 1 95  ? 113.125 46.026 -37.444 1.00 110.13 ? 241  DA  J C4    1 
ATOM   4928  P P     . DT  B 1 96  ? 118.275 45.981 -34.028 1.00 136.22 ? 242  DT  J P     1 
ATOM   4929  O OP1   . DT  B 1 96  ? 119.666 46.426 -33.815 1.00 105.60 ? 242  DT  J OP1   1 
ATOM   4930  O OP2   . DT  B 1 96  ? 117.742 44.824 -33.257 1.00 105.32 ? 242  DT  J OP2   1 
ATOM   4931  O "O5'" . DT  B 1 96  ? 117.327 47.248 -33.835 1.00 135.10 ? 242  DT  J "O5'" 1 
ATOM   4932  C "C5'" . DT  B 1 96  ? 117.564 48.441 -34.578 1.00 133.35 ? 242  DT  J "C5'" 1 
ATOM   4933  C "C4'" . DT  B 1 96  ? 116.558 49.507 -34.206 1.00 132.09 ? 242  DT  J "C4'" 1 
ATOM   4934  O "O4'" . DT  B 1 96  ? 115.241 49.168 -34.698 1.00 132.19 ? 242  DT  J "O4'" 1 
ATOM   4935  C "C3'" . DT  B 1 96  ? 116.383 49.761 -32.707 1.00 131.00 ? 242  DT  J "C3'" 1 
ATOM   4936  O "O3'" . DT  B 1 96  ? 116.178 51.155 -32.491 1.00 128.63 ? 242  DT  J "O3'" 1 
ATOM   4937  C "C2'" . DT  B 1 96  ? 115.084 49.048 -32.385 1.00 131.30 ? 242  DT  J "C2'" 1 
ATOM   4938  C "C1'" . DT  B 1 96  ? 114.310 49.358 -33.643 1.00 131.91 ? 242  DT  J "C1'" 1 
ATOM   4939  N N1    . DT  B 1 96  ? 113.143 48.510 -33.902 1.00 101.27 ? 242  DT  J N1    1 
ATOM   4940  C C2    . DT  B 1 96  ? 111.955 49.142 -34.153 1.00 101.16 ? 242  DT  J C2    1 
ATOM   4941  O O2    . DT  B 1 96  ? 111.840 50.358 -34.148 1.00 100.49 ? 242  DT  J O2    1 
ATOM   4942  N N3    . DT  B 1 96  ? 110.904 48.299 -34.411 1.00 101.54 ? 242  DT  J N3    1 
ATOM   4943  C C4    . DT  B 1 96  ? 110.930 46.914 -34.432 1.00 101.88 ? 242  DT  J C4    1 
ATOM   4944  O O4    . DT  B 1 96  ? 109.911 46.287 -34.693 1.00 102.29 ? 242  DT  J O4    1 
ATOM   4945  C C5    . DT  B 1 96  ? 112.212 46.317 -34.139 1.00 101.91 ? 242  DT  J C5    1 
ATOM   4946  C C7    . DT  B 1 96  ? 112.336 44.825 -34.116 1.00 101.52 ? 242  DT  J C7    1 
ATOM   4947  C C6    . DT  B 1 96  ? 113.241 47.136 -33.895 1.00 101.86 ? 242  DT  J C6    1 
ATOM   4948  P P     . DG  B 1 97  ? 116.157 51.725 -30.991 1.00 118.83 ? 243  DG  J P     1 
ATOM   4949  O OP1   . DG  B 1 97  ? 117.582 51.849 -30.588 1.00 127.80 ? 243  DG  J OP1   1 
ATOM   4950  O OP2   . DG  B 1 97  ? 115.229 50.904 -30.165 1.00 127.00 ? 243  DG  J OP2   1 
ATOM   4951  O "O5'" . DG  B 1 97  ? 115.543 53.186 -31.172 1.00 116.61 ? 243  DG  J "O5'" 1 
ATOM   4952  C "C5'" . DG  B 1 97  ? 114.822 53.814 -30.119 1.00 113.03 ? 243  DG  J "C5'" 1 
ATOM   4953  C "C4'" . DG  B 1 97  ? 113.530 54.385 -30.655 1.00 110.29 ? 243  DG  J "C4'" 1 
ATOM   4954  O "O4'" . DG  B 1 97  ? 112.755 53.354 -31.320 1.00 109.95 ? 243  DG  J "O4'" 1 
ATOM   4955  C "C3'" . DG  B 1 97  ? 112.605 54.981 -29.602 1.00 108.12 ? 243  DG  J "C3'" 1 
ATOM   4956  O "O3'" . DG  B 1 97  ? 111.953 56.100 -30.191 1.00 104.78 ? 243  DG  J "O3'" 1 
ATOM   4957  C "C2'" . DG  B 1 97  ? 111.635 53.848 -29.307 1.00 108.54 ? 243  DG  J "C2'" 1 
ATOM   4958  C "C1'" . DG  B 1 97  ? 111.511 53.146 -30.657 1.00 108.69 ? 243  DG  J "C1'" 1 
ATOM   4959  N N9    . DG  B 1 97  ? 111.278 51.703 -30.603 1.00 116.73 ? 243  DG  J N9    1 
ATOM   4960  C C8    . DG  B 1 97  ? 112.147 50.736 -30.137 1.00 116.69 ? 243  DG  J C8    1 
ATOM   4961  N N7    . DG  B 1 97  ? 111.687 49.520 -30.267 1.00 116.09 ? 243  DG  J N7    1 
ATOM   4962  C C5    . DG  B 1 97  ? 110.431 49.686 -30.842 1.00 116.66 ? 243  DG  J C5    1 
ATOM   4963  C C6    . DG  B 1 97  ? 109.465 48.722 -31.236 1.00 116.06 ? 243  DG  J C6    1 
ATOM   4964  O O6    . DG  B 1 97  ? 109.521 47.489 -31.145 1.00 116.13 ? 243  DG  J O6    1 
ATOM   4965  N N1    . DG  B 1 97  ? 108.339 49.328 -31.790 1.00 115.86 ? 243  DG  J N1    1 
ATOM   4966  C C2    . DG  B 1 97  ? 108.164 50.684 -31.941 1.00 115.46 ? 243  DG  J C2    1 
ATOM   4967  N N2    . DG  B 1 97  ? 107.016 51.073 -32.494 1.00 114.37 ? 243  DG  J N2    1 
ATOM   4968  N N3    . DG  B 1 97  ? 109.051 51.592 -31.576 1.00 116.40 ? 243  DG  J N3    1 
ATOM   4969  C C4    . DG  B 1 97  ? 110.159 51.029 -31.041 1.00 116.92 ? 243  DG  J C4    1 
ATOM   4970  P P     . DG  B 1 98  ? 110.960 56.993 -29.312 1.00 109.58 ? 244  DG  J P     1 
ATOM   4971  O OP1   . DG  B 1 98  ? 110.827 58.300 -29.994 1.00 107.93 ? 244  DG  J OP1   1 
ATOM   4972  O OP2   . DG  B 1 98  ? 111.347 56.940 -27.883 1.00 109.13 ? 244  DG  J OP2   1 
ATOM   4973  O "O5'" . DG  B 1 98  ? 109.575 56.237 -29.432 1.00 107.95 ? 244  DG  J "O5'" 1 
ATOM   4974  C "C5'" . DG  B 1 98  ? 108.690 56.518 -30.506 1.00 104.42 ? 244  DG  J "C5'" 1 
ATOM   4975  C "C4'" . DG  B 1 98  ? 107.327 55.951 -30.199 1.00 101.42 ? 244  DG  J "C4'" 1 
ATOM   4976  O "O4'" . DG  B 1 98  ? 107.451 54.515 -30.085 1.00 100.65 ? 244  DG  J "O4'" 1 
ATOM   4977  C "C3'" . DG  B 1 98  ? 106.759 56.417 -28.860 1.00 99.83  ? 244  DG  J "C3'" 1 
ATOM   4978  O "O3'" . DG  B 1 98  ? 105.347 56.390 -28.939 1.00 97.36  ? 244  DG  J "O3'" 1 
ATOM   4979  C "C2'" . DG  B 1 98  ? 107.173 55.310 -27.916 1.00 99.69  ? 244  DG  J "C2'" 1 
ATOM   4980  C "C1'" . DG  B 1 98  ? 106.965 54.119 -28.817 1.00 99.92  ? 244  DG  J "C1'" 1 
ATOM   4981  N N9    . DG  B 1 98  ? 107.648 52.897 -28.428 1.00 98.95  ? 244  DG  J N9    1 
ATOM   4982  C C8    . DG  B 1 98  ? 108.812 52.768 -27.714 1.00 99.06  ? 244  DG  J C8    1 
ATOM   4983  N N7    . DG  B 1 98  ? 109.144 51.526 -27.496 1.00 99.24  ? 244  DG  J N7    1 
ATOM   4984  C C5    . DG  B 1 98  ? 108.140 50.793 -28.114 1.00 98.57  ? 244  DG  J C5    1 
ATOM   4985  C C6    . DG  B 1 98  ? 107.953 49.392 -28.216 1.00 98.13  ? 244  DG  J C6    1 
ATOM   4986  O O6    . DG  B 1 98  ? 108.656 48.487 -27.765 1.00 96.13  ? 244  DG  J O6    1 
ATOM   4987  N N1    . DG  B 1 98  ? 106.805 49.081 -28.937 1.00 98.03  ? 244  DG  J N1    1 
ATOM   4988  C C2    . DG  B 1 98  ? 105.948 49.998 -29.496 1.00 98.31  ? 244  DG  J C2    1 
ATOM   4989  N N2    . DG  B 1 98  ? 104.906 49.499 -30.171 1.00 97.68  ? 244  DG  J N2    1 
ATOM   4990  N N3    . DG  B 1 98  ? 106.106 51.305 -29.403 1.00 97.99  ? 244  DG  J N3    1 
ATOM   4991  C C4    . DG  B 1 98  ? 107.217 51.628 -28.702 1.00 99.07  ? 244  DG  J C4    1 
ATOM   4992  P P     . DA  B 1 99  ? 104.539 57.759 -29.012 1.00 105.46 ? 245  DA  J P     1 
ATOM   4993  O OP1   . DA  B 1 99  ? 105.149 58.589 -30.086 1.00 94.05  ? 245  DA  J OP1   1 
ATOM   4994  O OP2   . DA  B 1 99  ? 104.450 58.276 -27.627 1.00 93.19  ? 245  DA  J OP2   1 
ATOM   4995  O "O5'" . DA  B 1 99  ? 103.088 57.322 -29.485 1.00 103.39 ? 245  DA  J "O5'" 1 
ATOM   4996  C "C5'" . DA  B 1 99  ? 102.902 56.723 -30.762 1.00 100.23 ? 245  DA  J "C5'" 1 
ATOM   4997  C "C4'" . DA  B 1 99  ? 102.012 55.507 -30.646 1.00 98.21  ? 245  DA  J "C4'" 1 
ATOM   4998  O "O4'" . DA  B 1 99  ? 102.698 54.404 -30.003 1.00 97.13  ? 245  DA  J "O4'" 1 
ATOM   4999  C "C3'" . DA  B 1 99  ? 100.746 55.740 -29.831 1.00 95.69  ? 245  DA  J "C3'" 1 
ATOM   5000  O "O3'" . DA  B 1 99  ? 99.695  54.986 -30.408 1.00 94.61  ? 245  DA  J "O3'" 1 
ATOM   5001  C "C2'" . DA  B 1 99  ? 101.096 55.155 -28.479 1.00 95.88  ? 245  DA  J "C2'" 1 
ATOM   5002  C "C1'" . DA  B 1 99  ? 101.930 53.962 -28.891 1.00 96.89  ? 245  DA  J "C1'" 1 
ATOM   5003  N N9    . DA  B 1 99  ? 102.858 53.480 -27.876 1.00 86.01  ? 245  DA  J N9    1 
ATOM   5004  C C8    . DA  B 1 99  ? 103.633 54.221 -27.034 1.00 86.30  ? 245  DA  J C8    1 
ATOM   5005  N N7    . DA  B 1 99  ? 104.419 53.503 -26.275 1.00 87.59  ? 245  DA  J N7    1 
ATOM   5006  C C5    . DA  B 1 99  ? 104.133 52.198 -26.637 1.00 87.46  ? 245  DA  J C5    1 
ATOM   5007  C C6    . DA  B 1 99  ? 104.644 50.970 -26.208 1.00 87.97  ? 245  DA  J C6    1 
ATOM   5008  N N6    . DA  B 1 99  ? 105.611 50.851 -25.293 1.00 90.64  ? 245  DA  J N6    1 
ATOM   5009  N N1    . DA  B 1 99  ? 104.129 49.849 -26.759 1.00 87.57  ? 245  DA  J N1    1 
ATOM   5010  C C2    . DA  B 1 99  ? 103.171 49.973 -27.681 1.00 86.19  ? 245  DA  J C2    1 
ATOM   5011  N N3    . DA  B 1 99  ? 102.620 51.073 -28.173 1.00 86.04  ? 245  DA  J N3    1 
ATOM   5012  C C4    . DA  B 1 99  ? 103.154 52.167 -27.603 1.00 87.11  ? 245  DA  J C4    1 
ATOM   5013  P P     . DG  B 1 100 ? 98.326  55.712 -30.780 1.00 78.92  ? 246  DG  J P     1 
ATOM   5014  O OP1   . DG  B 1 100 ? 98.382  56.248 -32.162 1.00 95.71  ? 246  DG  J OP1   1 
ATOM   5015  O OP2   . DG  B 1 100 ? 97.994  56.614 -29.645 1.00 94.39  ? 246  DG  J OP2   1 
ATOM   5016  O "O5'" . DG  B 1 100 ? 97.279  54.526 -30.764 1.00 76.97  ? 246  DG  J "O5'" 1 
ATOM   5017  C "C5'" . DG  B 1 100 ? 96.692  54.122 -29.545 1.00 73.38  ? 246  DG  J "C5'" 1 
ATOM   5018  C "C4'" . DG  B 1 100 ? 97.040  52.685 -29.247 1.00 69.08  ? 246  DG  J "C4'" 1 
ATOM   5019  O "O4'" . DG  B 1 100 ? 98.355  52.605 -28.628 1.00 70.27  ? 246  DG  J "O4'" 1 
ATOM   5020  C "C3'" . DG  B 1 100 ? 96.064  52.142 -28.215 1.00 66.24  ? 246  DG  J "C3'" 1 
ATOM   5021  O "O3'" . DG  B 1 100 ? 95.747  50.775 -28.450 1.00 62.21  ? 246  DG  J "O3'" 1 
ATOM   5022  C "C2'" . DG  B 1 100 ? 96.817  52.330 -26.929 1.00 68.49  ? 246  DG  J "C2'" 1 
ATOM   5023  C "C1'" . DG  B 1 100 ? 98.221  51.994 -27.351 1.00 69.63  ? 246  DG  J "C1'" 1 
ATOM   5024  N N9    . DG  B 1 100 ? 99.229  52.542 -26.447 1.00 84.93  ? 246  DG  J N9    1 
ATOM   5025  C C8    . DG  B 1 100 ? 99.452  53.870 -26.181 1.00 84.93  ? 246  DG  J C8    1 
ATOM   5026  N N7    . DG  B 1 100 ? 100.421 54.073 -25.334 1.00 85.10  ? 246  DG  J N7    1 
ATOM   5027  C C5    . DG  B 1 100 ? 100.873 52.801 -25.019 1.00 86.04  ? 246  DG  J C5    1 
ATOM   5028  C C6    . DG  B 1 100 ? 101.925 52.394 -24.160 1.00 86.28  ? 246  DG  J C6    1 
ATOM   5029  O O6    . DG  B 1 100 ? 102.706 53.105 -23.501 1.00 89.09  ? 246  DG  J O6    1 
ATOM   5030  N N1    . DG  B 1 100 ? 102.034 51.004 -24.113 1.00 85.72  ? 246  DG  J N1    1 
ATOM   5031  C C2    . DG  B 1 100 ? 101.239 50.125 -24.808 1.00 85.49  ? 246  DG  J C2    1 
ATOM   5032  N N2    . DG  B 1 100 ? 101.496 48.825 -24.620 1.00 83.14  ? 246  DG  J N2    1 
ATOM   5033  N N3    . DG  B 1 100 ? 100.262 50.496 -25.624 1.00 83.31  ? 246  DG  J N3    1 
ATOM   5034  C C4    . DG  B 1 100 ? 100.138 51.842 -25.684 1.00 85.14  ? 246  DG  J C4    1 
ATOM   5035  P P     . DC  B 1 101 ? 94.215  50.322 -28.443 1.00 62.46  ? 247  DC  J P     1 
ATOM   5036  O OP1   . DC  B 1 101 ? 93.551  51.012 -29.560 1.00 66.14  ? 247  DC  J OP1   1 
ATOM   5037  O OP2   . DC  B 1 101 ? 93.660  50.430 -27.080 1.00 65.80  ? 247  DC  J OP2   1 
ATOM   5038  O "O5'" . DC  B 1 101 ? 94.270  48.789 -28.805 1.00 66.80  ? 247  DC  J "O5'" 1 
ATOM   5039  C "C5'" . DC  B 1 101 ? 95.505  48.163 -29.093 1.00 68.68  ? 247  DC  J "C5'" 1 
ATOM   5040  C "C4'" . DC  B 1 101 ? 95.876  47.211 -27.978 1.00 72.42  ? 247  DC  J "C4'" 1 
ATOM   5041  O "O4'" . DC  B 1 101 ? 96.796  47.805 -27.039 1.00 72.70  ? 247  DC  J "O4'" 1 
ATOM   5042  C "C3'" . DC  B 1 101 ? 94.716  46.667 -27.144 1.00 73.48  ? 247  DC  J "C3'" 1 
ATOM   5043  O "O3'" . DC  B 1 101 ? 94.967  45.281 -26.938 1.00 73.31  ? 247  DC  J "O3'" 1 
ATOM   5044  C "C2'" . DC  B 1 101 ? 94.828  47.451 -25.846 1.00 72.73  ? 247  DC  J "C2'" 1 
ATOM   5045  C "C1'" . DC  B 1 101 ? 96.329  47.597 -25.715 1.00 72.91  ? 247  DC  J "C1'" 1 
ATOM   5046  N N1    . DC  B 1 101 ? 96.812  48.719 -24.893 1.00 77.51  ? 247  DC  J N1    1 
ATOM   5047  C C2    . DC  B 1 101 ? 97.645  48.460 -23.805 1.00 78.04  ? 247  DC  J C2    1 
ATOM   5048  O O2    . DC  B 1 101 ? 97.890  47.290 -23.506 1.00 76.59  ? 247  DC  J O2    1 
ATOM   5049  N N3    . DC  B 1 101 ? 98.159  49.495 -23.105 1.00 78.59  ? 247  DC  J N3    1 
ATOM   5050  C C4    . DC  B 1 101 ? 97.862  50.745 -23.452 1.00 80.06  ? 247  DC  J C4    1 
ATOM   5051  N N4    . DC  B 1 101 ? 98.428  51.746 -22.776 1.00 82.21  ? 247  DC  J N4    1 
ATOM   5052  C C5    . DC  B 1 101 ? 96.984  51.031 -24.515 1.00 79.01  ? 247  DC  J C5    1 
ATOM   5053  C C6    . DC  B 1 101 ? 96.481  50.000 -25.205 1.00 78.98  ? 247  DC  J C6    1 
ATOM   5054  P P     . DA  B 1 102 ? 93.910  44.378 -26.145 1.00 71.72  ? 248  DA  J P     1 
ATOM   5055  O OP1   . DA  B 1 102 ? 93.541  43.271 -27.053 1.00 80.04  ? 248  DA  J OP1   1 
ATOM   5056  O OP2   . DA  B 1 102 ? 92.842  45.211 -25.506 1.00 78.40  ? 248  DA  J OP2   1 
ATOM   5057  O "O5'" . DA  B 1 102 ? 94.806  43.734 -25.011 1.00 73.72  ? 248  DA  J "O5'" 1 
ATOM   5058  C "C5'" . DA  B 1 102 ? 94.258  43.484 -23.744 1.00 78.53  ? 248  DA  J "C5'" 1 
ATOM   5059  C "C4'" . DA  B 1 102 ? 95.320  43.620 -22.682 1.00 81.07  ? 248  DA  J "C4'" 1 
ATOM   5060  O "O4'" . DA  B 1 102 ? 95.871  44.959 -22.688 1.00 81.00  ? 248  DA  J "O4'" 1 
ATOM   5061  C "C3'" . DA  B 1 102 ? 94.718  43.419 -21.302 1.00 83.03  ? 248  DA  J "C3'" 1 
ATOM   5062  O "O3'" . DA  B 1 102 ? 95.556  42.613 -20.507 1.00 87.14  ? 248  DA  J "O3'" 1 
ATOM   5063  C "C2'" . DA  B 1 102 ? 94.573  44.820 -20.748 1.00 81.91  ? 248  DA  J "C2'" 1 
ATOM   5064  C "C1'" . DA  B 1 102 ? 95.706  45.562 -21.414 1.00 82.16  ? 248  DA  J "C1'" 1 
ATOM   5065  N N9    . DA  B 1 102 ? 95.393  46.978 -21.614 1.00 88.09  ? 248  DA  J N9    1 
ATOM   5066  C C8    . DA  B 1 102 ? 94.475  47.525 -22.472 1.00 87.36  ? 248  DA  J C8    1 
ATOM   5067  N N7    . DA  B 1 102 ? 94.378  48.830 -22.382 1.00 87.10  ? 248  DA  J N7    1 
ATOM   5068  C C5    . DA  B 1 102 ? 95.301  49.163 -21.404 1.00 87.97  ? 248  DA  J C5    1 
ATOM   5069  C C6    . DA  B 1 102 ? 95.665  50.385 -20.835 1.00 88.26  ? 248  DA  J C6    1 
ATOM   5070  N N6    . DA  B 1 102 ? 95.100  51.544 -21.168 1.00 86.32  ? 248  DA  J N6    1 
ATOM   5071  N N1    . DA  B 1 102 ? 96.634  50.378 -19.895 1.00 88.43  ? 248  DA  J N1    1 
ATOM   5072  C C2    . DA  B 1 102 ? 97.184  49.214 -19.553 1.00 88.55  ? 248  DA  J C2    1 
ATOM   5073  N N3    . DA  B 1 102 ? 96.916  47.996 -20.003 1.00 88.77  ? 248  DA  J N3    1 
ATOM   5074  C C4    . DA  B 1 102 ? 95.952  48.037 -20.937 1.00 88.42  ? 248  DA  J C4    1 
ATOM   5075  P P     . DG  B 1 103 ? 94.900  41.736 -19.348 1.00 95.95  ? 249  DG  J P     1 
ATOM   5076  O OP1   . DG  B 1 103 ? 95.323  40.328 -19.553 1.00 93.62  ? 249  DG  J OP1   1 
ATOM   5077  O OP2   . DG  B 1 103 ? 93.452  42.061 -19.240 1.00 91.89  ? 249  DG  J OP2   1 
ATOM   5078  O "O5'" . DG  B 1 103 ? 95.630  42.305 -18.066 1.00 97.44  ? 249  DG  J "O5'" 1 
ATOM   5079  C "C5'" . DG  B 1 103 ? 97.044  42.304 -17.992 1.00 99.71  ? 249  DG  J "C5'" 1 
ATOM   5080  C "C4'" . DG  B 1 103 ? 97.462  43.020 -16.738 1.00 100.71 ? 249  DG  J "C4'" 1 
ATOM   5081  O "O4'" . DG  B 1 103 ? 97.241  44.438 -16.919 1.00 101.07 ? 249  DG  J "O4'" 1 
ATOM   5082  C "C3'" . DG  B 1 103 ? 96.584  42.601 -15.568 1.00 102.44 ? 249  DG  J "C3'" 1 
ATOM   5083  O "O3'" . DG  B 1 103 ? 97.357  42.520 -14.382 1.00 105.72 ? 249  DG  J "O3'" 1 
ATOM   5084  C "C2'" . DG  B 1 103 ? 95.532  43.695 -15.497 1.00 100.97 ? 249  DG  J "C2'" 1 
ATOM   5085  C "C1'" . DG  B 1 103 ? 96.280  44.918 -15.993 1.00 101.33 ? 249  DG  J "C1'" 1 
ATOM   5086  N N9    . DG  B 1 103 ? 95.448  45.886 -16.698 1.00 97.62  ? 249  DG  J N9    1 
ATOM   5087  C C8    . DG  B 1 103 ? 94.471  45.610 -17.616 1.00 97.71  ? 249  DG  J C8    1 
ATOM   5088  N N7    . DG  B 1 103 ? 93.918  46.680 -18.116 1.00 97.81  ? 249  DG  J N7    1 
ATOM   5089  C C5    . DG  B 1 103 ? 94.563  47.727 -17.480 1.00 97.59  ? 249  DG  J C5    1 
ATOM   5090  C C6    . DG  B 1 103 ? 94.391  49.129 -17.615 1.00 97.49  ? 249  DG  J C6    1 
ATOM   5091  O O6    . DG  B 1 103 ? 93.618  49.743 -18.360 1.00 97.47  ? 249  DG  J O6    1 
ATOM   5092  N N1    . DG  B 1 103 ? 95.241  49.832 -16.772 1.00 97.84  ? 249  DG  J N1    1 
ATOM   5093  C C2    . DG  B 1 103 ? 96.147  49.264 -15.916 1.00 97.56  ? 249  DG  J C2    1 
ATOM   5094  N N2    . DG  B 1 103 ? 96.872  50.118 -15.179 1.00 96.96  ? 249  DG  J N2    1 
ATOM   5095  N N3    . DG  B 1 103 ? 96.329  47.957 -15.789 1.00 96.85  ? 249  DG  J N3    1 
ATOM   5096  C C4    . DG  B 1 103 ? 95.507  47.255 -16.594 1.00 97.63  ? 249  DG  J C4    1 
ATOM   5097  P P     . DT  B 1 104 ? 96.628  42.223 -12.990 1.00 88.69  ? 250  DT  J P     1 
ATOM   5098  O OP1   . DT  B 1 104 ? 97.676  41.597 -12.147 1.00 83.58  ? 250  DT  J OP1   1 
ATOM   5099  O OP2   . DT  B 1 104 ? 95.338  41.499 -13.234 1.00 84.48  ? 250  DT  J OP2   1 
ATOM   5100  O "O5'" . DT  B 1 104 ? 96.308  43.682 -12.436 1.00 90.92  ? 250  DT  J "O5'" 1 
ATOM   5101  C "C5'" . DT  B 1 104 ? 97.353  44.646 -12.328 1.00 94.19  ? 250  DT  J "C5'" 1 
ATOM   5102  C "C4'" . DT  B 1 104 ? 96.937  45.781 -11.424 1.00 96.97  ? 250  DT  J "C4'" 1 
ATOM   5103  O "O4'" . DT  B 1 104 ? 96.324  46.845 -12.180 1.00 96.84  ? 250  DT  J "O4'" 1 
ATOM   5104  C "C3'" . DT  B 1 104 ? 95.953  45.417 -10.314 1.00 98.86  ? 250  DT  J "C3'" 1 
ATOM   5105  O "O3'" . DT  B 1 104 ? 96.357  46.081 -9.107  1.00 103.35 ? 250  DT  J "O3'" 1 
ATOM   5106  C "C2'" . DT  B 1 104 ? 94.635  45.967 -10.833 1.00 97.95  ? 250  DT  J "C2'" 1 
ATOM   5107  C "C1'" . DT  B 1 104 ? 95.099  47.204 -11.577 1.00 96.90  ? 250  DT  J "C1'" 1 
ATOM   5108  N N1    . DT  B 1 104 ? 94.212  47.676 -12.642 1.00 91.34  ? 250  DT  J N1    1 
ATOM   5109  C C2    . DT  B 1 104 ? 94.056  49.034 -12.789 1.00 91.26  ? 250  DT  J C2    1 
ATOM   5110  O O2    . DT  B 1 104 ? 94.591  49.843 -12.059 1.00 91.50  ? 250  DT  J O2    1 
ATOM   5111  N N3    . DT  B 1 104 ? 93.241  49.411 -13.824 1.00 90.81  ? 250  DT  J N3    1 
ATOM   5112  C C4    . DT  B 1 104 ? 92.571  48.583 -14.694 1.00 90.50  ? 250  DT  J C4    1 
ATOM   5113  O O4    . DT  B 1 104 ? 91.885  49.066 -15.582 1.00 90.49  ? 250  DT  J O4    1 
ATOM   5114  C C5    . DT  B 1 104 ? 92.757  47.164 -14.466 1.00 90.47  ? 250  DT  J C5    1 
ATOM   5115  C C7    . DT  B 1 104 ? 92.032  46.185 -15.333 1.00 90.66  ? 250  DT  J C7    1 
ATOM   5116  C C6    . DT  B 1 104 ? 93.568  46.787 -13.471 1.00 90.64  ? 250  DT  J C6    1 
ATOM   5117  P P     . DT  B 1 105 ? 95.484  45.925 -7.767  1.00 126.34 ? 251  DT  J P     1 
ATOM   5118  O OP1   . DT  B 1 105 ? 96.431  45.728 -6.643  1.00 101.67 ? 251  DT  J OP1   1 
ATOM   5119  O OP2   . DT  B 1 105 ? 94.406  44.924 -8.007  1.00 101.45 ? 251  DT  J OP2   1 
ATOM   5120  O "O5'" . DT  B 1 105 ? 94.830  47.366 -7.609  1.00 127.39 ? 251  DT  J "O5'" 1 
ATOM   5121  C "C5'" . DT  B 1 105 ? 95.656  48.526 -7.587  1.00 128.43 ? 251  DT  J "C5'" 1 
ATOM   5122  C "C4'" . DT  B 1 105 ? 94.816  49.757 -7.355  1.00 129.11 ? 251  DT  J "C4'" 1 
ATOM   5123  O "O4'" . DT  B 1 105 ? 94.155  50.158 -8.580  1.00 129.05 ? 251  DT  J "O4'" 1 
ATOM   5124  C "C3'" . DT  B 1 105 ? 93.711  49.570 -6.315  1.00 129.51 ? 251  DT  J "C3'" 1 
ATOM   5125  O "O3'" . DT  B 1 105 ? 93.607  50.752 -5.517  1.00 129.45 ? 251  DT  J "O3'" 1 
ATOM   5126  C "C2'" . DT  B 1 105 ? 92.466  49.382 -7.165  1.00 129.27 ? 251  DT  J "C2'" 1 
ATOM   5127  C "C1'" . DT  B 1 105 ? 92.767  50.301 -8.331  1.00 129.27 ? 251  DT  J "C1'" 1 
ATOM   5128  N N1    . DT  B 1 105 ? 92.040  50.014 -9.581  1.00 103.40 ? 251  DT  J N1    1 
ATOM   5129  C C2    . DT  B 1 105 ? 91.452  51.081 -10.215 1.00 103.03 ? 251  DT  J C2    1 
ATOM   5130  O O2    . DT  B 1 105 ? 91.504  52.216 -9.777  1.00 102.88 ? 251  DT  J O2    1 
ATOM   5131  N N3    . DT  B 1 105 ? 90.792  50.768 -11.380 1.00 102.72 ? 251  DT  J N3    1 
ATOM   5132  C C4    . DT  B 1 105 ? 90.641  49.516 -11.940 1.00 102.74 ? 251  DT  J C4    1 
ATOM   5133  O O4    . DT  B 1 105 ? 90.030  49.384 -12.990 1.00 102.17 ? 251  DT  J O4    1 
ATOM   5134  C C5    . DT  B 1 105 ? 91.258  48.437 -11.208 1.00 102.93 ? 251  DT  J C5    1 
ATOM   5135  C C7    . DT  B 1 105 ? 91.096  47.041 -11.718 1.00 102.89 ? 251  DT  J C7    1 
ATOM   5136  C C6    . DT  B 1 105 ? 91.932  48.735 -10.086 1.00 103.19 ? 251  DT  J C6    1 
ATOM   5137  P P     . DT  B 1 106 ? 92.576  50.799 -4.290  1.00 113.20 ? 252  DT  J P     1 
ATOM   5138  O OP1   . DT  B 1 106 ? 93.360  51.057 -3.054  1.00 92.57  ? 252  DT  J OP1   1 
ATOM   5139  O OP2   . DT  B 1 106 ? 91.697  49.597 -4.368  1.00 92.00  ? 252  DT  J OP2   1 
ATOM   5140  O "O5'" . DT  B 1 106 ? 91.708  52.090 -4.628  1.00 112.94 ? 252  DT  J "O5'" 1 
ATOM   5141  C "C5'" . DT  B 1 106 ? 92.314  53.218 -5.255  1.00 112.03 ? 252  DT  J "C5'" 1 
ATOM   5142  C "C4'" . DT  B 1 106 ? 91.261  54.124 -5.852  1.00 111.08 ? 252  DT  J "C4'" 1 
ATOM   5143  O "O4'" . DT  B 1 106 ? 90.769  53.631 -7.123  1.00 110.40 ? 252  DT  J "O4'" 1 
ATOM   5144  C "C3'" . DT  B 1 106 ? 90.023  54.370 -4.988  1.00 110.40 ? 252  DT  J "C3'" 1 
ATOM   5145  O "O3'" . DT  B 1 106 ? 89.682  55.750 -5.090  1.00 109.45 ? 252  DT  J "O3'" 1 
ATOM   5146  C "C2'" . DT  B 1 106 ? 88.952  53.526 -5.665  1.00 110.42 ? 252  DT  J "C2'" 1 
ATOM   5147  C "C1'" . DT  B 1 106 ? 89.345  53.688 -7.116  1.00 110.26 ? 252  DT  J "C1'" 1 
ATOM   5148  N N1    . DT  B 1 106 ? 88.838  52.665 -8.045  1.00 89.39  ? 252  DT  J N1    1 
ATOM   5149  C C2    . DT  B 1 106 ? 88.021  53.087 -9.067  1.00 89.19  ? 252  DT  J C2    1 
ATOM   5150  O O2    . DT  B 1 106 ? 87.620  54.238 -9.166  1.00 89.42  ? 252  DT  J O2    1 
ATOM   5151  N N3    . DT  B 1 106 ? 87.674  52.104 -9.962  1.00 88.85  ? 252  DT  J N3    1 
ATOM   5152  C C4    . DT  B 1 106 ? 88.032  50.766 -9.911  1.00 88.44  ? 252  DT  J C4    1 
ATOM   5153  O O4    . DT  B 1 106 ? 87.677  49.997 -10.791 1.00 87.74  ? 252  DT  J O4    1 
ATOM   5154  C C5    . DT  B 1 106 ? 88.829  50.386 -8.785  1.00 88.64  ? 252  DT  J C5    1 
ATOM   5155  C C7    . DT  B 1 106 ? 89.212  48.951 -8.638  1.00 88.42  ? 252  DT  J C7    1 
ATOM   5156  C C6    . DT  B 1 106 ? 89.193  51.340 -7.917  1.00 89.14  ? 252  DT  J C6    1 
ATOM   5157  P P     . DC  B 1 107 ? 88.875  56.458 -3.907  1.00 118.73 ? 253  DC  J P     1 
ATOM   5158  O OP1   . DC  B 1 107 ? 89.463  57.814 -3.799  1.00 98.74  ? 253  DC  J OP1   1 
ATOM   5159  O OP2   . DC  B 1 107 ? 88.822  55.565 -2.714  1.00 98.16  ? 253  DC  J OP2   1 
ATOM   5160  O "O5'" . DC  B 1 107 ? 87.400  56.594 -4.481  1.00 117.90 ? 253  DC  J "O5'" 1 
ATOM   5161  C "C5'" . DC  B 1 107 ? 87.103  57.541 -5.497  1.00 114.88 ? 253  DC  J "C5'" 1 
ATOM   5162  C "C4'" . DC  B 1 107 ? 85.661  57.402 -5.918  1.00 113.23 ? 253  DC  J "C4'" 1 
ATOM   5163  O "O4'" . DC  B 1 107 ? 85.491  56.161 -6.640  1.00 112.54 ? 253  DC  J "O4'" 1 
ATOM   5164  C "C3'" . DC  B 1 107 ? 84.663  57.355 -4.758  1.00 112.04 ? 253  DC  J "C3'" 1 
ATOM   5165  O "O3'" . DC  B 1 107 ? 83.448  57.974 -5.168  1.00 110.53 ? 253  DC  J "O3'" 1 
ATOM   5166  C "C2'" . DC  B 1 107 ? 84.388  55.870 -4.608  1.00 111.80 ? 253  DC  J "C2'" 1 
ATOM   5167  C "C1'" . DC  B 1 107 ? 84.415  55.446 -6.062  1.00 111.63 ? 253  DC  J "C1'" 1 
ATOM   5168  N N1    . DC  B 1 107 ? 84.636  54.022 -6.312  1.00 89.60  ? 253  DC  J N1    1 
ATOM   5169  C C2    . DC  B 1 107 ? 84.288  53.501 -7.563  1.00 89.53  ? 253  DC  J C2    1 
ATOM   5170  O O2    . DC  B 1 107 ? 83.770  54.256 -8.403  1.00 89.21  ? 253  DC  J O2    1 
ATOM   5171  N N3    . DC  B 1 107 ? 84.521  52.196 -7.824  1.00 88.92  ? 253  DC  J N3    1 
ATOM   5172  C C4    . DC  B 1 107 ? 85.072  51.421 -6.890  1.00 89.04  ? 253  DC  J C4    1 
ATOM   5173  N N4    . DC  B 1 107 ? 85.300  50.139 -7.190  1.00 88.32  ? 253  DC  J N4    1 
ATOM   5174  C C5    . DC  B 1 107 ? 85.417  51.924 -5.602  1.00 89.30  ? 253  DC  J C5    1 
ATOM   5175  C C6    . DC  B 1 107 ? 85.182  53.217 -5.357  1.00 89.66  ? 253  DC  J C6    1 
ATOM   5176  P P     . DC  B 1 108 ? 83.320  59.568 -5.148  1.00 102.36 ? 254  DC  J P     1 
ATOM   5177  O OP1   . DC  B 1 108 ? 84.581  60.162 -5.660  1.00 100.59 ? 254  DC  J OP1   1 
ATOM   5178  O OP2   . DC  B 1 108 ? 82.809  59.938 -3.805  1.00 100.12 ? 254  DC  J OP2   1 
ATOM   5179  O "O5'" . DC  B 1 108 ? 82.173  59.860 -6.209  1.00 100.57 ? 254  DC  J "O5'" 1 
ATOM   5180  C "C5'" . DC  B 1 108 ? 82.433  59.801 -7.612  1.00 96.96  ? 254  DC  J "C5'" 1 
ATOM   5181  C "C4'" . DC  B 1 108 ? 81.275  59.142 -8.323  1.00 95.18  ? 254  DC  J "C4'" 1 
ATOM   5182  O "O4'" . DC  B 1 108 ? 81.412  57.702 -8.325  1.00 93.78  ? 254  DC  J "O4'" 1 
ATOM   5183  C "C3'" . DC  B 1 108 ? 79.909  59.432 -7.698  1.00 94.21  ? 254  DC  J "C3'" 1 
ATOM   5184  O "O3'" . DC  B 1 108 ? 78.951  59.635 -8.731  1.00 93.12  ? 254  DC  J "O3'" 1 
ATOM   5185  C "C2'" . DC  B 1 108 ? 79.586  58.152 -6.944  1.00 93.76  ? 254  DC  J "C2'" 1 
ATOM   5186  C "C1'" . DC  B 1 108 ? 80.190  57.132 -7.882  1.00 93.58  ? 254  DC  J "C1'" 1 
ATOM   5187  N N1    . DC  B 1 108 ? 80.463  55.791 -7.341  1.00 90.10  ? 254  DC  J N1    1 
ATOM   5188  C C2    . DC  B 1 108 ? 79.920  54.699 -8.005  1.00 89.48  ? 254  DC  J C2    1 
ATOM   5189  O O2    . DC  B 1 108 ? 79.230  54.902 -9.017  1.00 87.33  ? 254  DC  J O2    1 
ATOM   5190  N N3    . DC  B 1 108 ? 80.158  53.452 -7.541  1.00 89.22  ? 254  DC  J N3    1 
ATOM   5191  C C4    . DC  B 1 108 ? 80.913  53.279 -6.462  1.00 89.81  ? 254  DC  J C4    1 
ATOM   5192  N N4    . DC  B 1 108 ? 81.128  52.033 -6.050  1.00 89.86  ? 254  DC  J N4    1 
ATOM   5193  C C5    . DC  B 1 108 ? 81.482  54.376 -5.760  1.00 90.07  ? 254  DC  J C5    1 
ATOM   5194  C C6    . DC  B 1 108 ? 81.229  55.607 -6.226  1.00 90.18  ? 254  DC  J C6    1 
ATOM   5195  P P     . DA  B 1 109 ? 77.864  60.799 -8.578  1.00 86.92  ? 255  DA  J P     1 
ATOM   5196  O OP1   . DA  B 1 109 ? 78.615  62.082 -8.512  1.00 83.12  ? 255  DA  J OP1   1 
ATOM   5197  O OP2   . DA  B 1 109 ? 76.925  60.422 -7.479  1.00 81.46  ? 255  DA  J OP2   1 
ATOM   5198  O "O5'" . DA  B 1 109 ? 77.090  60.750 -9.966  1.00 85.10  ? 255  DA  J "O5'" 1 
ATOM   5199  C "C5'" . DA  B 1 109 ? 77.779  60.420 -11.167 1.00 80.54  ? 255  DA  J "C5'" 1 
ATOM   5200  C "C4'" . DA  B 1 109 ? 77.122  59.238 -11.850 1.00 77.22  ? 255  DA  J "C4'" 1 
ATOM   5201  O "O4'" . DA  B 1 109 ? 77.268  58.034 -11.062 1.00 75.60  ? 255  DA  J "O4'" 1 
ATOM   5202  C "C3'" . DA  B 1 109 ? 75.632  59.358 -12.152 1.00 75.84  ? 255  DA  J "C3'" 1 
ATOM   5203  O "O3'" . DA  B 1 109 ? 75.416  58.835 -13.453 1.00 75.19  ? 255  DA  J "O3'" 1 
ATOM   5204  C "C2'" . DA  B 1 109 ? 74.970  58.489 -11.091 1.00 75.11  ? 255  DA  J "C2'" 1 
ATOM   5205  C "C1'" . DA  B 1 109 ? 76.011  57.413 -10.846 1.00 74.41  ? 255  DA  J "C1'" 1 
ATOM   5206  N N9    . DA  B 1 109 ? 76.054  56.846 -9.500  1.00 68.96  ? 255  DA  J N9    1 
ATOM   5207  C C8    . DA  B 1 109 ? 75.968  57.489 -8.287  1.00 68.42  ? 255  DA  J C8    1 
ATOM   5208  N N7    . DA  B 1 109 ? 76.163  56.700 -7.257  1.00 69.34  ? 255  DA  J N7    1 
ATOM   5209  C C5    . DA  B 1 109 ? 76.369  55.450 -7.827  1.00 69.78  ? 255  DA  J C5    1 
ATOM   5210  C C6    . DA  B 1 109 ? 76.655  54.177 -7.272  1.00 69.90  ? 255  DA  J C6    1 
ATOM   5211  N N6    . DA  B 1 109 ? 76.836  53.947 -5.973  1.00 69.81  ? 255  DA  J N6    1 
ATOM   5212  N N1    . DA  B 1 109 ? 76.766  53.137 -8.121  1.00 69.75  ? 255  DA  J N1    1 
ATOM   5213  C C2    . DA  B 1 109 ? 76.627  53.366 -9.430  1.00 69.60  ? 255  DA  J C2    1 
ATOM   5214  N N3    . DA  B 1 109 ? 76.386  54.509 -10.072 1.00 69.77  ? 255  DA  J N3    1 
ATOM   5215  C C4    . DA  B 1 109 ? 76.268  55.524 -9.204  1.00 69.51  ? 255  DA  J C4    1 
ATOM   5216  P P     . DA  B 1 110 ? 73.926  58.611 -13.972 1.00 93.58  ? 256  DA  J P     1 
ATOM   5217  O OP1   . DA  B 1 110 ? 73.987  58.763 -15.446 1.00 92.01  ? 256  DA  J OP1   1 
ATOM   5218  O OP2   . DA  B 1 110 ? 73.007  59.455 -13.164 1.00 92.26  ? 256  DA  J OP2   1 
ATOM   5219  O "O5'" . DA  B 1 110 ? 73.647  57.086 -13.635 1.00 93.04  ? 256  DA  J "O5'" 1 
ATOM   5220  C "C5'" . DA  B 1 110 ? 74.572  56.087 -14.049 1.00 89.95  ? 256  DA  J "C5'" 1 
ATOM   5221  C "C4'" . DA  B 1 110 ? 74.016  54.717 -13.761 1.00 87.95  ? 256  DA  J "C4'" 1 
ATOM   5222  O "O4'" . DA  B 1 110 ? 74.197  54.361 -12.375 1.00 87.38  ? 256  DA  J "O4'" 1 
ATOM   5223  C "C3'" . DA  B 1 110 ? 72.529  54.564 -14.038 1.00 86.47  ? 256  DA  J "C3'" 1 
ATOM   5224  O "O3'" . DA  B 1 110 ? 72.361  53.247 -14.505 1.00 82.94  ? 256  DA  J "O3'" 1 
ATOM   5225  C "C2'" . DA  B 1 110 ? 71.909  54.698 -12.659 1.00 87.37  ? 256  DA  J "C2'" 1 
ATOM   5226  C "C1'" . DA  B 1 110 ? 72.951  53.999 -11.810 1.00 88.49  ? 256  DA  J "C1'" 1 
ATOM   5227  N N9    . DA  B 1 110 ? 72.997  54.348 -10.392 1.00 88.60  ? 256  DA  J N9    1 
ATOM   5228  C C8    . DA  B 1 110 ? 72.806  55.571 -9.793  1.00 89.47  ? 256  DA  J C8    1 
ATOM   5229  N N7    . DA  B 1 110 ? 72.995  55.559 -8.496  1.00 89.84  ? 256  DA  J N7    1 
ATOM   5230  C C5    . DA  B 1 110 ? 73.317  54.238 -8.221  1.00 89.91  ? 256  DA  J C5    1 
ATOM   5231  C C6    . DA  B 1 110 ? 73.652  53.588 -7.035  1.00 90.78  ? 256  DA  J C6    1 
ATOM   5232  N N6    . DA  B 1 110 ? 73.731  54.205 -5.860  1.00 90.63  ? 256  DA  J N6    1 
ATOM   5233  N N1    . DA  B 1 110 ? 73.918  52.265 -7.096  1.00 90.89  ? 256  DA  J N1    1 
ATOM   5234  C C2    . DA  B 1 110 ? 73.853  51.653 -8.282  1.00 90.27  ? 256  DA  J C2    1 
ATOM   5235  N N3    . DA  B 1 110 ? 73.557  52.162 -9.475  1.00 89.41  ? 256  DA  J N3    1 
ATOM   5236  C C4    . DA  B 1 110 ? 73.299  53.480 -9.374  1.00 88.89  ? 256  DA  J C4    1 
ATOM   5237  P P     . DA  B 1 111 ? 70.954  52.781 -15.069 1.00 66.38  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 111 ? 71.128  52.772 -16.543 1.00 74.54  ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 111 ? 69.854  53.571 -14.443 1.00 72.05  ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 111 ? 70.906  51.273 -14.574 1.00 66.92  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 111 ? 72.090  50.482 -14.644 1.00 66.91  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 111 ? 71.981  49.310 -13.706 1.00 66.54  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 111 ? 72.221  49.761 -12.354 1.00 66.42  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 111 ? 70.572  48.742 -13.732 1.00 66.22  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 111 ? 70.540  47.330 -13.661 1.00 64.92  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 111 ? 69.939  49.316 -12.492 1.00 67.52  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 111 ? 71.112  49.461 -11.543 1.00 67.49  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 111 ? 70.919  50.563 -10.596 1.00 76.67  ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 111 ? 70.624  51.889 -10.863 1.00 77.39  ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 111 ? 70.425  52.612 -9.791  1.00 78.08  ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 111 ? 70.619  51.713 -8.745  1.00 78.41  ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 111 ? 70.542  51.856 -7.360  1.00 79.21  ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 111 ? 70.253  53.007 -6.754  1.00 78.71  ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 111 ? 70.780  50.759 -6.601  1.00 77.82  ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 111 ? 71.086  49.612 -7.204  1.00 78.45  ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 111 ? 71.196  49.352 -8.495  1.00 78.80  ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 111 ? 70.943  50.459 -9.226  1.00 77.72  ? 257  DA  J C4    1 
ATOM   5258  P P     . DT  B 1 112 ? 69.131  46.598 -13.833 1.00 60.82  ? 258  DT  J P     1 
ATOM   5259  O OP1   . DT  B 1 112 ? 69.294  45.247 -14.411 1.00 65.40  ? 258  DT  J OP1   1 
ATOM   5260  O OP2   . DT  B 1 112 ? 68.209  47.554 -14.478 1.00 63.24  ? 258  DT  J OP2   1 
ATOM   5261  O "O5'" . DT  B 1 112 ? 68.646  46.481 -12.338 1.00 67.27  ? 258  DT  J "O5'" 1 
ATOM   5262  C "C5'" . DT  B 1 112 ? 68.028  45.310 -11.880 1.00 76.40  ? 258  DT  J "C5'" 1 
ATOM   5263  C "C4'" . DT  B 1 112 ? 68.863  44.694 -10.789 1.00 82.30  ? 258  DT  J "C4'" 1 
ATOM   5264  O "O4'" . DT  B 1 112 ? 69.486  45.745 -10.018 1.00 83.07  ? 258  DT  J "O4'" 1 
ATOM   5265  C "C3'" . DT  B 1 112 ? 67.980  43.920 -9.830  1.00 85.67  ? 258  DT  J "C3'" 1 
ATOM   5266  O "O3'" . DT  B 1 112 ? 68.601  42.740 -9.372  1.00 90.30  ? 258  DT  J "O3'" 1 
ATOM   5267  C "C2'" . DT  B 1 112 ? 67.712  44.897 -8.705  1.00 85.48  ? 258  DT  J "C2'" 1 
ATOM   5268  C "C1'" . DT  B 1 112 ? 68.895  45.848 -8.731  1.00 84.38  ? 258  DT  J "C1'" 1 
ATOM   5269  N N1    . DT  B 1 112 ? 68.463  47.245 -8.544  1.00 86.56  ? 258  DT  J N1    1 
ATOM   5270  C C2    . DT  B 1 112 ? 68.374  47.735 -7.267  1.00 86.18  ? 258  DT  J C2    1 
ATOM   5271  O O2    . DT  B 1 112 ? 68.619  47.066 -6.277  1.00 87.96  ? 258  DT  J O2    1 
ATOM   5272  N N3    . DT  B 1 112 ? 67.969  49.043 -7.188  1.00 85.02  ? 258  DT  J N3    1 
ATOM   5273  C C4    . DT  B 1 112 ? 67.637  49.878 -8.231  1.00 84.65  ? 258  DT  J C4    1 
ATOM   5274  O O4    . DT  B 1 112 ? 67.309  51.031 -8.014  1.00 83.82  ? 258  DT  J O4    1 
ATOM   5275  C C5    . DT  B 1 112 ? 67.717  49.293 -9.530  1.00 84.89  ? 258  DT  J C5    1 
ATOM   5276  C C7    . DT  B 1 112 ? 67.314  50.113 -10.710 1.00 84.62  ? 258  DT  J C7    1 
ATOM   5277  C C6    . DT  B 1 112 ? 68.141  48.027 -9.628  1.00 85.49  ? 258  DT  J C6    1 
ATOM   5278  P P     . DA  B 1 113 ? 67.682  41.563 -8.821  1.00 110.38 ? 259  DA  J P     1 
ATOM   5279  O OP1   . DA  B 1 113 ? 68.596  40.451 -8.441  1.00 94.95  ? 259  DA  J OP1   1 
ATOM   5280  O OP2   . DA  B 1 113 ? 66.597  41.326 -9.810  1.00 93.57  ? 259  DA  J OP2   1 
ATOM   5281  O "O5'" . DA  B 1 113 ? 67.036  42.216 -7.521  1.00 112.41 ? 259  DA  J "O5'" 1 
ATOM   5282  C "C5'" . DA  B 1 113 ? 67.840  42.508 -6.378  1.00 116.40 ? 259  DA  J "C5'" 1 
ATOM   5283  C "C4'" . DA  B 1 113 ? 66.966  42.946 -5.228  1.00 118.95 ? 259  DA  J "C4'" 1 
ATOM   5284  O "O4'" . DA  B 1 113 ? 66.696  44.365 -5.292  1.00 119.60 ? 259  DA  J "O4'" 1 
ATOM   5285  C "C3'" . DA  B 1 113 ? 65.604  42.253 -5.187  1.00 120.38 ? 259  DA  J "C3'" 1 
ATOM   5286  O "O3'" . DA  B 1 113 ? 65.276  41.913 -3.837  1.00 121.90 ? 259  DA  J "O3'" 1 
ATOM   5287  C "C2'" . DA  B 1 113 ? 64.659  43.307 -5.735  1.00 120.17 ? 259  DA  J "C2'" 1 
ATOM   5288  C "C1'" . DA  B 1 113 ? 65.297  44.586 -5.229  1.00 120.44 ? 259  DA  J "C1'" 1 
ATOM   5289  N N9    . DA  B 1 113 ? 65.002  45.770 -6.032  1.00 106.09 ? 259  DA  J N9    1 
ATOM   5290  C C8    . DA  B 1 113 ? 64.837  45.825 -7.388  1.00 106.49 ? 259  DA  J C8    1 
ATOM   5291  N N7    . DA  B 1 113 ? 64.617  47.035 -7.843  1.00 106.85 ? 259  DA  J N7    1 
ATOM   5292  C C5    . DA  B 1 113 ? 64.631  47.826 -6.706  1.00 106.93 ? 259  DA  J C5    1 
ATOM   5293  C C6    . DA  B 1 113 ? 64.463  49.202 -6.516  1.00 107.12 ? 259  DA  J C6    1 
ATOM   5294  N N6    . DA  B 1 113 ? 64.253  50.057 -7.518  1.00 107.27 ? 259  DA  J N6    1 
ATOM   5295  N N1    . DA  B 1 113 ? 64.520  49.678 -5.255  1.00 106.88 ? 259  DA  J N1    1 
ATOM   5296  C C2    . DA  B 1 113 ? 64.735  48.817 -4.263  1.00 106.70 ? 259  DA  J C2    1 
ATOM   5297  N N3    . DA  B 1 113 ? 64.915  47.501 -4.315  1.00 106.45 ? 259  DA  J N3    1 
ATOM   5298  C C4    . DA  B 1 113 ? 64.853  47.061 -5.578  1.00 106.49 ? 259  DA  J C4    1 
ATOM   5299  P P     . DC  B 1 114 ? 63.933  41.093 -3.521  1.00 125.57 ? 260  DC  J P     1 
ATOM   5300  O OP1   . DC  B 1 114 ? 64.280  40.130 -2.444  1.00 97.20  ? 260  DC  J OP1   1 
ATOM   5301  O OP2   . DC  B 1 114 ? 63.316  40.598 -4.787  1.00 96.86  ? 260  DC  J OP2   1 
ATOM   5302  O "O5'" . DC  B 1 114 ? 63.011  42.215 -2.883  1.00 126.66 ? 260  DC  J "O5'" 1 
ATOM   5303  C "C5'" . DC  B 1 114 ? 63.530  43.052 -1.857  1.00 129.63 ? 260  DC  J "C5'" 1 
ATOM   5304  C "C4'" . DC  B 1 114 ? 62.500  44.078 -1.456  1.00 131.88 ? 260  DC  J "C4'" 1 
ATOM   5305  O "O4'" . DC  B 1 114 ? 62.520  45.212 -2.353  1.00 132.17 ? 260  DC  J "O4'" 1 
ATOM   5306  C "C3'" . DC  B 1 114 ? 61.068  43.546 -1.478  1.00 133.15 ? 260  DC  J "C3'" 1 
ATOM   5307  O "O3'" . DC  B 1 114 ? 60.349  44.079 -0.370  1.00 134.62 ? 260  DC  J "O3'" 1 
ATOM   5308  C "C2'" . DC  B 1 114 ? 60.505  44.126 -2.761  1.00 132.78 ? 260  DC  J "C2'" 1 
ATOM   5309  C "C1'" . DC  B 1 114 ? 61.197  45.471 -2.786  1.00 132.67 ? 260  DC  J "C1'" 1 
ATOM   5310  N N1    . DC  B 1 114 ? 61.268  46.118 -4.099  1.00 105.52 ? 260  DC  J N1    1 
ATOM   5311  C C2    . DC  B 1 114 ? 61.208  47.513 -4.158  1.00 105.63 ? 260  DC  J C2    1 
ATOM   5312  O O2    . DC  B 1 114 ? 61.071  48.152 -3.105  1.00 105.70 ? 260  DC  J O2    1 
ATOM   5313  N N3    . DC  B 1 114 ? 61.298  48.126 -5.359  1.00 105.65 ? 260  DC  J N3    1 
ATOM   5314  C C4    . DC  B 1 114 ? 61.438  47.399 -6.471  1.00 105.13 ? 260  DC  J C4    1 
ATOM   5315  N N4    . DC  B 1 114 ? 61.548  48.047 -7.630  1.00 104.59 ? 260  DC  J N4    1 
ATOM   5316  C C5    . DC  B 1 114 ? 61.481  45.974 -6.440  1.00 104.91 ? 260  DC  J C5    1 
ATOM   5317  C C6    . DC  B 1 114 ? 61.395  45.381 -5.244  1.00 105.15 ? 260  DC  J C6    1 
ATOM   5318  P P     . DA  B 1 115 ? 58.925  43.457 0.025   1.00 127.90 ? 261  DA  J P     1 
ATOM   5319  O OP1   . DA  B 1 115 ? 59.094  42.862 1.374   1.00 128.34 ? 261  DA  J OP1   1 
ATOM   5320  O OP2   . DA  B 1 115 ? 58.433  42.614 -1.101  1.00 127.38 ? 261  DA  J OP2   1 
ATOM   5321  O "O5'" . DA  B 1 115 ? 57.986  44.736 0.142   1.00 128.19 ? 261  DA  J "O5'" 1 
ATOM   5322  C "C5'" . DA  B 1 115 ? 58.368  45.852 0.945   1.00 128.24 ? 261  DA  J "C5'" 1 
ATOM   5323  C "C4'" . DA  B 1 115 ? 57.414  47.000 0.717   1.00 128.39 ? 261  DA  J "C4'" 1 
ATOM   5324  O "O4'" . DA  B 1 115 ? 57.681  47.624 -0.560  1.00 128.64 ? 261  DA  J "O4'" 1 
ATOM   5325  C "C3'" . DA  B 1 115 ? 55.956  46.555 0.664   1.00 128.68 ? 261  DA  J "C3'" 1 
ATOM   5326  O "O3'" . DA  B 1 115 ? 55.125  47.577 1.215   1.00 128.59 ? 261  DA  J "O3'" 1 
ATOM   5327  C "C2'" . DA  B 1 115 ? 55.703  46.387 -0.823  1.00 128.76 ? 261  DA  J "C2'" 1 
ATOM   5328  C "C1'" . DA  B 1 115 ? 56.532  47.523 -1.398  1.00 129.05 ? 261  DA  J "C1'" 1 
ATOM   5329  N N9    . DA  B 1 115 ? 56.990  47.337 -2.779  1.00 128.84 ? 261  DA  J N9    1 
ATOM   5330  C C8    . DA  B 1 115 ? 57.395  46.177 -3.394  1.00 128.52 ? 261  DA  J C8    1 
ATOM   5331  N N7    . DA  B 1 115 ? 57.770  46.343 -4.639  1.00 128.54 ? 261  DA  J N7    1 
ATOM   5332  C C5    . DA  B 1 115 ? 57.596  47.701 -4.862  1.00 128.81 ? 261  DA  J C5    1 
ATOM   5333  C C6    . DA  B 1 115 ? 57.815  48.510 -5.988  1.00 128.88 ? 261  DA  J C6    1 
ATOM   5334  N N6    . DA  B 1 115 ? 58.277  48.046 -7.152  1.00 128.41 ? 261  DA  J N6    1 
ATOM   5335  N N1    . DA  B 1 115 ? 57.539  49.828 -5.880  1.00 128.75 ? 261  DA  J N1    1 
ATOM   5336  C C2    . DA  B 1 115 ? 57.071  50.289 -4.717  1.00 128.87 ? 261  DA  J C2    1 
ATOM   5337  N N3    . DA  B 1 115 ? 56.823  49.631 -3.590  1.00 129.03 ? 261  DA  J N3    1 
ATOM   5338  C C4    . DA  B 1 115 ? 57.111  48.325 -3.728  1.00 128.77 ? 261  DA  J C4    1 
ATOM   5339  P P     . DC  B 1 116 ? 53.692  47.191 1.822   1.00 138.79 ? 262  DC  J P     1 
ATOM   5340  O OP1   . DC  B 1 116 ? 53.511  47.972 3.074   1.00 154.99 ? 262  DC  J OP1   1 
ATOM   5341  O OP2   . DC  B 1 116 ? 53.566  45.708 1.844   1.00 154.93 ? 262  DC  J OP2   1 
ATOM   5342  O "O5'" . DC  B 1 116 ? 52.682  47.736 0.730   1.00 138.36 ? 262  DC  J "O5'" 1 
ATOM   5343  C "C5'" . DC  B 1 116 ? 53.187  48.219 -0.495  1.00 138.11 ? 262  DC  J "C5'" 1 
ATOM   5344  C "C4'" . DC  B 1 116 ? 52.744  49.641 -0.711  1.00 137.80 ? 262  DC  J "C4'" 1 
ATOM   5345  O "O4'" . DC  B 1 116 ? 53.467  50.155 -1.848  1.00 138.33 ? 262  DC  J "O4'" 1 
ATOM   5346  C "C3'" . DC  B 1 116 ? 51.267  49.746 -1.067  1.00 137.61 ? 262  DC  J "C3'" 1 
ATOM   5347  O "O3'" . DC  B 1 116 ? 50.723  50.981 -0.620  1.00 136.88 ? 262  DC  J "O3'" 1 
ATOM   5348  C "C2'" . DC  B 1 116 ? 51.268  49.660 -2.579  1.00 138.24 ? 262  DC  J "C2'" 1 
ATOM   5349  C "C1'" . DC  B 1 116 ? 52.624  50.229 -2.987  1.00 138.76 ? 262  DC  J "C1'" 1 
ATOM   5350  N N1    . DC  B 1 116 ? 53.269  49.452 -4.053  1.00 155.94 ? 262  DC  J N1    1 
ATOM   5351  C C2    . DC  B 1 116 ? 53.577  50.082 -5.248  1.00 156.34 ? 262  DC  J C2    1 
ATOM   5352  O O2    . DC  B 1 116 ? 53.297  51.282 -5.378  1.00 156.53 ? 262  DC  J O2    1 
ATOM   5353  N N3    . DC  B 1 116 ? 54.171  49.371 -6.232  1.00 156.84 ? 262  DC  J N3    1 
ATOM   5354  C C4    . DC  B 1 116 ? 54.451  48.078 -6.047  1.00 157.01 ? 262  DC  J C4    1 
ATOM   5355  N N4    . DC  B 1 116 ? 55.038  47.411 -7.043  1.00 157.62 ? 262  DC  J N4    1 
ATOM   5356  C C5    . DC  B 1 116 ? 54.142  47.410 -4.834  1.00 156.87 ? 262  DC  J C5    1 
ATOM   5357  C C6    . DC  B 1 116 ? 53.560  48.128 -3.872  1.00 156.52 ? 262  DC  J C6    1 
ATOM   5358  P P     . DT  B 1 117 ? 49.238  51.389 -1.057  1.00 114.83 ? 263  DT  J P     1 
ATOM   5359  O OP1   . DT  B 1 117 ? 48.780  52.445 -0.112  1.00 98.62  ? 263  DT  J OP1   1 
ATOM   5360  O OP2   . DT  B 1 117 ? 48.431  50.157 -1.260  1.00 98.75  ? 263  DT  J OP2   1 
ATOM   5361  O "O5'" . DT  B 1 117 ? 49.439  52.071 -2.475  1.00 113.31 ? 263  DT  J "O5'" 1 
ATOM   5362  C "C5'" . DT  B 1 117 ? 50.144  53.303 -2.588  1.00 110.92 ? 263  DT  J "C5'" 1 
ATOM   5363  C "C4'" . DT  B 1 117 ? 49.846  53.948 -3.920  1.00 109.14 ? 263  DT  J "C4'" 1 
ATOM   5364  O "O4'" . DT  B 1 117 ? 50.502  53.222 -4.986  1.00 108.31 ? 263  DT  J "O4'" 1 
ATOM   5365  C "C3'" . DT  B 1 117 ? 48.361  53.951 -4.263  1.00 108.26 ? 263  DT  J "C3'" 1 
ATOM   5366  O "O3'" . DT  B 1 117 ? 48.049  55.159 -4.950  1.00 107.18 ? 263  DT  J "O3'" 1 
ATOM   5367  C "C2'" . DT  B 1 117 ? 48.209  52.737 -5.160  1.00 107.85 ? 263  DT  J "C2'" 1 
ATOM   5368  C "C1'" . DT  B 1 117 ? 49.538  52.719 -5.897  1.00 108.15 ? 263  DT  J "C1'" 1 
ATOM   5369  N N1    . DT  B 1 117 ? 49.994  51.389 -6.348  1.00 92.03  ? 263  DT  J N1    1 
ATOM   5370  C C2    . DT  B 1 117 ? 50.462  51.283 -7.637  1.00 92.13  ? 263  DT  J C2    1 
ATOM   5371  O O2    . DT  B 1 117 ? 50.476  52.220 -8.427  1.00 92.30  ? 263  DT  J O2    1 
ATOM   5372  N N3    . DT  B 1 117 ? 50.912  50.028 -7.976  1.00 91.67  ? 263  DT  J N3    1 
ATOM   5373  C C4    . DT  B 1 117 ? 50.924  48.897 -7.181  1.00 91.76  ? 263  DT  J C4    1 
ATOM   5374  O O4    . DT  B 1 117 ? 51.376  47.849 -7.612  1.00 91.64  ? 263  DT  J O4    1 
ATOM   5375  C C5    . DT  B 1 117 ? 50.390  49.066 -5.866  1.00 91.64  ? 263  DT  J C5    1 
ATOM   5376  C C7    . DT  B 1 117 ? 50.329  47.873 -4.967  1.00 91.13  ? 263  DT  J C7    1 
ATOM   5377  C C6    . DT  B 1 117 ? 49.962  50.290 -5.508  1.00 91.60  ? 263  DT  J C6    1 
ATOM   5378  P P     . DT  B 1 118 ? 46.538  55.456 -5.390  1.00 112.66 ? 264  DT  J P     1 
ATOM   5379  O OP1   . DT  B 1 118 ? 46.145  56.720 -4.728  1.00 106.38 ? 264  DT  J OP1   1 
ATOM   5380  O OP2   . DT  B 1 118 ? 45.711  54.228 -5.212  1.00 105.46 ? 264  DT  J OP2   1 
ATOM   5381  O "O5'" . DT  B 1 118 ? 46.688  55.749 -6.942  1.00 110.69 ? 264  DT  J "O5'" 1 
ATOM   5382  C "C5'" . DT  B 1 118 ? 47.868  56.379 -7.430  1.00 106.07 ? 264  DT  J "C5'" 1 
ATOM   5383  C "C4'" . DT  B 1 118 ? 48.067  56.060 -8.892  1.00 102.35 ? 264  DT  J "C4'" 1 
ATOM   5384  O "O4'" . DT  B 1 118 ? 48.479  54.688 -9.087  1.00 101.28 ? 264  DT  J "O4'" 1 
ATOM   5385  C "C3'" . DT  B 1 118 ? 46.820  56.251 -9.749  1.00 99.97  ? 264  DT  J "C3'" 1 
ATOM   5386  O "O3'" . DT  B 1 118 ? 47.232  56.830 -10.979 1.00 97.27  ? 264  DT  J "O3'" 1 
ATOM   5387  C "C2'" . DT  B 1 118 ? 46.313  54.834 -9.956  1.00 99.17  ? 264  DT  J "C2'" 1 
ATOM   5388  C "C1'" . DT  B 1 118 ? 47.616  54.060 -10.021 1.00 99.59  ? 264  DT  J "C1'" 1 
ATOM   5389  N N1    . DT  B 1 118 ? 47.544  52.621 -9.682  1.00 91.29  ? 264  DT  J N1    1 
ATOM   5390  C C2    . DT  B 1 118 ? 48.035  51.722 -10.602 1.00 90.59  ? 264  DT  J C2    1 
ATOM   5391  O O2    . DT  B 1 118 ? 48.491  52.054 -11.688 1.00 91.02  ? 264  DT  J O2    1 
ATOM   5392  N N3    . DT  B 1 118 ? 47.971  50.407 -10.204 1.00 89.28  ? 264  DT  J N3    1 
ATOM   5393  C C4    . DT  B 1 118 ? 47.479  49.912 -9.012  1.00 88.52  ? 264  DT  J C4    1 
ATOM   5394  O O4    . DT  B 1 118 ? 47.507  48.701 -8.787  1.00 86.33  ? 264  DT  J O4    1 
ATOM   5395  C C5    . DT  B 1 118 ? 46.967  50.903 -8.109  1.00 88.89  ? 264  DT  J C5    1 
ATOM   5396  C C7    . DT  B 1 118 ? 46.406  50.455 -6.798  1.00 89.05  ? 264  DT  J C7    1 
ATOM   5397  C C6    . DT  B 1 118 ? 47.020  52.193 -8.482  1.00 90.21  ? 264  DT  J C6    1 
ATOM   5398  P P     . DT  B 1 119 ? 46.193  57.682 -11.845 1.00 95.82  ? 265  DT  J P     1 
ATOM   5399  O OP1   . DT  B 1 119 ? 46.484  59.130 -11.683 1.00 117.28 ? 265  DT  J OP1   1 
ATOM   5400  O OP2   . DT  B 1 119 ? 44.828  57.165 -11.573 1.00 117.53 ? 265  DT  J OP2   1 
ATOM   5401  O "O5'" . DT  B 1 119 ? 46.605  57.271 -13.317 1.00 94.84  ? 265  DT  J "O5'" 1 
ATOM   5402  C "C5'" . DT  B 1 119 ? 47.973  57.072 -13.640 1.00 90.01  ? 265  DT  J "C5'" 1 
ATOM   5403  C "C4'" . DT  B 1 119 ? 48.097  56.100 -14.788 1.00 87.11  ? 265  DT  J "C4'" 1 
ATOM   5404  O "O4'" . DT  B 1 119 ? 47.928  54.735 -14.337 1.00 86.05  ? 265  DT  J "O4'" 1 
ATOM   5405  C "C3'" . DT  B 1 119 ? 47.089  56.303 -15.923 1.00 85.58  ? 265  DT  J "C3'" 1 
ATOM   5406  O "O3'" . DT  B 1 119 ? 47.796  56.296 -17.159 1.00 83.63  ? 265  DT  J "O3'" 1 
ATOM   5407  C "C2'" . DT  B 1 119 ? 46.152  55.110 -15.801 1.00 85.23  ? 265  DT  J "C2'" 1 
ATOM   5408  C "C1'" . DT  B 1 119 ? 47.095  54.057 -15.262 1.00 86.32  ? 265  DT  J "C1'" 1 
ATOM   5409  N N1    . DT  B 1 119 ? 46.488  52.905 -14.575 1.00 109.22 ? 265  DT  J N1    1 
ATOM   5410  C C2    . DT  B 1 119 ? 46.761  51.654 -15.077 1.00 111.16 ? 265  DT  J C2    1 
ATOM   5411  O O2    . DT  B 1 119 ? 47.469  51.466 -16.055 1.00 113.31 ? 265  DT  J O2    1 
ATOM   5412  N N3    . DT  B 1 119 ? 46.179  50.624 -14.390 1.00 111.46 ? 265  DT  J N3    1 
ATOM   5413  C C4    . DT  B 1 119 ? 45.380  50.713 -13.274 1.00 113.07 ? 265  DT  J C4    1 
ATOM   5414  O O4    . DT  B 1 119 ? 44.928  49.694 -12.766 1.00 113.99 ? 265  DT  J O4    1 
ATOM   5415  C C5    . DT  B 1 119 ? 45.140  52.054 -12.793 1.00 112.32 ? 265  DT  J C5    1 
ATOM   5416  C C7    . DT  B 1 119 ? 44.303  52.247 -11.568 1.00 112.96 ? 265  DT  J C7    1 
ATOM   5417  C C6    . DT  B 1 119 ? 45.693  53.072 -13.467 1.00 111.00 ? 265  DT  J C6    1 
ATOM   5418  P P     . DT  B 1 120 ? 47.005  56.076 -18.524 1.00 90.63  ? 266  DT  J P     1 
ATOM   5419  O OP1   . DT  B 1 120 ? 47.877  56.650 -19.580 1.00 82.16  ? 266  DT  J OP1   1 
ATOM   5420  O OP2   . DT  B 1 120 ? 45.600  56.535 -18.389 1.00 84.25  ? 266  DT  J OP2   1 
ATOM   5421  O "O5'" . DT  B 1 120 ? 46.989  54.495 -18.668 1.00 90.95  ? 266  DT  J "O5'" 1 
ATOM   5422  C "C5'" . DT  B 1 120 ? 48.209  53.771 -18.774 1.00 89.74  ? 266  DT  J "C5'" 1 
ATOM   5423  C "C4'" . DT  B 1 120 ? 47.964  52.450 -19.459 1.00 88.66  ? 266  DT  J "C4'" 1 
ATOM   5424  O "O4'" . DT  B 1 120 ? 47.247  51.568 -18.566 1.00 88.73  ? 266  DT  J "O4'" 1 
ATOM   5425  C "C3'" . DT  B 1 120 ? 47.115  52.554 -20.726 1.00 88.97  ? 266  DT  J "C3'" 1 
ATOM   5426  O "O3'" . DT  B 1 120 ? 47.608  51.660 -21.720 1.00 88.49  ? 266  DT  J "O3'" 1 
ATOM   5427  C "C2'" . DT  B 1 120 ? 45.749  52.084 -20.262 1.00 89.65  ? 266  DT  J "C2'" 1 
ATOM   5428  C "C1'" . DT  B 1 120 ? 46.125  51.033 -19.240 1.00 89.33  ? 266  DT  J "C1'" 1 
ATOM   5429  N N1    . DT  B 1 120 ? 45.090  50.729 -18.234 1.00 82.29  ? 266  DT  J N1    1 
ATOM   5430  C C2    . DT  B 1 120 ? 44.881  49.410 -17.873 1.00 82.95  ? 266  DT  J C2    1 
ATOM   5431  O O2    . DT  B 1 120 ? 45.510  48.476 -18.333 1.00 80.67  ? 266  DT  J O2    1 
ATOM   5432  N N3    . DT  B 1 120 ? 43.896  49.225 -16.941 1.00 84.73  ? 266  DT  J N3    1 
ATOM   5433  C C4    . DT  B 1 120 ? 43.122  50.197 -16.336 1.00 85.25  ? 266  DT  J C4    1 
ATOM   5434  O O4    . DT  B 1 120 ? 42.273  49.875 -15.497 1.00 87.08  ? 266  DT  J O4    1 
ATOM   5435  C C5    . DT  B 1 120 ? 43.398  51.553 -16.760 1.00 84.24  ? 266  DT  J C5    1 
ATOM   5436  C C7    . DT  B 1 120 ? 42.614  52.675 -16.160 1.00 84.45  ? 266  DT  J C7    1 
ATOM   5437  C C6    . DT  B 1 120 ? 44.354  51.745 -17.674 1.00 83.23  ? 266  DT  J C6    1 
ATOM   5438  P P     . DG  B 1 121 ? 47.706  52.141 -23.243 1.00 81.60  ? 267  DG  J P     1 
ATOM   5439  O OP1   . DG  B 1 121 ? 48.940  52.954 -23.404 1.00 96.22  ? 267  DG  J OP1   1 
ATOM   5440  O OP2   . DG  B 1 121 ? 46.392  52.707 -23.639 1.00 94.90  ? 267  DG  J OP2   1 
ATOM   5441  O "O5'" . DG  B 1 121 ? 47.891  50.770 -24.025 1.00 78.24  ? 267  DG  J "O5'" 1 
ATOM   5442  C "C5'" . DG  B 1 121 ? 48.754  49.757 -23.528 1.00 70.99  ? 267  DG  J "C5'" 1 
ATOM   5443  C "C4'" . DG  B 1 121 ? 48.023  48.438 -23.484 1.00 67.26  ? 267  DG  J "C4'" 1 
ATOM   5444  O "O4'" . DG  B 1 121 ? 46.996  48.483 -22.482 1.00 66.99  ? 267  DG  J "O4'" 1 
ATOM   5445  C "C3'" . DG  B 1 121 ? 47.308  48.063 -24.775 1.00 64.92  ? 267  DG  J "C3'" 1 
ATOM   5446  O "O3'" . DG  B 1 121 ? 47.287  46.658 -24.872 1.00 60.88  ? 267  DG  J "O3'" 1 
ATOM   5447  C "C2'" . DG  B 1 121 ? 45.887  48.517 -24.535 1.00 65.11  ? 267  DG  J "C2'" 1 
ATOM   5448  C "C1'" . DG  B 1 121 ? 45.737  48.207 -23.074 1.00 67.40  ? 267  DG  J "C1'" 1 
ATOM   5449  N N9    . DG  B 1 121 ? 44.750  49.028 -22.392 1.00 84.03  ? 267  DG  J N9    1 
ATOM   5450  C C8    . DG  B 1 121 ? 44.459  50.358 -22.592 1.00 84.81  ? 267  DG  J C8    1 
ATOM   5451  N N7    . DG  B 1 121 ? 43.551  50.808 -21.771 1.00 85.11  ? 267  DG  J N7    1 
ATOM   5452  C C5    . DG  B 1 121 ? 43.222  49.702 -21.001 1.00 84.56  ? 267  DG  J C5    1 
ATOM   5453  C C6    . DG  B 1 121 ? 42.314  49.567 -19.948 1.00 84.41  ? 267  DG  J C6    1 
ATOM   5454  O O6    . DG  B 1 121 ? 41.570  50.425 -19.473 1.00 82.05  ? 267  DG  J O6    1 
ATOM   5455  N N1    . DG  B 1 121 ? 42.313  48.268 -19.437 1.00 84.71  ? 267  DG  J N1    1 
ATOM   5456  C C2    . DG  B 1 121 ? 43.087  47.231 -19.907 1.00 86.70  ? 267  DG  J C2    1 
ATOM   5457  N N2    . DG  B 1 121 ? 42.960  46.034 -19.315 1.00 86.49  ? 267  DG  J N2    1 
ATOM   5458  N N3    . DG  B 1 121 ? 43.929  47.354 -20.895 1.00 86.68  ? 267  DG  J N3    1 
ATOM   5459  C C4    . DG  B 1 121 ? 43.950  48.601 -21.388 1.00 85.09  ? 267  DG  J C4    1 
ATOM   5460  P P     . DG  B 1 122 ? 48.035  45.942 -26.083 1.00 60.11  ? 268  DG  J P     1 
ATOM   5461  O OP1   . DG  B 1 122 ? 49.499  46.014 -25.864 1.00 87.18  ? 268  DG  J OP1   1 
ATOM   5462  O OP2   . DG  B 1 122 ? 47.435  46.458 -27.351 1.00 84.66  ? 268  DG  J OP2   1 
ATOM   5463  O "O5'" . DG  B 1 122 ? 47.584  44.442 -25.902 1.00 63.75  ? 268  DG  J "O5'" 1 
ATOM   5464  C "C5'" . DG  B 1 122 ? 46.266  44.091 -26.220 1.00 66.18  ? 268  DG  J "C5'" 1 
ATOM   5465  C "C4'" . DG  B 1 122 ? 45.698  43.185 -25.164 1.00 70.18  ? 268  DG  J "C4'" 1 
ATOM   5466  O "O4'" . DG  B 1 122 ? 45.147  43.981 -24.094 1.00 71.84  ? 268  DG  J "O4'" 1 
ATOM   5467  C "C3'" . DG  B 1 122 ? 44.535  42.413 -25.753 1.00 71.43  ? 268  DG  J "C3'" 1 
ATOM   5468  O "O3'" . DG  B 1 122 ? 44.584  41.083 -25.342 1.00 73.86  ? 268  DG  J "O3'" 1 
ATOM   5469  C "C2'" . DG  B 1 122 ? 43.299  43.120 -25.250 1.00 73.47  ? 268  DG  J "C2'" 1 
ATOM   5470  C "C1'" . DG  B 1 122 ? 43.760  43.713 -23.946 1.00 75.14  ? 268  DG  J "C1'" 1 
ATOM   5471  N N9    . DG  B 1 122 ? 43.088  44.968 -23.647 1.00 106.86 ? 268  DG  J N9    1 
ATOM   5472  C C8    . DG  B 1 122 ? 43.375  46.205 -24.166 1.00 109.43 ? 268  DG  J C8    1 
ATOM   5473  N N7    . DG  B 1 122 ? 42.596  47.146 -23.707 1.00 111.60 ? 268  DG  J N7    1 
ATOM   5474  C C5    . DG  B 1 122 ? 41.740  46.487 -22.835 1.00 112.16 ? 268  DG  J C5    1 
ATOM   5475  C C6    . DG  B 1 122 ? 40.668  46.984 -22.037 1.00 114.43 ? 268  DG  J C6    1 
ATOM   5476  O O6    . DG  B 1 122 ? 40.241  48.150 -21.947 1.00 115.66 ? 268  DG  J O6    1 
ATOM   5477  N N1    . DG  B 1 122 ? 40.073  45.967 -21.296 1.00 114.24 ? 268  DG  J N1    1 
ATOM   5478  C C2    . DG  B 1 122 ? 40.448  44.647 -21.319 1.00 113.95 ? 268  DG  J C2    1 
ATOM   5479  N N2    . DG  B 1 122 ? 39.750  43.825 -20.528 1.00 115.47 ? 268  DG  J N2    1 
ATOM   5480  N N3    . DG  B 1 122 ? 41.435  44.170 -22.061 1.00 112.26 ? 268  DG  J N3    1 
ATOM   5481  C C4    . DG  B 1 122 ? 42.034  45.140 -22.787 1.00 110.62 ? 268  DG  J C4    1 
ATOM   5482  P P     . DT  B 1 123 ? 43.735  40.019 -26.145 1.00 82.11  ? 269  DT  J P     1 
ATOM   5483  O OP1   . DT  B 1 123 ? 44.265  38.671 -25.797 1.00 93.93  ? 269  DT  J OP1   1 
ATOM   5484  O OP2   . DT  B 1 123 ? 43.707  40.456 -27.556 1.00 93.63  ? 269  DT  J OP2   1 
ATOM   5485  O "O5'" . DT  B 1 123 ? 42.272  40.250 -25.560 1.00 87.60  ? 269  DT  J "O5'" 1 
ATOM   5486  C "C5'" . DT  B 1 123 ? 41.986  40.001 -24.189 1.00 95.35  ? 269  DT  J "C5'" 1 
ATOM   5487  C "C4'" . DT  B 1 123 ? 40.507  40.148 -23.947 1.00 102.14 ? 269  DT  J "C4'" 1 
ATOM   5488  O "O4'" . DT  B 1 123 ? 40.170  41.535 -23.713 1.00 102.21 ? 269  DT  J "O4'" 1 
ATOM   5489  C "C3'" . DT  B 1 123 ? 39.668  39.694 -25.143 1.00 106.63 ? 269  DT  J "C3'" 1 
ATOM   5490  O "O3'" . DT  B 1 123 ? 38.518  38.974 -24.692 1.00 115.15 ? 269  DT  J "O3'" 1 
ATOM   5491  C "C2'" . DT  B 1 123 ? 39.229  41.007 -25.764 1.00 105.65 ? 269  DT  J "C2'" 1 
ATOM   5492  C "C1'" . DT  B 1 123 ? 39.063  41.862 -24.526 1.00 104.75 ? 269  DT  J "C1'" 1 
ATOM   5493  N N1    . DT  B 1 123 ? 39.048  43.324 -24.738 1.00 117.72 ? 269  DT  J N1    1 
ATOM   5494  C C2    . DT  B 1 123 ? 38.066  44.051 -24.104 1.00 117.78 ? 269  DT  J C2    1 
ATOM   5495  O O2    . DT  B 1 123 ? 37.243  43.549 -23.356 1.00 118.42 ? 269  DT  J O2    1 
ATOM   5496  N N3    . DT  B 1 123 ? 38.084  45.396 -24.371 1.00 117.14 ? 269  DT  J N3    1 
ATOM   5497  C C4    . DT  B 1 123 ? 38.967  46.073 -25.182 1.00 117.63 ? 269  DT  J C4    1 
ATOM   5498  O O4    . DT  B 1 123 ? 38.848  47.286 -25.337 1.00 115.45 ? 269  DT  J O4    1 
ATOM   5499  C C5    . DT  B 1 123 ? 39.988  45.252 -25.794 1.00 118.35 ? 269  DT  J C5    1 
ATOM   5500  C C7    . DT  B 1 123 ? 41.015  45.903 -26.668 1.00 120.79 ? 269  DT  J C7    1 
ATOM   5501  C C6    . DT  B 1 123 ? 39.973  43.935 -25.550 1.00 118.36 ? 269  DT  J C6    1 
ATOM   5502  P P     . DA  B 1 124 ? 38.357  37.413 -25.046 1.00 160.91 ? 270  DA  J P     1 
ATOM   5503  O OP1   . DA  B 1 124 ? 39.250  36.625 -24.156 1.00 112.48 ? 270  DA  J OP1   1 
ATOM   5504  O OP2   . DA  B 1 124 ? 38.453  37.250 -26.518 1.00 112.44 ? 270  DA  J OP2   1 
ATOM   5505  O "O5'" . DA  B 1 124 ? 36.862  37.099 -24.615 1.00 164.34 ? 270  DA  J "O5'" 1 
ATOM   5506  C "C5'" . DA  B 1 124 ? 36.471  37.168 -23.247 1.00 168.74 ? 270  DA  J "C5'" 1 
ATOM   5507  C "C4'" . DA  B 1 124 ? 35.074  37.730 -23.146 1.00 171.68 ? 270  DA  J "C4'" 1 
ATOM   5508  O "O4'" . DA  B 1 124 ? 35.093  39.172 -23.298 1.00 171.83 ? 270  DA  J "O4'" 1 
ATOM   5509  C "C3'" . DA  B 1 124 ? 34.165  37.206 -24.255 1.00 173.61 ? 270  DA  J "C3'" 1 
ATOM   5510  O "O3'" . DA  B 1 124 ? 32.845  36.981 -23.773 1.00 175.98 ? 270  DA  J "O3'" 1 
ATOM   5511  C "C2'" . DA  B 1 124 ? 34.154  38.342 -25.261 1.00 173.12 ? 270  DA  J "C2'" 1 
ATOM   5512  C "C1'" . DA  B 1 124 ? 34.217  39.546 -24.345 1.00 172.10 ? 270  DA  J "C1'" 1 
ATOM   5513  N N9    . DA  B 1 124 ? 34.736  40.774 -24.946 1.00 122.32 ? 270  DA  J N9    1 
ATOM   5514  C C8    . DA  B 1 124 ? 35.709  40.912 -25.901 1.00 121.84 ? 270  DA  J C8    1 
ATOM   5515  N N7    . DA  B 1 124 ? 35.956  42.161 -26.225 1.00 121.62 ? 270  DA  J N7    1 
ATOM   5516  C C5    . DA  B 1 124 ? 35.084  42.893 -25.431 1.00 121.80 ? 270  DA  J C5    1 
ATOM   5517  C C6    . DA  B 1 124 ? 34.844  44.283 -25.301 1.00 121.69 ? 270  DA  J C6    1 
ATOM   5518  N N6    . DA  B 1 124 ? 35.490  45.222 -26.002 1.00 120.79 ? 270  DA  J N6    1 
ATOM   5519  N N1    . DA  B 1 124 ? 33.903  44.676 -24.418 1.00 121.97 ? 270  DA  J N1    1 
ATOM   5520  C C2    . DA  B 1 124 ? 33.247  43.738 -23.722 1.00 121.90 ? 270  DA  J C2    1 
ATOM   5521  N N3    . DA  B 1 124 ? 33.378  42.412 -23.757 1.00 122.03 ? 270  DA  J N3    1 
ATOM   5522  C C4    . DA  B 1 124 ? 34.324  42.050 -24.639 1.00 121.97 ? 270  DA  J C4    1 
ATOM   5523  P P     . DG  B 1 125 ? 31.684  36.648 -24.822 1.00 126.06 ? 271  DG  J P     1 
ATOM   5524  O OP1   . DG  B 1 125 ? 30.542  36.056 -24.074 1.00 142.87 ? 271  DG  J OP1   1 
ATOM   5525  O OP2   . DG  B 1 125 ? 32.306  35.897 -25.944 1.00 142.17 ? 271  DG  J OP2   1 
ATOM   5526  O "O5'" . DG  B 1 125 ? 31.236  38.080 -25.359 1.00 127.80 ? 271  DG  J "O5'" 1 
ATOM   5527  C "C5'" . DG  B 1 125 ? 30.511  38.976 -24.518 1.00 130.81 ? 271  DG  J "C5'" 1 
ATOM   5528  C "C4'" . DG  B 1 125 ? 29.736  39.965 -25.353 1.00 132.82 ? 271  DG  J "C4'" 1 
ATOM   5529  O "O4'" . DG  B 1 125 ? 30.579  41.065 -25.758 1.00 132.91 ? 271  DG  J "O4'" 1 
ATOM   5530  C "C3'" . DG  B 1 125 ? 29.149  39.395 -26.642 1.00 134.12 ? 271  DG  J "C3'" 1 
ATOM   5531  O "O3'" . DG  B 1 125 ? 27.901  40.019 -26.897 1.00 136.19 ? 271  DG  J "O3'" 1 
ATOM   5532  C "C2'" . DG  B 1 125 ? 30.123  39.872 -27.703 1.00 133.83 ? 271  DG  J "C2'" 1 
ATOM   5533  C "C1'" . DG  B 1 125 ? 30.479  41.240 -27.161 1.00 133.28 ? 271  DG  J "C1'" 1 
ATOM   5534  N N9    . DG  B 1 125 ? 31.729  41.823 -27.629 1.00 149.79 ? 271  DG  J N9    1 
ATOM   5535  C C8    . DG  B 1 125 ? 32.875  41.169 -28.032 1.00 149.86 ? 271  DG  J C8    1 
ATOM   5536  N N7    . DG  B 1 125 ? 33.841  41.985 -28.366 1.00 149.41 ? 271  DG  J N7    1 
ATOM   5537  C C5    . DG  B 1 125 ? 33.301  43.255 -28.179 1.00 149.00 ? 271  DG  J C5    1 
ATOM   5538  C C6    . DG  B 1 125 ? 33.879  44.546 -28.366 1.00 148.62 ? 271  DG  J C6    1 
ATOM   5539  O O6    . DG  B 1 125 ? 35.023  44.835 -28.735 1.00 147.96 ? 271  DG  J O6    1 
ATOM   5540  N N1    . DG  B 1 125 ? 32.973  45.559 -28.068 1.00 148.91 ? 271  DG  J N1    1 
ATOM   5541  C C2    . DG  B 1 125 ? 31.683  45.365 -27.641 1.00 148.87 ? 271  DG  J C2    1 
ATOM   5542  N N2    . DG  B 1 125 ? 30.964  46.471 -27.426 1.00 148.83 ? 271  DG  J N2    1 
ATOM   5543  N N3    . DG  B 1 125 ? 31.136  44.173 -27.448 1.00 149.01 ? 271  DG  J N3    1 
ATOM   5544  C C4    . DG  B 1 125 ? 31.997  43.169 -27.736 1.00 149.40 ? 271  DG  J C4    1 
ATOM   5545  P P     . DA  B 1 126 ? 26.743  39.192 -27.630 1.00 189.78 ? 272  DA  J P     1 
ATOM   5546  O OP1   . DA  B 1 126 ? 26.143  38.208 -26.688 1.00 183.20 ? 272  DA  J OP1   1 
ATOM   5547  O OP2   . DA  B 1 126 ? 27.338  38.718 -28.909 1.00 182.94 ? 272  DA  J OP2   1 
ATOM   5548  O "O5'" . DA  B 1 126 ? 25.696  40.355 -27.922 1.00 190.50 ? 272  DA  J "O5'" 1 
ATOM   5549  C "C5'" . DA  B 1 126 ? 25.326  41.253 -26.866 1.00 191.54 ? 272  DA  J "C5'" 1 
ATOM   5550  C "C4'" . DA  B 1 126 ? 25.149  42.662 -27.384 1.00 192.17 ? 272  DA  J "C4'" 1 
ATOM   5551  O "O4'" . DA  B 1 126 ? 26.426  43.281 -27.673 1.00 192.62 ? 272  DA  J "O4'" 1 
ATOM   5552  C "C3'" . DA  B 1 126 ? 24.316  42.799 -28.654 1.00 192.73 ? 272  DA  J "C3'" 1 
ATOM   5553  O "O3'" . DA  B 1 126 ? 23.516  43.973 -28.524 1.00 193.30 ? 272  DA  J "O3'" 1 
ATOM   5554  C "C2'" . DA  B 1 126 ? 25.370  42.973 -29.731 1.00 192.93 ? 272  DA  J "C2'" 1 
ATOM   5555  C "C1'" . DA  B 1 126 ? 26.420  43.787 -28.995 1.00 193.23 ? 272  DA  J "C1'" 1 
ATOM   5556  N N9    . DA  B 1 126 ? 27.786  43.707 -29.513 1.00 187.58 ? 272  DA  J N9    1 
ATOM   5557  C C8    . DA  B 1 126 ? 28.547  42.591 -29.775 1.00 187.73 ? 272  DA  J C8    1 
ATOM   5558  N N7    . DA  B 1 126 ? 29.757  42.865 -30.208 1.00 187.91 ? 272  DA  J N7    1 
ATOM   5559  C C5    . DA  B 1 126 ? 29.794  44.255 -30.243 1.00 187.99 ? 272  DA  J C5    1 
ATOM   5560  C C6    . DA  B 1 126 ? 30.804  45.173 -30.614 1.00 187.83 ? 272  DA  J C6    1 
ATOM   5561  N N6    . DA  B 1 126 ? 32.018  44.814 -31.041 1.00 187.67 ? 272  DA  J N6    1 
ATOM   5562  N N1    . DA  B 1 126 ? 30.515  46.491 -30.526 1.00 187.67 ? 272  DA  J N1    1 
ATOM   5563  C C2    . DA  B 1 126 ? 29.299  46.853 -30.100 1.00 187.85 ? 272  DA  J C2    1 
ATOM   5564  N N3    . DA  B 1 126 ? 28.271  46.090 -29.728 1.00 187.92 ? 272  DA  J N3    1 
ATOM   5565  C C4    . DA  B 1 126 ? 28.587  44.784 -29.821 1.00 187.96 ? 272  DA  J C4    1 
ATOM   5566  P P     . DA  B 1 127 ? 22.862  44.644 -29.822 1.00 163.12 ? 273  DA  J P     1 
ATOM   5567  O OP1   . DA  B 1 127 ? 21.764  45.510 -29.326 1.00 162.05 ? 273  DA  J OP1   1 
ATOM   5568  O OP2   . DA  B 1 127 ? 22.576  43.591 -30.835 1.00 162.09 ? 273  DA  J OP2   1 
ATOM   5569  O "O5'" . DA  B 1 127 ? 24.012  45.587 -30.381 1.00 163.08 ? 273  DA  J "O5'" 1 
ATOM   5570  C "C5'" . DA  B 1 127 ? 24.195  46.894 -29.850 1.00 163.19 ? 273  DA  J "C5'" 1 
ATOM   5571  C "C4'" . DA  B 1 127 ? 24.553  47.847 -30.962 1.00 163.17 ? 273  DA  J "C4'" 1 
ATOM   5572  O "O4'" . DA  B 1 127 ? 25.914  47.593 -31.393 1.00 163.90 ? 273  DA  J "O4'" 1 
ATOM   5573  C "C3'" . DA  B 1 127 ? 23.673  47.658 -32.196 1.00 162.80 ? 273  DA  J "C3'" 1 
ATOM   5574  O "O3'" . DA  B 1 127 ? 23.409  48.921 -32.788 1.00 160.78 ? 273  DA  J "O3'" 1 
ATOM   5575  C "C2'" . DA  B 1 127 ? 24.537  46.814 -33.114 1.00 163.56 ? 273  DA  J "C2'" 1 
ATOM   5576  C "C1'" . DA  B 1 127 ? 25.928  47.322 -32.785 1.00 164.23 ? 273  DA  J "C1'" 1 
ATOM   5577  N N9    . DA  B 1 127 ? 27.011  46.374 -33.065 1.00 163.72 ? 273  DA  J N9    1 
ATOM   5578  C C8    . DA  B 1 127 ? 26.954  45.001 -33.092 1.00 163.97 ? 273  DA  J C8    1 
ATOM   5579  N N7    . DA  B 1 127 ? 28.095  44.430 -33.394 1.00 163.84 ? 273  DA  J N7    1 
ATOM   5580  C C5    . DA  B 1 127 ? 28.966  45.499 -33.574 1.00 163.32 ? 273  DA  J C5    1 
ATOM   5581  C C6    . DA  B 1 127 ? 30.336  45.564 -33.906 1.00 163.02 ? 273  DA  J C6    1 
ATOM   5582  N N6    . DA  B 1 127 ? 31.099  44.491 -34.123 1.00 162.79 ? 273  DA  J N6    1 
ATOM   5583  N N1    . DA  B 1 127 ? 30.902  46.787 -34.008 1.00 162.82 ? 273  DA  J N1    1 
ATOM   5584  C C2    . DA  B 1 127 ? 30.139  47.863 -33.787 1.00 162.83 ? 273  DA  J C2    1 
ATOM   5585  N N3    . DA  B 1 127 ? 28.847  47.932 -33.466 1.00 163.16 ? 273  DA  J N3    1 
ATOM   5586  C C4    . DA  B 1 127 ? 28.312  46.700 -33.373 1.00 163.39 ? 273  DA  J C4    1 
ATOM   5587  P P     . DT  B 1 128 ? 22.372  49.037 -34.007 1.00 160.29 ? 274  DT  J P     1 
ATOM   5588  O OP1   . DT  B 1 128 ? 21.140  49.668 -33.493 1.00 135.79 ? 274  DT  J OP1   1 
ATOM   5589  O OP2   . DT  B 1 128 ? 22.289  47.775 -34.784 1.00 135.60 ? 274  DT  J OP2   1 
ATOM   5590  O "O5'" . DT  B 1 128 ? 23.079  50.138 -34.888 1.00 158.78 ? 274  DT  J "O5'" 1 
ATOM   5591  C "C5'" . DT  B 1 128 ? 23.744  51.201 -34.240 1.00 155.79 ? 274  DT  J "C5'" 1 
ATOM   5592  C "C4'" . DT  B 1 128 ? 24.840  51.724 -35.124 1.00 153.69 ? 274  DT  J "C4'" 1 
ATOM   5593  O "O4'" . DT  B 1 128 ? 26.025  50.888 -35.117 1.00 153.49 ? 274  DT  J "O4'" 1 
ATOM   5594  C "C3'" . DT  B 1 128 ? 24.420  51.869 -36.579 1.00 152.05 ? 274  DT  J "C3'" 1 
ATOM   5595  O "O3'" . DT  B 1 128 ? 24.909  53.141 -36.944 1.00 149.04 ? 274  DT  J "O3'" 1 
ATOM   5596  C "C2'" . DT  B 1 128 ? 25.167  50.746 -37.277 1.00 152.49 ? 274  DT  J "C2'" 1 
ATOM   5597  C "C1'" . DT  B 1 128 ? 26.442  50.678 -36.456 1.00 153.09 ? 274  DT  J "C1'" 1 
ATOM   5598  N N1    . DT  B 1 128 ? 27.098  49.365 -36.533 1.00 129.05 ? 274  DT  J N1    1 
ATOM   5599  C C2    . DT  B 1 128 ? 28.448  49.289 -36.836 1.00 129.16 ? 274  DT  J C2    1 
ATOM   5600  O O2    . DT  B 1 128 ? 29.167  50.269 -36.989 1.00 129.09 ? 274  DT  J O2    1 
ATOM   5601  N N3    . DT  B 1 128 ? 28.928  48.006 -36.951 1.00 128.83 ? 274  DT  J N3    1 
ATOM   5602  C C4    . DT  B 1 128 ? 28.220  46.830 -36.779 1.00 128.54 ? 274  DT  J C4    1 
ATOM   5603  O O4    . DT  B 1 128 ? 28.778  45.752 -36.935 1.00 128.48 ? 274  DT  J O4    1 
ATOM   5604  C C5    . DT  B 1 128 ? 26.831  46.991 -36.423 1.00 128.36 ? 274  DT  J C5    1 
ATOM   5605  C C7    . DT  B 1 128 ? 25.999  45.773 -36.175 1.00 127.92 ? 274  DT  J C7    1 
ATOM   5606  C C6    . DT  B 1 128 ? 26.346  48.231 -36.324 1.00 128.59 ? 274  DT  J C6    1 
ATOM   5607  P P     . DC  B 1 129 ? 25.175  53.502 -38.469 1.00 155.71 ? 275  DC  J P     1 
ATOM   5608  O OP1   . DC  B 1 129 ? 24.753  54.923 -38.526 1.00 133.01 ? 275  DC  J OP1   1 
ATOM   5609  O OP2   . DC  B 1 129 ? 24.528  52.500 -39.368 1.00 132.68 ? 275  DC  J OP2   1 
ATOM   5610  O "O5'" . DC  B 1 129 ? 26.769  53.411 -38.593 1.00 152.70 ? 275  DC  J "O5'" 1 
ATOM   5611  C "C5'" . DC  B 1 129 ? 27.644  53.712 -37.478 1.00 146.41 ? 275  DC  J "C5'" 1 
ATOM   5612  C "C4'" . DC  B 1 129 ? 29.094  53.655 -37.910 1.00 141.47 ? 275  DC  J "C4'" 1 
ATOM   5613  O "O4'" . DC  B 1 129 ? 29.547  52.281 -38.072 1.00 139.92 ? 275  DC  J "O4'" 1 
ATOM   5614  C "C3'" . DC  B 1 129 ? 29.307  54.326 -39.268 1.00 137.91 ? 275  DC  J "C3'" 1 
ATOM   5615  O "O3'" . DC  B 1 129 ? 30.589  54.953 -39.388 1.00 132.07 ? 275  DC  J "O3'" 1 
ATOM   5616  C "C2'" . DC  B 1 129 ? 29.276  53.158 -40.223 1.00 137.69 ? 275  DC  J "C2'" 1 
ATOM   5617  C "C1'" . DC  B 1 129 ? 29.987  52.109 -39.408 1.00 138.57 ? 275  DC  J "C1'" 1 
ATOM   5618  N N1    . DC  B 1 129 ? 29.667  50.758 -39.868 1.00 115.17 ? 275  DC  J N1    1 
ATOM   5619  C C2    . DC  B 1 129 ? 30.691  50.039 -40.445 1.00 115.10 ? 275  DC  J C2    1 
ATOM   5620  O O2    . DC  B 1 129 ? 31.832  50.537 -40.454 1.00 114.88 ? 275  DC  J O2    1 
ATOM   5621  N N3    . DC  B 1 129 ? 30.433  48.828 -40.979 1.00 114.80 ? 275  DC  J N3    1 
ATOM   5622  C C4    . DC  B 1 129 ? 29.199  48.326 -40.926 1.00 115.22 ? 275  DC  J C4    1 
ATOM   5623  N N4    . DC  B 1 129 ? 28.987  47.149 -41.507 1.00 115.32 ? 275  DC  J N4    1 
ATOM   5624  C C5    . DC  B 1 129 ? 28.132  49.019 -40.288 1.00 115.04 ? 275  DC  J C5    1 
ATOM   5625  C C6    . DC  B 1 129 ? 28.408  50.228 -39.778 1.00 115.01 ? 275  DC  J C6    1 
ATOM   5626  P P     . DT  B 1 130 ? 30.946  55.761 -40.734 1.00 101.00 ? 276  DT  J P     1 
ATOM   5627  O OP1   . DT  B 1 130 ? 32.032  56.725 -40.433 1.00 109.17 ? 276  DT  J OP1   1 
ATOM   5628  O OP2   . DT  B 1 130 ? 29.669  56.231 -41.320 1.00 109.79 ? 276  DT  J OP2   1 
ATOM   5629  O "O5'" . DT  B 1 130 ? 31.566  54.689 -41.739 1.00 95.97  ? 276  DT  J "O5'" 1 
ATOM   5630  C "C5'" . DT  B 1 130 ? 32.982  54.631 -41.928 1.00 85.56  ? 276  DT  J "C5'" 1 
ATOM   5631  C "C4'" . DT  B 1 130 ? 33.358  53.802 -43.141 1.00 78.85  ? 276  DT  J "C4'" 1 
ATOM   5632  O "O4'" . DT  B 1 130 ? 32.649  52.514 -43.098 1.00 77.23  ? 276  DT  J "O4'" 1 
ATOM   5633  C "C3'" . DT  B 1 130 ? 33.188  54.376 -44.576 1.00 74.85  ? 276  DT  J "C3'" 1 
ATOM   5634  O "O3'" . DT  B 1 130 ? 34.324  53.961 -45.433 1.00 68.73  ? 276  DT  J "O3'" 1 
ATOM   5635  C "C2'" . DT  B 1 130 ? 31.993  53.546 -45.044 1.00 74.73  ? 276  DT  J "C2'" 1 
ATOM   5636  C "C1'" . DT  B 1 130 ? 32.307  52.183 -44.428 1.00 77.77  ? 276  DT  J "C1'" 1 
ATOM   5637  N N1    . DT  B 1 130 ? 31.219  51.191 -44.410 1.00 88.94  ? 276  DT  J N1    1 
ATOM   5638  C C2    . DT  B 1 130 ? 31.513  49.872 -44.698 1.00 91.17  ? 276  DT  J C2    1 
ATOM   5639  O O2    . DT  B 1 130 ? 32.620  49.484 -45.015 1.00 90.69  ? 276  DT  J O2    1 
ATOM   5640  N N3    . DT  B 1 130 ? 30.450  49.018 -44.607 1.00 92.80  ? 276  DT  J N3    1 
ATOM   5641  C C4    . DT  B 1 130 ? 29.145  49.338 -44.284 1.00 94.79  ? 276  DT  J C4    1 
ATOM   5642  O O4    . DT  B 1 130 ? 28.294  48.445 -44.220 1.00 96.85  ? 276  DT  J O4    1 
ATOM   5643  C C5    . DT  B 1 130 ? 28.902  50.749 -44.034 1.00 94.68  ? 276  DT  J C5    1 
ATOM   5644  C C7    . DT  B 1 130 ? 27.513  51.207 -43.721 1.00 94.75  ? 276  DT  J C7    1 
ATOM   5645  C C6    . DT  B 1 130 ? 29.942  51.587 -44.103 1.00 92.45  ? 276  DT  J C6    1 
ATOM   5646  P P     . DG  B 1 131 ? 35.279  55.000 -46.271 1.00 64.18  ? 277  DG  J P     1 
ATOM   5647  O OP1   . DG  B 1 131 ? 35.950  55.999 -45.350 1.00 80.94  ? 277  DG  J OP1   1 
ATOM   5648  O OP2   . DG  B 1 131 ? 34.605  55.438 -47.570 1.00 81.54  ? 277  DG  J OP2   1 
ATOM   5649  O "O5'" . DG  B 1 131 ? 36.417  54.011 -46.818 1.00 62.88  ? 277  DG  J "O5'" 1 
ATOM   5650  C "C5'" . DG  B 1 131 ? 37.386  53.376 -46.005 1.00 55.41  ? 277  DG  J "C5'" 1 
ATOM   5651  C "C4'" . DG  B 1 131 ? 37.822  52.154 -46.759 1.00 52.35  ? 277  DG  J "C4'" 1 
ATOM   5652  O "O4'" . DG  B 1 131 ? 36.603  51.400 -46.739 1.00 54.28  ? 277  DG  J "O4'" 1 
ATOM   5653  C "C3'" . DG  B 1 131 ? 38.154  52.365 -48.248 1.00 50.50  ? 277  DG  J "C3'" 1 
ATOM   5654  O "O3'" . DG  B 1 131 ? 39.276  51.521 -48.551 1.00 44.74  ? 277  DG  J "O3'" 1 
ATOM   5655  C "C2'" . DG  B 1 131 ? 36.888  51.991 -49.003 1.00 51.18  ? 277  DG  J "C2'" 1 
ATOM   5656  C "C1'" . DG  B 1 131 ? 36.194  51.041 -48.057 1.00 55.74  ? 277  DG  J "C1'" 1 
ATOM   5657  N N9    . DG  B 1 131 ? 34.735  51.142 -48.122 1.00 78.51  ? 277  DG  J N9    1 
ATOM   5658  C C8    . DG  B 1 131 ? 34.010  52.303 -48.130 1.00 80.12  ? 277  DG  J C8    1 
ATOM   5659  N N7    . DG  B 1 131 ? 32.721  52.111 -48.138 1.00 81.89  ? 277  DG  J N7    1 
ATOM   5660  C C5    . DG  B 1 131 ? 32.579  50.734 -48.150 1.00 83.96  ? 277  DG  J C5    1 
ATOM   5661  C C6    . DG  B 1 131 ? 31.411  49.931 -48.143 1.00 87.25  ? 277  DG  J C6    1 
ATOM   5662  O O6    . DG  B 1 131 ? 30.222  50.294 -48.121 1.00 90.11  ? 277  DG  J O6    1 
ATOM   5663  N N1    . DG  B 1 131 ? 31.731  48.569 -48.166 1.00 86.85  ? 277  DG  J N1    1 
ATOM   5664  C C2    . DG  B 1 131 ? 33.007  48.059 -48.201 1.00 86.40  ? 277  DG  J C2    1 
ATOM   5665  N N2    . DG  B 1 131 ? 33.112  46.735 -48.258 1.00 85.44  ? 277  DG  J N2    1 
ATOM   5666  N N3    . DG  B 1 131 ? 34.098  48.799 -48.191 1.00 84.18  ? 277  DG  J N3    1 
ATOM   5667  C C4    . DG  B 1 131 ? 33.816  50.118 -48.164 1.00 81.64  ? 277  DG  J C4    1 
ATOM   5668  P P     . DC  B 1 132 ? 39.770  51.330 -50.072 1.00 51.95  ? 278  DC  J P     1 
ATOM   5669  O OP1   . DC  B 1 132 ? 41.179  50.917 -50.168 1.00 66.39  ? 278  DC  J OP1   1 
ATOM   5670  O OP2   . DC  B 1 132 ? 39.366  52.551 -50.821 1.00 68.54  ? 278  DC  J OP2   1 
ATOM   5671  O "O5'" . DC  B 1 132 ? 38.854  50.130 -50.631 1.00 52.42  ? 278  DC  J "O5'" 1 
ATOM   5672  C "C5'" . DC  B 1 132 ? 38.546  48.943 -49.891 1.00 52.90  ? 278  DC  J "C5'" 1 
ATOM   5673  C "C4'" . DC  B 1 132 ? 37.686  48.012 -50.726 1.00 58.68  ? 278  DC  J "C4'" 1 
ATOM   5674  O "O4'" . DC  B 1 132 ? 36.262  48.266 -50.599 1.00 56.74  ? 278  DC  J "O4'" 1 
ATOM   5675  C "C3'" . DC  B 1 132 ? 37.959  48.019 -52.224 1.00 59.35  ? 278  DC  J "C3'" 1 
ATOM   5676  O "O3'" . DC  B 1 132 ? 37.883  46.674 -52.722 1.00 62.49  ? 278  DC  J "O3'" 1 
ATOM   5677  C "C2'" . DC  B 1 132 ? 36.852  48.907 -52.776 1.00 60.23  ? 278  DC  J "C2'" 1 
ATOM   5678  C "C1'" . DC  B 1 132 ? 35.692  48.479 -51.899 1.00 60.39  ? 278  DC  J "C1'" 1 
ATOM   5679  N N1    . DC  B 1 132 ? 34.603  49.459 -51.753 1.00 77.31  ? 278  DC  J N1    1 
ATOM   5680  C C2    . DC  B 1 132 ? 33.305  49.001 -51.625 1.00 78.61  ? 278  DC  J C2    1 
ATOM   5681  O O2    . DC  B 1 132 ? 33.112  47.792 -51.678 1.00 77.01  ? 278  DC  J O2    1 
ATOM   5682  N N3    . DC  B 1 132 ? 32.302  49.892 -51.434 1.00 81.22  ? 278  DC  J N3    1 
ATOM   5683  C C4    . DC  B 1 132 ? 32.574  51.197 -51.385 1.00 81.70  ? 278  DC  J C4    1 
ATOM   5684  N N4    . DC  B 1 132 ? 31.566  52.035 -51.177 1.00 84.96  ? 278  DC  J N4    1 
ATOM   5685  C C5    . DC  B 1 132 ? 33.898  51.690 -51.539 1.00 81.13  ? 278  DC  J C5    1 
ATOM   5686  C C6    . DC  B 1 132 ? 34.869  50.795 -51.727 1.00 77.93  ? 278  DC  J C6    1 
ATOM   5687  P P     . DA  B 1 133 ? 39.135  46.038 -53.542 1.00 55.36  ? 279  DA  J P     1 
ATOM   5688  O OP1   . DA  B 1 133 ? 40.338  46.131 -52.667 1.00 57.85  ? 279  DA  J OP1   1 
ATOM   5689  O OP2   . DA  B 1 133 ? 39.209  46.619 -54.927 1.00 65.30  ? 279  DA  J OP2   1 
ATOM   5690  O "O5'" . DA  B 1 133 ? 38.757  44.477 -53.624 1.00 59.57  ? 279  DA  J "O5'" 1 
ATOM   5691  C "C5'" . DA  B 1 133 ? 38.275  43.733 -52.461 1.00 62.61  ? 279  DA  J "C5'" 1 
ATOM   5692  C "C4'" . DA  B 1 133 ? 37.053  42.912 -52.822 1.00 66.97  ? 279  DA  J "C4'" 1 
ATOM   5693  O "O4'" . DA  B 1 133 ? 35.896  43.751 -52.967 1.00 66.44  ? 279  DA  J "O4'" 1 
ATOM   5694  C "C3'" . DA  B 1 133 ? 37.167  42.216 -54.170 1.00 67.96  ? 279  DA  J "C3'" 1 
ATOM   5695  O "O3'" . DA  B 1 133 ? 36.392  41.016 -54.124 1.00 74.98  ? 279  DA  J "O3'" 1 
ATOM   5696  C "C2'" . DA  B 1 133 ? 36.630  43.228 -55.166 1.00 66.42  ? 279  DA  J "C2'" 1 
ATOM   5697  C "C1'" . DA  B 1 133 ? 35.495  43.799 -54.347 1.00 65.43  ? 279  DA  J "C1'" 1 
ATOM   5698  N N9    . DA  B 1 133 ? 35.162  45.190 -54.621 1.00 70.44  ? 279  DA  J N9    1 
ATOM   5699  C C8    . DA  B 1 133 ? 36.032  46.221 -54.819 1.00 67.90  ? 279  DA  J C8    1 
ATOM   5700  N N7    . DA  B 1 133 ? 35.452  47.392 -54.891 1.00 67.18  ? 279  DA  J N7    1 
ATOM   5701  C C5    . DA  B 1 133 ? 34.108  47.105 -54.751 1.00 70.53  ? 279  DA  J C5    1 
ATOM   5702  C C6    . DA  B 1 133 ? 32.971  47.914 -54.706 1.00 70.72  ? 279  DA  J C6    1 
ATOM   5703  N N6    . DA  B 1 133 ? 33.010  49.249 -54.756 1.00 70.55  ? 279  DA  J N6    1 
ATOM   5704  N N1    . DA  B 1 133 ? 31.776  47.304 -54.599 1.00 72.26  ? 279  DA  J N1    1 
ATOM   5705  C C2    . DA  B 1 133 ? 31.736  45.971 -54.530 1.00 70.17  ? 279  DA  J C2    1 
ATOM   5706  N N3    . DA  B 1 133 ? 32.731  45.108 -54.533 1.00 72.03  ? 279  DA  J N3    1 
ATOM   5707  C C4    . DA  B 1 133 ? 33.905  45.743 -54.641 1.00 70.54  ? 279  DA  J C4    1 
ATOM   5708  P P     . DG  B 1 134 ? 36.560  39.927 -55.283 1.00 87.81  ? 280  DG  J P     1 
ATOM   5709  O OP1   . DG  B 1 134 ? 36.421  38.630 -54.587 1.00 91.35  ? 280  DG  J OP1   1 
ATOM   5710  O OP2   . DG  B 1 134 ? 37.783  40.208 -56.085 1.00 89.25  ? 280  DG  J OP2   1 
ATOM   5711  O "O5'" . DG  B 1 134 ? 35.265  40.160 -56.175 1.00 89.35  ? 280  DG  J "O5'" 1 
ATOM   5712  C "C5'" . DG  B 1 134 ? 33.972  40.157 -55.578 1.00 92.68  ? 280  DG  J "C5'" 1 
ATOM   5713  C "C4'" . DG  B 1 134 ? 32.925  40.493 -56.611 1.00 94.48  ? 280  DG  J "C4'" 1 
ATOM   5714  O "O4'" . DG  B 1 134 ? 32.824  41.923 -56.773 1.00 94.34  ? 280  DG  J "O4'" 1 
ATOM   5715  C "C3'" . DG  B 1 134 ? 33.176  39.920 -58.003 1.00 96.26  ? 280  DG  J "C3'" 1 
ATOM   5716  O "O3'" . DG  B 1 134 ? 31.911  39.505 -58.515 1.00 98.81  ? 280  DG  J "O3'" 1 
ATOM   5717  C "C2'" . DG  B 1 134 ? 33.760  41.101 -58.772 1.00 95.02  ? 280  DG  J "C2'" 1 
ATOM   5718  C "C1'" . DG  B 1 134 ? 33.084  42.306 -58.118 1.00 93.78  ? 280  DG  J "C1'" 1 
ATOM   5719  N N9    . DG  B 1 134 ? 33.824  43.572 -58.082 1.00 94.83  ? 280  DG  J N9    1 
ATOM   5720  C C8    . DG  B 1 134 ? 35.193  43.755 -58.070 1.00 93.51  ? 280  DG  J C8    1 
ATOM   5721  N N7    . DG  B 1 134 ? 35.546  45.013 -58.020 1.00 91.09  ? 280  DG  J N7    1 
ATOM   5722  C C5    . DG  B 1 134 ? 34.346  45.713 -58.004 1.00 91.88  ? 280  DG  J C5    1 
ATOM   5723  C C6    . DG  B 1 134 ? 34.102  47.112 -57.967 1.00 92.13  ? 280  DG  J C6    1 
ATOM   5724  O O6    . DG  B 1 134 ? 34.924  48.037 -57.952 1.00 89.07  ? 280  DG  J O6    1 
ATOM   5725  N N1    . DG  B 1 134 ? 32.735  47.393 -57.960 1.00 93.13  ? 280  DG  J N1    1 
ATOM   5726  C C2    . DG  B 1 134 ? 31.735  46.446 -57.998 1.00 93.47  ? 280  DG  J C2    1 
ATOM   5727  N N2    . DG  B 1 134 ? 30.481  46.913 -58.007 1.00 94.01  ? 280  DG  J N2    1 
ATOM   5728  N N3    . DG  B 1 134 ? 31.952  45.139 -58.035 1.00 93.77  ? 280  DG  J N3    1 
ATOM   5729  C C4    . DG  B 1 134 ? 33.276  44.843 -58.037 1.00 93.30  ? 280  DG  J C4    1 
ATOM   5730  P P     . DG  B 1 135 ? 31.794  38.865 -59.975 1.00 105.66 ? 281  DG  J P     1 
ATOM   5731  O OP1   . DG  B 1 135 ? 31.121  37.568 -59.770 1.00 86.99  ? 281  DG  J OP1   1 
ATOM   5732  O OP2   . DG  B 1 135 ? 33.066  38.924 -60.744 1.00 84.95  ? 281  DG  J OP2   1 
ATOM   5733  O "O5'" . DG  B 1 135 ? 30.743  39.857 -60.632 1.00 108.89 ? 281  DG  J "O5'" 1 
ATOM   5734  C "C5'" . DG  B 1 135 ? 29.550  40.203 -59.921 1.00 113.51 ? 281  DG  J "C5'" 1 
ATOM   5735  C "C4'" . DG  B 1 135 ? 28.776  41.250 -60.685 1.00 117.57 ? 281  DG  J "C4'" 1 
ATOM   5736  O "O4'" . DG  B 1 135 ? 29.294  42.569 -60.384 1.00 117.37 ? 281  DG  J "O4'" 1 
ATOM   5737  C "C3'" . DG  B 1 135 ? 28.885  41.074 -62.202 1.00 120.64 ? 281  DG  J "C3'" 1 
ATOM   5738  O "O3'" . DG  B 1 135 ? 27.620  41.275 -62.846 1.00 126.04 ? 281  DG  J "O3'" 1 
ATOM   5739  C "C2'" . DG  B 1 135 ? 29.881  42.144 -62.610 1.00 119.47 ? 281  DG  J "C2'" 1 
ATOM   5740  C "C1'" . DG  B 1 135 ? 29.628  43.239 -61.591 1.00 117.59 ? 281  DG  J "C1'" 1 
ATOM   5741  N N9    . DG  B 1 135 ? 30.798  44.072 -61.350 1.00 95.93  ? 281  DG  J N9    1 
ATOM   5742  C C8    . DG  B 1 135 ? 32.068  43.642 -61.040 1.00 95.40  ? 281  DG  J C8    1 
ATOM   5743  N N7    . DG  B 1 135 ? 32.930  44.615 -60.914 1.00 95.14  ? 281  DG  J N7    1 
ATOM   5744  C C5    . DG  B 1 135 ? 32.188  45.768 -61.147 1.00 94.76  ? 281  DG  J C5    1 
ATOM   5745  C C6    . DG  B 1 135 ? 32.587  47.126 -61.151 1.00 94.00  ? 281  DG  J C6    1 
ATOM   5746  O O6    . DG  B 1 135 ? 33.707  47.600 -60.954 1.00 92.98  ? 281  DG  J O6    1 
ATOM   5747  N N1    . DG  B 1 135 ? 31.517  47.971 -61.425 1.00 94.66  ? 281  DG  J N1    1 
ATOM   5748  C C2    . DG  B 1 135 ? 30.233  47.565 -61.672 1.00 94.93  ? 281  DG  J C2    1 
ATOM   5749  N N2    . DG  B 1 135 ? 29.352  48.542 -61.912 1.00 95.77  ? 281  DG  J N2    1 
ATOM   5750  N N3    . DG  B 1 135 ? 29.843  46.298 -61.682 1.00 95.07  ? 281  DG  J N3    1 
ATOM   5751  C C4    . DG  B 1 135 ? 30.871  45.453 -61.409 1.00 95.58  ? 281  DG  J C4    1 
ATOM   5752  P P     . DT  B 1 136 ? 27.558  41.488 -64.442 1.00 122.76 ? 282  DT  J P     1 
ATOM   5753  O OP1   . DT  B 1 136 ? 26.192  41.107 -64.891 1.00 101.44 ? 282  DT  J OP1   1 
ATOM   5754  O OP2   . DT  B 1 136 ? 28.748  40.845 -65.073 1.00 101.15 ? 282  DT  J OP2   1 
ATOM   5755  O "O5'" . DT  B 1 136 ? 27.733  43.063 -64.598 1.00 123.57 ? 282  DT  J "O5'" 1 
ATOM   5756  C "C5'" . DT  B 1 136 ? 26.771  43.958 -64.049 1.00 125.95 ? 282  DT  J "C5'" 1 
ATOM   5757  C "C4'" . DT  B 1 136 ? 26.694  45.197 -64.903 1.00 127.63 ? 282  DT  J "C4'" 1 
ATOM   5758  O "O4'" . DT  B 1 136 ? 27.730  46.130 -64.512 1.00 126.93 ? 282  DT  J "O4'" 1 
ATOM   5759  C "C3'" . DT  B 1 136 ? 26.935  44.870 -66.376 1.00 129.49 ? 282  DT  J "C3'" 1 
ATOM   5760  O "O3'" . DT  B 1 136 ? 26.029  45.574 -67.216 1.00 133.34 ? 282  DT  J "O3'" 1 
ATOM   5761  C "C2'" . DT  B 1 136 ? 28.355  45.338 -66.620 1.00 127.99 ? 282  DT  J "C2'" 1 
ATOM   5762  C "C1'" . DT  B 1 136 ? 28.501  46.489 -65.643 1.00 125.92 ? 282  DT  J "C1'" 1 
ATOM   5763  N N1    . DT  B 1 136 ? 29.891  46.708 -65.201 1.00 102.37 ? 282  DT  J N1    1 
ATOM   5764  C C2    . DT  B 1 136 ? 30.375  47.994 -65.179 1.00 101.26 ? 282  DT  J C2    1 
ATOM   5765  O O2    . DT  B 1 136 ? 29.700  48.960 -65.463 1.00 101.34 ? 282  DT  J O2    1 
ATOM   5766  N N3    . DT  B 1 136 ? 31.689  48.108 -64.812 1.00 100.60 ? 282  DT  J N3    1 
ATOM   5767  C C4    . DT  B 1 136 ? 32.551  47.085 -64.482 1.00 100.21 ? 282  DT  J C4    1 
ATOM   5768  O O4    . DT  B 1 136 ? 33.711  47.337 -64.195 1.00 99.49  ? 282  DT  J O4    1 
ATOM   5769  C C5    . DT  B 1 136 ? 31.978  45.760 -64.511 1.00 100.61 ? 282  DT  J C5    1 
ATOM   5770  C C7    . DT  B 1 136 ? 32.843  44.586 -64.178 1.00 100.15 ? 282  DT  J C7    1 
ATOM   5771  C C6    . DT  B 1 136 ? 30.689  45.641 -64.852 1.00 101.42 ? 282  DT  J C6    1 
ATOM   5772  P P     . DG  B 1 137 ? 25.894  45.160 -68.762 1.00 150.73 ? 283  DG  J P     1 
ATOM   5773  O OP1   . DG  B 1 137 ? 24.472  44.775 -69.016 1.00 117.96 ? 283  DG  J OP1   1 
ATOM   5774  O OP2   . DG  B 1 137 ? 26.983  44.209 -69.095 1.00 118.40 ? 283  DG  J OP2   1 
ATOM   5775  O "O5'" . DG  B 1 137 ? 26.227  46.524 -69.505 1.00 151.01 ? 283  DG  J "O5'" 1 
ATOM   5776  C "C5'" . DG  B 1 137 ? 25.806  47.761 -68.947 1.00 152.19 ? 283  DG  J "C5'" 1 
ATOM   5777  C "C4'" . DG  B 1 137 ? 26.730  48.863 -69.395 1.00 152.87 ? 283  DG  J "C4'" 1 
ATOM   5778  O "O4'" . DG  B 1 137 ? 27.993  48.801 -68.689 1.00 152.76 ? 283  DG  J "O4'" 1 
ATOM   5779  C "C3'" . DG  B 1 137 ? 27.071  48.756 -70.877 1.00 153.51 ? 283  DG  J "C3'" 1 
ATOM   5780  O "O3'" . DG  B 1 137 ? 27.228  50.069 -71.400 1.00 154.76 ? 283  DG  J "O3'" 1 
ATOM   5781  C "C2'" . DG  B 1 137 ? 28.416  48.064 -70.850 1.00 153.19 ? 283  DG  J "C2'" 1 
ATOM   5782  C "C1'" . DG  B 1 137 ? 29.038  48.729 -69.641 1.00 152.17 ? 283  DG  J "C1'" 1 
ATOM   5783  N N9    . DG  B 1 137 ? 30.142  47.986 -69.051 1.00 117.91 ? 283  DG  J N9    1 
ATOM   5784  C C8    . DG  B 1 137 ? 30.239  46.621 -68.903 1.00 117.24 ? 283  DG  J C8    1 
ATOM   5785  N N7    . DG  B 1 137 ? 31.360  46.242 -68.356 1.00 116.65 ? 283  DG  J N7    1 
ATOM   5786  C C5    . DG  B 1 137 ? 32.041  47.427 -68.118 1.00 116.17 ? 283  DG  J C5    1 
ATOM   5787  C C6    . DG  B 1 137 ? 33.302  47.641 -67.548 1.00 115.65 ? 283  DG  J C6    1 
ATOM   5788  O O6    . DG  B 1 137 ? 34.089  46.800 -67.097 1.00 115.47 ? 283  DG  J O6    1 
ATOM   5789  N N1    . DG  B 1 137 ? 33.632  48.997 -67.527 1.00 114.67 ? 283  DG  J N1    1 
ATOM   5790  C C2    . DG  B 1 137 ? 32.839  50.016 -67.998 1.00 114.57 ? 283  DG  J C2    1 
ATOM   5791  N N2    . DG  B 1 137 ? 33.359  51.256 -67.924 1.00 113.34 ? 283  DG  J N2    1 
ATOM   5792  N N3    . DG  B 1 137 ? 31.633  49.827 -68.515 1.00 115.20 ? 283  DG  J N3    1 
ATOM   5793  C C4    . DG  B 1 137 ? 31.303  48.514 -68.547 1.00 116.43 ? 283  DG  J C4    1 
ATOM   5794  P P     . DG  B 1 138 ? 26.445  50.503 -72.732 1.00 182.67 ? 284  DG  J P     1 
ATOM   5795  O OP1   . DG  B 1 138 ? 25.023  50.843 -72.415 1.00 100.99 ? 284  DG  J OP1   1 
ATOM   5796  O OP2   . DG  B 1 138 ? 26.743  49.473 -73.764 1.00 101.38 ? 284  DG  J OP2   1 
ATOM   5797  O "O5'" . DG  B 1 138 ? 27.201  51.845 -73.120 1.00 182.51 ? 284  DG  J "O5'" 1 
ATOM   5798  C "C5'" . DG  B 1 138 ? 27.830  52.633 -72.111 1.00 183.26 ? 284  DG  J "C5'" 1 
ATOM   5799  C "C4'" . DG  B 1 138 ? 29.296  52.794 -72.427 1.00 184.11 ? 284  DG  J "C4'" 1 
ATOM   5800  O "O4'" . DG  B 1 138 ? 30.132  51.787 -71.801 1.00 184.47 ? 284  DG  J "O4'" 1 
ATOM   5801  C "C3'" . DG  B 1 138 ? 29.586  52.700 -73.920 1.00 184.36 ? 284  DG  J "C3'" 1 
ATOM   5802  O "O3'" . DG  B 1 138 ? 30.557  53.670 -74.259 1.00 184.74 ? 284  DG  J "O3'" 1 
ATOM   5803  C "C2'" . DG  B 1 138 ? 30.199  51.324 -74.073 1.00 184.22 ? 284  DG  J "C2'" 1 
ATOM   5804  C "C1'" . DG  B 1 138 ? 31.004  51.261 -72.798 1.00 183.92 ? 284  DG  J "C1'" 1 
ATOM   5805  N N9    . DG  B 1 138 ? 31.422  49.923 -72.404 1.00 101.63 ? 284  DG  J N9    1 
ATOM   5806  C C8    . DG  B 1 138 ? 30.725  48.748 -72.579 1.00 101.22 ? 284  DG  J C8    1 
ATOM   5807  N N7    . DG  B 1 138 ? 31.335  47.710 -72.084 1.00 100.63 ? 284  DG  J N7    1 
ATOM   5808  C C5    . DG  B 1 138 ? 32.515  48.225 -71.557 1.00 100.76 ? 284  DG  J C5    1 
ATOM   5809  C C6    . DG  B 1 138 ? 33.564  47.578 -70.864 1.00 100.40 ? 284  DG  J C6    1 
ATOM   5810  O O6    . DG  B 1 138 ? 33.642  46.383 -70.522 1.00 100.50 ? 284  DG  J O6    1 
ATOM   5811  N N1    . DG  B 1 138 ? 34.583  48.476 -70.530 1.00 99.65  ? 284  DG  J N1    1 
ATOM   5812  C C2    . DG  B 1 138 ? 34.571  49.828 -70.802 1.00 99.46  ? 284  DG  J C2    1 
ATOM   5813  N N2    . DG  B 1 138 ? 35.643  50.526 -70.400 1.00 98.85  ? 284  DG  J N2    1 
ATOM   5814  N N3    . DG  B 1 138 ? 33.578  50.446 -71.420 1.00 99.87  ? 284  DG  J N3    1 
ATOM   5815  C C4    . DG  B 1 138 ? 32.589  49.587 -71.769 1.00 100.66 ? 284  DG  J C4    1 
ATOM   5816  P P     . DA  B 1 139 ? 30.232  54.702 -75.422 1.00 164.73 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 139 ? 29.130  55.559 -74.913 1.00 150.85 ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 139 ? 30.018  53.856 -76.625 1.00 150.57 ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 139 ? 31.567  55.558 -75.581 1.00 162.88 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 139 ? 31.956  56.498 -74.584 1.00 159.42 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 139 ? 33.454  56.466 -74.386 1.00 157.23 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 139 ? 33.840  55.189 -73.825 1.00 156.26 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 139 ? 34.316  56.641 -75.641 1.00 156.02 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 139 ? 35.521  57.317 -75.266 1.00 154.41 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 139 ? 34.681  55.215 -75.998 1.00 155.74 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 139 ? 34.896  54.655 -74.607 1.00 155.16 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 139 ? 34.875  53.197 -74.491 1.00 139.43 ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 139 ? 33.867  52.310 -74.785 1.00 138.96 ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 139 ? 34.196  51.054 -74.596 1.00 137.71 ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 139 ? 35.506  51.118 -74.140 1.00 137.03 ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 139 ? 36.427  50.126 -73.775 1.00 136.14 ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 139 ? 36.166  48.820 -73.833 1.00 135.04 ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 139 ? 37.645  50.526 -73.352 1.00 135.52 ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 139 ? 37.913  51.836 -73.316 1.00 136.11 ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 139 ? 37.137  52.864 -73.651 1.00 136.25 ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 139 ? 35.931  52.431 -74.058 1.00 137.57 ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 140 ? 36.734  57.449 -76.316 1.00 149.94 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 140 ? 37.327  58.800 -76.118 1.00 126.54 ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 140 ? 36.229  57.058 -77.660 1.00 127.20 ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 140 ? 37.808  56.389 -75.800 1.00 147.57 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 140 ? 38.375  56.520 -74.493 1.00 142.57 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 140 ? 39.687  55.770 -74.386 1.00 139.40 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 140 ? 39.461  54.342 -74.314 1.00 137.27 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 140 ? 40.697  55.982 -75.517 1.00 137.82 ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 140 ? 42.022  56.086 -74.975 1.00 135.89 ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 140 ? 40.569  54.713 -76.343 1.00 136.27 ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 140 ? 40.270  53.677 -75.277 1.00 134.48 ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 140 ? 39.528  52.490 -75.751 1.00 108.06 ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 140 ? 40.099  51.244 -75.560 1.00 105.82 ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 140 ? 41.199  51.079 -75.041 1.00 103.19 ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 140 ? 39.325  50.192 -75.997 1.00 104.69 ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 140 ? 38.075  50.257 -76.580 1.00 104.75 ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 140 ? 37.503  49.227 -76.913 1.00 103.18 ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 140 ? 37.539  51.587 -76.750 1.00 106.01 ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 140 ? 36.176  51.744 -77.346 1.00 106.60 ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 140 ? 38.288  52.625 -76.346 1.00 106.91 ? 286  DT  J C6    1 
ATOM   5857  P P     . DA  B 1 141 ? 43.296  56.086 -75.962 1.00 132.23 ? 287  DA  J P     1 
ATOM   5858  O OP1   . DA  B 1 141 ? 44.549  56.332 -75.191 1.00 105.07 ? 287  DA  J OP1   1 
ATOM   5859  O OP2   . DA  B 1 141 ? 42.997  56.911 -77.162 1.00 105.59 ? 287  DA  J OP2   1 
ATOM   5860  O "O5'" . DA  B 1 141 ? 43.362  54.586 -76.465 1.00 128.99 ? 287  DA  J "O5'" 1 
ATOM   5861  C "C5'" . DA  B 1 141 ? 44.571  54.068 -76.973 1.00 123.20 ? 287  DA  J "C5'" 1 
ATOM   5862  C "C4'" . DA  B 1 141 ? 45.053  52.937 -76.099 1.00 119.09 ? 287  DA  J "C4'" 1 
ATOM   5863  O "O4'" . DA  B 1 141 ? 44.014  51.937 -75.987 1.00 115.79 ? 287  DA  J "O4'" 1 
ATOM   5864  C "C3'" . DA  B 1 141 ? 46.243  52.230 -76.724 1.00 116.62 ? 287  DA  J "C3'" 1 
ATOM   5865  O "O3'" . DA  B 1 141 ? 47.137  51.752 -75.729 1.00 113.47 ? 287  DA  J "O3'" 1 
ATOM   5866  C "C2'" . DA  B 1 141 ? 45.607  51.118 -77.532 1.00 115.18 ? 287  DA  J "C2'" 1 
ATOM   5867  C "C1'" . DA  B 1 141 ? 44.342  50.788 -76.759 1.00 112.76 ? 287  DA  J "C1'" 1 
ATOM   5868  N N9    . DA  B 1 141 ? 43.192  50.485 -77.617 1.00 82.84  ? 287  DA  J N9    1 
ATOM   5869  C C8    . DA  B 1 141 ? 42.404  51.368 -78.317 1.00 82.09  ? 287  DA  J C8    1 
ATOM   5870  N N7    . DA  B 1 141 ? 41.409  50.800 -78.955 1.00 80.72  ? 287  DA  J N7    1 
ATOM   5871  C C5    . DA  B 1 141 ? 41.557  49.451 -78.667 1.00 80.48  ? 287  DA  J C5    1 
ATOM   5872  C C6    . DA  B 1 141 ? 40.813  48.324 -79.034 1.00 79.81  ? 287  DA  J C6    1 
ATOM   5873  N N6    . DA  B 1 141 ? 39.714  48.378 -79.784 1.00 78.84  ? 287  DA  J N6    1 
ATOM   5874  N N1    . DA  B 1 141 ? 41.238  47.120 -78.591 1.00 79.48  ? 287  DA  J N1    1 
ATOM   5875  C C2    . DA  B 1 141 ? 42.333  47.065 -77.824 1.00 79.64  ? 287  DA  J C2    1 
ATOM   5876  N N3    . DA  B 1 141 ? 43.109  48.054 -77.399 1.00 80.33  ? 287  DA  J N3    1 
ATOM   5877  C C4    . DA  B 1 141 ? 42.662  49.239 -77.860 1.00 81.40  ? 287  DA  J C4    1 
ATOM   5878  P P     . DT  B 1 142 ? 48.570  51.188 -76.177 1.00 93.76  ? 288  DT  J P     1 
ATOM   5879  O OP1   . DT  B 1 142 ? 49.468  51.118 -74.989 1.00 105.52 ? 288  DT  J OP1   1 
ATOM   5880  O OP2   . DT  B 1 142 ? 49.014  51.942 -77.382 1.00 105.19 ? 288  DT  J OP2   1 
ATOM   5881  O "O5'" . DT  B 1 142 ? 48.221  49.703 -76.645 1.00 89.03  ? 288  DT  J "O5'" 1 
ATOM   5882  C "C5'" . DT  B 1 142 ? 47.648  48.756 -75.732 1.00 80.98  ? 288  DT  J "C5'" 1 
ATOM   5883  C "C4'" . DT  B 1 142 ? 47.604  47.385 -76.362 1.00 75.69  ? 288  DT  J "C4'" 1 
ATOM   5884  O "O4'" . DT  B 1 142 ? 46.403  47.192 -77.139 1.00 74.55  ? 288  DT  J "O4'" 1 
ATOM   5885  C "C3'" . DT  B 1 142 ? 48.768  47.099 -77.305 1.00 73.31  ? 288  DT  J "C3'" 1 
ATOM   5886  O "O3'" . DT  B 1 142 ? 49.166  45.740 -77.133 1.00 68.02  ? 288  DT  J "O3'" 1 
ATOM   5887  C "C2'" . DT  B 1 142 ? 48.155  47.310 -78.675 1.00 72.43  ? 288  DT  J "C2'" 1 
ATOM   5888  C "C1'" . DT  B 1 142 ? 46.757  46.776 -78.444 1.00 73.02  ? 288  DT  J "C1'" 1 
ATOM   5889  N N1    . DT  B 1 142 ? 45.717  47.252 -79.368 1.00 84.46  ? 288  DT  J N1    1 
ATOM   5890  C C2    . DT  B 1 142 ? 44.839  46.325 -79.876 1.00 84.00  ? 288  DT  J C2    1 
ATOM   5891  O O2    . DT  B 1 142 ? 44.912  45.137 -79.633 1.00 86.80  ? 288  DT  J O2    1 
ATOM   5892  N N3    . DT  B 1 142 ? 43.869  46.839 -80.692 1.00 85.31  ? 288  DT  J N3    1 
ATOM   5893  C C4    . DT  B 1 142 ? 43.697  48.155 -81.056 1.00 84.64  ? 288  DT  J C4    1 
ATOM   5894  O O4    . DT  B 1 142 ? 42.768  48.457 -81.790 1.00 84.60  ? 288  DT  J O4    1 
ATOM   5895  C C5    . DT  B 1 142 ? 44.670  49.078 -80.506 1.00 83.66  ? 288  DT  J C5    1 
ATOM   5896  C C7    . DT  B 1 142 ? 44.581  50.528 -80.851 1.00 82.66  ? 288  DT  J C7    1 
ATOM   5897  C C6    . DT  B 1 142 ? 45.617  48.583 -79.700 1.00 83.56  ? 288  DT  J C6    1 
ATOM   5898  P P     . DT  B 1 143 ? 50.566  45.238 -77.734 1.00 71.91  ? 289  DT  J P     1 
ATOM   5899  O OP1   . DT  B 1 143 ? 51.420  44.740 -76.627 1.00 86.75  ? 289  DT  J OP1   1 
ATOM   5900  O OP2   . DT  B 1 143 ? 51.075  46.288 -78.655 1.00 80.93  ? 289  DT  J OP2   1 
ATOM   5901  O "O5'" . DT  B 1 143 ? 50.114  44.019 -78.634 1.00 68.88  ? 289  DT  J "O5'" 1 
ATOM   5902  C "C5'" . DT  B 1 143 ? 48.952  44.154 -79.416 1.00 67.28  ? 289  DT  J "C5'" 1 
ATOM   5903  C "C4'" . DT  B 1 143 ? 48.464  42.809 -79.870 1.00 61.75  ? 289  DT  J "C4'" 1 
ATOM   5904  O "O4'" . DT  B 1 143 ? 47.201  43.030 -80.515 1.00 62.68  ? 289  DT  J "O4'" 1 
ATOM   5905  C "C3'" . DT  B 1 143 ? 49.347  42.145 -80.914 1.00 59.96  ? 289  DT  J "C3'" 1 
ATOM   5906  O "O3'" . DT  B 1 143 ? 49.101  40.736 -80.848 1.00 52.25  ? 289  DT  J "O3'" 1 
ATOM   5907  C "C2'" . DT  B 1 143 ? 48.828  42.746 -82.202 1.00 58.81  ? 289  DT  J "C2'" 1 
ATOM   5908  C "C1'" . DT  B 1 143 ? 47.336  42.919 -81.922 1.00 60.62  ? 289  DT  J "C1'" 1 
ATOM   5909  N N1    . DT  B 1 143 ? 46.752  44.138 -82.508 1.00 74.30  ? 289  DT  J N1    1 
ATOM   5910  C C2    . DT  B 1 143 ? 45.568  44.048 -83.206 1.00 73.77  ? 289  DT  J C2    1 
ATOM   5911  O O2    . DT  B 1 143 ? 44.978  42.994 -83.393 1.00 69.44  ? 289  DT  J O2    1 
ATOM   5912  N N3    . DT  B 1 143 ? 45.107  45.245 -83.690 1.00 75.97  ? 289  DT  J N3    1 
ATOM   5913  C C4    . DT  B 1 143 ? 45.705  46.493 -83.555 1.00 76.21  ? 289  DT  J C4    1 
ATOM   5914  O O4    . DT  B 1 143 ? 45.176  47.489 -84.042 1.00 81.79  ? 289  DT  J O4    1 
ATOM   5915  C C5    . DT  B 1 143 ? 46.942  46.505 -82.827 1.00 76.04  ? 289  DT  J C5    1 
ATOM   5916  C C7    . DT  B 1 143 ? 47.662  47.800 -82.646 1.00 73.89  ? 289  DT  J C7    1 
ATOM   5917  C C6    . DT  B 1 143 ? 47.395  45.347 -82.342 1.00 74.60  ? 289  DT  J C6    1 
ATOM   5918  P P     . DG  B 1 144 ? 49.998  39.720 -81.689 1.00 54.90  ? 290  DG  J P     1 
ATOM   5919  O OP1   . DG  B 1 144 ? 49.922  38.404 -81.014 1.00 52.61  ? 290  DG  J OP1   1 
ATOM   5920  O OP2   . DG  B 1 144 ? 51.310  40.357 -81.945 1.00 51.34  ? 290  DG  J OP2   1 
ATOM   5921  O "O5'" . DG  B 1 144 ? 49.229  39.595 -83.069 1.00 53.53  ? 290  DG  J "O5'" 1 
ATOM   5922  C "C5'" . DG  B 1 144 ? 47.953  38.959 -83.131 1.00 57.71  ? 290  DG  J "C5'" 1 
ATOM   5923  C "C4'" . DG  B 1 144 ? 47.388  39.062 -84.527 1.00 64.42  ? 290  DG  J "C4'" 1 
ATOM   5924  O "O4'" . DG  B 1 144 ? 47.026  40.431 -84.835 1.00 64.59  ? 290  DG  J "O4'" 1 
ATOM   5925  C "C3'" . DG  B 1 144 ? 48.365  38.633 -85.626 1.00 66.58  ? 290  DG  J "C3'" 1 
ATOM   5926  O "O3'" . DG  B 1 144 ? 47.606  38.012 -86.654 1.00 71.95  ? 290  DG  J "O3'" 1 
ATOM   5927  C "C2'" . DG  B 1 144 ? 48.903  39.951 -86.147 1.00 64.40  ? 290  DG  J "C2'" 1 
ATOM   5928  C "C1'" . DG  B 1 144 ? 47.654  40.798 -86.054 1.00 64.19  ? 290  DG  J "C1'" 1 
ATOM   5929  N N9    . DG  B 1 144 ? 47.848  42.239 -86.056 1.00 63.66  ? 290  DG  J N9    1 
ATOM   5930  C C8    . DG  B 1 144 ? 48.931  42.965 -85.609 1.00 63.57  ? 290  DG  J C8    1 
ATOM   5931  N N7    . DG  B 1 144 ? 48.775  44.253 -85.743 1.00 64.99  ? 290  DG  J N7    1 
ATOM   5932  C C5    . DG  B 1 144 ? 47.510  44.382 -86.312 1.00 66.82  ? 290  DG  J C5    1 
ATOM   5933  C C6    . DG  B 1 144 ? 46.774  45.539 -86.679 1.00 69.05  ? 290  DG  J C6    1 
ATOM   5934  O O6    . DG  B 1 144 ? 47.078  46.729 -86.532 1.00 71.86  ? 290  DG  J O6    1 
ATOM   5935  N N1    . DG  B 1 144 ? 45.556  45.202 -87.257 1.00 66.93  ? 290  DG  J N1    1 
ATOM   5936  C C2    . DG  B 1 144 ? 45.095  43.923 -87.441 1.00 67.29  ? 290  DG  J C2    1 
ATOM   5937  N N2    . DG  B 1 144 ? 43.914  43.798 -88.046 1.00 66.06  ? 290  DG  J N2    1 
ATOM   5938  N N3    . DG  B 1 144 ? 45.747  42.844 -87.069 1.00 65.03  ? 290  DG  J N3    1 
ATOM   5939  C C4    . DG  B 1 144 ? 46.942  43.145 -86.521 1.00 65.10  ? 290  DG  J C4    1 
ATOM   5940  P P     . DA  B 1 145 ? 48.321  37.061 -87.722 1.00 78.05  ? 291  DA  J P     1 
ATOM   5941  O OP1   . DA  B 1 145 ? 48.179  35.671 -87.237 1.00 66.14  ? 291  DA  J OP1   1 
ATOM   5942  O OP2   . DA  B 1 145 ? 49.663  37.593 -88.065 1.00 61.37  ? 291  DA  J OP2   1 
ATOM   5943  O "O5'" . DA  B 1 145 ? 47.352  37.220 -88.962 1.00 80.07  ? 291  DA  J "O5'" 1 
ATOM   5944  C "C5'" . DA  B 1 145 ? 45.940  37.161 -88.772 1.00 81.61  ? 291  DA  J "C5'" 1 
ATOM   5945  C "C4'" . DA  B 1 145 ? 45.250  37.886 -89.900 1.00 84.02  ? 291  DA  J "C4'" 1 
ATOM   5946  O "O4'" . DA  B 1 145 ? 45.316  39.313 -89.673 1.00 81.45  ? 291  DA  J "O4'" 1 
ATOM   5947  C "C3'" . DA  B 1 145 ? 45.932  37.637 -91.240 1.00 83.46  ? 291  DA  J "C3'" 1 
ATOM   5948  O "O3'" . DA  B 1 145 ? 44.973  37.439 -92.287 1.00 88.65  ? 291  DA  J "O3'" 1 
ATOM   5949  C "C2'" . DA  B 1 145 ? 46.737  38.899 -91.467 1.00 82.39  ? 291  DA  J "C2'" 1 
ATOM   5950  C "C1'" . DA  B 1 145 ? 45.915  39.958 -90.774 1.00 78.78  ? 291  DA  J "C1'" 1 
ATOM   5951  N N9    . DA  B 1 145 ? 46.773  41.022 -90.264 1.00 61.89  ? 291  DA  J N9    1 
ATOM   5952  C C8    . DA  B 1 145 ? 47.961  40.860 -89.588 1.00 60.24  ? 291  DA  J C8    1 
ATOM   5953  N N7    . DA  B 1 145 ? 48.575  41.988 -89.319 1.00 59.52  ? 291  DA  J N7    1 
ATOM   5954  C C5    . DA  B 1 145 ? 47.727  42.957 -89.834 1.00 58.93  ? 291  DA  J C5    1 
ATOM   5955  C C6    . DA  B 1 145 ? 47.814  44.352 -89.874 1.00 57.74  ? 291  DA  J C6    1 
ATOM   5956  N N6    . DA  B 1 145 ? 48.833  45.031 -89.362 1.00 58.71  ? 291  DA  J N6    1 
ATOM   5957  N N1    . DA  B 1 145 ? 46.809  45.032 -90.461 1.00 55.65  ? 291  DA  J N1    1 
ATOM   5958  C C2    . DA  B 1 145 ? 45.780  44.341 -90.958 1.00 57.60  ? 291  DA  J C2    1 
ATOM   5959  N N3    . DA  B 1 145 ? 45.577  43.026 -90.978 1.00 60.49  ? 291  DA  J N3    1 
ATOM   5960  C C4    . DA  B 1 145 ? 46.602  42.380 -90.400 1.00 60.11  ? 291  DA  J C4    1 
ATOM   5961  P P     . DT  B 1 146 ? 45.472  37.019 -93.760 1.00 81.69  ? 292  DT  J P     1 
ATOM   5962  O OP1   . DT  B 1 146 ? 44.469  36.085 -94.322 1.00 77.05  ? 292  DT  J OP1   1 
ATOM   5963  O OP2   . DT  B 1 146 ? 46.917  36.610 -93.679 1.00 73.86  ? 292  DT  J OP2   1 
ATOM   5964  O "O5'" . DT  B 1 146 ? 45.366  38.374 -94.575 1.00 80.19  ? 292  DT  J "O5'" 1 
ATOM   5965  C "C5'" . DT  B 1 146 ? 44.188  39.165 -94.488 1.00 77.98  ? 292  DT  J "C5'" 1 
ATOM   5966  C "C4'" . DT  B 1 146 ? 44.380  40.459 -95.243 1.00 78.77  ? 292  DT  J "C4'" 1 
ATOM   5967  O "O4'" . DT  B 1 146 ? 45.067  41.474 -94.461 1.00 76.51  ? 292  DT  J "O4'" 1 
ATOM   5968  C "C3'" . DT  B 1 146 ? 45.208  40.286 -96.519 1.00 78.48  ? 292  DT  J "C3'" 1 
ATOM   5969  O "O3'" . DT  B 1 146 ? 44.671  41.145 -97.547 1.00 79.47  ? 292  DT  J "O3'" 1 
ATOM   5970  C "C2'" . DT  B 1 146 ? 46.575  40.802 -96.099 1.00 76.33  ? 292  DT  J "C2'" 1 
ATOM   5971  C "C1'" . DT  B 1 146 ? 46.150  41.959 -95.229 1.00 74.08  ? 292  DT  J "C1'" 1 
ATOM   5972  N N1    . DT  B 1 146 ? 47.174  42.505 -94.333 1.00 67.29  ? 292  DT  J N1    1 
ATOM   5973  C C2    . DT  B 1 146 ? 47.189  43.873 -94.195 1.00 68.23  ? 292  DT  J C2    1 
ATOM   5974  O O2    . DT  B 1 146 ? 46.387  44.608 -94.753 1.00 69.93  ? 292  DT  J O2    1 
ATOM   5975  N N3    . DT  B 1 146 ? 48.185  44.355 -93.391 1.00 65.87  ? 292  DT  J N3    1 
ATOM   5976  C C4    . DT  B 1 146 ? 49.157  43.621 -92.744 1.00 63.91  ? 292  DT  J C4    1 
ATOM   5977  O O4    . DT  B 1 146 ? 50.017  44.182 -92.085 1.00 63.13  ? 292  DT  J O4    1 
ATOM   5978  C C5    . DT  B 1 146 ? 49.081  42.201 -92.921 1.00 63.45  ? 292  DT  J C5    1 
ATOM   5979  C C7    . DT  B 1 146 ? 50.118  41.351 -92.257 1.00 62.88  ? 292  DT  J C7    1 
ATOM   5980  C C6    . DT  B 1 146 ? 48.093  41.708 -93.686 1.00 67.15  ? 292  DT  J C6    1 
ATOM   5981  N N     . HIS C 2 39  ? 110.123 25.449 -78.929 1.00 144.00 ? 439  HIS A N     1 
ATOM   5982  C CA    . HIS C 2 39  ? 109.013 24.855 -78.121 1.00 140.35 ? 439  HIS A CA    1 
ATOM   5983  C C     . HIS C 2 39  ? 107.979 25.850 -77.632 1.00 136.83 ? 439  HIS A C     1 
ATOM   5984  O O     . HIS C 2 39  ? 108.298 27.005 -77.347 1.00 136.45 ? 439  HIS A O     1 
ATOM   5985  C CB    . HIS C 2 39  ? 109.550 24.135 -76.898 1.00 85.93  ? 439  HIS A CB    1 
ATOM   5986  C CG    . HIS C 2 39  ? 108.495 23.377 -76.160 1.00 87.25  ? 439  HIS A CG    1 
ATOM   5987  N ND1   . HIS C 2 39  ? 107.631 23.980 -75.269 1.00 87.03  ? 439  HIS A ND1   1 
ATOM   5988  C CD2   . HIS C 2 39  ? 108.108 22.086 -76.252 1.00 87.71  ? 439  HIS A CD2   1 
ATOM   5989  C CE1   . HIS C 2 39  ? 106.756 23.085 -74.848 1.00 87.09  ? 439  HIS A CE1   1 
ATOM   5990  N NE2   . HIS C 2 39  ? 107.021 21.929 -75.427 1.00 87.41  ? 439  HIS A NE2   1 
ATOM   5991  N N     . ARG C 2 40  ? 106.743 25.380 -77.492 1.00 77.03  ? 440  ARG A N     1 
ATOM   5992  C CA    . ARG C 2 40  ? 105.655 26.240 -77.047 1.00 72.98  ? 440  ARG A CA    1 
ATOM   5993  C C     . ARG C 2 40  ? 104.432 25.422 -76.633 1.00 68.94  ? 440  ARG A C     1 
ATOM   5994  O O     . ARG C 2 40  ? 104.044 24.479 -77.327 1.00 67.80  ? 440  ARG A O     1 
ATOM   5995  C CB    . ARG C 2 40  ? 105.291 27.193 -78.181 1.00 77.63  ? 440  ARG A CB    1 
ATOM   5996  C CG    . ARG C 2 40  ? 104.424 28.328 -77.774 1.00 77.30  ? 440  ARG A CG    1 
ATOM   5997  C CD    . ARG C 2 40  ? 104.134 29.183 -78.961 1.00 74.35  ? 440  ARG A CD    1 
ATOM   5998  N NE    . ARG C 2 40  ? 103.421 30.400 -78.596 1.00 72.40  ? 440  ARG A NE    1 
ATOM   5999  C CZ    . ARG C 2 40  ? 103.950 31.388 -77.884 1.00 71.56  ? 440  ARG A CZ    1 
ATOM   6000  N NH1   . ARG C 2 40  ? 105.202 31.306 -77.452 1.00 70.43  ? 440  ARG A NH1   1 
ATOM   6001  N NH2   . ARG C 2 40  ? 103.229 32.467 -77.625 1.00 70.01  ? 440  ARG A NH2   1 
ATOM   6002  N N     . TYR C 2 41  ? 103.826 25.772 -75.502 1.00 63.08  ? 441  TYR A N     1 
ATOM   6003  C CA    . TYR C 2 41  ? 102.629 25.058 -75.032 1.00 58.42  ? 441  TYR A CA    1 
ATOM   6004  C C     . TYR C 2 41  ? 101.336 25.673 -75.587 1.00 55.13  ? 441  TYR A C     1 
ATOM   6005  O O     . TYR C 2 41  ? 101.199 26.903 -75.704 1.00 53.97  ? 441  TYR A O     1 
ATOM   6006  C CB    . TYR C 2 41  ? 102.570 25.044 -73.502 1.00 60.20  ? 441  TYR A CB    1 
ATOM   6007  C CG    . TYR C 2 41  ? 103.525 24.071 -72.855 1.00 58.48  ? 441  TYR A CG    1 
ATOM   6008  C CD1   . TYR C 2 41  ? 104.590 24.525 -72.079 1.00 57.55  ? 441  TYR A CD1   1 
ATOM   6009  C CD2   . TYR C 2 41  ? 103.378 22.695 -73.050 1.00 57.61  ? 441  TYR A CD2   1 
ATOM   6010  C CE1   . TYR C 2 41  ? 105.495 23.633 -71.521 1.00 57.60  ? 441  TYR A CE1   1 
ATOM   6011  C CE2   . TYR C 2 41  ? 104.273 21.795 -72.498 1.00 57.93  ? 441  TYR A CE2   1 
ATOM   6012  C CZ    . TYR C 2 41  ? 105.338 22.271 -71.737 1.00 57.24  ? 441  TYR A CZ    1 
ATOM   6013  O OH    . TYR C 2 41  ? 106.286 21.396 -71.245 1.00 60.42  ? 441  TYR A OH    1 
ATOM   6014  N N     . ARG C 2 42  ? 100.389 24.815 -75.943 1.00 51.55  ? 442  ARG A N     1 
ATOM   6015  C CA    . ARG C 2 42  ? 99.142  25.309 -76.495 1.00 53.22  ? 442  ARG A CA    1 
ATOM   6016  C C     . ARG C 2 42  ? 98.360  26.010 -75.398 1.00 51.80  ? 442  ARG A C     1 
ATOM   6017  O O     . ARG C 2 42  ? 98.432  25.623 -74.227 1.00 49.83  ? 442  ARG A O     1 
ATOM   6018  C CB    . ARG C 2 42  ? 98.358  24.155 -77.093 1.00 69.24  ? 442  ARG A CB    1 
ATOM   6019  C CG    . ARG C 2 42  ? 99.182  23.356 -78.069 1.00 76.15  ? 442  ARG A CG    1 
ATOM   6020  C CD    . ARG C 2 42  ? 98.333  22.861 -79.196 1.00 81.99  ? 442  ARG A CD    1 
ATOM   6021  N NE    . ARG C 2 42  ? 97.088  22.309 -78.683 1.00 88.05  ? 442  ARG A NE    1 
ATOM   6022  C CZ    . ARG C 2 42  ? 96.049  21.972 -79.440 1.00 91.28  ? 442  ARG A CZ    1 
ATOM   6023  N NH1   . ARG C 2 42  ? 96.103  22.125 -80.761 1.00 92.49  ? 442  ARG A NH1   1 
ATOM   6024  N NH2   . ARG C 2 42  ? 94.942  21.504 -78.873 1.00 92.92  ? 442  ARG A NH2   1 
ATOM   6025  N N     . PRO C 2 43  ? 97.604  27.055 -75.752 1.00 67.21  ? 443  PRO A N     1 
ATOM   6026  C CA    . PRO C 2 43  ? 96.837  27.770 -74.732 1.00 65.10  ? 443  PRO A CA    1 
ATOM   6027  C C     . PRO C 2 43  ? 95.973  26.804 -73.943 1.00 63.78  ? 443  PRO A C     1 
ATOM   6028  O O     . PRO C 2 43  ? 95.421  25.860 -74.509 1.00 61.55  ? 443  PRO A O     1 
ATOM   6029  C CB    . PRO C 2 43  ? 96.007  28.747 -75.551 1.00 56.60  ? 443  PRO A CB    1 
ATOM   6030  C CG    . PRO C 2 43  ? 96.815  28.928 -76.811 1.00 55.40  ? 443  PRO A CG    1 
ATOM   6031  C CD    . PRO C 2 43  ? 97.233  27.518 -77.096 1.00 56.27  ? 443  PRO A CD    1 
ATOM   6032  N N     . GLY C 2 44  ? 95.864  27.023 -72.639 1.00 58.13  ? 444  GLY A N     1 
ATOM   6033  C CA    . GLY C 2 44  ? 95.051  26.135 -71.830 1.00 57.69  ? 444  GLY A CA    1 
ATOM   6034  C C     . GLY C 2 44  ? 95.860  25.065 -71.130 1.00 58.11  ? 444  GLY A C     1 
ATOM   6035  O O     . GLY C 2 44  ? 95.533  24.653 -70.022 1.00 57.88  ? 444  GLY A O     1 
ATOM   6036  N N     . THR C 2 45  ? 96.932  24.619 -71.774 1.00 51.15  ? 445  THR A N     1 
ATOM   6037  C CA    . THR C 2 45  ? 97.788  23.582 -71.213 1.00 50.09  ? 445  THR A CA    1 
ATOM   6038  C C     . THR C 2 45  ? 98.463  24.019 -69.921 1.00 49.57  ? 445  THR A C     1 
ATOM   6039  O O     . THR C 2 45  ? 98.502  23.271 -68.925 1.00 50.08  ? 445  THR A O     1 
ATOM   6040  C CB    . THR C 2 45  ? 98.862  23.179 -72.220 1.00 52.14  ? 445  THR A CB    1 
ATOM   6041  O OG1   . THR C 2 45  ? 98.241  22.482 -73.300 1.00 52.43  ? 445  THR A OG1   1 
ATOM   6042  C CG2   . THR C 2 45  ? 99.901  22.274 -71.573 1.00 50.01  ? 445  THR A CG2   1 
ATOM   6043  N N     . VAL C 2 46  ? 99.002  25.231 -69.956 1.00 45.86  ? 446  VAL A N     1 
ATOM   6044  C CA    . VAL C 2 46  ? 99.683  25.768 -68.807 1.00 47.94  ? 446  VAL A CA    1 
ATOM   6045  C C     . VAL C 2 46  ? 98.642  26.176 -67.795 1.00 47.07  ? 446  VAL A C     1 
ATOM   6046  O O     . VAL C 2 46  ? 98.916  26.218 -66.585 1.00 47.81  ? 446  VAL A O     1 
ATOM   6047  C CB    . VAL C 2 46  ? 100.548 26.996 -69.179 1.00 62.22  ? 446  VAL A CB    1 
ATOM   6048  C CG1   . VAL C 2 46  ? 101.272 27.529 -67.946 1.00 64.05  ? 446  VAL A CG1   1 
ATOM   6049  C CG2   . VAL C 2 46  ? 101.546 26.611 -70.230 1.00 64.15  ? 446  VAL A CG2   1 
ATOM   6050  N N     . ALA C 2 47  ? 97.446  26.480 -68.288 1.00 63.34  ? 447  ALA A N     1 
ATOM   6051  C CA    . ALA C 2 47  ? 96.370  26.896 -67.405 1.00 63.78  ? 447  ALA A CA    1 
ATOM   6052  C C     . ALA C 2 47  ? 95.965  25.726 -66.515 1.00 64.47  ? 447  ALA A C     1 
ATOM   6053  O O     . ALA C 2 47  ? 95.954  25.853 -65.290 1.00 63.14  ? 447  ALA A O     1 
ATOM   6054  C CB    . ALA C 2 47  ? 95.181  27.406 -68.213 1.00 38.43  ? 447  ALA A CB    1 
ATOM   6055  N N     . LEU C 2 48  ? 95.652  24.585 -67.120 1.00 53.19  ? 448  LEU A N     1 
ATOM   6056  C CA    . LEU C 2 48  ? 95.269  23.425 -66.327 1.00 53.63  ? 448  LEU A CA    1 
ATOM   6057  C C     . LEU C 2 48  ? 96.400  23.049 -65.378 1.00 53.81  ? 448  LEU A C     1 
ATOM   6058  O O     . LEU C 2 48  ? 96.176  22.555 -64.271 1.00 51.66  ? 448  LEU A O     1 
ATOM   6059  C CB    . LEU C 2 48  ? 94.911  22.240 -67.225 1.00 49.87  ? 448  LEU A CB    1 
ATOM   6060  C CG    . LEU C 2 48  ? 93.479  22.267 -67.746 1.00 53.48  ? 448  LEU A CG    1 
ATOM   6061  C CD1   . LEU C 2 48  ? 93.323  23.472 -68.608 1.00 53.45  ? 448  LEU A CD1   1 
ATOM   6062  C CD2   . LEU C 2 48  ? 93.167  21.034 -68.537 1.00 53.66  ? 448  LEU A CD2   1 
ATOM   6063  N N     . ARG C 2 49  ? 97.625  23.283 -65.820 1.00 50.74  ? 449  ARG A N     1 
ATOM   6064  C CA    . ARG C 2 49  ? 98.782  23.006 -64.996 1.00 50.88  ? 449  ARG A CA    1 
ATOM   6065  C C     . ARG C 2 49  ? 98.605  23.937 -63.780 1.00 48.53  ? 449  ARG A C     1 
ATOM   6066  O O     . ARG C 2 49  ? 98.606  23.484 -62.644 1.00 48.29  ? 449  ARG A O     1 
ATOM   6067  C CB    . ARG C 2 49  ? 100.046 23.325 -65.808 1.00 58.29  ? 449  ARG A CB    1 
ATOM   6068  C CG    . ARG C 2 49  ? 101.355 22.817 -65.224 1.00 61.27  ? 449  ARG A CG    1 
ATOM   6069  C CD    . ARG C 2 49  ? 102.423 22.607 -66.302 1.00 63.14  ? 449  ARG A CD    1 
ATOM   6070  N NE    . ARG C 2 49  ? 102.950 23.848 -66.880 1.00 62.99  ? 449  ARG A NE    1 
ATOM   6071  C CZ    . ARG C 2 49  ? 103.380 23.959 -68.136 1.00 64.83  ? 449  ARG A CZ    1 
ATOM   6072  N NH1   . ARG C 2 49  ? 103.341 22.904 -68.943 1.00 66.30  ? 449  ARG A NH1   1 
ATOM   6073  N NH2   . ARG C 2 49  ? 103.832 25.123 -68.588 1.00 62.18  ? 449  ARG A NH2   1 
ATOM   6074  N N     . GLU C 2 50  ? 98.414  25.231 -64.039 1.00 44.80  ? 450  GLU A N     1 
ATOM   6075  C CA    . GLU C 2 50  ? 98.207  26.233 -62.998 1.00 44.56  ? 450  GLU A CA    1 
ATOM   6076  C C     . GLU C 2 50  ? 97.029  25.894 -62.084 1.00 43.92  ? 450  GLU A C     1 
ATOM   6077  O O     . GLU C 2 50  ? 97.072  26.177 -60.881 1.00 44.76  ? 450  GLU A O     1 
ATOM   6078  C CB    . GLU C 2 50  ? 97.959  27.590 -63.631 1.00 41.91  ? 450  GLU A CB    1 
ATOM   6079  C CG    . GLU C 2 50  ? 99.180  28.258 -64.159 1.00 46.70  ? 450  GLU A CG    1 
ATOM   6080  C CD    . GLU C 2 50  ? 98.863  29.547 -64.899 1.00 49.89  ? 450  GLU A CD    1 
ATOM   6081  O OE1   . GLU C 2 50  ? 98.480  30.547 -64.251 1.00 51.96  ? 450  GLU A OE1   1 
ATOM   6082  O OE2   . GLU C 2 50  ? 98.993  29.557 -66.147 1.00 52.88  ? 450  GLU A OE2   1 
ATOM   6083  N N     . ILE C 2 51  ? 95.974  25.315 -62.659 1.00 35.69  ? 451  ILE A N     1 
ATOM   6084  C CA    . ILE C 2 51  ? 94.812  24.933 -61.877 1.00 33.49  ? 451  ILE A CA    1 
ATOM   6085  C C     . ILE C 2 51  ? 95.237  23.801 -60.966 1.00 34.78  ? 451  ILE A C     1 
ATOM   6086  O O     . ILE C 2 51  ? 95.142  23.916 -59.747 1.00 32.47  ? 451  ILE A O     1 
ATOM   6087  C CB    . ILE C 2 51  ? 93.612  24.456 -62.768 1.00 47.71  ? 451  ILE A CB    1 
ATOM   6088  C CG1   . ILE C 2 51  ? 93.061  25.628 -63.586 1.00 45.44  ? 451  ILE A CG1   1 
ATOM   6089  C CG2   . ILE C 2 51  ? 92.481  23.934 -61.907 1.00 44.42  ? 451  ILE A CG2   1 
ATOM   6090  C CD1   . ILE C 2 51  ? 91.858  25.272 -64.428 1.00 45.11  ? 451  ILE A CD1   1 
ATOM   6091  N N     . ARG C 2 52  ? 95.727  22.709 -61.540 1.00 37.40  ? 452  ARG A N     1 
ATOM   6092  C CA    . ARG C 2 52  ? 96.132  21.592 -60.705 1.00 38.98  ? 452  ARG A CA    1 
ATOM   6093  C C     . ARG C 2 52  ? 97.033  22.027 -59.561 1.00 38.24  ? 452  ARG A C     1 
ATOM   6094  O O     . ARG C 2 52  ? 96.825  21.627 -58.416 1.00 39.46  ? 452  ARG A O     1 
ATOM   6095  C CB    . ARG C 2 52  ? 96.808  20.514 -61.532 1.00 61.25  ? 452  ARG A CB    1 
ATOM   6096  C CG    . ARG C 2 52  ? 95.880  19.931 -62.548 1.00 64.23  ? 452  ARG A CG    1 
ATOM   6097  C CD    . ARG C 2 52  ? 96.229  18.494 -62.871 1.00 69.90  ? 452  ARG A CD    1 
ATOM   6098  N NE    . ARG C 2 52  ? 95.543  18.068 -64.087 1.00 73.59  ? 452  ARG A NE    1 
ATOM   6099  C CZ    . ARG C 2 52  ? 95.944  18.385 -65.315 1.00 75.23  ? 452  ARG A CZ    1 
ATOM   6100  N NH1   . ARG C 2 52  ? 97.041  19.126 -65.488 1.00 76.51  ? 452  ARG A NH1   1 
ATOM   6101  N NH2   . ARG C 2 52  ? 95.234  17.982 -66.369 1.00 76.95  ? 452  ARG A NH2   1 
ATOM   6102  N N     . ARG C 2 53  ? 98.011  22.864 -59.867 1.00 51.11  ? 453  ARG A N     1 
ATOM   6103  C CA    . ARG C 2 53  ? 98.932  23.367 -58.856 1.00 52.36  ? 453  ARG A CA    1 
ATOM   6104  C C     . ARG C 2 53  ? 98.284  24.156 -57.694 1.00 50.06  ? 453  ARG A C     1 
ATOM   6105  O O     . ARG C 2 53  ? 98.476  23.823 -56.507 1.00 48.70  ? 453  ARG A O     1 
ATOM   6106  C CB    . ARG C 2 53  ? 99.980  24.248 -59.525 1.00 57.15  ? 453  ARG A CB    1 
ATOM   6107  C CG    . ARG C 2 53  ? 100.742 25.135 -58.583 1.00 61.86  ? 453  ARG A CG    1 
ATOM   6108  C CD    . ARG C 2 53  ? 101.616 26.045 -59.385 1.00 70.13  ? 453  ARG A CD    1 
ATOM   6109  N NE    . ARG C 2 53  ? 102.394 26.920 -58.524 1.00 75.92  ? 453  ARG A NE    1 
ATOM   6110  C CZ    . ARG C 2 53  ? 103.378 27.704 -58.954 1.00 79.66  ? 453  ARG A CZ    1 
ATOM   6111  N NH1   . ARG C 2 53  ? 103.703 27.719 -60.249 1.00 82.10  ? 453  ARG A NH1   1 
ATOM   6112  N NH2   . ARG C 2 53  ? 104.043 28.467 -58.089 1.00 81.15  ? 453  ARG A NH2   1 
ATOM   6113  N N     . TYR C 2 54  ? 97.535  25.201 -58.039 1.00 48.52  ? 454  TYR A N     1 
ATOM   6114  C CA    . TYR C 2 54  ? 96.901  26.041 -57.041 1.00 47.97  ? 454  TYR A CA    1 
ATOM   6115  C C     . TYR C 2 54  ? 95.785  25.379 -56.220 1.00 47.67  ? 454  TYR A C     1 
ATOM   6116  O O     . TYR C 2 54  ? 95.539  25.772 -55.076 1.00 46.74  ? 454  TYR A O     1 
ATOM   6117  C CB    . TYR C 2 54  ? 96.429  27.321 -57.710 1.00 38.53  ? 454  TYR A CB    1 
ATOM   6118  C CG    . TYR C 2 54  ? 97.581  28.208 -58.124 1.00 39.62  ? 454  TYR A CG    1 
ATOM   6119  C CD1   . TYR C 2 54  ? 97.625  28.794 -59.390 1.00 39.93  ? 454  TYR A CD1   1 
ATOM   6120  C CD2   . TYR C 2 54  ? 98.657  28.447 -57.253 1.00 41.00  ? 454  TYR A CD2   1 
ATOM   6121  C CE1   . TYR C 2 54  ? 98.708  29.594 -59.783 1.00 41.44  ? 454  TYR A CE1   1 
ATOM   6122  C CE2   . TYR C 2 54  ? 99.756  29.242 -57.646 1.00 42.13  ? 454  TYR A CE2   1 
ATOM   6123  C CZ    . TYR C 2 54  ? 99.765  29.803 -58.909 1.00 43.90  ? 454  TYR A CZ    1 
ATOM   6124  O OH    . TYR C 2 54  ? 100.837 30.549 -59.311 1.00 44.16  ? 454  TYR A OH    1 
ATOM   6125  N N     . GLN C 2 55  ? 95.106  24.379 -56.773 1.00 35.04  ? 455  GLN A N     1 
ATOM   6126  C CA    . GLN C 2 55  ? 94.097  23.707 -55.974 1.00 35.26  ? 455  GLN A CA    1 
ATOM   6127  C C     . GLN C 2 55  ? 94.767  22.756 -54.981 1.00 36.31  ? 455  GLN A C     1 
ATOM   6128  O O     . GLN C 2 55  ? 94.119  22.235 -54.067 1.00 35.27  ? 455  GLN A O     1 
ATOM   6129  C CB    . GLN C 2 55  ? 93.133  22.936 -56.851 1.00 34.90  ? 455  GLN A CB    1 
ATOM   6130  C CG    . GLN C 2 55  ? 92.435  23.832 -57.822 1.00 35.11  ? 455  GLN A CG    1 
ATOM   6131  C CD    . GLN C 2 55  ? 91.189  23.226 -58.419 1.00 39.21  ? 455  GLN A CD    1 
ATOM   6132  O OE1   . GLN C 2 55  ? 91.153  22.022 -58.730 1.00 37.90  ? 455  GLN A OE1   1 
ATOM   6133  N NE2   . GLN C 2 55  ? 90.156  24.067 -58.612 1.00 36.38  ? 455  GLN A NE2   1 
ATOM   6134  N N     . LYS C 2 56  ? 96.066  22.532 -55.155 1.00 40.46  ? 456  LYS A N     1 
ATOM   6135  C CA    . LYS C 2 56  ? 96.800  21.657 -54.255 1.00 43.93  ? 456  LYS A CA    1 
ATOM   6136  C C     . LYS C 2 56  ? 97.304  22.427 -53.061 1.00 41.80  ? 456  LYS A C     1 
ATOM   6137  O O     . LYS C 2 56  ? 97.298  21.920 -51.950 1.00 43.41  ? 456  LYS A O     1 
ATOM   6138  C CB    . LYS C 2 56  ? 97.986  20.998 -54.961 1.00 74.31  ? 456  LYS A CB    1 
ATOM   6139  C CG    . LYS C 2 56  ? 97.568  19.963 -55.976 1.00 82.79  ? 456  LYS A CG    1 
ATOM   6140  C CD    . LYS C 2 56  ? 98.706  19.040 -56.384 1.00 86.34  ? 456  LYS A CD    1 
ATOM   6141  C CE    . LYS C 2 56  ? 98.268  18.095 -57.519 1.00 89.54  ? 456  LYS A CE    1 
ATOM   6142  N NZ    . LYS C 2 56  ? 96.995  17.361 -57.207 1.00 91.30  ? 456  LYS A NZ    1 
ATOM   6143  N N     . SER C 2 57  ? 97.714  23.661 -53.296 1.00 44.90  ? 457  SER A N     1 
ATOM   6144  C CA    . SER C 2 57  ? 98.256  24.506 -52.252 1.00 43.46  ? 457  SER A CA    1 
ATOM   6145  C C     . SER C 2 57  ? 97.234  25.368 -51.491 1.00 42.97  ? 457  SER A C     1 
ATOM   6146  O O     . SER C 2 57  ? 96.089  25.507 -51.906 1.00 44.07  ? 457  SER A O     1 
ATOM   6147  C CB    . SER C 2 57  ? 99.304  25.418 -52.874 1.00 56.25  ? 457  SER A CB    1 
ATOM   6148  O OG    . SER C 2 57  ? 98.705  26.265 -53.829 1.00 58.88  ? 457  SER A OG    1 
ATOM   6149  N N     . THR C 2 58  ? 97.667  25.969 -50.386 1.00 35.21  ? 458  THR A N     1 
ATOM   6150  C CA    . THR C 2 58  ? 96.782  26.809 -49.605 1.00 35.55  ? 458  THR A CA    1 
ATOM   6151  C C     . THR C 2 58  ? 97.334  28.201 -49.329 1.00 36.31  ? 458  THR A C     1 
ATOM   6152  O O     . THR C 2 58  ? 96.683  29.029 -48.698 1.00 35.58  ? 458  THR A O     1 
ATOM   6153  C CB    . THR C 2 58  ? 96.447  26.146 -48.262 1.00 27.78  ? 458  THR A CB    1 
ATOM   6154  O OG1   . THR C 2 58  ? 97.545  26.282 -47.365 1.00 29.78  ? 458  THR A OG1   1 
ATOM   6155  C CG2   . THR C 2 58  ? 96.139  24.691 -48.469 1.00 23.95  ? 458  THR A CG2   1 
ATOM   6156  N N     . GLU C 2 59  ? 98.548  28.462 -49.789 1.00 37.18  ? 459  GLU A N     1 
ATOM   6157  C CA    . GLU C 2 59  ? 99.131  29.774 -49.571 1.00 39.16  ? 459  GLU A CA    1 
ATOM   6158  C C     . GLU C 2 59  ? 98.214  30.816 -50.169 1.00 37.24  ? 459  GLU A C     1 
ATOM   6159  O O     . GLU C 2 59  ? 97.391  30.516 -51.047 1.00 36.38  ? 459  GLU A O     1 
ATOM   6160  C CB    . GLU C 2 59  ? 100.529 29.877 -50.192 1.00 51.42  ? 459  GLU A CB    1 
ATOM   6161  C CG    . GLU C 2 59  ? 100.851 28.833 -51.215 1.00 62.75  ? 459  GLU A CG    1 
ATOM   6162  C CD    . GLU C 2 59  ? 100.250 29.132 -52.564 1.00 65.33  ? 459  GLU A CD    1 
ATOM   6163  O OE1   . GLU C 2 59  ? 100.675 30.117 -53.201 1.00 71.54  ? 459  GLU A OE1   1 
ATOM   6164  O OE2   . GLU C 2 59  ? 99.345  28.380 -52.991 1.00 67.05  ? 459  GLU A OE2   1 
ATOM   6165  N N     . LEU C 2 60  ? 98.334  32.038 -49.678 1.00 39.66  ? 460  LEU A N     1 
ATOM   6166  C CA    . LEU C 2 60  ? 97.520  33.105 -50.202 1.00 40.15  ? 460  LEU A CA    1 
ATOM   6167  C C     . LEU C 2 60  ? 98.051  33.478 -51.584 1.00 40.45  ? 460  LEU A C     1 
ATOM   6168  O O     . LEU C 2 60  ? 99.206  33.255 -51.877 1.00 41.18  ? 460  LEU A O     1 
ATOM   6169  C CB    . LEU C 2 60  ? 97.555  34.263 -49.234 1.00 34.88  ? 460  LEU A CB    1 
ATOM   6170  C CG    . LEU C 2 60  ? 96.926  33.874 -47.892 1.00 36.39  ? 460  LEU A CG    1 
ATOM   6171  C CD1   . LEU C 2 60  ? 97.110  35.007 -46.927 1.00 36.18  ? 460  LEU A CD1   1 
ATOM   6172  C CD2   . LEU C 2 60  ? 95.446  33.527 -48.073 1.00 37.84  ? 460  LEU A CD2   1 
ATOM   6173  N N     . LEU C 2 61  ? 97.217  34.043 -52.442 1.00 44.87  ? 461  LEU A N     1 
ATOM   6174  C CA    . LEU C 2 61  ? 97.649  34.335 -53.797 1.00 43.50  ? 461  LEU A CA    1 
ATOM   6175  C C     . LEU C 2 61  ? 97.826  35.815 -54.089 1.00 44.35  ? 461  LEU A C     1 
ATOM   6176  O O     . LEU C 2 61  ? 98.341  36.202 -55.144 1.00 44.55  ? 461  LEU A O     1 
ATOM   6177  C CB    . LEU C 2 61  ? 96.654  33.700 -54.765 1.00 36.79  ? 461  LEU A CB    1 
ATOM   6178  C CG    . LEU C 2 61  ? 96.289  32.250 -54.410 1.00 34.39  ? 461  LEU A CG    1 
ATOM   6179  C CD1   . LEU C 2 61  ? 95.518  31.688 -55.542 1.00 36.35  ? 461  LEU A CD1   1 
ATOM   6180  C CD2   . LEU C 2 61  ? 97.515  31.376 -54.116 1.00 36.16  ? 461  LEU A CD2   1 
ATOM   6181  N N     . ILE C 2 62  ? 97.394  36.655 -53.158 1.00 43.15  ? 462  ILE A N     1 
ATOM   6182  C CA    . ILE C 2 62  ? 97.559  38.089 -53.323 1.00 45.25  ? 462  ILE A CA    1 
ATOM   6183  C C     . ILE C 2 62  ? 98.751  38.474 -52.468 1.00 47.25  ? 462  ILE A C     1 
ATOM   6184  O O     . ILE C 2 62  ? 98.951  37.902 -51.405 1.00 48.85  ? 462  ILE A O     1 
ATOM   6185  C CB    . ILE C 2 62  ? 96.329  38.843 -52.832 1.00 33.25  ? 462  ILE A CB    1 
ATOM   6186  C CG1   . ILE C 2 62  ? 95.120  38.399 -53.641 1.00 35.34  ? 462  ILE A CG1   1 
ATOM   6187  C CG2   . ILE C 2 62  ? 96.565  40.362 -52.940 1.00 32.22  ? 462  ILE A CG2   1 
ATOM   6188  C CD1   . ILE C 2 62  ? 93.855  39.190 -53.314 1.00 29.58  ? 462  ILE A CD1   1 
ATOM   6189  N N     . ARG C 2 63  ? 99.550  39.423 -52.939 1.00 43.98  ? 463  ARG A N     1 
ATOM   6190  C CA    . ARG C 2 63  ? 100.714 39.847 -52.173 1.00 46.04  ? 463  ARG A CA    1 
ATOM   6191  C C     . ARG C 2 63  ? 100.268 40.683 -50.968 1.00 46.40  ? 463  ARG A C     1 
ATOM   6192  O O     . ARG C 2 63  ? 99.480  41.636 -51.110 1.00 45.22  ? 463  ARG A O     1 
ATOM   6193  C CB    . ARG C 2 63  ? 101.685 40.652 -53.044 1.00 75.20  ? 463  ARG A CB    1 
ATOM   6194  C CG    . ARG C 2 63  ? 102.530 39.816 -53.974 1.00 78.45  ? 463  ARG A CG    1 
ATOM   6195  C CD    . ARG C 2 63  ? 102.243 40.176 -55.414 1.00 85.67  ? 463  ARG A CD    1 
ATOM   6196  N NE    . ARG C 2 63  ? 102.780 41.490 -55.754 1.00 93.41  ? 463  ARG A NE    1 
ATOM   6197  C CZ    . ARG C 2 63  ? 102.440 42.187 -56.839 1.00 95.91  ? 463  ARG A CZ    1 
ATOM   6198  N NH1   . ARG C 2 63  ? 101.553 41.689 -57.702 1.00 99.63  ? 463  ARG A NH1   1 
ATOM   6199  N NH2   . ARG C 2 63  ? 102.978 43.389 -57.052 1.00 95.34  ? 463  ARG A NH2   1 
ATOM   6200  N N     . LYS C 2 64  ? 100.789 40.310 -49.793 1.00 45.17  ? 464  LYS A N     1 
ATOM   6201  C CA    . LYS C 2 64  ? 100.476 40.948 -48.524 1.00 46.82  ? 464  LYS A CA    1 
ATOM   6202  C C     . LYS C 2 64  ? 100.534 42.466 -48.519 1.00 45.63  ? 464  LYS A C     1 
ATOM   6203  O O     . LYS C 2 64  ? 99.555  43.123 -48.145 1.00 44.74  ? 464  LYS A O     1 
ATOM   6204  C CB    . LYS C 2 64  ? 101.386 40.381 -47.441 1.00 65.16  ? 464  LYS A CB    1 
ATOM   6205  C CG    . LYS C 2 64  ? 101.344 38.870 -47.421 1.00 74.06  ? 464  LYS A CG    1 
ATOM   6206  C CD    . LYS C 2 64  ? 101.606 38.291 -46.034 1.00 77.91  ? 464  LYS A CD    1 
ATOM   6207  C CE    . LYS C 2 64  ? 101.228 36.797 -45.980 1.00 80.14  ? 464  LYS A CE    1 
ATOM   6208  N NZ    . LYS C 2 64  ? 101.521 36.158 -44.652 1.00 80.68  ? 464  LYS A NZ    1 
ATOM   6209  N N     . LEU C 2 65  ? 101.660 43.037 -48.944 1.00 49.39  ? 465  LEU A N     1 
ATOM   6210  C CA    . LEU C 2 65  ? 101.804 44.488 -48.934 1.00 47.10  ? 465  LEU A CA    1 
ATOM   6211  C C     . LEU C 2 65  ? 100.744 45.234 -49.735 1.00 45.99  ? 465  LEU A C     1 
ATOM   6212  O O     . LEU C 2 65  ? 100.072 46.105 -49.220 1.00 47.13  ? 465  LEU A O     1 
ATOM   6213  C CB    . LEU C 2 65  ? 103.196 44.894 -49.415 1.00 58.53  ? 465  LEU A CB    1 
ATOM   6214  C CG    . LEU C 2 65  ? 103.473 46.395 -49.227 1.00 59.61  ? 465  LEU A CG    1 
ATOM   6215  C CD1   . LEU C 2 65  ? 103.543 46.699 -47.737 1.00 58.83  ? 465  LEU A CD1   1 
ATOM   6216  C CD2   . LEU C 2 65  ? 104.756 46.803 -49.931 1.00 62.06  ? 465  LEU A CD2   1 
ATOM   6217  N N     . PRO C 2 66  ? 100.579 44.899 -51.010 1.00 39.89  ? 466  PRO A N     1 
ATOM   6218  C CA    . PRO C 2 66  ? 99.557  45.624 -51.764 1.00 39.27  ? 466  PRO A CA    1 
ATOM   6219  C C     . PRO C 2 66  ? 98.202  45.484 -51.084 1.00 39.46  ? 466  PRO A C     1 
ATOM   6220  O O     . PRO C 2 66  ? 97.392  46.414 -51.103 1.00 39.58  ? 466  PRO A O     1 
ATOM   6221  C CB    . PRO C 2 66  ? 99.549  44.932 -53.126 1.00 37.07  ? 466  PRO A CB    1 
ATOM   6222  C CG    . PRO C 2 66  ? 100.854 44.184 -53.180 1.00 39.98  ? 466  PRO A CG    1 
ATOM   6223  C CD    . PRO C 2 66  ? 101.075 43.744 -51.764 1.00 38.43  ? 466  PRO A CD    1 
ATOM   6224  N N     . PHE C 2 67  ? 97.962  44.317 -50.488 1.00 45.31  ? 467  PHE A N     1 
ATOM   6225  C CA    . PHE C 2 67  ? 96.694  44.070 -49.840 1.00 44.92  ? 467  PHE A CA    1 
ATOM   6226  C C     . PHE C 2 67  ? 96.502  44.970 -48.636 1.00 44.57  ? 467  PHE A C     1 
ATOM   6227  O O     . PHE C 2 67  ? 95.519  45.725 -48.553 1.00 41.11  ? 467  PHE A O     1 
ATOM   6228  C CB    . PHE C 2 67  ? 96.576  42.617 -49.391 1.00 49.62  ? 467  PHE A CB    1 
ATOM   6229  C CG    . PHE C 2 67  ? 95.185  42.223 -48.949 1.00 49.30  ? 467  PHE A CG    1 
ATOM   6230  C CD1   . PHE C 2 67  ? 94.188  41.942 -49.893 1.00 48.00  ? 467  PHE A CD1   1 
ATOM   6231  C CD2   . PHE C 2 67  ? 94.842  42.206 -47.595 1.00 47.41  ? 467  PHE A CD2   1 
ATOM   6232  C CE1   . PHE C 2 67  ? 92.891  41.615 -49.497 1.00 45.96  ? 467  PHE A CE1   1 
ATOM   6233  C CE2   . PHE C 2 67  ? 93.534  41.876 -47.191 1.00 48.76  ? 467  PHE A CE2   1 
ATOM   6234  C CZ    . PHE C 2 67  ? 92.559  41.601 -48.144 1.00 45.83  ? 467  PHE A CZ    1 
ATOM   6235  N N     . GLN C 2 68  ? 97.449  44.892 -47.708 1.00 51.03  ? 468  GLN A N     1 
ATOM   6236  C CA    . GLN C 2 68  ? 97.379  45.671 -46.491 1.00 53.02  ? 468  GLN A CA    1 
ATOM   6237  C C     . GLN C 2 68  ? 97.108  47.134 -46.795 1.00 51.16  ? 468  GLN A C     1 
ATOM   6238  O O     . GLN C 2 68  ? 96.349  47.800 -46.088 1.00 50.34  ? 468  GLN A O     1 
ATOM   6239  C CB    . GLN C 2 68  ? 98.674  45.532 -45.723 1.00 49.87  ? 468  GLN A CB    1 
ATOM   6240  C CG    . GLN C 2 68  ? 98.534  45.956 -44.286 1.00 58.11  ? 468  GLN A CG    1 
ATOM   6241  C CD    . GLN C 2 68  ? 99.780  45.664 -43.504 1.00 62.38  ? 468  GLN A CD    1 
ATOM   6242  O OE1   . GLN C 2 68  ? 100.836 46.232 -43.780 1.00 68.09  ? 468  GLN A OE1   1 
ATOM   6243  N NE2   . GLN C 2 68  ? 99.678  44.768 -42.531 1.00 65.61  ? 468  GLN A NE2   1 
ATOM   6244  N N     . ARG C 2 69  ? 97.725  47.622 -47.865 1.00 38.57  ? 469  ARG A N     1 
ATOM   6245  C CA    . ARG C 2 69  ? 97.565  48.997 -48.279 1.00 39.88  ? 469  ARG A CA    1 
ATOM   6246  C C     . ARG C 2 69  ? 96.109  49.254 -48.636 1.00 38.47  ? 469  ARG A C     1 
ATOM   6247  O O     . ARG C 2 69  ? 95.542  50.290 -48.268 1.00 36.44  ? 469  ARG A O     1 
ATOM   6248  C CB    . ARG C 2 69  ? 98.447  49.294 -49.496 1.00 61.71  ? 469  ARG A CB    1 
ATOM   6249  C CG    . ARG C 2 69  ? 99.602  50.250 -49.232 1.00 66.37  ? 469  ARG A CG    1 
ATOM   6250  C CD    . ARG C 2 69  ? 99.984  51.019 -50.487 1.00 67.76  ? 469  ARG A CD    1 
ATOM   6251  N NE    . ARG C 2 69  ? 100.249 50.134 -51.615 1.00 67.28  ? 469  ARG A NE    1 
ATOM   6252  C CZ    . ARG C 2 69  ? 101.296 49.315 -51.708 1.00 67.53  ? 469  ARG A CZ    1 
ATOM   6253  N NH1   . ARG C 2 69  ? 102.199 49.261 -50.735 1.00 68.96  ? 469  ARG A NH1   1 
ATOM   6254  N NH2   . ARG C 2 69  ? 101.438 48.538 -52.777 1.00 65.08  ? 469  ARG A NH2   1 
ATOM   6255  N N     . LEU C 2 70  ? 95.513  48.308 -49.365 1.00 37.80  ? 470  LEU A N     1 
ATOM   6256  C CA    . LEU C 2 70  ? 94.133  48.433 -49.791 1.00 37.41  ? 470  LEU A CA    1 
ATOM   6257  C C     . LEU C 2 70  ? 93.176  48.390 -48.597 1.00 35.09  ? 470  LEU A C     1 
ATOM   6258  O O     . LEU C 2 70  ? 92.148  49.073 -48.570 1.00 36.35  ? 470  LEU A O     1 
ATOM   6259  C CB    . LEU C 2 70  ? 93.817  47.312 -50.758 1.00 43.64  ? 470  LEU A CB    1 
ATOM   6260  C CG    . LEU C 2 70  ? 92.405  47.289 -51.327 1.00 44.17  ? 470  LEU A CG    1 
ATOM   6261  C CD1   . LEU C 2 70  ? 92.049  48.607 -51.962 1.00 41.95  ? 470  LEU A CD1   1 
ATOM   6262  C CD2   . LEU C 2 70  ? 92.357  46.198 -52.350 1.00 41.08  ? 470  LEU A CD2   1 
ATOM   6263  N N     . VAL C 2 71  ? 93.533  47.582 -47.603 1.00 34.42  ? 471  VAL A N     1 
ATOM   6264  C CA    . VAL C 2 71  ? 92.721  47.455 -46.404 1.00 35.99  ? 471  VAL A CA    1 
ATOM   6265  C C     . VAL C 2 71  ? 92.704  48.751 -45.619 1.00 36.58  ? 471  VAL A C     1 
ATOM   6266  O O     . VAL C 2 71  ? 91.639  49.257 -45.276 1.00 36.77  ? 471  VAL A O     1 
ATOM   6267  C CB    . VAL C 2 71  ? 93.246  46.342 -45.487 1.00 47.81  ? 471  VAL A CB    1 
ATOM   6268  C CG1   . VAL C 2 71  ? 92.553  46.408 -44.123 1.00 48.13  ? 471  VAL A CG1   1 
ATOM   6269  C CG2   . VAL C 2 71  ? 93.013  44.999 -46.151 1.00 49.70  ? 471  VAL A CG2   1 
ATOM   6270  N N     . ARG C 2 72  ? 93.892  49.283 -45.335 1.00 54.13  ? 472  ARG A N     1 
ATOM   6271  C CA    . ARG C 2 72  ? 93.998  50.529 -44.584 1.00 53.72  ? 472  ARG A CA    1 
ATOM   6272  C C     . ARG C 2 72  ? 93.302  51.662 -45.333 1.00 52.56  ? 472  ARG A C     1 
ATOM   6273  O O     . ARG C 2 72  ? 92.565  52.451 -44.742 1.00 50.62  ? 472  ARG A O     1 
ATOM   6274  C CB    . ARG C 2 72  ? 95.470  50.863 -44.327 1.00 45.74  ? 472  ARG A CB    1 
ATOM   6275  C CG    . ARG C 2 72  ? 96.169  49.891 -43.366 1.00 47.33  ? 472  ARG A CG    1 
ATOM   6276  C CD    . ARG C 2 72  ? 97.667  50.100 -43.326 1.00 50.65  ? 472  ARG A CD    1 
ATOM   6277  N NE    . ARG C 2 72  ? 98.338  49.040 -42.576 1.00 52.92  ? 472  ARG A NE    1 
ATOM   6278  C CZ    . ARG C 2 72  ? 98.483  49.024 -41.250 1.00 53.20  ? 472  ARG A CZ    1 
ATOM   6279  N NH1   . ARG C 2 72  ? 98.001  50.021 -40.506 1.00 53.87  ? 472  ARG A NH1   1 
ATOM   6280  N NH2   . ARG C 2 72  ? 99.118  48.016 -40.658 1.00 55.68  ? 472  ARG A NH2   1 
ATOM   6281  N N     . GLU C 2 73  ? 93.514  51.717 -46.643 1.00 44.84  ? 473  GLU A N     1 
ATOM   6282  C CA    . GLU C 2 73  ? 92.899  52.748 -47.452 1.00 47.42  ? 473  GLU A CA    1 
ATOM   6283  C C     . GLU C 2 73  ? 91.397  52.748 -47.299 1.00 47.76  ? 473  GLU A C     1 
ATOM   6284  O O     . GLU C 2 73  ? 90.782  53.776 -47.033 1.00 48.38  ? 473  GLU A O     1 
ATOM   6285  C CB    . GLU C 2 73  ? 93.202  52.551 -48.922 1.00 54.64  ? 473  GLU A CB    1 
ATOM   6286  C CG    . GLU C 2 73  ? 92.587  53.647 -49.770 1.00 60.28  ? 473  GLU A CG    1 
ATOM   6287  C CD    . GLU C 2 73  ? 92.428  53.258 -51.214 1.00 63.90  ? 473  GLU A CD    1 
ATOM   6288  O OE1   . GLU C 2 73  ? 93.447  53.123 -51.926 1.00 67.17  ? 473  GLU A OE1   1 
ATOM   6289  O OE2   . GLU C 2 73  ? 91.270  53.077 -51.645 1.00 69.73  ? 473  GLU A OE2   1 
ATOM   6290  N N     . ILE C 2 74  ? 90.797  51.586 -47.500 1.00 52.01  ? 474  ILE A N     1 
ATOM   6291  C CA    . ILE C 2 74  ? 89.361  51.468 -47.396 1.00 49.07  ? 474  ILE A CA    1 
ATOM   6292  C C     . ILE C 2 74  ? 88.868  51.851 -46.014 1.00 49.18  ? 474  ILE A C     1 
ATOM   6293  O O     . ILE C 2 74  ? 87.840  52.503 -45.879 1.00 48.46  ? 474  ILE A O     1 
ATOM   6294  C CB    . ILE C 2 74  ? 88.914  50.032 -47.687 1.00 37.97  ? 474  ILE A CB    1 
ATOM   6295  C CG1   . ILE C 2 74  ? 89.073  49.716 -49.173 1.00 38.34  ? 474  ILE A CG1   1 
ATOM   6296  C CG2   . ILE C 2 74  ? 87.472  49.860 -47.286 1.00 36.14  ? 474  ILE A CG2   1 
ATOM   6297  C CD1   . ILE C 2 74  ? 88.870  48.253 -49.528 1.00 36.18  ? 474  ILE A CD1   1 
ATOM   6298  N N     . ALA C 2 75  ? 89.602  51.455 -44.984 1.00 39.02  ? 475  ALA A N     1 
ATOM   6299  C CA    . ALA C 2 75  ? 89.169  51.743 -43.627 1.00 41.78  ? 475  ALA A CA    1 
ATOM   6300  C C     . ALA C 2 75  ? 89.317  53.205 -43.245 1.00 45.57  ? 475  ALA A C     1 
ATOM   6301  O O     . ALA C 2 75  ? 88.553  53.722 -42.425 1.00 44.79  ? 475  ALA A O     1 
ATOM   6302  C CB    . ALA C 2 75  ? 89.920  50.867 -42.653 1.00 23.07  ? 475  ALA A CB    1 
ATOM   6303  N N     . GLN C 2 76  ? 90.297  53.867 -43.850 1.00 46.85  ? 476  GLN A N     1 
ATOM   6304  C CA    . GLN C 2 76  ? 90.555  55.274 -43.583 1.00 50.32  ? 476  GLN A CA    1 
ATOM   6305  C C     . GLN C 2 76  ? 89.328  56.097 -43.875 1.00 50.84  ? 476  GLN A C     1 
ATOM   6306  O O     . GLN C 2 76  ? 89.215  57.206 -43.400 1.00 51.96  ? 476  GLN A O     1 
ATOM   6307  C CB    . GLN C 2 76  ? 91.731  55.776 -44.427 1.00 59.83  ? 476  GLN A CB    1 
ATOM   6308  C CG    . GLN C 2 76  ? 92.279  57.174 -44.076 1.00 64.79  ? 476  GLN A CG    1 
ATOM   6309  C CD    . GLN C 2 76  ? 92.435  57.434 -42.579 1.00 67.88  ? 476  GLN A CD    1 
ATOM   6310  O OE1   . GLN C 2 76  ? 92.738  56.532 -41.794 1.00 68.73  ? 476  GLN A OE1   1 
ATOM   6311  N NE2   . GLN C 2 76  ? 92.234  58.684 -42.183 1.00 70.91  ? 476  GLN A NE2   1 
ATOM   6312  N N     . ASP C 2 77  ? 88.403  55.561 -44.655 1.00 40.61  ? 477  ASP A N     1 
ATOM   6313  C CA    . ASP C 2 77  ? 87.191  56.290 -44.952 1.00 39.56  ? 477  ASP A CA    1 
ATOM   6314  C C     . ASP C 2 77  ? 86.173  56.037 -43.871 1.00 39.19  ? 477  ASP A C     1 
ATOM   6315  O O     . ASP C 2 77  ? 85.155  56.714 -43.844 1.00 39.83  ? 477  ASP A O     1 
ATOM   6316  C CB    . ASP C 2 77  ? 86.606  55.872 -46.288 1.00 78.26  ? 477  ASP A CB    1 
ATOM   6317  C CG    . ASP C 2 77  ? 87.550  56.127 -47.424 1.00 82.62  ? 477  ASP A CG    1 
ATOM   6318  O OD1   . ASP C 2 77  ? 87.160  55.896 -48.588 1.00 85.19  ? 477  ASP A OD1   1 
ATOM   6319  O OD2   . ASP C 2 77  ? 88.693  56.557 -47.153 1.00 85.48  ? 477  ASP A OD2   1 
ATOM   6320  N N     . PHE C 2 78  ? 86.427  55.077 -42.977 1.00 51.40  ? 478  PHE A N     1 
ATOM   6321  C CA    . PHE C 2 78  ? 85.455  54.780 -41.920 1.00 50.87  ? 478  PHE A CA    1 
ATOM   6322  C C     . PHE C 2 78  ? 85.895  55.371 -40.590 1.00 51.25  ? 478  PHE A C     1 
ATOM   6323  O O     . PHE C 2 78  ? 85.080  55.682 -39.709 1.00 50.98  ? 478  PHE A O     1 
ATOM   6324  C CB    . PHE C 2 78  ? 85.200  53.249 -41.775 1.00 45.38  ? 478  PHE A CB    1 
ATOM   6325  C CG    . PHE C 2 78  ? 84.582  52.612 -42.997 1.00 45.02  ? 478  PHE A CG    1 
ATOM   6326  C CD1   . PHE C 2 78  ? 85.265  51.604 -43.692 1.00 42.30  ? 478  PHE A CD1   1 
ATOM   6327  C CD2   . PHE C 2 78  ? 83.372  53.094 -43.521 1.00 46.09  ? 478  PHE A CD2   1 
ATOM   6328  C CE1   . PHE C 2 78  ? 84.763  51.106 -44.913 1.00 42.19  ? 478  PHE A CE1   1 
ATOM   6329  C CE2   . PHE C 2 78  ? 82.858  52.601 -44.740 1.00 44.81  ? 478  PHE A CE2   1 
ATOM   6330  C CZ    . PHE C 2 78  ? 83.554  51.607 -45.437 1.00 42.90  ? 478  PHE A CZ    1 
ATOM   6331  N N     . LYS C 2 79  ? 87.191  55.536 -40.431 1.00 53.05  ? 479  LYS A N     1 
ATOM   6332  C CA    . LYS C 2 79  ? 87.675  56.118 -39.202 1.00 53.28  ? 479  LYS A CA    1 
ATOM   6333  C C     . LYS C 2 79  ? 89.144  56.419 -39.366 1.00 53.00  ? 479  LYS A C     1 
ATOM   6334  O O     . LYS C 2 79  ? 89.947  55.540 -39.657 1.00 49.71  ? 479  LYS A O     1 
ATOM   6335  C CB    . LYS C 2 79  ? 87.442  55.175 -38.031 1.00 32.66  ? 479  LYS A CB    1 
ATOM   6336  C CG    . LYS C 2 79  ? 87.725  55.840 -36.728 1.00 34.75  ? 479  LYS A CG    1 
ATOM   6337  C CD    . LYS C 2 79  ? 87.563  54.948 -35.494 1.00 43.16  ? 479  LYS A CD    1 
ATOM   6338  C CE    . LYS C 2 79  ? 87.735  55.828 -34.233 1.00 46.68  ? 479  LYS A CE    1 
ATOM   6339  N NZ    . LYS C 2 79  ? 87.617  55.109 -32.925 1.00 51.30  ? 479  LYS A NZ    1 
ATOM   6340  N N     . THR C 2 80  ? 89.496  57.680 -39.196 1.00 56.62  ? 480  THR A N     1 
ATOM   6341  C CA    . THR C 2 80  ? 90.876  58.102 -39.347 1.00 56.33  ? 480  THR A CA    1 
ATOM   6342  C C     . THR C 2 80  ? 91.770  57.543 -38.260 1.00 57.21  ? 480  THR A C     1 
ATOM   6343  O O     . THR C 2 80  ? 91.311  57.181 -37.177 1.00 57.29  ? 480  THR A O     1 
ATOM   6344  C CB    . THR C 2 80  ? 90.976  59.587 -39.254 1.00 51.66  ? 480  THR A CB    1 
ATOM   6345  O OG1   . THR C 2 80  ? 90.346  59.989 -38.035 1.00 52.09  ? 480  THR A OG1   1 
ATOM   6346  C CG2   . THR C 2 80  ? 90.295  60.253 -40.435 1.00 52.50  ? 480  THR A CG2   1 
ATOM   6347  N N     . ASP C 2 81  ? 93.058  57.499 -38.568 1.00 60.62  ? 481  ASP A N     1 
ATOM   6348  C CA    . ASP C 2 81  ? 94.072  57.019 -37.651 1.00 61.30  ? 481  ASP A CA    1 
ATOM   6349  C C     . ASP C 2 81  ? 93.698  55.704 -36.998 1.00 62.34  ? 481  ASP A C     1 
ATOM   6350  O O     . ASP C 2 81  ? 93.279  55.656 -35.850 1.00 62.40  ? 481  ASP A O     1 
ATOM   6351  C CB    . ASP C 2 81  ? 94.356  58.076 -36.580 1.00 86.15  ? 481  ASP A CB    1 
ATOM   6352  C CG    . ASP C 2 81  ? 95.573  57.737 -35.734 1.00 86.65  ? 481  ASP A CG    1 
ATOM   6353  O OD1   . ASP C 2 81  ? 96.653  57.462 -36.317 1.00 87.63  ? 481  ASP A OD1   1 
ATOM   6354  O OD2   . ASP C 2 81  ? 95.446  57.752 -34.487 1.00 90.23  ? 481  ASP A OD2   1 
ATOM   6355  N N     . LEU C 2 82  ? 93.868  54.624 -37.736 1.00 57.15  ? 482  LEU A N     1 
ATOM   6356  C CA    . LEU C 2 82  ? 93.541  53.329 -37.204 1.00 54.25  ? 482  LEU A CA    1 
ATOM   6357  C C     . LEU C 2 82  ? 94.765  52.454 -37.320 1.00 53.56  ? 482  LEU A C     1 
ATOM   6358  O O     . LEU C 2 82  ? 95.534  52.599 -38.258 1.00 54.47  ? 482  LEU A O     1 
ATOM   6359  C CB    . LEU C 2 82  ? 92.377  52.723 -38.002 1.00 37.25  ? 482  LEU A CB    1 
ATOM   6360  C CG    . LEU C 2 82  ? 90.963  53.008 -37.479 1.00 37.54  ? 482  LEU A CG    1 
ATOM   6361  C CD1   . LEU C 2 82  ? 89.878  52.428 -38.401 1.00 39.30  ? 482  LEU A CD1   1 
ATOM   6362  C CD2   . LEU C 2 82  ? 90.849  52.404 -36.089 1.00 34.73  ? 482  LEU A CD2   1 
ATOM   6363  N N     . ARG C 2 83  ? 94.962  51.557 -36.366 1.00 68.33  ? 483  ARG A N     1 
ATOM   6364  C CA    . ARG C 2 83  ? 96.092  50.654 -36.437 1.00 68.65  ? 483  ARG A CA    1 
ATOM   6365  C C     . ARG C 2 83  ? 95.509  49.252 -36.550 1.00 68.48  ? 483  ARG A C     1 
ATOM   6366  O O     . ARG C 2 83  ? 94.511  48.943 -35.904 1.00 63.92  ? 483  ARG A O     1 
ATOM   6367  C CB    . ARG C 2 83  ? 96.956  50.779 -35.185 1.00 68.41  ? 483  ARG A CB    1 
ATOM   6368  C CG    . ARG C 2 83  ? 97.266  52.215 -34.824 1.00 75.04  ? 483  ARG A CG    1 
ATOM   6369  C CD    . ARG C 2 83  ? 98.264  52.316 -33.696 1.00 78.68  ? 483  ARG A CD    1 
ATOM   6370  N NE    . ARG C 2 83  ? 99.632  52.280 -34.188 1.00 87.51  ? 483  ARG A NE    1 
ATOM   6371  C CZ    . ARG C 2 83  ? 100.669 51.891 -33.454 1.00 89.17  ? 483  ARG A CZ    1 
ATOM   6372  N NH1   . ARG C 2 83  ? 100.472 51.510 -32.199 1.00 91.15  ? 483  ARG A NH1   1 
ATOM   6373  N NH2   . ARG C 2 83  ? 101.895 51.869 -33.973 1.00 91.38  ? 483  ARG A NH2   1 
ATOM   6374  N N     . PHE C 2 84  ? 96.120  48.412 -37.378 1.00 57.96  ? 484  PHE A N     1 
ATOM   6375  C CA    . PHE C 2 84  ? 95.650  47.051 -37.574 1.00 58.13  ? 484  PHE A CA    1 
ATOM   6376  C C     . PHE C 2 84  ? 96.570  45.992 -36.974 1.00 59.12  ? 484  PHE A C     1 
ATOM   6377  O O     . PHE C 2 84  ? 97.784  46.051 -37.148 1.00 59.73  ? 484  PHE A O     1 
ATOM   6378  C CB    . PHE C 2 84  ? 95.511  46.756 -39.063 1.00 51.91  ? 484  PHE A CB    1 
ATOM   6379  C CG    . PHE C 2 84  ? 94.248  47.261 -39.662 1.00 50.95  ? 484  PHE A CG    1 
ATOM   6380  C CD1   . PHE C 2 84  ? 94.176  48.544 -40.171 1.00 52.32  ? 484  PHE A CD1   1 
ATOM   6381  C CD2   . PHE C 2 84  ? 93.109  46.454 -39.696 1.00 51.87  ? 484  PHE A CD2   1 
ATOM   6382  C CE1   . PHE C 2 84  ? 92.987  49.029 -40.703 1.00 49.69  ? 484  PHE A CE1   1 
ATOM   6383  C CE2   . PHE C 2 84  ? 91.910  46.924 -40.226 1.00 49.00  ? 484  PHE A CE2   1 
ATOM   6384  C CZ    . PHE C 2 84  ? 91.846  48.214 -40.731 1.00 49.33  ? 484  PHE A CZ    1 
ATOM   6385  N N     . GLN C 2 85  ? 95.996  45.025 -36.264 1.00 42.92  ? 485  GLN A N     1 
ATOM   6386  C CA    . GLN C 2 85  ? 96.795  43.947 -35.727 1.00 42.03  ? 485  GLN A CA    1 
ATOM   6387  C C     . GLN C 2 85  ? 97.199  43.175 -36.987 1.00 42.79  ? 485  GLN A C     1 
ATOM   6388  O O     . GLN C 2 85  ? 96.428  43.119 -37.942 1.00 41.39  ? 485  GLN A O     1 
ATOM   6389  C CB    . GLN C 2 85  ? 95.960  43.033 -34.832 1.00 40.05  ? 485  GLN A CB    1 
ATOM   6390  C CG    . GLN C 2 85  ? 95.500  43.635 -33.534 1.00 40.50  ? 485  GLN A CG    1 
ATOM   6391  C CD    . GLN C 2 85  ? 95.005  42.582 -32.576 1.00 44.90  ? 485  GLN A CD    1 
ATOM   6392  O OE1   . GLN C 2 85  ? 94.439  41.580 -32.993 1.00 43.38  ? 485  GLN A OE1   1 
ATOM   6393  N NE2   . GLN C 2 85  ? 95.202  42.808 -31.283 1.00 44.78  ? 485  GLN A NE2   1 
ATOM   6394  N N     . SER C 2 86  ? 98.381  42.575 -37.021 1.00 50.78  ? 486  SER A N     1 
ATOM   6395  C CA    . SER C 2 86  ? 98.776  41.856 -38.215 1.00 49.06  ? 486  SER A CA    1 
ATOM   6396  C C     . SER C 2 86  ? 97.804  40.715 -38.424 1.00 47.30  ? 486  SER A C     1 
ATOM   6397  O O     . SER C 2 86  ? 97.526  40.335 -39.561 1.00 46.82  ? 486  SER A O     1 
ATOM   6398  C CB    . SER C 2 86  ? 100.149 41.275 -38.039 1.00 49.23  ? 486  SER A CB    1 
ATOM   6399  O OG    . SER C 2 86  ? 100.030 40.196 -37.139 1.00 58.07  ? 486  SER A OG    1 
ATOM   6400  N N     . SER C 2 87  ? 97.294  40.172 -37.318 1.00 45.69  ? 487  SER A N     1 
ATOM   6401  C CA    . SER C 2 87  ? 96.368  39.048 -37.391 1.00 46.76  ? 487  SER A CA    1 
ATOM   6402  C C     . SER C 2 87  ? 95.009  39.444 -37.955 1.00 45.42  ? 487  SER A C     1 
ATOM   6403  O O     . SER C 2 87  ? 94.300  38.605 -38.526 1.00 43.90  ? 487  SER A O     1 
ATOM   6404  C CB    . SER C 2 87  ? 96.174  38.412 -36.020 1.00 42.56  ? 487  SER A CB    1 
ATOM   6405  O OG    . SER C 2 87  ? 95.365  39.217 -35.187 1.00 50.48  ? 487  SER A OG    1 
ATOM   6406  N N     . ALA C 2 88  ? 94.646  40.712 -37.785 1.00 59.46  ? 488  ALA A N     1 
ATOM   6407  C CA    . ALA C 2 88  ? 93.387  41.211 -38.308 1.00 57.81  ? 488  ALA A CA    1 
ATOM   6408  C C     . ALA C 2 88  ? 93.481  41.304 -39.834 1.00 58.31  ? 488  ALA A C     1 
ATOM   6409  O O     . ALA C 2 88  ? 92.585  40.858 -40.551 1.00 57.72  ? 488  ALA A O     1 
ATOM   6410  C CB    . ALA C 2 88  ? 93.080  42.565 -37.726 1.00 51.88  ? 488  ALA A CB    1 
ATOM   6411  N N     . VAL C 2 89  ? 94.562  41.886 -40.340 1.00 36.36  ? 489  VAL A N     1 
ATOM   6412  C CA    . VAL C 2 89  ? 94.725  41.992 -41.792 1.00 37.18  ? 489  VAL A CA    1 
ATOM   6413  C C     . VAL C 2 89  ? 94.770  40.579 -42.367 1.00 39.22  ? 489  VAL A C     1 
ATOM   6414  O O     . VAL C 2 89  ? 94.226  40.297 -43.422 1.00 41.11  ? 489  VAL A O     1 
ATOM   6415  C CB    . VAL C 2 89  ? 96.042  42.734 -42.167 1.00 26.94  ? 489  VAL A CB    1 
ATOM   6416  C CG1   . VAL C 2 89  ? 96.224  42.762 -43.666 1.00 24.09  ? 489  VAL A CG1   1 
ATOM   6417  C CG2   . VAL C 2 89  ? 96.018  44.137 -41.629 1.00 25.79  ? 489  VAL A CG2   1 
ATOM   6418  N N     . MET C 2 90  ? 95.427  39.689 -41.643 1.00 37.70  ? 490  MET A N     1 
ATOM   6419  C CA    . MET C 2 90  ? 95.549  38.319 -42.074 1.00 39.40  ? 490  MET A CA    1 
ATOM   6420  C C     . MET C 2 90  ? 94.193  37.670 -42.201 1.00 36.31  ? 490  MET A C     1 
ATOM   6421  O O     . MET C 2 90  ? 93.929  37.019 -43.187 1.00 35.30  ? 490  MET A O     1 
ATOM   6422  C CB    . MET C 2 90  ? 96.422  37.544 -41.099 1.00 47.01  ? 490  MET A CB    1 
ATOM   6423  C CG    . MET C 2 90  ? 97.877  37.803 -41.299 1.00 57.41  ? 490  MET A CG    1 
ATOM   6424  S SD    . MET C 2 90  ? 98.336  37.304 -42.955 1.00 67.15  ? 490  MET A SD    1 
ATOM   6425  C CE    . MET C 2 90  ? 98.980  35.727 -42.548 1.00 67.72  ? 490  MET A CE    1 
ATOM   6426  N N     . ALA C 2 91  ? 93.332  37.851 -41.208 1.00 53.54  ? 491  ALA A N     1 
ATOM   6427  C CA    . ALA C 2 91  ? 91.998  37.281 -41.267 1.00 51.36  ? 491  ALA A CA    1 
ATOM   6428  C C     . ALA C 2 91  ? 91.223  37.865 -42.471 1.00 50.75  ? 491  ALA A C     1 
ATOM   6429  O O     . ALA C 2 91  ? 90.632  37.116 -43.248 1.00 51.17  ? 491  ALA A O     1 
ATOM   6430  C CB    . ALA C 2 91  ? 91.275  37.559 -39.991 1.00 34.71  ? 491  ALA A CB    1 
ATOM   6431  N N     . LEU C 2 92  ? 91.228  39.188 -42.630 1.00 42.75  ? 492  LEU A N     1 
ATOM   6432  C CA    . LEU C 2 92  ? 90.555  39.820 -43.756 1.00 44.17  ? 492  LEU A CA    1 
ATOM   6433  C C     . LEU C 2 92  ? 91.023  39.242 -45.086 1.00 43.98  ? 492  LEU A C     1 
ATOM   6434  O O     . LEU C 2 92  ? 90.210  39.036 -45.995 1.00 43.86  ? 492  LEU A O     1 
ATOM   6435  C CB    . LEU C 2 92  ? 90.807  41.329 -43.777 1.00 30.87  ? 492  LEU A CB    1 
ATOM   6436  C CG    . LEU C 2 92  ? 90.056  42.220 -42.779 1.00 34.69  ? 492  LEU A CG    1 
ATOM   6437  C CD1   . LEU C 2 92  ? 90.503  43.623 -42.939 1.00 35.27  ? 492  LEU A CD1   1 
ATOM   6438  C CD2   . LEU C 2 92  ? 88.579  42.162 -43.014 1.00 32.49  ? 492  LEU A CD2   1 
ATOM   6439  N N     . GLN C 2 93  ? 92.324  38.975 -45.215 1.00 38.87  ? 493  GLN A N     1 
ATOM   6440  C CA    . GLN C 2 93  ? 92.861  38.436 -46.470 1.00 41.33  ? 493  GLN A CA    1 
ATOM   6441  C C     . GLN C 2 93  ? 92.473  36.990 -46.697 1.00 38.97  ? 493  GLN A C     1 
ATOM   6442  O O     . GLN C 2 93  ? 92.160  36.580 -47.810 1.00 39.87  ? 493  GLN A O     1 
ATOM   6443  C CB    . GLN C 2 93  ? 94.383  38.541 -46.509 1.00 40.32  ? 493  GLN A CB    1 
ATOM   6444  C CG    . GLN C 2 93  ? 94.870  38.599 -47.929 1.00 41.17  ? 493  GLN A CG    1 
ATOM   6445  C CD    . GLN C 2 93  ? 96.365  38.574 -48.080 1.00 45.49  ? 493  GLN A CD    1 
ATOM   6446  O OE1   . GLN C 2 93  ? 97.094  39.377 -47.476 1.00 43.88  ? 493  GLN A OE1   1 
ATOM   6447  N NE2   . GLN C 2 93  ? 96.839  37.668 -48.918 1.00 40.08  ? 493  GLN A NE2   1 
ATOM   6448  N N     . GLU C 2 94  ? 92.515  36.218 -45.624 1.00 33.08  ? 494  GLU A N     1 
ATOM   6449  C CA    . GLU C 2 94  ? 92.161  34.816 -45.677 1.00 35.32  ? 494  GLU A CA    1 
ATOM   6450  C C     . GLU C 2 94  ? 90.711  34.723 -46.087 1.00 34.17  ? 494  GLU A C     1 
ATOM   6451  O O     . GLU C 2 94  ? 90.327  33.817 -46.817 1.00 32.05  ? 494  GLU A O     1 
ATOM   6452  C CB    . GLU C 2 94  ? 92.328  34.179 -44.307 1.00 54.44  ? 494  GLU A CB    1 
ATOM   6453  C CG    . GLU C 2 94  ? 93.643  33.540 -44.111 1.00 60.80  ? 494  GLU A CG    1 
ATOM   6454  C CD    . GLU C 2 94  ? 93.772  32.275 -44.897 1.00 62.04  ? 494  GLU A CD    1 
ATOM   6455  O OE1   . GLU C 2 94  ? 94.925  31.818 -45.026 1.00 62.41  ? 494  GLU A OE1   1 
ATOM   6456  O OE2   . GLU C 2 94  ? 92.742  31.731 -45.378 1.00 60.89  ? 494  GLU A OE2   1 
ATOM   6457  N N     . ALA C 2 95  ? 89.913  35.663 -45.594 1.00 46.53  ? 495  ALA A N     1 
ATOM   6458  C CA    . ALA C 2 95  ? 88.499  35.695 -45.892 1.00 48.10  ? 495  ALA A CA    1 
ATOM   6459  C C     . ALA C 2 95  ? 88.289  36.167 -47.311 1.00 46.95  ? 495  ALA A C     1 
ATOM   6460  O O     . ALA C 2 95  ? 87.559  35.536 -48.070 1.00 44.63  ? 495  ALA A O     1 
ATOM   6461  C CB    . ALA C 2 95  ? 87.743  36.615 -44.887 1.00 13.06  ? 495  ALA A CB    1 
ATOM   6462  N N     . SER C 2 96  ? 88.931  37.270 -47.674 1.00 31.14  ? 496  SER A N     1 
ATOM   6463  C CA    . SER C 2 96  ? 88.787  37.809 -49.022 1.00 32.32  ? 496  SER A CA    1 
ATOM   6464  C C     . SER C 2 96  ? 89.110  36.821 -50.129 1.00 32.55  ? 496  SER A C     1 
ATOM   6465  O O     . SER C 2 96  ? 88.380  36.693 -51.103 1.00 30.92  ? 496  SER A O     1 
ATOM   6466  C CB    . SER C 2 96  ? 89.680  39.016 -49.199 1.00 38.32  ? 496  SER A CB    1 
ATOM   6467  O OG    . SER C 2 96  ? 89.128  40.112 -48.516 1.00 40.75  ? 496  SER A OG    1 
ATOM   6468  N N     . GLU C 2 97  ? 90.231  36.127 -50.001 1.00 45.10  ? 497  GLU A N     1 
ATOM   6469  C CA    . GLU C 2 97  ? 90.619  35.188 -51.025 1.00 46.25  ? 497  GLU A CA    1 
ATOM   6470  C C     . GLU C 2 97  ? 89.665  34.026 -51.080 1.00 46.33  ? 497  GLU A C     1 
ATOM   6471  O O     . GLU C 2 97  ? 89.281  33.601 -52.160 1.00 45.09  ? 497  GLU A O     1 
ATOM   6472  C CB    . GLU C 2 97  ? 92.036  34.725 -50.772 1.00 53.33  ? 497  GLU A CB    1 
ATOM   6473  C CG    . GLU C 2 97  ? 93.028  35.783 -51.144 1.00 55.82  ? 497  GLU A CG    1 
ATOM   6474  C CD    . GLU C 2 97  ? 94.454  35.278 -51.121 1.00 57.90  ? 497  GLU A CD    1 
ATOM   6475  O OE1   . GLU C 2 97  ? 94.656  34.086 -51.429 1.00 53.43  ? 497  GLU A OE1   1 
ATOM   6476  O OE2   . GLU C 2 97  ? 95.370  36.074 -50.812 1.00 58.50  ? 497  GLU A OE2   1 
ATOM   6477  N N     . ALA C 2 98  ? 89.261  33.524 -49.917 1.00 30.67  ? 498  ALA A N     1 
ATOM   6478  C CA    . ALA C 2 98  ? 88.337  32.391 -49.862 1.00 33.54  ? 498  ALA A CA    1 
ATOM   6479  C C     . ALA C 2 98  ? 86.994  32.785 -50.493 1.00 32.34  ? 498  ALA A C     1 
ATOM   6480  O O     . ALA C 2 98  ? 86.268  31.947 -51.024 1.00 29.14  ? 498  ALA A O     1 
ATOM   6481  C CB    . ALA C 2 98  ? 88.146  31.932 -48.408 1.00 15.58  ? 498  ALA A CB    1 
ATOM   6482  N N     . TYR C 2 99  ? 86.689  34.072 -50.425 1.00 33.77  ? 499  TYR A N     1 
ATOM   6483  C CA    . TYR C 2 99  ? 85.484  34.605 -50.999 1.00 32.14  ? 499  TYR A CA    1 
ATOM   6484  C C     . TYR C 2 99  ? 85.617  34.639 -52.516 1.00 35.10  ? 499  TYR A C     1 
ATOM   6485  O O     . TYR C 2 99  ? 84.748  34.115 -53.219 1.00 33.02  ? 499  TYR A O     1 
ATOM   6486  C CB    . TYR C 2 99  ? 85.215  36.016 -50.476 1.00 29.12  ? 499  TYR A CB    1 
ATOM   6487  C CG    . TYR C 2 99  ? 84.230  36.798 -51.329 1.00 28.20  ? 499  TYR A CG    1 
ATOM   6488  C CD1   . TYR C 2 99  ? 82.853  36.578 -51.222 1.00 28.06  ? 499  TYR A CD1   1 
ATOM   6489  C CD2   . TYR C 2 99  ? 84.667  37.758 -52.231 1.00 30.78  ? 499  TYR A CD2   1 
ATOM   6490  C CE1   . TYR C 2 99  ? 81.936  37.295 -51.980 1.00 29.85  ? 499  TYR A CE1   1 
ATOM   6491  C CE2   . TYR C 2 99  ? 83.755  38.481 -52.993 1.00 32.11  ? 499  TYR A CE2   1 
ATOM   6492  C CZ    . TYR C 2 99  ? 82.393  38.241 -52.852 1.00 29.42  ? 499  TYR A CZ    1 
ATOM   6493  O OH    . TYR C 2 99  ? 81.482  38.977 -53.563 1.00 28.44  ? 499  TYR A OH    1 
ATOM   6494  N N     . LEU C 2 100 ? 86.674  35.268 -53.023 1.00 22.59  ? 500  LEU A N     1 
ATOM   6495  C CA    . LEU C 2 100 ? 86.873  35.352 -54.462 1.00 21.99  ? 500  LEU A CA    1 
ATOM   6496  C C     . LEU C 2 100 ? 87.021  33.969 -55.092 1.00 21.88  ? 500  LEU A C     1 
ATOM   6497  O O     . LEU C 2 100 ? 86.359  33.669 -56.081 1.00 25.01  ? 500  LEU A O     1 
ATOM   6498  C CB    . LEU C 2 100 ? 88.097  36.199 -54.788 1.00 33.92  ? 500  LEU A CB    1 
ATOM   6499  C CG    . LEU C 2 100 ? 87.918  37.657 -54.375 1.00 37.16  ? 500  LEU A CG    1 
ATOM   6500  C CD1   . LEU C 2 100 ? 89.149  38.487 -54.636 1.00 37.78  ? 500  LEU A CD1   1 
ATOM   6501  C CD2   . LEU C 2 100 ? 86.747  38.205 -55.147 1.00 33.71  ? 500  LEU A CD2   1 
ATOM   6502  N N     . VAL C 2 101 ? 87.860  33.110 -54.525 1.00 31.76  ? 501  VAL A N     1 
ATOM   6503  C CA    . VAL C 2 101 ? 88.047  31.780 -55.104 1.00 33.76  ? 501  VAL A CA    1 
ATOM   6504  C C     . VAL C 2 101 ? 86.745  31.031 -55.317 1.00 32.81  ? 501  VAL A C     1 
ATOM   6505  O O     . VAL C 2 101 ? 86.635  30.186 -56.196 1.00 33.52  ? 501  VAL A O     1 
ATOM   6506  C CB    . VAL C 2 101 ? 88.964  30.901 -54.231 1.00 21.77  ? 501  VAL A CB    1 
ATOM   6507  C CG1   . VAL C 2 101 ? 88.799  29.410 -54.601 1.00 18.61  ? 501  VAL A CG1   1 
ATOM   6508  C CG2   . VAL C 2 101 ? 90.398  31.342 -54.417 1.00 21.80  ? 501  VAL A CG2   1 
ATOM   6509  N N     . ALA C 2 102 ? 85.754  31.348 -54.504 1.00 32.35  ? 502  ALA A N     1 
ATOM   6510  C CA    . ALA C 2 102 ? 84.477  30.674 -54.602 1.00 32.35  ? 502  ALA A CA    1 
ATOM   6511  C C     . ALA C 2 102 ? 83.604  31.349 -55.610 1.00 32.00  ? 502  ALA A C     1 
ATOM   6512  O O     . ALA C 2 102 ? 82.891  30.691 -56.328 1.00 31.71  ? 502  ALA A O     1 
ATOM   6513  C CB    . ALA C 2 102 ? 83.826  30.666 -53.293 1.00 2.43   ? 502  ALA A CB    1 
ATOM   6514  N N     . LEU C 2 103 ? 83.659  32.672 -55.650 1.00 29.66  ? 503  LEU A N     1 
ATOM   6515  C CA    . LEU C 2 103 ? 82.889  33.433 -56.609 1.00 30.32  ? 503  LEU A CA    1 
ATOM   6516  C C     . LEU C 2 103 ? 83.364  33.042 -58.006 1.00 32.13  ? 503  LEU A C     1 
ATOM   6517  O O     . LEU C 2 103 ? 82.564  32.967 -58.949 1.00 32.79  ? 503  LEU A O     1 
ATOM   6518  C CB    . LEU C 2 103 ? 83.082  34.936 -56.388 1.00 16.39  ? 503  LEU A CB    1 
ATOM   6519  C CG    . LEU C 2 103 ? 82.353  35.829 -57.412 1.00 21.04  ? 503  LEU A CG    1 
ATOM   6520  C CD1   . LEU C 2 103 ? 80.816  35.630 -57.290 1.00 17.58  ? 503  LEU A CD1   1 
ATOM   6521  C CD2   . LEU C 2 103 ? 82.739  37.275 -57.206 1.00 16.50  ? 503  LEU A CD2   1 
ATOM   6522  N N     . PHE C 2 104 ? 84.666  32.787 -58.141 1.00 40.90  ? 504  PHE A N     1 
ATOM   6523  C CA    . PHE C 2 104 ? 85.219  32.365 -59.432 1.00 41.50  ? 504  PHE A CA    1 
ATOM   6524  C C     . PHE C 2 104 ? 84.665  30.972 -59.773 1.00 41.19  ? 504  PHE A C     1 
ATOM   6525  O O     . PHE C 2 104 ? 84.446  30.675 -60.928 1.00 44.64  ? 504  PHE A O     1 
ATOM   6526  C CB    . PHE C 2 104 ? 86.781  32.365 -59.423 1.00 22.38  ? 504  PHE A CB    1 
ATOM   6527  C CG    . PHE C 2 104 ? 87.364  33.680 -59.849 1.00 22.33  ? 504  PHE A CG    1 
ATOM   6528  C CD1   . PHE C 2 104 ? 88.260  34.364 -59.028 1.00 23.18  ? 504  PHE A CD1   1 
ATOM   6529  C CD2   . PHE C 2 104 ? 86.983  34.286 -61.044 1.00 24.61  ? 504  PHE A CD2   1 
ATOM   6530  C CE1   . PHE C 2 104 ? 88.654  35.693 -59.318 1.00 26.01  ? 504  PHE A CE1   1 
ATOM   6531  C CE2   . PHE C 2 104 ? 87.371  35.610 -61.339 1.00 24.22  ? 504  PHE A CE2   1 
ATOM   6532  C CZ    . PHE C 2 104 ? 88.246  36.295 -60.500 1.00 25.62  ? 504  PHE A CZ    1 
ATOM   6533  N N     . GLU C 2 105 ? 84.416  30.121 -58.781 1.00 39.65  ? 505  GLU A N     1 
ATOM   6534  C CA    . GLU C 2 105 ? 83.847  28.813 -59.098 1.00 41.03  ? 505  GLU A CA    1 
ATOM   6535  C C     . GLU C 2 105 ? 82.472  29.007 -59.723 1.00 39.48  ? 505  GLU A C     1 
ATOM   6536  O O     . GLU C 2 105 ? 82.226  28.547 -60.835 1.00 41.45  ? 505  GLU A O     1 
ATOM   6537  C CB    . GLU C 2 105 ? 83.697  27.938 -57.863 1.00 34.03  ? 505  GLU A CB    1 
ATOM   6538  C CG    . GLU C 2 105 ? 84.968  27.326 -57.332 1.00 41.66  ? 505  GLU A CG    1 
ATOM   6539  C CD    . GLU C 2 105 ? 84.764  26.702 -55.933 1.00 45.54  ? 505  GLU A CD    1 
ATOM   6540  O OE1   . GLU C 2 105 ? 83.836  25.850 -55.774 1.00 45.37  ? 505  GLU A OE1   1 
ATOM   6541  O OE2   . GLU C 2 105 ? 85.522  27.061 -54.992 1.00 43.95  ? 505  GLU A OE2   1 
ATOM   6542  N N     . ASP C 2 106 ? 81.582  29.695 -59.012 1.00 35.41  ? 506  ASP A N     1 
ATOM   6543  C CA    . ASP C 2 106 ? 80.227  29.946 -59.508 1.00 35.44  ? 506  ASP A CA    1 
ATOM   6544  C C     . ASP C 2 106 ? 80.249  30.674 -60.845 1.00 34.73  ? 506  ASP A C     1 
ATOM   6545  O O     . ASP C 2 106 ? 79.378  30.459 -61.691 1.00 35.82  ? 506  ASP A O     1 
ATOM   6546  C CB    . ASP C 2 106 ? 79.421  30.800 -58.530 1.00 40.93  ? 506  ASP A CB    1 
ATOM   6547  C CG    . ASP C 2 106 ? 79.224  30.142 -57.210 1.00 41.51  ? 506  ASP A CG    1 
ATOM   6548  O OD1   . ASP C 2 106 ? 79.383  28.905 -57.108 1.00 44.91  ? 506  ASP A OD1   1 
ATOM   6549  O OD2   . ASP C 2 106 ? 78.895  30.869 -56.259 1.00 46.46  ? 506  ASP A OD2   1 
ATOM   6550  N N     . THR C 2 107 ? 81.214  31.568 -61.018 1.00 30.46  ? 507  THR A N     1 
ATOM   6551  C CA    . THR C 2 107 ? 81.330  32.297 -62.276 1.00 30.37  ? 507  THR A CA    1 
ATOM   6552  C C     . THR C 2 107 ? 81.658  31.339 -63.439 1.00 31.83  ? 507  THR A C     1 
ATOM   6553  O O     . THR C 2 107 ? 81.120  31.474 -64.546 1.00 32.41  ? 507  THR A O     1 
ATOM   6554  C CB    . THR C 2 107 ? 82.450  33.376 -62.199 1.00 33.07  ? 507  THR A CB    1 
ATOM   6555  O OG1   . THR C 2 107 ? 82.084  34.367 -61.230 1.00 27.95  ? 507  THR A OG1   1 
ATOM   6556  C CG2   . THR C 2 107 ? 82.682  34.027 -63.568 1.00 29.58  ? 507  THR A CG2   1 
ATOM   6557  N N     . ASN C 2 108 ? 82.535  30.374 -63.154 1.00 40.75  ? 508  ASN A N     1 
ATOM   6558  C CA    . ASN C 2 108 ? 82.994  29.405 -64.124 1.00 41.06  ? 508  ASN A CA    1 
ATOM   6559  C C     . ASN C 2 108 ? 81.791  28.599 -64.516 1.00 41.74  ? 508  ASN A C     1 
ATOM   6560  O O     . ASN C 2 108 ? 81.617  28.245 -65.687 1.00 38.45  ? 508  ASN A O     1 
ATOM   6561  C CB    . ASN C 2 108 ? 84.069  28.528 -63.488 1.00 51.29  ? 508  ASN A CB    1 
ATOM   6562  C CG    . ASN C 2 108 ? 84.889  27.767 -64.507 1.00 54.90  ? 508  ASN A CG    1 
ATOM   6563  O OD1   . ASN C 2 108 ? 85.148  28.256 -65.600 1.00 53.13  ? 508  ASN A OD1   1 
ATOM   6564  N ND2   . ASN C 2 108 ? 85.323  26.569 -64.138 1.00 55.41  ? 508  ASN A ND2   1 
ATOM   6565  N N     . LEU C 2 109 ? 80.951  28.322 -63.531 1.00 39.56  ? 509  LEU A N     1 
ATOM   6566  C CA    . LEU C 2 109 ? 79.728  27.583 -63.769 1.00 42.59  ? 509  LEU A CA    1 
ATOM   6567  C C     . LEU C 2 109 ? 78.765  28.394 -64.639 1.00 43.25  ? 509  LEU A C     1 
ATOM   6568  O O     . LEU C 2 109 ? 78.015  27.818 -65.426 1.00 43.60  ? 509  LEU A O     1 
ATOM   6569  C CB    . LEU C 2 109 ? 79.038  27.232 -62.449 1.00 19.58  ? 509  LEU A CB    1 
ATOM   6570  C CG    . LEU C 2 109 ? 79.580  26.060 -61.631 1.00 23.65  ? 509  LEU A CG    1 
ATOM   6571  C CD1   . LEU C 2 109 ? 78.776  25.878 -60.366 1.00 22.78  ? 509  LEU A CD1   1 
ATOM   6572  C CD2   . LEU C 2 109 ? 79.560  24.792 -62.502 1.00 20.73  ? 509  LEU A CD2   1 
ATOM   6573  N N     . CYS C 2 110 ? 78.753  29.716 -64.497 1.00 31.75  ? 510  CYS A N     1 
ATOM   6574  C CA    . CYS C 2 110 ? 77.859  30.500 -65.332 1.00 33.42  ? 510  CYS A CA    1 
ATOM   6575  C C     . CYS C 2 110 ? 78.401  30.605 -66.768 1.00 35.86  ? 510  CYS A C     1 
ATOM   6576  O O     . CYS C 2 110 ? 77.640  30.617 -67.738 1.00 34.49  ? 510  CYS A O     1 
ATOM   6577  C CB    . CYS C 2 110 ? 77.627  31.893 -64.750 1.00 29.85  ? 510  CYS A CB    1 
ATOM   6578  S SG    . CYS C 2 110 ? 76.824  31.856 -63.170 1.00 31.75  ? 510  CYS A SG    1 
ATOM   6579  N N     . ALA C 2 111 ? 79.714  30.674 -66.911 1.00 46.16  ? 511  ALA A N     1 
ATOM   6580  C CA    . ALA C 2 111 ? 80.282  30.727 -68.245 1.00 46.21  ? 511  ALA A CA    1 
ATOM   6581  C C     . ALA C 2 111 ? 79.985  29.388 -68.917 1.00 45.79  ? 511  ALA A C     1 
ATOM   6582  O O     . ALA C 2 111 ? 79.497  29.317 -70.054 1.00 46.79  ? 511  ALA A O     1 
ATOM   6583  C CB    . ALA C 2 111 ? 81.757  30.924 -68.164 1.00 24.23  ? 511  ALA A CB    1 
ATOM   6584  N N     . ILE C 2 112 ? 80.272  28.312 -68.205 1.00 38.68  ? 512  ILE A N     1 
ATOM   6585  C CA    . ILE C 2 112 ? 80.036  27.020 -68.790 1.00 39.96  ? 512  ILE A CA    1 
ATOM   6586  C C     . ILE C 2 112 ? 78.564  26.869 -69.169 1.00 40.87  ? 512  ILE A C     1 
ATOM   6587  O O     . ILE C 2 112 ? 78.239  26.308 -70.201 1.00 38.28  ? 512  ILE A O     1 
ATOM   6588  C CB    . ILE C 2 112 ? 80.494  25.906 -67.829 1.00 22.87  ? 512  ILE A CB    1 
ATOM   6589  C CG1   . ILE C 2 112 ? 82.021  25.956 -67.690 1.00 21.49  ? 512  ILE A CG1   1 
ATOM   6590  C CG2   . ILE C 2 112 ? 80.015  24.552 -68.322 1.00 24.80  ? 512  ILE A CG2   1 
ATOM   6591  C CD1   . ILE C 2 112 ? 82.594  24.965 -66.694 1.00 22.16  ? 512  ILE A CD1   1 
ATOM   6592  N N     . HIS C 2 113 ? 77.671  27.405 -68.356 1.00 43.79  ? 513  HIS A N     1 
ATOM   6593  C CA    . HIS C 2 113 ? 76.254  27.281 -68.647 1.00 43.50  ? 513  HIS A CA    1 
ATOM   6594  C C     . HIS C 2 113 ? 75.932  27.836 -70.016 1.00 44.92  ? 513  HIS A C     1 
ATOM   6595  O O     . HIS C 2 113 ? 75.107  27.274 -70.735 1.00 42.94  ? 513  HIS A O     1 
ATOM   6596  C CB    . HIS C 2 113 ? 75.447  28.030 -67.599 1.00 31.56  ? 513  HIS A CB    1 
ATOM   6597  C CG    . HIS C 2 113 ? 73.962  27.919 -67.767 1.00 30.51  ? 513  HIS A CG    1 
ATOM   6598  N ND1   . HIS C 2 113 ? 73.276  26.734 -67.579 1.00 31.66  ? 513  HIS A ND1   1 
ATOM   6599  C CD2   . HIS C 2 113 ? 73.019  28.865 -67.990 1.00 29.47  ? 513  HIS A CD2   1 
ATOM   6600  C CE1   . HIS C 2 113 ? 71.978  26.961 -67.666 1.00 29.96  ? 513  HIS A CE1   1 
ATOM   6601  N NE2   . HIS C 2 113 ? 71.794  28.247 -67.912 1.00 28.44  ? 513  HIS A NE2   1 
ATOM   6602  N N     . ALA C 2 114 ? 76.593  28.944 -70.359 1.00 29.46  ? 514  ALA A N     1 
ATOM   6603  C CA    . ALA C 2 114 ? 76.401  29.661 -71.629 1.00 30.76  ? 514  ALA A CA    1 
ATOM   6604  C C     . ALA C 2 114 ? 77.263  29.104 -72.753 1.00 31.23  ? 514  ALA A C     1 
ATOM   6605  O O     . ALA C 2 114 ? 77.529  29.779 -73.754 1.00 32.80  ? 514  ALA A O     1 
ATOM   6606  C CB    . ALA C 2 114 ? 76.698  31.128 -71.432 1.00 44.85  ? 514  ALA A CB    1 
ATOM   6607  N N     . LYS C 2 115 ? 77.683  27.858 -72.551 1.00 38.30  ? 515  LYS A N     1 
ATOM   6608  C CA    . LYS C 2 115 ? 78.497  27.105 -73.483 1.00 42.61  ? 515  LYS A CA    1 
ATOM   6609  C C     . LYS C 2 115 ? 79.779  27.797 -73.894 1.00 42.30  ? 515  LYS A C     1 
ATOM   6610  O O     . LYS C 2 115 ? 80.169  27.758 -75.048 1.00 42.46  ? 515  LYS A O     1 
ATOM   6611  C CB    . LYS C 2 115 ? 77.659  26.726 -74.695 1.00 48.05  ? 515  LYS A CB    1 
ATOM   6612  C CG    . LYS C 2 115 ? 76.490  25.828 -74.314 1.00 54.77  ? 515  LYS A CG    1 
ATOM   6613  C CD    . LYS C 2 115 ? 75.578  25.510 -75.473 1.00 59.73  ? 515  LYS A CD    1 
ATOM   6614  C CE    . LYS C 2 115 ? 74.568  24.449 -75.075 1.00 64.48  ? 515  LYS A CE    1 
ATOM   6615  N NZ    . LYS C 2 115 ? 73.741  24.015 -76.242 1.00 67.55  ? 515  LYS A NZ    1 
ATOM   6616  N N     . ARG C 2 116 ? 80.431  28.425 -72.923 1.00 36.63  ? 516  ARG A N     1 
ATOM   6617  C CA    . ARG C 2 116 ? 81.698  29.097 -73.141 1.00 35.67  ? 516  ARG A CA    1 
ATOM   6618  C C     . ARG C 2 116 ? 82.732  28.494 -72.185 1.00 36.02  ? 516  ARG A C     1 
ATOM   6619  O O     . ARG C 2 116 ? 82.406  27.655 -71.342 1.00 34.32  ? 516  ARG A O     1 
ATOM   6620  C CB    . ARG C 2 116 ? 81.565  30.591 -72.887 1.00 38.03  ? 516  ARG A CB    1 
ATOM   6621  C CG    . ARG C 2 116 ? 80.604  31.253 -73.802 1.00 37.86  ? 516  ARG A CG    1 
ATOM   6622  C CD    . ARG C 2 116 ? 80.597  32.760 -73.635 1.00 37.85  ? 516  ARG A CD    1 
ATOM   6623  N NE    . ARG C 2 116 ? 79.702  33.275 -72.584 1.00 36.48  ? 516  ARG A NE    1 
ATOM   6624  C CZ    . ARG C 2 116 ? 80.063  33.570 -71.329 1.00 37.87  ? 516  ARG A CZ    1 
ATOM   6625  N NH1   . ARG C 2 116 ? 81.317  33.388 -70.938 1.00 34.06  ? 516  ARG A NH1   1 
ATOM   6626  N NH2   . ARG C 2 116 ? 79.191  34.102 -70.475 1.00 36.68  ? 516  ARG A NH2   1 
ATOM   6627  N N     . VAL C 2 117 ? 83.983  28.913 -72.315 1.00 39.20  ? 517  VAL A N     1 
ATOM   6628  C CA    . VAL C 2 117 ? 85.020  28.381 -71.449 1.00 38.49  ? 517  VAL A CA    1 
ATOM   6629  C C     . VAL C 2 117 ? 85.782  29.505 -70.789 1.00 37.70  ? 517  VAL A C     1 
ATOM   6630  O O     . VAL C 2 117 ? 86.643  29.290 -69.949 1.00 39.68  ? 517  VAL A O     1 
ATOM   6631  C CB    . VAL C 2 117 ? 85.993  27.537 -72.229 1.00 29.76  ? 517  VAL A CB    1 
ATOM   6632  C CG1   . VAL C 2 117 ? 85.333  26.237 -72.665 1.00 25.35  ? 517  VAL A CG1   1 
ATOM   6633  C CG2   . VAL C 2 117 ? 86.464  28.314 -73.430 1.00 26.90  ? 517  VAL A CG2   1 
ATOM   6634  N N     . ALA C 2 118 ? 85.455  30.720 -71.164 1.00 44.43  ? 518  ALA A N     1 
ATOM   6635  C CA    . ALA C 2 118 ? 86.126  31.840 -70.576 1.00 44.79  ? 518  ALA A CA    1 
ATOM   6636  C C     . ALA C 2 118 ? 85.131  32.638 -69.783 1.00 44.53  ? 518  ALA A C     1 
ATOM   6637  O O     . ALA C 2 118 ? 84.139  33.110 -70.329 1.00 43.91  ? 518  ALA A O     1 
ATOM   6638  C CB    . ALA C 2 118 ? 86.728  32.694 -71.650 1.00 51.94  ? 518  ALA A CB    1 
ATOM   6639  N N     . ILE C 2 119 ? 85.399  32.786 -68.495 1.00 33.11  ? 519  ILE A N     1 
ATOM   6640  C CA    . ILE C 2 119 ? 84.541  33.561 -67.628 1.00 32.58  ? 519  ILE A CA    1 
ATOM   6641  C C     . ILE C 2 119 ? 84.553  35.034 -68.088 1.00 33.46  ? 519  ILE A C     1 
ATOM   6642  O O     . ILE C 2 119 ? 85.576  35.550 -68.515 1.00 33.96  ? 519  ILE A O     1 
ATOM   6643  C CB    . ILE C 2 119 ? 85.068  33.520 -66.222 1.00 29.52  ? 519  ILE A CB    1 
ATOM   6644  C CG1   . ILE C 2 119 ? 86.438  34.195 -66.196 1.00 25.25  ? 519  ILE A CG1   1 
ATOM   6645  C CG2   . ILE C 2 119 ? 85.156  32.083 -65.740 1.00 25.90  ? 519  ILE A CG2   1 
ATOM   6646  C CD1   . ILE C 2 119 ? 86.933  34.485 -64.847 1.00 30.06  ? 519  ILE A CD1   1 
ATOM   6647  N N     . MET C 2 120 ? 83.420  35.709 -67.984 1.00 35.64  ? 520  MET A N     1 
ATOM   6648  C CA    . MET C 2 120 ? 83.309  37.104 -68.388 1.00 34.74  ? 520  MET A CA    1 
ATOM   6649  C C     . MET C 2 120 ? 82.701  37.927 -67.277 1.00 35.24  ? 520  MET A C     1 
ATOM   6650  O O     . MET C 2 120 ? 82.236  37.403 -66.292 1.00 32.74  ? 520  MET A O     1 
ATOM   6651  C CB    . MET C 2 120 ? 82.409  37.244 -69.605 1.00 47.26  ? 520  MET A CB    1 
ATOM   6652  C CG    . MET C 2 120 ? 83.006  36.804 -70.899 1.00 51.23  ? 520  MET A CG    1 
ATOM   6653  S SD    . MET C 2 120 ? 81.768  37.005 -72.169 1.00 55.57  ? 520  MET A SD    1 
ATOM   6654  C CE    . MET C 2 120 ? 82.067  35.541 -73.070 1.00 54.83  ? 520  MET A CE    1 
ATOM   6655  N N     . PRO C 2 121 ? 82.685  39.247 -67.442 1.00 47.62  ? 521  PRO A N     1 
ATOM   6656  C CA    . PRO C 2 121 ? 82.113  40.084 -66.398 1.00 49.61  ? 521  PRO A CA    1 
ATOM   6657  C C     . PRO C 2 121 ? 80.671  39.760 -66.144 1.00 50.74  ? 521  PRO A C     1 
ATOM   6658  O O     . PRO C 2 121 ? 80.222  39.810 -65.017 1.00 49.77  ? 521  PRO A O     1 
ATOM   6659  C CB    . PRO C 2 121 ? 82.313  41.481 -66.947 1.00 55.01  ? 521  PRO A CB    1 
ATOM   6660  C CG    . PRO C 2 121 ? 83.593  41.351 -67.683 1.00 56.09  ? 521  PRO A CG    1 
ATOM   6661  C CD    . PRO C 2 121 ? 83.390  40.072 -68.435 1.00 57.36  ? 521  PRO A CD    1 
ATOM   6662  N N     . LYS C 2 122 ? 79.952  39.414 -67.201 1.00 35.96  ? 522  LYS A N     1 
ATOM   6663  C CA    . LYS C 2 122 ? 78.534  39.087 -67.082 1.00 36.13  ? 522  LYS A CA    1 
ATOM   6664  C C     . LYS C 2 122 ? 78.380  37.848 -66.212 1.00 35.10  ? 522  LYS A C     1 
ATOM   6665  O O     . LYS C 2 122 ? 77.429  37.751 -65.466 1.00 34.98  ? 522  LYS A O     1 
ATOM   6666  C CB    . LYS C 2 122 ? 77.904  38.843 -68.468 1.00 38.21  ? 522  LYS A CB    1 
ATOM   6667  C CG    . LYS C 2 122 ? 78.668  37.812 -69.294 1.00 44.23  ? 522  LYS A CG    1 
ATOM   6668  C CD    . LYS C 2 122 ? 77.913  37.210 -70.487 1.00 49.40  ? 522  LYS A CD    1 
ATOM   6669  C CE    . LYS C 2 122 ? 77.861  38.123 -71.674 1.00 53.43  ? 522  LYS A CE    1 
ATOM   6670  N NZ    . LYS C 2 122 ? 77.355  37.377 -72.849 1.00 58.48  ? 522  LYS A NZ    1 
ATOM   6671  N N     . ASP C 2 123 ? 79.314  36.904 -66.311 1.00 30.85  ? 523  ASP A N     1 
ATOM   6672  C CA    . ASP C 2 123 ? 79.265  35.692 -65.504 1.00 31.57  ? 523  ASP A CA    1 
ATOM   6673  C C     . ASP C 2 123 ? 79.426  36.020 -64.005 1.00 29.14  ? 523  ASP A C     1 
ATOM   6674  O O     . ASP C 2 123 ? 78.860  35.351 -63.139 1.00 26.81  ? 523  ASP A O     1 
ATOM   6675  C CB    . ASP C 2 123 ? 80.363  34.725 -65.935 1.00 44.28  ? 523  ASP A CB    1 
ATOM   6676  C CG    . ASP C 2 123 ? 80.256  34.320 -67.402 1.00 47.10  ? 523  ASP A CG    1 
ATOM   6677  O OD1   . ASP C 2 123 ? 79.133  34.094 -67.878 1.00 46.23  ? 523  ASP A OD1   1 
ATOM   6678  O OD2   . ASP C 2 123 ? 81.294  34.199 -68.083 1.00 44.88  ? 523  ASP A OD2   1 
ATOM   6679  N N     . ILE C 2 124 ? 80.215  37.035 -63.673 1.00 28.15  ? 524  ILE A N     1 
ATOM   6680  C CA    . ILE C 2 124 ? 80.359  37.380 -62.275 1.00 29.68  ? 524  ILE A CA    1 
ATOM   6681  C C     . ILE C 2 124 ? 79.046  38.025 -61.900 1.00 28.47  ? 524  ILE A C     1 
ATOM   6682  O O     . ILE C 2 124 ? 78.424  37.652 -60.920 1.00 29.14  ? 524  ILE A O     1 
ATOM   6683  C CB    . ILE C 2 124 ? 81.539  38.339 -62.034 1.00 31.34  ? 524  ILE A CB    1 
ATOM   6684  C CG1   . ILE C 2 124 ? 82.855  37.604 -62.311 1.00 35.05  ? 524  ILE A CG1   1 
ATOM   6685  C CG2   . ILE C 2 124 ? 81.534  38.834 -60.577 1.00 32.24  ? 524  ILE A CG2   1 
ATOM   6686  C CD1   . ILE C 2 124 ? 84.099  38.462 -62.170 1.00 36.43  ? 524  ILE A CD1   1 
ATOM   6687  N N     . GLN C 2 125 ? 78.611  38.966 -62.726 1.00 27.02  ? 525  GLN A N     1 
ATOM   6688  C CA    . GLN C 2 125 ? 77.360  39.680 -62.541 1.00 31.06  ? 525  GLN A CA    1 
ATOM   6689  C C     . GLN C 2 125 ? 76.191  38.752 -62.255 1.00 28.65  ? 525  GLN A C     1 
ATOM   6690  O O     . GLN C 2 125 ? 75.469  38.979 -61.292 1.00 31.15  ? 525  GLN A O     1 
ATOM   6691  C CB    . GLN C 2 125 ? 77.050  40.507 -63.777 1.00 58.23  ? 525  GLN A CB    1 
ATOM   6692  C CG    . GLN C 2 125 ? 77.914  41.734 -63.959 1.00 65.56  ? 525  GLN A CG    1 
ATOM   6693  C CD    . GLN C 2 125 ? 77.700  42.355 -65.323 1.00 68.23  ? 525  GLN A CD    1 
ATOM   6694  O OE1   . GLN C 2 125 ? 76.558  42.472 -65.794 1.00 69.34  ? 525  GLN A OE1   1 
ATOM   6695  N NE2   . GLN C 2 125 ? 78.794  42.755 -65.972 1.00 74.14  ? 525  GLN A NE2   1 
ATOM   6696  N N     . LEU C 2 126 ? 76.013  37.707 -63.071 1.00 34.65  ? 526  LEU A N     1 
ATOM   6697  C CA    . LEU C 2 126 ? 74.921  36.759 -62.884 1.00 34.86  ? 526  LEU A CA    1 
ATOM   6698  C C     . LEU C 2 126 ? 75.062  36.002 -61.592 1.00 36.44  ? 526  LEU A C     1 
ATOM   6699  O O     . LEU C 2 126 ? 74.083  35.710 -60.908 1.00 35.35  ? 526  LEU A O     1 
ATOM   6700  C CB    . LEU C 2 126 ? 74.849  35.738 -64.013 1.00 18.15  ? 526  LEU A CB    1 
ATOM   6701  C CG    . LEU C 2 126 ? 73.788  34.621 -63.799 1.00 18.94  ? 526  LEU A CG    1 
ATOM   6702  C CD1   . LEU C 2 126 ? 72.369  35.185 -63.605 1.00 18.61  ? 526  LEU A CD1   1 
ATOM   6703  C CD2   . LEU C 2 126 ? 73.839  33.654 -64.972 1.00 15.65  ? 526  LEU A CD2   1 
ATOM   6704  N N     . ALA C 2 127 ? 76.284  35.671 -61.243 1.00 22.77  ? 527  ALA A N     1 
ATOM   6705  C CA    . ALA C 2 127 ? 76.469  34.927 -60.015 1.00 22.96  ? 527  ALA A CA    1 
ATOM   6706  C C     . ALA C 2 127 ? 76.109  35.768 -58.771 1.00 23.88  ? 527  ALA A C     1 
ATOM   6707  O O     . ALA C 2 127 ? 75.280  35.361 -57.946 1.00 22.66  ? 527  ALA A O     1 
ATOM   6708  C CB    . ALA C 2 127 ? 77.901  34.391 -59.941 1.00 24.42  ? 527  ALA A CB    1 
ATOM   6709  N N     . ARG C 2 128 ? 76.706  36.946 -58.654 1.00 30.40  ? 528  ARG A N     1 
ATOM   6710  C CA    . ARG C 2 128 ? 76.431  37.784 -57.498 1.00 29.41  ? 528  ARG A CA    1 
ATOM   6711  C C     . ARG C 2 128 ? 74.953  38.111 -57.386 1.00 31.70  ? 528  ARG A C     1 
ATOM   6712  O O     . ARG C 2 128 ? 74.415  38.260 -56.288 1.00 31.34  ? 528  ARG A O     1 
ATOM   6713  C CB    . ARG C 2 128 ? 77.246  39.062 -57.552 1.00 29.63  ? 528  ARG A CB    1 
ATOM   6714  C CG    . ARG C 2 128 ? 78.718  38.829 -57.349 1.00 30.85  ? 528  ARG A CG    1 
ATOM   6715  C CD    . ARG C 2 128 ? 79.437  40.149 -57.279 1.00 38.59  ? 528  ARG A CD    1 
ATOM   6716  N NE    . ARG C 2 128 ? 78.912  40.955 -56.194 1.00 39.11  ? 528  ARG A NE    1 
ATOM   6717  C CZ    . ARG C 2 128 ? 78.754  42.265 -56.256 1.00 41.63  ? 528  ARG A CZ    1 
ATOM   6718  N NH1   . ARG C 2 128 ? 79.079  42.917 -57.361 1.00 42.21  ? 528  ARG A NH1   1 
ATOM   6719  N NH2   . ARG C 2 128 ? 78.275  42.929 -55.211 1.00 44.08  ? 528  ARG A NH2   1 
ATOM   6720  N N     . ARG C 2 129 ? 74.296  38.188 -58.529 1.00 30.64  ? 529  ARG A N     1 
ATOM   6721  C CA    . ARG C 2 129 ? 72.881  38.474 -58.529 1.00 34.01  ? 529  ARG A CA    1 
ATOM   6722  C C     . ARG C 2 129 ? 72.060  37.293 -57.952 1.00 32.75  ? 529  ARG A C     1 
ATOM   6723  O O     . ARG C 2 129 ? 71.056  37.483 -57.238 1.00 31.12  ? 529  ARG A O     1 
ATOM   6724  C CB    . ARG C 2 129 ? 72.451  38.803 -59.954 1.00 47.08  ? 529  ARG A CB    1 
ATOM   6725  C CG    . ARG C 2 129 ? 71.193  39.577 -60.037 1.00 54.45  ? 529  ARG A CG    1 
ATOM   6726  C CD    . ARG C 2 129 ? 70.050  38.669 -59.743 1.00 59.32  ? 529  ARG A CD    1 
ATOM   6727  N NE    . ARG C 2 129 ? 68.898  39.376 -59.209 1.00 58.86  ? 529  ARG A NE    1 
ATOM   6728  C CZ    . ARG C 2 129 ? 67.864  38.763 -58.648 1.00 58.61  ? 529  ARG A CZ    1 
ATOM   6729  N NH1   . ARG C 2 129 ? 67.853  37.426 -58.565 1.00 50.96  ? 529  ARG A NH1   1 
ATOM   6730  N NH2   . ARG C 2 129 ? 66.867  39.495 -58.141 1.00 60.53  ? 529  ARG A NH2   1 
ATOM   6731  N N     . ILE C 2 130 ? 72.477  36.066 -58.238 1.00 40.60  ? 530  ILE A N     1 
ATOM   6732  C CA    . ILE C 2 130 ? 71.714  34.953 -57.734 1.00 42.39  ? 530  ILE A CA    1 
ATOM   6733  C C     . ILE C 2 130 ? 72.020  34.711 -56.272 1.00 43.42  ? 530  ILE A C     1 
ATOM   6734  O O     . ILE C 2 130 ? 71.203  34.162 -55.541 1.00 42.82  ? 530  ILE A O     1 
ATOM   6735  C CB    . ILE C 2 130 ? 71.953  33.725 -58.585 1.00 34.57  ? 530  ILE A CB    1 
ATOM   6736  C CG1   . ILE C 2 130 ? 71.327  33.954 -59.946 1.00 35.70  ? 530  ILE A CG1   1 
ATOM   6737  C CG2   . ILE C 2 130 ? 71.290  32.496 -57.982 1.00 32.27  ? 530  ILE A CG2   1 
ATOM   6738  C CD1   . ILE C 2 130 ? 71.332  32.731 -60.806 1.00 41.06  ? 530  ILE A CD1   1 
ATOM   6739  N N     . ARG C 2 131 ? 73.190  35.157 -55.844 1.00 27.37  ? 531  ARG A N     1 
ATOM   6740  C CA    . ARG C 2 131 ? 73.620  35.031 -54.454 1.00 28.88  ? 531  ARG A CA    1 
ATOM   6741  C C     . ARG C 2 131 ? 72.929  36.058 -53.527 1.00 31.44  ? 531  ARG A C     1 
ATOM   6742  O O     . ARG C 2 131 ? 72.992  35.939 -52.304 1.00 32.93  ? 531  ARG A O     1 
ATOM   6743  C CB    . ARG C 2 131 ? 75.132  35.240 -54.367 1.00 31.17  ? 531  ARG A CB    1 
ATOM   6744  C CG    . ARG C 2 131 ? 75.971  34.090 -54.837 1.00 29.66  ? 531  ARG A CG    1 
ATOM   6745  C CD    . ARG C 2 131 ? 77.347  34.555 -54.940 1.00 29.98  ? 531  ARG A CD    1 
ATOM   6746  N NE    . ARG C 2 131 ? 78.309  33.475 -54.889 1.00 32.80  ? 531  ARG A NE    1 
ATOM   6747  C CZ    . ARG C 2 131 ? 79.514  33.601 -54.319 1.00 31.42  ? 531  ARG A CZ    1 
ATOM   6748  N NH1   . ARG C 2 131 ? 79.860  34.775 -53.745 1.00 23.81  ? 531  ARG A NH1   1 
ATOM   6749  N NH2   . ARG C 2 131 ? 80.393  32.584 -54.354 1.00 29.62  ? 531  ARG A NH2   1 
ATOM   6750  N N     . GLY C 2 132 ? 72.300  37.073 -54.111 1.00 39.36  ? 532  GLY A N     1 
ATOM   6751  C CA    . GLY C 2 132 ? 71.631  38.086 -53.319 1.00 42.51  ? 532  GLY A CA    1 
ATOM   6752  C C     . GLY C 2 132 ? 72.563  39.222 -52.957 1.00 45.73  ? 532  GLY A C     1 
ATOM   6753  O O     . GLY C 2 132 ? 72.215  40.102 -52.169 1.00 45.50  ? 532  GLY A O     1 
ATOM   6754  N N     . GLU C 2 133 ? 73.761  39.202 -53.526 1.00 38.38  ? 533  GLU A N     1 
ATOM   6755  C CA    . GLU C 2 133 ? 74.744  40.236 -53.254 1.00 42.51  ? 533  GLU A CA    1 
ATOM   6756  C C     . GLU C 2 133 ? 74.379  41.452 -54.064 1.00 47.76  ? 533  GLU A C     1 
ATOM   6757  O O     . GLU C 2 133 ? 75.026  42.496 -53.970 1.00 48.64  ? 533  GLU A O     1 
ATOM   6758  C CB    . GLU C 2 133 ? 76.151  39.741 -53.614 1.00 46.47  ? 533  GLU A CB    1 
ATOM   6759  C CG    . GLU C 2 133 ? 76.679  38.701 -52.648 1.00 41.63  ? 533  GLU A CG    1 
ATOM   6760  C CD    . GLU C 2 133 ? 77.915  38.012 -53.151 1.00 41.45  ? 533  GLU A CD    1 
ATOM   6761  O OE1   . GLU C 2 133 ? 78.685  38.671 -53.877 1.00 38.15  ? 533  GLU A OE1   1 
ATOM   6762  O OE2   . GLU C 2 133 ? 78.124  36.817 -52.809 1.00 39.22  ? 533  GLU A OE2   1 
ATOM   6763  N N     . ARG C 2 134 ? 73.334  41.290 -54.868 1.00 88.25  ? 534  ARG A N     1 
ATOM   6764  C CA    . ARG C 2 134 ? 72.801  42.346 -55.719 1.00 95.49  ? 534  ARG A CA    1 
ATOM   6765  C C     . ARG C 2 134 ? 71.287  42.473 -55.489 1.00 98.62  ? 534  ARG A C     1 
ATOM   6766  O O     . ARG C 2 134 ? 70.614  43.217 -56.216 1.00 99.99  ? 534  ARG A O     1 
ATOM   6767  C CB    . ARG C 2 134 ? 73.039  42.042 -57.212 1.00 127.45 ? 534  ARG A CB    1 
ATOM   6768  C CG    . ARG C 2 134 ? 74.419  42.376 -57.790 1.00 129.42 ? 534  ARG A CG    1 
ATOM   6769  C CD    . ARG C 2 134 ? 74.432  42.125 -59.305 1.00 131.39 ? 534  ARG A CD    1 
ATOM   6770  N NE    . ARG C 2 134 ? 75.612  42.669 -59.974 1.00 135.65 ? 534  ARG A NE    1 
ATOM   6771  C CZ    . ARG C 2 134 ? 76.108  43.885 -59.754 1.00 136.18 ? 534  ARG A CZ    1 
ATOM   6772  N NH1   . ARG C 2 134 ? 75.534  44.695 -58.871 1.00 138.24 ? 534  ARG A NH1   1 
ATOM   6773  N NH2   . ARG C 2 134 ? 77.172  44.301 -60.429 1.00 137.39 ? 534  ARG A NH2   1 
ATOM   6774  N N     . ALA C 2 135 ? 70.745  41.769 -54.489 1.00 194.66 ? 535  ALA A N     1 
ATOM   6775  C CA    . ALA C 2 135 ? 69.302  41.824 -54.233 1.00 198.65 ? 535  ALA A CA    1 
ATOM   6776  C C     . ALA C 2 135 ? 68.871  41.906 -52.758 1.00 201.18 ? 535  ALA A C     1 
ATOM   6777  O O     . ALA C 2 135 ? 67.838  41.251 -52.491 1.00 161.36 ? 535  ALA A O     1 
ATOM   6778  C CB    . ALA C 2 135 ? 68.631  40.587 -54.877 1.00 108.90 ? 535  ALA A CB    1 
ATOM   6779  O OXT   . ALA C 2 135 ? 69.504  42.559 -51.894 1.00 72.56  ? 535  ALA A OXT   1 
ATOM   6780  N N     . ASP D 3 24  ? 98.191  52.646 -58.109 1.00 116.87 ? 24   ASP B N     1 
ATOM   6781  C CA    . ASP D 3 24  ? 96.983  52.787 -57.242 1.00 110.56 ? 24   ASP B CA    1 
ATOM   6782  C C     . ASP D 3 24  ? 96.879  51.582 -56.319 1.00 104.56 ? 24   ASP B C     1 
ATOM   6783  O O     . ASP D 3 24  ? 97.482  50.536 -56.580 1.00 103.70 ? 24   ASP B O     1 
ATOM   6784  C CB    . ASP D 3 24  ? 95.716  52.886 -58.090 1.00 110.92 ? 24   ASP B CB    1 
ATOM   6785  C CG    . ASP D 3 24  ? 94.601  53.622 -57.383 1.00 112.24 ? 24   ASP B CG    1 
ATOM   6786  O OD1   . ASP D 3 24  ? 94.184  53.184 -56.285 1.00 113.84 ? 24   ASP B OD1   1 
ATOM   6787  O OD2   . ASP D 3 24  ? 94.145  54.647 -57.931 1.00 112.59 ? 24   ASP B OD2   1 
ATOM   6788  N N     . ASN D 3 25  ? 96.099  51.718 -55.249 1.00 58.28  ? 25   ASN B N     1 
ATOM   6789  C CA    . ASN D 3 25  ? 95.984  50.628 -54.284 1.00 51.63  ? 25   ASN B CA    1 
ATOM   6790  C C     . ASN D 3 25  ? 95.192  49.433 -54.751 1.00 48.36  ? 25   ASN B C     1 
ATOM   6791  O O     . ASN D 3 25  ? 95.688  48.305 -54.677 1.00 47.02  ? 25   ASN B O     1 
ATOM   6792  C CB    . ASN D 3 25  ? 95.441  51.154 -52.959 1.00 57.79  ? 25   ASN B CB    1 
ATOM   6793  C CG    . ASN D 3 25  ? 96.482  51.941 -52.197 1.00 57.08  ? 25   ASN B CG    1 
ATOM   6794  O OD1   . ASN D 3 25  ? 97.615  51.488 -52.008 1.00 54.65  ? 25   ASN B OD1   1 
ATOM   6795  N ND2   . ASN D 3 25  ? 96.109  53.124 -51.761 1.00 55.50  ? 25   ASN B ND2   1 
ATOM   6796  N N     . ILE D 3 26  ? 93.973  49.682 -55.234 1.00 50.20  ? 26   ILE B N     1 
ATOM   6797  C CA    . ILE D 3 26  ? 93.123  48.612 -55.739 1.00 47.85  ? 26   ILE B CA    1 
ATOM   6798  C C     . ILE D 3 26  ? 93.755  47.994 -56.983 1.00 46.89  ? 26   ILE B C     1 
ATOM   6799  O O     . ILE D 3 26  ? 93.397  46.877 -57.357 1.00 45.74  ? 26   ILE B O     1 
ATOM   6800  C CB    . ILE D 3 26  ? 91.760  49.110 -56.129 1.00 40.90  ? 26   ILE B CB    1 
ATOM   6801  C CG1   . ILE D 3 26  ? 90.847  47.919 -56.478 1.00 40.15  ? 26   ILE B CG1   1 
ATOM   6802  C CG2   . ILE D 3 26  ? 91.905  49.978 -57.347 1.00 40.66  ? 26   ILE B CG2   1 
ATOM   6803  C CD1   . ILE D 3 26  ? 90.738  46.839 -55.416 1.00 36.00  ? 26   ILE B CD1   1 
ATOM   6804  N N     . GLN D 3 27  ? 94.678  48.740 -57.610 1.00 53.69  ? 27   GLN B N     1 
ATOM   6805  C CA    . GLN D 3 27  ? 95.431  48.299 -58.800 1.00 52.94  ? 27   GLN B CA    1 
ATOM   6806  C C     . GLN D 3 27  ? 96.636  47.495 -58.326 1.00 53.27  ? 27   GLN B C     1 
ATOM   6807  O O     . GLN D 3 27  ? 97.319  46.825 -59.107 1.00 54.13  ? 27   GLN B O     1 
ATOM   6808  C CB    . GLN D 3 27  ? 95.904  49.494 -59.616 1.00 62.13  ? 27   GLN B CB    1 
ATOM   6809  C CG    . GLN D 3 27  ? 94.780  50.285 -60.282 1.00 60.89  ? 27   GLN B CG    1 
ATOM   6810  C CD    . GLN D 3 27  ? 93.947  49.426 -61.208 1.00 60.55  ? 27   GLN B CD    1 
ATOM   6811  O OE1   . GLN D 3 27  ? 94.479  48.766 -62.102 1.00 61.72  ? 27   GLN B OE1   1 
ATOM   6812  N NE2   . GLN D 3 27  ? 92.629  49.424 -60.996 1.00 55.84  ? 27   GLN B NE2   1 
ATOM   6813  N N     . GLY D 3 28  ? 96.866  47.577 -57.018 1.00 58.11  ? 28   GLY B N     1 
ATOM   6814  C CA    . GLY D 3 28  ? 97.944  46.856 -56.379 1.00 57.06  ? 28   GLY B CA    1 
ATOM   6815  C C     . GLY D 3 28  ? 97.578  45.393 -56.320 1.00 56.38  ? 28   GLY B C     1 
ATOM   6816  O O     . GLY D 3 28  ? 98.440  44.527 -56.159 1.00 55.84  ? 28   GLY B O     1 
ATOM   6817  N N     . ILE D 3 29  ? 96.280  45.124 -56.420 1.00 59.44  ? 29   ILE B N     1 
ATOM   6818  C CA    . ILE D 3 29  ? 95.780  43.758 -56.439 1.00 57.21  ? 29   ILE B CA    1 
ATOM   6819  C C     . ILE D 3 29  ? 95.875  43.485 -57.930 1.00 56.75  ? 29   ILE B C     1 
ATOM   6820  O O     . ILE D 3 29  ? 95.003  43.884 -58.713 1.00 57.48  ? 29   ILE B O     1 
ATOM   6821  C CB    . ILE D 3 29  ? 94.336  43.705 -55.956 1.00 36.81  ? 29   ILE B CB    1 
ATOM   6822  C CG1   . ILE D 3 29  ? 94.223  44.467 -54.635 1.00 35.53  ? 29   ILE B CG1   1 
ATOM   6823  C CG2   . ILE D 3 29  ? 93.917  42.270 -55.732 1.00 34.90  ? 29   ILE B CG2   1 
ATOM   6824  C CD1   . ILE D 3 29  ? 94.906  43.801 -53.468 1.00 36.89  ? 29   ILE B CD1   1 
ATOM   6825  N N     . THR D 3 30  ? 96.963  42.816 -58.307 1.00 64.99  ? 30   THR B N     1 
ATOM   6826  C CA    . THR D 3 30  ? 97.290  42.554 -59.704 1.00 65.57  ? 30   THR B CA    1 
ATOM   6827  C C     . THR D 3 30  ? 96.741  41.363 -60.484 1.00 66.91  ? 30   THR B C     1 
ATOM   6828  O O     . THR D 3 30  ? 96.371  40.322 -59.933 1.00 67.26  ? 30   THR B O     1 
ATOM   6829  C CB    . THR D 3 30  ? 98.815  42.539 -59.866 1.00 46.95  ? 30   THR B CB    1 
ATOM   6830  O OG1   . THR D 3 30  ? 99.365  41.366 -59.251 1.00 47.05  ? 30   THR B OG1   1 
ATOM   6831  C CG2   . THR D 3 30  ? 99.407  43.751 -59.194 1.00 46.13  ? 30   THR B CG2   1 
ATOM   6832  N N     . LYS D 3 31  ? 96.713  41.547 -61.798 1.00 49.95  ? 31   LYS B N     1 
ATOM   6833  C CA    . LYS D 3 31  ? 96.268  40.531 -62.738 1.00 51.01  ? 31   LYS B CA    1 
ATOM   6834  C C     . LYS D 3 31  ? 96.837  39.158 -62.366 1.00 51.03  ? 31   LYS B C     1 
ATOM   6835  O O     . LYS D 3 31  ? 96.080  38.219 -62.147 1.00 51.70  ? 31   LYS B O     1 
ATOM   6836  C CB    . LYS D 3 31  ? 96.698  40.941 -64.150 1.00 47.68  ? 31   LYS B CB    1 
ATOM   6837  C CG    . LYS D 3 31  ? 96.335  39.982 -65.252 1.00 50.66  ? 31   LYS B CG    1 
ATOM   6838  C CD    . LYS D 3 31  ? 96.841  40.536 -66.573 1.00 55.24  ? 31   LYS B CD    1 
ATOM   6839  C CE    . LYS D 3 31  ? 96.739  39.546 -67.736 1.00 56.77  ? 31   LYS B CE    1 
ATOM   6840  N NZ    . LYS D 3 31  ? 97.301  40.142 -68.981 1.00 58.83  ? 31   LYS B NZ    1 
ATOM   6841  N N     . PRO D 3 32  ? 98.176  39.020 -62.280 1.00 40.26  ? 32   PRO B N     1 
ATOM   6842  C CA    . PRO D 3 32  ? 98.760  37.708 -61.920 1.00 40.31  ? 32   PRO B CA    1 
ATOM   6843  C C     . PRO D 3 32  ? 98.081  37.094 -60.683 1.00 38.20  ? 32   PRO B C     1 
ATOM   6844  O O     . PRO D 3 32  ? 97.726  35.914 -60.662 1.00 40.06  ? 32   PRO B O     1 
ATOM   6845  C CB    . PRO D 3 32  ? 100.230 38.044 -61.650 1.00 41.79  ? 32   PRO B CB    1 
ATOM   6846  C CG    . PRO D 3 32  ? 100.471 39.238 -62.530 1.00 41.89  ? 32   PRO B CG    1 
ATOM   6847  C CD    . PRO D 3 32  ? 99.219  40.062 -62.349 1.00 41.31  ? 32   PRO B CD    1 
ATOM   6848  N N     . ALA D 3 33  ? 97.909  37.913 -59.649 1.00 51.32  ? 33   ALA B N     1 
ATOM   6849  C CA    . ALA D 3 33  ? 97.261  37.459 -58.433 1.00 50.67  ? 33   ALA B CA    1 
ATOM   6850  C C     . ALA D 3 33  ? 95.792  37.129 -58.702 1.00 50.02  ? 33   ALA B C     1 
ATOM   6851  O O     . ALA D 3 33  ? 95.319  36.057 -58.304 1.00 49.92  ? 33   ALA B O     1 
ATOM   6852  C CB    . ALA D 3 33  ? 97.375  38.512 -57.357 1.00 29.05  ? 33   ALA B CB    1 
ATOM   6853  N N     . ILE D 3 34  ? 95.065  38.029 -59.370 1.00 37.08  ? 34   ILE B N     1 
ATOM   6854  C CA    . ILE D 3 34  ? 93.664  37.750 -59.670 1.00 38.39  ? 34   ILE B CA    1 
ATOM   6855  C C     . ILE D 3 34  ? 93.550  36.504 -60.527 1.00 40.43  ? 34   ILE B C     1 
ATOM   6856  O O     . ILE D 3 34  ? 92.598  35.735 -60.383 1.00 39.59  ? 34   ILE B O     1 
ATOM   6857  C CB    . ILE D 3 34  ? 92.990  38.875 -60.413 1.00 19.14  ? 34   ILE B CB    1 
ATOM   6858  C CG1   . ILE D 3 34  ? 92.859  40.107 -59.515 1.00 19.62  ? 34   ILE B CG1   1 
ATOM   6859  C CG2   . ILE D 3 34  ? 91.648  38.434 -60.885 1.00 18.88  ? 34   ILE B CG2   1 
ATOM   6860  C CD1   . ILE D 3 34  ? 92.494  41.340 -60.353 1.00 19.65  ? 34   ILE B CD1   1 
ATOM   6861  N N     . ARG D 3 35  ? 94.505  36.312 -61.434 1.00 34.04  ? 35   ARG B N     1 
ATOM   6862  C CA    . ARG D 3 35  ? 94.538  35.115 -62.263 1.00 35.08  ? 35   ARG B CA    1 
ATOM   6863  C C     . ARG D 3 35  ? 94.880  33.898 -61.361 1.00 34.86  ? 35   ARG B C     1 
ATOM   6864  O O     . ARG D 3 35  ? 94.319  32.812 -61.525 1.00 34.88  ? 35   ARG B O     1 
ATOM   6865  C CB    . ARG D 3 35  ? 95.578  35.281 -63.371 1.00 62.69  ? 35   ARG B CB    1 
ATOM   6866  C CG    . ARG D 3 35  ? 95.932  33.998 -64.091 1.00 68.88  ? 35   ARG B CG    1 
ATOM   6867  C CD    . ARG D 3 35  ? 96.942  34.261 -65.177 1.00 74.88  ? 35   ARG B CD    1 
ATOM   6868  N NE    . ARG D 3 35  ? 96.358  35.066 -66.250 1.00 80.94  ? 35   ARG B NE    1 
ATOM   6869  C CZ    . ARG D 3 35  ? 95.539  34.589 -67.190 1.00 83.74  ? 35   ARG B CZ    1 
ATOM   6870  N NH1   . ARG D 3 35  ? 95.199  33.302 -67.208 1.00 85.14  ? 35   ARG B NH1   1 
ATOM   6871  N NH2   . ARG D 3 35  ? 95.042  35.404 -68.111 1.00 87.29  ? 35   ARG B NH2   1 
ATOM   6872  N N     . ARG D 3 36  ? 95.807  34.074 -60.416 1.00 43.69  ? 36   ARG B N     1 
ATOM   6873  C CA    . ARG D 3 36  ? 96.167  32.985 -59.523 1.00 43.29  ? 36   ARG B CA    1 
ATOM   6874  C C     . ARG D 3 36  ? 94.925  32.506 -58.767 1.00 40.89  ? 36   ARG B C     1 
ATOM   6875  O O     . ARG D 3 36  ? 94.742  31.307 -58.585 1.00 40.79  ? 36   ARG B O     1 
ATOM   6876  C CB    . ARG D 3 36  ? 97.225  33.436 -58.523 1.00 46.66  ? 36   ARG B CB    1 
ATOM   6877  C CG    . ARG D 3 36  ? 98.661  33.154 -58.915 1.00 48.85  ? 36   ARG B CG    1 
ATOM   6878  C CD    . ARG D 3 36  ? 99.587  33.260 -57.700 1.00 47.90  ? 36   ARG B CD    1 
ATOM   6879  N NE    . ARG D 3 36  ? 99.703  34.605 -57.140 1.00 47.15  ? 36   ARG B NE    1 
ATOM   6880  C CZ    . ARG D 3 36  ? 100.172 35.654 -57.808 1.00 49.50  ? 36   ARG B CZ    1 
ATOM   6881  N NH1   . ARG D 3 36  ? 100.569 35.511 -59.062 1.00 48.18  ? 36   ARG B NH1   1 
ATOM   6882  N NH2   . ARG D 3 36  ? 100.243 36.849 -57.232 1.00 46.73  ? 36   ARG B NH2   1 
ATOM   6883  N N     . LEU D 3 37  ? 94.082  33.445 -58.321 1.00 43.16  ? 37   LEU B N     1 
ATOM   6884  C CA    . LEU D 3 37  ? 92.828  33.117 -57.614 1.00 43.72  ? 37   LEU B CA    1 
ATOM   6885  C C     . LEU D 3 37  ? 91.887  32.330 -58.521 1.00 42.08  ? 37   LEU B C     1 
ATOM   6886  O O     . LEU D 3 37  ? 91.480  31.217 -58.201 1.00 43.45  ? 37   LEU B O     1 
ATOM   6887  C CB    . LEU D 3 37  ? 92.111  34.385 -57.185 1.00 31.02  ? 37   LEU B CB    1 
ATOM   6888  C CG    . LEU D 3 37  ? 92.830  35.241 -56.147 1.00 34.51  ? 37   LEU B CG    1 
ATOM   6889  C CD1   . LEU D 3 37  ? 92.240  36.644 -56.170 1.00 36.67  ? 37   LEU B CD1   1 
ATOM   6890  C CD2   . LEU D 3 37  ? 92.724  34.605 -54.782 1.00 30.89  ? 37   LEU B CD2   1 
ATOM   6891  N N     . ALA D 3 38  ? 91.524  32.928 -59.649 1.00 37.48  ? 38   ALA B N     1 
ATOM   6892  C CA    . ALA D 3 38  ? 90.658  32.256 -60.611 1.00 38.05  ? 38   ALA B CA    1 
ATOM   6893  C C     . ALA D 3 38  ? 91.091  30.802 -60.816 1.00 37.88  ? 38   ALA B C     1 
ATOM   6894  O O     . ALA D 3 38  ? 90.278  29.893 -60.880 1.00 35.25  ? 38   ALA B O     1 
ATOM   6895  C CB    . ALA D 3 38  ? 90.704  32.987 -61.926 1.00 13.05  ? 38   ALA B CB    1 
ATOM   6896  N N     . ARG D 3 39  ? 92.390  30.592 -60.926 1.00 53.22  ? 39   ARG B N     1 
ATOM   6897  C CA    . ARG D 3 39  ? 92.921  29.258 -61.133 1.00 52.62  ? 39   ARG B CA    1 
ATOM   6898  C C     . ARG D 3 39  ? 92.468  28.307 -60.026 1.00 53.53  ? 39   ARG B C     1 
ATOM   6899  O O     . ARG D 3 39  ? 91.930  27.242 -60.298 1.00 54.23  ? 39   ARG B O     1 
ATOM   6900  C CB    . ARG D 3 39  ? 94.457  29.322 -61.222 1.00 44.58  ? 39   ARG B CB    1 
ATOM   6901  C CG    . ARG D 3 39  ? 95.000  29.905 -62.513 1.00 45.29  ? 39   ARG B CG    1 
ATOM   6902  C CD    . ARG D 3 39  ? 94.551  29.057 -63.676 1.00 47.48  ? 39   ARG B CD    1 
ATOM   6903  N NE    . ARG D 3 39  ? 95.168  29.413 -64.950 1.00 49.83  ? 39   ARG B NE    1 
ATOM   6904  C CZ    . ARG D 3 39  ? 94.704  30.315 -65.802 1.00 53.78  ? 39   ARG B CZ    1 
ATOM   6905  N NH1   . ARG D 3 39  ? 93.608  30.990 -65.533 1.00 51.28  ? 39   ARG B NH1   1 
ATOM   6906  N NH2   . ARG D 3 39  ? 95.310  30.507 -66.959 1.00 50.42  ? 39   ARG B NH2   1 
ATOM   6907  N N     . ARG D 3 40  ? 92.684  28.703 -58.780 1.00 44.60  ? 40   ARG B N     1 
ATOM   6908  C CA    . ARG D 3 40  ? 92.293  27.896 -57.638 1.00 43.12  ? 40   ARG B CA    1 
ATOM   6909  C C     . ARG D 3 40  ? 90.810  27.570 -57.733 1.00 43.45  ? 40   ARG B C     1 
ATOM   6910  O O     . ARG D 3 40  ? 90.352  26.534 -57.236 1.00 42.61  ? 40   ARG B O     1 
ATOM   6911  C CB    . ARG D 3 40  ? 92.599  28.652 -56.338 1.00 36.24  ? 40   ARG B CB    1 
ATOM   6912  C CG    . ARG D 3 40  ? 92.292  27.896 -55.056 1.00 39.89  ? 40   ARG B CG    1 
ATOM   6913  C CD    . ARG D 3 40  ? 93.026  28.489 -53.843 1.00 41.15  ? 40   ARG B CD    1 
ATOM   6914  N NE    . ARG D 3 40  ? 94.461  28.205 -53.832 1.00 43.13  ? 40   ARG B NE    1 
ATOM   6915  C CZ    . ARG D 3 40  ? 95.333  28.661 -52.930 1.00 44.32  ? 40   ARG B CZ    1 
ATOM   6916  N NH1   . ARG D 3 40  ? 94.942  29.444 -51.943 1.00 40.62  ? 40   ARG B NH1   1 
ATOM   6917  N NH2   . ARG D 3 40  ? 96.612  28.304 -53.001 1.00 44.40  ? 40   ARG B NH2   1 
ATOM   6918  N N     . GLY D 3 41  ? 90.059  28.446 -58.390 1.00 29.83  ? 41   GLY B N     1 
ATOM   6919  C CA    . GLY D 3 41  ? 88.630  28.219 -58.543 1.00 30.65  ? 41   GLY B CA    1 
ATOM   6920  C C     . GLY D 3 41  ? 88.239  27.422 -59.779 1.00 31.73  ? 41   GLY B C     1 
ATOM   6921  O O     . GLY D 3 41  ? 87.076  27.420 -60.154 1.00 33.11  ? 41   GLY B O     1 
ATOM   6922  N N     . GLY D 3 42  ? 89.202  26.755 -60.415 1.00 39.86  ? 42   GLY B N     1 
ATOM   6923  C CA    . GLY D 3 42  ? 88.927  25.960 -61.604 1.00 39.80  ? 42   GLY B CA    1 
ATOM   6924  C C     . GLY D 3 42  ? 88.761  26.679 -62.940 1.00 40.71  ? 42   GLY B C     1 
ATOM   6925  O O     . GLY D 3 42  ? 88.275  26.070 -63.888 1.00 41.94  ? 42   GLY B O     1 
ATOM   6926  N N     . VAL D 3 43  ? 89.171  27.942 -63.024 1.00 29.62  ? 43   VAL B N     1 
ATOM   6927  C CA    . VAL D 3 43  ? 89.033  28.741 -64.231 1.00 30.32  ? 43   VAL B CA    1 
ATOM   6928  C C     . VAL D 3 43  ? 90.163  28.565 -65.259 1.00 32.37  ? 43   VAL B C     1 
ATOM   6929  O O     . VAL D 3 43  ? 91.341  28.881 -64.994 1.00 29.73  ? 43   VAL B O     1 
ATOM   6930  C CB    . VAL D 3 43  ? 88.933  30.205 -63.840 1.00 28.97  ? 43   VAL B CB    1 
ATOM   6931  C CG1   . VAL D 3 43  ? 88.976  31.152 -65.089 1.00 27.64  ? 43   VAL B CG1   1 
ATOM   6932  C CG2   . VAL D 3 43  ? 87.690  30.383 -63.009 1.00 28.82  ? 43   VAL B CG2   1 
ATOM   6933  N N     . LYS D 3 44  ? 89.797  28.090 -66.446 1.00 55.75  ? 44   LYS B N     1 
ATOM   6934  C CA    . LYS D 3 44  ? 90.758  27.844 -67.504 1.00 57.16  ? 44   LYS B CA    1 
ATOM   6935  C C     . LYS D 3 44  ? 91.077  29.058 -68.371 1.00 57.95  ? 44   LYS B C     1 
ATOM   6936  O O     . LYS D 3 44  ? 92.234  29.431 -68.518 1.00 57.89  ? 44   LYS B O     1 
ATOM   6937  C CB    . LYS D 3 44  ? 90.236  26.715 -68.372 1.00 57.83  ? 44   LYS B CB    1 
ATOM   6938  C CG    . LYS D 3 44  ? 91.179  26.272 -69.463 1.00 61.92  ? 44   LYS B CG    1 
ATOM   6939  C CD    . LYS D 3 44  ? 90.535  25.153 -70.261 1.00 59.54  ? 44   LYS B CD    1 
ATOM   6940  C CE    . LYS D 3 44  ? 91.402  24.645 -71.389 1.00 60.52  ? 44   LYS B CE    1 
ATOM   6941  N NZ    . LYS D 3 44  ? 90.641  23.600 -72.131 1.00 57.80  ? 44   LYS B NZ    1 
ATOM   6942  N N     . ARG D 3 45  ? 90.052  29.676 -68.949 1.00 42.77  ? 45   ARG B N     1 
ATOM   6943  C CA    . ARG D 3 45  ? 90.236  30.840 -69.821 1.00 42.59  ? 45   ARG B CA    1 
ATOM   6944  C C     . ARG D 3 45  ? 89.648  32.085 -69.165 1.00 42.48  ? 45   ARG B C     1 
ATOM   6945  O O     . ARG D 3 45  ? 88.523  32.053 -68.698 1.00 38.64  ? 45   ARG B O     1 
ATOM   6946  C CB    . ARG D 3 45  ? 89.543  30.603 -71.157 1.00 83.46  ? 45   ARG B CB    1 
ATOM   6947  C CG    . ARG D 3 45  ? 90.159  31.353 -72.300 1.00 84.69  ? 45   ARG B CG    1 
ATOM   6948  C CD    . ARG D 3 45  ? 91.241  30.498 -72.943 1.00 83.40  ? 45   ARG B CD    1 
ATOM   6949  N NE    . ARG D 3 45  ? 91.785  31.060 -74.182 1.00 85.54  ? 45   ARG B NE    1 
ATOM   6950  C CZ    . ARG D 3 45  ? 91.077  31.729 -75.089 1.00 89.11  ? 45   ARG B CZ    1 
ATOM   6951  N NH1   . ARG D 3 45  ? 89.779  31.943 -74.905 1.00 85.84  ? 45   ARG B NH1   1 
ATOM   6952  N NH2   . ARG D 3 45  ? 91.666  32.166 -76.196 1.00 90.59  ? 45   ARG B NH2   1 
ATOM   6953  N N     . ILE D 3 46  ? 90.403  33.182 -69.142 1.00 52.96  ? 46   ILE B N     1 
ATOM   6954  C CA    . ILE D 3 46  ? 89.927  34.415 -68.521 1.00 53.20  ? 46   ILE B CA    1 
ATOM   6955  C C     . ILE D 3 46  ? 89.808  35.617 -69.479 1.00 53.99  ? 46   ILE B C     1 
ATOM   6956  O O     . ILE D 3 46  ? 90.796  36.098 -70.020 1.00 55.61  ? 46   ILE B O     1 
ATOM   6957  C CB    . ILE D 3 46  ? 90.836  34.821 -67.323 1.00 38.91  ? 46   ILE B CB    1 
ATOM   6958  C CG1   . ILE D 3 46  ? 90.765  33.784 -66.211 1.00 38.30  ? 46   ILE B CG1   1 
ATOM   6959  C CG2   . ILE D 3 46  ? 90.370  36.106 -66.705 1.00 37.08  ? 46   ILE B CG2   1 
ATOM   6960  C CD1   . ILE D 3 46  ? 91.817  34.042 -65.120 1.00 42.89  ? 46   ILE B CD1   1 
ATOM   6961  N N     . SER D 3 47  ? 88.586  36.094 -69.685 1.00 75.14  ? 47   SER B N     1 
ATOM   6962  C CA    . SER D 3 47  ? 88.358  37.259 -70.522 1.00 74.90  ? 47   SER B CA    1 
ATOM   6963  C C     . SER D 3 47  ? 89.243  38.429 -70.038 1.00 74.82  ? 47   SER B C     1 
ATOM   6964  O O     . SER D 3 47  ? 89.842  38.377 -68.957 1.00 74.83  ? 47   SER B O     1 
ATOM   6965  C CB    . SER D 3 47  ? 86.888  37.660 -70.455 1.00 43.24  ? 47   SER B CB    1 
ATOM   6966  O OG    . SER D 3 47  ? 86.707  39.023 -70.810 1.00 47.45  ? 47   SER B OG    1 
ATOM   6967  N N     . GLY D 3 48  ? 89.302  39.494 -70.833 1.00 60.93  ? 48   GLY B N     1 
ATOM   6968  C CA    . GLY D 3 48  ? 90.139  40.617 -70.485 1.00 59.70  ? 48   GLY B CA    1 
ATOM   6969  C C     . GLY D 3 48  ? 89.579  41.568 -69.464 1.00 61.63  ? 48   GLY B C     1 
ATOM   6970  O O     . GLY D 3 48  ? 90.357  42.149 -68.699 1.00 64.13  ? 48   GLY B O     1 
ATOM   6971  N N     . LEU D 3 49  ? 88.251  41.725 -69.426 1.00 47.00  ? 49   LEU B N     1 
ATOM   6972  C CA    . LEU D 3 49  ? 87.622  42.661 -68.488 1.00 47.22  ? 49   LEU B CA    1 
ATOM   6973  C C     . LEU D 3 49  ? 87.334  42.159 -67.072 1.00 47.07  ? 49   LEU B C     1 
ATOM   6974  O O     . LEU D 3 49  ? 86.714  42.855 -66.265 1.00 47.27  ? 49   LEU B O     1 
ATOM   6975  C CB    . LEU D 3 49  ? 86.351  43.195 -69.109 1.00 39.42  ? 49   LEU B CB    1 
ATOM   6976  C CG    . LEU D 3 49  ? 86.652  44.219 -70.205 1.00 41.84  ? 49   LEU B CG    1 
ATOM   6977  C CD1   . LEU D 3 49  ? 85.355  44.795 -70.785 1.00 41.52  ? 49   LEU B CD1   1 
ATOM   6978  C CD2   . LEU D 3 49  ? 87.523  45.327 -69.603 1.00 40.70  ? 49   LEU B CD2   1 
ATOM   6979  N N     . ILE D 3 50  ? 87.793  40.949 -66.774 1.00 48.40  ? 50   ILE B N     1 
ATOM   6980  C CA    . ILE D 3 50  ? 87.602  40.339 -65.471 1.00 46.93  ? 50   ILE B CA    1 
ATOM   6981  C C     . ILE D 3 50  ? 88.326  41.090 -64.365 1.00 47.52  ? 50   ILE B C     1 
ATOM   6982  O O     . ILE D 3 50  ? 87.712  41.522 -63.394 1.00 45.46  ? 50   ILE B O     1 
ATOM   6983  C CB    . ILE D 3 50  ? 88.105  38.884 -65.477 1.00 42.03  ? 50   ILE B CB    1 
ATOM   6984  C CG1   . ILE D 3 50  ? 87.123  38.007 -66.239 1.00 39.44  ? 50   ILE B CG1   1 
ATOM   6985  C CG2   . ILE D 3 50  ? 88.337  38.395 -64.074 1.00 36.40  ? 50   ILE B CG2   1 
ATOM   6986  C CD1   . ILE D 3 50  ? 85.719  38.055 -65.689 1.00 41.07  ? 50   ILE B CD1   1 
ATOM   6987  N N     . TYR D 3 51  ? 89.637  41.236 -64.525 1.00 42.50  ? 51   TYR B N     1 
ATOM   6988  C CA    . TYR D 3 51  ? 90.479  41.905 -63.543 1.00 41.69  ? 51   TYR B CA    1 
ATOM   6989  C C     . TYR D 3 51  ? 89.875  43.197 -63.024 1.00 40.64  ? 51   TYR B C     1 
ATOM   6990  O O     . TYR D 3 51  ? 89.853  43.410 -61.818 1.00 41.24  ? 51   TYR B O     1 
ATOM   6991  C CB    . TYR D 3 51  ? 91.864  42.146 -64.138 1.00 31.98  ? 51   TYR B CB    1 
ATOM   6992  C CG    . TYR D 3 51  ? 92.388  40.935 -64.874 1.00 30.41  ? 51   TYR B CG    1 
ATOM   6993  C CD1   . TYR D 3 51  ? 92.770  39.795 -64.187 1.00 29.31  ? 51   TYR B CD1   1 
ATOM   6994  C CD2   . TYR D 3 51  ? 92.396  40.898 -66.264 1.00 30.96  ? 51   TYR B CD2   1 
ATOM   6995  C CE1   . TYR D 3 51  ? 93.136  38.643 -64.869 1.00 31.19  ? 51   TYR B CE1   1 
ATOM   6996  C CE2   . TYR D 3 51  ? 92.758  39.762 -66.951 1.00 27.70  ? 51   TYR B CE2   1 
ATOM   6997  C CZ    . TYR D 3 51  ? 93.125  38.627 -66.264 1.00 31.21  ? 51   TYR B CZ    1 
ATOM   6998  O OH    . TYR D 3 51  ? 93.435  37.464 -66.968 1.00 33.19  ? 51   TYR B OH    1 
ATOM   6999  N N     . GLU D 3 52  ? 89.372  44.062 -63.894 1.00 49.51  ? 52   GLU B N     1 
ATOM   7000  C CA    . GLU D 3 52  ? 88.769  45.290 -63.375 1.00 49.53  ? 52   GLU B CA    1 
ATOM   7001  C C     . GLU D 3 52  ? 87.479  44.985 -62.619 1.00 48.42  ? 52   GLU B C     1 
ATOM   7002  O O     . GLU D 3 52  ? 87.179  45.643 -61.621 1.00 46.40  ? 52   GLU B O     1 
ATOM   7003  C CB    . GLU D 3 52  ? 88.497  46.310 -64.483 1.00 70.70  ? 52   GLU B CB    1 
ATOM   7004  C CG    . GLU D 3 52  ? 89.743  47.080 -64.918 1.00 75.32  ? 52   GLU B CG    1 
ATOM   7005  C CD    . GLU D 3 52  ? 90.210  48.126 -63.901 1.00 77.16  ? 52   GLU B CD    1 
ATOM   7006  O OE1   . GLU D 3 52  ? 89.545  49.176 -63.793 1.00 79.02  ? 52   GLU B OE1   1 
ATOM   7007  O OE2   . GLU D 3 52  ? 91.236  47.903 -63.218 1.00 79.01  ? 52   GLU B OE2   1 
ATOM   7008  N N     . GLU D 3 53  ? 86.724  43.987 -63.082 1.00 43.00  ? 53   GLU B N     1 
ATOM   7009  C CA    . GLU D 3 53  ? 85.480  43.592 -62.419 1.00 40.27  ? 53   GLU B CA    1 
ATOM   7010  C C     . GLU D 3 53  ? 85.823  42.994 -61.065 1.00 40.18  ? 53   GLU B C     1 
ATOM   7011  O O     . GLU D 3 53  ? 85.239  43.350 -60.051 1.00 38.18  ? 53   GLU B O     1 
ATOM   7012  C CB    . GLU D 3 53  ? 84.762  42.525 -63.237 1.00 45.88  ? 53   GLU B CB    1 
ATOM   7013  C CG    . GLU D 3 53  ? 83.371  42.191 -62.786 1.00 47.70  ? 53   GLU B CG    1 
ATOM   7014  C CD    . GLU D 3 53  ? 82.396  43.272 -63.168 1.00 53.17  ? 53   GLU B CD    1 
ATOM   7015  O OE1   . GLU D 3 53  ? 82.737  44.117 -64.031 1.00 54.84  ? 53   GLU B OE1   1 
ATOM   7016  O OE2   . GLU D 3 53  ? 81.278  43.279 -62.610 1.00 56.60  ? 53   GLU B OE2   1 
ATOM   7017  N N     . THR D 3 54  ? 86.789  42.083 -61.061 1.00 35.59  ? 54   THR B N     1 
ATOM   7018  C CA    . THR D 3 54  ? 87.200  41.416 -59.839 1.00 34.66  ? 54   THR B CA    1 
ATOM   7019  C C     . THR D 3 54  ? 87.524  42.378 -58.729 1.00 35.84  ? 54   THR B C     1 
ATOM   7020  O O     . THR D 3 54  ? 87.059  42.200 -57.606 1.00 34.21  ? 54   THR B O     1 
ATOM   7021  C CB    . THR D 3 54  ? 88.410  40.491 -60.070 1.00 39.09  ? 54   THR B CB    1 
ATOM   7022  O OG1   . THR D 3 54  ? 88.053  39.451 -60.994 1.00 41.39  ? 54   THR B OG1   1 
ATOM   7023  C CG2   . THR D 3 54  ? 88.823  39.846 -58.779 1.00 38.96  ? 54   THR B CG2   1 
ATOM   7024  N N     . ARG D 3 55  ? 88.325  43.392 -59.035 1.00 49.57  ? 55   ARG B N     1 
ATOM   7025  C CA    . ARG D 3 55  ? 88.699  44.386 -58.033 1.00 51.33  ? 55   ARG B CA    1 
ATOM   7026  C C     . ARG D 3 55  ? 87.482  45.083 -57.429 1.00 49.50  ? 55   ARG B C     1 
ATOM   7027  O O     . ARG D 3 55  ? 87.336  45.164 -56.207 1.00 52.14  ? 55   ARG B O     1 
ATOM   7028  C CB    . ARG D 3 55  ? 89.628  45.418 -58.656 1.00 38.03  ? 55   ARG B CB    1 
ATOM   7029  C CG    . ARG D 3 55  ? 90.907  44.817 -59.187 1.00 36.92  ? 55   ARG B CG    1 
ATOM   7030  C CD    . ARG D 3 55  ? 91.928  45.899 -59.581 1.00 42.27  ? 55   ARG B CD    1 
ATOM   7031  N NE    . ARG D 3 55  ? 93.121  45.250 -60.111 1.00 40.11  ? 55   ARG B NE    1 
ATOM   7032  C CZ    . ARG D 3 55  ? 93.467  45.262 -61.383 1.00 40.95  ? 55   ARG B CZ    1 
ATOM   7033  N NH1   . ARG D 3 55  ? 92.728  45.917 -62.262 1.00 40.91  ? 55   ARG B NH1   1 
ATOM   7034  N NH2   . ARG D 3 55  ? 94.507  44.544 -61.773 1.00 42.33  ? 55   ARG B NH2   1 
ATOM   7035  N N     . GLY D 3 56  ? 86.609  45.576 -58.298 1.00 44.86  ? 56   GLY B N     1 
ATOM   7036  C CA    . GLY D 3 56  ? 85.409  46.252 -57.854 1.00 46.62  ? 56   GLY B CA    1 
ATOM   7037  C C     . GLY D 3 56  ? 84.598  45.425 -56.881 1.00 46.33  ? 56   GLY B C     1 
ATOM   7038  O O     . GLY D 3 56  ? 83.945  45.960 -55.976 1.00 46.54  ? 56   GLY B O     1 
ATOM   7039  N N     . VAL D 3 57  ? 84.622  44.116 -57.082 1.00 40.14  ? 57   VAL B N     1 
ATOM   7040  C CA    . VAL D 3 57  ? 83.902  43.213 -56.207 1.00 39.06  ? 57   VAL B CA    1 
ATOM   7041  C C     . VAL D 3 57  ? 84.703  43.099 -54.896 1.00 37.11  ? 57   VAL B C     1 
ATOM   7042  O O     . VAL D 3 57  ? 84.130  43.170 -53.801 1.00 37.96  ? 57   VAL B O     1 
ATOM   7043  C CB    . VAL D 3 57  ? 83.736  41.786 -56.864 1.00 30.60  ? 57   VAL B CB    1 
ATOM   7044  C CG1   . VAL D 3 57  ? 83.148  40.794 -55.864 1.00 31.93  ? 57   VAL B CG1   1 
ATOM   7045  C CG2   . VAL D 3 57  ? 82.841  41.861 -58.068 1.00 29.04  ? 57   VAL B CG2   1 
ATOM   7046  N N     . LEU D 3 58  ? 86.021  42.935 -55.009 1.00 35.94  ? 58   LEU B N     1 
ATOM   7047  C CA    . LEU D 3 58  ? 86.866  42.804 -53.832 1.00 35.09  ? 58   LEU B CA    1 
ATOM   7048  C C     . LEU D 3 58  ? 86.704  44.059 -53.008 1.00 36.17  ? 58   LEU B C     1 
ATOM   7049  O O     . LEU D 3 58  ? 86.688  44.009 -51.772 1.00 35.51  ? 58   LEU B O     1 
ATOM   7050  C CB    . LEU D 3 58  ? 88.347  42.628 -54.228 1.00 26.61  ? 58   LEU B CB    1 
ATOM   7051  C CG    . LEU D 3 58  ? 89.373  42.724 -53.087 1.00 27.67  ? 58   LEU B CG    1 
ATOM   7052  C CD1   . LEU D 3 58  ? 89.051  41.769 -51.990 1.00 27.42  ? 58   LEU B CD1   1 
ATOM   7053  C CD2   . LEU D 3 58  ? 90.758  42.452 -53.625 1.00 29.50  ? 58   LEU B CD2   1 
ATOM   7054  N N     . LYS D 3 59  ? 86.553  45.188 -53.697 1.00 36.42  ? 59   LYS B N     1 
ATOM   7055  C CA    . LYS D 3 59  ? 86.407  46.439 -52.981 1.00 38.03  ? 59   LYS B CA    1 
ATOM   7056  C C     . LYS D 3 59  ? 85.136  46.459 -52.161 1.00 35.98  ? 59   LYS B C     1 
ATOM   7057  O O     . LYS D 3 59  ? 85.181  46.792 -50.990 1.00 33.24  ? 59   LYS B O     1 
ATOM   7058  C CB    . LYS D 3 59  ? 86.444  47.635 -53.935 1.00 35.41  ? 59   LYS B CB    1 
ATOM   7059  C CG    . LYS D 3 59  ? 86.488  49.000 -53.233 1.00 42.55  ? 59   LYS B CG    1 
ATOM   7060  C CD    . LYS D 3 59  ? 86.898  50.104 -54.216 1.00 50.39  ? 59   LYS B CD    1 
ATOM   7061  C CE    . LYS D 3 59  ? 86.491  51.509 -53.757 1.00 53.68  ? 59   LYS B CE    1 
ATOM   7062  N NZ    . LYS D 3 59  ? 85.005  51.722 -53.754 1.00 57.89  ? 59   LYS B NZ    1 
ATOM   7063  N N     . VAL D 3 60  ? 84.011  46.086 -52.762 1.00 28.15  ? 60   VAL B N     1 
ATOM   7064  C CA    . VAL D 3 60  ? 82.758  46.084 -52.042 1.00 26.38  ? 60   VAL B CA    1 
ATOM   7065  C C     . VAL D 3 60  ? 82.838  45.119 -50.861 1.00 26.50  ? 60   VAL B C     1 
ATOM   7066  O O     . VAL D 3 60  ? 82.302  45.401 -49.793 1.00 24.96  ? 60   VAL B O     1 
ATOM   7067  C CB    . VAL D 3 60  ? 81.603  45.629 -52.926 1.00 17.97  ? 60   VAL B CB    1 
ATOM   7068  C CG1   . VAL D 3 60  ? 80.377  45.436 -52.083 1.00 18.09  ? 60   VAL B CG1   1 
ATOM   7069  C CG2   . VAL D 3 60  ? 81.319  46.620 -53.995 1.00 18.16  ? 60   VAL B CG2   1 
ATOM   7070  N N     . PHE D 3 61  ? 83.506  43.982 -51.059 1.00 32.34  ? 61   PHE B N     1 
ATOM   7071  C CA    . PHE D 3 61  ? 83.637  42.979 -50.006 1.00 34.83  ? 61   PHE B CA    1 
ATOM   7072  C C     . PHE D 3 61  ? 84.300  43.600 -48.798 1.00 34.03  ? 61   PHE B C     1 
ATOM   7073  O O     . PHE D 3 61  ? 83.736  43.639 -47.709 1.00 33.29  ? 61   PHE B O     1 
ATOM   7074  C CB    . PHE D 3 61  ? 84.485  41.794 -50.481 1.00 29.91  ? 61   PHE B CB    1 
ATOM   7075  C CG    . PHE D 3 61  ? 84.533  40.645 -49.495 1.00 30.30  ? 61   PHE B CG    1 
ATOM   7076  C CD1   . PHE D 3 61  ? 83.472  39.759 -49.377 1.00 27.27  ? 61   PHE B CD1   1 
ATOM   7077  C CD2   . PHE D 3 61  ? 85.631  40.490 -48.629 1.00 29.38  ? 61   PHE B CD2   1 
ATOM   7078  C CE1   . PHE D 3 61  ? 83.495  38.735 -48.399 1.00 30.50  ? 61   PHE B CE1   1 
ATOM   7079  C CE2   . PHE D 3 61  ? 85.649  39.454 -47.648 1.00 31.15  ? 61   PHE B CE2   1 
ATOM   7080  C CZ    . PHE D 3 61  ? 84.586  38.587 -47.541 1.00 28.98  ? 61   PHE B CZ    1 
ATOM   7081  N N     . LEU D 3 62  ? 85.512  44.099 -48.996 1.00 39.45  ? 62   LEU B N     1 
ATOM   7082  C CA    . LEU D 3 62  ? 86.238  44.734 -47.913 1.00 37.69  ? 62   LEU B CA    1 
ATOM   7083  C C     . LEU D 3 62  ? 85.479  45.924 -47.280 1.00 38.56  ? 62   LEU B C     1 
ATOM   7084  O O     . LEU D 3 62  ? 85.413  46.025 -46.050 1.00 39.52  ? 62   LEU B O     1 
ATOM   7085  C CB    . LEU D 3 62  ? 87.650  45.104 -48.406 1.00 26.33  ? 62   LEU B CB    1 
ATOM   7086  C CG    . LEU D 3 62  ? 88.483  43.828 -48.735 1.00 27.99  ? 62   LEU B CG    1 
ATOM   7087  C CD1   . LEU D 3 62  ? 89.739  44.184 -49.475 1.00 26.99  ? 62   LEU B CD1   1 
ATOM   7088  C CD2   . LEU D 3 62  ? 88.832  43.066 -47.483 1.00 26.61  ? 62   LEU B CD2   1 
ATOM   7089  N N     . GLU D 3 63  ? 84.878  46.798 -48.088 1.00 32.07  ? 63   GLU B N     1 
ATOM   7090  C CA    . GLU D 3 63  ? 84.119  47.921 -47.523 1.00 34.14  ? 63   GLU B CA    1 
ATOM   7091  C C     . GLU D 3 63  ? 82.996  47.404 -46.626 1.00 34.19  ? 63   GLU B C     1 
ATOM   7092  O O     . GLU D 3 63  ? 82.687  48.010 -45.592 1.00 32.28  ? 63   GLU B O     1 
ATOM   7093  C CB    . GLU D 3 63  ? 83.498  48.805 -48.603 1.00 40.97  ? 63   GLU B CB    1 
ATOM   7094  C CG    . GLU D 3 63  ? 84.492  49.263 -49.651 1.00 45.90  ? 63   GLU B CG    1 
ATOM   7095  C CD    . GLU D 3 63  ? 83.940  50.320 -50.597 1.00 49.18  ? 63   GLU B CD    1 
ATOM   7096  O OE1   . GLU D 3 63  ? 82.882  50.078 -51.206 1.00 46.80  ? 63   GLU B OE1   1 
ATOM   7097  O OE2   . GLU D 3 63  ? 84.586  51.392 -50.726 1.00 50.24  ? 63   GLU B OE2   1 
ATOM   7098  N N     . ASN D 3 64  ? 82.378  46.286 -46.998 1.00 36.21  ? 64   ASN B N     1 
ATOM   7099  C CA    . ASN D 3 64  ? 81.313  45.772 -46.155 1.00 36.76  ? 64   ASN B CA    1 
ATOM   7100  C C     . ASN D 3 64  ? 81.842  45.195 -44.872 1.00 36.30  ? 64   ASN B C     1 
ATOM   7101  O O     . ASN D 3 64  ? 81.348  45.537 -43.799 1.00 35.63  ? 64   ASN B O     1 
ATOM   7102  C CB    . ASN D 3 64  ? 80.479  44.718 -46.864 1.00 32.97  ? 64   ASN B CB    1 
ATOM   7103  C CG    . ASN D 3 64  ? 79.442  45.321 -47.737 1.00 36.37  ? 64   ASN B CG    1 
ATOM   7104  O OD1   . ASN D 3 64  ? 78.653  46.130 -47.283 1.00 41.31  ? 64   ASN B OD1   1 
ATOM   7105  N ND2   . ASN D 3 64  ? 79.430  44.950 -48.997 1.00 39.46  ? 64   ASN B ND2   1 
ATOM   7106  N N     . VAL D 3 65  ? 82.845  44.329 -44.974 1.00 28.92  ? 65   VAL B N     1 
ATOM   7107  C CA    . VAL D 3 65  ? 83.420  43.695 -43.791 1.00 29.85  ? 65   VAL B CA    1 
ATOM   7108  C C     . VAL D 3 65  ? 84.147  44.671 -42.864 1.00 28.40  ? 65   VAL B C     1 
ATOM   7109  O O     . VAL D 3 65  ? 83.911  44.667 -41.653 1.00 26.66  ? 65   VAL B O     1 
ATOM   7110  C CB    . VAL D 3 65  ? 84.411  42.559 -44.176 1.00 26.70  ? 65   VAL B CB    1 
ATOM   7111  C CG1   . VAL D 3 65  ? 85.013  41.935 -42.934 1.00 23.65  ? 65   VAL B CG1   1 
ATOM   7112  C CG2   . VAL D 3 65  ? 83.713  41.506 -44.982 1.00 30.21  ? 65   VAL B CG2   1 
ATOM   7113  N N     . ILE D 3 66  ? 85.025  45.502 -43.426 1.00 31.80  ? 66   ILE B N     1 
ATOM   7114  C CA    . ILE D 3 66  ? 85.780  46.444 -42.612 1.00 32.92  ? 66   ILE B CA    1 
ATOM   7115  C C     . ILE D 3 66  ? 84.873  47.408 -41.876 1.00 33.89  ? 66   ILE B C     1 
ATOM   7116  O O     . ILE D 3 66  ? 85.029  47.601 -40.673 1.00 32.45  ? 66   ILE B O     1 
ATOM   7117  C CB    . ILE D 3 66  ? 86.782  47.257 -43.454 1.00 27.30  ? 66   ILE B CB    1 
ATOM   7118  C CG1   . ILE D 3 66  ? 87.932  46.339 -43.932 1.00 25.38  ? 66   ILE B CG1   1 
ATOM   7119  C CG2   . ILE D 3 66  ? 87.287  48.453 -42.630 1.00 26.18  ? 66   ILE B CG2   1 
ATOM   7120  C CD1   . ILE D 3 66  ? 88.838  46.961 -44.926 1.00 30.34  ? 66   ILE B CD1   1 
ATOM   7121  N N     . ARG D 3 67  ? 83.929  48.020 -42.593 1.00 39.63  ? 67   ARG B N     1 
ATOM   7122  C CA    . ARG D 3 67  ? 82.994  48.957 -41.970 1.00 42.35  ? 67   ARG B CA    1 
ATOM   7123  C C     . ARG D 3 67  ? 82.488  48.371 -40.655 1.00 41.74  ? 67   ARG B C     1 
ATOM   7124  O O     . ARG D 3 67  ? 82.572  49.008 -39.617 1.00 40.65  ? 67   ARG B O     1 
ATOM   7125  C CB    . ARG D 3 67  ? 81.817  49.226 -42.906 1.00 33.73  ? 67   ARG B CB    1 
ATOM   7126  C CG    . ARG D 3 67  ? 80.615  49.876 -42.251 1.00 40.37  ? 67   ARG B CG    1 
ATOM   7127  C CD    . ARG D 3 67  ? 79.389  49.863 -43.164 1.00 45.40  ? 67   ARG B CD    1 
ATOM   7128  N NE    . ARG D 3 67  ? 79.608  50.659 -44.363 1.00 52.11  ? 67   ARG B NE    1 
ATOM   7129  C CZ    . ARG D 3 67  ? 79.561  50.194 -45.616 1.00 53.67  ? 67   ARG B CZ    1 
ATOM   7130  N NH1   . ARG D 3 67  ? 79.291  48.918 -45.860 1.00 53.56  ? 67   ARG B NH1   1 
ATOM   7131  N NH2   . ARG D 3 67  ? 79.810  51.007 -46.639 1.00 53.66  ? 67   ARG B NH2   1 
ATOM   7132  N N     . ASP D 3 68  ? 81.977  47.143 -40.720 1.00 39.92  ? 68   ASP B N     1 
ATOM   7133  C CA    . ASP D 3 68  ? 81.446  46.405 -39.575 1.00 38.77  ? 68   ASP B CA    1 
ATOM   7134  C C     . ASP D 3 68  ? 82.527  46.190 -38.526 1.00 38.85  ? 68   ASP B C     1 
ATOM   7135  O O     . ASP D 3 68  ? 82.308  46.431 -37.350 1.00 39.97  ? 68   ASP B O     1 
ATOM   7136  C CB    . ASP D 3 68  ? 80.888  45.044 -40.042 1.00 51.16  ? 68   ASP B CB    1 
ATOM   7137  C CG    . ASP D 3 68  ? 79.384  45.077 -40.345 1.00 53.23  ? 68   ASP B CG    1 
ATOM   7138  O OD1   . ASP D 3 68  ? 78.826  46.128 -40.721 1.00 50.10  ? 68   ASP B OD1   1 
ATOM   7139  O OD2   . ASP D 3 68  ? 78.745  44.020 -40.229 1.00 53.86  ? 68   ASP B OD2   1 
ATOM   7140  N N     . ALA D 3 69  ? 83.697  45.735 -38.960 1.00 38.34  ? 69   ALA B N     1 
ATOM   7141  C CA    . ALA D 3 69  ? 84.816  45.488 -38.056 1.00 41.14  ? 69   ALA B CA    1 
ATOM   7142  C C     . ALA D 3 69  ? 85.213  46.776 -37.363 1.00 40.64  ? 69   ALA B C     1 
ATOM   7143  O O     . ALA D 3 69  ? 85.425  46.789 -36.177 1.00 38.38  ? 69   ALA B O     1 
ATOM   7144  C CB    . ALA D 3 69  ? 86.000  44.930 -38.834 1.00 22.53  ? 69   ALA B CB    1 
ATOM   7145  N N     . VAL D 3 70  ? 85.313  47.860 -38.114 1.00 36.99  ? 70   VAL B N     1 
ATOM   7146  C CA    . VAL D 3 70  ? 85.666  49.145 -37.539 1.00 37.29  ? 70   VAL B CA    1 
ATOM   7147  C C     . VAL D 3 70  ? 84.585  49.676 -36.590 1.00 40.46  ? 70   VAL B C     1 
ATOM   7148  O O     . VAL D 3 70  ? 84.888  50.444 -35.688 1.00 41.50  ? 70   VAL B O     1 
ATOM   7149  C CB    . VAL D 3 70  ? 85.995  50.177 -38.658 1.00 24.93  ? 70   VAL B CB    1 
ATOM   7150  C CG1   . VAL D 3 70  ? 85.961  51.618 -38.124 1.00 26.27  ? 70   VAL B CG1   1 
ATOM   7151  C CG2   . VAL D 3 70  ? 87.362  49.858 -39.211 1.00 23.49  ? 70   VAL B CG2   1 
ATOM   7152  N N     . THR D 3 71  ? 83.331  49.287 -36.790 1.00 30.81  ? 71   THR B N     1 
ATOM   7153  C CA    . THR D 3 71  ? 82.286  49.701 -35.860 1.00 30.81  ? 71   THR B CA    1 
ATOM   7154  C C     . THR D 3 71  ? 82.560  48.999 -34.527 1.00 31.08  ? 71   THR B C     1 
ATOM   7155  O O     . THR D 3 71  ? 82.355  49.561 -33.460 1.00 29.86  ? 71   THR B O     1 
ATOM   7156  C CB    . THR D 3 71  ? 80.880  49.284 -36.335 1.00 24.52  ? 71   THR B CB    1 
ATOM   7157  O OG1   . THR D 3 71  ? 80.499  50.106 -37.430 1.00 26.10  ? 71   THR B OG1   1 
ATOM   7158  C CG2   . THR D 3 71  ? 79.843  49.426 -35.223 1.00 22.42  ? 71   THR B CG2   1 
ATOM   7159  N N     . TYR D 3 72  ? 83.002  47.751 -34.591 1.00 34.96  ? 72   TYR B N     1 
ATOM   7160  C CA    . TYR D 3 72  ? 83.317  47.014 -33.378 1.00 35.15  ? 72   TYR B CA    1 
ATOM   7161  C C     . TYR D 3 72  ? 84.538  47.618 -32.661 1.00 38.57  ? 72   TYR B C     1 
ATOM   7162  O O     . TYR D 3 72  ? 84.616  47.598 -31.449 1.00 38.31  ? 72   TYR B O     1 
ATOM   7163  C CB    . TYR D 3 72  ? 83.610  45.557 -33.710 1.00 29.57  ? 72   TYR B CB    1 
ATOM   7164  C CG    . TYR D 3 72  ? 82.400  44.682 -33.882 1.00 30.35  ? 72   TYR B CG    1 
ATOM   7165  C CD1   . TYR D 3 72  ? 82.204  43.966 -35.059 1.00 30.33  ? 72   TYR B CD1   1 
ATOM   7166  C CD2   . TYR D 3 72  ? 81.454  44.567 -32.865 1.00 30.43  ? 72   TYR B CD2   1 
ATOM   7167  C CE1   . TYR D 3 72  ? 81.089  43.159 -35.230 1.00 29.30  ? 72   TYR B CE1   1 
ATOM   7168  C CE2   . TYR D 3 72  ? 80.334  43.755 -33.026 1.00 28.85  ? 72   TYR B CE2   1 
ATOM   7169  C CZ    . TYR D 3 72  ? 80.165  43.059 -34.217 1.00 28.55  ? 72   TYR B CZ    1 
ATOM   7170  O OH    . TYR D 3 72  ? 79.070  42.274 -34.385 1.00 31.98  ? 72   TYR B OH    1 
ATOM   7171  N N     . THR D 3 73  ? 85.490  48.137 -33.424 1.00 44.38  ? 73   THR B N     1 
ATOM   7172  C CA    . THR D 3 73  ? 86.677  48.749 -32.858 1.00 45.54  ? 73   THR B CA    1 
ATOM   7173  C C     . THR D 3 73  ? 86.251  49.969 -32.045 1.00 48.07  ? 73   THR B C     1 
ATOM   7174  O O     . THR D 3 73  ? 86.673  50.151 -30.901 1.00 47.26  ? 73   THR B O     1 
ATOM   7175  C CB    . THR D 3 73  ? 87.651  49.220 -33.969 1.00 38.36  ? 73   THR B CB    1 
ATOM   7176  O OG1   . THR D 3 73  ? 87.962  48.121 -34.841 1.00 37.15  ? 73   THR B OG1   1 
ATOM   7177  C CG2   . THR D 3 73  ? 88.956  49.793 -33.337 1.00 39.73  ? 73   THR B CG2   1 
ATOM   7178  N N     . GLU D 3 74  ? 85.413  50.812 -32.637 1.00 48.13  ? 74   GLU B N     1 
ATOM   7179  C CA    . GLU D 3 74  ? 84.957  51.997 -31.939 1.00 49.73  ? 74   GLU B CA    1 
ATOM   7180  C C     . GLU D 3 74  ? 84.121  51.651 -30.726 1.00 49.24  ? 74   GLU B C     1 
ATOM   7181  O O     . GLU D 3 74  ? 84.243  52.280 -29.677 1.00 47.60  ? 74   GLU B O     1 
ATOM   7182  C CB    . GLU D 3 74  ? 84.130  52.903 -32.855 1.00 59.38  ? 74   GLU B CB    1 
ATOM   7183  C CG    . GLU D 3 74  ? 84.909  53.525 -34.000 1.00 71.05  ? 74   GLU B CG    1 
ATOM   7184  C CD    . GLU D 3 74  ? 84.229  54.770 -34.547 1.00 77.30  ? 74   GLU B CD    1 
ATOM   7185  O OE1   . GLU D 3 74  ? 84.235  55.806 -33.841 1.00 82.65  ? 74   GLU B OE1   1 
ATOM   7186  O OE2   . GLU D 3 74  ? 83.681  54.714 -35.675 1.00 80.87  ? 74   GLU B OE2   1 
ATOM   7187  N N     . HIS D 3 75  ? 83.271  50.645 -30.830 1.00 44.79  ? 75   HIS B N     1 
ATOM   7188  C CA    . HIS D 3 75  ? 82.445  50.379 -29.678 1.00 46.39  ? 75   HIS B CA    1 
ATOM   7189  C C     . HIS D 3 75  ? 83.323  50.078 -28.488 1.00 47.51  ? 75   HIS B C     1 
ATOM   7190  O O     . HIS D 3 75  ? 83.013  50.474 -27.370 1.00 50.08  ? 75   HIS B O     1 
ATOM   7191  C CB    . HIS D 3 75  ? 81.477  49.234 -29.935 1.00 36.17  ? 75   HIS B CB    1 
ATOM   7192  C CG    . HIS D 3 75  ? 80.487  49.035 -28.829 1.00 33.88  ? 75   HIS B CG    1 
ATOM   7193  N ND1   . HIS D 3 75  ? 79.393  49.856 -28.656 1.00 34.79  ? 75   HIS B ND1   1 
ATOM   7194  C CD2   . HIS D 3 75  ? 80.466  48.152 -27.808 1.00 34.28  ? 75   HIS B CD2   1 
ATOM   7195  C CE1   . HIS D 3 75  ? 78.738  49.483 -27.568 1.00 32.77  ? 75   HIS B CE1   1 
ATOM   7196  N NE2   . HIS D 3 75  ? 79.365  48.453 -27.033 1.00 33.88  ? 75   HIS B NE2   1 
ATOM   7197  N N     . ALA D 3 76  ? 84.433  49.396 -28.747 1.00 51.90  ? 76   ALA B N     1 
ATOM   7198  C CA    . ALA D 3 76  ? 85.382  49.015 -27.701 1.00 53.17  ? 76   ALA B CA    1 
ATOM   7199  C C     . ALA D 3 76  ? 86.322  50.186 -27.339 1.00 54.62  ? 76   ALA B C     1 
ATOM   7200  O O     . ALA D 3 76  ? 87.182  50.067 -26.469 1.00 52.13  ? 76   ALA B O     1 
ATOM   7201  C CB    . ALA D 3 76  ? 86.181  47.785 -28.152 1.00 89.47  ? 76   ALA B CB    1 
ATOM   7202  N N     . LYS D 3 77  ? 86.143  51.317 -28.014 1.00 49.74  ? 77   LYS B N     1 
ATOM   7203  C CA    . LYS D 3 77  ? 86.937  52.507 -27.736 1.00 52.39  ? 77   LYS B CA    1 
ATOM   7204  C C     . LYS D 3 77  ? 88.419  52.285 -27.938 1.00 51.69  ? 77   LYS B C     1 
ATOM   7205  O O     . LYS D 3 77  ? 89.216  52.724 -27.121 1.00 51.15  ? 77   LYS B O     1 
ATOM   7206  C CB    . LYS D 3 77  ? 86.687  52.954 -26.299 1.00 59.33  ? 77   LYS B CB    1 
ATOM   7207  C CG    . LYS D 3 77  ? 85.207  53.130 -25.951 1.00 63.56  ? 77   LYS B CG    1 
ATOM   7208  C CD    . LYS D 3 77  ? 84.997  53.449 -24.469 1.00 68.23  ? 77   LYS B CD    1 
ATOM   7209  C CE    . LYS D 3 77  ? 83.528  53.700 -24.147 1.00 71.22  ? 77   LYS B CE    1 
ATOM   7210  N NZ    . LYS D 3 77  ? 83.280  53.972 -22.703 1.00 72.18  ? 77   LYS B NZ    1 
ATOM   7211  N N     . ARG D 3 78  ? 88.786  51.605 -29.024 1.00 34.33  ? 78   ARG B N     1 
ATOM   7212  C CA    . ARG D 3 78  ? 90.184  51.316 -29.341 1.00 31.67  ? 78   ARG B CA    1 
ATOM   7213  C C     . ARG D 3 78  ? 90.555  52.005 -30.634 1.00 31.70  ? 78   ARG B C     1 
ATOM   7214  O O     . ARG D 3 78  ? 89.684  52.449 -31.368 1.00 30.17  ? 78   ARG B O     1 
ATOM   7215  C CB    . ARG D 3 78  ? 90.395  49.805 -29.503 1.00 40.91  ? 78   ARG B CB    1 
ATOM   7216  C CG    . ARG D 3 78  ? 90.227  49.033 -28.234 1.00 41.31  ? 78   ARG B CG    1 
ATOM   7217  C CD    . ARG D 3 78  ? 90.701  47.591 -28.370 1.00 39.37  ? 78   ARG B CD    1 
ATOM   7218  N NE    . ARG D 3 78  ? 89.618  46.678 -28.741 1.00 40.89  ? 78   ARG B NE    1 
ATOM   7219  C CZ    . ARG D 3 78  ? 89.218  46.482 -29.994 1.00 40.92  ? 78   ARG B CZ    1 
ATOM   7220  N NH1   . ARG D 3 78  ? 89.826  47.118 -30.987 1.00 36.07  ? 78   ARG B NH1   1 
ATOM   7221  N NH2   . ARG D 3 78  ? 88.190  45.701 -30.253 1.00 37.16  ? 78   ARG B NH2   1 
ATOM   7222  N N     . LYS D 3 79  ? 91.846  52.086 -30.922 1.00 52.24  ? 79   LYS B N     1 
ATOM   7223  C CA    . LYS D 3 79  ? 92.331  52.711 -32.148 1.00 53.88  ? 79   LYS B CA    1 
ATOM   7224  C C     . LYS D 3 79  ? 92.926  51.648 -33.060 1.00 51.70  ? 79   LYS B C     1 
ATOM   7225  O O     . LYS D 3 79  ? 93.430  51.955 -34.145 1.00 54.17  ? 79   LYS B O     1 
ATOM   7226  C CB    . LYS D 3 79  ? 93.423  53.724 -31.833 1.00 65.48  ? 79   LYS B CB    1 
ATOM   7227  C CG    . LYS D 3 79  ? 92.951  55.051 -31.347 1.00 71.07  ? 79   LYS B CG    1 
ATOM   7228  C CD    . LYS D 3 79  ? 94.121  56.004 -31.391 1.00 76.43  ? 79   LYS B CD    1 
ATOM   7229  C CE    . LYS D 3 79  ? 93.674  57.438 -31.173 1.00 82.01  ? 79   LYS B CE    1 
ATOM   7230  N NZ    . LYS D 3 79  ? 94.792  58.412 -31.350 1.00 84.62  ? 79   LYS B NZ    1 
ATOM   7231  N N     . THR D 3 80  ? 92.852  50.400 -32.607 1.00 46.95  ? 80   THR B N     1 
ATOM   7232  C CA    . THR D 3 80  ? 93.409  49.255 -33.314 1.00 49.07  ? 80   THR B CA    1 
ATOM   7233  C C     . THR D 3 80  ? 92.370  48.210 -33.700 1.00 47.40  ? 80   THR B C     1 
ATOM   7234  O O     . THR D 3 80  ? 91.783  47.565 -32.837 1.00 46.65  ? 80   THR B O     1 
ATOM   7235  C CB    . THR D 3 80  ? 94.412  48.510 -32.424 1.00 43.06  ? 80   THR B CB    1 
ATOM   7236  O OG1   . THR D 3 80  ? 95.160  49.444 -31.647 1.00 47.65  ? 80   THR B OG1   1 
ATOM   7237  C CG2   . THR D 3 80  ? 95.339  47.705 -33.245 1.00 41.21  ? 80   THR B CG2   1 
ATOM   7238  N N     . VAL D 3 81  ? 92.146  48.011 -34.983 1.00 33.79  ? 81   VAL B N     1 
ATOM   7239  C CA    . VAL D 3 81  ? 91.222  46.970 -35.387 1.00 31.85  ? 81   VAL B CA    1 
ATOM   7240  C C     . VAL D 3 81  ? 91.852  45.611 -35.002 1.00 31.50  ? 81   VAL B C     1 
ATOM   7241  O O     . VAL D 3 81  ? 92.952  45.275 -35.433 1.00 34.17  ? 81   VAL B O     1 
ATOM   7242  C CB    . VAL D 3 81  ? 90.987  47.037 -36.903 1.00 26.02  ? 81   VAL B CB    1 
ATOM   7243  C CG1   . VAL D 3 81  ? 90.125  45.902 -37.376 1.00 25.52  ? 81   VAL B CG1   1 
ATOM   7244  C CG2   . VAL D 3 81  ? 90.297  48.306 -37.214 1.00 24.91  ? 81   VAL B CG2   1 
ATOM   7245  N N     . THR D 3 82  ? 91.160  44.818 -34.197 1.00 34.91  ? 82   THR B N     1 
ATOM   7246  C CA    . THR D 3 82  ? 91.711  43.526 -33.803 1.00 37.09  ? 82   THR B CA    1 
ATOM   7247  C C     . THR D 3 82  ? 91.194  42.343 -34.642 1.00 36.79  ? 82   THR B C     1 
ATOM   7248  O O     . THR D 3 82  ? 90.174  42.434 -35.306 1.00 34.50  ? 82   THR B O     1 
ATOM   7249  C CB    . THR D 3 82  ? 91.418  43.251 -32.320 1.00 40.35  ? 82   THR B CB    1 
ATOM   7250  O OG1   . THR D 3 82  ? 90.006  43.133 -32.135 1.00 39.94  ? 82   THR B OG1   1 
ATOM   7251  C CG2   . THR D 3 82  ? 91.919  44.392 -31.458 1.00 41.18  ? 82   THR B CG2   1 
ATOM   7252  N N     . ALA D 3 83  ? 91.904  41.223 -34.616 1.00 45.24  ? 83   ALA B N     1 
ATOM   7253  C CA    . ALA D 3 83  ? 91.457  40.064 -35.375 1.00 45.09  ? 83   ALA B CA    1 
ATOM   7254  C C     . ALA D 3 83  ? 90.030  39.662 -34.964 1.00 45.45  ? 83   ALA B C     1 
ATOM   7255  O O     . ALA D 3 83  ? 89.240  39.241 -35.798 1.00 47.23  ? 83   ALA B O     1 
ATOM   7256  C CB    . ALA D 3 83  ? 92.437  38.893 -35.182 1.00 26.22  ? 83   ALA B CB    1 
ATOM   7257  N N     . MET D 3 84  ? 89.702  39.777 -33.682 1.00 27.10  ? 84   MET B N     1 
ATOM   7258  C CA    . MET D 3 84  ? 88.354  39.454 -33.247 1.00 27.61  ? 84   MET B CA    1 
ATOM   7259  C C     . MET D 3 84  ? 87.375  40.450 -33.862 1.00 28.06  ? 84   MET B C     1 
ATOM   7260  O O     . MET D 3 84  ? 86.248  40.081 -34.214 1.00 26.41  ? 84   MET B O     1 
ATOM   7261  C CB    . MET D 3 84  ? 88.205  39.523 -31.733 1.00 33.87  ? 84   MET B CB    1 
ATOM   7262  C CG    . MET D 3 84  ? 88.729  38.338 -30.993 1.00 39.14  ? 84   MET B CG    1 
ATOM   7263  S SD    . MET D 3 84  ? 88.236  36.757 -31.698 1.00 44.27  ? 84   MET B SD    1 
ATOM   7264  C CE    . MET D 3 84  ? 86.524  36.590 -31.037 1.00 45.48  ? 84   MET B CE    1 
ATOM   7265  N N     . ASP D 3 85  ? 87.798  41.712 -33.985 1.00 40.05  ? 85   ASP B N     1 
ATOM   7266  C CA    . ASP D 3 85  ? 86.935  42.730 -34.577 1.00 42.17  ? 85   ASP B CA    1 
ATOM   7267  C C     . ASP D 3 85  ? 86.520  42.275 -35.973 1.00 41.43  ? 85   ASP B C     1 
ATOM   7268  O O     . ASP D 3 85  ? 85.400  42.519 -36.390 1.00 42.52  ? 85   ASP B O     1 
ATOM   7269  C CB    . ASP D 3 85  ? 87.641  44.104 -34.693 1.00 42.72  ? 85   ASP B CB    1 
ATOM   7270  C CG    . ASP D 3 85  ? 87.642  44.923 -33.379 1.00 44.62  ? 85   ASP B CG    1 
ATOM   7271  O OD1   . ASP D 3 85  ? 86.685  44.825 -32.577 1.00 44.99  ? 85   ASP B OD1   1 
ATOM   7272  O OD2   . ASP D 3 85  ? 88.606  45.698 -33.179 1.00 48.06  ? 85   ASP B OD2   1 
ATOM   7273  N N     . VAL D 3 86  ? 87.438  41.638 -36.697 1.00 36.14  ? 86   VAL B N     1 
ATOM   7274  C CA    . VAL D 3 86  ? 87.182  41.141 -38.054 1.00 38.83  ? 86   VAL B CA    1 
ATOM   7275  C C     . VAL D 3 86  ? 86.319  39.864 -38.001 1.00 39.37  ? 86   VAL B C     1 
ATOM   7276  O O     . VAL D 3 86  ? 85.322  39.745 -38.718 1.00 40.58  ? 86   VAL B O     1 
ATOM   7277  C CB    . VAL D 3 86  ? 88.542  40.871 -38.792 1.00 33.82  ? 86   VAL B CB    1 
ATOM   7278  C CG1   . VAL D 3 86  ? 88.312  40.165 -40.122 1.00 32.58  ? 86   VAL B CG1   1 
ATOM   7279  C CG2   . VAL D 3 86  ? 89.279  42.196 -39.013 1.00 34.50  ? 86   VAL B CG2   1 
ATOM   7280  N N     . VAL D 3 87  ? 86.703  38.920 -37.146 1.00 35.37  ? 87   VAL B N     1 
ATOM   7281  C CA    . VAL D 3 87  ? 85.950  37.685 -36.979 1.00 32.30  ? 87   VAL B CA    1 
ATOM   7282  C C     . VAL D 3 87  ? 84.472  37.936 -36.668 1.00 34.64  ? 87   VAL B C     1 
ATOM   7283  O O     . VAL D 3 87  ? 83.608  37.282 -37.227 1.00 32.84  ? 87   VAL B O     1 
ATOM   7284  C CB    . VAL D 3 87  ? 86.545  36.829 -35.872 1.00 34.41  ? 87   VAL B CB    1 
ATOM   7285  C CG1   . VAL D 3 87  ? 85.660  35.624 -35.613 1.00 33.04  ? 87   VAL B CG1   1 
ATOM   7286  C CG2   . VAL D 3 87  ? 87.943  36.388 -36.276 1.00 33.08  ? 87   VAL B CG2   1 
ATOM   7287  N N     . TYR D 3 88  ? 84.185  38.865 -35.772 1.00 30.09  ? 88   TYR B N     1 
ATOM   7288  C CA    . TYR D 3 88  ? 82.825  39.212 -35.452 1.00 29.68  ? 88   TYR B CA    1 
ATOM   7289  C C     . TYR D 3 88  ? 82.110  39.844 -36.653 1.00 28.56  ? 88   TYR B C     1 
ATOM   7290  O O     . TYR D 3 88  ? 80.902  39.660 -36.840 1.00 27.40  ? 88   TYR B O     1 
ATOM   7291  C CB    . TYR D 3 88  ? 82.803  40.200 -34.304 1.00 37.52  ? 88   TYR B CB    1 
ATOM   7292  C CG    . TYR D 3 88  ? 83.247  39.613 -32.998 1.00 41.36  ? 88   TYR B CG    1 
ATOM   7293  C CD1   . TYR D 3 88  ? 83.958  40.363 -32.074 1.00 41.73  ? 88   TYR B CD1   1 
ATOM   7294  C CD2   . TYR D 3 88  ? 82.921  38.315 -32.668 1.00 42.81  ? 88   TYR B CD2   1 
ATOM   7295  C CE1   . TYR D 3 88  ? 84.319  39.825 -30.856 1.00 44.10  ? 88   TYR B CE1   1 
ATOM   7296  C CE2   . TYR D 3 88  ? 83.270  37.778 -31.468 1.00 45.64  ? 88   TYR B CE2   1 
ATOM   7297  C CZ    . TYR D 3 88  ? 83.959  38.530 -30.558 1.00 46.48  ? 88   TYR B CZ    1 
ATOM   7298  O OH    . TYR D 3 88  ? 84.201  37.977 -29.312 1.00 49.33  ? 88   TYR B OH    1 
ATOM   7299  N N     . ALA D 3 89  ? 82.825  40.588 -37.481 1.00 30.72  ? 89   ALA B N     1 
ATOM   7300  C CA    . ALA D 3 89  ? 82.175  41.234 -38.624 1.00 32.38  ? 89   ALA B CA    1 
ATOM   7301  C C     . ALA D 3 89  ? 81.869  40.180 -39.662 1.00 32.43  ? 89   ALA B C     1 
ATOM   7302  O O     . ALA D 3 89  ? 80.767  40.119 -40.219 1.00 30.96  ? 89   ALA B O     1 
ATOM   7303  C CB    . ALA D 3 89  ? 83.081  42.318 -39.219 1.00 22.75  ? 89   ALA B CB    1 
ATOM   7304  N N     . LEU D 3 90  ? 82.859  39.339 -39.917 1.00 30.92  ? 90   LEU B N     1 
ATOM   7305  C CA    . LEU D 3 90  ? 82.675  38.286 -40.874 1.00 34.06  ? 90   LEU B CA    1 
ATOM   7306  C C     . LEU D 3 90  ? 81.475  37.403 -40.481 1.00 33.80  ? 90   LEU B C     1 
ATOM   7307  O O     . LEU D 3 90  ? 80.683  37.029 -41.337 1.00 35.57  ? 90   LEU B O     1 
ATOM   7308  C CB    . LEU D 3 90  ? 83.970  37.468 -40.998 1.00 23.63  ? 90   LEU B CB    1 
ATOM   7309  C CG    . LEU D 3 90  ? 85.047  38.124 -41.882 1.00 24.58  ? 90   LEU B CG    1 
ATOM   7310  C CD1   . LEU D 3 90  ? 86.357  37.411 -41.716 1.00 24.13  ? 90   LEU B CD1   1 
ATOM   7311  C CD2   . LEU D 3 90  ? 84.627  38.130 -43.353 1.00 25.26  ? 90   LEU B CD2   1 
ATOM   7312  N N     . LYS D 3 91  ? 81.313  37.104 -39.194 1.00 35.58  ? 91   LYS B N     1 
ATOM   7313  C CA    . LYS D 3 91  ? 80.217  36.245 -38.784 1.00 36.94  ? 91   LYS B CA    1 
ATOM   7314  C C     . LYS D 3 91  ? 78.835  36.807 -39.085 1.00 39.59  ? 91   LYS B C     1 
ATOM   7315  O O     . LYS D 3 91  ? 77.940  36.062 -39.504 1.00 37.27  ? 91   LYS B O     1 
ATOM   7316  C CB    . LYS D 3 91  ? 80.305  35.906 -37.299 1.00 27.74  ? 91   LYS B CB    1 
ATOM   7317  C CG    . LYS D 3 91  ? 79.377  34.753 -36.887 1.00 31.57  ? 91   LYS B CG    1 
ATOM   7318  C CD    . LYS D 3 91  ? 79.885  33.981 -35.668 1.00 40.32  ? 91   LYS B CD    1 
ATOM   7319  C CE    . LYS D 3 91  ? 79.781  34.804 -34.392 1.00 43.99  ? 91   LYS B CE    1 
ATOM   7320  N NZ    . LYS D 3 91  ? 80.229  34.097 -33.154 1.00 44.22  ? 91   LYS B NZ    1 
ATOM   7321  N N     . ARG D 3 92  ? 78.635  38.100 -38.875 1.00 33.02  ? 92   ARG B N     1 
ATOM   7322  C CA    . ARG D 3 92  ? 77.332  38.652 -39.141 1.00 36.90  ? 92   ARG B CA    1 
ATOM   7323  C C     . ARG D 3 92  ? 77.174  38.908 -40.628 1.00 37.21  ? 92   ARG B C     1 
ATOM   7324  O O     . ARG D 3 92  ? 76.064  39.122 -41.110 1.00 36.84  ? 92   ARG B O     1 
ATOM   7325  C CB    . ARG D 3 92  ? 77.106  39.913 -38.325 1.00 34.95  ? 92   ARG B CB    1 
ATOM   7326  C CG    . ARG D 3 92  ? 78.100  40.995 -38.587 1.00 36.80  ? 92   ARG B CG    1 
ATOM   7327  C CD    . ARG D 3 92  ? 77.869  42.134 -37.625 1.00 31.50  ? 92   ARG B CD    1 
ATOM   7328  N NE    . ARG D 3 92  ? 76.465  42.512 -37.638 1.00 29.99  ? 92   ARG B NE    1 
ATOM   7329  C CZ    . ARG D 3 92  ? 75.834  42.962 -38.719 1.00 32.05  ? 92   ARG B CZ    1 
ATOM   7330  N NH1   . ARG D 3 92  ? 76.509  43.105 -39.862 1.00 30.80  ? 92   ARG B NH1   1 
ATOM   7331  N NH2   . ARG D 3 92  ? 74.519  43.193 -38.682 1.00 33.26  ? 92   ARG B NH2   1 
ATOM   7332  N N     . GLN D 3 93  ? 78.273  38.898 -41.372 1.00 37.11  ? 93   GLN B N     1 
ATOM   7333  C CA    . GLN D 3 93  ? 78.167  39.059 -42.825 1.00 38.65  ? 93   GLN B CA    1 
ATOM   7334  C C     . GLN D 3 93  ? 77.810  37.662 -43.365 1.00 35.69  ? 93   GLN B C     1 
ATOM   7335  O O     . GLN D 3 93  ? 77.548  37.487 -44.554 1.00 36.78  ? 93   GLN B O     1 
ATOM   7336  C CB    . GLN D 3 93  ? 79.507  39.476 -43.457 1.00 56.71  ? 93   GLN B CB    1 
ATOM   7337  C CG    . GLN D 3 93  ? 80.015  40.853 -43.108 1.00 63.14  ? 93   GLN B CG    1 
ATOM   7338  C CD    . GLN D 3 93  ? 79.050  41.937 -43.511 1.00 66.56  ? 93   GLN B CD    1 
ATOM   7339  O OE1   . GLN D 3 93  ? 78.745  42.109 -44.692 1.00 67.27  ? 93   GLN B OE1   1 
ATOM   7340  N NE2   . GLN D 3 93  ? 78.556  42.678 -42.527 1.00 65.70  ? 93   GLN B NE2   1 
ATOM   7341  N N     . GLY D 3 94  ? 77.827  36.672 -42.476 1.00 37.87  ? 94   GLY B N     1 
ATOM   7342  C CA    . GLY D 3 94  ? 77.547  35.309 -42.857 1.00 35.97  ? 94   GLY B CA    1 
ATOM   7343  C C     . GLY D 3 94  ? 78.775  34.647 -43.456 1.00 37.86  ? 94   GLY B C     1 
ATOM   7344  O O     . GLY D 3 94  ? 78.674  33.625 -44.118 1.00 37.03  ? 94   GLY B O     1 
ATOM   7345  N N     . ARG D 3 95  ? 79.946  35.232 -43.238 1.00 32.91  ? 95   ARG B N     1 
ATOM   7346  C CA    . ARG D 3 95  ? 81.176  34.677 -43.765 1.00 32.40  ? 95   ARG B CA    1 
ATOM   7347  C C     . ARG D 3 95  ? 82.075  34.127 -42.631 1.00 33.50  ? 95   ARG B C     1 
ATOM   7348  O O     . ARG D 3 95  ? 83.296  34.371 -42.650 1.00 33.02  ? 95   ARG B O     1 
ATOM   7349  C CB    . ARG D 3 95  ? 81.947  35.755 -44.535 1.00 51.25  ? 95   ARG B CB    1 
ATOM   7350  C CG    . ARG D 3 95  ? 81.195  36.522 -45.597 1.00 56.14  ? 95   ARG B CG    1 
ATOM   7351  C CD    . ARG D 3 95  ? 80.824  35.697 -46.803 1.00 61.10  ? 95   ARG B CD    1 
ATOM   7352  N NE    . ARG D 3 95  ? 81.952  34.948 -47.348 1.00 65.86  ? 95   ARG B NE    1 
ATOM   7353  C CZ    . ARG D 3 95  ? 81.856  34.060 -48.345 1.00 67.25  ? 95   ARG B CZ    1 
ATOM   7354  N NH1   . ARG D 3 95  ? 80.677  33.814 -48.917 1.00 68.39  ? 95   ARG B NH1   1 
ATOM   7355  N NH2   . ARG D 3 95  ? 82.935  33.393 -48.763 1.00 67.42  ? 95   ARG B NH2   1 
ATOM   7356  N N     . THR D 3 96  ? 81.494  33.388 -41.672 1.00 30.44  ? 96   THR B N     1 
ATOM   7357  C CA    . THR D 3 96  ? 82.236  32.826 -40.518 1.00 30.37  ? 96   THR B CA    1 
ATOM   7358  C C     . THR D 3 96  ? 83.614  32.318 -40.860 1.00 32.87  ? 96   THR B C     1 
ATOM   7359  O O     . THR D 3 96  ? 83.743  31.540 -41.791 1.00 29.43  ? 96   THR B O     1 
ATOM   7360  C CB    . THR D 3 96  ? 81.512  31.658 -39.921 1.00 34.00  ? 96   THR B CB    1 
ATOM   7361  O OG1   . THR D 3 96  ? 80.423  32.139 -39.164 1.00 33.38  ? 96   THR B OG1   1 
ATOM   7362  C CG2   . THR D 3 96  ? 82.390  30.891 -39.002 1.00 36.48  ? 96   THR B CG2   1 
ATOM   7363  N N     . LEU D 3 97  ? 84.632  32.723 -40.109 1.00 30.06  ? 97   LEU B N     1 
ATOM   7364  C CA    . LEU D 3 97  ? 85.992  32.293 -40.370 1.00 29.18  ? 97   LEU B CA    1 
ATOM   7365  C C     . LEU D 3 97  ? 86.647  31.630 -39.143 1.00 30.96  ? 97   LEU B C     1 
ATOM   7366  O O     . LEU D 3 97  ? 86.659  32.217 -38.068 1.00 31.57  ? 97   LEU B O     1 
ATOM   7367  C CB    . LEU D 3 97  ? 86.818  33.492 -40.787 1.00 19.77  ? 97   LEU B CB    1 
ATOM   7368  C CG    . LEU D 3 97  ? 88.338  33.293 -40.885 1.00 21.87  ? 97   LEU B CG    1 
ATOM   7369  C CD1   . LEU D 3 97  ? 88.655  32.416 -42.118 1.00 17.71  ? 97   LEU B CD1   1 
ATOM   7370  C CD2   . LEU D 3 97  ? 89.055  34.661 -40.989 1.00 23.64  ? 97   LEU B CD2   1 
ATOM   7371  N N     . TYR D 3 98  ? 87.193  30.416 -39.306 1.00 40.69  ? 98   TYR B N     1 
ATOM   7372  C CA    . TYR D 3 98  ? 87.846  29.701 -38.216 1.00 39.56  ? 98   TYR B CA    1 
ATOM   7373  C C     . TYR D 3 98  ? 89.356  29.921 -38.291 1.00 39.58  ? 98   TYR B C     1 
ATOM   7374  O O     . TYR D 3 98  ? 89.933  29.930 -39.386 1.00 38.28  ? 98   TYR B O     1 
ATOM   7375  C CB    . TYR D 3 98  ? 87.627  28.202 -38.320 1.00 31.98  ? 98   TYR B CB    1 
ATOM   7376  C CG    . TYR D 3 98  ? 86.259  27.658 -37.998 1.00 32.39  ? 98   TYR B CG    1 
ATOM   7377  C CD1   . TYR D 3 98  ? 85.256  28.451 -37.454 1.00 35.64  ? 98   TYR B CD1   1 
ATOM   7378  C CD2   . TYR D 3 98  ? 85.961  26.332 -38.267 1.00 31.89  ? 98   TYR B CD2   1 
ATOM   7379  C CE1   . TYR D 3 98  ? 84.006  27.929 -37.194 1.00 33.34  ? 98   TYR B CE1   1 
ATOM   7380  C CE2   . TYR D 3 98  ? 84.723  25.816 -38.015 1.00 35.93  ? 98   TYR B CE2   1 
ATOM   7381  C CZ    . TYR D 3 98  ? 83.759  26.617 -37.477 1.00 35.23  ? 98   TYR B CZ    1 
ATOM   7382  O OH    . TYR D 3 98  ? 82.549  26.054 -37.199 1.00 38.94  ? 98   TYR B OH    1 
ATOM   7383  N N     . GLY D 3 99  ? 89.998  30.073 -37.127 1.00 41.66  ? 99   GLY B N     1 
ATOM   7384  C CA    . GLY D 3 99  ? 91.436  30.254 -37.086 1.00 45.08  ? 99   GLY B CA    1 
ATOM   7385  C C     . GLY D 3 99  ? 92.022  31.509 -36.484 1.00 47.90  ? 99   GLY B C     1 
ATOM   7386  O O     . GLY D 3 99  ? 93.200  31.555 -36.229 1.00 47.64  ? 99   GLY B O     1 
ATOM   7387  N N     . PHE D 3 100 ? 91.243  32.538 -36.248 1.00 42.14  ? 100  PHE B N     1 
ATOM   7388  C CA    . PHE D 3 100 ? 91.840  33.720 -35.693 1.00 42.22  ? 100  PHE B CA    1 
ATOM   7389  C C     . PHE D 3 100 ? 91.094  34.216 -34.495 1.00 43.90  ? 100  PHE B C     1 
ATOM   7390  O O     . PHE D 3 100 ? 90.930  35.417 -34.358 1.00 42.42  ? 100  PHE B O     1 
ATOM   7391  C CB    . PHE D 3 100 ? 91.889  34.849 -36.712 1.00 39.15  ? 100  PHE B CB    1 
ATOM   7392  C CG    . PHE D 3 100 ? 92.486  34.463 -38.027 1.00 38.16  ? 100  PHE B CG    1 
ATOM   7393  C CD1   . PHE D 3 100 ? 91.752  33.737 -38.954 1.00 38.16  ? 100  PHE B CD1   1 
ATOM   7394  C CD2   . PHE D 3 100 ? 93.790  34.828 -38.345 1.00 37.92  ? 100  PHE B CD2   1 
ATOM   7395  C CE1   . PHE D 3 100 ? 92.312  33.382 -40.185 1.00 39.19  ? 100  PHE B CE1   1 
ATOM   7396  C CE2   . PHE D 3 100 ? 94.356  34.477 -39.570 1.00 38.35  ? 100  PHE B CE2   1 
ATOM   7397  C CZ    . PHE D 3 100 ? 93.617  33.754 -40.492 1.00 39.95  ? 100  PHE B CZ    1 
ATOM   7398  N N     . GLY D 3 101 ? 90.644  33.329 -33.620 1.00 30.97  ? 101  GLY B N     1 
ATOM   7399  C CA    . GLY D 3 101 ? 89.925  33.800 -32.450 1.00 36.32  ? 101  GLY B CA    1 
ATOM   7400  C C     . GLY D 3 101 ? 88.479  33.335 -32.328 1.00 39.87  ? 101  GLY B C     1 
ATOM   7401  O O     . GLY D 3 101 ? 87.845  32.874 -33.309 1.00 39.80  ? 101  GLY B O     1 
ATOM   7402  N N     . GLY D 3 102 ? 87.953  33.443 -31.107 1.00 90.83  ? 102  GLY B N     1 
ATOM   7403  C CA    . GLY D 3 102 ? 86.590  33.023 -30.836 1.00 91.63  ? 102  GLY B CA    1 
ATOM   7404  C C     . GLY D 3 102 ? 86.413  31.580 -31.250 1.00 93.27  ? 102  GLY B C     1 
ATOM   7405  O O     . GLY D 3 102 ? 86.910  30.690 -30.522 1.00 74.49  ? 102  GLY B O     1 
ATOM   7406  O OXT   . GLY D 3 102 ? 85.811  31.338 -32.319 1.00 145.94 ? 102  GLY B OXT   1 
ATOM   7407  N N     . LYS E 4 15  ? 53.962  60.441 -15.009 1.00 88.88  ? 815  LYS C N     1 
ATOM   7408  C CA    . LYS E 4 15  ? 54.143  60.503 -16.491 1.00 85.04  ? 815  LYS C CA    1 
ATOM   7409  C C     . LYS E 4 15  ? 54.800  59.258 -17.090 1.00 79.51  ? 815  LYS C C     1 
ATOM   7410  O O     . LYS E 4 15  ? 55.814  58.780 -16.589 1.00 78.49  ? 815  LYS C O     1 
ATOM   7411  C CB    . LYS E 4 15  ? 54.987  61.725 -16.875 1.00 61.30  ? 815  LYS C CB    1 
ATOM   7412  C CG    . LYS E 4 15  ? 54.242  63.034 -16.814 1.00 65.85  ? 815  LYS C CG    1 
ATOM   7413  C CD    . LYS E 4 15  ? 54.914  64.081 -17.673 1.00 68.86  ? 815  LYS C CD    1 
ATOM   7414  C CE    . LYS E 4 15  ? 54.950  63.649 -19.135 1.00 70.67  ? 815  LYS C CE    1 
ATOM   7415  N NZ    . LYS E 4 15  ? 55.651  64.631 -19.995 1.00 71.99  ? 815  LYS C NZ    1 
ATOM   7416  N N     . THR E 4 16  ? 54.234  58.738 -18.174 1.00 60.92  ? 816  THR C N     1 
ATOM   7417  C CA    . THR E 4 16  ? 54.825  57.569 -18.812 1.00 53.32  ? 816  THR C CA    1 
ATOM   7418  C C     . THR E 4 16  ? 56.193  57.946 -19.339 1.00 48.55  ? 816  THR C C     1 
ATOM   7419  O O     . THR E 4 16  ? 56.413  59.081 -19.750 1.00 44.65  ? 816  THR C O     1 
ATOM   7420  C CB    . THR E 4 16  ? 53.984  57.052 -19.990 1.00 40.56  ? 816  THR C CB    1 
ATOM   7421  O OG1   . THR E 4 16  ? 53.950  58.026 -21.057 1.00 38.71  ? 816  THR C OG1   1 
ATOM   7422  C CG2   . THR E 4 16  ? 52.587  56.704 -19.496 1.00 37.74  ? 816  THR C CG2   1 
ATOM   7423  N N     . ARG E 4 17  ? 57.114  56.996 -19.321 1.00 50.55  ? 817  ARG C N     1 
ATOM   7424  C CA    . ARG E 4 17  ? 58.455  57.263 -19.803 1.00 48.14  ? 817  ARG C CA    1 
ATOM   7425  C C     . ARG E 4 17  ? 58.451  57.590 -21.303 1.00 44.84  ? 817  ARG C C     1 
ATOM   7426  O O     . ARG E 4 17  ? 59.414  58.169 -21.834 1.00 42.71  ? 817  ARG C O     1 
ATOM   7427  C CB    . ARG E 4 17  ? 59.345  56.061 -19.529 1.00 42.84  ? 817  ARG C CB    1 
ATOM   7428  C CG    . ARG E 4 17  ? 59.250  55.569 -18.120 1.00 46.39  ? 817  ARG C CG    1 
ATOM   7429  C CD    . ARG E 4 17  ? 60.532  54.917 -17.781 1.00 45.58  ? 817  ARG C CD    1 
ATOM   7430  N NE    . ARG E 4 17  ? 60.452  53.478 -17.906 1.00 48.30  ? 817  ARG C NE    1 
ATOM   7431  C CZ    . ARG E 4 17  ? 61.497  52.718 -18.217 1.00 48.91  ? 817  ARG C CZ    1 
ATOM   7432  N NH1   . ARG E 4 17  ? 62.691  53.282 -18.451 1.00 46.72  ? 817  ARG C NH1   1 
ATOM   7433  N NH2   . ARG E 4 17  ? 61.355  51.396 -18.244 1.00 48.94  ? 817  ARG C NH2   1 
ATOM   7434  N N     . SER E 4 18  ? 57.365  57.226 -21.982 1.00 55.41  ? 818  SER C N     1 
ATOM   7435  C CA    . SER E 4 18  ? 57.246  57.504 -23.403 1.00 57.38  ? 818  SER C CA    1 
ATOM   7436  C C     . SER E 4 18  ? 57.091  59.008 -23.592 1.00 57.60  ? 818  SER C C     1 
ATOM   7437  O O     . SER E 4 18  ? 57.744  59.605 -24.452 1.00 56.52  ? 818  SER C O     1 
ATOM   7438  C CB    . SER E 4 18  ? 56.053  56.756 -23.982 1.00 35.89  ? 818  SER C CB    1 
ATOM   7439  O OG    . SER E 4 18  ? 56.222  55.362 -23.807 1.00 37.61  ? 818  SER C OG    1 
ATOM   7440  N N     . SER E 4 19  ? 56.229  59.621 -22.782 1.00 47.46  ? 819  SER C N     1 
ATOM   7441  C CA    . SER E 4 19  ? 56.036  61.076 -22.854 1.00 50.12  ? 819  SER C CA    1 
ATOM   7442  C C     . SER E 4 19  ? 57.323  61.784 -22.447 1.00 48.87  ? 819  SER C C     1 
ATOM   7443  O O     . SER E 4 19  ? 57.775  62.703 -23.139 1.00 49.76  ? 819  SER C O     1 
ATOM   7444  C CB    . SER E 4 19  ? 54.902  61.522 -21.941 1.00 52.30  ? 819  SER C CB    1 
ATOM   7445  O OG    . SER E 4 19  ? 54.993  60.850 -20.708 1.00 58.64  ? 819  SER C OG    1 
ATOM   7446  N N     . ARG E 4 20  ? 57.902  61.352 -21.327 1.00 37.77  ? 820  ARG C N     1 
ATOM   7447  C CA    . ARG E 4 20  ? 59.143  61.923 -20.857 1.00 37.39  ? 820  ARG C CA    1 
ATOM   7448  C C     . ARG E 4 20  ? 60.165  61.869 -21.999 1.00 35.97  ? 820  ARG C C     1 
ATOM   7449  O O     . ARG E 4 20  ? 60.952  62.805 -22.187 1.00 35.24  ? 820  ARG C O     1 
ATOM   7450  C CB    . ARG E 4 20  ? 59.603  61.161 -19.624 1.00 80.72  ? 820  ARG C CB    1 
ATOM   7451  C CG    . ARG E 4 20  ? 58.555  61.279 -18.547 1.00 87.20  ? 820  ARG C CG    1 
ATOM   7452  C CD    . ARG E 4 20  ? 58.706  60.181 -17.488 1.00 93.75  ? 820  ARG C CD    1 
ATOM   7453  N NE    . ARG E 4 20  ? 58.078  60.492 -16.192 1.00 98.88  ? 820  ARG C NE    1 
ATOM   7454  C CZ    . ARG E 4 20  ? 57.962  61.695 -15.602 1.00 101.92 ? 820  ARG C CZ    1 
ATOM   7455  N NH1   . ARG E 4 20  ? 58.395  62.833 -16.156 1.00 104.15 ? 820  ARG C NH1   1 
ATOM   7456  N NH2   . ARG E 4 20  ? 57.502  61.741 -14.357 1.00 102.69 ? 820  ARG C NH2   1 
ATOM   7457  N N     . ALA E 4 21  ? 60.111  60.809 -22.803 1.00 46.77  ? 821  ALA C N     1 
ATOM   7458  C CA    . ALA E 4 21  ? 61.047  60.659 -23.919 1.00 46.09  ? 821  ALA C CA    1 
ATOM   7459  C C     . ALA E 4 21  ? 60.534  61.294 -25.195 1.00 45.42  ? 821  ALA C C     1 
ATOM   7460  O O     . ALA E 4 21  ? 61.274  61.415 -26.170 1.00 47.65  ? 821  ALA C O     1 
ATOM   7461  C CB    . ALA E 4 21  ? 61.331  59.191 -24.160 1.00 68.67  ? 821  ALA C CB    1 
ATOM   7462  N N     . GLY E 4 22  ? 59.265  61.706 -25.162 1.00 40.59  ? 822  GLY C N     1 
ATOM   7463  C CA    . GLY E 4 22  ? 58.625  62.305 -26.314 1.00 37.72  ? 822  GLY C CA    1 
ATOM   7464  C C     . GLY E 4 22  ? 58.365  61.269 -27.408 1.00 36.29  ? 822  GLY C C     1 
ATOM   7465  O O     . GLY E 4 22  ? 58.718  61.496 -28.562 1.00 34.36  ? 822  GLY C O     1 
ATOM   7466  N N     . LEU E 4 23  ? 57.715  60.155 -27.072 1.00 28.94  ? 823  LEU C N     1 
ATOM   7467  C CA    . LEU E 4 23  ? 57.486  59.096 -28.053 1.00 28.00  ? 823  LEU C CA    1 
ATOM   7468  C C     . LEU E 4 23  ? 56.102  58.466 -28.017 1.00 29.10  ? 823  LEU C C     1 
ATOM   7469  O O     . LEU E 4 23  ? 55.411  58.494 -27.003 1.00 31.94  ? 823  LEU C O     1 
ATOM   7470  C CB    . LEU E 4 23  ? 58.534  57.975 -27.859 1.00 41.01  ? 823  LEU C CB    1 
ATOM   7471  C CG    . LEU E 4 23  ? 60.033  58.297 -27.988 1.00 39.38  ? 823  LEU C CG    1 
ATOM   7472  C CD1   . LEU E 4 23  ? 60.859  57.174 -27.415 1.00 36.73  ? 823  LEU C CD1   1 
ATOM   7473  C CD2   . LEU E 4 23  ? 60.398  58.504 -29.429 1.00 39.30  ? 823  LEU C CD2   1 
ATOM   7474  N N     . GLN E 4 24  ? 55.722  57.867 -29.139 1.00 38.07  ? 824  GLN C N     1 
ATOM   7475  C CA    . GLN E 4 24  ? 54.441  57.193 -29.269 1.00 38.47  ? 824  GLN C CA    1 
ATOM   7476  C C     . GLN E 4 24  ? 54.593  55.758 -28.834 1.00 38.14  ? 824  GLN C C     1 
ATOM   7477  O O     . GLN E 4 24  ? 53.750  55.262 -28.115 1.00 39.69  ? 824  GLN C O     1 
ATOM   7478  C CB    . GLN E 4 24  ? 53.946  57.235 -30.710 1.00 36.89  ? 824  GLN C CB    1 
ATOM   7479  C CG    . GLN E 4 24  ? 53.711  58.640 -31.218 1.00 39.96  ? 824  GLN C CG    1 
ATOM   7480  C CD    . GLN E 4 24  ? 52.774  59.367 -30.325 1.00 38.15  ? 824  GLN C CD    1 
ATOM   7481  O OE1   . GLN E 4 24  ? 51.622  58.976 -30.160 1.00 36.69  ? 824  GLN C OE1   1 
ATOM   7482  N NE2   . GLN E 4 24  ? 53.255  60.423 -29.718 1.00 42.82  ? 824  GLN C NE2   1 
ATOM   7483  N N     . PHE E 4 25  ? 55.666  55.091 -29.258 1.00 40.34  ? 825  PHE C N     1 
ATOM   7484  C CA    . PHE E 4 25  ? 55.900  53.691 -28.873 1.00 40.67  ? 825  PHE C CA    1 
ATOM   7485  C C     . PHE E 4 25  ? 56.102  53.549 -27.369 1.00 42.82  ? 825  PHE C C     1 
ATOM   7486  O O     . PHE E 4 25  ? 56.759  54.365 -26.744 1.00 41.14  ? 825  PHE C O     1 
ATOM   7487  C CB    . PHE E 4 25  ? 57.103  53.133 -29.626 1.00 29.72  ? 825  PHE C CB    1 
ATOM   7488  C CG    . PHE E 4 25  ? 56.756  52.580 -30.961 1.00 32.52  ? 825  PHE C CG    1 
ATOM   7489  C CD1   . PHE E 4 25  ? 55.868  53.236 -31.777 1.00 31.46  ? 825  PHE C CD1   1 
ATOM   7490  C CD2   . PHE E 4 25  ? 57.292  51.367 -31.383 1.00 34.69  ? 825  PHE C CD2   1 
ATOM   7491  C CE1   . PHE E 4 25  ? 55.487  52.687 -33.006 1.00 33.13  ? 825  PHE C CE1   1 
ATOM   7492  C CE2   . PHE E 4 25  ? 56.931  50.803 -32.593 1.00 35.04  ? 825  PHE C CE2   1 
ATOM   7493  C CZ    . PHE E 4 25  ? 56.020  51.471 -33.419 1.00 34.14  ? 825  PHE C CZ    1 
ATOM   7494  N N     . PRO E 4 26  ? 55.555  52.483 -26.776 1.00 44.11  ? 826  PRO C N     1 
ATOM   7495  C CA    . PRO E 4 26  ? 55.606  52.166 -25.345 1.00 43.28  ? 826  PRO C CA    1 
ATOM   7496  C C     . PRO E 4 26  ? 56.978  51.835 -24.767 1.00 45.30  ? 826  PRO C C     1 
ATOM   7497  O O     . PRO E 4 26  ? 57.416  50.685 -24.830 1.00 41.97  ? 826  PRO C O     1 
ATOM   7498  C CB    . PRO E 4 26  ? 54.644  51.002 -25.240 1.00 46.20  ? 826  PRO C CB    1 
ATOM   7499  C CG    . PRO E 4 26  ? 54.950  50.242 -26.492 1.00 46.99  ? 826  PRO C CG    1 
ATOM   7500  C CD    . PRO E 4 26  ? 55.088  51.315 -27.548 1.00 45.68  ? 826  PRO C CD    1 
ATOM   7501  N N     . VAL E 4 27  ? 57.648  52.836 -24.190 1.00 30.63  ? 827  VAL C N     1 
ATOM   7502  C CA    . VAL E 4 27  ? 58.954  52.607 -23.619 1.00 30.83  ? 827  VAL C CA    1 
ATOM   7503  C C     . VAL E 4 27  ? 58.966  51.508 -22.552 1.00 32.41  ? 827  VAL C C     1 
ATOM   7504  O O     . VAL E 4 27  ? 59.794  50.618 -22.616 1.00 29.42  ? 827  VAL C O     1 
ATOM   7505  C CB    . VAL E 4 27  ? 59.542  53.870 -23.013 1.00 32.04  ? 827  VAL C CB    1 
ATOM   7506  C CG1   . VAL E 4 27  ? 60.833  53.516 -22.263 1.00 33.78  ? 827  VAL C CG1   1 
ATOM   7507  C CG2   . VAL E 4 27  ? 59.843  54.866 -24.095 1.00 30.99  ? 827  VAL C CG2   1 
ATOM   7508  N N     . GLY E 4 28  ? 58.066  51.559 -21.574 1.00 44.48  ? 828  GLY C N     1 
ATOM   7509  C CA    . GLY E 4 28  ? 58.046  50.532 -20.546 1.00 44.45  ? 828  GLY C CA    1 
ATOM   7510  C C     . GLY E 4 28  ? 58.001  49.121 -21.121 1.00 46.15  ? 828  GLY C C     1 
ATOM   7511  O O     . GLY E 4 28  ? 58.822  48.262 -20.794 1.00 43.95  ? 828  GLY C O     1 
ATOM   7512  N N     . ARG E 4 29  ? 57.027  48.884 -21.993 1.00 39.94  ? 829  ARG C N     1 
ATOM   7513  C CA    . ARG E 4 29  ? 56.854  47.594 -22.627 1.00 40.43  ? 829  ARG C CA    1 
ATOM   7514  C C     . ARG E 4 29  ? 58.155  47.074 -23.238 1.00 40.02  ? 829  ARG C C     1 
ATOM   7515  O O     . ARG E 4 29  ? 58.469  45.880 -23.165 1.00 39.77  ? 829  ARG C O     1 
ATOM   7516  C CB    . ARG E 4 29  ? 55.796  47.705 -23.711 1.00 39.40  ? 829  ARG C CB    1 
ATOM   7517  C CG    . ARG E 4 29  ? 55.700  46.474 -24.527 1.00 39.90  ? 829  ARG C CG    1 
ATOM   7518  C CD    . ARG E 4 29  ? 54.336  45.891 -24.472 1.00 42.88  ? 829  ARG C CD    1 
ATOM   7519  N NE    . ARG E 4 29  ? 53.551  46.404 -25.571 1.00 46.12  ? 829  ARG C NE    1 
ATOM   7520  C CZ    . ARG E 4 29  ? 52.226  46.424 -25.586 1.00 45.28  ? 829  ARG C CZ    1 
ATOM   7521  N NH1   . ARG E 4 29  ? 51.522  45.957 -24.566 1.00 46.25  ? 829  ARG C NH1   1 
ATOM   7522  N NH2   . ARG E 4 29  ? 51.598  46.941 -26.618 1.00 50.15  ? 829  ARG C NH2   1 
ATOM   7523  N N     . VAL E 4 30  ? 58.900  47.970 -23.865 1.00 49.30  ? 830  VAL C N     1 
ATOM   7524  C CA    . VAL E 4 30  ? 60.145  47.585 -24.483 1.00 50.17  ? 830  VAL C CA    1 
ATOM   7525  C C     . VAL E 4 30  ? 61.115  47.208 -23.379 1.00 53.62  ? 830  VAL C C     1 
ATOM   7526  O O     . VAL E 4 30  ? 61.636  46.097 -23.345 1.00 53.58  ? 830  VAL C O     1 
ATOM   7527  C CB    . VAL E 4 30  ? 60.752  48.745 -25.332 1.00 26.55  ? 830  VAL C CB    1 
ATOM   7528  C CG1   . VAL E 4 30  ? 62.164  48.367 -25.813 1.00 24.21  ? 830  VAL C CG1   1 
ATOM   7529  C CG2   . VAL E 4 30  ? 59.891  49.028 -26.517 1.00 24.05  ? 830  VAL C CG2   1 
ATOM   7530  N N     . HIS E 4 31  ? 61.344  48.127 -22.458 1.00 48.34  ? 831  HIS C N     1 
ATOM   7531  C CA    . HIS E 4 31  ? 62.280  47.870 -21.375 1.00 51.28  ? 831  HIS C CA    1 
ATOM   7532  C C     . HIS E 4 31  ? 61.994  46.509 -20.747 1.00 52.46  ? 831  HIS C C     1 
ATOM   7533  O O     . HIS E 4 31  ? 62.894  45.747 -20.395 1.00 52.46  ? 831  HIS C O     1 
ATOM   7534  C CB    . HIS E 4 31  ? 62.170  48.972 -20.328 1.00 43.29  ? 831  HIS C CB    1 
ATOM   7535  C CG    . HIS E 4 31  ? 63.266  48.954 -19.319 1.00 44.37  ? 831  HIS C CG    1 
ATOM   7536  N ND1   . HIS E 4 31  ? 64.371  48.134 -19.439 1.00 48.06  ? 831  HIS C ND1   1 
ATOM   7537  C CD2   . HIS E 4 31  ? 63.427  49.628 -18.158 1.00 45.16  ? 831  HIS C CD2   1 
ATOM   7538  C CE1   . HIS E 4 31  ? 65.155  48.303 -18.394 1.00 46.66  ? 831  HIS C CE1   1 
ATOM   7539  N NE2   . HIS E 4 31  ? 64.605  49.206 -17.599 1.00 47.22  ? 831  HIS C NE2   1 
ATOM   7540  N N     . ARG E 4 32  ? 60.715  46.199 -20.653 1.00 48.75  ? 832  ARG C N     1 
ATOM   7541  C CA    . ARG E 4 32  ? 60.274  44.961 -20.057 1.00 50.25  ? 832  ARG C CA    1 
ATOM   7542  C C     . ARG E 4 32  ? 60.604  43.778 -20.937 1.00 50.01  ? 832  ARG C C     1 
ATOM   7543  O O     . ARG E 4 32  ? 61.083  42.757 -20.458 1.00 51.61  ? 832  ARG C O     1 
ATOM   7544  C CB    . ARG E 4 32  ? 58.781  45.040 -19.849 1.00 34.75  ? 832  ARG C CB    1 
ATOM   7545  C CG    . ARG E 4 32  ? 58.216  43.990 -18.987 1.00 36.83  ? 832  ARG C CG    1 
ATOM   7546  C CD    . ARG E 4 32  ? 56.737  43.977 -19.201 1.00 42.28  ? 832  ARG C CD    1 
ATOM   7547  N NE    . ARG E 4 32  ? 56.378  42.939 -20.164 1.00 43.85  ? 832  ARG C NE    1 
ATOM   7548  C CZ    . ARG E 4 32  ? 55.450  43.081 -21.106 1.00 45.44  ? 832  ARG C CZ    1 
ATOM   7549  N NH1   . ARG E 4 32  ? 54.778  44.230 -21.235 1.00 46.92  ? 832  ARG C NH1   1 
ATOM   7550  N NH2   . ARG E 4 32  ? 55.174  42.055 -21.899 1.00 48.50  ? 832  ARG C NH2   1 
ATOM   7551  N N     . LEU E 4 33  ? 60.330  43.920 -22.230 1.00 53.05  ? 833  LEU C N     1 
ATOM   7552  C CA    . LEU E 4 33  ? 60.592  42.859 -23.175 1.00 51.79  ? 833  LEU C CA    1 
ATOM   7553  C C     . LEU E 4 33  ? 62.075  42.628 -23.265 1.00 50.07  ? 833  LEU C C     1 
ATOM   7554  O O     . LEU E 4 33  ? 62.502  41.530 -23.578 1.00 51.03  ? 833  LEU C O     1 
ATOM   7555  C CB    . LEU E 4 33  ? 60.011  43.186 -24.554 1.00 36.64  ? 833  LEU C CB    1 
ATOM   7556  C CG    . LEU E 4 33  ? 58.479  43.135 -24.695 1.00 37.42  ? 833  LEU C CG    1 
ATOM   7557  C CD1   . LEU E 4 33  ? 58.032  43.454 -26.131 1.00 38.61  ? 833  LEU C CD1   1 
ATOM   7558  C CD2   . LEU E 4 33  ? 58.001  41.759 -24.314 1.00 38.24  ? 833  LEU C CD2   1 
ATOM   7559  N N     . LEU E 4 34  ? 62.875  43.644 -22.981 1.00 35.90  ? 834  LEU C N     1 
ATOM   7560  C CA    . LEU E 4 34  ? 64.317  43.445 -23.027 1.00 36.83  ? 834  LEU C CA    1 
ATOM   7561  C C     . LEU E 4 34  ? 64.745  42.499 -21.910 1.00 40.86  ? 834  LEU C C     1 
ATOM   7562  O O     . LEU E 4 34  ? 65.628  41.659 -22.086 1.00 41.07  ? 834  LEU C O     1 
ATOM   7563  C CB    . LEU E 4 34  ? 65.063  44.761 -22.871 1.00 35.79  ? 834  LEU C CB    1 
ATOM   7564  C CG    . LEU E 4 34  ? 65.094  45.619 -24.137 1.00 38.71  ? 834  LEU C CG    1 
ATOM   7565  C CD1   . LEU E 4 34  ? 65.746  46.992 -23.855 1.00 35.23  ? 834  LEU C CD1   1 
ATOM   7566  C CD2   . LEU E 4 34  ? 65.838  44.865 -25.226 1.00 34.04  ? 834  LEU C CD2   1 
ATOM   7567  N N     . ARG E 4 35  ? 64.111  42.630 -20.757 1.00 56.71  ? 835  ARG C N     1 
ATOM   7568  C CA    . ARG E 4 35  ? 64.454  41.789 -19.629 1.00 61.14  ? 835  ARG C CA    1 
ATOM   7569  C C     . ARG E 4 35  ? 64.061  40.349 -19.872 1.00 62.70  ? 835  ARG C C     1 
ATOM   7570  O O     . ARG E 4 35  ? 64.890  39.447 -19.808 1.00 65.47  ? 835  ARG C O     1 
ATOM   7571  C CB    . ARG E 4 35  ? 63.777  42.301 -18.354 1.00 63.71  ? 835  ARG C CB    1 
ATOM   7572  C CG    . ARG E 4 35  ? 64.246  43.681 -17.907 1.00 65.54  ? 835  ARG C CG    1 
ATOM   7573  C CD    . ARG E 4 35  ? 63.570  44.093 -16.601 1.00 71.49  ? 835  ARG C CD    1 
ATOM   7574  N NE    . ARG E 4 35  ? 63.796  45.501 -16.257 1.00 75.01  ? 835  ARG C NE    1 
ATOM   7575  C CZ    . ARG E 4 35  ? 64.981  46.031 -15.943 1.00 76.99  ? 835  ARG C CZ    1 
ATOM   7576  N NH1   . ARG E 4 35  ? 66.078  45.272 -15.926 1.00 78.89  ? 835  ARG C NH1   1 
ATOM   7577  N NH2   . ARG E 4 35  ? 65.069  47.325 -15.640 1.00 78.68  ? 835  ARG C NH2   1 
ATOM   7578  N N     . LYS E 4 36  ? 62.798  40.126 -20.179 1.00 49.75  ? 836  LYS C N     1 
ATOM   7579  C CA    . LYS E 4 36  ? 62.351  38.763 -20.361 1.00 52.28  ? 836  LYS C CA    1 
ATOM   7580  C C     . LYS E 4 36  ? 63.097  38.057 -21.492 1.00 51.16  ? 836  LYS C C     1 
ATOM   7581  O O     . LYS E 4 36  ? 63.178  36.829 -21.538 1.00 49.83  ? 836  LYS C O     1 
ATOM   7582  C CB    . LYS E 4 36  ? 60.832  38.725 -20.614 1.00 62.46  ? 836  LYS C CB    1 
ATOM   7583  C CG    . LYS E 4 36  ? 60.437  39.059 -22.049 1.00 68.69  ? 836  LYS C CG    1 
ATOM   7584  C CD    . LYS E 4 36  ? 58.930  39.264 -22.225 1.00 73.60  ? 836  LYS C CD    1 
ATOM   7585  C CE    . LYS E 4 36  ? 58.150  37.964 -22.328 1.00 75.20  ? 836  LYS C CE    1 
ATOM   7586  N NZ    . LYS E 4 36  ? 56.706  38.274 -22.547 1.00 79.22  ? 836  LYS C NZ    1 
ATOM   7587  N N     . GLY E 4 37  ? 63.673  38.835 -22.391 1.00 41.55  ? 837  GLY C N     1 
ATOM   7588  C CA    . GLY E 4 37  ? 64.328  38.227 -23.526 1.00 38.34  ? 837  GLY C CA    1 
ATOM   7589  C C     . GLY E 4 37  ? 65.708  37.716 -23.284 1.00 38.76  ? 837  GLY C C     1 
ATOM   7590  O O     . GLY E 4 37  ? 66.254  37.049 -24.162 1.00 37.89  ? 837  GLY C O     1 
ATOM   7591  N N     . ASN E 4 38  ? 66.262  38.025 -22.114 1.00 44.61  ? 838  ASN C N     1 
ATOM   7592  C CA    . ASN E 4 38  ? 67.608  37.603 -21.735 1.00 46.32  ? 838  ASN C CA    1 
ATOM   7593  C C     . ASN E 4 38  ? 68.680  37.964 -22.740 1.00 43.16  ? 838  ASN C C     1 
ATOM   7594  O O     . ASN E 4 38  ? 69.159  37.123 -23.508 1.00 45.10  ? 838  ASN C O     1 
ATOM   7595  C CB    . ASN E 4 38  ? 67.645  36.105 -21.483 1.00 86.42  ? 838  ASN C CB    1 
ATOM   7596  C CG    . ASN E 4 38  ? 67.035  35.749 -20.176 1.00 89.92  ? 838  ASN C CG    1 
ATOM   7597  O OD1   . ASN E 4 38  ? 65.834  35.923 -19.972 1.00 91.54  ? 838  ASN C OD1   1 
ATOM   7598  N ND2   . ASN E 4 38  ? 67.859  35.267 -19.259 1.00 92.58  ? 838  ASN C ND2   1 
ATOM   7599  N N     . TYR E 4 39  ? 69.079  39.224 -22.719 1.00 49.06  ? 839  TYR C N     1 
ATOM   7600  C CA    . TYR E 4 39  ? 70.093  39.687 -23.640 1.00 44.79  ? 839  TYR C CA    1 
ATOM   7601  C C     . TYR E 4 39  ? 71.343  40.051 -22.882 1.00 44.03  ? 839  TYR C C     1 
ATOM   7602  O O     . TYR E 4 39  ? 72.431  40.075 -23.437 1.00 43.81  ? 839  TYR C O     1 
ATOM   7603  C CB    . TYR E 4 39  ? 69.555  40.876 -24.426 1.00 37.27  ? 839  TYR C CB    1 
ATOM   7604  C CG    . TYR E 4 39  ? 68.384  40.517 -25.317 1.00 38.13  ? 839  TYR C CG    1 
ATOM   7605  C CD1   . TYR E 4 39  ? 67.070  40.646 -24.877 1.00 36.28  ? 839  TYR C CD1   1 
ATOM   7606  C CD2   . TYR E 4 39  ? 68.601  40.058 -26.611 1.00 37.05  ? 839  TYR C CD2   1 
ATOM   7607  C CE1   . TYR E 4 39  ? 66.001  40.331 -25.718 1.00 37.98  ? 839  TYR C CE1   1 
ATOM   7608  C CE2   . TYR E 4 39  ? 67.555  39.741 -27.448 1.00 38.97  ? 839  TYR C CE2   1 
ATOM   7609  C CZ    . TYR E 4 39  ? 66.257  39.877 -27.011 1.00 40.55  ? 839  TYR C CZ    1 
ATOM   7610  O OH    . TYR E 4 39  ? 65.243  39.556 -27.897 1.00 43.24  ? 839  TYR C OH    1 
ATOM   7611  N N     . ALA E 4 40  ? 71.177  40.335 -21.600 1.00 27.68  ? 840  ALA C N     1 
ATOM   7612  C CA    . ALA E 4 40  ? 72.299  40.678 -20.734 1.00 30.36  ? 840  ALA C CA    1 
ATOM   7613  C C     . ALA E 4 40  ? 71.838  40.632 -19.286 1.00 31.87  ? 840  ALA C C     1 
ATOM   7614  O O     . ALA E 4 40  ? 70.633  40.590 -19.013 1.00 31.71  ? 840  ALA C O     1 
ATOM   7615  C CB    . ALA E 4 40  ? 72.810  42.037 -21.072 1.00 18.38  ? 840  ALA C CB    1 
ATOM   7616  N N     . GLU E 4 41  ? 72.774  40.630 -18.347 1.00 46.21  ? 841  GLU C N     1 
ATOM   7617  C CA    . GLU E 4 41  ? 72.367  40.584 -16.953 1.00 49.10  ? 841  GLU C CA    1 
ATOM   7618  C C     . GLU E 4 41  ? 71.550  41.828 -16.594 1.00 47.86  ? 841  GLU C C     1 
ATOM   7619  O O     . GLU E 4 41  ? 70.671  41.783 -15.725 1.00 47.97  ? 841  GLU C O     1 
ATOM   7620  C CB    . GLU E 4 41  ? 73.591  40.486 -16.045 1.00 90.93  ? 841  GLU C CB    1 
ATOM   7621  C CG    . GLU E 4 41  ? 74.339  39.171 -16.148 1.00 99.12  ? 841  GLU C CG    1 
ATOM   7622  C CD    . GLU E 4 41  ? 73.463  37.975 -15.808 1.00 104.04 ? 841  GLU C CD    1 
ATOM   7623  O OE1   . GLU E 4 41  ? 72.821  37.996 -14.740 1.00 104.32 ? 841  GLU C OE1   1 
ATOM   7624  O OE2   . GLU E 4 41  ? 73.419  37.013 -16.604 1.00 106.27 ? 841  GLU C OE2   1 
ATOM   7625  N N     . ARG E 4 42  ? 71.827  42.945 -17.268 1.00 53.03  ? 842  ARG C N     1 
ATOM   7626  C CA    . ARG E 4 42  ? 71.118  44.182 -16.964 1.00 52.54  ? 842  ARG C CA    1 
ATOM   7627  C C     . ARG E 4 42  ? 70.805  45.016 -18.181 1.00 51.06  ? 842  ARG C C     1 
ATOM   7628  O O     . ARG E 4 42  ? 71.402  44.840 -19.241 1.00 49.45  ? 842  ARG C O     1 
ATOM   7629  C CB    . ARG E 4 42  ? 71.947  45.033 -16.010 1.00 54.09  ? 842  ARG C CB    1 
ATOM   7630  C CG    . ARG E 4 42  ? 72.455  44.283 -14.823 1.00 59.51  ? 842  ARG C CG    1 
ATOM   7631  C CD    . ARG E 4 42  ? 73.773  44.871 -14.367 1.00 62.18  ? 842  ARG C CD    1 
ATOM   7632  N NE    . ARG E 4 42  ? 73.678  45.419 -13.024 1.00 69.05  ? 842  ARG C NE    1 
ATOM   7633  C CZ    . ARG E 4 42  ? 74.205  46.581 -12.675 1.00 70.43  ? 842  ARG C CZ    1 
ATOM   7634  N NH1   . ARG E 4 42  ? 74.864  47.311 -13.580 1.00 70.64  ? 842  ARG C NH1   1 
ATOM   7635  N NH2   . ARG E 4 42  ? 74.052  47.014 -11.430 1.00 71.95  ? 842  ARG C NH2   1 
ATOM   7636  N N     . VAL E 4 43  ? 69.867  45.944 -17.999 1.00 48.29  ? 843  VAL C N     1 
ATOM   7637  C CA    . VAL E 4 43  ? 69.481  46.855 -19.060 1.00 47.08  ? 843  VAL C CA    1 
ATOM   7638  C C     . VAL E 4 43  ? 69.371  48.283 -18.566 1.00 47.03  ? 843  VAL C C     1 
ATOM   7639  O O     . VAL E 4 43  ? 68.568  48.570 -17.694 1.00 47.31  ? 843  VAL C O     1 
ATOM   7640  C CB    . VAL E 4 43  ? 68.138  46.483 -19.643 1.00 21.52  ? 843  VAL C CB    1 
ATOM   7641  C CG1   . VAL E 4 43  ? 67.901  47.243 -20.907 1.00 19.14  ? 843  VAL C CG1   1 
ATOM   7642  C CG2   . VAL E 4 43  ? 68.099  45.034 -19.897 1.00 23.62  ? 843  VAL C CG2   1 
ATOM   7643  N N     . GLY E 4 44  ? 70.173  49.182 -19.119 1.00 49.04  ? 844  GLY C N     1 
ATOM   7644  C CA    . GLY E 4 44  ? 70.073  50.579 -18.719 1.00 49.18  ? 844  GLY C CA    1 
ATOM   7645  C C     . GLY E 4 44  ? 68.718  51.174 -19.106 1.00 48.99  ? 844  GLY C C     1 
ATOM   7646  O O     . GLY E 4 44  ? 68.048  50.674 -20.022 1.00 47.59  ? 844  GLY C O     1 
ATOM   7647  N N     . ALA E 4 45  ? 68.300  52.237 -18.422 1.00 63.84  ? 845  ALA C N     1 
ATOM   7648  C CA    . ALA E 4 45  ? 67.008  52.860 -18.713 1.00 62.68  ? 845  ALA C CA    1 
ATOM   7649  C C     . ALA E 4 45  ? 67.062  53.594 -20.039 1.00 59.39  ? 845  ALA C C     1 
ATOM   7650  O O     . ALA E 4 45  ? 66.029  53.820 -20.687 1.00 61.53  ? 845  ALA C O     1 
ATOM   7651  C CB    . ALA E 4 45  ? 66.624  53.822 -17.609 1.00 81.60  ? 845  ALA C CB    1 
ATOM   7652  N N     . GLY E 4 46  ? 68.277  53.961 -20.435 1.00 35.26  ? 846  GLY C N     1 
ATOM   7653  C CA    . GLY E 4 46  ? 68.443  54.670 -21.678 1.00 37.18  ? 846  GLY C CA    1 
ATOM   7654  C C     . GLY E 4 46  ? 68.221  53.762 -22.862 1.00 36.15  ? 846  GLY C C     1 
ATOM   7655  O O     . GLY E 4 46  ? 67.837  54.214 -23.933 1.00 37.46  ? 846  GLY C O     1 
ATOM   7656  N N     . ALA E 4 47  ? 68.435  52.465 -22.651 1.00 34.72  ? 847  ALA C N     1 
ATOM   7657  C CA    . ALA E 4 47  ? 68.323  51.461 -23.696 1.00 34.22  ? 847  ALA C CA    1 
ATOM   7658  C C     . ALA E 4 47  ? 66.965  51.327 -24.318 1.00 32.09  ? 847  ALA C C     1 
ATOM   7659  O O     . ALA E 4 47  ? 66.826  51.410 -25.517 1.00 34.09  ? 847  ALA C O     1 
ATOM   7660  C CB    . ALA E 4 47  ? 68.769  50.120 -23.164 1.00 37.11  ? 847  ALA C CB    1 
ATOM   7661  N N     . PRO E 4 48  ? 65.942  51.107 -23.504 1.00 38.57  ? 848  PRO C N     1 
ATOM   7662  C CA    . PRO E 4 48  ? 64.583  50.952 -24.029 1.00 39.01  ? 848  PRO C CA    1 
ATOM   7663  C C     . PRO E 4 48  ? 64.040  52.233 -24.661 1.00 40.73  ? 848  PRO C C     1 
ATOM   7664  O O     . PRO E 4 48  ? 63.178  52.184 -25.544 1.00 39.44  ? 848  PRO C O     1 
ATOM   7665  C CB    . PRO E 4 48  ? 63.791  50.495 -22.803 1.00 29.43  ? 848  PRO C CB    1 
ATOM   7666  C CG    . PRO E 4 48  ? 64.506  51.165 -21.674 1.00 30.25  ? 848  PRO C CG    1 
ATOM   7667  C CD    . PRO E 4 48  ? 65.968  51.056 -22.031 1.00 29.32  ? 848  PRO C CD    1 
ATOM   7668  N N     . VAL E 4 49  ? 64.562  53.371 -24.211 1.00 30.79  ? 849  VAL C N     1 
ATOM   7669  C CA    . VAL E 4 49  ? 64.165  54.659 -24.741 1.00 30.38  ? 849  VAL C CA    1 
ATOM   7670  C C     . VAL E 4 49  ? 64.673  54.716 -26.166 1.00 29.97  ? 849  VAL C C     1 
ATOM   7671  O O     . VAL E 4 49  ? 63.922  54.958 -27.106 1.00 31.84  ? 849  VAL C O     1 
ATOM   7672  C CB    . VAL E 4 49  ? 64.782  55.802 -23.908 1.00 39.37  ? 849  VAL C CB    1 
ATOM   7673  C CG1   . VAL E 4 49  ? 64.698  57.139 -24.650 1.00 38.93  ? 849  VAL C CG1   1 
ATOM   7674  C CG2   . VAL E 4 49  ? 64.065  55.879 -22.568 1.00 39.76  ? 849  VAL C CG2   1 
ATOM   7675  N N     . TYR E 4 50  ? 65.953  54.461 -26.337 1.00 30.66  ? 850  TYR C N     1 
ATOM   7676  C CA    . TYR E 4 50  ? 66.556  54.481 -27.658 1.00 32.54  ? 850  TYR C CA    1 
ATOM   7677  C C     . TYR E 4 50  ? 65.916  53.447 -28.616 1.00 34.20  ? 850  TYR C C     1 
ATOM   7678  O O     . TYR E 4 50  ? 65.531  53.748 -29.748 1.00 34.99  ? 850  TYR C O     1 
ATOM   7679  C CB    . TYR E 4 50  ? 68.053  54.205 -27.492 1.00 25.49  ? 850  TYR C CB    1 
ATOM   7680  C CG    . TYR E 4 50  ? 68.915  54.663 -28.630 1.00 28.22  ? 850  TYR C CG    1 
ATOM   7681  C CD1   . TYR E 4 50  ? 70.029  55.455 -28.389 1.00 28.10  ? 850  TYR C CD1   1 
ATOM   7682  C CD2   . TYR E 4 50  ? 68.660  54.272 -29.926 1.00 29.19  ? 850  TYR C CD2   1 
ATOM   7683  C CE1   . TYR E 4 50  ? 70.881  55.848 -29.413 1.00 31.98  ? 850  TYR C CE1   1 
ATOM   7684  C CE2   . TYR E 4 50  ? 69.508  54.657 -30.958 1.00 27.36  ? 850  TYR C CE2   1 
ATOM   7685  C CZ    . TYR E 4 50  ? 70.621  55.447 -30.689 1.00 31.42  ? 850  TYR C CZ    1 
ATOM   7686  O OH    . TYR E 4 50  ? 71.472  55.830 -31.685 1.00 30.64  ? 850  TYR C OH    1 
ATOM   7687  N N     . LEU E 4 51  ? 65.810  52.219 -28.152 1.00 40.48  ? 851  LEU C N     1 
ATOM   7688  C CA    . LEU E 4 51  ? 65.260  51.182 -28.974 1.00 39.50  ? 851  LEU C CA    1 
ATOM   7689  C C     . LEU E 4 51  ? 63.790  51.435 -29.335 1.00 40.78  ? 851  LEU C C     1 
ATOM   7690  O O     . LEU E 4 51  ? 63.324  50.971 -30.384 1.00 40.27  ? 851  LEU C O     1 
ATOM   7691  C CB    . LEU E 4 51  ? 65.469  49.811 -28.286 1.00 25.16  ? 851  LEU C CB    1 
ATOM   7692  C CG    . LEU E 4 51  ? 64.770  48.589 -28.889 1.00 23.96  ? 851  LEU C CG    1 
ATOM   7693  C CD1   . LEU E 4 51  ? 65.235  48.355 -30.352 1.00 21.46  ? 851  LEU C CD1   1 
ATOM   7694  C CD2   . LEU E 4 51  ? 65.046  47.403 -27.994 1.00 21.85  ? 851  LEU C CD2   1 
ATOM   7695  N N     . ALA E 4 52  ? 63.044  52.140 -28.490 1.00 38.91  ? 852  ALA C N     1 
ATOM   7696  C CA    . ALA E 4 52  ? 61.659  52.408 -28.863 1.00 38.08  ? 852  ALA C CA    1 
ATOM   7697  C C     . ALA E 4 52  ? 61.651  53.556 -29.892 1.00 36.58  ? 852  ALA C C     1 
ATOM   7698  O O     . ALA E 4 52  ? 60.773  53.655 -30.768 1.00 35.90  ? 852  ALA C O     1 
ATOM   7699  C CB    . ALA E 4 52  ? 60.838  52.781 -27.662 1.00 20.70  ? 852  ALA C CB    1 
ATOM   7700  N N     . ALA E 4 53  ? 62.644  54.429 -29.800 1.00 38.33  ? 853  ALA C N     1 
ATOM   7701  C CA    . ALA E 4 53  ? 62.716  55.522 -30.736 1.00 37.89  ? 853  ALA C CA    1 
ATOM   7702  C C     . ALA E 4 53  ? 63.027  54.955 -32.104 1.00 38.10  ? 853  ALA C C     1 
ATOM   7703  O O     . ALA E 4 53  ? 62.401  55.307 -33.089 1.00 36.27  ? 853  ALA C O     1 
ATOM   7704  C CB    . ALA E 4 53  ? 63.782  56.455 -30.326 1.00 33.57  ? 853  ALA C CB    1 
ATOM   7705  N N     . VAL E 4 54  ? 64.014  54.074 -32.162 1.00 27.80  ? 854  VAL C N     1 
ATOM   7706  C CA    . VAL E 4 54  ? 64.415  53.462 -33.423 1.00 28.76  ? 854  VAL C CA    1 
ATOM   7707  C C     . VAL E 4 54  ? 63.285  52.608 -34.000 1.00 30.13  ? 854  VAL C C     1 
ATOM   7708  O O     . VAL E 4 54  ? 63.083  52.601 -35.201 1.00 29.91  ? 854  VAL C O     1 
ATOM   7709  C CB    . VAL E 4 54  ? 65.725  52.636 -33.208 1.00 29.12  ? 854  VAL C CB    1 
ATOM   7710  C CG1   . VAL E 4 54  ? 66.042  51.750 -34.398 1.00 29.86  ? 854  VAL C CG1   1 
ATOM   7711  C CG2   . VAL E 4 54  ? 66.868  53.586 -32.944 1.00 27.42  ? 854  VAL C CG2   1 
ATOM   7712  N N     . LEU E 4 55  ? 62.533  51.917 -33.147 1.00 32.12  ? 855  LEU C N     1 
ATOM   7713  C CA    . LEU E 4 55  ? 61.434  51.090 -33.632 1.00 32.97  ? 855  LEU C CA    1 
ATOM   7714  C C     . LEU E 4 55  ? 60.366  51.969 -34.227 1.00 35.32  ? 855  LEU C C     1 
ATOM   7715  O O     . LEU E 4 55  ? 59.883  51.713 -35.340 1.00 33.52  ? 855  LEU C O     1 
ATOM   7716  C CB    . LEU E 4 55  ? 60.822  50.236 -32.520 1.00 28.44  ? 855  LEU C CB    1 
ATOM   7717  C CG    . LEU E 4 55  ? 61.721  49.069 -32.069 1.00 26.23  ? 855  LEU C CG    1 
ATOM   7718  C CD1   . LEU E 4 55  ? 61.128  48.437 -30.795 1.00 27.94  ? 855  LEU C CD1   1 
ATOM   7719  C CD2   . LEU E 4 55  ? 61.887  48.026 -33.200 1.00 27.34  ? 855  LEU C CD2   1 
ATOM   7720  N N     . GLU E 4 56  ? 60.018  53.021 -33.492 1.00 49.00  ? 856  GLU C N     1 
ATOM   7721  C CA    . GLU E 4 56  ? 59.004  53.970 -33.929 1.00 49.58  ? 856  GLU C CA    1 
ATOM   7722  C C     . GLU E 4 56  ? 59.386  54.701 -35.230 1.00 46.82  ? 856  GLU C C     1 
ATOM   7723  O O     . GLU E 4 56  ? 58.532  54.984 -36.079 1.00 47.81  ? 856  GLU C O     1 
ATOM   7724  C CB    . GLU E 4 56  ? 58.767  54.986 -32.814 1.00 49.65  ? 856  GLU C CB    1 
ATOM   7725  C CG    . GLU E 4 56  ? 57.717  56.035 -33.111 1.00 50.23  ? 856  GLU C CG    1 
ATOM   7726  C CD    . GLU E 4 56  ? 57.515  57.001 -31.940 1.00 54.43  ? 856  GLU C CD    1 
ATOM   7727  O OE1   . GLU E 4 56  ? 57.365  56.524 -30.781 1.00 53.49  ? 856  GLU C OE1   1 
ATOM   7728  O OE2   . GLU E 4 56  ? 57.495  58.238 -32.178 1.00 48.98  ? 856  GLU C OE2   1 
ATOM   7729  N N     . TYR E 4 57  ? 60.672  55.003 -35.390 1.00 33.63  ? 857  TYR C N     1 
ATOM   7730  C CA    . TYR E 4 57  ? 61.121  55.738 -36.560 1.00 33.92  ? 857  TYR C CA    1 
ATOM   7731  C C     . TYR E 4 57  ? 60.952  54.859 -37.728 1.00 35.38  ? 857  TYR C C     1 
ATOM   7732  O O     . TYR E 4 57  ? 60.499  55.330 -38.778 1.00 34.40  ? 857  TYR C O     1 
ATOM   7733  C CB    . TYR E 4 57  ? 62.579  56.146 -36.440 1.00 40.55  ? 857  TYR C CB    1 
ATOM   7734  C CG    . TYR E 4 57  ? 63.246  56.385 -37.770 1.00 42.12  ? 857  TYR C CG    1 
ATOM   7735  C CD1   . TYR E 4 57  ? 62.712  57.269 -38.694 1.00 47.09  ? 857  TYR C CD1   1 
ATOM   7736  C CD2   . TYR E 4 57  ? 64.404  55.700 -38.116 1.00 45.61  ? 857  TYR C CD2   1 
ATOM   7737  C CE1   . TYR E 4 57  ? 63.316  57.458 -39.936 1.00 47.28  ? 857  TYR C CE1   1 
ATOM   7738  C CE2   . TYR E 4 57  ? 65.007  55.875 -39.333 1.00 45.74  ? 857  TYR C CE2   1 
ATOM   7739  C CZ    . TYR E 4 57  ? 64.462  56.750 -40.245 1.00 47.76  ? 857  TYR C CZ    1 
ATOM   7740  O OH    . TYR E 4 57  ? 65.048  56.890 -41.490 1.00 49.32  ? 857  TYR C OH    1 
ATOM   7741  N N     . LEU E 4 58  ? 61.303  53.580 -37.537 1.00 25.52  ? 858  LEU C N     1 
ATOM   7742  C CA    . LEU E 4 58  ? 61.199  52.584 -38.611 1.00 26.99  ? 858  LEU C CA    1 
ATOM   7743  C C     . LEU E 4 58  ? 59.784  52.293 -39.049 1.00 24.88  ? 858  LEU C C     1 
ATOM   7744  O O     . LEU E 4 58  ? 59.541  52.183 -40.252 1.00 28.50  ? 858  LEU C O     1 
ATOM   7745  C CB    . LEU E 4 58  ? 61.885  51.266 -38.247 1.00 22.09  ? 858  LEU C CB    1 
ATOM   7746  C CG    . LEU E 4 58  ? 63.395  51.403 -38.328 1.00 23.25  ? 858  LEU C CG    1 
ATOM   7747  C CD1   . LEU E 4 58  ? 64.071  50.129 -37.841 1.00 23.73  ? 858  LEU C CD1   1 
ATOM   7748  C CD2   . LEU E 4 58  ? 63.757  51.820 -39.765 1.00 23.38  ? 858  LEU C CD2   1 
ATOM   7749  N N     . THR E 4 59  ? 58.848  52.193 -38.107 1.00 26.83  ? 859  THR C N     1 
ATOM   7750  C CA    . THR E 4 59  ? 57.496  51.925 -38.544 1.00 30.14  ? 859  THR C CA    1 
ATOM   7751  C C     . THR E 4 59  ? 56.913  53.178 -39.228 1.00 30.28  ? 859  THR C C     1 
ATOM   7752  O O     . THR E 4 59  ? 56.048  53.085 -40.113 1.00 31.45  ? 859  THR C O     1 
ATOM   7753  C CB    . THR E 4 59  ? 56.583  51.420 -37.408 1.00 23.58  ? 859  THR C CB    1 
ATOM   7754  O OG1   . THR E 4 59  ? 55.807  52.498 -36.921 1.00 37.03  ? 859  THR C OG1   1 
ATOM   7755  C CG2   . THR E 4 59  ? 57.372  50.825 -36.278 1.00 16.17  ? 859  THR C CG2   1 
ATOM   7756  N N     . ALA E 4 60  ? 57.422  54.346 -38.871 1.00 31.87  ? 860  ALA C N     1 
ATOM   7757  C CA    . ALA E 4 60  ? 56.937  55.579 -39.511 1.00 31.09  ? 860  ALA C CA    1 
ATOM   7758  C C     . ALA E 4 60  ? 57.340  55.628 -40.995 1.00 29.60  ? 860  ALA C C     1 
ATOM   7759  O O     . ALA E 4 60  ? 56.530  55.945 -41.863 1.00 29.75  ? 860  ALA C O     1 
ATOM   7760  C CB    . ALA E 4 60  ? 57.486  56.800 -38.787 1.00 33.38  ? 860  ALA C CB    1 
ATOM   7761  N N     . GLU E 4 61  ? 58.599  55.304 -41.257 1.00 24.81  ? 861  GLU C N     1 
ATOM   7762  C CA    . GLU E 4 61  ? 59.191  55.297 -42.585 1.00 27.04  ? 861  GLU C CA    1 
ATOM   7763  C C     . GLU E 4 61  ? 58.445  54.323 -43.524 1.00 27.43  ? 861  GLU C C     1 
ATOM   7764  O O     . GLU E 4 61  ? 58.095  54.666 -44.660 1.00 23.22  ? 861  GLU C O     1 
ATOM   7765  C CB    . GLU E 4 61  ? 60.652  54.878 -42.422 1.00 42.34  ? 861  GLU C CB    1 
ATOM   7766  C CG    . GLU E 4 61  ? 61.482  54.989 -43.628 1.00 50.94  ? 861  GLU C CG    1 
ATOM   7767  C CD    . GLU E 4 61  ? 61.646  56.417 -44.077 1.00 58.07  ? 861  GLU C CD    1 
ATOM   7768  O OE1   . GLU E 4 61  ? 62.013  57.257 -43.223 1.00 63.31  ? 861  GLU C OE1   1 
ATOM   7769  O OE2   . GLU E 4 61  ? 61.422  56.698 -45.282 1.00 61.52  ? 861  GLU C OE2   1 
ATOM   7770  N N     . ILE E 4 62  ? 58.217  53.097 -43.053 1.00 33.03  ? 862  ILE C N     1 
ATOM   7771  C CA    . ILE E 4 62  ? 57.521  52.126 -43.875 1.00 31.77  ? 862  ILE C CA    1 
ATOM   7772  C C     . ILE E 4 62  ? 56.051  52.548 -44.057 1.00 30.02  ? 862  ILE C C     1 
ATOM   7773  O O     . ILE E 4 62  ? 55.492  52.349 -45.143 1.00 30.89  ? 862  ILE C O     1 
ATOM   7774  C CB    . ILE E 4 62  ? 57.626  50.689 -43.277 1.00 50.51  ? 862  ILE C CB    1 
ATOM   7775  C CG1   . ILE E 4 62  ? 57.262  49.648 -44.311 1.00 53.15  ? 862  ILE C CG1   1 
ATOM   7776  C CG2   . ILE E 4 62  ? 56.629  50.480 -42.186 1.00 51.51  ? 862  ILE C CG2   1 
ATOM   7777  C CD1   . ILE E 4 62  ? 57.594  48.265 -43.850 1.00 58.47  ? 862  ILE C CD1   1 
ATOM   7778  N N     . LEU E 4 63  ? 55.438  53.155 -43.024 1.00 34.02  ? 863  LEU C N     1 
ATOM   7779  C CA    . LEU E 4 63  ? 54.044  53.595 -43.142 1.00 36.56  ? 863  LEU C CA    1 
ATOM   7780  C C     . LEU E 4 63  ? 53.893  54.828 -44.040 1.00 37.40  ? 863  LEU C C     1 
ATOM   7781  O O     . LEU E 4 63  ? 52.848  55.023 -44.705 1.00 37.50  ? 863  LEU C O     1 
ATOM   7782  C CB    . LEU E 4 63  ? 53.439  53.866 -41.787 1.00 18.09  ? 863  LEU C CB    1 
ATOM   7783  C CG    . LEU E 4 63  ? 53.016  52.637 -40.969 1.00 19.20  ? 863  LEU C CG    1 
ATOM   7784  C CD1   . LEU E 4 63  ? 52.425  53.122 -39.691 1.00 18.81  ? 863  LEU C CD1   1 
ATOM   7785  C CD2   . LEU E 4 63  ? 51.998  51.787 -41.700 1.00 21.13  ? 863  LEU C CD2   1 
ATOM   7786  N N     . GLU E 4 64  ? 54.933  55.662 -44.067 1.00 35.00  ? 864  GLU C N     1 
ATOM   7787  C CA    . GLU E 4 64  ? 54.919  56.811 -44.946 1.00 35.57  ? 864  GLU C CA    1 
ATOM   7788  C C     . GLU E 4 64  ? 54.878  56.256 -46.367 1.00 36.21  ? 864  GLU C C     1 
ATOM   7789  O O     . GLU E 4 64  ? 54.033  56.625 -47.147 1.00 33.13  ? 864  GLU C O     1 
ATOM   7790  C CB    . GLU E 4 64  ? 56.165  57.656 -44.765 1.00 36.40  ? 864  GLU C CB    1 
ATOM   7791  C CG    . GLU E 4 64  ? 56.304  58.748 -45.818 1.00 43.71  ? 864  GLU C CG    1 
ATOM   7792  C CD    . GLU E 4 64  ? 55.217  59.830 -45.742 1.00 45.50  ? 864  GLU C CD    1 
ATOM   7793  O OE1   . GLU E 4 64  ? 55.176  60.726 -46.612 1.00 53.11  ? 864  GLU C OE1   1 
ATOM   7794  O OE2   . GLU E 4 64  ? 54.407  59.785 -44.804 1.00 49.18  ? 864  GLU C OE2   1 
ATOM   7795  N N     . LEU E 4 65  ? 55.773  55.331 -46.683 1.00 36.58  ? 865  LEU C N     1 
ATOM   7796  C CA    . LEU E 4 65  ? 55.835  54.729 -48.021 1.00 38.81  ? 865  LEU C CA    1 
ATOM   7797  C C     . LEU E 4 65  ? 54.676  53.820 -48.422 1.00 34.61  ? 865  LEU C C     1 
ATOM   7798  O O     . LEU E 4 65  ? 54.349  53.743 -49.612 1.00 36.11  ? 865  LEU C O     1 
ATOM   7799  C CB    . LEU E 4 65  ? 57.150  53.973 -48.187 1.00 28.43  ? 865  LEU C CB    1 
ATOM   7800  C CG    . LEU E 4 65  ? 58.359  54.880 -48.031 1.00 30.21  ? 865  LEU C CG    1 
ATOM   7801  C CD1   . LEU E 4 65  ? 59.669  54.144 -48.298 1.00 25.14  ? 865  LEU C CD1   1 
ATOM   7802  C CD2   . LEU E 4 65  ? 58.154  55.982 -48.986 1.00 32.62  ? 865  LEU C CD2   1 
ATOM   7803  N N     . ALA E 4 66  ? 54.076  53.124 -47.451 1.00 24.96  ? 866  ALA C N     1 
ATOM   7804  C CA    . ALA E 4 66  ? 52.920  52.253 -47.732 1.00 28.72  ? 866  ALA C CA    1 
ATOM   7805  C C     . ALA E 4 66  ? 51.778  53.194 -47.982 1.00 26.87  ? 866  ALA C C     1 
ATOM   7806  O O     . ALA E 4 66  ? 51.022  53.061 -48.948 1.00 27.67  ? 866  ALA C O     1 
ATOM   7807  C CB    . ALA E 4 66  ? 52.587  51.384 -46.550 1.00 23.37  ? 866  ALA C CB    1 
ATOM   7808  N N     . GLY E 4 67  ? 51.652  54.165 -47.100 1.00 31.37  ? 867  GLY C N     1 
ATOM   7809  C CA    . GLY E 4 67  ? 50.608  55.123 -47.312 1.00 27.47  ? 867  GLY C CA    1 
ATOM   7810  C C     . GLY E 4 67  ? 50.622  55.645 -48.743 1.00 28.29  ? 867  GLY C C     1 
ATOM   7811  O O     . GLY E 4 67  ? 49.572  55.685 -49.393 1.00 28.14  ? 867  GLY C O     1 
ATOM   7812  N N     . ASN E 4 68  ? 51.782  56.031 -49.272 1.00 26.81  ? 868  ASN C N     1 
ATOM   7813  C CA    . ASN E 4 68  ? 51.797  56.563 -50.650 1.00 27.75  ? 868  ASN C CA    1 
ATOM   7814  C C     . ASN E 4 68  ? 51.402  55.506 -51.681 1.00 31.85  ? 868  ASN C C     1 
ATOM   7815  O O     . ASN E 4 68  ? 50.748  55.803 -52.671 1.00 31.68  ? 868  ASN C O     1 
ATOM   7816  C CB    . ASN E 4 68  ? 53.173  57.125 -51.059 1.00 37.40  ? 868  ASN C CB    1 
ATOM   7817  C CG    . ASN E 4 68  ? 53.673  58.218 -50.149 1.00 39.17  ? 868  ASN C CG    1 
ATOM   7818  O OD1   . ASN E 4 68  ? 52.911  59.030 -49.621 1.00 40.02  ? 868  ASN C OD1   1 
ATOM   7819  N ND2   . ASN E 4 68  ? 54.978  58.255 -49.974 1.00 39.94  ? 868  ASN C ND2   1 
ATOM   7820  N N     . ALA E 4 69  ? 51.819  54.271 -51.444 1.00 27.41  ? 869  ALA C N     1 
ATOM   7821  C CA    . ALA E 4 69  ? 51.519  53.204 -52.363 1.00 30.37  ? 869  ALA C CA    1 
ATOM   7822  C C     . ALA E 4 69  ? 50.018  53.042 -52.476 1.00 30.80  ? 869  ALA C C     1 
ATOM   7823  O O     . ALA E 4 69  ? 49.501  52.829 -53.565 1.00 31.67  ? 869  ALA C O     1 
ATOM   7824  C CB    . ALA E 4 69  ? 52.166  51.920 -51.890 1.00 23.63  ? 869  ALA C CB    1 
ATOM   7825  N N     . ALA E 4 70  ? 49.318  53.150 -51.351 1.00 31.09  ? 870  ALA C N     1 
ATOM   7826  C CA    . ALA E 4 70  ? 47.865  53.015 -51.361 1.00 33.57  ? 870  ALA C CA    1 
ATOM   7827  C C     . ALA E 4 70  ? 47.271  54.152 -52.151 1.00 34.71  ? 870  ALA C C     1 
ATOM   7828  O O     . ALA E 4 70  ? 46.381  53.952 -52.955 1.00 33.93  ? 870  ALA C O     1 
ATOM   7829  C CB    . ALA E 4 70  ? 47.324  53.042 -49.961 1.00 19.53  ? 870  ALA C CB    1 
ATOM   7830  N N     . ARG E 4 71  ? 47.757  55.359 -51.914 1.00 40.43  ? 871  ARG C N     1 
ATOM   7831  C CA    . ARG E 4 71  ? 47.247  56.494 -52.649 1.00 42.41  ? 871  ARG C CA    1 
ATOM   7832  C C     . ARG E 4 71  ? 47.454  56.257 -54.137 1.00 40.26  ? 871  ARG C C     1 
ATOM   7833  O O     . ARG E 4 71  ? 46.529  56.428 -54.924 1.00 38.25  ? 871  ARG C O     1 
ATOM   7834  C CB    . ARG E 4 71  ? 47.953  57.777 -52.219 1.00 56.93  ? 871  ARG C CB    1 
ATOM   7835  C CG    . ARG E 4 71  ? 47.614  58.981 -53.065 1.00 67.89  ? 871  ARG C CG    1 
ATOM   7836  C CD    . ARG E 4 71  ? 47.947  60.270 -52.368 1.00 74.85  ? 871  ARG C CD    1 
ATOM   7837  N NE    . ARG E 4 71  ? 47.088  60.470 -51.203 1.00 83.45  ? 871  ARG C NE    1 
ATOM   7838  C CZ    . ARG E 4 71  ? 47.054  61.584 -50.475 1.00 87.36  ? 871  ARG C CZ    1 
ATOM   7839  N NH1   . ARG E 4 71  ? 47.835  62.613 -50.793 1.00 88.51  ? 871  ARG C NH1   1 
ATOM   7840  N NH2   . ARG E 4 71  ? 46.238  61.668 -49.427 1.00 90.45  ? 871  ARG C NH2   1 
ATOM   7841  N N     . ASP E 4 72  ? 48.657  55.848 -54.528 1.00 32.70  ? 872  ASP C N     1 
ATOM   7842  C CA    . ASP E 4 72  ? 48.941  55.601 -55.933 1.00 34.38  ? 872  ASP C CA    1 
ATOM   7843  C C     . ASP E 4 72  ? 48.015  54.562 -56.546 1.00 36.81  ? 872  ASP C C     1 
ATOM   7844  O O     . ASP E 4 72  ? 47.899  54.495 -57.747 1.00 37.08  ? 872  ASP C O     1 
ATOM   7845  C CB    . ASP E 4 72  ? 50.395  55.162 -56.140 1.00 57.95  ? 872  ASP C CB    1 
ATOM   7846  C CG    . ASP E 4 72  ? 51.389  56.246 -55.785 1.00 59.36  ? 872  ASP C CG    1 
ATOM   7847  O OD1   . ASP E 4 72  ? 51.019  57.433 -55.813 1.00 57.60  ? 872  ASP C OD1   1 
ATOM   7848  O OD2   . ASP E 4 72  ? 52.551  55.922 -55.488 1.00 62.53  ? 872  ASP C OD2   1 
ATOM   7849  N N     . ASN E 4 73  ? 47.356  53.757 -55.731 1.00 42.16  ? 873  ASN C N     1 
ATOM   7850  C CA    . ASN E 4 73  ? 46.457  52.734 -56.249 1.00 44.74  ? 873  ASN C CA    1 
ATOM   7851  C C     . ASN E 4 73  ? 45.023  53.118 -55.915 1.00 44.89  ? 873  ASN C C     1 
ATOM   7852  O O     . ASN E 4 73  ? 44.129  52.262 -55.815 1.00 43.22  ? 873  ASN C O     1 
ATOM   7853  C CB    . ASN E 4 73  ? 46.798  51.364 -55.652 1.00 70.82  ? 873  ASN C CB    1 
ATOM   7854  C CG    . ASN E 4 73  ? 48.175  50.871 -56.071 1.00 75.52  ? 873  ASN C CG    1 
ATOM   7855  O OD1   . ASN E 4 73  ? 48.398  50.539 -57.231 1.00 79.47  ? 873  ASN C OD1   1 
ATOM   7856  N ND2   . ASN E 4 73  ? 49.107  50.834 -55.130 1.00 74.83  ? 873  ASN C ND2   1 
ATOM   7857  N N     . LYS E 4 74  ? 44.820  54.418 -55.735 1.00 39.21  ? 874  LYS C N     1 
ATOM   7858  C CA    . LYS E 4 74  ? 43.511  54.957 -55.433 1.00 40.76  ? 874  LYS C CA    1 
ATOM   7859  C C     . LYS E 4 74  ? 42.847  54.308 -54.228 1.00 40.13  ? 874  LYS C C     1 
ATOM   7860  O O     . LYS E 4 74  ? 41.622  54.262 -54.157 1.00 41.01  ? 874  LYS C O     1 
ATOM   7861  C CB    . LYS E 4 74  ? 42.630  54.829 -56.668 1.00 93.26  ? 874  LYS C CB    1 
ATOM   7862  C CG    . LYS E 4 74  ? 43.258  55.504 -57.876 1.00 98.84  ? 874  LYS C CG    1 
ATOM   7863  C CD    . LYS E 4 74  ? 42.425  55.371 -59.143 1.00 103.28 ? 874  LYS C CD    1 
ATOM   7864  C CE    . LYS E 4 74  ? 43.152  55.990 -60.336 1.00 106.20 ? 874  LYS C CE    1 
ATOM   7865  N NZ    . LYS E 4 74  ? 42.361  55.855 -61.585 1.00 107.97 ? 874  LYS C NZ    1 
ATOM   7866  N N     . LYS E 4 75  ? 43.652  53.836 -53.271 1.00 49.40  ? 875  LYS C N     1 
ATOM   7867  C CA    . LYS E 4 75  ? 43.146  53.179 -52.060 1.00 46.47  ? 875  LYS C CA    1 
ATOM   7868  C C     . LYS E 4 75  ? 43.328  54.028 -50.826 1.00 45.05  ? 875  LYS C C     1 
ATOM   7869  O O     . LYS E 4 75  ? 44.222  54.884 -50.781 1.00 44.44  ? 875  LYS C O     1 
ATOM   7870  C CB    . LYS E 4 75  ? 43.866  51.862 -51.820 1.00 51.05  ? 875  LYS C CB    1 
ATOM   7871  C CG    . LYS E 4 75  ? 43.690  50.885 -52.905 1.00 53.20  ? 875  LYS C CG    1 
ATOM   7872  C CD    . LYS E 4 75  ? 42.276  50.415 -52.983 1.00 57.43  ? 875  LYS C CD    1 
ATOM   7873  C CE    . LYS E 4 75  ? 42.145  49.475 -54.149 1.00 61.94  ? 875  LYS C CE    1 
ATOM   7874  N NZ    . LYS E 4 75  ? 42.534  50.202 -55.389 1.00 65.08  ? 875  LYS C NZ    1 
ATOM   7875  N N     . THR E 4 76  ? 42.516  53.736 -49.809 1.00 41.42  ? 876  THR C N     1 
ATOM   7876  C CA    . THR E 4 76  ? 42.511  54.469 -48.541 1.00 44.01  ? 876  THR C CA    1 
ATOM   7877  C C     . THR E 4 76  ? 42.985  53.644 -47.368 1.00 41.86  ? 876  THR C C     1 
ATOM   7878  O O     . THR E 4 76  ? 43.493  54.179 -46.383 1.00 40.91  ? 876  THR C O     1 
ATOM   7879  C CB    . THR E 4 76  ? 41.084  55.004 -48.262 1.00 36.15  ? 876  THR C CB    1 
ATOM   7880  O OG1   . THR E 4 76  ? 40.989  56.309 -48.819 1.00 42.60  ? 876  THR C OG1   1 
ATOM   7881  C CG2   . THR E 4 76  ? 40.740  55.042 -46.760 1.00 40.01  ? 876  THR C CG2   1 
ATOM   7882  N N     . ARG E 4 77  ? 42.786  52.335 -47.464 1.00 49.19  ? 877  ARG C N     1 
ATOM   7883  C CA    . ARG E 4 77  ? 43.210  51.417 -46.423 1.00 49.23  ? 877  ARG C CA    1 
ATOM   7884  C C     . ARG E 4 77  ? 44.425  50.680 -46.941 1.00 47.00  ? 877  ARG C C     1 
ATOM   7885  O O     . ARG E 4 77  ? 44.385  50.092 -48.012 1.00 42.85  ? 877  ARG C O     1 
ATOM   7886  C CB    . ARG E 4 77  ? 42.110  50.424 -46.141 1.00 50.02  ? 877  ARG C CB    1 
ATOM   7887  C CG    . ARG E 4 77  ? 42.457  49.391 -45.114 1.00 54.43  ? 877  ARG C CG    1 
ATOM   7888  C CD    . ARG E 4 77  ? 41.345  48.372 -45.007 1.00 55.17  ? 877  ARG C CD    1 
ATOM   7889  N NE    . ARG E 4 77  ? 40.049  49.026 -44.864 1.00 55.92  ? 877  ARG C NE    1 
ATOM   7890  C CZ    . ARG E 4 77  ? 38.951  48.646 -45.509 1.00 58.48  ? 877  ARG C CZ    1 
ATOM   7891  N NH1   . ARG E 4 77  ? 39.000  47.609 -46.340 1.00 57.69  ? 877  ARG C NH1   1 
ATOM   7892  N NH2   . ARG E 4 77  ? 37.814  49.312 -45.337 1.00 59.29  ? 877  ARG C NH2   1 
ATOM   7893  N N     . ILE E 4 78  ? 45.514  50.742 -46.197 1.00 36.36  ? 878  ILE C N     1 
ATOM   7894  C CA    . ILE E 4 78  ? 46.743  50.056 -46.575 1.00 34.32  ? 878  ILE C CA    1 
ATOM   7895  C C     . ILE E 4 78  ? 46.559  48.528 -46.473 1.00 32.55  ? 878  ILE C C     1 
ATOM   7896  O O     . ILE E 4 78  ? 45.918  48.041 -45.535 1.00 30.96  ? 878  ILE C O     1 
ATOM   7897  C CB    . ILE E 4 78  ? 47.908  50.492 -45.622 1.00 23.25  ? 878  ILE C CB    1 
ATOM   7898  C CG1   . ILE E 4 78  ? 48.507  51.805 -46.111 1.00 22.85  ? 878  ILE C CG1   1 
ATOM   7899  C CG2   . ILE E 4 78  ? 48.962  49.415 -45.510 1.00 22.32  ? 878  ILE C CG2   1 
ATOM   7900  C CD1   . ILE E 4 78  ? 49.437  52.426 -45.144 1.00 18.51  ? 878  ILE C CD1   1 
ATOM   7901  N N     . ILE E 4 79  ? 47.090  47.777 -47.441 1.00 33.35  ? 879  ILE C N     1 
ATOM   7902  C CA    . ILE E 4 79  ? 47.019  46.317 -47.364 1.00 34.48  ? 879  ILE C CA    1 
ATOM   7903  C C     . ILE E 4 79  ? 48.428  45.800 -47.586 1.00 35.72  ? 879  ILE C C     1 
ATOM   7904  O O     . ILE E 4 79  ? 49.289  46.567 -47.975 1.00 32.65  ? 879  ILE C O     1 
ATOM   7905  C CB    . ILE E 4 79  ? 46.056  45.723 -48.408 1.00 24.93  ? 879  ILE C CB    1 
ATOM   7906  C CG1   . ILE E 4 79  ? 46.539  46.022 -49.834 1.00 24.97  ? 879  ILE C CG1   1 
ATOM   7907  C CG2   . ILE E 4 79  ? 44.637  46.255 -48.158 1.00 26.24  ? 879  ILE C CG2   1 
ATOM   7908  C CD1   . ILE E 4 79  ? 45.600  45.441 -50.903 1.00 23.21  ? 879  ILE C CD1   1 
ATOM   7909  N N     . PRO E 4 80  ? 48.696  44.510 -47.318 1.00 34.09  ? 880  PRO C N     1 
ATOM   7910  C CA    . PRO E 4 80  ? 50.021  43.898 -47.494 1.00 30.01  ? 880  PRO C CA    1 
ATOM   7911  C C     . PRO E 4 80  ? 50.722  44.268 -48.774 1.00 27.97  ? 880  PRO C C     1 
ATOM   7912  O O     . PRO E 4 80  ? 51.866  44.663 -48.733 1.00 29.99  ? 880  PRO C O     1 
ATOM   7913  C CB    . PRO E 4 80  ? 49.722  42.414 -47.410 1.00 23.85  ? 880  PRO C CB    1 
ATOM   7914  C CG    . PRO E 4 80  ? 48.724  42.382 -46.325 1.00 23.32  ? 880  PRO C CG    1 
ATOM   7915  C CD    . PRO E 4 80  ? 47.768  43.518 -46.760 1.00 23.02  ? 880  PRO C CD    1 
ATOM   7916  N N     . ARG E 4 81  ? 50.048  44.159 -49.917 1.00 32.96  ? 881  ARG C N     1 
ATOM   7917  C CA    . ARG E 4 81  ? 50.694  44.525 -51.168 1.00 36.34  ? 881  ARG C CA    1 
ATOM   7918  C C     . ARG E 4 81  ? 51.319  45.910 -51.095 1.00 35.82  ? 881  ARG C C     1 
ATOM   7919  O O     . ARG E 4 81  ? 52.409  46.114 -51.610 1.00 35.64  ? 881  ARG C O     1 
ATOM   7920  C CB    . ARG E 4 81  ? 49.712  44.497 -52.342 1.00 24.94  ? 881  ARG C CB    1 
ATOM   7921  C CG    . ARG E 4 81  ? 50.001  45.584 -53.332 1.00 29.10  ? 881  ARG C CG    1 
ATOM   7922  C CD    . ARG E 4 81  ? 50.189  45.140 -54.766 1.00 34.75  ? 881  ARG C CD    1 
ATOM   7923  N NE    . ARG E 4 81  ? 51.242  44.145 -54.953 1.00 36.63  ? 881  ARG C NE    1 
ATOM   7924  C CZ    . ARG E 4 81  ? 52.007  44.031 -56.045 1.00 34.33  ? 881  ARG C CZ    1 
ATOM   7925  N NH1   . ARG E 4 81  ? 51.865  44.858 -57.078 1.00 31.78  ? 881  ARG C NH1   1 
ATOM   7926  N NH2   . ARG E 4 81  ? 52.910  43.068 -56.115 1.00 30.54  ? 881  ARG C NH2   1 
ATOM   7927  N N     . HIS E 4 82  ? 50.624  46.878 -50.494 1.00 49.28  ? 882  HIS C N     1 
ATOM   7928  C CA    . HIS E 4 82  ? 51.175  48.239 -50.406 1.00 49.85  ? 882  HIS C CA    1 
ATOM   7929  C C     . HIS E 4 82  ? 52.489  48.181 -49.638 1.00 51.90  ? 882  HIS C C     1 
ATOM   7930  O O     . HIS E 4 82  ? 53.496  48.751 -50.063 1.00 49.68  ? 882  HIS C O     1 
ATOM   7931  C CB    . HIS E 4 82  ? 50.207  49.203 -49.702 1.00 27.00  ? 882  HIS C CB    1 
ATOM   7932  C CG    . HIS E 4 82  ? 48.898  49.389 -50.412 1.00 27.17  ? 882  HIS C CG    1 
ATOM   7933  N ND1   . HIS E 4 82  ? 47.686  49.433 -49.748 1.00 28.65  ? 882  HIS C ND1   1 
ATOM   7934  C CD2   . HIS E 4 82  ? 48.604  49.465 -51.729 1.00 27.25  ? 882  HIS C CD2   1 
ATOM   7935  C CE1   . HIS E 4 82  ? 46.706  49.516 -50.630 1.00 27.37  ? 882  HIS C CE1   1 
ATOM   7936  N NE2   . HIS E 4 82  ? 47.238  49.537 -51.839 1.00 30.15  ? 882  HIS C NE2   1 
ATOM   7937  N N     . LEU E 4 83  ? 52.468  47.483 -48.504 1.00 22.12  ? 883  LEU C N     1 
ATOM   7938  C CA    . LEU E 4 83  ? 53.651  47.322 -47.682 1.00 22.48  ? 883  LEU C CA    1 
ATOM   7939  C C     . LEU E 4 83  ? 54.746  46.752 -48.564 1.00 24.38  ? 883  LEU C C     1 
ATOM   7940  O O     . LEU E 4 83  ? 55.852  47.281 -48.587 1.00 23.13  ? 883  LEU C O     1 
ATOM   7941  C CB    . LEU E 4 83  ? 53.361  46.376 -46.528 1.00 16.30  ? 883  LEU C CB    1 
ATOM   7942  C CG    . LEU E 4 83  ? 52.547  46.921 -45.368 1.00 20.57  ? 883  LEU C CG    1 
ATOM   7943  C CD1   . LEU E 4 83  ? 52.218  45.861 -44.303 1.00 17.21  ? 883  LEU C CD1   1 
ATOM   7944  C CD2   . LEU E 4 83  ? 53.356  48.022 -44.754 1.00 16.57  ? 883  LEU C CD2   1 
ATOM   7945  N N     . GLN E 4 84  ? 54.433  45.683 -49.299 1.00 19.75  ? 884  GLN C N     1 
ATOM   7946  C CA    . GLN E 4 84  ? 55.404  45.052 -50.183 1.00 20.47  ? 884  GLN C CA    1 
ATOM   7947  C C     . GLN E 4 84  ? 55.974  46.055 -51.217 1.00 19.95  ? 884  GLN C C     1 
ATOM   7948  O O     . GLN E 4 84  ? 57.188  46.143 -51.382 1.00 20.54  ? 884  GLN C O     1 
ATOM   7949  C CB    . GLN E 4 84  ? 54.772  43.856 -50.871 1.00 30.51  ? 884  GLN C CB    1 
ATOM   7950  C CG    . GLN E 4 84  ? 55.574  43.379 -52.060 1.00 30.39  ? 884  GLN C CG    1 
ATOM   7951  C CD    . GLN E 4 84  ? 56.793  42.538 -51.705 1.00 31.20  ? 884  GLN C CD    1 
ATOM   7952  O OE1   . GLN E 4 84  ? 57.544  42.826 -50.755 1.00 24.90  ? 884  GLN C OE1   1 
ATOM   7953  N NE2   . GLN E 4 84  ? 57.007  41.499 -52.487 1.00 27.80  ? 884  GLN C NE2   1 
ATOM   7954  N N     . LEU E 4 85  ? 55.106  46.824 -51.883 1.00 25.37  ? 885  LEU C N     1 
ATOM   7955  C CA    . LEU E 4 85  ? 55.539  47.823 -52.856 1.00 26.54  ? 885  LEU C CA    1 
ATOM   7956  C C     . LEU E 4 85  ? 56.472  48.860 -52.230 1.00 25.18  ? 885  LEU C C     1 
ATOM   7957  O O     . LEU E 4 85  ? 57.491  49.222 -52.806 1.00 30.32  ? 885  LEU C O     1 
ATOM   7958  C CB    . LEU E 4 85  ? 54.346  48.565 -53.433 1.00 27.59  ? 885  LEU C CB    1 
ATOM   7959  C CG    . LEU E 4 85  ? 53.325  47.785 -54.240 1.00 29.44  ? 885  LEU C CG    1 
ATOM   7960  C CD1   . LEU E 4 85  ? 52.299  48.746 -54.759 1.00 33.09  ? 885  LEU C CD1   1 
ATOM   7961  C CD2   . LEU E 4 85  ? 54.021  47.070 -55.374 1.00 33.10  ? 885  LEU C CD2   1 
ATOM   7962  N N     . ALA E 4 86  ? 56.108  49.353 -51.052 1.00 26.89  ? 886  ALA C N     1 
ATOM   7963  C CA    . ALA E 4 86  ? 56.922  50.327 -50.363 1.00 32.13  ? 886  ALA C CA    1 
ATOM   7964  C C     . ALA E 4 86  ? 58.292  49.767 -50.000 1.00 31.62  ? 886  ALA C C     1 
ATOM   7965  O O     . ALA E 4 86  ? 59.299  50.444 -50.122 1.00 29.44  ? 886  ALA C O     1 
ATOM   7966  C CB    . ALA E 4 86  ? 56.205  50.793 -49.124 1.00 23.39  ? 886  ALA C CB    1 
ATOM   7967  N N     . VAL E 4 87  ? 58.333  48.527 -49.545 1.00 39.69  ? 887  VAL C N     1 
ATOM   7968  C CA    . VAL E 4 87  ? 59.597  47.927 -49.159 1.00 36.90  ? 887  VAL C CA    1 
ATOM   7969  C C     . VAL E 4 87  ? 60.433  47.565 -50.384 1.00 36.00  ? 887  VAL C C     1 
ATOM   7970  O O     . VAL E 4 87  ? 61.607  47.864 -50.450 1.00 38.87  ? 887  VAL C O     1 
ATOM   7971  C CB    . VAL E 4 87  ? 59.336  46.672 -48.264 1.00 30.25  ? 887  VAL C CB    1 
ATOM   7972  C CG1   . VAL E 4 87  ? 60.615  45.947 -47.934 1.00 28.34  ? 887  VAL C CG1   1 
ATOM   7973  C CG2   . VAL E 4 87  ? 58.616  47.114 -46.980 1.00 31.22  ? 887  VAL C CG2   1 
ATOM   7974  N N     . ARG E 4 88  ? 59.827  46.968 -51.390 1.00 30.59  ? 888  ARG C N     1 
ATOM   7975  C CA    . ARG E 4 88  ? 60.637  46.579 -52.520 1.00 34.96  ? 888  ARG C CA    1 
ATOM   7976  C C     . ARG E 4 88  ? 61.107  47.742 -53.384 1.00 35.80  ? 888  ARG C C     1 
ATOM   7977  O O     . ARG E 4 88  ? 62.092  47.659 -54.120 1.00 33.63  ? 888  ARG C O     1 
ATOM   7978  C CB    . ARG E 4 88  ? 59.913  45.489 -53.341 1.00 24.08  ? 888  ARG C CB    1 
ATOM   7979  C CG    . ARG E 4 88  ? 59.719  44.216 -52.541 1.00 21.34  ? 888  ARG C CG    1 
ATOM   7980  C CD    . ARG E 4 88  ? 60.934  43.810 -51.669 1.00 25.74  ? 888  ARG C CD    1 
ATOM   7981  N NE    . ARG E 4 88  ? 60.529  42.969 -50.538 1.00 24.03  ? 888  ARG C NE    1 
ATOM   7982  C CZ    . ARG E 4 88  ? 61.355  42.520 -49.581 1.00 24.32  ? 888  ARG C CZ    1 
ATOM   7983  N NH1   . ARG E 4 88  ? 62.666  42.807 -49.580 1.00 20.41  ? 888  ARG C NH1   1 
ATOM   7984  N NH2   . ARG E 4 88  ? 60.871  41.784 -48.593 1.00 23.07  ? 888  ARG C NH2   1 
ATOM   7985  N N     . ASN E 4 89  ? 60.416  48.849 -53.280 1.00 27.40  ? 889  ASN C N     1 
ATOM   7986  C CA    . ASN E 4 89  ? 60.816  49.996 -54.060 1.00 30.31  ? 889  ASN C CA    1 
ATOM   7987  C C     . ASN E 4 89  ? 61.826  50.898 -53.368 1.00 32.37  ? 889  ASN C C     1 
ATOM   7988  O O     . ASN E 4 89  ? 62.407  51.758 -54.000 1.00 32.60  ? 889  ASN C O     1 
ATOM   7989  C CB    . ASN E 4 89  ? 59.586  50.761 -54.473 1.00 29.18  ? 889  ASN C CB    1 
ATOM   7990  C CG    . ASN E 4 89  ? 58.996  50.211 -55.732 1.00 30.63  ? 889  ASN C CG    1 
ATOM   7991  O OD1   . ASN E 4 89  ? 59.725  50.008 -56.700 1.00 30.88  ? 889  ASN C OD1   1 
ATOM   7992  N ND2   . ASN E 4 89  ? 57.682  49.961 -55.748 1.00 31.79  ? 889  ASN C ND2   1 
ATOM   7993  N N     . ASP E 4 90  ? 62.047  50.671 -52.076 1.00 39.20  ? 890  ASP C N     1 
ATOM   7994  C CA    . ASP E 4 90  ? 62.982  51.466 -51.312 1.00 38.15  ? 890  ASP C CA    1 
ATOM   7995  C C     . ASP E 4 90  ? 64.275  50.699 -51.108 1.00 38.96  ? 890  ASP C C     1 
ATOM   7996  O O     . ASP E 4 90  ? 64.302  49.664 -50.445 1.00 38.64  ? 890  ASP C O     1 
ATOM   7997  C CB    . ASP E 4 90  ? 62.398  51.826 -49.967 1.00 64.03  ? 890  ASP C CB    1 
ATOM   7998  C CG    . ASP E 4 90  ? 63.370  52.580 -49.125 1.00 69.40  ? 890  ASP C CG    1 
ATOM   7999  O OD1   . ASP E 4 90  ? 63.759  53.676 -49.559 1.00 68.81  ? 890  ASP C OD1   1 
ATOM   8000  O OD2   . ASP E 4 90  ? 63.759  52.079 -48.048 1.00 65.74  ? 890  ASP C OD2   1 
ATOM   8001  N N     . GLU E 4 91  ? 65.360  51.223 -51.666 1.00 38.09  ? 891  GLU C N     1 
ATOM   8002  C CA    . GLU E 4 91  ? 66.650  50.570 -51.596 1.00 40.29  ? 891  GLU C CA    1 
ATOM   8003  C C     . GLU E 4 91  ? 67.004  50.002 -50.253 1.00 39.13  ? 891  GLU C C     1 
ATOM   8004  O O     . GLU E 4 91  ? 67.352  48.825 -50.160 1.00 36.97  ? 891  GLU C O     1 
ATOM   8005  C CB    . GLU E 4 91  ? 67.737  51.524 -52.047 1.00 60.99  ? 891  GLU C CB    1 
ATOM   8006  C CG    . GLU E 4 91  ? 68.765  50.866 -52.930 1.00 71.75  ? 891  GLU C CG    1 
ATOM   8007  C CD    . GLU E 4 91  ? 69.254  51.783 -54.029 1.00 78.70  ? 891  GLU C CD    1 
ATOM   8008  O OE1   . GLU E 4 91  ? 70.003  52.742 -53.724 1.00 79.22  ? 891  GLU C OE1   1 
ATOM   8009  O OE2   . GLU E 4 91  ? 68.873  51.543 -55.198 1.00 82.19  ? 891  GLU C OE2   1 
ATOM   8010  N N     . GLU E 4 92  ? 66.891  50.817 -49.210 1.00 28.12  ? 892  GLU C N     1 
ATOM   8011  C CA    . GLU E 4 92  ? 67.268  50.385 -47.853 1.00 29.48  ? 892  GLU C CA    1 
ATOM   8012  C C     . GLU E 4 92  ? 66.278  49.496 -47.125 1.00 25.92  ? 892  GLU C C     1 
ATOM   8013  O O     . GLU E 4 92  ? 66.673  48.482 -46.531 1.00 24.16  ? 892  GLU C O     1 
ATOM   8014  C CB    . GLU E 4 92  ? 67.653  51.602 -47.009 1.00 48.13  ? 892  GLU C CB    1 
ATOM   8015  C CG    . GLU E 4 92  ? 68.737  52.406 -47.725 1.00 57.56  ? 892  GLU C CG    1 
ATOM   8016  C CD    . GLU E 4 92  ? 69.249  53.586 -46.956 1.00 59.54  ? 892  GLU C CD    1 
ATOM   8017  O OE1   . GLU E 4 92  ? 68.433  54.252 -46.298 1.00 62.55  ? 892  GLU C OE1   1 
ATOM   8018  O OE2   . GLU E 4 92  ? 70.463  53.861 -47.025 1.00 62.50  ? 892  GLU C OE2   1 
ATOM   8019  N N     . LEU E 4 93  ? 64.997  49.840 -47.172 1.00 30.83  ? 893  LEU C N     1 
ATOM   8020  C CA    . LEU E 4 93  ? 64.015  48.974 -46.532 1.00 31.71  ? 893  LEU C CA    1 
ATOM   8021  C C     . LEU E 4 93  ? 64.146  47.632 -47.198 1.00 30.33  ? 893  LEU C C     1 
ATOM   8022  O O     . LEU E 4 93  ? 64.087  46.601 -46.563 1.00 28.85  ? 893  LEU C O     1 
ATOM   8023  C CB    . LEU E 4 93  ? 62.589  49.498 -46.716 1.00 22.45  ? 893  LEU C CB    1 
ATOM   8024  C CG    . LEU E 4 93  ? 62.310  50.656 -45.765 1.00 22.87  ? 893  LEU C CG    1 
ATOM   8025  C CD1   . LEU E 4 93  ? 60.904  51.200 -46.042 1.00 23.11  ? 893  LEU C CD1   1 
ATOM   8026  C CD2   . LEU E 4 93  ? 62.449  50.204 -44.319 1.00 20.72  ? 893  LEU C CD2   1 
ATOM   8027  N N     . ASN E 4 94  ? 64.335  47.651 -48.502 1.00 22.56  ? 894  ASN C N     1 
ATOM   8028  C CA    . ASN E 4 94  ? 64.479  46.412 -49.216 1.00 24.56  ? 894  ASN C CA    1 
ATOM   8029  C C     . ASN E 4 94  ? 65.654  45.600 -48.726 1.00 27.17  ? 894  ASN C C     1 
ATOM   8030  O O     . ASN E 4 94  ? 65.551  44.393 -48.650 1.00 25.19  ? 894  ASN C O     1 
ATOM   8031  C CB    . ASN E 4 94  ? 64.628  46.622 -50.706 1.00 30.27  ? 894  ASN C CB    1 
ATOM   8032  C CG    . ASN E 4 94  ? 64.858  45.326 -51.408 1.00 35.53  ? 894  ASN C CG    1 
ATOM   8033  O OD1   . ASN E 4 94  ? 64.039  44.414 -51.328 1.00 29.61  ? 894  ASN C OD1   1 
ATOM   8034  N ND2   . ASN E 4 94  ? 65.994  45.209 -52.063 1.00 32.66  ? 894  ASN C ND2   1 
ATOM   8035  N N     . LYS E 4 95  ? 66.774  46.245 -48.413 1.00 30.64  ? 895  LYS C N     1 
ATOM   8036  C CA    . LYS E 4 95  ? 67.911  45.509 -47.907 1.00 34.13  ? 895  LYS C CA    1 
ATOM   8037  C C     . LYS E 4 95  ? 67.631  45.029 -46.485 1.00 33.04  ? 895  LYS C C     1 
ATOM   8038  O O     . LYS E 4 95  ? 67.878  43.865 -46.172 1.00 33.61  ? 895  LYS C O     1 
ATOM   8039  C CB    . LYS E 4 95  ? 69.163  46.360 -47.915 1.00 40.98  ? 895  LYS C CB    1 
ATOM   8040  C CG    . LYS E 4 95  ? 70.382  45.574 -47.556 1.00 49.16  ? 895  LYS C CG    1 
ATOM   8041  C CD    . LYS E 4 95  ? 71.614  46.412 -47.778 1.00 59.09  ? 895  LYS C CD    1 
ATOM   8042  C CE    . LYS E 4 95  ? 72.910  45.601 -47.575 1.00 64.65  ? 895  LYS C CE    1 
ATOM   8043  N NZ    . LYS E 4 95  ? 74.151  46.374 -48.000 1.00 69.21  ? 895  LYS C NZ    1 
ATOM   8044  N N     . LEU E 4 96  ? 67.123  45.922 -45.629 1.00 25.33  ? 896  LEU C N     1 
ATOM   8045  C CA    . LEU E 4 96  ? 66.814  45.571 -44.246 1.00 23.39  ? 896  LEU C CA    1 
ATOM   8046  C C     . LEU E 4 96  ? 65.925  44.361 -44.192 1.00 23.05  ? 896  LEU C C     1 
ATOM   8047  O O     . LEU E 4 96  ? 66.003  43.575 -43.234 1.00 23.30  ? 896  LEU C O     1 
ATOM   8048  C CB    . LEU E 4 96  ? 66.100  46.719 -43.520 1.00 14.12  ? 896  LEU C CB    1 
ATOM   8049  C CG    . LEU E 4 96  ? 65.586  46.537 -42.075 1.00 17.17  ? 896  LEU C CG    1 
ATOM   8050  C CD1   . LEU E 4 96  ? 66.702  46.022 -41.160 1.00 14.48  ? 896  LEU C CD1   1 
ATOM   8051  C CD2   . LEU E 4 96  ? 65.045  47.866 -41.541 1.00 16.69  ? 896  LEU C CD2   1 
ATOM   8052  N N     . LEU E 4 97  ? 65.085  44.222 -45.217 1.00 36.09  ? 897  LEU C N     1 
ATOM   8053  C CA    . LEU E 4 97  ? 64.129  43.130 -45.293 1.00 37.92  ? 897  LEU C CA    1 
ATOM   8054  C C     . LEU E 4 97  ? 64.414  42.209 -46.463 1.00 37.51  ? 897  LEU C C     1 
ATOM   8055  O O     . LEU E 4 97  ? 63.503  41.595 -47.042 1.00 36.55  ? 897  LEU C O     1 
ATOM   8056  C CB    . LEU E 4 97  ? 62.722  43.691 -45.417 1.00 27.10  ? 897  LEU C CB    1 
ATOM   8057  C CG    . LEU E 4 97  ? 62.231  44.489 -44.220 1.00 33.77  ? 897  LEU C CG    1 
ATOM   8058  C CD1   . LEU E 4 97  ? 60.857  44.991 -44.520 1.00 33.27  ? 897  LEU C CD1   1 
ATOM   8059  C CD2   . LEU E 4 97  ? 62.178  43.640 -43.000 1.00 31.18  ? 897  LEU C CD2   1 
ATOM   8060  N N     . GLY E 4 98  ? 65.699  42.101 -46.780 1.00 21.79  ? 898  GLY C N     1 
ATOM   8061  C CA    . GLY E 4 98  ? 66.125  41.290 -47.897 1.00 24.88  ? 898  GLY C CA    1 
ATOM   8062  C C     . GLY E 4 98  ? 65.824  39.824 -47.800 1.00 27.46  ? 898  GLY C C     1 
ATOM   8063  O O     . GLY E 4 98  ? 65.827  39.121 -48.802 1.00 26.63  ? 898  GLY C O     1 
ATOM   8064  N N     . ARG E 4 99  ? 65.597  39.347 -46.590 1.00 27.38  ? 899  ARG C N     1 
ATOM   8065  C CA    . ARG E 4 99  ? 65.287  37.955 -46.399 1.00 31.08  ? 899  ARG C CA    1 
ATOM   8066  C C     . ARG E 4 99  ? 63.969  37.814 -45.641 1.00 30.51  ? 899  ARG C C     1 
ATOM   8067  O O     . ARG E 4 99  ? 63.791  36.939 -44.788 1.00 31.09  ? 899  ARG C O     1 
ATOM   8068  C CB    . ARG E 4 99  ? 66.460  37.288 -45.698 1.00 36.57  ? 899  ARG C CB    1 
ATOM   8069  C CG    . ARG E 4 99  ? 67.667  37.291 -46.583 1.00 43.95  ? 899  ARG C CG    1 
ATOM   8070  C CD    . ARG E 4 99  ? 68.641  36.195 -46.249 1.00 57.39  ? 899  ARG C CD    1 
ATOM   8071  N NE    . ARG E 4 99  ? 69.911  36.393 -46.964 1.00 65.64  ? 899  ARG C NE    1 
ATOM   8072  C CZ    . ARG E 4 99  ? 71.000  35.630 -46.822 1.00 70.17  ? 899  ARG C CZ    1 
ATOM   8073  N NH1   . ARG E 4 99  ? 70.988  34.585 -45.984 1.00 72.45  ? 899  ARG C NH1   1 
ATOM   8074  N NH2   . ARG E 4 99  ? 72.112  35.926 -47.504 1.00 72.32  ? 899  ARG C NH2   1 
ATOM   8075  N N     . VAL E 4 100 ? 63.037  38.707 -45.947 1.00 24.75  ? 900  VAL C N     1 
ATOM   8076  C CA    . VAL E 4 100 ? 61.758  38.639 -45.282 1.00 24.14  ? 900  VAL C CA    1 
ATOM   8077  C C     . VAL E 4 100 ? 60.683  38.427 -46.339 1.00 24.81  ? 900  VAL C C     1 
ATOM   8078  O O     . VAL E 4 100 ? 60.833  38.900 -47.453 1.00 23.26  ? 900  VAL C O     1 
ATOM   8079  C CB    . VAL E 4 100 ? 61.474  39.918 -44.463 1.00 25.45  ? 900  VAL C CB    1 
ATOM   8080  C CG1   . VAL E 4 100 ? 59.989  39.979 -44.084 1.00 21.94  ? 900  VAL C CG1   1 
ATOM   8081  C CG2   . VAL E 4 100 ? 62.305  39.912 -43.203 1.00 23.36  ? 900  VAL C CG2   1 
ATOM   8082  N N     . THR E 4 101 ? 59.631  37.677 -46.013 1.00 30.63  ? 901  THR C N     1 
ATOM   8083  C CA    . THR E 4 101 ? 58.566  37.444 -46.976 1.00 27.74  ? 901  THR C CA    1 
ATOM   8084  C C     . THR E 4 101 ? 57.337  38.038 -46.361 1.00 32.19  ? 901  THR C C     1 
ATOM   8085  O O     . THR E 4 101 ? 56.950  37.644 -45.256 1.00 33.31  ? 901  THR C O     1 
ATOM   8086  C CB    . THR E 4 101 ? 58.332  35.960 -47.214 1.00 36.83  ? 901  THR C CB    1 
ATOM   8087  O OG1   . THR E 4 101 ? 59.569  35.344 -47.583 1.00 35.97  ? 901  THR C OG1   1 
ATOM   8088  C CG2   . THR E 4 101 ? 57.318  35.745 -48.314 1.00 30.79  ? 901  THR C CG2   1 
ATOM   8089  N N     . ILE E 4 102 ? 56.751  39.017 -47.054 1.00 23.70  ? 902  ILE C N     1 
ATOM   8090  C CA    . ILE E 4 102 ? 55.550  39.685 -46.572 1.00 22.61  ? 902  ILE C CA    1 
ATOM   8091  C C     . ILE E 4 102 ? 54.424  38.917 -47.239 1.00 20.68  ? 902  ILE C C     1 
ATOM   8092  O O     . ILE E 4 102 ? 54.241  38.977 -48.432 1.00 20.74  ? 902  ILE C O     1 
ATOM   8093  C CB    . ILE E 4 102 ? 55.536  41.182 -47.001 1.00 17.62  ? 902  ILE C CB    1 
ATOM   8094  C CG1   . ILE E 4 102 ? 56.682  41.932 -46.311 1.00 16.58  ? 902  ILE C CG1   1 
ATOM   8095  C CG2   . ILE E 4 102 ? 54.172  41.834 -46.682 1.00 16.70  ? 902  ILE C CG2   1 
ATOM   8096  C CD1   . ILE E 4 102 ? 56.922  43.313 -46.870 1.00 18.70  ? 902  ILE C CD1   1 
ATOM   8097  N N     . ALA E 4 103 ? 53.693  38.150 -46.453 1.00 20.03  ? 903  ALA C N     1 
ATOM   8098  C CA    . ALA E 4 103 ? 52.608  37.363 -46.975 1.00 19.40  ? 903  ALA C CA    1 
ATOM   8099  C C     . ALA E 4 103 ? 51.620  38.245 -47.706 1.00 24.07  ? 903  ALA C C     1 
ATOM   8100  O O     . ALA E 4 103 ? 51.326  39.337 -47.253 1.00 22.41  ? 903  ALA C O     1 
ATOM   8101  C CB    . ALA E 4 103 ? 51.936  36.656 -45.854 1.00 13.21  ? 903  ALA C CB    1 
ATOM   8102  N N     . GLN E 4 104 ? 51.116  37.757 -48.836 1.00 31.49  ? 904  GLN C N     1 
ATOM   8103  C CA    . GLN E 4 104 ? 50.147  38.465 -49.659 1.00 34.38  ? 904  GLN C CA    1 
ATOM   8104  C C     . GLN E 4 104 ? 50.598  39.781 -50.302 1.00 33.39  ? 904  GLN C C     1 
ATOM   8105  O O     . GLN E 4 104 ? 49.767  40.612 -50.683 1.00 32.19  ? 904  GLN C O     1 
ATOM   8106  C CB    . GLN E 4 104 ? 48.832  38.656 -48.882 1.00 40.57  ? 904  GLN C CB    1 
ATOM   8107  C CG    . GLN E 4 104 ? 47.911  37.424 -48.924 1.00 45.40  ? 904  GLN C CG    1 
ATOM   8108  C CD    . GLN E 4 104 ? 47.670  36.928 -50.369 1.00 46.94  ? 904  GLN C CD    1 
ATOM   8109  O OE1   . GLN E 4 104 ? 46.983  37.596 -51.184 1.00 47.03  ? 904  GLN C OE1   1 
ATOM   8110  N NE2   . GLN E 4 104 ? 48.261  35.764 -50.700 1.00 39.77  ? 904  GLN C NE2   1 
ATOM   8111  N N     . GLY E 4 105 ? 51.912  39.932 -50.462 1.00 33.65  ? 905  GLY C N     1 
ATOM   8112  C CA    . GLY E 4 105 ? 52.465  41.123 -51.082 1.00 34.09  ? 905  GLY C CA    1 
ATOM   8113  C C     . GLY E 4 105 ? 52.811  41.075 -52.571 1.00 34.76  ? 905  GLY C C     1 
ATOM   8114  O O     . GLY E 4 105 ? 53.061  42.114 -53.182 1.00 32.82  ? 905  GLY C O     1 
ATOM   8115  N N     . GLY E 4 106 ? 52.817  39.894 -53.175 1.00 27.01  ? 906  GLY C N     1 
ATOM   8116  C CA    . GLY E 4 106 ? 53.175  39.814 -54.584 1.00 20.27  ? 906  GLY C CA    1 
ATOM   8117  C C     . GLY E 4 106 ? 54.653  40.137 -54.821 1.00 27.28  ? 906  GLY C C     1 
ATOM   8118  O O     . GLY E 4 106 ? 55.492  39.982 -53.923 1.00 27.79  ? 906  GLY C O     1 
ATOM   8119  N N     . VAL E 4 107 ? 54.967  40.575 -56.038 1.00 18.66  ? 907  VAL C N     1 
ATOM   8120  C CA    . VAL E 4 107 ? 56.315  40.944 -56.458 1.00 25.49  ? 907  VAL C CA    1 
ATOM   8121  C C     . VAL E 4 107 ? 56.133  42.271 -57.154 1.00 24.84  ? 907  VAL C C     1 
ATOM   8122  O O     . VAL E 4 107 ? 55.008  42.661 -57.382 1.00 23.48  ? 907  VAL C O     1 
ATOM   8123  C CB    . VAL E 4 107 ? 56.877  39.946 -57.480 1.00 19.29  ? 907  VAL C CB    1 
ATOM   8124  C CG1   . VAL E 4 107 ? 56.887  38.545 -56.890 1.00 20.45  ? 907  VAL C CG1   1 
ATOM   8125  C CG2   . VAL E 4 107 ? 56.080  39.979 -58.751 1.00 17.96  ? 907  VAL C CG2   1 
ATOM   8126  N N     . LEU E 4 108 ? 57.194  42.994 -57.478 1.00 32.13  ? 908  LEU C N     1 
ATOM   8127  C CA    . LEU E 4 108 ? 57.010  44.264 -58.188 1.00 34.31  ? 908  LEU C CA    1 
ATOM   8128  C C     . LEU E 4 108 ? 56.803  43.904 -59.656 1.00 34.45  ? 908  LEU C C     1 
ATOM   8129  O O     . LEU E 4 108 ? 57.274  42.861 -60.096 1.00 32.86  ? 908  LEU C O     1 
ATOM   8130  C CB    . LEU E 4 108 ? 58.260  45.123 -58.090 1.00 25.94  ? 908  LEU C CB    1 
ATOM   8131  C CG    . LEU E 4 108 ? 58.613  45.663 -56.712 1.00 27.54  ? 908  LEU C CG    1 
ATOM   8132  C CD1   . LEU E 4 108 ? 59.879  46.506 -56.729 1.00 31.06  ? 908  LEU C CD1   1 
ATOM   8133  C CD2   . LEU E 4 108 ? 57.409  46.478 -56.233 1.00 27.98  ? 908  LEU C CD2   1 
ATOM   8134  N N     . PRO E 4 109 ? 56.072  44.719 -60.430 1.00 40.41  ? 909  PRO C N     1 
ATOM   8135  C CA    . PRO E 4 109 ? 55.897  44.360 -61.846 1.00 41.72  ? 909  PRO C CA    1 
ATOM   8136  C C     . PRO E 4 109 ? 57.242  44.542 -62.499 1.00 45.07  ? 909  PRO C C     1 
ATOM   8137  O O     . PRO E 4 109 ? 57.894  45.547 -62.267 1.00 44.93  ? 909  PRO C O     1 
ATOM   8138  C CB    . PRO E 4 109 ? 54.890  45.376 -62.326 1.00 27.29  ? 909  PRO C CB    1 
ATOM   8139  C CG    . PRO E 4 109 ? 54.007  45.483 -61.183 1.00 26.21  ? 909  PRO C CG    1 
ATOM   8140  C CD    . PRO E 4 109 ? 54.997  45.624 -60.020 1.00 23.55  ? 909  PRO C CD    1 
ATOM   8141  N N     . ASN E 4 110 ? 57.661  43.585 -63.309 1.00 29.78  ? 910  ASN C N     1 
ATOM   8142  C CA    . ASN E 4 110 ? 58.978  43.690 -63.896 1.00 32.69  ? 910  ASN C CA    1 
ATOM   8143  C C     . ASN E 4 110 ? 59.248  42.585 -64.918 1.00 32.86  ? 910  ASN C C     1 
ATOM   8144  O O     . ASN E 4 110 ? 59.366  41.414 -64.553 1.00 33.19  ? 910  ASN C O     1 
ATOM   8145  C CB    . ASN E 4 110 ? 60.005  43.616 -62.773 1.00 44.95  ? 910  ASN C CB    1 
ATOM   8146  C CG    . ASN E 4 110 ? 61.390  43.842 -63.259 1.00 50.83  ? 910  ASN C CG    1 
ATOM   8147  O OD1   . ASN E 4 110 ? 61.615  44.705 -64.095 1.00 53.75  ? 910  ASN C OD1   1 
ATOM   8148  N ND2   . ASN E 4 110 ? 62.337  43.081 -62.743 1.00 50.29  ? 910  ASN C ND2   1 
ATOM   8149  N N     . ILE E 4 111 ? 59.360  42.962 -66.188 1.00 46.88  ? 911  ILE C N     1 
ATOM   8150  C CA    . ILE E 4 111 ? 59.601  42.013 -67.266 1.00 45.55  ? 911  ILE C CA    1 
ATOM   8151  C C     . ILE E 4 111 ? 60.962  42.316 -67.879 1.00 47.50  ? 911  ILE C C     1 
ATOM   8152  O O     . ILE E 4 111 ? 61.252  43.469 -68.164 1.00 47.67  ? 911  ILE C O     1 
ATOM   8153  C CB    . ILE E 4 111 ? 58.524  42.171 -68.355 1.00 29.98  ? 911  ILE C CB    1 
ATOM   8154  C CG1   . ILE E 4 111 ? 57.139  42.007 -67.724 1.00 28.86  ? 911  ILE C CG1   1 
ATOM   8155  C CG2   . ILE E 4 111 ? 58.742  41.181 -69.472 1.00 32.67  ? 911  ILE C CG2   1 
ATOM   8156  C CD1   . ILE E 4 111 ? 55.972  42.232 -68.661 1.00 29.21  ? 911  ILE C CD1   1 
ATOM   8157  N N     . GLN E 4 112 ? 61.798  41.302 -68.083 1.00 34.50  ? 912  GLN C N     1 
ATOM   8158  C CA    . GLN E 4 112 ? 63.104  41.512 -68.681 1.00 35.17  ? 912  GLN C CA    1 
ATOM   8159  C C     . GLN E 4 112 ? 62.942  42.052 -70.094 1.00 37.83  ? 912  GLN C C     1 
ATOM   8160  O O     . GLN E 4 112 ? 62.048  41.610 -70.829 1.00 36.87  ? 912  GLN C O     1 
ATOM   8161  C CB    . GLN E 4 112 ? 63.846  40.197 -68.753 1.00 42.86  ? 912  GLN C CB    1 
ATOM   8162  C CG    . GLN E 4 112 ? 64.000  39.540 -67.429 1.00 43.63  ? 912  GLN C CG    1 
ATOM   8163  C CD    . GLN E 4 112 ? 64.885  40.337 -66.541 1.00 46.88  ? 912  GLN C CD    1 
ATOM   8164  O OE1   . GLN E 4 112 ? 66.086  40.425 -66.788 1.00 42.37  ? 912  GLN C OE1   1 
ATOM   8165  N NE2   . GLN E 4 112 ? 64.303  40.951 -65.500 1.00 46.63  ? 912  GLN C NE2   1 
ATOM   8166  N N     . SER E 4 113 ? 63.812  42.989 -70.480 1.00 50.75  ? 913  SER C N     1 
ATOM   8167  C CA    . SER E 4 113 ? 63.781  43.596 -71.815 1.00 52.81  ? 913  SER C CA    1 
ATOM   8168  C C     . SER E 4 113 ? 63.748  42.596 -72.975 1.00 51.04  ? 913  SER C C     1 
ATOM   8169  O O     . SER E 4 113 ? 62.900  42.683 -73.857 1.00 52.47  ? 913  SER C O     1 
ATOM   8170  C CB    . SER E 4 113 ? 64.996  44.493 -72.001 1.00 65.46  ? 913  SER C CB    1 
ATOM   8171  O OG    . SER E 4 113 ? 65.023  45.496 -71.015 1.00 74.42  ? 913  SER C OG    1 
ATOM   8172  N N     . VAL E 4 114 ? 64.683  41.654 -72.970 1.00 56.97  ? 914  VAL C N     1 
ATOM   8173  C CA    . VAL E 4 114 ? 64.792  40.652 -74.026 1.00 57.52  ? 914  VAL C CA    1 
ATOM   8174  C C     . VAL E 4 114 ? 63.520  39.872 -74.270 1.00 56.69  ? 914  VAL C C     1 
ATOM   8175  O O     . VAL E 4 114 ? 63.429  39.155 -75.249 1.00 56.68  ? 914  VAL C O     1 
ATOM   8176  C CB    . VAL E 4 114 ? 65.900  39.627 -73.700 1.00 49.73  ? 914  VAL C CB    1 
ATOM   8177  C CG1   . VAL E 4 114 ? 67.070  40.321 -73.017 1.00 52.90  ? 914  VAL C CG1   1 
ATOM   8178  C CG2   . VAL E 4 114 ? 65.373  38.553 -72.783 1.00 48.26  ? 914  VAL C CG2   1 
ATOM   8179  N N     . LEU E 4 115 ? 62.548  39.987 -73.370 1.00 47.53  ? 915  LEU C N     1 
ATOM   8180  C CA    . LEU E 4 115 ? 61.294  39.243 -73.487 1.00 48.12  ? 915  LEU C CA    1 
ATOM   8181  C C     . LEU E 4 115 ? 60.176  40.036 -74.148 1.00 49.34  ? 915  LEU C C     1 
ATOM   8182  O O     . LEU E 4 115 ? 59.186  39.450 -74.600 1.00 48.62  ? 915  LEU C O     1 
ATOM   8183  C CB    . LEU E 4 115 ? 60.836  38.768 -72.107 1.00 53.15  ? 915  LEU C CB    1 
ATOM   8184  C CG    . LEU E 4 115 ? 61.802  37.853 -71.359 1.00 53.92  ? 915  LEU C CG    1 
ATOM   8185  C CD1   . LEU E 4 115 ? 61.226  37.515 -70.005 1.00 52.71  ? 915  LEU C CD1   1 
ATOM   8186  C CD2   . LEU E 4 115 ? 62.049  36.591 -72.181 1.00 52.08  ? 915  LEU C CD2   1 
ATOM   8187  N N     . LEU E 4 116 ? 60.328  41.361 -74.175 1.00 35.27  ? 916  LEU C N     1 
ATOM   8188  C CA    . LEU E 4 116 ? 59.360  42.242 -74.825 1.00 39.90  ? 916  LEU C CA    1 
ATOM   8189  C C     . LEU E 4 116 ? 59.503  42.040 -76.328 1.00 42.38  ? 916  LEU C C     1 
ATOM   8190  O O     . LEU E 4 116 ? 60.597  41.776 -76.820 1.00 42.11  ? 916  LEU C O     1 
ATOM   8191  C CB    . LEU E 4 116 ? 59.652  43.696 -74.502 1.00 45.74  ? 916  LEU C CB    1 
ATOM   8192  C CG    . LEU E 4 116 ? 59.598  44.070 -73.037 1.00 48.05  ? 916  LEU C CG    1 
ATOM   8193  C CD1   . LEU E 4 116 ? 60.124  45.476 -72.915 1.00 49.38  ? 916  LEU C CD1   1 
ATOM   8194  C CD2   . LEU E 4 116 ? 58.165  43.930 -72.508 1.00 45.72  ? 916  LEU C CD2   1 
ATOM   8195  N N     . PRO E 4 117 ? 58.408  42.191 -77.079 1.00 53.74  ? 917  PRO C N     1 
ATOM   8196  C CA    . PRO E 4 117 ? 58.472  41.998 -78.531 1.00 59.78  ? 917  PRO C CA    1 
ATOM   8197  C C     . PRO E 4 117 ? 59.006  43.181 -79.320 1.00 66.20  ? 917  PRO C C     1 
ATOM   8198  O O     . PRO E 4 117 ? 59.444  44.182 -78.738 1.00 65.45  ? 917  PRO C O     1 
ATOM   8199  C CB    . PRO E 4 117 ? 57.030  41.654 -78.893 1.00 51.12  ? 917  PRO C CB    1 
ATOM   8200  C CG    . PRO E 4 117 ? 56.260  42.518 -77.944 1.00 49.16  ? 917  PRO C CG    1 
ATOM   8201  C CD    . PRO E 4 117 ? 57.026  42.418 -76.626 1.00 48.37  ? 917  PRO C CD    1 
ATOM   8202  N N     . LYS E 4 118 ? 58.953  43.038 -80.649 1.00 130.13 ? 918  LYS C N     1 
ATOM   8203  C CA    . LYS E 4 118 ? 59.398  44.041 -81.621 1.00 137.26 ? 918  LYS C CA    1 
ATOM   8204  C C     . LYS E 4 118 ? 60.836  44.496 -81.451 1.00 140.80 ? 918  LYS C C     1 
ATOM   8205  O O     . LYS E 4 118 ? 61.633  43.854 -80.768 1.00 141.87 ? 918  LYS C O     1 
ATOM   8206  C CB    . LYS E 4 118 ? 58.487  45.272 -81.590 1.00 148.06 ? 918  LYS C CB    1 
ATOM   8207  C CG    . LYS E 4 118 ? 57.112  45.062 -82.200 1.00 152.33 ? 918  LYS C CG    1 
ATOM   8208  C CD    . LYS E 4 118 ? 56.344  46.376 -82.251 1.00 155.75 ? 918  LYS C CD    1 
ATOM   8209  C CE    . LYS E 4 118 ? 54.996  46.214 -82.930 1.00 158.02 ? 918  LYS C CE    1 
ATOM   8210  N NZ    . LYS E 4 118 ? 54.287  47.517 -83.058 1.00 158.47 ? 918  LYS C NZ    1 
ATOM   8211  N N     . LYS E 4 119 ? 61.157  45.616 -82.091 1.00 161.84 ? 919  LYS C N     1 
ATOM   8212  C CA    . LYS E 4 119 ? 62.492  46.192 -82.029 1.00 164.97 ? 919  LYS C CA    1 
ATOM   8213  C C     . LYS E 4 119 ? 62.441  47.677 -81.697 1.00 166.76 ? 919  LYS C C     1 
ATOM   8214  O O     . LYS E 4 119 ? 61.369  48.287 -81.706 1.00 167.14 ? 919  LYS C O     1 
ATOM   8215  C CB    . LYS E 4 119 ? 63.229  45.989 -83.356 1.00 96.31  ? 919  LYS C CB    1 
ATOM   8216  C CG    . LYS E 4 119 ? 62.353  46.087 -84.607 1.00 96.41  ? 919  LYS C CG    1 
ATOM   8217  C CD    . LYS E 4 119 ? 61.605  44.775 -84.884 1.00 96.51  ? 919  LYS C CD    1 
ATOM   8218  C CE    . LYS E 4 119 ? 60.965  44.775 -86.262 1.00 96.40  ? 919  LYS C CE    1 
ATOM   8219  N NZ    . LYS E 4 119 ? 60.319  43.478 -86.573 1.00 95.86  ? 919  LYS C NZ    1 
ATOM   8220  N N     . THR E 4 120 ? 63.612  48.243 -81.407 1.00 201.43 ? 920  THR C N     1 
ATOM   8221  C CA    . THR E 4 120 ? 63.762  49.656 -81.056 1.00 201.43 ? 920  THR C CA    1 
ATOM   8222  C C     . THR E 4 120 ? 63.272  49.932 -79.628 1.00 201.43 ? 920  THR C C     1 
ATOM   8223  O O     . THR E 4 120 ? 64.115  50.308 -78.781 1.00 154.85 ? 920  THR C O     1 
ATOM   8224  C CB    . THR E 4 120 ? 63.001  50.575 -82.057 1.00 191.80 ? 920  THR C CB    1 
ATOM   8225  O OG1   . THR E 4 120 ? 63.507  50.366 -83.383 1.00 192.05 ? 920  THR C OG1   1 
ATOM   8226  C CG2   . THR E 4 120 ? 63.180  52.042 -81.685 1.00 191.80 ? 920  THR C CG2   1 
ATOM   8227  N N     . LYS F 5 34  ? 47.377  38.598 -25.170 1.00 69.51  ? 1231 LYS D N     1 
ATOM   8228  C CA    . LYS F 5 34  ? 48.480  38.775 -26.165 1.00 62.85  ? 1231 LYS D CA    1 
ATOM   8229  C C     . LYS F 5 34  ? 48.709  40.227 -26.585 1.00 57.38  ? 1231 LYS D C     1 
ATOM   8230  O O     . LYS F 5 34  ? 47.895  40.818 -27.301 1.00 56.29  ? 1231 LYS D O     1 
ATOM   8231  C CB    . LYS F 5 34  ? 48.226  37.908 -27.413 1.00 86.14  ? 1231 LYS D CB    1 
ATOM   8232  C CG    . LYS F 5 34  ? 46.798  37.920 -27.911 1.00 89.11  ? 1231 LYS D CG    1 
ATOM   8233  C CD    . LYS F 5 34  ? 46.441  36.629 -28.643 1.00 91.35  ? 1231 LYS D CD    1 
ATOM   8234  C CE    . LYS F 5 34  ? 44.922  36.550 -28.856 1.00 93.28  ? 1231 LYS D CE    1 
ATOM   8235  N NZ    . LYS F 5 34  ? 44.431  35.270 -29.460 1.00 93.90  ? 1231 LYS D NZ    1 
ATOM   8236  N N     . GLU F 5 35  ? 49.832  40.788 -26.146 1.00 61.06  ? 1232 GLU D N     1 
ATOM   8237  C CA    . GLU F 5 35  ? 50.178  42.169 -26.465 1.00 56.53  ? 1232 GLU D CA    1 
ATOM   8238  C C     . GLU F 5 35  ? 50.491  42.353 -27.952 1.00 53.35  ? 1232 GLU D C     1 
ATOM   8239  O O     . GLU F 5 35  ? 50.879  41.413 -28.652 1.00 52.35  ? 1232 GLU D O     1 
ATOM   8240  C CB    . GLU F 5 35  ? 51.395  42.612 -25.673 1.00 85.39  ? 1232 GLU D CB    1 
ATOM   8241  C CG    . GLU F 5 35  ? 51.378  42.220 -24.243 1.00 86.68  ? 1232 GLU D CG    1 
ATOM   8242  C CD    . GLU F 5 35  ? 52.564  42.784 -23.521 1.00 88.38  ? 1232 GLU D CD    1 
ATOM   8243  O OE1   . GLU F 5 35  ? 53.673  42.734 -24.103 1.00 89.43  ? 1232 GLU D OE1   1 
ATOM   8244  O OE2   . GLU F 5 35  ? 52.386  43.274 -22.382 1.00 87.65  ? 1232 GLU D OE2   1 
ATOM   8245  N N     . SER F 5 36  ? 50.356  43.587 -28.424 1.00 55.46  ? 1233 SER D N     1 
ATOM   8246  C CA    . SER F 5 36  ? 50.611  43.880 -29.820 1.00 53.21  ? 1233 SER D CA    1 
ATOM   8247  C C     . SER F 5 36  ? 51.476  45.129 -29.897 1.00 49.37  ? 1233 SER D C     1 
ATOM   8248  O O     . SER F 5 36  ? 52.248  45.435 -29.011 1.00 46.74  ? 1233 SER D O     1 
ATOM   8249  C CB    . SER F 5 36  ? 49.269  44.104 -30.516 1.00 46.79  ? 1233 SER D CB    1 
ATOM   8250  O OG    . SER F 5 36  ? 49.357  44.012 -31.915 1.00 50.29  ? 1233 SER D OG    1 
ATOM   8251  N N     . TYR F 5 37  ? 51.361  45.838 -30.989 1.00 42.25  ? 1234 TYR D N     1 
ATOM   8252  C CA    . TYR F 5 37  ? 52.087  47.075 -31.185 1.00 40.33  ? 1234 TYR D CA    1 
ATOM   8253  C C     . TYR F 5 37  ? 51.115  47.885 -32.006 1.00 37.70  ? 1234 TYR D C     1 
ATOM   8254  O O     . TYR F 5 37  ? 51.378  49.040 -32.357 1.00 35.72  ? 1234 TYR D O     1 
ATOM   8255  C CB    . TYR F 5 37  ? 53.349  46.847 -31.989 1.00 31.50  ? 1234 TYR D CB    1 
ATOM   8256  C CG    . TYR F 5 37  ? 54.540  46.521 -31.163 1.00 33.54  ? 1234 TYR D CG    1 
ATOM   8257  C CD1   . TYR F 5 37  ? 55.205  45.340 -31.331 1.00 33.40  ? 1234 TYR D CD1   1 
ATOM   8258  C CD2   . TYR F 5 37  ? 55.018  47.415 -30.227 1.00 35.22  ? 1234 TYR D CD2   1 
ATOM   8259  C CE1   . TYR F 5 37  ? 56.329  45.041 -30.592 1.00 31.98  ? 1234 TYR D CE1   1 
ATOM   8260  C CE2   . TYR F 5 37  ? 56.149  47.139 -29.466 1.00 33.79  ? 1234 TYR D CE2   1 
ATOM   8261  C CZ    . TYR F 5 37  ? 56.801  45.951 -29.656 1.00 32.77  ? 1234 TYR D CZ    1 
ATOM   8262  O OH    . TYR F 5 37  ? 57.944  45.661 -28.940 1.00 32.61  ? 1234 TYR D OH    1 
ATOM   8263  N N     . ALA F 5 38  ? 49.963  47.252 -32.245 1.00 33.09  ? 1235 ALA D N     1 
ATOM   8264  C CA    . ALA F 5 38  ? 48.908  47.785 -33.070 1.00 36.96  ? 1235 ALA D CA    1 
ATOM   8265  C C     . ALA F 5 38  ? 48.385  49.181 -32.779 1.00 37.79  ? 1235 ALA D C     1 
ATOM   8266  O O     . ALA F 5 38  ? 48.229  49.963 -33.713 1.00 37.94  ? 1235 ALA D O     1 
ATOM   8267  C CB    . ALA F 5 38  ? 47.784  46.793 -33.132 1.00 17.24  ? 1235 ALA D CB    1 
ATOM   8268  N N     . ILE F 5 39  ? 48.120  49.519 -31.522 1.00 44.74  ? 1236 ILE D N     1 
ATOM   8269  C CA    . ILE F 5 39  ? 47.635  50.862 -31.240 1.00 45.89  ? 1236 ILE D CA    1 
ATOM   8270  C C     . ILE F 5 39  ? 48.735  51.884 -31.497 1.00 44.55  ? 1236 ILE D C     1 
ATOM   8271  O O     . ILE F 5 39  ? 48.463  53.023 -31.885 1.00 43.68  ? 1236 ILE D O     1 
ATOM   8272  C CB    . ILE F 5 39  ? 47.157  51.024 -29.789 1.00 25.56  ? 1236 ILE D CB    1 
ATOM   8273  C CG1   . ILE F 5 39  ? 48.348  50.945 -28.828 1.00 28.78  ? 1236 ILE D CG1   1 
ATOM   8274  C CG2   . ILE F 5 39  ? 46.040  50.005 -29.498 1.00 24.95  ? 1236 ILE D CG2   1 
ATOM   8275  C CD1   . ILE F 5 39  ? 47.944  51.027 -27.388 1.00 31.97  ? 1236 ILE D CD1   1 
ATOM   8276  N N     . TYR F 5 40  ? 49.980  51.475 -31.297 1.00 39.50  ? 1237 TYR D N     1 
ATOM   8277  C CA    . TYR F 5 40  ? 51.074  52.385 -31.524 1.00 41.34  ? 1237 TYR D CA    1 
ATOM   8278  C C     . TYR F 5 40  ? 51.305  52.529 -33.016 1.00 42.23  ? 1237 TYR D C     1 
ATOM   8279  O O     . TYR F 5 40  ? 51.558  53.628 -33.499 1.00 41.78  ? 1237 TYR D O     1 
ATOM   8280  C CB    . TYR F 5 40  ? 52.339  51.884 -30.824 1.00 31.19  ? 1237 TYR D CB    1 
ATOM   8281  C CG    . TYR F 5 40  ? 52.105  51.496 -29.388 1.00 34.31  ? 1237 TYR D CG    1 
ATOM   8282  C CD1   . TYR F 5 40  ? 51.923  50.155 -29.012 1.00 37.16  ? 1237 TYR D CD1   1 
ATOM   8283  C CD2   . TYR F 5 40  ? 52.013  52.463 -28.403 1.00 34.00  ? 1237 TYR D CD2   1 
ATOM   8284  C CE1   . TYR F 5 40  ? 51.658  49.816 -27.682 1.00 38.64  ? 1237 TYR D CE1   1 
ATOM   8285  C CE2   . TYR F 5 40  ? 51.740  52.140 -27.097 1.00 39.04  ? 1237 TYR D CE2   1 
ATOM   8286  C CZ    . TYR F 5 40  ? 51.565  50.830 -26.735 1.00 40.39  ? 1237 TYR D CZ    1 
ATOM   8287  O OH    . TYR F 5 40  ? 51.272  50.562 -25.415 1.00 41.98  ? 1237 TYR D OH    1 
ATOM   8288  N N     . VAL F 5 41  ? 51.217  51.433 -33.760 1.00 37.43  ? 1238 VAL D N     1 
ATOM   8289  C CA    . VAL F 5 41  ? 51.425  51.513 -35.204 1.00 37.03  ? 1238 VAL D CA    1 
ATOM   8290  C C     . VAL F 5 41  ? 50.353  52.443 -35.746 1.00 37.16  ? 1238 VAL D C     1 
ATOM   8291  O O     . VAL F 5 41  ? 50.624  53.313 -36.563 1.00 35.01  ? 1238 VAL D O     1 
ATOM   8292  C CB    . VAL F 5 41  ? 51.294  50.137 -35.897 1.00 26.42  ? 1238 VAL D CB    1 
ATOM   8293  C CG1   . VAL F 5 41  ? 51.373  50.299 -37.392 1.00 26.00  ? 1238 VAL D CG1   1 
ATOM   8294  C CG2   . VAL F 5 41  ? 52.395  49.239 -35.460 1.00 24.33  ? 1238 VAL D CG2   1 
ATOM   8295  N N     . TYR F 5 42  ? 49.135  52.273 -35.251 1.00 32.36  ? 1239 TYR D N     1 
ATOM   8296  C CA    . TYR F 5 42  ? 48.016  53.105 -35.666 1.00 33.52  ? 1239 TYR D CA    1 
ATOM   8297  C C     . TYR F 5 42  ? 48.258  54.597 -35.354 1.00 33.28  ? 1239 TYR D C     1 
ATOM   8298  O O     . TYR F 5 42  ? 48.031  55.475 -36.202 1.00 35.02  ? 1239 TYR D O     1 
ATOM   8299  C CB    . TYR F 5 42  ? 46.751  52.630 -34.983 1.00 53.35  ? 1239 TYR D CB    1 
ATOM   8300  C CG    . TYR F 5 42  ? 45.554  53.121 -35.700 1.00 59.77  ? 1239 TYR D CG    1 
ATOM   8301  C CD1   . TYR F 5 42  ? 45.095  52.471 -36.838 1.00 61.63  ? 1239 TYR D CD1   1 
ATOM   8302  C CD2   . TYR F 5 42  ? 44.931  54.304 -35.307 1.00 63.34  ? 1239 TYR D CD2   1 
ATOM   8303  C CE1   . TYR F 5 42  ? 44.033  52.991 -37.587 1.00 69.50  ? 1239 TYR D CE1   1 
ATOM   8304  C CE2   . TYR F 5 42  ? 43.880  54.840 -36.036 1.00 67.60  ? 1239 TYR D CE2   1 
ATOM   8305  C CZ    . TYR F 5 42  ? 43.429  54.182 -37.182 1.00 70.08  ? 1239 TYR D CZ    1 
ATOM   8306  O OH    . TYR F 5 42  ? 42.387  54.726 -37.915 1.00 74.79  ? 1239 TYR D OH    1 
ATOM   8307  N N     . LYS F 5 43  ? 48.716  54.884 -34.139 1.00 31.42  ? 1240 LYS D N     1 
ATOM   8308  C CA    . LYS F 5 43  ? 49.010  56.253 -33.760 1.00 32.93  ? 1240 LYS D CA    1 
ATOM   8309  C C     . LYS F 5 43  ? 49.995  56.859 -34.743 1.00 34.93  ? 1240 LYS D C     1 
ATOM   8310  O O     . LYS F 5 43  ? 49.774  57.956 -35.277 1.00 32.76  ? 1240 LYS D O     1 
ATOM   8311  C CB    . LYS F 5 43  ? 49.602  56.307 -32.376 1.00 28.70  ? 1240 LYS D CB    1 
ATOM   8312  C CG    . LYS F 5 43  ? 48.594  56.196 -31.276 1.00 28.11  ? 1240 LYS D CG    1 
ATOM   8313  C CD    . LYS F 5 43  ? 49.276  56.195 -29.900 1.00 34.62  ? 1240 LYS D CD    1 
ATOM   8314  C CE    . LYS F 5 43  ? 48.260  56.166 -28.768 1.00 36.64  ? 1240 LYS D CE    1 
ATOM   8315  N NZ    . LYS F 5 43  ? 48.950  56.356 -27.454 1.00 42.49  ? 1240 LYS D NZ    1 
ATOM   8316  N N     . VAL F 5 44  ? 51.096  56.153 -34.971 1.00 42.87  ? 1241 VAL D N     1 
ATOM   8317  C CA    . VAL F 5 44  ? 52.089  56.617 -35.921 1.00 39.21  ? 1241 VAL D CA    1 
ATOM   8318  C C     . VAL F 5 44  ? 51.471  56.709 -37.330 1.00 39.56  ? 1241 VAL D C     1 
ATOM   8319  O O     . VAL F 5 44  ? 51.766  57.657 -38.069 1.00 40.74  ? 1241 VAL D O     1 
ATOM   8320  C CB    . VAL F 5 44  ? 53.315  55.670 -35.960 1.00 34.35  ? 1241 VAL D CB    1 
ATOM   8321  C CG1   . VAL F 5 44  ? 54.191  56.014 -37.132 1.00 30.81  ? 1241 VAL D CG1   1 
ATOM   8322  C CG2   . VAL F 5 44  ? 54.125  55.797 -34.682 1.00 29.21  ? 1241 VAL D CG2   1 
ATOM   8323  N N     . LEU F 5 45  ? 50.623  55.740 -37.705 1.00 33.19  ? 1242 LEU D N     1 
ATOM   8324  C CA    . LEU F 5 45  ? 50.002  55.774 -39.041 1.00 35.71  ? 1242 LEU D CA    1 
ATOM   8325  C C     . LEU F 5 45  ? 49.331  57.128 -39.215 1.00 37.03  ? 1242 LEU D C     1 
ATOM   8326  O O     . LEU F 5 45  ? 49.561  57.859 -40.195 1.00 34.88  ? 1242 LEU D O     1 
ATOM   8327  C CB    . LEU F 5 45  ? 48.940  54.662 -39.245 1.00 21.27  ? 1242 LEU D CB    1 
ATOM   8328  C CG    . LEU F 5 45  ? 48.016  54.725 -40.509 1.00 25.15  ? 1242 LEU D CG    1 
ATOM   8329  C CD1   . LEU F 5 45  ? 48.841  54.852 -41.788 1.00 23.71  ? 1242 LEU D CD1   1 
ATOM   8330  C CD2   . LEU F 5 45  ? 47.132  53.500 -40.663 1.00 23.11  ? 1242 LEU D CD2   1 
ATOM   8331  N N     . LYS F 5 46  ? 48.515  57.461 -38.228 1.00 32.92  ? 1243 LYS D N     1 
ATOM   8332  C CA    . LYS F 5 46  ? 47.772  58.693 -38.256 1.00 37.56  ? 1243 LYS D CA    1 
ATOM   8333  C C     . LYS F 5 46  ? 48.625  59.937 -38.293 1.00 36.32  ? 1243 LYS D C     1 
ATOM   8334  O O     . LYS F 5 46  ? 48.196  60.971 -38.797 1.00 38.22  ? 1243 LYS D O     1 
ATOM   8335  C CB    . LYS F 5 46  ? 46.774  58.714 -37.088 1.00 34.93  ? 1243 LYS D CB    1 
ATOM   8336  C CG    . LYS F 5 46  ? 45.664  57.648 -37.260 1.00 37.25  ? 1243 LYS D CG    1 
ATOM   8337  C CD    . LYS F 5 46  ? 45.125  57.804 -38.658 1.00 42.34  ? 1243 LYS D CD    1 
ATOM   8338  C CE    . LYS F 5 46  ? 43.997  56.908 -38.984 1.00 43.25  ? 1243 LYS D CE    1 
ATOM   8339  N NZ    . LYS F 5 46  ? 43.552  57.291 -40.344 1.00 43.57  ? 1243 LYS D NZ    1 
ATOM   8340  N N     . GLN F 5 47  ? 49.839  59.863 -37.787 1.00 37.51  ? 1244 GLN D N     1 
ATOM   8341  C CA    . GLN F 5 47  ? 50.668  61.045 -37.864 1.00 35.83  ? 1244 GLN D CA    1 
ATOM   8342  C C     . GLN F 5 47  ? 51.120  61.302 -39.307 1.00 35.63  ? 1244 GLN D C     1 
ATOM   8343  O O     . GLN F 5 47  ? 51.091  62.439 -39.806 1.00 32.30  ? 1244 GLN D O     1 
ATOM   8344  C CB    . GLN F 5 47  ? 51.910  60.915 -36.980 1.00 41.59  ? 1244 GLN D CB    1 
ATOM   8345  C CG    . GLN F 5 47  ? 51.628  60.769 -35.516 1.00 42.66  ? 1244 GLN D CG    1 
ATOM   8346  C CD    . GLN F 5 47  ? 52.880  60.784 -34.685 1.00 45.07  ? 1244 GLN D CD    1 
ATOM   8347  O OE1   . GLN F 5 47  ? 53.836  60.023 -34.940 1.00 48.89  ? 1244 GLN D OE1   1 
ATOM   8348  N NE2   . GLN F 5 47  ? 52.887  61.642 -33.668 1.00 41.11  ? 1244 GLN D NE2   1 
ATOM   8349  N N     . VAL F 5 48  ? 51.527  60.250 -39.999 1.00 43.87  ? 1245 VAL D N     1 
ATOM   8350  C CA    . VAL F 5 48  ? 52.040  60.458 -41.337 1.00 42.65  ? 1245 VAL D CA    1 
ATOM   8351  C C     . VAL F 5 48  ? 50.982  60.530 -42.422 1.00 42.19  ? 1245 VAL D C     1 
ATOM   8352  O O     . VAL F 5 48  ? 51.134  61.287 -43.393 1.00 47.64  ? 1245 VAL D O     1 
ATOM   8353  C CB    . VAL F 5 48  ? 53.143  59.395 -41.649 1.00 22.45  ? 1245 VAL D CB    1 
ATOM   8354  C CG1   . VAL F 5 48  ? 54.134  59.358 -40.488 1.00 21.70  ? 1245 VAL D CG1   1 
ATOM   8355  C CG2   . VAL F 5 48  ? 52.535  58.041 -41.914 1.00 18.34  ? 1245 VAL D CG2   1 
ATOM   8356  N N     . HIS F 5 49  ? 49.902  59.778 -42.226 1.00 41.49  ? 1246 HIS D N     1 
ATOM   8357  C CA    . HIS F 5 49  ? 48.804  59.732 -43.186 1.00 42.95  ? 1246 HIS D CA    1 
ATOM   8358  C C     . HIS F 5 49  ? 47.461  59.751 -42.468 1.00 43.96  ? 1246 HIS D C     1 
ATOM   8359  O O     . HIS F 5 49  ? 46.756  58.741 -42.407 1.00 44.62  ? 1246 HIS D O     1 
ATOM   8360  C CB    . HIS F 5 49  ? 48.930  58.495 -44.093 1.00 36.22  ? 1246 HIS D CB    1 
ATOM   8361  C CG    . HIS F 5 49  ? 50.057  58.595 -45.069 1.00 37.07  ? 1246 HIS D CG    1 
ATOM   8362  N ND1   . HIS F 5 49  ? 50.212  59.676 -45.910 1.00 35.56  ? 1246 HIS D ND1   1 
ATOM   8363  C CD2   . HIS F 5 49  ? 51.070  57.747 -45.367 1.00 37.17  ? 1246 HIS D CD2   1 
ATOM   8364  C CE1   . HIS F 5 49  ? 51.258  59.486 -46.692 1.00 38.10  ? 1246 HIS D CE1   1 
ATOM   8365  N NE2   . HIS F 5 49  ? 51.798  58.323 -46.383 1.00 37.32  ? 1246 HIS D NE2   1 
ATOM   8366  N N     . PRO F 5 50  ? 47.084  60.941 -41.954 1.00 38.19  ? 1247 PRO D N     1 
ATOM   8367  C CA    . PRO F 5 50  ? 45.866  61.255 -41.212 1.00 38.85  ? 1247 PRO D CA    1 
ATOM   8368  C C     . PRO F 5 50  ? 44.601  60.630 -41.739 1.00 36.04  ? 1247 PRO D C     1 
ATOM   8369  O O     . PRO F 5 50  ? 43.744  60.278 -40.960 1.00 38.09  ? 1247 PRO D O     1 
ATOM   8370  C CB    . PRO F 5 50  ? 45.816  62.779 -41.276 1.00 48.58  ? 1247 PRO D CB    1 
ATOM   8371  C CG    . PRO F 5 50  ? 47.251  63.171 -41.355 1.00 50.79  ? 1247 PRO D CG    1 
ATOM   8372  C CD    . PRO F 5 50  ? 47.763  62.197 -42.352 1.00 45.01  ? 1247 PRO D CD    1 
ATOM   8373  N N     . ASP F 5 51  ? 44.455  60.467 -43.044 1.00 32.27  ? 1248 ASP D N     1 
ATOM   8374  C CA    . ASP F 5 51  ? 43.201  59.877 -43.507 1.00 35.41  ? 1248 ASP D CA    1 
ATOM   8375  C C     . ASP F 5 51  ? 43.305  58.472 -44.095 1.00 35.24  ? 1248 ASP D C     1 
ATOM   8376  O O     . ASP F 5 51  ? 42.469  58.080 -44.906 1.00 33.42  ? 1248 ASP D O     1 
ATOM   8377  C CB    . ASP F 5 51  ? 42.528  60.796 -44.548 1.00 44.10  ? 1248 ASP D CB    1 
ATOM   8378  C CG    . ASP F 5 51  ? 42.358  62.230 -44.055 1.00 49.67  ? 1248 ASP D CG    1 
ATOM   8379  O OD1   . ASP F 5 51  ? 42.014  62.436 -42.870 1.00 49.74  ? 1248 ASP D OD1   1 
ATOM   8380  O OD2   . ASP F 5 51  ? 42.550  63.154 -44.860 1.00 52.26  ? 1248 ASP D OD2   1 
ATOM   8381  N N     . THR F 5 52  ? 44.304  57.702 -43.676 1.00 30.70  ? 1249 THR D N     1 
ATOM   8382  C CA    . THR F 5 52  ? 44.527  56.361 -44.218 1.00 28.54  ? 1249 THR D CA    1 
ATOM   8383  C C     . THR F 5 52  ? 44.305  55.269 -43.188 1.00 27.18  ? 1249 THR D C     1 
ATOM   8384  O O     . THR F 5 52  ? 44.546  55.455 -42.010 1.00 27.52  ? 1249 THR D O     1 
ATOM   8385  C CB    . THR F 5 52  ? 45.965  56.275 -44.721 1.00 35.86  ? 1249 THR D CB    1 
ATOM   8386  O OG1   . THR F 5 52  ? 46.141  57.178 -45.815 1.00 32.84  ? 1249 THR D OG1   1 
ATOM   8387  C CG2   . THR F 5 52  ? 46.334  54.863 -45.121 1.00 31.83  ? 1249 THR D CG2   1 
ATOM   8388  N N     . GLY F 5 53  ? 43.863  54.110 -43.624 1.00 38.63  ? 1250 GLY D N     1 
ATOM   8389  C CA    . GLY F 5 53  ? 43.667  53.043 -42.663 1.00 38.71  ? 1250 GLY D CA    1 
ATOM   8390  C C     . GLY F 5 53  ? 44.603  51.879 -42.931 1.00 39.16  ? 1250 GLY D C     1 
ATOM   8391  O O     . GLY F 5 53  ? 45.450  51.920 -43.813 1.00 36.29  ? 1250 GLY D O     1 
ATOM   8392  N N     . ILE F 5 54  ? 44.450  50.815 -42.168 1.00 29.53  ? 1251 ILE D N     1 
ATOM   8393  C CA    . ILE F 5 54  ? 45.302  49.667 -42.366 1.00 29.85  ? 1251 ILE D CA    1 
ATOM   8394  C C     . ILE F 5 54  ? 44.478  48.441 -42.069 1.00 30.85  ? 1251 ILE D C     1 
ATOM   8395  O O     . ILE F 5 54  ? 43.830  48.365 -41.040 1.00 28.90  ? 1251 ILE D O     1 
ATOM   8396  C CB    . ILE F 5 54  ? 46.600  49.769 -41.478 1.00 24.01  ? 1251 ILE D CB    1 
ATOM   8397  C CG1   . ILE F 5 54  ? 47.551  48.618 -41.845 1.00 23.61  ? 1251 ILE D CG1   1 
ATOM   8398  C CG2   . ILE F 5 54  ? 46.261  49.842 -39.992 1.00 22.44  ? 1251 ILE D CG2   1 
ATOM   8399  C CD1   . ILE F 5 54  ? 48.943  48.749 -41.212 1.00 20.12  ? 1251 ILE D CD1   1 
ATOM   8400  N N     . SER F 5 55  ? 44.460  47.515 -43.021 1.00 37.67  ? 1252 SER D N     1 
ATOM   8401  C CA    . SER F 5 55  ? 43.702  46.270 -42.933 1.00 37.61  ? 1252 SER D CA    1 
ATOM   8402  C C     . SER F 5 55  ? 44.335  45.488 -41.817 1.00 39.30  ? 1252 SER D C     1 
ATOM   8403  O O     . SER F 5 55  ? 45.494  45.717 -41.504 1.00 37.91  ? 1252 SER D O     1 
ATOM   8404  C CB    . SER F 5 55  ? 43.825  45.498 -44.247 1.00 39.20  ? 1252 SER D CB    1 
ATOM   8405  O OG    . SER F 5 55  ? 45.133  44.968 -44.423 1.00 43.61  ? 1252 SER D OG    1 
ATOM   8406  N N     . SER F 5 56  ? 43.615  44.562 -41.212 1.00 48.85  ? 1253 SER D N     1 
ATOM   8407  C CA    . SER F 5 56  ? 44.233  43.839 -40.117 1.00 50.24  ? 1253 SER D CA    1 
ATOM   8408  C C     . SER F 5 56  ? 45.381  42.948 -40.596 1.00 49.08  ? 1253 SER D C     1 
ATOM   8409  O O     . SER F 5 56  ? 46.369  42.739 -39.867 1.00 47.45  ? 1253 SER D O     1 
ATOM   8410  C CB    . SER F 5 56  ? 43.188  43.028 -39.355 1.00 35.18  ? 1253 SER D CB    1 
ATOM   8411  O OG    . SER F 5 56  ? 42.521  42.213 -40.268 1.00 38.94  ? 1253 SER D OG    1 
ATOM   8412  N N     . LYS F 5 57  ? 45.280  42.435 -41.818 1.00 39.24  ? 1254 LYS D N     1 
ATOM   8413  C CA    . LYS F 5 57  ? 46.360  41.597 -42.307 1.00 40.07  ? 1254 LYS D CA    1 
ATOM   8414  C C     . LYS F 5 57  ? 47.624  42.412 -42.404 1.00 38.57  ? 1254 LYS D C     1 
ATOM   8415  O O     . LYS F 5 57  ? 48.705  41.884 -42.193 1.00 38.40  ? 1254 LYS D O     1 
ATOM   8416  C CB    . LYS F 5 57  ? 46.027  40.989 -43.660 1.00 41.98  ? 1254 LYS D CB    1 
ATOM   8417  C CG    . LYS F 5 57  ? 45.146  39.764 -43.561 1.00 50.71  ? 1254 LYS D CG    1 
ATOM   8418  C CD    . LYS F 5 57  ? 44.978  39.105 -44.920 1.00 57.28  ? 1254 LYS D CD    1 
ATOM   8419  C CE    . LYS F 5 57  ? 43.890  38.044 -44.931 1.00 60.15  ? 1254 LYS D CE    1 
ATOM   8420  N NZ    . LYS F 5 57  ? 43.636  37.640 -46.345 1.00 66.31  ? 1254 LYS D NZ    1 
ATOM   8421  N N     . ALA F 5 58  ? 47.484  43.700 -42.719 1.00 35.60  ? 1255 ALA D N     1 
ATOM   8422  C CA    . ALA F 5 58  ? 48.636  44.599 -42.817 1.00 35.54  ? 1255 ALA D CA    1 
ATOM   8423  C C     . ALA F 5 58  ? 49.125  44.945 -41.423 1.00 32.04  ? 1255 ALA D C     1 
ATOM   8424  O O     . ALA F 5 58  ? 50.321  44.932 -41.164 1.00 35.87  ? 1255 ALA D O     1 
ATOM   8425  C CB    . ALA F 5 58  ? 48.273  45.834 -43.560 1.00 16.78  ? 1255 ALA D CB    1 
ATOM   8426  N N     . MET F 5 59  ? 48.203  45.243 -40.516 1.00 34.77  ? 1256 MET D N     1 
ATOM   8427  C CA    . MET F 5 59  ? 48.591  45.537 -39.139 1.00 34.58  ? 1256 MET D CA    1 
ATOM   8428  C C     . MET F 5 59  ? 49.405  44.368 -38.654 1.00 37.11  ? 1256 MET D C     1 
ATOM   8429  O O     . MET F 5 59  ? 50.412  44.545 -37.994 1.00 38.44  ? 1256 MET D O     1 
ATOM   8430  C CB    . MET F 5 59  ? 47.396  45.690 -38.223 1.00 23.71  ? 1256 MET D CB    1 
ATOM   8431  C CG    . MET F 5 59  ? 47.807  46.105 -36.830 1.00 26.89  ? 1256 MET D CG    1 
ATOM   8432  S SD    . MET F 5 59  ? 48.960  47.515 -36.863 1.00 29.25  ? 1256 MET D SD    1 
ATOM   8433  C CE    . MET F 5 59  ? 47.865  48.965 -36.909 1.00 31.47  ? 1256 MET D CE    1 
ATOM   8434  N N     . SER F 5 60  ? 48.972  43.167 -39.011 1.00 28.06  ? 1257 SER D N     1 
ATOM   8435  C CA    . SER F 5 60  ? 49.682  41.954 -38.624 1.00 33.41  ? 1257 SER D CA    1 
ATOM   8436  C C     . SER F 5 60  ? 51.120  41.939 -39.150 1.00 31.05  ? 1257 SER D C     1 
ATOM   8437  O O     . SER F 5 60  ? 52.055  41.682 -38.395 1.00 33.51  ? 1257 SER D O     1 
ATOM   8438  C CB    . SER F 5 60  ? 48.922  40.745 -39.132 1.00 20.04  ? 1257 SER D CB    1 
ATOM   8439  O OG    . SER F 5 60  ? 49.445  39.568 -38.574 1.00 26.66  ? 1257 SER D OG    1 
ATOM   8440  N N     . ILE F 5 61  ? 51.297  42.202 -40.439 1.00 26.01  ? 1258 ILE D N     1 
ATOM   8441  C CA    . ILE F 5 61  ? 52.651  42.296 -40.988 1.00 29.19  ? 1258 ILE D CA    1 
ATOM   8442  C C     . ILE F 5 61  ? 53.491  43.405 -40.314 1.00 30.01  ? 1258 ILE D C     1 
ATOM   8443  O O     . ILE F 5 61  ? 54.710  43.273 -40.202 1.00 27.84  ? 1258 ILE D O     1 
ATOM   8444  C CB    . ILE F 5 61  ? 52.639  42.580 -42.478 1.00 28.63  ? 1258 ILE D CB    1 
ATOM   8445  C CG1   . ILE F 5 61  ? 52.192  41.320 -43.210 1.00 33.36  ? 1258 ILE D CG1   1 
ATOM   8446  C CG2   . ILE F 5 61  ? 54.023  43.070 -42.920 1.00 23.88  ? 1258 ILE D CG2   1 
ATOM   8447  C CD1   . ILE F 5 61  ? 51.771  41.584 -44.601 1.00 37.24  ? 1258 ILE D CD1   1 
ATOM   8448  N N     . MET F 5 62  ? 52.841  44.495 -39.891 1.00 27.13  ? 1259 MET D N     1 
ATOM   8449  C CA    . MET F 5 62  ? 53.549  45.562 -39.208 1.00 27.81  ? 1259 MET D CA    1 
ATOM   8450  C C     . MET F 5 62  ? 54.001  45.088 -37.832 1.00 27.35  ? 1259 MET D C     1 
ATOM   8451  O O     . MET F 5 62  ? 55.021  45.517 -37.291 1.00 23.93  ? 1259 MET D O     1 
ATOM   8452  C CB    . MET F 5 62  ? 52.663  46.791 -39.044 1.00 23.19  ? 1259 MET D CB    1 
ATOM   8453  C CG    . MET F 5 62  ? 52.558  47.613 -40.294 1.00 21.95  ? 1259 MET D CG    1 
ATOM   8454  S SD    . MET F 5 62  ? 54.145  47.956 -40.968 1.00 27.80  ? 1259 MET D SD    1 
ATOM   8455  C CE    . MET F 5 62  ? 54.653  49.248 -40.013 1.00 25.84  ? 1259 MET D CE    1 
ATOM   8456  N N     . ASN F 5 63  ? 53.230  44.182 -37.270 1.00 34.83  ? 1260 ASN D N     1 
ATOM   8457  C CA    . ASN F 5 63  ? 53.561  43.692 -35.964 1.00 36.64  ? 1260 ASN D CA    1 
ATOM   8458  C C     . ASN F 5 63  ? 54.770  42.759 -36.013 1.00 35.06  ? 1260 ASN D C     1 
ATOM   8459  O O     . ASN F 5 63  ? 55.625  42.758 -35.103 1.00 37.67  ? 1260 ASN D O     1 
ATOM   8460  C CB    . ASN F 5 63  ? 52.357  42.990 -35.379 1.00 17.90  ? 1260 ASN D CB    1 
ATOM   8461  C CG    . ASN F 5 63  ? 52.393  42.994 -33.896 1.00 26.44  ? 1260 ASN D CG    1 
ATOM   8462  O OD1   . ASN F 5 63  ? 52.630  44.022 -33.272 1.00 27.69  ? 1260 ASN D OD1   1 
ATOM   8463  N ND2   . ASN F 5 63  ? 52.176  41.837 -33.313 1.00 23.89  ? 1260 ASN D ND2   1 
ATOM   8464  N N     . SER F 5 64  ? 54.834  41.977 -37.086 1.00 37.47  ? 1261 SER D N     1 
ATOM   8465  C CA    . SER F 5 64  ? 55.932  41.050 -37.274 1.00 38.60  ? 1261 SER D CA    1 
ATOM   8466  C C     . SER F 5 64  ? 57.158  41.864 -37.544 1.00 38.69  ? 1261 SER D C     1 
ATOM   8467  O O     . SER F 5 64  ? 58.246  41.531 -37.076 1.00 39.59  ? 1261 SER D O     1 
ATOM   8468  C CB    . SER F 5 64  ? 55.654  40.132 -38.442 1.00 41.43  ? 1261 SER D CB    1 
ATOM   8469  O OG    . SER F 5 64  ? 54.422  39.484 -38.212 1.00 43.54  ? 1261 SER D OG    1 
ATOM   8470  N N     . PHE F 5 65  ? 56.967  42.942 -38.304 1.00 33.05  ? 1262 PHE D N     1 
ATOM   8471  C CA    . PHE F 5 65  ? 58.046  43.847 -38.630 1.00 32.90  ? 1262 PHE D CA    1 
ATOM   8472  C C     . PHE F 5 65  ? 58.665  44.394 -37.340 1.00 31.30  ? 1262 PHE D C     1 
ATOM   8473  O O     . PHE F 5 65  ? 59.851  44.218 -37.100 1.00 32.59  ? 1262 PHE D O     1 
ATOM   8474  C CB    . PHE F 5 65  ? 57.525  44.977 -39.490 1.00 36.94  ? 1262 PHE D CB    1 
ATOM   8475  C CG    . PHE F 5 65  ? 58.531  46.048 -39.766 1.00 36.98  ? 1262 PHE D CG    1 
ATOM   8476  C CD1   . PHE F 5 65  ? 59.749  45.737 -40.372 1.00 38.23  ? 1262 PHE D CD1   1 
ATOM   8477  C CD2   . PHE F 5 65  ? 58.304  47.361 -39.353 1.00 39.02  ? 1262 PHE D CD2   1 
ATOM   8478  C CE1   . PHE F 5 65  ? 60.714  46.739 -40.583 1.00 40.34  ? 1262 PHE D CE1   1 
ATOM   8479  C CE2   . PHE F 5 65  ? 59.264  48.356 -39.565 1.00 40.44  ? 1262 PHE D CE2   1 
ATOM   8480  C CZ    . PHE F 5 65  ? 60.472  48.047 -40.158 1.00 37.53  ? 1262 PHE D CZ    1 
ATOM   8481  N N     . VAL F 5 66  ? 57.873  45.030 -36.489 1.00 32.40  ? 1263 VAL D N     1 
ATOM   8482  C CA    . VAL F 5 66  ? 58.417  45.575 -35.250 1.00 31.34  ? 1263 VAL D CA    1 
ATOM   8483  C C     . VAL F 5 66  ? 59.139  44.498 -34.398 1.00 33.08  ? 1263 VAL D C     1 
ATOM   8484  O O     . VAL F 5 66  ? 60.310  44.668 -34.000 1.00 31.31  ? 1263 VAL D O     1 
ATOM   8485  C CB    . VAL F 5 66  ? 57.296  46.268 -34.442 1.00 33.17  ? 1263 VAL D CB    1 
ATOM   8486  C CG1   . VAL F 5 66  ? 57.842  46.771 -33.110 1.00 31.25  ? 1263 VAL D CG1   1 
ATOM   8487  C CG2   . VAL F 5 66  ? 56.732  47.439 -35.245 1.00 31.35  ? 1263 VAL D CG2   1 
ATOM   8488  N N     . ASN F 5 67  ? 58.451  43.385 -34.135 1.00 19.96  ? 1264 ASN D N     1 
ATOM   8489  C CA    . ASN F 5 67  ? 59.036  42.303 -33.377 1.00 20.28  ? 1264 ASN D CA    1 
ATOM   8490  C C     . ASN F 5 67  ? 60.316  41.797 -34.045 1.00 17.65  ? 1264 ASN D C     1 
ATOM   8491  O O     . ASN F 5 67  ? 61.276  41.468 -33.390 1.00 18.64  ? 1264 ASN D O     1 
ATOM   8492  C CB    . ASN F 5 67  ? 58.012  41.192 -33.183 1.00 34.75  ? 1264 ASN D CB    1 
ATOM   8493  C CG    . ASN F 5 67  ? 57.037  41.510 -32.051 1.00 39.36  ? 1264 ASN D CG    1 
ATOM   8494  O OD1   . ASN F 5 67  ? 57.415  42.153 -31.067 1.00 40.83  ? 1264 ASN D OD1   1 
ATOM   8495  N ND2   . ASN F 5 67  ? 55.783  41.064 -32.179 1.00 43.75  ? 1264 ASN D ND2   1 
ATOM   8496  N N     . ASP F 5 68  ? 60.347  41.766 -35.360 1.00 23.60  ? 1265 ASP D N     1 
ATOM   8497  C CA    . ASP F 5 68  ? 61.541  41.334 -36.031 1.00 25.83  ? 1265 ASP D CA    1 
ATOM   8498  C C     . ASP F 5 68  ? 62.720  42.259 -35.709 1.00 26.53  ? 1265 ASP D C     1 
ATOM   8499  O O     . ASP F 5 68  ? 63.703  41.854 -35.099 1.00 25.71  ? 1265 ASP D O     1 
ATOM   8500  C CB    . ASP F 5 68  ? 61.305  41.302 -37.535 1.00 33.60  ? 1265 ASP D CB    1 
ATOM   8501  C CG    . ASP F 5 68  ? 62.422  40.614 -38.262 1.00 35.97  ? 1265 ASP D CG    1 
ATOM   8502  O OD1   . ASP F 5 68  ? 63.097  39.817 -37.586 1.00 41.46  ? 1265 ASP D OD1   1 
ATOM   8503  O OD2   . ASP F 5 68  ? 62.627  40.845 -39.479 1.00 33.47  ? 1265 ASP D OD2   1 
ATOM   8504  N N     . VAL F 5 69  ? 62.614  43.515 -36.117 1.00 33.76  ? 1266 VAL D N     1 
ATOM   8505  C CA    . VAL F 5 69  ? 63.682  44.459 -35.902 1.00 30.81  ? 1266 VAL D CA    1 
ATOM   8506  C C     . VAL F 5 69  ? 64.002  44.492 -34.430 1.00 32.33  ? 1266 VAL D C     1 
ATOM   8507  O O     . VAL F 5 69  ? 65.167  44.620 -34.065 1.00 31.53  ? 1266 VAL D O     1 
ATOM   8508  C CB    . VAL F 5 69  ? 63.297  45.893 -36.385 1.00 25.16  ? 1266 VAL D CB    1 
ATOM   8509  C CG1   . VAL F 5 69  ? 64.464  46.849 -36.112 1.00 25.39  ? 1266 VAL D CG1   1 
ATOM   8510  C CG2   . VAL F 5 69  ? 62.938  45.892 -37.866 1.00 24.30  ? 1266 VAL D CG2   1 
ATOM   8511  N N     . PHE F 5 70  ? 62.980  44.403 -33.573 1.00 24.37  ? 1267 PHE D N     1 
ATOM   8512  C CA    . PHE F 5 70  ? 63.250  44.400 -32.137 1.00 26.33  ? 1267 PHE D CA    1 
ATOM   8513  C C     . PHE F 5 70  ? 64.273  43.327 -31.770 1.00 27.63  ? 1267 PHE D C     1 
ATOM   8514  O O     . PHE F 5 70  ? 65.232  43.635 -31.093 1.00 26.61  ? 1267 PHE D O     1 
ATOM   8515  C CB    . PHE F 5 70  ? 62.007  44.119 -31.307 1.00 31.51  ? 1267 PHE D CB    1 
ATOM   8516  C CG    . PHE F 5 70  ? 62.286  44.048 -29.813 1.00 35.37  ? 1267 PHE D CG    1 
ATOM   8517  C CD1   . PHE F 5 70  ? 62.158  45.166 -29.009 1.00 39.02  ? 1267 PHE D CD1   1 
ATOM   8518  C CD2   . PHE F 5 70  ? 62.705  42.857 -29.215 1.00 38.92  ? 1267 PHE D CD2   1 
ATOM   8519  C CE1   . PHE F 5 70  ? 62.438  45.101 -27.641 1.00 38.55  ? 1267 PHE D CE1   1 
ATOM   8520  C CE2   . PHE F 5 70  ? 62.987  42.795 -27.845 1.00 40.42  ? 1267 PHE D CE2   1 
ATOM   8521  C CZ    . PHE F 5 70  ? 62.852  43.921 -27.066 1.00 39.21  ? 1267 PHE D CZ    1 
ATOM   8522  N N     . GLU F 5 71  ? 64.049  42.076 -32.208 1.00 23.15  ? 1268 GLU D N     1 
ATOM   8523  C CA    . GLU F 5 71  ? 64.924  40.945 -31.898 1.00 25.30  ? 1268 GLU D CA    1 
ATOM   8524  C C     . GLU F 5 71  ? 66.292  41.118 -32.518 1.00 24.93  ? 1268 GLU D C     1 
ATOM   8525  O O     . GLU F 5 71  ? 67.328  40.941 -31.859 1.00 24.58  ? 1268 GLU D O     1 
ATOM   8526  C CB    . GLU F 5 71  ? 64.332  39.625 -32.386 1.00 58.63  ? 1268 GLU D CB    1 
ATOM   8527  C CG    . GLU F 5 71  ? 62.951  39.299 -31.870 1.00 70.06  ? 1268 GLU D CG    1 
ATOM   8528  C CD    . GLU F 5 71  ? 62.320  38.156 -32.647 1.00 76.92  ? 1268 GLU D CD    1 
ATOM   8529  O OE1   . GLU F 5 71  ? 62.531  38.096 -33.883 1.00 80.68  ? 1268 GLU D OE1   1 
ATOM   8530  O OE2   . GLU F 5 71  ? 61.610  37.328 -32.034 1.00 81.59  ? 1268 GLU D OE2   1 
ATOM   8531  N N     . ARG F 5 72  ? 66.303  41.467 -33.788 1.00 36.32  ? 1269 ARG D N     1 
ATOM   8532  C CA    . ARG F 5 72  ? 67.552  41.684 -34.443 1.00 35.30  ? 1269 ARG D CA    1 
ATOM   8533  C C     . ARG F 5 72  ? 68.423  42.664 -33.667 1.00 36.46  ? 1269 ARG D C     1 
ATOM   8534  O O     . ARG F 5 72  ? 69.572  42.360 -33.354 1.00 33.07  ? 1269 ARG D O     1 
ATOM   8535  C CB    . ARG F 5 72  ? 67.300  42.228 -35.818 1.00 21.63  ? 1269 ARG D CB    1 
ATOM   8536  C CG    . ARG F 5 72  ? 66.484  41.290 -36.721 1.00 22.90  ? 1269 ARG D CG    1 
ATOM   8537  C CD    . ARG F 5 72  ? 66.998  41.367 -38.150 1.00 25.26  ? 1269 ARG D CD    1 
ATOM   8538  N NE    . ARG F 5 72  ? 65.914  41.444 -39.085 1.00 23.89  ? 1269 ARG D NE    1 
ATOM   8539  C CZ    . ARG F 5 72  ? 66.078  41.811 -40.340 1.00 24.92  ? 1269 ARG D CZ    1 
ATOM   8540  N NH1   . ARG F 5 72  ? 67.285  42.133 -40.773 1.00 20.39  ? 1269 ARG D NH1   1 
ATOM   8541  N NH2   . ARG F 5 72  ? 65.043  41.852 -41.163 1.00 26.91  ? 1269 ARG D NH2   1 
ATOM   8542  N N     . ILE F 5 73  ? 67.883  43.832 -33.338 1.00 41.50  ? 1270 ILE D N     1 
ATOM   8543  C CA    . ILE F 5 73  ? 68.679  44.822 -32.636 1.00 40.22  ? 1270 ILE D CA    1 
ATOM   8544  C C     . ILE F 5 73  ? 69.127  44.351 -31.272 1.00 41.68  ? 1270 ILE D C     1 
ATOM   8545  O O     . ILE F 5 73  ? 70.297  44.491 -30.929 1.00 42.79  ? 1270 ILE D O     1 
ATOM   8546  C CB    . ILE F 5 73  ? 67.946  46.209 -32.499 1.00 22.35  ? 1270 ILE D CB    1 
ATOM   8547  C CG1   . ILE F 5 73  ? 67.880  46.932 -33.853 1.00 20.12  ? 1270 ILE D CG1   1 
ATOM   8548  C CG2   . ILE F 5 73  ? 68.744  47.101 -31.595 1.00 22.62  ? 1270 ILE D CG2   1 
ATOM   8549  C CD1   . ILE F 5 73  ? 67.002  48.117 -33.869 1.00 22.90  ? 1270 ILE D CD1   1 
ATOM   8550  N N     . ALA F 5 74  ? 68.214  43.781 -30.499 1.00 31.73  ? 1271 ALA D N     1 
ATOM   8551  C CA    . ALA F 5 74  ? 68.557  43.311 -29.148 1.00 31.72  ? 1271 ALA D CA    1 
ATOM   8552  C C     . ALA F 5 74  ? 69.608  42.186 -29.206 1.00 30.93  ? 1271 ALA D C     1 
ATOM   8553  O O     . ALA F 5 74  ? 70.492  42.090 -28.363 1.00 30.39  ? 1271 ALA D O     1 
ATOM   8554  C CB    . ALA F 5 74  ? 67.264  42.832 -28.380 1.00 21.00  ? 1271 ALA D CB    1 
ATOM   8555  N N     . GLY F 5 75  ? 69.487  41.337 -30.215 1.00 34.15  ? 1272 GLY D N     1 
ATOM   8556  C CA    . GLY F 5 75  ? 70.444  40.279 -30.362 1.00 35.77  ? 1272 GLY D CA    1 
ATOM   8557  C C     . GLY F 5 75  ? 71.823  40.863 -30.634 1.00 38.98  ? 1272 GLY D C     1 
ATOM   8558  O O     . GLY F 5 75  ? 72.825  40.452 -30.005 1.00 38.62  ? 1272 GLY D O     1 
ATOM   8559  N N     . GLU F 5 76  ? 71.886  41.802 -31.583 1.00 43.00  ? 1273 GLU D N     1 
ATOM   8560  C CA    . GLU F 5 76  ? 73.143  42.436 -31.930 1.00 44.56  ? 1273 GLU D CA    1 
ATOM   8561  C C     . GLU F 5 76  ? 73.650  43.072 -30.663 1.00 41.92  ? 1273 GLU D C     1 
ATOM   8562  O O     . GLU F 5 76  ? 74.840  42.981 -30.341 1.00 42.81  ? 1273 GLU D O     1 
ATOM   8563  C CB    . GLU F 5 76  ? 72.930  43.512 -32.982 1.00 45.38  ? 1273 GLU D CB    1 
ATOM   8564  C CG    . GLU F 5 76  ? 72.774  43.009 -34.391 1.00 50.79  ? 1273 GLU D CG    1 
ATOM   8565  C CD    . GLU F 5 76  ? 74.113  42.630 -35.022 1.00 52.47  ? 1273 GLU D CD    1 
ATOM   8566  O OE1   . GLU F 5 76  ? 75.130  42.611 -34.278 1.00 52.60  ? 1273 GLU D OE1   1 
ATOM   8567  O OE2   . GLU F 5 76  ? 74.143  42.351 -36.251 1.00 53.06  ? 1273 GLU D OE2   1 
ATOM   8568  N N     . ALA F 5 77  ? 72.729  43.700 -29.931 1.00 34.20  ? 1274 ALA D N     1 
ATOM   8569  C CA    . ALA F 5 77  ? 73.067  44.379 -28.682 1.00 35.06  ? 1274 ALA D CA    1 
ATOM   8570  C C     . ALA F 5 77  ? 73.665  43.396 -27.696 1.00 34.63  ? 1274 ALA D C     1 
ATOM   8571  O O     . ALA F 5 77  ? 74.720  43.628 -27.099 1.00 35.33  ? 1274 ALA D O     1 
ATOM   8572  C CB    . ALA F 5 77  ? 71.837  45.001 -28.090 1.00 59.96  ? 1274 ALA D CB    1 
ATOM   8573  N N     . SER F 5 78  ? 72.963  42.284 -27.544 1.00 42.50  ? 1275 SER D N     1 
ATOM   8574  C CA    . SER F 5 78  ? 73.357  41.212 -26.663 1.00 45.20  ? 1275 SER D CA    1 
ATOM   8575  C C     . SER F 5 78  ? 74.792  40.752 -26.879 1.00 45.70  ? 1275 SER D C     1 
ATOM   8576  O O     . SER F 5 78  ? 75.567  40.738 -25.939 1.00 44.24  ? 1275 SER D O     1 
ATOM   8577  C CB    . SER F 5 78  ? 72.404  40.056 -26.866 1.00 40.27  ? 1275 SER D CB    1 
ATOM   8578  O OG    . SER F 5 78  ? 72.644  39.057 -25.917 1.00 43.41  ? 1275 SER D OG    1 
ATOM   8579  N N     . ARG F 5 79  ? 75.142  40.384 -28.113 1.00 50.38  ? 1276 ARG D N     1 
ATOM   8580  C CA    . ARG F 5 79  ? 76.491  39.894 -28.453 1.00 53.03  ? 1276 ARG D CA    1 
ATOM   8581  C C     . ARG F 5 79  ? 77.542  40.959 -28.302 1.00 53.04  ? 1276 ARG D C     1 
ATOM   8582  O O     . ARG F 5 79  ? 78.638  40.690 -27.836 1.00 53.47  ? 1276 ARG D O     1 
ATOM   8583  C CB    . ARG F 5 79  ? 76.538  39.347 -29.887 1.00 40.93  ? 1276 ARG D CB    1 
ATOM   8584  C CG    . ARG F 5 79  ? 75.933  37.976 -30.031 1.00 43.48  ? 1276 ARG D CG    1 
ATOM   8585  C CD    . ARG F 5 79  ? 75.725  37.624 -31.475 1.00 46.76  ? 1276 ARG D CD    1 
ATOM   8586  N NE    . ARG F 5 79  ? 74.312  37.669 -31.843 1.00 52.79  ? 1276 ARG D NE    1 
ATOM   8587  C CZ    . ARG F 5 79  ? 73.829  38.441 -32.807 1.00 52.93  ? 1276 ARG D CZ    1 
ATOM   8588  N NH1   . ARG F 5 79  ? 74.652  39.233 -33.494 1.00 60.29  ? 1276 ARG D NH1   1 
ATOM   8589  N NH2   . ARG F 5 79  ? 72.539  38.409 -33.092 1.00 56.96  ? 1276 ARG D NH2   1 
ATOM   8590  N N     . LEU F 5 80  ? 77.208  42.168 -28.717 1.00 44.49  ? 1277 LEU D N     1 
ATOM   8591  C CA    . LEU F 5 80  ? 78.123  43.295 -28.583 1.00 45.51  ? 1277 LEU D CA    1 
ATOM   8592  C C     . LEU F 5 80  ? 78.582  43.369 -27.104 1.00 45.30  ? 1277 LEU D C     1 
ATOM   8593  O O     . LEU F 5 80  ? 79.761  43.575 -26.785 1.00 45.98  ? 1277 LEU D O     1 
ATOM   8594  C CB    . LEU F 5 80  ? 77.376  44.584 -28.968 1.00 30.34  ? 1277 LEU D CB    1 
ATOM   8595  C CG    . LEU F 5 80  ? 78.204  45.813 -29.326 1.00 34.71  ? 1277 LEU D CG    1 
ATOM   8596  C CD1   . LEU F 5 80  ? 79.412  45.402 -30.162 1.00 31.60  ? 1277 LEU D CD1   1 
ATOM   8597  C CD2   . LEU F 5 80  ? 77.319  46.773 -30.097 1.00 36.92  ? 1277 LEU D CD2   1 
ATOM   8598  N N     . ALA F 5 81  ? 77.616  43.206 -26.208 1.00 39.87  ? 1278 ALA D N     1 
ATOM   8599  C CA    . ALA F 5 81  ? 77.887  43.237 -24.793 1.00 41.60  ? 1278 ALA D CA    1 
ATOM   8600  C C     . ALA F 5 81  ? 78.900  42.152 -24.436 1.00 42.67  ? 1278 ALA D C     1 
ATOM   8601  O O     . ALA F 5 81  ? 79.952  42.431 -23.845 1.00 43.36  ? 1278 ALA D O     1 
ATOM   8602  C CB    . ALA F 5 81  ? 76.583  43.025 -24.021 1.00 58.69  ? 1278 ALA D CB    1 
ATOM   8603  N N     . HIS F 5 82  ? 78.591  40.911 -24.806 1.00 37.31  ? 1279 HIS D N     1 
ATOM   8604  C CA    . HIS F 5 82  ? 79.479  39.830 -24.468 1.00 39.25  ? 1279 HIS D CA    1 
ATOM   8605  C C     . HIS F 5 82  ? 80.844  39.996 -25.098 1.00 38.50  ? 1279 HIS D C     1 
ATOM   8606  O O     . HIS F 5 82  ? 81.843  39.804 -24.437 1.00 40.26  ? 1279 HIS D O     1 
ATOM   8607  C CB    . HIS F 5 82  ? 78.871  38.485 -24.846 1.00 68.80  ? 1279 HIS D CB    1 
ATOM   8608  C CG    . HIS F 5 82  ? 77.606  38.167 -24.088 1.00 74.04  ? 1279 HIS D CG    1 
ATOM   8609  N ND1   . HIS F 5 82  ? 77.385  38.587 -22.807 1.00 79.20  ? 1279 HIS D ND1   1 
ATOM   8610  C CD2   . HIS F 5 82  ? 76.526  37.425 -24.450 1.00 76.47  ? 1279 HIS D CD2   1 
ATOM   8611  C CE1   . HIS F 5 82  ? 76.208  38.118 -22.388 1.00 78.43  ? 1279 HIS D CE1   1 
ATOM   8612  N NE2   . HIS F 5 82  ? 75.679  37.417 -23.359 1.00 78.30  ? 1279 HIS D NE2   1 
ATOM   8613  N N     . TYR F 5 83  ? 80.929  40.376 -26.358 1.00 49.22  ? 1280 TYR D N     1 
ATOM   8614  C CA    . TYR F 5 83  ? 82.261  40.487 -26.931 1.00 50.63  ? 1280 TYR D CA    1 
ATOM   8615  C C     . TYR F 5 83  ? 83.051  41.427 -26.079 1.00 51.45  ? 1280 TYR D C     1 
ATOM   8616  O O     . TYR F 5 83  ? 84.267  41.345 -26.024 1.00 51.86  ? 1280 TYR D O     1 
ATOM   8617  C CB    . TYR F 5 83  ? 82.230  41.033 -28.357 1.00 51.37  ? 1280 TYR D CB    1 
ATOM   8618  C CG    . TYR F 5 83  ? 81.407  40.212 -29.321 1.00 54.12  ? 1280 TYR D CG    1 
ATOM   8619  C CD1   . TYR F 5 83  ? 80.991  40.754 -30.540 1.00 53.96  ? 1280 TYR D CD1   1 
ATOM   8620  C CD2   . TYR F 5 83  ? 81.037  38.900 -29.018 1.00 54.54  ? 1280 TYR D CD2   1 
ATOM   8621  C CE1   . TYR F 5 83  ? 80.237  40.027 -31.423 1.00 56.11  ? 1280 TYR D CE1   1 
ATOM   8622  C CE2   . TYR F 5 83  ? 80.273  38.152 -29.906 1.00 56.59  ? 1280 TYR D CE2   1 
ATOM   8623  C CZ    . TYR F 5 83  ? 79.878  38.724 -31.111 1.00 59.05  ? 1280 TYR D CZ    1 
ATOM   8624  O OH    . TYR F 5 83  ? 79.149  37.989 -32.024 1.00 60.37  ? 1280 TYR D OH    1 
ATOM   8625  N N     . ASN F 5 84  ? 82.359  42.307 -25.380 1.00 48.77  ? 1281 ASN D N     1 
ATOM   8626  C CA    . ASN F 5 84  ? 83.059  43.288 -24.583 1.00 49.20  ? 1281 ASN D CA    1 
ATOM   8627  C C     . ASN F 5 84  ? 83.056  43.066 -23.100 1.00 48.91  ? 1281 ASN D C     1 
ATOM   8628  O O     . ASN F 5 84  ? 83.433  43.960 -22.341 1.00 49.24  ? 1281 ASN D O     1 
ATOM   8629  C CB    . ASN F 5 84  ? 82.524  44.663 -24.921 1.00 30.99  ? 1281 ASN D CB    1 
ATOM   8630  C CG    . ASN F 5 84  ? 83.100  45.171 -26.193 1.00 32.51  ? 1281 ASN D CG    1 
ATOM   8631  O OD1   . ASN F 5 84  ? 84.260  45.551 -26.208 1.00 30.14  ? 1281 ASN D OD1   1 
ATOM   8632  N ND2   . ASN F 5 84  ? 82.325  45.157 -27.286 1.00 32.08  ? 1281 ASN D ND2   1 
ATOM   8633  N N     . LYS F 5 85  ? 82.660  41.867 -22.687 1.00 39.99  ? 1282 LYS D N     1 
ATOM   8634  C CA    . LYS F 5 85  ? 82.621  41.523 -21.267 1.00 42.71  ? 1282 LYS D CA    1 
ATOM   8635  C C     . LYS F 5 85  ? 81.909  42.602 -20.460 1.00 41.70  ? 1282 LYS D C     1 
ATOM   8636  O O     . LYS F 5 85  ? 82.415  43.046 -19.444 1.00 42.19  ? 1282 LYS D O     1 
ATOM   8637  C CB    . LYS F 5 85  ? 84.040  41.323 -20.725 1.00 54.02  ? 1282 LYS D CB    1 
ATOM   8638  C CG    . LYS F 5 85  ? 84.876  40.356 -21.540 1.00 58.97  ? 1282 LYS D CG    1 
ATOM   8639  C CD    . LYS F 5 85  ? 86.308  40.330 -21.072 1.00 65.19  ? 1282 LYS D CD    1 
ATOM   8640  C CE    . LYS F 5 85  ? 87.239  39.790 -22.163 1.00 67.07  ? 1282 LYS D CE    1 
ATOM   8641  N NZ    . LYS F 5 85  ? 88.697  39.919 -21.797 1.00 72.56  ? 1282 LYS D NZ    1 
ATOM   8642  N N     . ARG F 5 86  ? 80.746  43.026 -20.949 1.00 45.07  ? 1283 ARG D N     1 
ATOM   8643  C CA    . ARG F 5 86  ? 79.912  44.027 -20.300 1.00 45.76  ? 1283 ARG D CA    1 
ATOM   8644  C C     . ARG F 5 86  ? 78.607  43.321 -19.928 1.00 44.42  ? 1283 ARG D C     1 
ATOM   8645  O O     . ARG F 5 86  ? 78.007  42.609 -20.735 1.00 43.29  ? 1283 ARG D O     1 
ATOM   8646  C CB    . ARG F 5 86  ? 79.632  45.192 -21.250 1.00 55.02  ? 1283 ARG D CB    1 
ATOM   8647  C CG    . ARG F 5 86  ? 80.827  46.049 -21.527 1.00 62.50  ? 1283 ARG D CG    1 
ATOM   8648  C CD    . ARG F 5 86  ? 81.266  46.780 -20.263 1.00 68.37  ? 1283 ARG D CD    1 
ATOM   8649  N NE    . ARG F 5 86  ? 82.409  47.673 -20.470 1.00 75.43  ? 1283 ARG D NE    1 
ATOM   8650  C CZ    . ARG F 5 86  ? 83.683  47.317 -20.319 1.00 78.95  ? 1283 ARG D CZ    1 
ATOM   8651  N NH1   . ARG F 5 86  ? 83.999  46.076 -19.947 1.00 82.44  ? 1283 ARG D NH1   1 
ATOM   8652  N NH2   . ARG F 5 86  ? 84.642  48.204 -20.558 1.00 81.79  ? 1283 ARG D NH2   1 
ATOM   8653  N N     . SER F 5 87  ? 78.155  43.498 -18.703 1.00 39.48  ? 1284 SER D N     1 
ATOM   8654  C CA    . SER F 5 87  ? 76.941  42.820 -18.301 1.00 39.34  ? 1284 SER D CA    1 
ATOM   8655  C C     . SER F 5 87  ? 75.710  43.676 -18.500 1.00 36.77  ? 1284 SER D C     1 
ATOM   8656  O O     . SER F 5 87  ? 74.589  43.261 -18.210 1.00 35.52  ? 1284 SER D O     1 
ATOM   8657  C CB    . SER F 5 87  ? 77.053  42.386 -16.843 1.00 34.88  ? 1284 SER D CB    1 
ATOM   8658  O OG    . SER F 5 87  ? 77.711  43.388 -16.106 1.00 35.54  ? 1284 SER D OG    1 
ATOM   8659  N N     . THR F 5 88  ? 75.908  44.867 -19.032 1.00 56.06  ? 1285 THR D N     1 
ATOM   8660  C CA    . THR F 5 88  ? 74.775  45.741 -19.209 1.00 55.28  ? 1285 THR D CA    1 
ATOM   8661  C C     . THR F 5 88  ? 74.548  46.224 -20.632 1.00 53.63  ? 1285 THR D C     1 
ATOM   8662  O O     . THR F 5 88  ? 75.473  46.635 -21.311 1.00 53.33  ? 1285 THR D O     1 
ATOM   8663  C CB    . THR F 5 88  ? 74.910  46.954 -18.287 1.00 55.73  ? 1285 THR D CB    1 
ATOM   8664  O OG1   . THR F 5 88  ? 75.228  46.514 -16.957 1.00 57.19  ? 1285 THR D OG1   1 
ATOM   8665  C CG2   . THR F 5 88  ? 73.610  47.744 -18.270 1.00 55.44  ? 1285 THR D CG2   1 
ATOM   8666  N N     . ILE F 5 89  ? 73.309  46.147 -21.092 1.00 41.68  ? 1286 ILE D N     1 
ATOM   8667  C CA    . ILE F 5 89  ? 72.994  46.650 -22.413 1.00 40.29  ? 1286 ILE D CA    1 
ATOM   8668  C C     . ILE F 5 89  ? 72.540  48.077 -22.142 1.00 40.00  ? 1286 ILE D C     1 
ATOM   8669  O O     . ILE F 5 89  ? 71.545  48.293 -21.430 1.00 40.99  ? 1286 ILE D O     1 
ATOM   8670  C CB    . ILE F 5 89  ? 71.802  45.887 -23.086 1.00 30.52  ? 1286 ILE D CB    1 
ATOM   8671  C CG1   . ILE F 5 89  ? 72.188  44.425 -23.341 1.00 31.80  ? 1286 ILE D CG1   1 
ATOM   8672  C CG2   . ILE F 5 89  ? 71.397  46.566 -24.399 1.00 30.58  ? 1286 ILE D CG2   1 
ATOM   8673  C CD1   . ILE F 5 89  ? 71.146  43.648 -24.095 1.00 31.16  ? 1286 ILE D CD1   1 
ATOM   8674  N N     . THR F 5 90  ? 73.268  49.050 -22.668 1.00 37.30  ? 1287 THR D N     1 
ATOM   8675  C CA    . THR F 5 90  ? 72.866  50.427 -22.480 1.00 38.97  ? 1287 THR D CA    1 
ATOM   8676  C C     . THR F 5 90  ? 72.499  51.060 -23.835 1.00 39.69  ? 1287 THR D C     1 
ATOM   8677  O O     . THR F 5 90  ? 72.631  50.425 -24.891 1.00 40.10  ? 1287 THR D O     1 
ATOM   8678  C CB    . THR F 5 90  ? 73.991  51.217 -21.873 1.00 52.18  ? 1287 THR D CB    1 
ATOM   8679  O OG1   . THR F 5 90  ? 75.011  51.402 -22.856 1.00 47.28  ? 1287 THR D OG1   1 
ATOM   8680  C CG2   . THR F 5 90  ? 74.577  50.459 -20.715 1.00 54.00  ? 1287 THR D CG2   1 
ATOM   8681  N N     . SER F 5 91  ? 72.037  52.310 -23.811 1.00 40.32  ? 1288 SER D N     1 
ATOM   8682  C CA    . SER F 5 91  ? 71.705  52.978 -25.058 1.00 40.37  ? 1288 SER D CA    1 
ATOM   8683  C C     . SER F 5 91  ? 72.930  52.922 -25.977 1.00 41.20  ? 1288 SER D C     1 
ATOM   8684  O O     . SER F 5 91  ? 72.797  52.891 -27.195 1.00 43.29  ? 1288 SER D O     1 
ATOM   8685  C CB    . SER F 5 91  ? 71.258  54.436 -24.806 1.00 44.14  ? 1288 SER D CB    1 
ATOM   8686  O OG    . SER F 5 91  ? 72.321  55.302 -24.455 1.00 45.83  ? 1288 SER D OG    1 
ATOM   8687  N N     . ARG F 5 92  ? 74.125  52.864 -25.404 1.00 41.73  ? 1289 ARG D N     1 
ATOM   8688  C CA    . ARG F 5 92  ? 75.319  52.805 -26.245 1.00 42.06  ? 1289 ARG D CA    1 
ATOM   8689  C C     . ARG F 5 92  ? 75.468  51.493 -27.042 1.00 42.35  ? 1289 ARG D C     1 
ATOM   8690  O O     . ARG F 5 92  ? 75.972  51.504 -28.163 1.00 38.09  ? 1289 ARG D O     1 
ATOM   8691  C CB    . ARG F 5 92  ? 76.577  53.055 -25.423 1.00 43.74  ? 1289 ARG D CB    1 
ATOM   8692  C CG    . ARG F 5 92  ? 77.798  53.235 -26.267 1.00 49.12  ? 1289 ARG D CG    1 
ATOM   8693  C CD    . ARG F 5 92  ? 78.831  54.042 -25.521 1.00 55.42  ? 1289 ARG D CD    1 
ATOM   8694  N NE    . ARG F 5 92  ? 79.972  54.354 -26.374 1.00 55.11  ? 1289 ARG D NE    1 
ATOM   8695  C CZ    . ARG F 5 92  ? 80.898  53.466 -26.721 1.00 54.90  ? 1289 ARG D CZ    1 
ATOM   8696  N NH1   . ARG F 5 92  ? 80.808  52.219 -26.275 1.00 51.83  ? 1289 ARG D NH1   1 
ATOM   8697  N NH2   . ARG F 5 92  ? 81.906  53.816 -27.520 1.00 55.90  ? 1289 ARG D NH2   1 
ATOM   8698  N N     . GLU F 5 93  ? 75.033  50.365 -26.479 1.00 54.53  ? 1290 GLU D N     1 
ATOM   8699  C CA    . GLU F 5 93  ? 75.118  49.113 -27.221 1.00 55.58  ? 1290 GLU D CA    1 
ATOM   8700  C C     . GLU F 5 93  ? 74.012  49.176 -28.257 1.00 53.76  ? 1290 GLU D C     1 
ATOM   8701  O O     . GLU F 5 93  ? 74.233  48.826 -29.420 1.00 53.51  ? 1290 GLU D O     1 
ATOM   8702  C CB    . GLU F 5 93  ? 74.882  47.893 -26.338 1.00 53.29  ? 1290 GLU D CB    1 
ATOM   8703  C CG    . GLU F 5 93  ? 75.238  48.049 -24.856 1.00 62.30  ? 1290 GLU D CG    1 
ATOM   8704  C CD    . GLU F 5 93  ? 76.562  48.730 -24.606 1.00 60.53  ? 1290 GLU D CD    1 
ATOM   8705  O OE1   . GLU F 5 93  ? 77.615  48.226 -25.046 1.00 63.57  ? 1290 GLU D OE1   1 
ATOM   8706  O OE2   . GLU F 5 93  ? 76.537  49.784 -23.951 1.00 63.92  ? 1290 GLU D OE2   1 
ATOM   8707  N N     . ILE F 5 94  ? 72.832  49.649 -27.840 1.00 34.05  ? 1291 ILE D N     1 
ATOM   8708  C CA    . ILE F 5 94  ? 71.691  49.748 -28.744 1.00 31.30  ? 1291 ILE D CA    1 
ATOM   8709  C C     . ILE F 5 94  ? 72.039  50.539 -29.975 1.00 32.54  ? 1291 ILE D C     1 
ATOM   8710  O O     . ILE F 5 94  ? 71.678  50.150 -31.091 1.00 32.60  ? 1291 ILE D O     1 
ATOM   8711  C CB    . ILE F 5 94  ? 70.458  50.416 -28.092 1.00 38.95  ? 1291 ILE D CB    1 
ATOM   8712  C CG1   . ILE F 5 94  ? 69.975  49.579 -26.912 1.00 40.86  ? 1291 ILE D CG1   1 
ATOM   8713  C CG2   . ILE F 5 94  ? 69.293  50.510 -29.121 1.00 33.87  ? 1291 ILE D CG2   1 
ATOM   8714  C CD1   . ILE F 5 94  ? 69.390  48.233 -27.338 1.00 40.97  ? 1291 ILE D CD1   1 
ATOM   8715  N N     . GLN F 5 95  ? 72.749  51.648 -29.787 1.00 40.55  ? 1292 GLN D N     1 
ATOM   8716  C CA    . GLN F 5 95  ? 73.129  52.477 -30.919 1.00 40.34  ? 1292 GLN D CA    1 
ATOM   8717  C C     . GLN F 5 95  ? 74.153  51.809 -31.846 1.00 37.24  ? 1292 GLN D C     1 
ATOM   8718  O O     . GLN F 5 95  ? 74.106  52.002 -33.055 1.00 38.53  ? 1292 GLN D O     1 
ATOM   8719  C CB    . GLN F 5 95  ? 73.664  53.811 -30.434 1.00 46.48  ? 1292 GLN D CB    1 
ATOM   8720  C CG    . GLN F 5 95  ? 73.845  54.799 -31.551 1.00 47.16  ? 1292 GLN D CG    1 
ATOM   8721  C CD    . GLN F 5 95  ? 74.399  56.104 -31.077 1.00 47.74  ? 1292 GLN D CD    1 
ATOM   8722  O OE1   . GLN F 5 95  ? 75.597  56.225 -30.825 1.00 50.59  ? 1292 GLN D OE1   1 
ATOM   8723  N NE2   . GLN F 5 95  ? 73.532  57.096 -30.939 1.00 40.80  ? 1292 GLN D NE2   1 
ATOM   8724  N N     . THR F 5 96  ? 75.086  51.036 -31.296 1.00 31.32  ? 1293 THR D N     1 
ATOM   8725  C CA    . THR F 5 96  ? 76.046  50.361 -32.158 1.00 33.25  ? 1293 THR D CA    1 
ATOM   8726  C C     . THR F 5 96  ? 75.297  49.296 -32.940 1.00 30.87  ? 1293 THR D C     1 
ATOM   8727  O O     . THR F 5 96  ? 75.534  49.103 -34.125 1.00 31.47  ? 1293 THR D O     1 
ATOM   8728  C CB    . THR F 5 96  ? 77.169  49.653 -31.375 1.00 38.97  ? 1293 THR D CB    1 
ATOM   8729  O OG1   . THR F 5 96  ? 77.893  50.595 -30.589 1.00 40.77  ? 1293 THR D OG1   1 
ATOM   8730  C CG2   . THR F 5 96  ? 78.149  49.019 -32.328 1.00 37.55  ? 1293 THR D CG2   1 
ATOM   8731  N N     . ALA F 5 97  ? 74.379  48.607 -32.277 1.00 33.17  ? 1294 ALA D N     1 
ATOM   8732  C CA    . ALA F 5 97  ? 73.624  47.552 -32.947 1.00 33.80  ? 1294 ALA D CA    1 
ATOM   8733  C C     . ALA F 5 97  ? 72.791  48.124 -34.078 1.00 35.02  ? 1294 ALA D C     1 
ATOM   8734  O O     . ALA F 5 97  ? 72.516  47.461 -35.091 1.00 35.97  ? 1294 ALA D O     1 
ATOM   8735  C CB    . ALA F 5 97  ? 72.711  46.842 -31.956 1.00 37.76  ? 1294 ALA D CB    1 
ATOM   8736  N N     . VAL F 5 98  ? 72.351  49.356 -33.900 1.00 32.29  ? 1295 VAL D N     1 
ATOM   8737  C CA    . VAL F 5 98  ? 71.544  49.960 -34.933 1.00 31.81  ? 1295 VAL D CA    1 
ATOM   8738  C C     . VAL F 5 98  ? 72.428  50.303 -36.107 1.00 30.56  ? 1295 VAL D C     1 
ATOM   8739  O O     . VAL F 5 98  ? 72.003  50.207 -37.250 1.00 30.03  ? 1295 VAL D O     1 
ATOM   8740  C CB    . VAL F 5 98  ? 70.850  51.199 -34.412 1.00 28.09  ? 1295 VAL D CB    1 
ATOM   8741  C CG1   . VAL F 5 98  ? 70.482  52.108 -35.567 1.00 27.33  ? 1295 VAL D CG1   1 
ATOM   8742  C CG2   . VAL F 5 98  ? 69.637  50.782 -33.594 1.00 25.61  ? 1295 VAL D CG2   1 
ATOM   8743  N N     . ARG F 5 99  ? 73.664  50.689 -35.814 1.00 28.87  ? 1296 ARG D N     1 
ATOM   8744  C CA    . ARG F 5 99  ? 74.613  51.039 -36.853 1.00 30.49  ? 1296 ARG D CA    1 
ATOM   8745  C C     . ARG F 5 99  ? 75.049  49.767 -37.555 1.00 31.20  ? 1296 ARG D C     1 
ATOM   8746  O O     . ARG F 5 99  ? 75.212  49.738 -38.782 1.00 30.65  ? 1296 ARG D O     1 
ATOM   8747  C CB    . ARG F 5 99  ? 75.821  51.782 -36.264 1.00 43.92  ? 1296 ARG D CB    1 
ATOM   8748  C CG    . ARG F 5 99  ? 75.523  53.226 -35.836 1.00 51.14  ? 1296 ARG D CG    1 
ATOM   8749  C CD    . ARG F 5 99  ? 76.653  54.162 -36.245 1.00 57.59  ? 1296 ARG D CD    1 
ATOM   8750  N NE    . ARG F 5 99  ? 76.345  55.587 -36.084 1.00 61.54  ? 1296 ARG D NE    1 
ATOM   8751  C CZ    . ARG F 5 99  ? 76.435  56.254 -34.933 1.00 63.46  ? 1296 ARG D CZ    1 
ATOM   8752  N NH1   . ARG F 5 99  ? 76.823  55.636 -33.829 1.00 61.22  ? 1296 ARG D NH1   1 
ATOM   8753  N NH2   . ARG F 5 99  ? 76.141  57.546 -34.882 1.00 65.65  ? 1296 ARG D NH2   1 
ATOM   8754  N N     . LEU F 5 100 ? 75.222  48.707 -36.782 1.00 30.89  ? 1297 LEU D N     1 
ATOM   8755  C CA    . LEU F 5 100 ? 75.628  47.437 -37.358 1.00 32.89  ? 1297 LEU D CA    1 
ATOM   8756  C C     . LEU F 5 100 ? 74.554  46.839 -38.246 1.00 33.85  ? 1297 LEU D C     1 
ATOM   8757  O O     . LEU F 5 100 ? 74.878  46.332 -39.317 1.00 33.37  ? 1297 LEU D O     1 
ATOM   8758  C CB    . LEU F 5 100 ? 76.001  46.428 -36.265 1.00 35.58  ? 1297 LEU D CB    1 
ATOM   8759  C CG    . LEU F 5 100 ? 77.446  46.551 -35.761 1.00 37.41  ? 1297 LEU D CG    1 
ATOM   8760  C CD1   . LEU F 5 100 ? 77.659  45.612 -34.598 1.00 35.59  ? 1297 LEU D CD1   1 
ATOM   8761  C CD2   . LEU F 5 100 ? 78.441  46.285 -36.908 1.00 37.15  ? 1297 LEU D CD2   1 
ATOM   8762  N N     . LEU F 5 101 ? 73.288  46.933 -37.825 1.00 37.92  ? 1298 LEU D N     1 
ATOM   8763  C CA    . LEU F 5 101 ? 72.164  46.353 -38.560 1.00 37.74  ? 1298 LEU D CA    1 
ATOM   8764  C C     . LEU F 5 101 ? 71.482  47.110 -39.720 1.00 39.50  ? 1298 LEU D C     1 
ATOM   8765  O O     . LEU F 5 101 ? 71.131  46.497 -40.733 1.00 41.31  ? 1298 LEU D O     1 
ATOM   8766  C CB    . LEU F 5 101 ? 71.094  45.916 -37.553 1.00 54.86  ? 1298 LEU D CB    1 
ATOM   8767  C CG    . LEU F 5 101 ? 69.767  45.380 -38.110 1.00 59.88  ? 1298 LEU D CG    1 
ATOM   8768  C CD1   . LEU F 5 101 ? 70.014  44.154 -38.953 1.00 61.74  ? 1298 LEU D CD1   1 
ATOM   8769  C CD2   . LEU F 5 101 ? 68.847  45.007 -36.984 1.00 57.61  ? 1298 LEU D CD2   1 
ATOM   8770  N N     . LEU F 5 102 ? 71.302  48.422 -39.597 1.00 24.80  ? 1299 LEU D N     1 
ATOM   8771  C CA    . LEU F 5 102 ? 70.604  49.183 -40.629 1.00 26.20  ? 1299 LEU D CA    1 
ATOM   8772  C C     . LEU F 5 102 ? 71.444  49.770 -41.731 1.00 26.26  ? 1299 LEU D C     1 
ATOM   8773  O O     . LEU F 5 102 ? 72.597  50.097 -41.516 1.00 28.76  ? 1299 LEU D O     1 
ATOM   8774  C CB    . LEU F 5 102 ? 69.822  50.315 -39.998 1.00 35.08  ? 1299 LEU D CB    1 
ATOM   8775  C CG    . LEU F 5 102 ? 68.899  49.936 -38.865 1.00 38.39  ? 1299 LEU D CG    1 
ATOM   8776  C CD1   . LEU F 5 102 ? 68.253  51.180 -38.381 1.00 34.49  ? 1299 LEU D CD1   1 
ATOM   8777  C CD2   . LEU F 5 102 ? 67.852  48.963 -39.334 1.00 33.77  ? 1299 LEU D CD2   1 
ATOM   8778  N N     . PRO F 5 103 ? 70.879  49.878 -42.943 1.00 40.93  ? 1300 PRO D N     1 
ATOM   8779  C CA    . PRO F 5 103 ? 71.542  50.435 -44.128 1.00 43.60  ? 1300 PRO D CA    1 
ATOM   8780  C C     . PRO F 5 103 ? 71.804  51.911 -43.915 1.00 42.10  ? 1300 PRO D C     1 
ATOM   8781  O O     . PRO F 5 103 ? 71.051  52.579 -43.194 1.00 45.78  ? 1300 PRO D O     1 
ATOM   8782  C CB    . PRO F 5 103 ? 70.529  50.230 -45.230 1.00 39.10  ? 1300 PRO D CB    1 
ATOM   8783  C CG    . PRO F 5 103 ? 69.849  48.998 -44.864 1.00 39.69  ? 1300 PRO D CG    1 
ATOM   8784  C CD    . PRO F 5 103 ? 69.794  48.959 -43.340 1.00 37.19  ? 1300 PRO D CD    1 
ATOM   8785  N N     . GLY F 5 104 ? 72.860  52.403 -44.561 1.00 36.73  ? 1301 GLY D N     1 
ATOM   8786  C CA    . GLY F 5 104 ? 73.272  53.793 -44.464 1.00 35.84  ? 1301 GLY D CA    1 
ATOM   8787  C C     . GLY F 5 104 ? 72.357  54.931 -44.044 1.00 36.88  ? 1301 GLY D C     1 
ATOM   8788  O O     . GLY F 5 104 ? 72.492  55.473 -42.952 1.00 38.47  ? 1301 GLY D O     1 
ATOM   8789  N N     . GLU F 5 105 ? 71.437  55.315 -44.910 1.00 38.50  ? 1302 GLU D N     1 
ATOM   8790  C CA    . GLU F 5 105 ? 70.575  56.436 -44.590 1.00 38.45  ? 1302 GLU D CA    1 
ATOM   8791  C C     . GLU F 5 105 ? 69.594  56.167 -43.472 1.00 40.59  ? 1302 GLU D C     1 
ATOM   8792  O O     . GLU F 5 105 ? 69.308  57.057 -42.676 1.00 39.28  ? 1302 GLU D O     1 
ATOM   8793  C CB    . GLU F 5 105 ? 69.821  56.908 -45.821 1.00 56.66  ? 1302 GLU D CB    1 
ATOM   8794  C CG    . GLU F 5 105 ? 69.350  58.330 -45.704 1.00 66.23  ? 1302 GLU D CG    1 
ATOM   8795  C CD    . GLU F 5 105 ? 70.484  59.270 -45.331 1.00 68.11  ? 1302 GLU D CD    1 
ATOM   8796  O OE1   . GLU F 5 105 ? 71.598  59.084 -45.868 1.00 68.86  ? 1302 GLU D OE1   1 
ATOM   8797  O OE2   . GLU F 5 105 ? 70.270  60.197 -44.507 1.00 73.67  ? 1302 GLU D OE2   1 
ATOM   8798  N N     . LEU F 5 106 ? 69.068  54.950 -43.407 1.00 50.49  ? 1303 LEU D N     1 
ATOM   8799  C CA    . LEU F 5 106 ? 68.125  54.619 -42.358 1.00 47.11  ? 1303 LEU D CA    1 
ATOM   8800  C C     . LEU F 5 106 ? 68.802  54.748 -41.021 1.00 45.60  ? 1303 LEU D C     1 
ATOM   8801  O O     . LEU F 5 106 ? 68.239  55.299 -40.088 1.00 45.80  ? 1303 LEU D O     1 
ATOM   8802  C CB    . LEU F 5 106 ? 67.608  53.197 -42.514 1.00 24.66  ? 1303 LEU D CB    1 
ATOM   8803  C CG    . LEU F 5 106 ? 66.287  53.022 -43.267 1.00 25.00  ? 1303 LEU D CG    1 
ATOM   8804  C CD1   . LEU F 5 106 ? 65.875  51.550 -43.314 1.00 20.96  ? 1303 LEU D CD1   1 
ATOM   8805  C CD2   . LEU F 5 106 ? 65.231  53.843 -42.589 1.00 22.23  ? 1303 LEU D CD2   1 
ATOM   8806  N N     . ALA F 5 107 ? 70.024  54.242 -40.938 1.00 36.01  ? 1304 ALA D N     1 
ATOM   8807  C CA    . ALA F 5 107 ? 70.802  54.265 -39.705 1.00 37.24  ? 1304 ALA D CA    1 
ATOM   8808  C C     . ALA F 5 107 ? 71.058  55.678 -39.182 1.00 41.06  ? 1304 ALA D C     1 
ATOM   8809  O O     . ALA F 5 107 ? 70.850  55.977 -37.993 1.00 40.24  ? 1304 ALA D O     1 
ATOM   8810  C CB    . ALA F 5 107 ? 72.112  53.537 -39.931 1.00 23.17  ? 1304 ALA D CB    1 
ATOM   8811  N N     . LYS F 5 108 ? 71.507  56.547 -40.078 1.00 36.95  ? 1305 LYS D N     1 
ATOM   8812  C CA    . LYS F 5 108 ? 71.765  57.915 -39.702 1.00 39.07  ? 1305 LYS D CA    1 
ATOM   8813  C C     . LYS F 5 108 ? 70.520  58.488 -39.057 1.00 40.24  ? 1305 LYS D C     1 
ATOM   8814  O O     . LYS F 5 108 ? 70.564  58.988 -37.945 1.00 38.43  ? 1305 LYS D O     1 
ATOM   8815  C CB    . LYS F 5 108 ? 72.197  58.726 -40.921 1.00 66.09  ? 1305 LYS D CB    1 
ATOM   8816  C CG    . LYS F 5 108 ? 73.690  58.564 -41.212 1.00 76.08  ? 1305 LYS D CG    1 
ATOM   8817  C CD    . LYS F 5 108 ? 74.135  59.286 -42.477 1.00 80.34  ? 1305 LYS D CD    1 
ATOM   8818  C CE    . LYS F 5 108 ? 73.596  58.598 -43.729 1.00 83.86  ? 1305 LYS D CE    1 
ATOM   8819  N NZ    . LYS F 5 108 ? 73.924  59.337 -44.987 1.00 88.32  ? 1305 LYS D NZ    1 
ATOM   8820  N N     . HIS F 5 109 ? 69.392  58.379 -39.722 1.00 37.35  ? 1306 HIS D N     1 
ATOM   8821  C CA    . HIS F 5 109 ? 68.196  58.912 -39.144 1.00 39.07  ? 1306 HIS D CA    1 
ATOM   8822  C C     . HIS F 5 109 ? 67.749  58.199 -37.854 1.00 37.51  ? 1306 HIS D C     1 
ATOM   8823  O O     . HIS F 5 109 ? 67.302  58.858 -36.887 1.00 35.80  ? 1306 HIS D O     1 
ATOM   8824  C CB    . HIS F 5 109 ? 67.116  58.933 -40.216 1.00 50.43  ? 1306 HIS D CB    1 
ATOM   8825  C CG    . HIS F 5 109 ? 67.382  59.940 -41.293 1.00 57.10  ? 1306 HIS D CG    1 
ATOM   8826  N ND1   . HIS F 5 109 ? 66.649  60.003 -42.456 1.00 61.33  ? 1306 HIS D ND1   1 
ATOM   8827  C CD2   . HIS F 5 109 ? 68.309  60.924 -41.384 1.00 59.29  ? 1306 HIS D CD2   1 
ATOM   8828  C CE1   . HIS F 5 109 ? 67.113  60.978 -43.217 1.00 61.38  ? 1306 HIS D CE1   1 
ATOM   8829  N NE2   . HIS F 5 109 ? 68.121  61.554 -42.589 1.00 61.21  ? 1306 HIS D NE2   1 
ATOM   8830  N N     . ALA F 5 110 ? 67.881  56.872 -37.817 1.00 38.30  ? 1307 ALA D N     1 
ATOM   8831  C CA    . ALA F 5 110 ? 67.512  56.099 -36.631 1.00 36.08  ? 1307 ALA D CA    1 
ATOM   8832  C C     . ALA F 5 110 ? 68.369  56.555 -35.467 1.00 36.96  ? 1307 ALA D C     1 
ATOM   8833  O O     . ALA F 5 110 ? 67.861  56.810 -34.379 1.00 36.44  ? 1307 ALA D O     1 
ATOM   8834  C CB    . ALA F 5 110 ? 67.743  54.618 -36.873 1.00 30.49  ? 1307 ALA D CB    1 
ATOM   8835  N N     . VAL F 5 111 ? 69.681  56.651 -35.696 1.00 34.12  ? 1308 VAL D N     1 
ATOM   8836  C CA    . VAL F 5 111 ? 70.608  57.086 -34.634 1.00 37.65  ? 1308 VAL D CA    1 
ATOM   8837  C C     . VAL F 5 111 ? 70.275  58.456 -34.117 1.00 39.11  ? 1308 VAL D C     1 
ATOM   8838  O O     . VAL F 5 111 ? 70.428  58.733 -32.942 1.00 35.37  ? 1308 VAL D O     1 
ATOM   8839  C CB    . VAL F 5 111 ? 72.078  57.118 -35.096 1.00 32.51  ? 1308 VAL D CB    1 
ATOM   8840  C CG1   . VAL F 5 111 ? 72.958  57.722 -33.998 1.00 33.27  ? 1308 VAL D CG1   1 
ATOM   8841  C CG2   . VAL F 5 111 ? 72.534  55.714 -35.418 1.00 32.16  ? 1308 VAL D CG2   1 
ATOM   8842  N N     . SER F 5 112 ? 69.825  59.316 -35.012 1.00 35.04  ? 1309 SER D N     1 
ATOM   8843  C CA    . SER F 5 112 ? 69.460  60.645 -34.597 1.00 36.93  ? 1309 SER D CA    1 
ATOM   8844  C C     . SER F 5 112 ? 68.230  60.648 -33.710 1.00 36.86  ? 1309 SER D C     1 
ATOM   8845  O O     . SER F 5 112 ? 68.241  61.267 -32.658 1.00 36.40  ? 1309 SER D O     1 
ATOM   8846  C CB    . SER F 5 112 ? 69.226  61.536 -35.791 1.00 40.45  ? 1309 SER D CB    1 
ATOM   8847  O OG    . SER F 5 112 ? 69.777  62.802 -35.490 1.00 48.91  ? 1309 SER D OG    1 
ATOM   8848  N N     . GLU F 5 113 ? 67.179  59.952 -34.127 1.00 33.06  ? 1310 GLU D N     1 
ATOM   8849  C CA    . GLU F 5 113 ? 65.954  59.894 -33.338 1.00 34.62  ? 1310 GLU D CA    1 
ATOM   8850  C C     . GLU F 5 113 ? 66.200  59.251 -31.971 1.00 33.61  ? 1310 GLU D C     1 
ATOM   8851  O O     . GLU F 5 113 ? 65.538  59.568 -30.976 1.00 32.16  ? 1310 GLU D O     1 
ATOM   8852  C CB    . GLU F 5 113 ? 64.910  59.070 -34.074 1.00 52.36  ? 1310 GLU D CB    1 
ATOM   8853  C CG    . GLU F 5 113 ? 64.349  59.722 -35.266 1.00 56.80  ? 1310 GLU D CG    1 
ATOM   8854  C CD    . GLU F 5 113 ? 63.087  60.431 -34.927 1.00 63.29  ? 1310 GLU D CD    1 
ATOM   8855  O OE1   . GLU F 5 113 ? 63.127  61.244 -33.982 1.00 62.68  ? 1310 GLU D OE1   1 
ATOM   8856  O OE2   . GLU F 5 113 ? 62.059  60.173 -35.591 1.00 65.62  ? 1310 GLU D OE2   1 
ATOM   8857  N N     . GLY F 5 114 ? 67.154  58.332 -31.947 1.00 46.27  ? 1311 GLY D N     1 
ATOM   8858  C CA    . GLY F 5 114 ? 67.444  57.614 -30.731 1.00 45.77  ? 1311 GLY D CA    1 
ATOM   8859  C C     . GLY F 5 114 ? 68.164  58.469 -29.741 1.00 44.52  ? 1311 GLY D C     1 
ATOM   8860  O O     . GLY F 5 114 ? 67.842  58.469 -28.576 1.00 44.31  ? 1311 GLY D O     1 
ATOM   8861  N N     . THR F 5 115 ? 69.163  59.190 -30.204 1.00 30.94  ? 1312 THR D N     1 
ATOM   8862  C CA    . THR F 5 115 ? 69.893  60.050 -29.318 1.00 35.19  ? 1312 THR D CA    1 
ATOM   8863  C C     . THR F 5 115 ? 68.922  61.105 -28.830 1.00 36.11  ? 1312 THR D C     1 
ATOM   8864  O O     . THR F 5 115 ? 68.833  61.377 -27.646 1.00 37.05  ? 1312 THR D O     1 
ATOM   8865  C CB    . THR F 5 115 ? 71.006  60.764 -30.050 1.00 28.27  ? 1312 THR D CB    1 
ATOM   8866  O OG1   . THR F 5 115 ? 71.790  59.809 -30.760 1.00 29.35  ? 1312 THR D OG1   1 
ATOM   8867  C CG2   . THR F 5 115 ? 71.886  61.506 -29.064 1.00 27.71  ? 1312 THR D CG2   1 
ATOM   8868  N N     . LYS F 5 116 ? 68.194  61.696 -29.762 1.00 46.82  ? 1313 LYS D N     1 
ATOM   8869  C CA    . LYS F 5 116 ? 67.245  62.742 -29.442 1.00 50.28  ? 1313 LYS D CA    1 
ATOM   8870  C C     . LYS F 5 116 ? 66.271  62.333 -28.334 1.00 48.25  ? 1313 LYS D C     1 
ATOM   8871  O O     . LYS F 5 116 ? 65.973  63.125 -27.438 1.00 46.53  ? 1313 LYS D O     1 
ATOM   8872  C CB    . LYS F 5 116 ? 66.487  63.127 -30.711 1.00 56.53  ? 1313 LYS D CB    1 
ATOM   8873  C CG    . LYS F 5 116 ? 65.626  64.353 -30.617 1.00 63.90  ? 1313 LYS D CG    1 
ATOM   8874  C CD    . LYS F 5 116 ? 64.978  64.619 -31.958 1.00 71.61  ? 1313 LYS D CD    1 
ATOM   8875  C CE    . LYS F 5 116 ? 64.036  65.803 -31.882 1.00 76.75  ? 1313 LYS D CE    1 
ATOM   8876  N NZ    . LYS F 5 116 ? 62.965  65.578 -30.870 1.00 81.14  ? 1313 LYS D NZ    1 
ATOM   8877  N N     . ALA F 5 117 ? 65.780  61.102 -28.379 1.00 32.49  ? 1314 ALA D N     1 
ATOM   8878  C CA    . ALA F 5 117 ? 64.850  60.652 -27.371 1.00 31.74  ? 1314 ALA D CA    1 
ATOM   8879  C C     . ALA F 5 117 ? 65.536  60.449 -26.022 1.00 34.11  ? 1314 ALA D C     1 
ATOM   8880  O O     . ALA F 5 117 ? 65.006  60.812 -24.962 1.00 33.51  ? 1314 ALA D O     1 
ATOM   8881  C CB    . ALA F 5 117 ? 64.203  59.355 -27.824 1.00 51.48  ? 1314 ALA D CB    1 
ATOM   8882  N N     . VAL F 5 118 ? 66.709  59.843 -26.052 1.00 45.96  ? 1315 VAL D N     1 
ATOM   8883  C CA    . VAL F 5 118 ? 67.429  59.600 -24.827 1.00 45.90  ? 1315 VAL D CA    1 
ATOM   8884  C C     . VAL F 5 118 ? 67.752  60.915 -24.160 1.00 46.06  ? 1315 VAL D C     1 
ATOM   8885  O O     . VAL F 5 118 ? 67.535  61.052 -22.960 1.00 45.49  ? 1315 VAL D O     1 
ATOM   8886  C CB    . VAL F 5 118 ? 68.729  58.818 -25.080 1.00 33.48  ? 1315 VAL D CB    1 
ATOM   8887  C CG1   . VAL F 5 118 ? 69.633  58.833 -23.826 1.00 29.36  ? 1315 VAL D CG1   1 
ATOM   8888  C CG2   . VAL F 5 118 ? 68.376  57.394 -25.472 1.00 30.90  ? 1315 VAL D CG2   1 
ATOM   8889  N N     . THR F 5 119 ? 68.271  61.874 -24.924 1.00 37.96  ? 1316 THR D N     1 
ATOM   8890  C CA    . THR F 5 119 ? 68.592  63.183 -24.374 1.00 41.08  ? 1316 THR D CA    1 
ATOM   8891  C C     . THR F 5 119 ? 67.346  63.773 -23.726 1.00 42.16  ? 1316 THR D C     1 
ATOM   8892  O O     . THR F 5 119 ? 67.352  64.087 -22.542 1.00 44.54  ? 1316 THR D O     1 
ATOM   8893  C CB    . THR F 5 119 ? 69.075  64.159 -25.434 1.00 42.54  ? 1316 THR D CB    1 
ATOM   8894  O OG1   . THR F 5 119 ? 70.264  63.663 -26.041 1.00 43.89  ? 1316 THR D OG1   1 
ATOM   8895  C CG2   . THR F 5 119 ? 69.426  65.466 -24.807 1.00 44.73  ? 1316 THR D CG2   1 
ATOM   8896  N N     . LYS F 5 120 ? 66.271  63.917 -24.484 1.00 39.34  ? 1317 LYS D N     1 
ATOM   8897  C CA    . LYS F 5 120 ? 65.064  64.453 -23.910 1.00 39.91  ? 1317 LYS D CA    1 
ATOM   8898  C C     . LYS F 5 120 ? 64.605  63.672 -22.656 1.00 40.79  ? 1317 LYS D C     1 
ATOM   8899  O O     . LYS F 5 120 ? 64.256  64.269 -21.629 1.00 42.14  ? 1317 LYS D O     1 
ATOM   8900  C CB    . LYS F 5 120 ? 63.938  64.507 -24.961 1.00 37.88  ? 1317 LYS D CB    1 
ATOM   8901  C CG    . LYS F 5 120 ? 62.610  64.904 -24.319 1.00 41.19  ? 1317 LYS D CG    1 
ATOM   8902  C CD    . LYS F 5 120 ? 61.439  65.179 -25.242 1.00 44.33  ? 1317 LYS D CD    1 
ATOM   8903  C CE    . LYS F 5 120 ? 60.234  65.542 -24.346 1.00 47.66  ? 1317 LYS D CE    1 
ATOM   8904  N NZ    . LYS F 5 120 ? 58.942  65.862 -25.030 1.00 54.89  ? 1317 LYS D NZ    1 
ATOM   8905  N N     . TYR F 5 121 ? 64.594  62.349 -22.708 1.00 44.26  ? 1318 TYR D N     1 
ATOM   8906  C CA    . TYR F 5 121 ? 64.160  61.593 -21.535 1.00 44.78  ? 1318 TYR D CA    1 
ATOM   8907  C C     . TYR F 5 121 ? 65.099  61.837 -20.348 1.00 47.75  ? 1318 TYR D C     1 
ATOM   8908  O O     . TYR F 5 121 ? 64.713  61.765 -19.177 1.00 45.17  ? 1318 TYR D O     1 
ATOM   8909  C CB    . TYR F 5 121 ? 64.160  60.116 -21.865 1.00 43.74  ? 1318 TYR D CB    1 
ATOM   8910  C CG    . TYR F 5 121 ? 63.968  59.204 -20.675 1.00 42.20  ? 1318 TYR D CG    1 
ATOM   8911  C CD1   . TYR F 5 121 ? 62.684  58.818 -20.261 1.00 40.41  ? 1318 TYR D CD1   1 
ATOM   8912  C CD2   . TYR F 5 121 ? 65.074  58.635 -20.029 1.00 40.87  ? 1318 TYR D CD2   1 
ATOM   8913  C CE1   . TYR F 5 121 ? 62.510  57.867 -19.246 1.00 43.24  ? 1318 TYR D CE1   1 
ATOM   8914  C CE2   . TYR F 5 121 ? 64.919  57.700 -19.032 1.00 41.59  ? 1318 TYR D CE2   1 
ATOM   8915  C CZ    . TYR F 5 121 ? 63.643  57.312 -18.651 1.00 42.87  ? 1318 TYR D CZ    1 
ATOM   8916  O OH    . TYR F 5 121 ? 63.514  56.301 -17.736 1.00 49.15  ? 1318 TYR D OH    1 
ATOM   8917  N N     . THR F 5 122 ? 66.349  62.116 -20.669 1.00 56.61  ? 1319 THR D N     1 
ATOM   8918  C CA    . THR F 5 122 ? 67.358  62.337 -19.664 1.00 62.17  ? 1319 THR D CA    1 
ATOM   8919  C C     . THR F 5 122 ? 67.151  63.644 -18.924 1.00 65.15  ? 1319 THR D C     1 
ATOM   8920  O O     . THR F 5 122 ? 67.503  63.760 -17.751 1.00 66.30  ? 1319 THR D O     1 
ATOM   8921  C CB    . THR F 5 122 ? 68.746  62.294 -20.327 1.00 65.44  ? 1319 THR D CB    1 
ATOM   8922  O OG1   . THR F 5 122 ? 69.498  61.232 -19.730 1.00 66.52  ? 1319 THR D OG1   1 
ATOM   8923  C CG2   . THR F 5 122 ? 69.479  63.659 -20.222 1.00 67.29  ? 1319 THR D CG2   1 
ATOM   8924  N N     . SER F 5 123 ? 66.546  64.610 -19.606 1.00 66.14  ? 1320 SER D N     1 
ATOM   8925  C CA    . SER F 5 123 ? 66.307  65.934 -19.038 1.00 69.55  ? 1320 SER D CA    1 
ATOM   8926  C C     . SER F 5 123 ? 64.951  66.087 -18.368 1.00 72.36  ? 1320 SER D C     1 
ATOM   8927  O O     . SER F 5 123 ? 64.680  67.098 -17.732 1.00 72.92  ? 1320 SER D O     1 
ATOM   8928  C CB    . SER F 5 123 ? 66.402  66.969 -20.134 1.00 41.13  ? 1320 SER D CB    1 
ATOM   8929  O OG    . SER F 5 123 ? 65.275  66.825 -20.975 1.00 39.61  ? 1320 SER D OG    1 
ATOM   8930  N N     . ALA F 5 124 ? 64.102  65.085 -18.554 1.00 69.48  ? 1321 ALA D N     1 
ATOM   8931  C CA    . ALA F 5 124 ? 62.736  65.090 -17.986 1.00 73.45  ? 1321 ALA D CA    1 
ATOM   8932  C C     . ALA F 5 124 ? 62.619  64.180 -16.693 1.00 77.88  ? 1321 ALA D C     1 
ATOM   8933  O O     . ALA F 5 124 ? 63.747  64.000 -16.070 1.00 80.06  ? 1321 ALA D O     1 
ATOM   8934  C CB    . ALA F 5 124 ? 61.729  64.709 -19.139 1.00 91.25  ? 1321 ALA D CB    1 
ATOM   8935  N N     . LYS F 5 125 ? 61.437  63.743 -16.205 1.00 164.63 ? 1322 LYS D N     1 
ATOM   8936  C CA    . LYS F 5 125 ? 61.602  62.795 -15.168 1.00 167.59 ? 1322 LYS D CA    1 
ATOM   8937  C C     . LYS F 5 125 ? 61.013  61.727 -16.204 1.00 169.38 ? 1322 LYS D C     1 
ATOM   8938  O O     . LYS F 5 125 ? 60.530  60.650 -15.684 1.00 124.54 ? 1322 LYS D O     1 
ATOM   8939  C CB    . LYS F 5 125 ? 60.669  63.182 -13.924 1.00 135.34 ? 1322 LYS D CB    1 
ATOM   8940  C CG    . LYS F 5 125 ? 61.196  62.285 -12.657 1.00 134.66 ? 1322 LYS D CG    1 
ATOM   8941  C CD    . LYS F 5 125 ? 60.756  60.784 -13.069 1.00 135.38 ? 1322 LYS D CD    1 
ATOM   8942  C CE    . LYS F 5 125 ? 60.483  60.055 -11.738 1.00 135.03 ? 1322 LYS D CE    1 
ATOM   8943  N NZ    . LYS F 5 125 ? 60.224  58.594 -11.536 1.00 135.12 ? 1322 LYS D NZ    1 
ATOM   8944  O OXT   . LYS F 5 125 ? 60.652  62.138 -17.514 1.00 92.63  ? 1322 LYS D OXT   1 
ATOM   8945  N N     . LYS G 2 37  ? 40.564  32.995 -91.005 1.00 36.22  ? 637  LYS E N     1 
ATOM   8946  C CA    . LYS G 2 37  ? 40.028  34.332 -90.563 1.00 37.77  ? 637  LYS E CA    1 
ATOM   8947  C C     . LYS G 2 37  ? 39.928  34.403 -89.018 1.00 36.32  ? 637  LYS E C     1 
ATOM   8948  O O     . LYS G 2 37  ? 39.893  35.542 -88.435 1.00 33.57  ? 637  LYS E O     1 
ATOM   8949  C CB    . LYS G 2 37  ? 38.637  34.610 -91.192 1.00 43.14  ? 637  LYS E CB    1 
ATOM   8950  C CG    . LYS G 2 37  ? 38.150  36.061 -90.992 1.00 51.00  ? 637  LYS E CG    1 
ATOM   8951  C CD    . LYS G 2 37  ? 37.277  36.545 -92.189 1.00 56.00  ? 637  LYS E CD    1 
ATOM   8952  C CE    . LYS G 2 37  ? 36.713  37.989 -91.952 1.00 62.54  ? 637  LYS E CE    1 
ATOM   8953  N NZ    . LYS G 2 37  ? 35.853  38.539 -93.087 1.00 67.19  ? 637  LYS E NZ    1 
ATOM   8954  N N     . PRO G 2 38  ? 39.798  33.224 -88.337 1.00 105.03 ? 638  PRO E N     1 
ATOM   8955  C CA    . PRO G 2 38  ? 39.722  33.297 -86.877 1.00 103.28 ? 638  PRO E CA    1 
ATOM   8956  C C     . PRO G 2 38  ? 40.893  34.111 -86.344 1.00 99.58  ? 638  PRO E C     1 
ATOM   8957  O O     . PRO G 2 38  ? 42.008  34.035 -86.874 1.00 99.01  ? 638  PRO E O     1 
ATOM   8958  C CB    . PRO G 2 38  ? 39.809  31.838 -86.467 1.00 57.58  ? 638  PRO E CB    1 
ATOM   8959  C CG    . PRO G 2 38  ? 38.988  31.168 -87.486 1.00 59.35  ? 638  PRO E CG    1 
ATOM   8960  C CD    . PRO G 2 38  ? 39.307  31.905 -88.802 1.00 59.53  ? 638  PRO E CD    1 
ATOM   8961  N N     . HIS G 2 39  ? 40.633  34.901 -85.311 1.00 125.39 ? 639  HIS E N     1 
ATOM   8962  C CA    . HIS G 2 39  ? 41.675  35.724 -84.724 1.00 119.68 ? 639  HIS E CA    1 
ATOM   8963  C C     . HIS G 2 39  ? 42.520  34.845 -83.814 1.00 113.78 ? 639  HIS E C     1 
ATOM   8964  O O     . HIS G 2 39  ? 41.984  34.013 -83.077 1.00 110.06 ? 639  HIS E O     1 
ATOM   8965  C CB    . HIS G 2 39  ? 41.042  36.871 -83.936 1.00 129.80 ? 639  HIS E CB    1 
ATOM   8966  C CG    . HIS G 2 39  ? 42.034  37.844 -83.378 1.00 132.75 ? 639  HIS E CG    1 
ATOM   8967  N ND1   . HIS G 2 39  ? 42.908  37.517 -82.364 1.00 133.65 ? 639  HIS E ND1   1 
ATOM   8968  C CD2   . HIS G 2 39  ? 42.284  39.139 -83.687 1.00 133.49 ? 639  HIS E CD2   1 
ATOM   8969  C CE1   . HIS G 2 39  ? 43.651  38.569 -82.071 1.00 134.28 ? 639  HIS E CE1   1 
ATOM   8970  N NE2   . HIS G 2 39  ? 43.293  39.567 -82.858 1.00 133.87 ? 639  HIS E NE2   1 
ATOM   8971  N N     . ARG G 2 40  ? 43.838  35.013 -83.879 1.00 58.75  ? 640  ARG E N     1 
ATOM   8972  C CA    . ARG G 2 40  ? 44.744  34.214 -83.050 1.00 54.61  ? 640  ARG E CA    1 
ATOM   8973  C C     . ARG G 2 40  ? 45.996  34.966 -82.640 1.00 51.07  ? 640  ARG E C     1 
ATOM   8974  O O     . ARG G 2 40  ? 46.778  35.372 -83.489 1.00 47.95  ? 640  ARG E O     1 
ATOM   8975  C CB    . ARG G 2 40  ? 45.148  32.914 -83.782 1.00 40.32  ? 640  ARG E CB    1 
ATOM   8976  C CG    . ARG G 2 40  ? 46.406  32.239 -83.246 1.00 44.35  ? 640  ARG E CG    1 
ATOM   8977  C CD    . ARG G 2 40  ? 46.658  30.847 -83.854 1.00 44.89  ? 640  ARG E CD    1 
ATOM   8978  N NE    . ARG G 2 40  ? 45.838  29.824 -83.194 1.00 49.33  ? 640  ARG E NE    1 
ATOM   8979  C CZ    . ARG G 2 40  ? 46.310  28.865 -82.405 1.00 47.95  ? 640  ARG E CZ    1 
ATOM   8980  N NH1   . ARG G 2 40  ? 47.614  28.767 -82.168 1.00 51.71  ? 640  ARG E NH1   1 
ATOM   8981  N NH2   . ARG G 2 40  ? 45.464  28.029 -81.834 1.00 49.58  ? 640  ARG E NH2   1 
ATOM   8982  N N     . TYR G 2 41  ? 46.187  35.141 -81.334 1.00 48.85  ? 641  TYR E N     1 
ATOM   8983  C CA    . TYR G 2 41  ? 47.370  35.824 -80.824 1.00 44.87  ? 641  TYR E CA    1 
ATOM   8984  C C     . TYR G 2 41  ? 48.609  35.002 -81.068 1.00 42.90  ? 641  TYR E C     1 
ATOM   8985  O O     . TYR G 2 41  ? 48.584  33.779 -80.901 1.00 42.36  ? 641  TYR E O     1 
ATOM   8986  C CB    . TYR G 2 41  ? 47.247  36.062 -79.329 1.00 36.04  ? 641  TYR E CB    1 
ATOM   8987  C CG    . TYR G 2 41  ? 46.218  37.101 -79.002 1.00 35.63  ? 641  TYR E CG    1 
ATOM   8988  C CD1   . TYR G 2 41  ? 44.987  36.731 -78.471 1.00 35.66  ? 641  TYR E CD1   1 
ATOM   8989  C CD2   . TYR G 2 41  ? 46.451  38.461 -79.275 1.00 35.87  ? 641  TYR E CD2   1 
ATOM   8990  C CE1   . TYR G 2 41  ? 44.007  37.675 -78.215 1.00 36.37  ? 641  TYR E CE1   1 
ATOM   8991  C CE2   . TYR G 2 41  ? 45.478  39.414 -79.023 1.00 34.48  ? 641  TYR E CE2   1 
ATOM   8992  C CZ    . TYR G 2 41  ? 44.255  38.999 -78.489 1.00 34.74  ? 641  TYR E CZ    1 
ATOM   8993  O OH    . TYR G 2 41  ? 43.264  39.882 -78.228 1.00 39.83  ? 641  TYR E OH    1 
ATOM   8994  N N     . ARG G 2 42  ? 49.695  35.660 -81.463 1.00 41.93  ? 642  ARG E N     1 
ATOM   8995  C CA    . ARG G 2 42  ? 50.946  34.961 -81.705 1.00 41.70  ? 642  ARG E CA    1 
ATOM   8996  C C     . ARG G 2 42  ? 51.562  34.449 -80.376 1.00 44.39  ? 642  ARG E C     1 
ATOM   8997  O O     . ARG G 2 42  ? 51.313  34.996 -79.281 1.00 41.48  ? 642  ARG E O     1 
ATOM   8998  C CB    . ARG G 2 42  ? 51.907  35.897 -82.419 1.00 68.64  ? 642  ARG E CB    1 
ATOM   8999  C CG    . ARG G 2 42  ? 51.398  36.358 -83.776 1.00 75.28  ? 642  ARG E CG    1 
ATOM   9000  C CD    . ARG G 2 42  ? 52.289  37.457 -84.342 1.00 83.57  ? 642  ARG E CD    1 
ATOM   9001  N NE    . ARG G 2 42  ? 53.689  37.035 -84.388 1.00 90.86  ? 642  ARG E NE    1 
ATOM   9002  C CZ    . ARG G 2 42  ? 54.712  37.845 -84.642 1.00 95.42  ? 642  ARG E CZ    1 
ATOM   9003  N NH1   . ARG G 2 42  ? 54.496  39.132 -84.874 1.00 97.60  ? 642  ARG E NH1   1 
ATOM   9004  N NH2   . ARG G 2 42  ? 55.951  37.368 -84.657 1.00 98.44  ? 642  ARG E NH2   1 
ATOM   9005  N N     . PRO G 2 43  ? 52.363  33.376 -80.445 1.00 51.16  ? 643  PRO E N     1 
ATOM   9006  C CA    . PRO G 2 43  ? 52.982  32.831 -79.243 1.00 50.12  ? 643  PRO E CA    1 
ATOM   9007  C C     . PRO G 2 43  ? 53.868  33.812 -78.500 1.00 48.97  ? 643  PRO E C     1 
ATOM   9008  O O     . PRO G 2 43  ? 54.844  34.330 -79.057 1.00 49.56  ? 643  PRO E O     1 
ATOM   9009  C CB    . PRO G 2 43  ? 53.757  31.631 -79.779 1.00 39.86  ? 643  PRO E CB    1 
ATOM   9010  C CG    . PRO G 2 43  ? 54.065  32.018 -81.145 1.00 42.97  ? 643  PRO E CG    1 
ATOM   9011  C CD    . PRO G 2 43  ? 52.759  32.577 -81.605 1.00 40.59  ? 643  PRO E CD    1 
ATOM   9012  N N     . GLY G 2 44  ? 53.509  34.049 -77.242 1.00 46.62  ? 644  GLY E N     1 
ATOM   9013  C CA    . GLY G 2 44  ? 54.261  34.947 -76.400 1.00 44.75  ? 644  GLY E CA    1 
ATOM   9014  C C     . GLY G 2 44  ? 53.447  36.142 -75.949 1.00 44.84  ? 644  GLY E C     1 
ATOM   9015  O O     . GLY G 2 44  ? 53.739  36.769 -74.919 1.00 46.52  ? 644  GLY E O     1 
ATOM   9016  N N     . THR G 2 45  ? 52.418  36.458 -76.729 1.00 49.98  ? 645  THR E N     1 
ATOM   9017  C CA    . THR G 2 45  ? 51.547  37.590 -76.453 1.00 49.47  ? 645  THR E CA    1 
ATOM   9018  C C     . THR G 2 45  ? 50.719  37.336 -75.209 1.00 48.59  ? 645  THR E C     1 
ATOM   9019  O O     . THR G 2 45  ? 50.680  38.177 -74.308 1.00 47.36  ? 645  THR E O     1 
ATOM   9020  C CB    . THR G 2 45  ? 50.624  37.847 -77.656 1.00 44.85  ? 645  THR E CB    1 
ATOM   9021  O OG1   . THR G 2 45  ? 51.422  37.975 -78.833 1.00 45.01  ? 645  THR E OG1   1 
ATOM   9022  C CG2   . THR G 2 45  ? 49.835  39.108 -77.481 1.00 43.87  ? 645  THR E CG2   1 
ATOM   9023  N N     . VAL G 2 46  ? 50.061  36.178 -75.158 1.00 40.48  ? 646  VAL E N     1 
ATOM   9024  C CA    . VAL G 2 46  ? 49.250  35.834 -74.003 1.00 41.18  ? 646  VAL E CA    1 
ATOM   9025  C C     . VAL G 2 46  ? 50.195  35.676 -72.817 1.00 41.21  ? 646  VAL E C     1 
ATOM   9026  O O     . VAL G 2 46  ? 49.902  36.145 -71.725 1.00 40.81  ? 646  VAL E O     1 
ATOM   9027  C CB    . VAL G 2 46  ? 48.472  34.504 -74.189 1.00 31.08  ? 646  VAL E CB    1 
ATOM   9028  C CG1   . VAL G 2 46  ? 47.515  34.295 -73.019 1.00 31.89  ? 646  VAL E CG1   1 
ATOM   9029  C CG2   . VAL G 2 46  ? 47.689  34.524 -75.465 1.00 32.90  ? 646  VAL E CG2   1 
ATOM   9030  N N     . ALA G 2 47  ? 51.334  35.029 -73.042 1.00 44.91  ? 647  ALA E N     1 
ATOM   9031  C CA    . ALA G 2 47  ? 52.343  34.818 -72.001 1.00 45.53  ? 647  ALA E CA    1 
ATOM   9032  C C     . ALA G 2 47  ? 52.711  36.122 -71.275 1.00 47.25  ? 647  ALA E C     1 
ATOM   9033  O O     . ALA G 2 47  ? 52.812  36.156 -70.029 1.00 43.41  ? 647  ALA E O     1 
ATOM   9034  C CB    . ALA G 2 47  ? 53.582  34.218 -72.615 1.00 23.87  ? 647  ALA E CB    1 
ATOM   9035  N N     . LEU G 2 48  ? 52.946  37.184 -72.055 1.00 33.86  ? 648  LEU E N     1 
ATOM   9036  C CA    . LEU G 2 48  ? 53.263  38.493 -71.496 1.00 32.66  ? 648  LEU E CA    1 
ATOM   9037  C C     . LEU G 2 48  ? 52.020  39.063 -70.796 1.00 32.29  ? 648  LEU E C     1 
ATOM   9038  O O     . LEU G 2 48  ? 52.144  39.743 -69.799 1.00 33.58  ? 648  LEU E O     1 
ATOM   9039  C CB    . LEU G 2 48  ? 53.741  39.420 -72.606 1.00 31.77  ? 648  LEU E CB    1 
ATOM   9040  C CG    . LEU G 2 48  ? 55.155  39.141 -73.096 1.00 34.19  ? 648  LEU E CG    1 
ATOM   9041  C CD1   . LEU G 2 48  ? 55.496  39.962 -74.318 1.00 34.66  ? 648  LEU E CD1   1 
ATOM   9042  C CD2   . LEU G 2 48  ? 56.089  39.493 -71.962 1.00 34.04  ? 648  LEU E CD2   1 
ATOM   9043  N N     . ARG G 2 49  ? 50.826  38.786 -71.315 1.00 29.37  ? 649  ARG E N     1 
ATOM   9044  C CA    . ARG G 2 49  ? 49.611  39.250 -70.650 1.00 31.73  ? 649  ARG E CA    1 
ATOM   9045  C C     . ARG G 2 49  ? 49.552  38.623 -69.241 1.00 30.76  ? 649  ARG E C     1 
ATOM   9046  O O     . ARG G 2 49  ? 49.236  39.289 -68.234 1.00 25.90  ? 649  ARG E O     1 
ATOM   9047  C CB    . ARG G 2 49  ? 48.361  38.812 -71.410 1.00 56.77  ? 649  ARG E CB    1 
ATOM   9048  C CG    . ARG G 2 49  ? 48.078  39.578 -72.668 1.00 62.56  ? 649  ARG E CG    1 
ATOM   9049  C CD    . ARG G 2 49  ? 46.566  39.739 -72.868 1.00 69.88  ? 649  ARG E CD    1 
ATOM   9050  N NE    . ARG G 2 49  ? 45.901  38.515 -73.310 1.00 74.24  ? 649  ARG E NE    1 
ATOM   9051  C CZ    . ARG G 2 49  ? 45.757  38.169 -74.582 1.00 75.39  ? 649  ARG E CZ    1 
ATOM   9052  N NH1   . ARG G 2 49  ? 46.229  38.967 -75.535 1.00 77.77  ? 649  ARG E NH1   1 
ATOM   9053  N NH2   . ARG G 2 49  ? 45.155  37.027 -74.893 1.00 74.80  ? 649  ARG E NH2   1 
ATOM   9054  N N     . GLU G 2 50  ? 49.853  37.325 -69.183 1.00 44.43  ? 650  GLU E N     1 
ATOM   9055  C CA    . GLU G 2 50  ? 49.836  36.600 -67.928 1.00 46.46  ? 650  GLU E CA    1 
ATOM   9056  C C     . GLU G 2 50  ? 50.869  37.145 -66.944 1.00 46.88  ? 650  GLU E C     1 
ATOM   9057  O O     . GLU G 2 50  ? 50.576  37.315 -65.757 1.00 48.10  ? 650  GLU E O     1 
ATOM   9058  C CB    . GLU G 2 50  ? 50.047  35.121 -68.201 1.00 56.94  ? 650  GLU E CB    1 
ATOM   9059  C CG    . GLU G 2 50  ? 48.943  34.555 -69.051 1.00 61.49  ? 650  GLU E CG    1 
ATOM   9060  C CD    . GLU G 2 50  ? 49.177  33.121 -69.454 1.00 64.79  ? 650  GLU E CD    1 
ATOM   9061  O OE1   . GLU G 2 50  ? 48.336  32.589 -70.207 1.00 67.06  ? 650  GLU E OE1   1 
ATOM   9062  O OE2   . GLU G 2 50  ? 50.194  32.522 -69.029 1.00 64.80  ? 650  GLU E OE2   1 
ATOM   9063  N N     . ILE G 2 51  ? 52.078  37.414 -67.428 1.00 27.60  ? 651  ILE E N     1 
ATOM   9064  C CA    . ILE G 2 51  ? 53.104  37.999 -66.570 1.00 29.29  ? 651  ILE E CA    1 
ATOM   9065  C C     . ILE G 2 51  ? 52.601  39.336 -66.001 1.00 31.09  ? 651  ILE E C     1 
ATOM   9066  O O     . ILE G 2 51  ? 52.731  39.619 -64.805 1.00 30.56  ? 651  ILE E O     1 
ATOM   9067  C CB    . ILE G 2 51  ? 54.398  38.273 -67.339 1.00 29.01  ? 651  ILE E CB    1 
ATOM   9068  C CG1   . ILE G 2 51  ? 54.924  36.960 -67.946 1.00 30.09  ? 651  ILE E CG1   1 
ATOM   9069  C CG2   . ILE G 2 51  ? 55.401  38.941 -66.396 1.00 29.06  ? 651  ILE E CG2   1 
ATOM   9070  C CD1   . ILE G 2 51  ? 56.248  37.054 -68.707 1.00 28.06  ? 651  ILE E CD1   1 
ATOM   9071  N N     . ARG G 2 52  ? 52.021  40.161 -66.861 1.00 24.58  ? 652  ARG E N     1 
ATOM   9072  C CA    . ARG G 2 52  ? 51.507  41.434 -66.405 1.00 27.37  ? 652  ARG E CA    1 
ATOM   9073  C C     . ARG G 2 52  ? 50.367  41.216 -65.415 1.00 25.65  ? 652  ARG E C     1 
ATOM   9074  O O     . ARG G 2 52  ? 50.237  41.935 -64.432 1.00 24.84  ? 652  ARG E O     1 
ATOM   9075  C CB    . ARG G 2 52  ? 51.042  42.279 -67.594 1.00 30.77  ? 652  ARG E CB    1 
ATOM   9076  C CG    . ARG G 2 52  ? 52.191  42.835 -68.463 1.00 38.01  ? 652  ARG E CG    1 
ATOM   9077  C CD    . ARG G 2 52  ? 51.694  43.625 -69.653 1.00 42.43  ? 652  ARG E CD    1 
ATOM   9078  N NE    . ARG G 2 52  ? 52.416  43.319 -70.892 1.00 46.49  ? 652  ARG E NE    1 
ATOM   9079  C CZ    . ARG G 2 52  ? 53.643  43.764 -71.183 1.00 47.85  ? 652  ARG E CZ    1 
ATOM   9080  N NH1   . ARG G 2 52  ? 54.301  44.541 -70.303 1.00 51.85  ? 652  ARG E NH1   1 
ATOM   9081  N NH2   . ARG G 2 52  ? 54.197  43.480 -72.376 1.00 45.20  ? 652  ARG E NH2   1 
ATOM   9082  N N     . ARG G 2 53  ? 49.552  40.202 -65.652 1.00 36.57  ? 653  ARG E N     1 
ATOM   9083  C CA    . ARG G 2 53  ? 48.429  39.943 -64.767 1.00 34.95  ? 653  ARG E CA    1 
ATOM   9084  C C     . ARG G 2 53  ? 48.825  39.416 -63.390 1.00 35.61  ? 653  ARG E C     1 
ATOM   9085  O O     . ARG G 2 53  ? 48.405  39.915 -62.340 1.00 33.88  ? 653  ARG E O     1 
ATOM   9086  C CB    . ARG G 2 53  ? 47.481  38.939 -65.411 1.00 32.63  ? 653  ARG E CB    1 
ATOM   9087  C CG    . ARG G 2 53  ? 46.362  38.520 -64.468 1.00 35.02  ? 653  ARG E CG    1 
ATOM   9088  C CD    . ARG G 2 53  ? 45.656  37.273 -64.948 1.00 41.82  ? 653  ARG E CD    1 
ATOM   9089  N NE    . ARG G 2 53  ? 44.654  36.794 -63.993 1.00 49.33  ? 653  ARG E NE    1 
ATOM   9090  C CZ    . ARG G 2 53  ? 43.834  35.769 -64.230 1.00 50.18  ? 653  ARG E CZ    1 
ATOM   9091  N NH1   . ARG G 2 53  ? 43.910  35.116 -65.387 1.00 49.46  ? 653  ARG E NH1   1 
ATOM   9092  N NH2   . ARG G 2 53  ? 42.917  35.422 -63.332 1.00 51.19  ? 653  ARG E NH2   1 
ATOM   9093  N N     . TYR G 2 54  ? 49.633  38.376 -63.401 1.00 40.76  ? 654  TYR E N     1 
ATOM   9094  C CA    . TYR G 2 54  ? 50.033  37.766 -62.170 1.00 41.86  ? 654  TYR E CA    1 
ATOM   9095  C C     . TYR G 2 54  ? 50.968  38.597 -61.328 1.00 40.67  ? 654  TYR E C     1 
ATOM   9096  O O     . TYR G 2 54  ? 50.913  38.529 -60.089 1.00 39.44  ? 654  TYR E O     1 
ATOM   9097  C CB    . TYR G 2 54  ? 50.587  36.396 -62.499 1.00 27.58  ? 654  TYR E CB    1 
ATOM   9098  C CG    . TYR G 2 54  ? 49.450  35.481 -62.888 1.00 29.28  ? 654  TYR E CG    1 
ATOM   9099  C CD1   . TYR G 2 54  ? 49.405  34.871 -64.155 1.00 26.82  ? 654  TYR E CD1   1 
ATOM   9100  C CD2   . TYR G 2 54  ? 48.368  35.287 -62.007 1.00 27.87  ? 654  TYR E CD2   1 
ATOM   9101  C CE1   . TYR G 2 54  ? 48.322  34.105 -64.524 1.00 26.08  ? 654  TYR E CE1   1 
ATOM   9102  C CE2   . TYR G 2 54  ? 47.280  34.534 -62.376 1.00 30.11  ? 654  TYR E CE2   1 
ATOM   9103  C CZ    . TYR G 2 54  ? 47.264  33.951 -63.624 1.00 27.52  ? 654  TYR E CZ    1 
ATOM   9104  O OH    . TYR G 2 54  ? 46.182  33.226 -63.959 1.00 30.28  ? 654  TYR E OH    1 
ATOM   9105  N N     . GLN G 2 55  ? 51.797  39.395 -62.004 1.00 36.92  ? 655  GLN E N     1 
ATOM   9106  C CA    . GLN G 2 55  ? 52.742  40.259 -61.324 1.00 38.03  ? 655  GLN E CA    1 
ATOM   9107  C C     . GLN G 2 55  ? 52.016  41.431 -60.712 1.00 40.67  ? 655  GLN E C     1 
ATOM   9108  O O     . GLN G 2 55  ? 52.583  42.187 -59.916 1.00 42.41  ? 655  GLN E O     1 
ATOM   9109  C CB    . GLN G 2 55  ? 53.801  40.761 -62.288 1.00 20.32  ? 655  GLN E CB    1 
ATOM   9110  C CG    . GLN G 2 55  ? 54.951  39.800 -62.474 1.00 19.79  ? 655  GLN E CG    1 
ATOM   9111  C CD    . GLN G 2 55  ? 56.139  40.399 -63.227 1.00 20.87  ? 655  GLN E CD    1 
ATOM   9112  O OE1   . GLN G 2 55  ? 56.080  41.518 -63.752 1.00 21.28  ? 655  GLN E OE1   1 
ATOM   9113  N NE2   . GLN G 2 55  ? 57.216  39.659 -63.276 1.00 22.48  ? 655  GLN E NE2   1 
ATOM   9114  N N     . LYS G 2 56  ? 50.746  41.569 -61.079 1.00 36.22  ? 656  LYS E N     1 
ATOM   9115  C CA    . LYS G 2 56  ? 49.920  42.660 -60.586 1.00 37.77  ? 656  LYS E CA    1 
ATOM   9116  C C     . LYS G 2 56  ? 49.091  42.205 -59.409 1.00 36.32  ? 656  LYS E C     1 
ATOM   9117  O O     . LYS G 2 56  ? 48.789  42.981 -58.517 1.00 33.57  ? 656  LYS E O     1 
ATOM   9118  C CB    . LYS G 2 56  ? 49.021  43.195 -61.700 1.00 43.14  ? 656  LYS E CB    1 
ATOM   9119  C CG    . LYS G 2 56  ? 48.052  44.243 -61.221 1.00 51.00  ? 656  LYS E CG    1 
ATOM   9120  C CD    . LYS G 2 56  ? 47.388  44.983 -62.377 1.00 56.00  ? 656  LYS E CD    1 
ATOM   9121  C CE    . LYS G 2 56  ? 46.409  46.065 -61.883 1.00 62.54  ? 656  LYS E CE    1 
ATOM   9122  N NZ    . LYS G 2 56  ? 45.681  46.737 -63.013 1.00 67.19  ? 656  LYS E NZ    1 
ATOM   9123  N N     . SER G 2 57  ? 48.736  40.938 -59.362 1.00 40.19  ? 657  SER E N     1 
ATOM   9124  C CA    . SER G 2 57  ? 47.945  40.500 -58.236 1.00 40.00  ? 657  SER E CA    1 
ATOM   9125  C C     . SER G 2 57  ? 48.792  39.908 -57.119 1.00 38.62  ? 657  SER E C     1 
ATOM   9126  O O     . SER G 2 57  ? 50.030  39.960 -57.155 1.00 37.70  ? 657  SER E O     1 
ATOM   9127  C CB    . SER G 2 57  ? 46.974  39.468 -58.712 1.00 37.24  ? 657  SER E CB    1 
ATOM   9128  O OG    . SER G 2 57  ? 47.678  38.528 -59.481 1.00 40.09  ? 657  SER E OG    1 
ATOM   9129  N N     . THR G 2 58  ? 48.123  39.326 -56.126 1.00 46.13  ? 658  THR E N     1 
ATOM   9130  C CA    . THR G 2 58  ? 48.831  38.694 -55.029 1.00 49.64  ? 658  THR E CA    1 
ATOM   9131  C C     . THR G 2 58  ? 48.138  37.453 -54.485 1.00 47.94  ? 658  THR E C     1 
ATOM   9132  O O     . THR G 2 58  ? 48.515  36.975 -53.420 1.00 48.59  ? 658  THR E O     1 
ATOM   9133  C CB    . THR G 2 58  ? 49.021  39.658 -53.859 1.00 28.41  ? 658  THR E CB    1 
ATOM   9134  O OG1   . THR G 2 58  ? 47.769  39.885 -53.211 1.00 30.62  ? 658  THR E OG1   1 
ATOM   9135  C CG2   . THR G 2 58  ? 49.552  40.955 -54.339 1.00 33.76  ? 658  THR E CG2   1 
ATOM   9136  N N     . GLU G 2 59  ? 47.134  36.919 -55.180 1.00 29.05  ? 659  GLU E N     1 
ATOM   9137  C CA    . GLU G 2 59  ? 46.458  35.742 -54.638 1.00 29.81  ? 659  GLU E CA    1 
ATOM   9138  C C     . GLU G 2 59  ? 47.370  34.608 -54.884 1.00 27.32  ? 659  GLU E C     1 
ATOM   9139  O O     . GLU G 2 59  ? 48.131  34.663 -55.863 1.00 24.05  ? 659  GLU E O     1 
ATOM   9140  C CB    . GLU G 2 59  ? 45.145  35.426 -55.337 1.00 29.26  ? 659  GLU E CB    1 
ATOM   9141  C CG    . GLU G 2 59  ? 44.834  36.278 -56.530 1.00 42.15  ? 659  GLU E CG    1 
ATOM   9142  C CD    . GLU G 2 59  ? 45.479  35.830 -57.828 1.00 43.27  ? 659  GLU E CD    1 
ATOM   9143  O OE1   . GLU G 2 59  ? 44.964  34.868 -58.417 1.00 52.21  ? 659  GLU E OE1   1 
ATOM   9144  O OE2   . GLU G 2 59  ? 46.480  36.445 -58.264 1.00 42.69  ? 659  GLU E OE2   1 
ATOM   9145  N N     . LEU G 2 60  ? 47.302  33.604 -53.999 1.00 36.60  ? 660  LEU E N     1 
ATOM   9146  C CA    . LEU G 2 60  ? 48.097  32.383 -54.111 1.00 39.47  ? 660  LEU E CA    1 
ATOM   9147  C C     . LEU G 2 60  ? 47.696  31.740 -55.434 1.00 39.41  ? 660  LEU E C     1 
ATOM   9148  O O     . LEU G 2 60  ? 46.550  31.828 -55.882 1.00 37.95  ? 660  LEU E O     1 
ATOM   9149  C CB    . LEU G 2 60  ? 47.808  31.433 -52.949 1.00 26.73  ? 660  LEU E CB    1 
ATOM   9150  C CG    . LEU G 2 60  ? 48.367  31.892 -51.598 1.00 28.63  ? 660  LEU E CG    1 
ATOM   9151  C CD1   . LEU G 2 60  ? 47.867  31.006 -50.495 1.00 30.15  ? 660  LEU E CD1   1 
ATOM   9152  C CD2   . LEU G 2 60  ? 49.919  31.884 -51.633 1.00 28.36  ? 660  LEU E CD2   1 
ATOM   9153  N N     . LEU G 2 61  ? 48.636  31.077 -56.066 1.00 23.20  ? 661  LEU E N     1 
ATOM   9154  C CA    . LEU G 2 61  ? 48.354  30.523 -57.362 1.00 21.10  ? 661  LEU E CA    1 
ATOM   9155  C C     . LEU G 2 61  ? 48.241  29.004 -57.409 1.00 21.03  ? 661  LEU E C     1 
ATOM   9156  O O     . LEU G 2 61  ? 48.141  28.440 -58.486 1.00 20.70  ? 661  LEU E O     1 
ATOM   9157  C CB    . LEU G 2 61  ? 49.449  31.007 -58.326 1.00 33.81  ? 661  LEU E CB    1 
ATOM   9158  C CG    . LEU G 2 61  ? 49.683  32.533 -58.357 1.00 35.29  ? 661  LEU E CG    1 
ATOM   9159  C CD1   . LEU G 2 61  ? 50.982  32.930 -59.116 1.00 34.08  ? 661  LEU E CD1   1 
ATOM   9160  C CD2   . LEU G 2 61  ? 48.428  33.147 -58.983 1.00 35.74  ? 661  LEU E CD2   1 
ATOM   9161  N N     . ILE G 2 62  ? 48.283  28.335 -56.265 1.00 27.50  ? 662  ILE E N     1 
ATOM   9162  C CA    . ILE G 2 62  ? 48.189  26.892 -56.258 1.00 29.28  ? 662  ILE E CA    1 
ATOM   9163  C C     . ILE G 2 62  ? 46.896  26.613 -55.543 1.00 29.78  ? 662  ILE E C     1 
ATOM   9164  O O     . ILE G 2 62  ? 46.614  27.293 -54.593 1.00 25.81  ? 662  ILE E O     1 
ATOM   9165  C CB    . ILE G 2 62  ? 49.307  26.247 -55.444 1.00 38.00  ? 662  ILE E CB    1 
ATOM   9166  C CG1   . ILE G 2 62  ? 50.666  26.404 -56.146 1.00 36.50  ? 662  ILE E CG1   1 
ATOM   9167  C CG2   . ILE G 2 62  ? 48.923  24.783 -55.142 1.00 38.58  ? 662  ILE E CG2   1 
ATOM   9168  C CD1   . ILE G 2 62  ? 51.828  25.786 -55.333 1.00 34.59  ? 662  ILE E CD1   1 
ATOM   9169  N N     . ARG G 2 63  ? 46.136  25.610 -55.998 1.00 17.07  ? 663  ARG E N     1 
ATOM   9170  C CA    . ARG G 2 63  ? 44.849  25.239 -55.426 1.00 18.47  ? 663  ARG E CA    1 
ATOM   9171  C C     . ARG G 2 63  ? 44.913  24.970 -53.907 1.00 18.66  ? 663  ARG E C     1 
ATOM   9172  O O     . ARG G 2 63  ? 45.706  24.154 -53.453 1.00 17.55  ? 663  ARG E O     1 
ATOM   9173  C CB    . ARG G 2 63  ? 44.344  24.011 -56.163 1.00 61.71  ? 663  ARG E CB    1 
ATOM   9174  C CG    . ARG G 2 63  ? 43.905  24.266 -57.591 1.00 69.00  ? 663  ARG E CG    1 
ATOM   9175  C CD    . ARG G 2 63  ? 42.750  25.252 -57.605 1.00 76.73  ? 663  ARG E CD    1 
ATOM   9176  N NE    . ARG G 2 63  ? 43.242  26.616 -57.506 1.00 87.17  ? 663  ARG E NE    1 
ATOM   9177  C CZ    . ARG G 2 63  ? 42.482  27.676 -57.270 1.00 92.27  ? 663  ARG E CZ    1 
ATOM   9178  N NH1   . ARG G 2 63  ? 41.177  27.523 -57.095 1.00 98.01  ? 663  ARG E NH1   1 
ATOM   9179  N NH2   . ARG G 2 63  ? 43.026  28.888 -57.237 1.00 92.76  ? 663  ARG E NH2   1 
ATOM   9180  N N     . LYS G 2 64  ? 44.079  25.646 -53.122 1.00 30.98  ? 664  LYS E N     1 
ATOM   9181  C CA    . LYS G 2 64  ? 44.087  25.470 -51.672 1.00 33.83  ? 664  LYS E CA    1 
ATOM   9182  C C     . LYS G 2 64  ? 44.103  24.023 -51.225 1.00 33.75  ? 664  LYS E C     1 
ATOM   9183  O O     . LYS G 2 64  ? 45.055  23.586 -50.576 1.00 30.17  ? 664  LYS E O     1 
ATOM   9184  C CB    . LYS G 2 64  ? 42.876  26.149 -51.019 1.00 40.51  ? 664  LYS E CB    1 
ATOM   9185  C CG    . LYS G 2 64  ? 42.915  27.679 -51.043 1.00 52.82  ? 664  LYS E CG    1 
ATOM   9186  C CD    . LYS G 2 64  ? 44.031  28.273 -50.139 1.00 59.33  ? 664  LYS E CD    1 
ATOM   9187  C CE    . LYS G 2 64  ? 44.530  29.617 -50.637 1.00 64.05  ? 664  LYS E CE    1 
ATOM   9188  N NZ    . LYS G 2 64  ? 45.210  29.417 -51.936 1.00 69.44  ? 664  LYS E NZ    1 
ATOM   9189  N N     . LEU G 2 65  ? 43.057  23.280 -51.576 1.00 29.31  ? 665  LEU E N     1 
ATOM   9190  C CA    . LEU G 2 65  ? 42.941  21.928 -51.126 1.00 28.72  ? 665  LEU E CA    1 
ATOM   9191  C C     . LEU G 2 65  ? 44.065  21.036 -51.606 1.00 27.98  ? 665  LEU E C     1 
ATOM   9192  O O     . LEU G 2 65  ? 44.679  20.315 -50.813 1.00 29.10  ? 665  LEU E O     1 
ATOM   9193  C CB    . LEU G 2 65  ? 41.585  21.353 -51.536 1.00 32.08  ? 665  LEU E CB    1 
ATOM   9194  C CG    . LEU G 2 65  ? 41.314  19.873 -51.221 1.00 33.81  ? 665  LEU E CG    1 
ATOM   9195  C CD1   . LEU G 2 65  ? 41.245  19.620 -49.742 1.00 34.93  ? 665  LEU E CD1   1 
ATOM   9196  C CD2   . LEU G 2 65  ? 40.036  19.508 -51.849 1.00 34.11  ? 665  LEU E CD2   1 
ATOM   9197  N N     . PRO G 2 66  ? 44.335  21.037 -52.904 1.00 33.51  ? 666  PRO E N     1 
ATOM   9198  C CA    . PRO G 2 66  ? 45.428  20.172 -53.339 1.00 34.01  ? 666  PRO E CA    1 
ATOM   9199  C C     . PRO G 2 66  ? 46.718  20.431 -52.568 1.00 36.01  ? 666  PRO E C     1 
ATOM   9200  O O     . PRO G 2 66  ? 47.424  19.493 -52.228 1.00 31.71  ? 666  PRO E O     1 
ATOM   9201  C CB    . PRO G 2 66  ? 45.542  20.480 -54.834 1.00 41.92  ? 666  PRO E CB    1 
ATOM   9202  C CG    . PRO G 2 66  ? 44.116  20.724 -55.210 1.00 44.01  ? 666  PRO E CG    1 
ATOM   9203  C CD    . PRO G 2 66  ? 43.570  21.556 -54.047 1.00 44.52  ? 666  PRO E CD    1 
ATOM   9204  N N     . PHE G 2 67  ? 47.031  21.689 -52.281 1.00 36.19  ? 667  PHE E N     1 
ATOM   9205  C CA    . PHE G 2 67  ? 48.248  21.999 -51.532 1.00 34.56  ? 667  PHE E CA    1 
ATOM   9206  C C     . PHE G 2 67  ? 48.183  21.440 -50.098 1.00 32.70  ? 667  PHE E C     1 
ATOM   9207  O O     . PHE G 2 67  ? 49.186  20.956 -49.586 1.00 28.81  ? 667  PHE E O     1 
ATOM   9208  C CB    . PHE G 2 67  ? 48.495  23.517 -51.485 1.00 28.49  ? 667  PHE E CB    1 
ATOM   9209  C CG    . PHE G 2 67  ? 49.769  23.898 -50.800 1.00 25.06  ? 667  PHE E CG    1 
ATOM   9210  C CD1   . PHE G 2 67  ? 50.984  23.855 -51.474 1.00 27.90  ? 667  PHE E CD1   1 
ATOM   9211  C CD2   . PHE G 2 67  ? 49.773  24.215 -49.454 1.00 25.91  ? 667  PHE E CD2   1 
ATOM   9212  C CE1   . PHE G 2 67  ? 52.188  24.144 -50.811 1.00 24.25  ? 667  PHE E CE1   1 
ATOM   9213  C CE2   . PHE G 2 67  ? 50.965  24.501 -48.787 1.00 21.00  ? 667  PHE E CE2   1 
ATOM   9214  C CZ    . PHE G 2 67  ? 52.177  24.453 -49.480 1.00 22.33  ? 667  PHE E CZ    1 
ATOM   9215  N N     . GLN G 2 68  ? 47.014  21.507 -49.455 1.00 29.39  ? 668  GLN E N     1 
ATOM   9216  C CA    . GLN G 2 68  ? 46.843  20.975 -48.101 1.00 34.58  ? 668  GLN E CA    1 
ATOM   9217  C C     . GLN G 2 68  ? 47.132  19.441 -47.977 1.00 33.15  ? 668  GLN E C     1 
ATOM   9218  O O     . GLN G 2 68  ? 47.819  18.983 -47.031 1.00 30.64  ? 668  GLN E O     1 
ATOM   9219  C CB    . GLN G 2 68  ? 45.432  21.272 -47.596 1.00 22.65  ? 668  GLN E CB    1 
ATOM   9220  C CG    . GLN G 2 68  ? 45.294  20.957 -46.132 1.00 31.89  ? 668  GLN E CG    1 
ATOM   9221  C CD    . GLN G 2 68  ? 44.057  21.529 -45.505 1.00 37.72  ? 668  GLN E CD    1 
ATOM   9222  O OE1   . GLN G 2 68  ? 42.959  21.065 -45.759 1.00 41.41  ? 668  GLN E OE1   1 
ATOM   9223  N NE2   . GLN G 2 68  ? 44.223  22.553 -44.671 1.00 41.38  ? 668  GLN E NE2   1 
ATOM   9224  N N     . ARG G 2 69  ? 46.604  18.652 -48.915 1.00 33.78  ? 669  ARG E N     1 
ATOM   9225  C CA    . ARG G 2 69  ? 46.845  17.219 -48.910 1.00 35.94  ? 669  ARG E CA    1 
ATOM   9226  C C     . ARG G 2 69  ? 48.330  16.948 -49.047 1.00 36.08  ? 669  ARG E C     1 
ATOM   9227  O O     . ARG G 2 69  ? 48.855  16.034 -48.397 1.00 36.92  ? 669  ARG E O     1 
ATOM   9228  C CB    . ARG G 2 69  ? 46.165  16.533 -50.077 1.00 23.38  ? 669  ARG E CB    1 
ATOM   9229  C CG    . ARG G 2 69  ? 44.700  16.626 -50.094 1.00 27.12  ? 669  ARG E CG    1 
ATOM   9230  C CD    . ARG G 2 69  ? 44.197  15.732 -51.175 1.00 31.26  ? 669  ARG E CD    1 
ATOM   9231  N NE    . ARG G 2 69  ? 43.012  16.270 -51.816 1.00 39.24  ? 669  ARG E NE    1 
ATOM   9232  C CZ    . ARG G 2 69  ? 43.018  16.660 -53.077 1.00 36.86  ? 669  ARG E CZ    1 
ATOM   9233  N NH1   . ARG G 2 69  ? 44.139  16.553 -53.789 1.00 31.39  ? 669  ARG E NH1   1 
ATOM   9234  N NH2   . ARG G 2 69  ? 41.924  17.185 -53.610 1.00 41.36  ? 669  ARG E NH2   1 
ATOM   9235  N N     . LEU G 2 70  ? 48.998  17.711 -49.920 1.00 36.40  ? 670  LEU E N     1 
ATOM   9236  C CA    . LEU G 2 70  ? 50.429  17.528 -50.134 1.00 36.75  ? 670  LEU E CA    1 
ATOM   9237  C C     . LEU G 2 70  ? 51.158  17.800 -48.816 1.00 36.24  ? 670  LEU E C     1 
ATOM   9238  O O     . LEU G 2 70  ? 52.159  17.150 -48.469 1.00 35.47  ? 670  LEU E O     1 
ATOM   9239  C CB    . LEU G 2 70  ? 50.943  18.474 -51.233 1.00 17.76  ? 670  LEU E CB    1 
ATOM   9240  C CG    . LEU G 2 70  ? 52.484  18.506 -51.396 1.00 17.28  ? 670  LEU E CG    1 
ATOM   9241  C CD1   . LEU G 2 70  ? 53.048  17.093 -51.726 1.00 13.09  ? 670  LEU E CD1   1 
ATOM   9242  C CD2   . LEU G 2 70  ? 52.873  19.518 -52.462 1.00 16.70  ? 670  LEU E CD2   1 
ATOM   9243  N N     . VAL G 2 71  ? 50.644  18.763 -48.066 1.00 29.29  ? 671  VAL E N     1 
ATOM   9244  C CA    . VAL G 2 71  ? 51.268  19.078 -46.801 1.00 29.21  ? 671  VAL E CA    1 
ATOM   9245  C C     . VAL G 2 71  ? 51.085  17.942 -45.835 1.00 31.25  ? 671  VAL E C     1 
ATOM   9246  O O     . VAL G 2 71  ? 52.061  17.466 -45.241 1.00 27.43  ? 671  VAL E O     1 
ATOM   9247  C CB    . VAL G 2 71  ? 50.712  20.375 -46.207 1.00 22.73  ? 671  VAL E CB    1 
ATOM   9248  C CG1   . VAL G 2 71  ? 50.811  20.367 -44.699 1.00 21.39  ? 671  VAL E CG1   1 
ATOM   9249  C CG2   . VAL G 2 71  ? 51.520  21.526 -46.750 1.00 24.66  ? 671  VAL E CG2   1 
ATOM   9250  N N     . ARG G 2 72  ? 49.837  17.501 -45.696 1.00 35.54  ? 672  ARG E N     1 
ATOM   9251  C CA    . ARG G 2 72  ? 49.525  16.407 -44.793 1.00 37.31  ? 672  ARG E CA    1 
ATOM   9252  C C     . ARG G 2 72  ? 50.260  15.098 -45.189 1.00 34.87  ? 672  ARG E C     1 
ATOM   9253  O O     . ARG G 2 72  ? 50.744  14.334 -44.326 1.00 39.16  ? 672  ARG E O     1 
ATOM   9254  C CB    . ARG G 2 72  ? 48.009  16.214 -44.750 1.00 28.82  ? 672  ARG E CB    1 
ATOM   9255  C CG    . ARG G 2 72  ? 47.302  17.309 -44.004 1.00 32.72  ? 672  ARG E CG    1 
ATOM   9256  C CD    . ARG G 2 72  ? 45.821  17.191 -44.163 1.00 34.99  ? 672  ARG E CD    1 
ATOM   9257  N NE    . ARG G 2 72  ? 45.111  18.380 -43.684 1.00 38.16  ? 672  ARG E NE    1 
ATOM   9258  C CZ    . ARG G 2 72  ? 44.939  18.731 -42.401 1.00 40.12  ? 672  ARG E CZ    1 
ATOM   9259  N NH1   . ARG G 2 72  ? 45.423  17.999 -41.399 1.00 34.27  ? 672  ARG E NH1   1 
ATOM   9260  N NH2   . ARG G 2 72  ? 44.257  19.829 -42.128 1.00 40.21  ? 672  ARG E NH2   1 
ATOM   9261  N N     . GLU G 2 73  ? 50.337  14.847 -46.494 1.00 31.42  ? 673  GLU E N     1 
ATOM   9262  C CA    . GLU G 2 73  ? 51.034  13.689 -46.949 1.00 30.08  ? 673  GLU E CA    1 
ATOM   9263  C C     . GLU G 2 73  ? 52.489  13.750 -46.477 1.00 31.86  ? 673  GLU E C     1 
ATOM   9264  O O     . GLU G 2 73  ? 52.974  12.837 -45.824 1.00 33.53  ? 673  GLU E O     1 
ATOM   9265  C CB    . GLU G 2 73  ? 51.021  13.615 -48.444 1.00 34.33  ? 673  GLU E CB    1 
ATOM   9266  C CG    . GLU G 2 73  ? 51.799  12.428 -48.898 1.00 32.28  ? 673  GLU E CG    1 
ATOM   9267  C CD    . GLU G 2 73  ? 51.935  12.369 -50.364 1.00 33.38  ? 673  GLU E CD    1 
ATOM   9268  O OE1   . GLU G 2 73  ? 50.894  12.317 -51.055 1.00 33.57  ? 673  GLU E OE1   1 
ATOM   9269  O OE2   . GLU G 2 73  ? 53.090  12.372 -50.838 1.00 34.18  ? 673  GLU E OE2   1 
ATOM   9270  N N     . ILE G 2 74  ? 53.195  14.815 -46.825 1.00 31.31  ? 674  ILE E N     1 
ATOM   9271  C CA    . ILE G 2 74  ? 54.568  14.964 -46.401 1.00 29.94  ? 674  ILE E CA    1 
ATOM   9272  C C     . ILE G 2 74  ? 54.727  14.973 -44.862 1.00 28.46  ? 674  ILE E C     1 
ATOM   9273  O O     . ILE G 2 74  ? 55.612  14.306 -44.301 1.00 31.06  ? 674  ILE E O     1 
ATOM   9274  C CB    . ILE G 2 74  ? 55.165  16.260 -46.980 1.00 29.95  ? 674  ILE E CB    1 
ATOM   9275  C CG1   . ILE G 2 74  ? 55.352  16.116 -48.481 1.00 28.62  ? 674  ILE E CG1   1 
ATOM   9276  C CG2   . ILE G 2 74  ? 56.532  16.537 -46.408 1.00 24.01  ? 674  ILE E CG2   1 
ATOM   9277  C CD1   . ILE G 2 74  ? 55.714  17.443 -49.163 1.00 30.58  ? 674  ILE E CD1   1 
ATOM   9278  N N     . ALA G 2 75  ? 53.890  15.738 -44.171 1.00 37.40  ? 675  ALA E N     1 
ATOM   9279  C CA    . ALA G 2 75  ? 54.006  15.810 -42.723 1.00 37.91  ? 675  ALA E CA    1 
ATOM   9280  C C     . ALA G 2 75  ? 53.836  14.425 -42.123 1.00 39.96  ? 675  ALA E C     1 
ATOM   9281  O O     . ALA G 2 75  ? 54.676  13.949 -41.393 1.00 38.92  ? 675  ALA E O     1 
ATOM   9282  C CB    . ALA G 2 75  ? 52.953  16.770 -42.150 1.00 30.99  ? 675  ALA E CB    1 
ATOM   9283  N N     . GLN G 2 76  ? 52.728  13.783 -42.466 1.00 40.73  ? 676  GLN E N     1 
ATOM   9284  C CA    . GLN G 2 76  ? 52.396  12.464 -41.952 1.00 43.37  ? 676  GLN E CA    1 
ATOM   9285  C C     . GLN G 2 76  ? 53.417  11.418 -42.292 1.00 43.80  ? 676  GLN E C     1 
ATOM   9286  O O     . GLN G 2 76  ? 53.877  10.688 -41.423 1.00 43.09  ? 676  GLN E O     1 
ATOM   9287  C CB    . GLN G 2 76  ? 51.044  12.051 -42.490 1.00 35.64  ? 676  GLN E CB    1 
ATOM   9288  C CG    . GLN G 2 76  ? 50.612  10.638 -42.255 1.00 38.06  ? 676  GLN E CG    1 
ATOM   9289  C CD    . GLN G 2 76  ? 49.851  10.181 -43.462 1.00 36.22  ? 676  GLN E CD    1 
ATOM   9290  O OE1   . GLN G 2 76  ? 50.444  10.047 -44.556 1.00 34.52  ? 676  GLN E OE1   1 
ATOM   9291  N NE2   . GLN G 2 76  ? 48.534  9.986  -43.316 1.00 36.92  ? 676  GLN E NE2   1 
ATOM   9292  N N     . ASP G 2 77  ? 53.791  11.306 -43.551 1.00 43.49  ? 677  ASP E N     1 
ATOM   9293  C CA    . ASP G 2 77  ? 54.753  10.270 -43.821 1.00 45.90  ? 677  ASP E CA    1 
ATOM   9294  C C     . ASP G 2 77  ? 56.196  10.816 -43.301 1.00 48.46  ? 677  ASP E C     1 
ATOM   9295  O O     . ASP G 2 77  ? 57.141  10.710 -44.023 1.00 46.68  ? 677  ASP E O     1 
ATOM   9296  C CB    . ASP G 2 77  ? 54.656  9.745  -45.387 1.00 8.64   ? 677  ASP E CB    1 
ATOM   9297  C CG    . ASP G 2 77  ? 53.333  8.685  -45.811 1.00 11.63  ? 677  ASP E CG    1 
ATOM   9298  O OD1   . ASP G 2 77  ? 52.765  7.892  -45.040 1.00 13.28  ? 677  ASP E OD1   1 
ATOM   9299  O OD2   . ASP G 2 77  ? 52.881  8.542  -46.962 1.00 6.68   ? 677  ASP E OD2   1 
ATOM   9300  N N     . PHE G 2 78  ? 56.308  11.401 -42.070 1.00 30.22  ? 678  PHE E N     1 
ATOM   9301  C CA    . PHE G 2 78  ? 57.531  11.937 -41.266 1.00 33.70  ? 678  PHE E CA    1 
ATOM   9302  C C     . PHE G 2 78  ? 56.796  12.142 -39.979 1.00 31.94  ? 678  PHE E C     1 
ATOM   9303  O O     . PHE G 2 78  ? 56.569  13.285 -39.668 1.00 29.19  ? 678  PHE E O     1 
ATOM   9304  C CB    . PHE G 2 78  ? 58.096  13.437 -41.437 1.00 118.97 ? 678  PHE E CB    1 
ATOM   9305  C CG    . PHE G 2 78  ? 59.035  13.968 -40.195 1.00 123.17 ? 678  PHE E CG    1 
ATOM   9306  C CD1   . PHE G 2 78  ? 60.285  13.389 -39.942 1.00 122.47 ? 678  PHE E CD1   1 
ATOM   9307  C CD2   . PHE G 2 78  ? 58.668  15.034 -39.316 1.00 124.81 ? 678  PHE E CD2   1 
ATOM   9308  C CE1   . PHE G 2 78  ? 61.163  13.848 -38.871 1.00 121.44 ? 678  PHE E CE1   1 
ATOM   9309  C CE2   . PHE G 2 78  ? 59.559  15.494 -38.234 1.00 126.22 ? 678  PHE E CE2   1 
ATOM   9310  C CZ    . PHE G 2 78  ? 60.788  14.889 -38.030 1.00 122.92 ? 678  PHE E CZ    1 
ATOM   9311  N N     . LYS G 2 79  ? 56.380  11.134 -39.234 1.00 41.19  ? 679  LYS E N     1 
ATOM   9312  C CA    . LYS G 2 79  ? 55.621  11.426 -38.010 1.00 43.41  ? 679  LYS E CA    1 
ATOM   9313  C C     . LYS G 2 79  ? 54.080  11.535 -38.203 1.00 43.08  ? 679  LYS E C     1 
ATOM   9314  O O     . LYS G 2 79  ? 53.557  12.513 -38.719 1.00 41.35  ? 679  LYS E O     1 
ATOM   9315  C CB    . LYS G 2 79  ? 56.140  12.726 -37.409 1.00 40.83  ? 679  LYS E CB    1 
ATOM   9316  C CG    . LYS G 2 79  ? 56.178  12.778 -35.942 1.00 48.76  ? 679  LYS E CG    1 
ATOM   9317  C CD    . LYS G 2 79  ? 54.920  12.238 -35.360 1.00 53.95  ? 679  LYS E CD    1 
ATOM   9318  C CE    . LYS G 2 79  ? 55.073  12.155 -33.857 1.00 54.87  ? 679  LYS E CE    1 
ATOM   9319  N NZ    . LYS G 2 79  ? 53.905  11.484 -33.235 1.00 58.65  ? 679  LYS E NZ    1 
ATOM   9320  N N     . THR G 2 80  ? 53.365  10.530 -37.727 1.00 35.81  ? 680  THR E N     1 
ATOM   9321  C CA    . THR G 2 80  ? 51.901  10.459 -37.831 1.00 35.78  ? 680  THR E CA    1 
ATOM   9322  C C     . THR G 2 80  ? 51.072  11.109 -36.718 1.00 36.02  ? 680  THR E C     1 
ATOM   9323  O O     . THR G 2 80  ? 51.599  11.574 -35.702 1.00 39.66  ? 680  THR E O     1 
ATOM   9324  C CB    . THR G 2 80  ? 51.429  9.016  -37.837 1.00 51.85  ? 680  THR E CB    1 
ATOM   9325  O OG1   . THR G 2 80  ? 51.893  8.406  -36.632 1.00 50.53  ? 680  THR E OG1   1 
ATOM   9326  C CG2   . THR G 2 80  ? 51.965  8.246  -39.047 1.00 53.40  ? 680  THR E CG2   1 
ATOM   9327  N N     . ASP G 2 81  ? 49.754  11.073 -36.907 1.00 46.91  ? 681  ASP E N     1 
ATOM   9328  C CA    . ASP G 2 81  ? 48.815  11.623 -35.932 1.00 50.67  ? 681  ASP E CA    1 
ATOM   9329  C C     . ASP G 2 81  ? 48.954  13.129 -35.711 1.00 51.19  ? 681  ASP E C     1 
ATOM   9330  O O     . ASP G 2 81  ? 48.726  13.620 -34.611 1.00 50.64  ? 681  ASP E O     1 
ATOM   9331  C CB    . ASP G 2 81  ? 48.982  10.909 -34.588 1.00 106.08 ? 681  ASP E CB    1 
ATOM   9332  C CG    . ASP G 2 81  ? 48.553  9.464  -34.641 1.00 112.18 ? 681  ASP E CG    1 
ATOM   9333  O OD1   . ASP G 2 81  ? 49.092  8.711  -35.477 1.00 116.19 ? 681  ASP E OD1   1 
ATOM   9334  O OD2   . ASP G 2 81  ? 47.674  9.085  -33.842 1.00 117.04 ? 681  ASP E OD2   1 
ATOM   9335  N N     . LEU G 2 82  ? 49.318  13.866 -36.750 1.00 48.91  ? 682  LEU E N     1 
ATOM   9336  C CA    . LEU G 2 82  ? 49.482  15.306 -36.615 1.00 47.46  ? 682  LEU E CA    1 
ATOM   9337  C C     . LEU G 2 82  ? 48.255  16.076 -37.049 1.00 44.86  ? 682  LEU E C     1 
ATOM   9338  O O     . LEU G 2 82  ? 47.541  15.639 -37.931 1.00 45.68  ? 682  LEU E O     1 
ATOM   9339  C CB    . LEU G 2 82  ? 50.683  15.770 -37.442 1.00 38.63  ? 682  LEU E CB    1 
ATOM   9340  C CG    . LEU G 2 82  ? 52.089  15.433 -36.922 1.00 36.79  ? 682  LEU E CG    1 
ATOM   9341  C CD1   . LEU G 2 82  ? 53.142  15.708 -37.979 1.00 36.68  ? 682  LEU E CD1   1 
ATOM   9342  C CD2   . LEU G 2 82  ? 52.366  16.268 -35.697 1.00 36.67  ? 682  LEU E CD2   1 
ATOM   9343  N N     . ARG G 2 83  ? 47.996  17.216 -36.419 1.00 48.37  ? 683  ARG E N     1 
ATOM   9344  C CA    . ARG G 2 83  ? 46.874  18.056 -36.823 1.00 47.91  ? 683  ARG E CA    1 
ATOM   9345  C C     . ARG G 2 83  ? 47.443  19.403 -37.290 1.00 47.19  ? 683  ARG E C     1 
ATOM   9346  O O     . ARG G 2 83  ? 48.561  19.783 -36.948 1.00 44.03  ? 683  ARG E O     1 
ATOM   9347  C CB    . ARG G 2 83  ? 45.898  18.261 -35.674 1.00 69.76  ? 683  ARG E CB    1 
ATOM   9348  C CG    . ARG G 2 83  ? 45.128  17.032 -35.307 1.00 74.65  ? 683  ARG E CG    1 
ATOM   9349  C CD    . ARG G 2 83  ? 44.014  17.371 -34.347 1.00 79.96  ? 683  ARG E CD    1 
ATOM   9350  N NE    . ARG G 2 83  ? 42.977  16.350 -34.397 1.00 89.36  ? 683  ARG E NE    1 
ATOM   9351  C CZ    . ARG G 2 83  ? 41.741  16.519 -33.945 1.00 90.53  ? 683  ARG E CZ    1 
ATOM   9352  N NH1   . ARG G 2 83  ? 41.390  17.676 -33.403 1.00 92.24  ? 683  ARG E NH1   1 
ATOM   9353  N NH2   . ARG G 2 83  ? 40.852  15.540 -34.055 1.00 95.65  ? 683  ARG E NH2   1 
ATOM   9354  N N     . PHE G 2 84  ? 46.673  20.132 -38.078 1.00 45.12  ? 684  PHE E N     1 
ATOM   9355  C CA    . PHE G 2 84  ? 47.156  21.394 -38.595 1.00 46.98  ? 684  PHE E CA    1 
ATOM   9356  C C     . PHE G 2 84  ? 46.205  22.538 -38.405 1.00 44.06  ? 684  PHE E C     1 
ATOM   9357  O O     . PHE G 2 84  ? 45.064  22.441 -38.812 1.00 47.34  ? 684  PHE E O     1 
ATOM   9358  C CB    . PHE G 2 84  ? 47.435  21.276 -40.103 1.00 34.90  ? 684  PHE E CB    1 
ATOM   9359  C CG    . PHE G 2 84  ? 48.762  20.664 -40.439 1.00 33.63  ? 684  PHE E CG    1 
ATOM   9360  C CD1   . PHE G 2 84  ? 48.882  19.301 -40.632 1.00 35.17  ? 684  PHE E CD1   1 
ATOM   9361  C CD2   . PHE G 2 84  ? 49.911  21.447 -40.515 1.00 33.82  ? 684  PHE E CD2   1 
ATOM   9362  C CE1   . PHE G 2 84  ? 50.131  18.726 -40.902 1.00 34.49  ? 684  PHE E CE1   1 
ATOM   9363  C CE2   . PHE G 2 84  ? 51.145  20.879 -40.779 1.00 34.27  ? 684  PHE E CE2   1 
ATOM   9364  C CZ    . PHE G 2 84  ? 51.256  19.522 -40.970 1.00 36.08  ? 684  PHE E CZ    1 
ATOM   9365  N N     . GLN G 2 85  ? 46.680  23.622 -37.797 1.00 43.87  ? 685  GLN E N     1 
ATOM   9366  C CA    . GLN G 2 85  ? 45.886  24.840 -37.650 1.00 43.42  ? 685  GLN E CA    1 
ATOM   9367  C C     . GLN G 2 85  ? 45.801  25.336 -39.096 1.00 43.33  ? 685  GLN E C     1 
ATOM   9368  O O     . GLN G 2 85  ? 46.804  25.353 -39.815 1.00 40.51  ? 685  GLN E O     1 
ATOM   9369  C CB    . GLN G 2 85  ? 46.612  25.905 -36.827 1.00 33.94  ? 685  GLN E CB    1 
ATOM   9370  C CG    . GLN G 2 85  ? 46.875  25.596 -35.351 1.00 35.00  ? 685  GLN E CG    1 
ATOM   9371  C CD    . GLN G 2 85  ? 47.367  26.842 -34.581 1.00 38.21  ? 685  GLN E CD    1 
ATOM   9372  O OE1   . GLN G 2 85  ? 48.053  27.709 -35.135 1.00 36.62  ? 685  GLN E OE1   1 
ATOM   9373  N NE2   . GLN G 2 85  ? 47.026  26.922 -33.297 1.00 38.66  ? 685  GLN E NE2   1 
ATOM   9374  N N     . SER G 2 86  ? 44.609  25.712 -39.534 1.00 43.52  ? 686  SER E N     1 
ATOM   9375  C CA    . SER G 2 86  ? 44.426  26.179 -40.895 1.00 43.70  ? 686  SER E CA    1 
ATOM   9376  C C     . SER G 2 86  ? 45.485  27.208 -41.277 1.00 41.96  ? 686  SER E C     1 
ATOM   9377  O O     . SER G 2 86  ? 45.954  27.213 -42.399 1.00 41.63  ? 686  SER E O     1 
ATOM   9378  C CB    . SER G 2 86  ? 43.044  26.793 -41.032 1.00 39.16  ? 686  SER E CB    1 
ATOM   9379  O OG    . SER G 2 86  ? 42.862  27.769 -40.011 1.00 49.76  ? 686  SER E OG    1 
ATOM   9380  N N     . SER G 2 87  ? 45.869  28.067 -40.338 1.00 33.43  ? 687  SER E N     1 
ATOM   9381  C CA    . SER G 2 87  ? 46.855  29.106 -40.614 1.00 34.91  ? 687  SER E CA    1 
ATOM   9382  C C     . SER G 2 87  ? 48.267  28.577 -40.782 1.00 33.90  ? 687  SER E C     1 
ATOM   9383  O O     . SER G 2 87  ? 49.110  29.256 -41.386 1.00 32.90  ? 687  SER E O     1 
ATOM   9384  C CB    . SER G 2 87  ? 46.842  30.190 -39.530 1.00 40.31  ? 687  SER E CB    1 
ATOM   9385  O OG    . SER G 2 87  ? 47.339  29.704 -38.307 1.00 51.71  ? 687  SER E OG    1 
ATOM   9386  N N     . ALA G 2 88  ? 48.532  27.387 -40.250 1.00 30.78  ? 688  ALA E N     1 
ATOM   9387  C CA    . ALA G 2 88  ? 49.844  26.778 -40.410 1.00 31.26  ? 688  ALA E CA    1 
ATOM   9388  C C     . ALA G 2 88  ? 49.937  26.262 -41.843 1.00 31.78  ? 688  ALA E C     1 
ATOM   9389  O O     . ALA G 2 88  ? 51.025  26.212 -42.450 1.00 28.28  ? 688  ALA E O     1 
ATOM   9390  C CB    . ALA G 2 88  ? 50.025  25.638 -39.449 1.00 18.06  ? 688  ALA E CB    1 
ATOM   9391  N N     . VAL G 2 89  ? 48.793  25.877 -42.394 1.00 31.00  ? 689  VAL E N     1 
ATOM   9392  C CA    . VAL G 2 89  ? 48.790  25.378 -43.757 1.00 34.03  ? 689  VAL E CA    1 
ATOM   9393  C C     . VAL G 2 89  ? 48.932  26.553 -44.701 1.00 32.96  ? 689  VAL E C     1 
ATOM   9394  O O     . VAL G 2 89  ? 49.518  26.418 -45.770 1.00 34.00  ? 689  VAL E O     1 
ATOM   9395  C CB    . VAL G 2 89  ? 47.469  24.632 -44.118 1.00 27.56  ? 689  VAL E CB    1 
ATOM   9396  C CG1   . VAL G 2 89  ? 47.634  23.906 -45.464 1.00 26.46  ? 689  VAL E CG1   1 
ATOM   9397  C CG2   . VAL G 2 89  ? 47.085  23.674 -43.037 1.00 29.77  ? 689  VAL E CG2   1 
ATOM   9398  N N     . MET G 2 90  ? 48.375  27.698 -44.314 1.00 31.00  ? 690  MET E N     1 
ATOM   9399  C CA    . MET G 2 90  ? 48.456  28.885 -45.143 1.00 32.68  ? 690  MET E CA    1 
ATOM   9400  C C     . MET G 2 90  ? 49.852  29.516 -45.114 1.00 29.64  ? 690  MET E C     1 
ATOM   9401  O O     . MET G 2 90  ? 50.291  30.058 -46.134 1.00 30.85  ? 690  MET E O     1 
ATOM   9402  C CB    . MET G 2 90  ? 47.406  29.915 -44.740 1.00 32.53  ? 690  MET E CB    1 
ATOM   9403  C CG    . MET G 2 90  ? 46.015  29.642 -45.252 1.00 40.87  ? 690  MET E CG    1 
ATOM   9404  S SD    . MET G 2 90  ? 45.934  29.255 -47.024 1.00 49.63  ? 690  MET E SD    1 
ATOM   9405  C CE    . MET G 2 90  ? 46.133  30.848 -47.662 1.00 45.13  ? 690  MET E CE    1 
ATOM   9406  N N     . ALA G 2 91  ? 50.556  29.453 -43.973 1.00 28.40  ? 691  ALA E N     1 
ATOM   9407  C CA    . ALA G 2 91  ? 51.903  30.008 -43.927 1.00 29.65  ? 691  ALA E CA    1 
ATOM   9408  C C     . ALA G 2 91  ? 52.837  29.176 -44.800 1.00 29.34  ? 691  ALA E C     1 
ATOM   9409  O O     . ALA G 2 91  ? 53.711  29.715 -45.467 1.00 28.83  ? 691  ALA E O     1 
ATOM   9410  C CB    . ALA G 2 91  ? 52.406  30.033 -42.557 1.00 13.19  ? 691  ALA E CB    1 
ATOM   9411  N N     . LEU G 2 92  ? 52.670  27.861 -44.803 1.00 34.44  ? 692  LEU E N     1 
ATOM   9412  C CA    . LEU G 2 92  ? 53.541  27.060 -45.643 1.00 35.16  ? 692  LEU E CA    1 
ATOM   9413  C C     . LEU G 2 92  ? 53.269  27.362 -47.117 1.00 34.29  ? 692  LEU E C     1 
ATOM   9414  O O     . LEU G 2 92  ? 54.194  27.357 -47.939 1.00 31.46  ? 692  LEU E O     1 
ATOM   9415  C CB    . LEU G 2 92  ? 53.359  25.562 -45.364 1.00 28.24  ? 692  LEU E CB    1 
ATOM   9416  C CG    . LEU G 2 92  ? 53.903  25.003 -44.054 1.00 30.35  ? 692  LEU E CG    1 
ATOM   9417  C CD1   . LEU G 2 92  ? 53.236  23.688 -43.783 1.00 30.62  ? 692  LEU E CD1   1 
ATOM   9418  C CD2   . LEU G 2 92  ? 55.402  24.839 -44.127 1.00 28.13  ? 692  LEU E CD2   1 
ATOM   9419  N N     . GLN G 2 93  ? 52.007  27.628 -47.462 1.00 28.81  ? 693  GLN E N     1 
ATOM   9420  C CA    . GLN G 2 93  ? 51.697  27.926 -48.854 1.00 33.12  ? 693  GLN E CA    1 
ATOM   9421  C C     . GLN G 2 93  ? 52.228  29.296 -49.225 1.00 33.31  ? 693  GLN E C     1 
ATOM   9422  O O     . GLN G 2 93  ? 52.682  29.465 -50.353 1.00 34.28  ? 693  GLN E O     1 
ATOM   9423  C CB    . GLN G 2 93  ? 50.205  27.850 -49.129 1.00 32.60  ? 693  GLN E CB    1 
ATOM   9424  C CG    . GLN G 2 93  ? 49.908  27.904 -50.612 1.00 33.34  ? 693  GLN E CG    1 
ATOM   9425  C CD    . GLN G 2 93  ? 48.455  27.618 -50.958 1.00 37.31  ? 693  GLN E CD    1 
ATOM   9426  O OE1   . GLN G 2 93  ? 47.593  27.539 -50.074 1.00 35.66  ? 693  GLN E OE1   1 
ATOM   9427  N NE2   . GLN G 2 93  ? 48.173  27.482 -52.249 1.00 35.62  ? 693  GLN E NE2   1 
ATOM   9428  N N     . GLU G 2 94  ? 52.175  30.252 -48.278 1.00 19.23  ? 694  GLU E N     1 
ATOM   9429  C CA    . GLU G 2 94  ? 52.700  31.599 -48.475 1.00 18.67  ? 694  GLU E CA    1 
ATOM   9430  C C     . GLU G 2 94  ? 54.225  31.526 -48.620 1.00 17.87  ? 694  GLU E C     1 
ATOM   9431  O O     . GLU G 2 94  ? 54.809  32.224 -49.438 1.00 16.58  ? 694  GLU E O     1 
ATOM   9432  C CB    . GLU G 2 94  ? 52.403  32.524 -47.286 1.00 37.82  ? 694  GLU E CB    1 
ATOM   9433  C CG    . GLU G 2 94  ? 50.969  33.026 -47.086 1.00 37.33  ? 694  GLU E CG    1 
ATOM   9434  C CD    . GLU G 2 94  ? 50.434  33.915 -48.208 1.00 42.53  ? 694  GLU E CD    1 
ATOM   9435  O OE1   . GLU G 2 94  ? 51.201  34.713 -48.757 1.00 41.82  ? 694  GLU E OE1   1 
ATOM   9436  O OE2   . GLU G 2 94  ? 49.226  33.831 -48.521 1.00 45.41  ? 694  GLU E OE2   1 
ATOM   9437  N N     . ALA G 2 95  ? 54.879  30.690 -47.824 1.00 28.18  ? 695  ALA E N     1 
ATOM   9438  C CA    . ALA G 2 95  ? 56.321  30.582 -47.913 1.00 27.37  ? 695  ALA E CA    1 
ATOM   9439  C C     . ALA G 2 95  ? 56.712  29.865 -49.163 1.00 27.97  ? 695  ALA E C     1 
ATOM   9440  O O     . ALA G 2 95  ? 57.627  30.309 -49.848 1.00 26.80  ? 695  ALA E O     1 
ATOM   9441  C CB    . ALA G 2 95  ? 56.880  29.854 -46.736 1.00 17.39  ? 695  ALA E CB    1 
ATOM   9442  N N     . SER G 2 96  ? 56.034  28.753 -49.459 1.00 23.65  ? 696  SER E N     1 
ATOM   9443  C CA    . SER G 2 96  ? 56.315  27.941 -50.659 1.00 23.05  ? 696  SER E CA    1 
ATOM   9444  C C     . SER G 2 96  ? 56.179  28.702 -51.982 1.00 20.59  ? 696  SER E C     1 
ATOM   9445  O O     . SER G 2 96  ? 57.064  28.644 -52.855 1.00 21.42  ? 696  SER E O     1 
ATOM   9446  C CB    . SER G 2 96  ? 55.377  26.731 -50.725 1.00 30.08  ? 696  SER E CB    1 
ATOM   9447  O OG    . SER G 2 96  ? 55.527  25.866 -49.624 1.00 35.88  ? 696  SER E OG    1 
ATOM   9448  N N     . GLU G 2 97  ? 55.064  29.408 -52.147 1.00 23.48  ? 697  GLU E N     1 
ATOM   9449  C CA    . GLU G 2 97  ? 54.880  30.138 -53.401 1.00 24.30  ? 697  GLU E CA    1 
ATOM   9450  C C     . GLU G 2 97  ? 55.903  31.263 -53.527 1.00 21.72  ? 697  GLU E C     1 
ATOM   9451  O O     . GLU G 2 97  ? 56.467  31.471 -54.608 1.00 23.37  ? 697  GLU E O     1 
ATOM   9452  C CB    . GLU G 2 97  ? 53.460  30.699 -53.535 1.00 39.22  ? 697  GLU E CB    1 
ATOM   9453  C CG    . GLU G 2 97  ? 52.401  29.666 -53.352 1.00 40.66  ? 697  GLU E CG    1 
ATOM   9454  C CD    . GLU G 2 97  ? 51.153  29.924 -54.171 1.00 45.16  ? 697  GLU E CD    1 
ATOM   9455  O OE1   . GLU G 2 97  ? 50.929  31.077 -54.583 1.00 41.42  ? 697  GLU E OE1   1 
ATOM   9456  O OE2   . GLU G 2 97  ? 50.373  28.976 -54.398 1.00 46.00  ? 697  GLU E OE2   1 
ATOM   9457  N N     . ALA G 2 98  ? 56.164  31.963 -52.422 1.00 20.63  ? 698  ALA E N     1 
ATOM   9458  C CA    . ALA G 2 98  ? 57.114  33.059 -52.485 1.00 22.68  ? 698  ALA E CA    1 
ATOM   9459  C C     . ALA G 2 98  ? 58.508  32.565 -52.773 1.00 24.01  ? 698  ALA E C     1 
ATOM   9460  O O     . ALA G 2 98  ? 59.310  33.312 -53.332 1.00 24.36  ? 698  ALA E O     1 
ATOM   9461  C CB    . ALA G 2 98  ? 57.105  33.853 -51.237 1.00 9.18   ? 698  ALA E CB    1 
ATOM   9462  N N     . TYR G 2 99  ? 58.779  31.320 -52.400 1.00 24.74  ? 699  TYR E N     1 
ATOM   9463  C CA    . TYR G 2 99  ? 60.066  30.692 -52.629 1.00 22.19  ? 699  TYR E CA    1 
ATOM   9464  C C     . TYR G 2 99  ? 60.255  30.350 -54.118 1.00 22.66  ? 699  TYR E C     1 
ATOM   9465  O O     . TYR G 2 99  ? 61.297  30.698 -54.741 1.00 23.56  ? 699  TYR E O     1 
ATOM   9466  C CB    . TYR G 2 99  ? 60.194  29.409 -51.778 1.00 20.75  ? 699  TYR E CB    1 
ATOM   9467  C CG    . TYR G 2 99  ? 61.346  28.514 -52.197 1.00 22.25  ? 699  TYR E CG    1 
ATOM   9468  C CD1   . TYR G 2 99  ? 62.667  28.821 -51.874 1.00 21.12  ? 699  TYR E CD1   1 
ATOM   9469  C CD2   . TYR G 2 99  ? 61.118  27.430 -53.038 1.00 24.92  ? 699  TYR E CD2   1 
ATOM   9470  C CE1   . TYR G 2 99  ? 63.740  28.056 -52.399 1.00 23.21  ? 699  TYR E CE1   1 
ATOM   9471  C CE2   . TYR G 2 99  ? 62.155  26.677 -53.571 1.00 23.66  ? 699  TYR E CE2   1 
ATOM   9472  C CZ    . TYR G 2 99  ? 63.465  26.981 -53.263 1.00 26.68  ? 699  TYR E CZ    1 
ATOM   9473  O OH    . TYR G 2 99  ? 64.469  26.219 -53.865 1.00 24.95  ? 699  TYR E OH    1 
ATOM   9474  N N     . LEU G 2 100 ? 59.248  29.653 -54.660 1.00 25.48  ? 700  LEU E N     1 
ATOM   9475  C CA    . LEU G 2 100 ? 59.215  29.207 -56.042 1.00 25.87  ? 700  LEU E CA    1 
ATOM   9476  C C     . LEU G 2 100 ? 59.177  30.386 -57.034 1.00 24.65  ? 700  LEU E C     1 
ATOM   9477  O O     . LEU G 2 100 ? 59.832  30.352 -58.061 1.00 26.27  ? 700  LEU E O     1 
ATOM   9478  C CB    . LEU G 2 100 ? 58.000  28.265 -56.247 1.00 19.37  ? 700  LEU E CB    1 
ATOM   9479  C CG    . LEU G 2 100 ? 58.018  26.817 -55.693 1.00 24.54  ? 700  LEU E CG    1 
ATOM   9480  C CD1   . LEU G 2 100 ? 56.735  26.058 -56.063 1.00 21.02  ? 700  LEU E CD1   1 
ATOM   9481  C CD2   . LEU G 2 100 ? 59.237  26.049 -56.260 1.00 20.48  ? 700  LEU E CD2   1 
ATOM   9482  N N     . VAL G 2 101 ? 58.416  31.432 -56.738 1.00 37.24  ? 701  VAL E N     1 
ATOM   9483  C CA    . VAL G 2 101 ? 58.348  32.580 -57.647 1.00 36.77  ? 701  VAL E CA    1 
ATOM   9484  C C     . VAL G 2 101 ? 59.709  33.255 -57.743 1.00 33.05  ? 701  VAL E C     1 
ATOM   9485  O O     . VAL G 2 101 ? 60.090  33.743 -58.800 1.00 36.08  ? 701  VAL E O     1 
ATOM   9486  C CB    . VAL G 2 101 ? 57.305  33.638 -57.188 1.00 23.85  ? 701  VAL E CB    1 
ATOM   9487  C CG1   . VAL G 2 101 ? 57.448  34.892 -58.013 1.00 23.14  ? 701  VAL E CG1   1 
ATOM   9488  C CG2   . VAL G 2 101 ? 55.896  33.090 -57.350 1.00 24.22  ? 701  VAL E CG2   1 
ATOM   9489  N N     . ALA G 2 102 ? 60.439  33.271 -56.639 1.00 33.56  ? 702  ALA E N     1 
ATOM   9490  C CA    . ALA G 2 102 ? 61.751  33.877 -56.632 1.00 34.10  ? 702  ALA E CA    1 
ATOM   9491  C C     . ALA G 2 102 ? 62.691  32.965 -57.307 1.00 35.12  ? 702  ALA E C     1 
ATOM   9492  O O     . ALA G 2 102 ? 63.618  33.420 -57.938 1.00 36.63  ? 702  ALA E O     1 
ATOM   9493  C CB    . ALA G 2 102 ? 62.207  34.064 -55.309 1.00 3.73   ? 702  ALA E CB    1 
ATOM   9494  N N     . LEU G 2 103 ? 62.495  31.667 -57.134 1.00 26.89  ? 703  LEU E N     1 
ATOM   9495  C CA    . LEU G 2 103 ? 63.348  30.699 -57.806 1.00 22.67  ? 703  LEU E CA    1 
ATOM   9496  C C     . LEU G 2 103 ? 63.190  30.849 -59.323 1.00 23.11  ? 703  LEU E C     1 
ATOM   9497  O O     . LEU G 2 103 ? 64.182  30.845 -60.046 1.00 22.04  ? 703  LEU E O     1 
ATOM   9498  C CB    . LEU G 2 103 ? 62.973  29.296 -57.391 1.00 14.28  ? 703  LEU E CB    1 
ATOM   9499  C CG    . LEU G 2 103 ? 63.869  28.220 -57.961 1.00 16.89  ? 703  LEU E CG    1 
ATOM   9500  C CD1   . LEU G 2 103 ? 65.347  28.496 -57.612 1.00 17.07  ? 703  LEU E CD1   1 
ATOM   9501  C CD2   . LEU G 2 103 ? 63.442  26.935 -57.396 1.00 15.62  ? 703  LEU E CD2   1 
ATOM   9502  N N     . PHE G 2 104 ? 61.949  30.985 -59.807 1.00 31.41  ? 704  PHE E N     1 
ATOM   9503  C CA    . PHE G 2 104 ? 61.693  31.171 -61.240 1.00 32.45  ? 704  PHE E CA    1 
ATOM   9504  C C     . PHE G 2 104 ? 62.359  32.448 -61.817 1.00 33.29  ? 704  PHE E C     1 
ATOM   9505  O O     . PHE G 2 104 ? 62.786  32.461 -62.976 1.00 36.22  ? 704  PHE E O     1 
ATOM   9506  C CB    . PHE G 2 104 ? 60.200  31.202 -61.502 1.00 17.74  ? 704  PHE E CB    1 
ATOM   9507  C CG    . PHE G 2 104 ? 59.568  29.848 -61.564 1.00 17.33  ? 704  PHE E CG    1 
ATOM   9508  C CD1   . PHE G 2 104 ? 58.500  29.530 -60.750 1.00 18.01  ? 704  PHE E CD1   1 
ATOM   9509  C CD2   . PHE G 2 104 ? 60.028  28.882 -62.455 1.00 18.22  ? 704  PHE E CD2   1 
ATOM   9510  C CE1   . PHE G 2 104 ? 57.900  28.271 -60.808 1.00 17.65  ? 704  PHE E CE1   1 
ATOM   9511  C CE2   . PHE G 2 104 ? 59.432  27.629 -62.519 1.00 17.70  ? 704  PHE E CE2   1 
ATOM   9512  C CZ    . PHE G 2 104 ? 58.364  27.321 -61.688 1.00 18.55  ? 704  PHE E CZ    1 
ATOM   9513  N N     . GLU G 2 105 ? 62.447  33.520 -61.031 1.00 36.35  ? 705  GLU E N     1 
ATOM   9514  C CA    . GLU G 2 105 ? 63.124  34.721 -61.517 1.00 38.50  ? 705  GLU E CA    1 
ATOM   9515  C C     . GLU G 2 105 ? 64.597  34.385 -61.787 1.00 36.73  ? 705  GLU E C     1 
ATOM   9516  O O     . GLU G 2 105 ? 65.108  34.684 -62.862 1.00 36.97  ? 705  GLU E O     1 
ATOM   9517  C CB    . GLU G 2 105 ? 63.045  35.851 -60.505 1.00 38.78  ? 705  GLU E CB    1 
ATOM   9518  C CG    . GLU G 2 105 ? 61.669  36.420 -60.310 1.00 45.97  ? 705  GLU E CG    1 
ATOM   9519  C CD    . GLU G 2 105 ? 61.545  37.195 -58.995 1.00 49.50  ? 705  GLU E CD    1 
ATOM   9520  O OE1   . GLU G 2 105 ? 62.610  37.676 -58.523 1.00 48.79  ? 705  GLU E OE1   1 
ATOM   9521  O OE2   . GLU G 2 105 ? 60.413  37.344 -58.445 1.00 49.17  ? 705  GLU E OE2   1 
ATOM   9522  N N     . ASP G 2 106 ? 65.273  33.760 -60.811 1.00 27.16  ? 706  ASP E N     1 
ATOM   9523  C CA    . ASP G 2 106 ? 66.682  33.371 -60.945 1.00 27.59  ? 706  ASP E CA    1 
ATOM   9524  C C     . ASP G 2 106 ? 66.840  32.442 -62.145 1.00 25.89  ? 706  ASP E C     1 
ATOM   9525  O O     . ASP G 2 106 ? 67.761  32.577 -62.943 1.00 26.17  ? 706  ASP E O     1 
ATOM   9526  C CB    . ASP G 2 106 ? 67.147  32.671 -59.678 1.00 38.82  ? 706  ASP E CB    1 
ATOM   9527  C CG    . ASP G 2 106 ? 67.255  33.617 -58.515 1.00 42.69  ? 706  ASP E CG    1 
ATOM   9528  O OD1   . ASP G 2 106 ? 66.835  34.773 -58.703 1.00 43.60  ? 706  ASP E OD1   1 
ATOM   9529  O OD2   . ASP G 2 106 ? 67.750  33.233 -57.422 1.00 43.26  ? 706  ASP E OD2   1 
ATOM   9530  N N     . THR G 2 107 ? 65.922  31.498 -62.268 1.00 33.11  ? 707  THR E N     1 
ATOM   9531  C CA    . THR G 2 107 ? 65.923  30.558 -63.382 1.00 29.42  ? 707  THR E CA    1 
ATOM   9532  C C     . THR G 2 107 ? 65.819  31.313 -64.697 1.00 30.23  ? 707  THR E C     1 
ATOM   9533  O O     . THR G 2 107 ? 66.507  31.000 -65.657 1.00 31.96  ? 707  THR E O     1 
ATOM   9534  C CB    . THR G 2 107 ? 64.710  29.631 -63.323 1.00 42.56  ? 707  THR E CB    1 
ATOM   9535  O OG1   . THR G 2 107 ? 64.784  28.822 -62.151 1.00 39.76  ? 707  THR E OG1   1 
ATOM   9536  C CG2   . THR G 2 107 ? 64.651  28.762 -64.547 1.00 44.74  ? 707  THR E CG2   1 
ATOM   9537  N N     . ASN G 2 108 ? 64.927  32.302 -64.733 1.00 34.67  ? 708  ASN E N     1 
ATOM   9538  C CA    . ASN G 2 108 ? 64.692  33.094 -65.931 1.00 33.10  ? 708  ASN E CA    1 
ATOM   9539  C C     . ASN G 2 108 ? 65.979  33.830 -66.287 1.00 38.04  ? 708  ASN E C     1 
ATOM   9540  O O     . ASN G 2 108 ? 66.345  33.935 -67.455 1.00 37.16  ? 708  ASN E O     1 
ATOM   9541  C CB    . ASN G 2 108 ? 63.533  34.041 -65.652 1.00 15.56  ? 708  ASN E CB    1 
ATOM   9542  C CG    . ASN G 2 108 ? 62.946  34.652 -66.906 1.00 17.02  ? 708  ASN E CG    1 
ATOM   9543  O OD1   . ASN G 2 108 ? 63.139  34.141 -67.997 1.00 19.74  ? 708  ASN E OD1   1 
ATOM   9544  N ND2   . ASN G 2 108 ? 62.207  35.753 -66.745 1.00 18.85  ? 708  ASN E ND2   1 
ATOM   9545  N N     . LEU G 2 109 ? 66.687  34.318 -65.275 1.00 32.58  ? 709  LEU E N     1 
ATOM   9546  C CA    . LEU G 2 109 ? 67.948  34.981 -65.536 1.00 32.43  ? 709  LEU E CA    1 
ATOM   9547  C C     . LEU G 2 109 ? 68.950  34.007 -66.121 1.00 33.38  ? 709  LEU E C     1 
ATOM   9548  O O     . LEU G 2 109 ? 69.597  34.312 -67.106 1.00 31.54  ? 709  LEU E O     1 
ATOM   9549  C CB    . LEU G 2 109 ? 68.530  35.571 -64.283 1.00 9.03   ? 709  LEU E CB    1 
ATOM   9550  C CG    . LEU G 2 109 ? 67.869  36.856 -63.782 1.00 10.39  ? 709  LEU E CG    1 
ATOM   9551  C CD1   . LEU G 2 109 ? 68.544  37.398 -62.532 1.00 12.25  ? 709  LEU E CD1   1 
ATOM   9552  C CD2   . LEU G 2 109 ? 67.915  37.852 -64.909 1.00 10.43  ? 709  LEU E CD2   1 
ATOM   9553  N N     . CYS G 2 110 ? 69.077  32.827 -65.530 1.00 35.82  ? 710  CYS E N     1 
ATOM   9554  C CA    . CYS G 2 110 ? 70.011  31.830 -66.052 1.00 39.83  ? 710  CYS E CA    1 
ATOM   9555  C C     . CYS G 2 110 ? 69.720  31.425 -67.510 1.00 39.14  ? 710  CYS E C     1 
ATOM   9556  O O     . CYS G 2 110 ? 70.636  31.171 -68.276 1.00 37.55  ? 710  CYS E O     1 
ATOM   9557  C CB    . CYS G 2 110 ? 70.010  30.594 -65.156 1.00 21.92  ? 710  CYS E CB    1 
ATOM   9558  S SG    . CYS G 2 110 ? 70.661  30.847 -63.517 1.00 29.14  ? 710  CYS E SG    1 
ATOM   9559  N N     . ALA G 2 111 ? 68.448  31.357 -67.881 1.00 33.76  ? 711  ALA E N     1 
ATOM   9560  C CA    . ALA G 2 111 ? 68.071  31.035 -69.247 1.00 32.79  ? 711  ALA E CA    1 
ATOM   9561  C C     . ALA G 2 111 ? 68.541  32.154 -70.192 1.00 32.40  ? 711  ALA E C     1 
ATOM   9562  O O     . ALA G 2 111 ? 69.143  31.906 -71.238 1.00 32.94  ? 711  ALA E O     1 
ATOM   9563  C CB    . ALA G 2 111 ? 66.553  30.893 -69.350 1.00 28.10  ? 711  ALA E CB    1 
ATOM   9564  N N     . ILE G 2 112 ? 68.245  33.392 -69.811 1.00 29.94  ? 712  ILE E N     1 
ATOM   9565  C CA    . ILE G 2 112 ? 68.598  34.542 -70.605 1.00 31.01  ? 712  ILE E CA    1 
ATOM   9566  C C     . ILE G 2 112 ? 70.113  34.628 -70.799 1.00 33.40  ? 712  ILE E C     1 
ATOM   9567  O O     . ILE G 2 112 ? 70.598  34.997 -71.866 1.00 34.74  ? 712  ILE E O     1 
ATOM   9568  C CB    . ILE G 2 112 ? 68.041  35.789 -69.928 1.00 19.42  ? 712  ILE E CB    1 
ATOM   9569  C CG1   . ILE G 2 112 ? 66.526  35.858 -70.133 1.00 15.47  ? 712  ILE E CG1   1 
ATOM   9570  C CG2   . ILE G 2 112 ? 68.663  37.020 -70.482 1.00 18.21  ? 712  ILE E CG2   1 
ATOM   9571  C CD1   . ILE G 2 112 ? 65.813  36.799 -69.106 1.00 18.08  ? 712  ILE E CD1   1 
ATOM   9572  N N     . HIS G 2 113 ? 70.854  34.261 -69.760 1.00 29.19  ? 713  HIS E N     1 
ATOM   9573  C CA    . HIS G 2 113 ? 72.308  34.251 -69.785 1.00 31.17  ? 713  HIS E CA    1 
ATOM   9574  C C     . HIS G 2 113 ? 72.758  33.362 -70.929 1.00 33.49  ? 713  HIS E C     1 
ATOM   9575  O O     . HIS G 2 113 ? 73.689  33.685 -71.644 1.00 35.53  ? 713  HIS E O     1 
ATOM   9576  C CB    . HIS G 2 113 ? 72.824  33.688 -68.463 1.00 42.02  ? 713  HIS E CB    1 
ATOM   9577  C CG    . HIS G 2 113 ? 74.311  33.777 -68.300 1.00 40.57  ? 713  HIS E CG    1 
ATOM   9578  N ND1   . HIS G 2 113 ? 74.978  34.980 -68.196 1.00 39.35  ? 713  HIS E ND1   1 
ATOM   9579  C CD2   . HIS G 2 113 ? 75.259  32.813 -68.233 1.00 41.40  ? 713  HIS E CD2   1 
ATOM   9580  C CE1   . HIS G 2 113 ? 76.274  34.754 -68.075 1.00 40.30  ? 713  HIS E CE1   1 
ATOM   9581  N NE2   . HIS G 2 113 ? 76.470  33.447 -68.093 1.00 40.26  ? 713  HIS E NE2   1 
ATOM   9582  N N     . ALA G 2 114 ? 72.083  32.226 -71.073 1.00 42.14  ? 714  ALA E N     1 
ATOM   9583  C CA    . ALA G 2 114 ? 72.371  31.248 -72.115 1.00 44.94  ? 714  ALA E CA    1 
ATOM   9584  C C     . ALA G 2 114 ? 71.674  31.629 -73.427 1.00 44.76  ? 714  ALA E C     1 
ATOM   9585  O O     . ALA G 2 114 ? 71.500  30.805 -74.329 1.00 44.23  ? 714  ALA E O     1 
ATOM   9586  C CB    . ALA G 2 114 ? 71.915  29.873 -71.664 1.00 42.94  ? 714  ALA E CB    1 
ATOM   9587  N N     . LYS G 2 115 ? 71.267  32.892 -73.516 1.00 40.36  ? 715  LYS E N     1 
ATOM   9588  C CA    . LYS G 2 115 ? 70.615  33.409 -74.699 1.00 42.77  ? 715  LYS E CA    1 
ATOM   9589  C C     . LYS G 2 115 ? 69.411  32.602 -75.165 1.00 41.88  ? 715  LYS E C     1 
ATOM   9590  O O     . LYS G 2 115 ? 69.193  32.447 -76.350 1.00 41.63  ? 715  LYS E O     1 
ATOM   9591  C CB    . LYS G 2 115 ? 71.641  33.526 -75.818 1.00 39.23  ? 715  LYS E CB    1 
ATOM   9592  C CG    . LYS G 2 115 ? 72.757  34.469 -75.478 1.00 46.73  ? 715  LYS E CG    1 
ATOM   9593  C CD    . LYS G 2 115 ? 73.817  34.485 -76.551 1.00 52.31  ? 715  LYS E CD    1 
ATOM   9594  C CE    . LYS G 2 115 ? 74.792  35.619 -76.335 1.00 56.60  ? 715  LYS E CE    1 
ATOM   9595  N NZ    . LYS G 2 115 ? 75.582  35.803 -77.584 1.00 61.02  ? 715  LYS E NZ    1 
ATOM   9596  N N     . ARG G 2 116 ? 68.632  32.086 -74.228 1.00 38.52  ? 716  ARG E N     1 
ATOM   9597  C CA    . ARG G 2 116 ? 67.414  31.355 -74.554 1.00 37.16  ? 716  ARG E CA    1 
ATOM   9598  C C     . ARG G 2 116 ? 66.233  32.115 -73.914 1.00 37.58  ? 716  ARG E C     1 
ATOM   9599  O O     . ARG G 2 116 ? 66.438  33.076 -73.152 1.00 37.58  ? 716  ARG E O     1 
ATOM   9600  C CB    . ARG G 2 116 ? 67.494  29.945 -73.986 1.00 38.54  ? 716  ARG E CB    1 
ATOM   9601  C CG    . ARG G 2 116 ? 68.609  29.144 -74.564 1.00 40.39  ? 716  ARG E CG    1 
ATOM   9602  C CD    . ARG G 2 116 ? 68.699  27.745 -73.976 1.00 39.87  ? 716  ARG E CD    1 
ATOM   9603  N NE    . ARG G 2 116 ? 69.397  27.688 -72.692 1.00 38.50  ? 716  ARG E NE    1 
ATOM   9604  C CZ    . ARG G 2 116 ? 68.802  27.645 -71.502 1.00 39.53  ? 716  ARG E CZ    1 
ATOM   9605  N NH1   . ARG G 2 116 ? 67.479  27.659 -71.422 1.00 35.46  ? 716  ARG E NH1   1 
ATOM   9606  N NH2   . ARG G 2 116 ? 69.523  27.542 -70.391 1.00 36.96  ? 716  ARG E NH2   1 
ATOM   9607  N N     . VAL G 2 117 ? 64.999  31.727 -74.213 1.00 42.97  ? 717  VAL E N     1 
ATOM   9608  C CA    . VAL G 2 117 ? 63.887  32.421 -73.579 1.00 41.70  ? 717  VAL E CA    1 
ATOM   9609  C C     . VAL G 2 117 ? 63.025  31.450 -72.820 1.00 39.69  ? 717  VAL E C     1 
ATOM   9610  O O     . VAL G 2 117 ? 62.205  31.851 -72.009 1.00 42.23  ? 717  VAL E O     1 
ATOM   9611  C CB    . VAL G 2 117 ? 63.010  33.219 -74.586 1.00 23.69  ? 717  VAL E CB    1 
ATOM   9612  C CG1   . VAL G 2 117 ? 63.750  34.401 -75.040 1.00 24.39  ? 717  VAL E CG1   1 
ATOM   9613  C CG2   . VAL G 2 117 ? 62.696  32.409 -75.794 1.00 21.59  ? 717  VAL E CG2   1 
ATOM   9614  N N     . ALA G 2 118 ? 63.210  30.167 -73.071 1.00 34.22  ? 718  ALA E N     1 
ATOM   9615  C CA    . ALA G 2 118 ? 62.419  29.179 -72.374 1.00 35.85  ? 718  ALA E CA    1 
ATOM   9616  C C     . ALA G 2 118 ? 63.273  28.523 -71.332 1.00 33.80  ? 718  ALA E C     1 
ATOM   9617  O O     . ALA G 2 118 ? 64.285  27.879 -71.644 1.00 36.28  ? 718  ALA E O     1 
ATOM   9618  C CB    . ALA G 2 118 ? 61.928  28.151 -73.315 1.00 41.33  ? 718  ALA E CB    1 
ATOM   9619  N N     . ILE G 2 119 ? 62.864  28.678 -70.082 1.00 25.37  ? 719  ILE E N     1 
ATOM   9620  C CA    . ILE G 2 119 ? 63.587  28.076 -68.985 1.00 25.01  ? 719  ILE E CA    1 
ATOM   9621  C C     . ILE G 2 119 ? 63.660  26.523 -69.029 1.00 26.84  ? 719  ILE E C     1 
ATOM   9622  O O     . ILE G 2 119 ? 62.727  25.829 -69.451 1.00 25.14  ? 719  ILE E O     1 
ATOM   9623  C CB    . ILE G 2 119 ? 62.954  28.542 -67.682 1.00 26.09  ? 719  ILE E CB    1 
ATOM   9624  C CG1   . ILE G 2 119 ? 61.522  28.015 -67.578 1.00 26.61  ? 719  ILE E CG1   1 
ATOM   9625  C CG2   . ILE G 2 119 ? 62.998  30.057 -67.640 1.00 24.62  ? 719  ILE E CG2   1 
ATOM   9626  C CD1   . ILE G 2 119 ? 60.904  28.229 -66.238 1.00 26.77  ? 719  ILE E CD1   1 
ATOM   9627  N N     . MET G 2 120 ? 64.778  25.979 -68.567 1.00 41.35  ? 720  MET E N     1 
ATOM   9628  C CA    . MET G 2 120 ? 64.965  24.527 -68.549 1.00 44.79  ? 720  MET E CA    1 
ATOM   9629  C C     . MET G 2 120 ? 65.361  24.021 -67.190 1.00 45.23  ? 720  MET E C     1 
ATOM   9630  O O     . MET G 2 120 ? 65.736  24.791 -66.332 1.00 43.54  ? 720  MET E O     1 
ATOM   9631  C CB    . MET G 2 120 ? 66.042  24.121 -69.541 1.00 29.48  ? 720  MET E CB    1 
ATOM   9632  C CG    . MET G 2 120 ? 65.706  24.526 -70.970 1.00 29.23  ? 720  MET E CG    1 
ATOM   9633  S SD    . MET G 2 120 ? 66.851  23.842 -72.138 1.00 35.90  ? 720  MET E SD    1 
ATOM   9634  C CE    . MET G 2 120 ? 67.572  25.223 -72.560 1.00 40.59  ? 720  MET E CE    1 
ATOM   9635  N N     . PRO G 2 121 ? 65.261  22.707 -66.972 1.00 42.68  ? 721  PRO E N     1 
ATOM   9636  C CA    . PRO G 2 121 ? 65.640  22.161 -65.678 1.00 42.87  ? 721  PRO E CA    1 
ATOM   9637  C C     . PRO G 2 121 ? 67.046  22.576 -65.338 1.00 41.25  ? 721  PRO E C     1 
ATOM   9638  O O     . PRO G 2 121 ? 67.338  22.905 -64.193 1.00 43.75  ? 721  PRO E O     1 
ATOM   9639  C CB    . PRO G 2 121 ? 65.509  20.665 -65.906 1.00 20.58  ? 721  PRO E CB    1 
ATOM   9640  C CG    . PRO G 2 121 ? 64.278  20.600 -66.705 1.00 21.07  ? 721  PRO E CG    1 
ATOM   9641  C CD    . PRO G 2 121 ? 64.553  21.673 -67.756 1.00 20.89  ? 721  PRO E CD    1 
ATOM   9642  N N     . LYS G 2 122 ? 67.906  22.575 -66.347 1.00 36.45  ? 722  LYS E N     1 
ATOM   9643  C CA    . LYS G 2 122 ? 69.299  22.948 -66.157 1.00 39.60  ? 722  LYS E CA    1 
ATOM   9644  C C     . LYS G 2 122 ? 69.449  24.381 -65.659 1.00 36.29  ? 722  LYS E C     1 
ATOM   9645  O O     . LYS G 2 122 ? 70.461  24.697 -65.072 1.00 36.40  ? 722  LYS E O     1 
ATOM   9646  C CB    . LYS G 2 122 ? 70.129  22.712 -67.459 1.00 26.62  ? 722  LYS E CB    1 
ATOM   9647  C CG    . LYS G 2 122 ? 70.486  23.929 -68.262 1.00 31.37  ? 722  LYS E CG    1 
ATOM   9648  C CD    . LYS G 2 122 ? 70.047  23.726 -69.696 1.00 36.72  ? 722  LYS E CD    1 
ATOM   9649  C CE    . LYS G 2 122 ? 71.041  22.926 -70.510 1.00 43.14  ? 722  LYS E CE    1 
ATOM   9650  N NZ    . LYS G 2 122 ? 71.882  23.787 -71.417 1.00 44.27  ? 722  LYS E NZ    1 
ATOM   9651  N N     . ASP G 2 123 ? 68.454  25.238 -65.886 1.00 34.95  ? 723  ASP E N     1 
ATOM   9652  C CA    . ASP G 2 123 ? 68.506  26.630 -65.420 1.00 34.06  ? 723  ASP E CA    1 
ATOM   9653  C C     . ASP G 2 123 ? 68.133  26.663 -63.950 1.00 34.97  ? 723  ASP E C     1 
ATOM   9654  O O     . ASP G 2 123 ? 68.775  27.333 -63.145 1.00 33.15  ? 723  ASP E O     1 
ATOM   9655  C CB    . ASP G 2 123 ? 67.529  27.506 -66.190 1.00 37.20  ? 723  ASP E CB    1 
ATOM   9656  C CG    . ASP G 2 123 ? 67.947  27.719 -67.623 1.00 35.62  ? 723  ASP E CG    1 
ATOM   9657  O OD1   . ASP G 2 123 ? 69.156  27.928 -67.823 1.00 35.63  ? 723  ASP E OD1   1 
ATOM   9658  O OD2   . ASP G 2 123 ? 67.086  27.689 -68.540 1.00 37.21  ? 723  ASP E OD2   1 
ATOM   9659  N N     . ILE G 2 124 ? 67.077  25.927 -63.606 1.00 30.32  ? 724  ILE E N     1 
ATOM   9660  C CA    . ILE G 2 124 ? 66.609  25.848 -62.223 1.00 31.28  ? 724  ILE E CA    1 
ATOM   9661  C C     . ILE G 2 124 ? 67.741  25.312 -61.368 1.00 32.29  ? 724  ILE E C     1 
ATOM   9662  O O     . ILE G 2 124 ? 67.939  25.750 -60.230 1.00 33.05  ? 724  ILE E O     1 
ATOM   9663  C CB    . ILE G 2 124 ? 65.389  24.898 -62.076 1.00 26.92  ? 724  ILE E CB    1 
ATOM   9664  C CG1   . ILE G 2 124 ? 64.186  25.491 -62.799 1.00 28.22  ? 724  ILE E CG1   1 
ATOM   9665  C CG2   . ILE G 2 124 ? 65.027  24.723 -60.611 1.00 25.96  ? 724  ILE E CG2   1 
ATOM   9666  C CD1   . ILE G 2 124 ? 62.875  24.648 -62.666 1.00 24.42  ? 724  ILE E CD1   1 
ATOM   9667  N N     . GLN G 2 125 ? 68.478  24.368 -61.958 1.00 28.14  ? 725  GLN E N     1 
ATOM   9668  C CA    . GLN G 2 125 ? 69.592  23.700 -61.300 1.00 28.65  ? 725  GLN E CA    1 
ATOM   9669  C C     . GLN G 2 125 ? 70.797  24.575 -61.120 1.00 25.46  ? 725  GLN E C     1 
ATOM   9670  O O     . GLN G 2 125 ? 71.448  24.497 -60.086 1.00 26.53  ? 725  GLN E O     1 
ATOM   9671  C CB    . GLN G 2 125 ? 69.989  22.441 -62.049 1.00 33.18  ? 725  GLN E CB    1 
ATOM   9672  C CG    . GLN G 2 125 ? 68.946  21.363 -61.976 1.00 35.31  ? 725  GLN E CG    1 
ATOM   9673  C CD    . GLN G 2 125 ? 69.122  20.262 -63.036 1.00 40.77  ? 725  GLN E CD    1 
ATOM   9674  O OE1   . GLN G 2 125 ? 70.111  20.222 -63.781 1.00 42.62  ? 725  GLN E OE1   1 
ATOM   9675  N NE2   . GLN G 2 125 ? 68.148  19.364 -63.101 1.00 39.94  ? 725  GLN E NE2   1 
ATOM   9676  N N     . LEU G 2 126 ? 71.090  25.421 -62.101 1.00 29.01  ? 726  LEU E N     1 
ATOM   9677  C CA    . LEU G 2 126 ? 72.253  26.282 -61.983 1.00 29.53  ? 726  LEU E CA    1 
ATOM   9678  C C     . LEU G 2 126 ? 71.906  27.245 -60.892 1.00 30.33  ? 726  LEU E C     1 
ATOM   9679  O O     . LEU G 2 126 ? 72.729  27.514 -60.001 1.00 29.79  ? 726  LEU E O     1 
ATOM   9680  C CB    . LEU G 2 126 ? 72.553  27.024 -63.293 1.00 15.55  ? 726  LEU E CB    1 
ATOM   9681  C CG    . LEU G 2 126 ? 73.684  28.041 -63.218 1.00 18.99  ? 726  LEU E CG    1 
ATOM   9682  C CD1   . LEU G 2 126 ? 74.977  27.365 -62.835 1.00 18.73  ? 726  LEU E CD1   1 
ATOM   9683  C CD2   . LEU G 2 126 ? 73.847  28.712 -64.508 1.00 18.17  ? 726  LEU E CD2   1 
ATOM   9684  N N     . ALA G 2 127 ? 70.668  27.730 -60.915 1.00 26.45  ? 727  ALA E N     1 
ATOM   9685  C CA    . ALA G 2 127 ? 70.260  28.678 -59.876 1.00 28.92  ? 727  ALA E CA    1 
ATOM   9686  C C     . ALA G 2 127 ? 70.351  28.091 -58.471 1.00 29.92  ? 727  ALA E C     1 
ATOM   9687  O O     . ALA G 2 127 ? 70.893  28.729 -57.590 1.00 31.24  ? 727  ALA E O     1 
ATOM   9688  C CB    . ALA G 2 127 ? 68.849  29.251 -60.135 1.00 15.66  ? 727  ALA E CB    1 
ATOM   9689  N N     . ARG G 2 128 ? 69.875  26.876 -58.253 1.00 34.97  ? 728  ARG E N     1 
ATOM   9690  C CA    . ARG G 2 128 ? 69.942  26.347 -56.909 1.00 37.52  ? 728  ARG E CA    1 
ATOM   9691  C C     . ARG G 2 128 ? 71.349  26.033 -56.542 1.00 38.63  ? 728  ARG E C     1 
ATOM   9692  O O     . ARG G 2 128 ? 71.705  26.111 -55.375 1.00 34.73  ? 728  ARG E O     1 
ATOM   9693  C CB    . ARG G 2 128 ? 69.071  25.124 -56.751 1.00 23.02  ? 728  ARG E CB    1 
ATOM   9694  C CG    . ARG G 2 128 ? 67.605  25.425 -57.124 1.00 24.61  ? 728  ARG E CG    1 
ATOM   9695  C CD    . ARG G 2 128 ? 66.636  24.565 -56.343 1.00 31.73  ? 728  ARG E CD    1 
ATOM   9696  N NE    . ARG G 2 128 ? 67.002  23.186 -56.516 1.00 42.22  ? 728  ARG E NE    1 
ATOM   9697  C CZ    . ARG G 2 128 ? 67.147  22.348 -55.518 1.00 41.17  ? 728  ARG E CZ    1 
ATOM   9698  N NH1   . ARG G 2 128 ? 66.942  22.763 -54.281 1.00 39.67  ? 728  ARG E NH1   1 
ATOM   9699  N NH2   . ARG G 2 128 ? 67.532  21.110 -55.772 1.00 42.62  ? 728  ARG E NH2   1 
ATOM   9700  N N     . ARG G 2 129 ? 72.176  25.704 -57.526 1.00 23.05  ? 729  ARG E N     1 
ATOM   9701  C CA    . ARG G 2 129 ? 73.557  25.424 -57.195 1.00 28.29  ? 729  ARG E CA    1 
ATOM   9702  C C     . ARG G 2 129 ? 74.198  26.701 -56.677 1.00 27.95  ? 729  ARG E C     1 
ATOM   9703  O O     . ARG G 2 129 ? 74.751  26.726 -55.598 1.00 27.08  ? 729  ARG E O     1 
ATOM   9704  C CB    . ARG G 2 129 ? 74.328  24.899 -58.398 1.00 60.16  ? 729  ARG E CB    1 
ATOM   9705  C CG    . ARG G 2 129 ? 75.768  24.493 -58.092 1.00 67.82  ? 729  ARG E CG    1 
ATOM   9706  C CD    . ARG G 2 129 ? 76.270  23.490 -59.134 1.00 75.98  ? 729  ARG E CD    1 
ATOM   9707  N NE    . ARG G 2 129 ? 77.676  23.109 -58.959 1.00 81.46  ? 729  ARG E NE    1 
ATOM   9708  C CZ    . ARG G 2 129 ? 78.355  22.311 -59.791 1.00 82.84  ? 729  ARG E CZ    1 
ATOM   9709  N NH1   . ARG G 2 129 ? 77.761  21.795 -60.871 1.00 82.82  ? 729  ARG E NH1   1 
ATOM   9710  N NH2   . ARG G 2 129 ? 79.638  22.035 -59.557 1.00 81.75  ? 729  ARG E NH2   1 
ATOM   9711  N N     . ILE G 2 130 ? 74.097  27.786 -57.420 1.00 28.04  ? 730  ILE E N     1 
ATOM   9712  C CA    . ILE G 2 130 ? 74.745  28.979 -56.940 1.00 29.73  ? 730  ILE E CA    1 
ATOM   9713  C C     . ILE G 2 130 ? 74.160  29.491 -55.633 1.00 31.03  ? 730  ILE E C     1 
ATOM   9714  O O     . ILE G 2 130 ? 74.899  29.973 -54.769 1.00 29.84  ? 730  ILE E O     1 
ATOM   9715  C CB    . ILE G 2 130 ? 74.744  30.065 -58.037 1.00 27.33  ? 730  ILE E CB    1 
ATOM   9716  C CG1   . ILE G 2 130 ? 75.754  29.645 -59.115 1.00 30.29  ? 730  ILE E CG1   1 
ATOM   9717  C CG2   . ILE G 2 130 ? 75.046  31.469 -57.448 1.00 24.89  ? 730  ILE E CG2   1 
ATOM   9718  C CD1   . ILE G 2 130 ? 75.812  30.578 -60.306 1.00 33.16  ? 730  ILE E CD1   1 
ATOM   9719  N N     . ARG G 2 131 ? 72.844  29.373 -55.481 1.00 40.59  ? 731  ARG E N     1 
ATOM   9720  C CA    . ARG G 2 131 ? 72.153  29.829 -54.273 1.00 43.04  ? 731  ARG E CA    1 
ATOM   9721  C C     . ARG G 2 131 ? 72.668  29.066 -53.060 1.00 44.37  ? 731  ARG E C     1 
ATOM   9722  O O     . ARG G 2 131 ? 72.365  29.430 -51.917 1.00 47.50  ? 731  ARG E O     1 
ATOM   9723  C CB    . ARG G 2 131 ? 70.645  29.575 -54.388 1.00 33.54  ? 731  ARG E CB    1 
ATOM   9724  C CG    . ARG G 2 131 ? 69.828  30.563 -55.189 1.00 30.35  ? 731  ARG E CG    1 
ATOM   9725  C CD    . ARG G 2 131 ? 68.447  30.042 -55.263 1.00 31.16  ? 731  ARG E CD    1 
ATOM   9726  N NE    . ARG G 2 131 ? 67.493  31.067 -55.636 1.00 29.02  ? 731  ARG E NE    1 
ATOM   9727  C CZ    . ARG G 2 131 ? 66.220  31.086 -55.207 1.00 28.90  ? 731  ARG E CZ    1 
ATOM   9728  N NH1   . ARG G 2 131 ? 65.766  30.121 -54.392 1.00 28.19  ? 731  ARG E NH1   1 
ATOM   9729  N NH2   . ARG G 2 131 ? 65.392  32.069 -55.566 1.00 24.73  ? 731  ARG E NH2   1 
ATOM   9730  N N     . GLY G 2 132 ? 73.417  27.990 -53.320 1.00 24.05  ? 732  GLY E N     1 
ATOM   9731  C CA    . GLY G 2 132 ? 73.972  27.166 -52.258 1.00 26.25  ? 732  GLY E CA    1 
ATOM   9732  C C     . GLY G 2 132 ? 72.902  26.284 -51.674 1.00 28.83  ? 732  GLY E C     1 
ATOM   9733  O O     . GLY G 2 132 ? 72.833  26.073 -50.476 1.00 26.38  ? 732  GLY E O     1 
ATOM   9734  N N     . GLU G 2 133 ? 72.040  25.766 -52.527 1.00 45.87  ? 733  GLU E N     1 
ATOM   9735  C CA    . GLU G 2 133 ? 70.979  24.899 -52.076 1.00 49.99  ? 733  GLU E CA    1 
ATOM   9736  C C     . GLU G 2 133 ? 71.347  23.444 -52.392 1.00 55.74  ? 733  GLU E C     1 
ATOM   9737  O O     . GLU G 2 133 ? 70.904  22.521 -51.718 1.00 57.39  ? 733  GLU E O     1 
ATOM   9738  C CB    . GLU G 2 133 ? 69.656  25.328 -52.728 1.00 36.30  ? 733  GLU E CB    1 
ATOM   9739  C CG    . GLU G 2 133 ? 69.076  26.620 -52.132 1.00 35.64  ? 733  GLU E CG    1 
ATOM   9740  C CD    . GLU G 2 133 ? 67.766  27.087 -52.796 1.00 30.58  ? 733  GLU E CD    1 
ATOM   9741  O OE1   . GLU G 2 133 ? 67.053  26.209 -53.333 1.00 30.96  ? 733  GLU E OE1   1 
ATOM   9742  O OE2   . GLU G 2 133 ? 67.455  28.322 -52.759 1.00 31.17  ? 733  GLU E OE2   1 
ATOM   9743  N N     . ARG G 2 134 ? 72.165  23.229 -53.411 1.00 100.91 ? 734  ARG E N     1 
ATOM   9744  C CA    . ARG G 2 134 ? 72.586  21.872 -53.729 1.00 108.56 ? 734  ARG E CA    1 
ATOM   9745  C C     . ARG G 2 134 ? 74.113  21.917 -53.810 1.00 111.06 ? 734  ARG E C     1 
ATOM   9746  O O     . ARG G 2 134 ? 74.807  21.017 -53.320 1.00 113.31 ? 734  ARG E O     1 
ATOM   9747  C CB    . ARG G 2 134 ? 71.980  21.395 -55.061 1.00 101.75 ? 734  ARG E CB    1 
ATOM   9748  C CG    . ARG G 2 134 ? 72.582  22.038 -56.302 1.00 105.19 ? 734  ARG E CG    1 
ATOM   9749  C CD    . ARG G 2 134 ? 72.103  21.373 -57.581 1.00 109.15 ? 734  ARG E CD    1 
ATOM   9750  N NE    . ARG G 2 134 ? 70.651  21.448 -57.716 1.00 115.27 ? 734  ARG E NE    1 
ATOM   9751  C CZ    . ARG G 2 134 ? 69.966  20.947 -58.741 1.00 115.63 ? 734  ARG E CZ    1 
ATOM   9752  N NH1   . ARG G 2 134 ? 70.618  20.334 -59.723 1.00 115.99 ? 734  ARG E NH1   1 
ATOM   9753  N NH2   . ARG G 2 134 ? 68.634  21.052 -58.780 1.00 116.39 ? 734  ARG E NH2   1 
ATOM   9754  N N     . ALA G 2 135 ? 74.615  22.995 -54.412 1.00 150.34 ? 735  ALA E N     1 
ATOM   9755  C CA    . ALA G 2 135 ? 76.043  23.249 -54.591 1.00 153.27 ? 735  ALA E CA    1 
ATOM   9756  C C     . ALA G 2 135 ? 76.872  22.092 -55.166 1.00 155.96 ? 735  ALA E C     1 
ATOM   9757  O O     . ALA G 2 135 ? 77.827  22.419 -55.906 1.00 114.56 ? 735  ALA E O     1 
ATOM   9758  C CB    . ALA G 2 135 ? 76.650  23.746 -53.281 1.00 75.34  ? 735  ALA E CB    1 
ATOM   9759  O OXT   . ALA G 2 135 ? 76.588  20.897 -54.881 1.00 36.82  ? 735  ALA E OXT   1 
ATOM   9760  N N     . LEU H 3 22  ? 46.730  8.889  -48.406 1.00 34.60  ? 222  LEU F N     1 
ATOM   9761  C CA    . LEU H 3 22  ? 47.498  9.970  -49.128 1.00 33.62  ? 222  LEU F CA    1 
ATOM   9762  C C     . LEU H 3 22  ? 48.563  9.448  -50.081 1.00 35.06  ? 222  LEU F C     1 
ATOM   9763  O O     . LEU H 3 22  ? 49.430  8.700  -49.698 1.00 32.02  ? 222  LEU F O     1 
ATOM   9764  C CB    . LEU H 3 22  ? 48.140  10.957 -48.140 1.00 39.15  ? 222  LEU F CB    1 
ATOM   9765  C CG    . LEU H 3 22  ? 47.333  12.157 -47.601 1.00 38.89  ? 222  LEU F CG    1 
ATOM   9766  C CD1   . LEU H 3 22  ? 45.868  12.141 -48.033 1.00 39.25  ? 222  LEU F CD1   1 
ATOM   9767  C CD2   . LEU H 3 22  ? 47.450  12.149 -46.091 1.00 40.68  ? 222  LEU F CD2   1 
ATOM   9768  N N     . ARG H 3 23  ? 48.518  9.873  -51.332 1.00 37.68  ? 223  ARG F N     1 
ATOM   9769  C CA    . ARG H 3 23  ? 49.476  9.379  -52.301 1.00 37.64  ? 223  ARG F CA    1 
ATOM   9770  C C     . ARG H 3 23  ? 49.538  10.294 -53.501 1.00 36.91  ? 223  ARG F C     1 
ATOM   9771  O O     . ARG H 3 23  ? 48.540  10.874 -53.882 1.00 37.49  ? 223  ARG F O     1 
ATOM   9772  C CB    . ARG H 3 23  ? 49.027  8.011  -52.815 1.00 6.83   ? 223  ARG F CB    1 
ATOM   9773  C CG    . ARG H 3 23  ? 49.363  6.769  -51.995 1.00 16.18  ? 223  ARG F CG    1 
ATOM   9774  C CD    . ARG H 3 23  ? 48.392  5.650  -52.418 1.00 23.16  ? 223  ARG F CD    1 
ATOM   9775  N NE    . ARG H 3 23  ? 48.493  5.253  -53.832 1.00 34.43  ? 223  ARG F NE    1 
ATOM   9776  C CZ    . ARG H 3 23  ? 47.456  4.939  -54.612 1.00 40.61  ? 223  ARG F CZ    1 
ATOM   9777  N NH1   . ARG H 3 23  ? 46.218  4.986  -54.144 1.00 45.71  ? 223  ARG F NH1   1 
ATOM   9778  N NH2   . ARG H 3 23  ? 47.679  4.532  -55.850 1.00 46.67  ? 223  ARG F NH2   1 
ATOM   9779  N N     . ASP H 3 24  ? 50.703  10.386 -54.120 1.00 34.83  ? 224  ASP F N     1 
ATOM   9780  C CA    . ASP H 3 24  ? 50.866  11.177 -55.324 1.00 35.68  ? 224  ASP F CA    1 
ATOM   9781  C C     . ASP H 3 24  ? 50.267  12.576 -55.232 1.00 32.30  ? 224  ASP F C     1 
ATOM   9782  O O     . ASP H 3 24  ? 49.864  13.154 -56.216 1.00 33.79  ? 224  ASP F O     1 
ATOM   9783  C CB    . ASP H 3 24  ? 50.263  10.411 -56.494 1.00 57.16  ? 224  ASP F CB    1 
ATOM   9784  C CG    . ASP H 3 24  ? 51.123  10.478 -57.727 1.00 59.72  ? 224  ASP F CG    1 
ATOM   9785  O OD1   . ASP H 3 24  ? 52.365  10.532 -57.567 1.00 61.12  ? 224  ASP F OD1   1 
ATOM   9786  O OD2   . ASP H 3 24  ? 50.567  10.460 -58.853 1.00 59.91  ? 224  ASP F OD2   1 
ATOM   9787  N N     . ASN H 3 25  ? 50.228  13.151 -54.050 1.00 35.03  ? 225  ASN F N     1 
ATOM   9788  C CA    . ASN H 3 25  ? 49.671  14.477 -53.939 1.00 40.06  ? 225  ASN F CA    1 
ATOM   9789  C C     . ASN H 3 25  ? 50.490  15.559 -54.607 1.00 38.22  ? 225  ASN F C     1 
ATOM   9790  O O     . ASN H 3 25  ? 49.986  16.650 -54.869 1.00 40.60  ? 225  ASN F O     1 
ATOM   9791  C CB    . ASN H 3 25  ? 49.445  14.806 -52.489 1.00 39.63  ? 225  ASN F CB    1 
ATOM   9792  C CG    . ASN H 3 25  ? 48.233  14.128 -51.972 1.00 43.59  ? 225  ASN F CG    1 
ATOM   9793  O OD1   . ASN H 3 25  ? 47.120  14.341 -52.477 1.00 41.55  ? 225  ASN F OD1   1 
ATOM   9794  N ND2   . ASN H 3 25  ? 48.420  13.276 -50.977 1.00 42.16  ? 225  ASN F ND2   1 
ATOM   9795  N N     . ILE H 3 26  ? 51.748  15.267 -54.888 1.00 33.51  ? 226  ILE F N     1 
ATOM   9796  C CA    . ILE H 3 26  ? 52.602  16.243 -55.531 1.00 36.83  ? 226  ILE F CA    1 
ATOM   9797  C C     . ILE H 3 26  ? 51.975  16.555 -56.885 1.00 39.74  ? 226  ILE F C     1 
ATOM   9798  O O     . ILE H 3 26  ? 52.162  17.636 -57.408 1.00 38.42  ? 226  ILE F O     1 
ATOM   9799  C CB    . ILE H 3 26  ? 54.033  15.662 -55.768 1.00 35.93  ? 226  ILE F CB    1 
ATOM   9800  C CG1   . ILE H 3 26  ? 55.025  16.750 -56.194 1.00 38.39  ? 226  ILE F CG1   1 
ATOM   9801  C CG2   . ILE H 3 26  ? 53.979  14.598 -56.879 1.00 32.80  ? 226  ILE F CG2   1 
ATOM   9802  C CD1   . ILE H 3 26  ? 55.449  17.588 -55.114 1.00 35.28  ? 226  ILE F CD1   1 
ATOM   9803  N N     . GLN H 3 27  ? 51.239  15.605 -57.460 1.00 33.95  ? 227  GLN F N     1 
ATOM   9804  C CA    . GLN H 3 27  ? 50.644  15.805 -58.779 1.00 39.46  ? 227  GLN F CA    1 
ATOM   9805  C C     . GLN H 3 27  ? 49.473  16.759 -58.696 1.00 40.49  ? 227  GLN F C     1 
ATOM   9806  O O     . GLN H 3 27  ? 48.813  17.039 -59.692 1.00 43.56  ? 227  GLN F O     1 
ATOM   9807  C CB    . GLN H 3 27  ? 50.198  14.473 -59.389 1.00 28.83  ? 227  GLN F CB    1 
ATOM   9808  C CG    . GLN H 3 27  ? 51.317  13.545 -59.765 1.00 29.99  ? 227  GLN F CG    1 
ATOM   9809  C CD    . GLN H 3 27  ? 52.355  14.198 -60.698 1.00 32.61  ? 227  GLN F CD    1 
ATOM   9810  O OE1   . GLN H 3 27  ? 51.990  14.768 -61.740 1.00 37.33  ? 227  GLN F OE1   1 
ATOM   9811  N NE2   . GLN H 3 27  ? 53.648  14.112 -60.335 1.00 32.08  ? 227  GLN F NE2   1 
ATOM   9812  N N     . GLY H 3 28  ? 49.222  17.262 -57.499 1.00 34.41  ? 228  GLY F N     1 
ATOM   9813  C CA    . GLY H 3 28  ? 48.142  18.196 -57.308 1.00 36.51  ? 228  GLY F CA    1 
ATOM   9814  C C     . GLY H 3 28  ? 48.682  19.581 -57.569 1.00 36.52  ? 228  GLY F C     1 
ATOM   9815  O O     . GLY H 3 28  ? 47.971  20.578 -57.534 1.00 39.61  ? 228  GLY F O     1 
ATOM   9816  N N     . ILE H 3 29  ? 49.977  19.666 -57.781 1.00 40.59  ? 229  ILE F N     1 
ATOM   9817  C CA    . ILE H 3 29  ? 50.575  20.944 -58.082 1.00 39.67  ? 229  ILE F CA    1 
ATOM   9818  C C     . ILE H 3 29  ? 50.519  20.756 -59.562 1.00 35.50  ? 229  ILE F C     1 
ATOM   9819  O O     . ILE H 3 29  ? 51.414  20.146 -60.144 1.00 36.57  ? 229  ILE F O     1 
ATOM   9820  C CB    . ILE H 3 29  ? 52.051  21.013 -57.609 1.00 39.83  ? 229  ILE F CB    1 
ATOM   9821  C CG1   . ILE H 3 29  ? 52.140  20.691 -56.114 1.00 41.45  ? 229  ILE F CG1   1 
ATOM   9822  C CG2   . ILE H 3 29  ? 52.624  22.386 -57.896 1.00 39.83  ? 229  ILE F CG2   1 
ATOM   9823  C CD1   . ILE H 3 29  ? 51.034  21.319 -55.278 1.00 39.67  ? 229  ILE F CD1   1 
ATOM   9824  N N     . THR H 3 30  ? 49.450  21.247 -60.168 1.00 36.65  ? 230  THR F N     1 
ATOM   9825  C CA    . THR H 3 30  ? 49.249  21.054 -61.601 1.00 36.42  ? 230  THR F CA    1 
ATOM   9826  C C     . THR H 3 30  ? 50.153  21.882 -62.492 1.00 38.21  ? 230  THR F C     1 
ATOM   9827  O O     . THR H 3 30  ? 50.786  22.821 -62.038 1.00 36.32  ? 230  THR F O     1 
ATOM   9828  C CB    . THR H 3 30  ? 47.760  21.353 -61.998 1.00 32.44  ? 230  THR F CB    1 
ATOM   9829  O OG1   . THR H 3 30  ? 47.576  22.758 -62.212 1.00 33.93  ? 230  THR F OG1   1 
ATOM   9830  C CG2   . THR H 3 30  ? 46.801  20.876 -60.889 1.00 30.62  ? 230  THR F CG2   1 
ATOM   9831  N N     . LYS H 3 31  ? 50.209  21.504 -63.765 1.00 35.48  ? 231  LYS F N     1 
ATOM   9832  C CA    . LYS H 3 31  ? 50.967  22.225 -64.775 1.00 39.26  ? 231  LYS F CA    1 
ATOM   9833  C C     . LYS H 3 31  ? 50.437  23.678 -64.832 1.00 37.91  ? 231  LYS F C     1 
ATOM   9834  O O     . LYS H 3 31  ? 51.217  24.612 -64.870 1.00 36.92  ? 231  LYS F O     1 
ATOM   9835  C CB    . LYS H 3 31  ? 50.785  21.542 -66.123 1.00 24.97  ? 231  LYS F CB    1 
ATOM   9836  C CG    . LYS H 3 31  ? 51.636  22.107 -67.192 1.00 30.64  ? 231  LYS F CG    1 
ATOM   9837  C CD    . LYS H 3 31  ? 51.294  21.544 -68.540 1.00 32.93  ? 231  LYS F CD    1 
ATOM   9838  C CE    . LYS H 3 31  ? 51.837  22.438 -69.660 1.00 37.09  ? 231  LYS F CE    1 
ATOM   9839  N NZ    . LYS H 3 31  ? 51.502  21.860 -70.988 1.00 39.81  ? 231  LYS F NZ    1 
ATOM   9840  N N     . PRO H 3 32  ? 49.096  23.883 -64.853 1.00 42.14  ? 232  PRO F N     1 
ATOM   9841  C CA    . PRO H 3 32  ? 48.549  25.246 -64.890 1.00 43.68  ? 232  PRO F CA    1 
ATOM   9842  C C     . PRO H 3 32  ? 49.036  26.097 -63.709 1.00 43.68  ? 232  PRO F C     1 
ATOM   9843  O O     . PRO H 3 32  ? 49.353  27.269 -63.857 1.00 42.85  ? 232  PRO F O     1 
ATOM   9844  C CB    . PRO H 3 32  ? 47.044  25.012 -64.800 1.00 36.39  ? 232  PRO F CB    1 
ATOM   9845  C CG    . PRO H 3 32  ? 46.857  23.710 -65.468 1.00 38.16  ? 232  PRO F CG    1 
ATOM   9846  C CD    . PRO H 3 32  ? 48.005  22.886 -64.991 1.00 35.29  ? 232  PRO F CD    1 
ATOM   9847  N N     . ALA H 3 33  ? 49.071  25.517 -62.518 1.00 33.04  ? 233  ALA F N     1 
ATOM   9848  C CA    . ALA H 3 33  ? 49.511  26.277 -61.360 1.00 31.26  ? 233  ALA F CA    1 
ATOM   9849  C C     . ALA H 3 33  ? 50.997  26.562 -61.427 1.00 34.00  ? 233  ALA F C     1 
ATOM   9850  O O     . ALA H 3 33  ? 51.416  27.675 -61.177 1.00 31.92  ? 233  ALA F O     1 
ATOM   9851  C CB    . ALA H 3 33  ? 49.147  25.539 -60.039 1.00 20.90  ? 233  ALA F CB    1 
ATOM   9852  N N     . ILE H 3 34  ? 51.800  25.579 -61.795 1.00 23.45  ? 234  ILE F N     1 
ATOM   9853  C CA    . ILE H 3 34  ? 53.237  25.818 -61.854 1.00 24.96  ? 234  ILE F CA    1 
ATOM   9854  C C     . ILE H 3 34  ? 53.550  26.870 -62.885 1.00 26.66  ? 234  ILE F C     1 
ATOM   9855  O O     . ILE H 3 34  ? 54.575  27.545 -62.804 1.00 23.92  ? 234  ILE F O     1 
ATOM   9856  C CB    . ILE H 3 34  ? 54.037  24.524 -62.208 1.00 17.43  ? 234  ILE F CB    1 
ATOM   9857  C CG1   . ILE H 3 34  ? 53.877  23.502 -61.067 1.00 18.44  ? 234  ILE F CG1   1 
ATOM   9858  C CG2   . ILE H 3 34  ? 55.515  24.857 -62.513 1.00 17.29  ? 234  ILE F CG2   1 
ATOM   9859  C CD1   . ILE H 3 34  ? 54.353  22.089 -61.449 1.00 17.58  ? 234  ILE F CD1   1 
ATOM   9860  N N     . ARG H 3 35  ? 52.656  27.003 -63.858 1.00 32.57  ? 235  ARG F N     1 
ATOM   9861  C CA    . ARG H 3 35  ? 52.825  27.942 -64.951 1.00 32.53  ? 235  ARG F CA    1 
ATOM   9862  C C     . ARG H 3 35  ? 52.471  29.321 -64.440 1.00 31.80  ? 235  ARG F C     1 
ATOM   9863  O O     . ARG H 3 35  ? 53.129  30.295 -64.739 1.00 32.38  ? 235  ARG F O     1 
ATOM   9864  C CB    . ARG H 3 35  ? 51.931  27.501 -66.093 1.00 47.11  ? 235  ARG F CB    1 
ATOM   9865  C CG    . ARG H 3 35  ? 52.018  28.341 -67.319 1.00 56.46  ? 235  ARG F CG    1 
ATOM   9866  C CD    . ARG H 3 35  ? 51.036  27.856 -68.350 1.00 63.44  ? 235  ARG F CD    1 
ATOM   9867  N NE    . ARG H 3 35  ? 51.735  27.224 -69.452 1.00 74.71  ? 235  ARG F NE    1 
ATOM   9868  C CZ    . ARG H 3 35  ? 51.427  27.429 -70.732 1.00 80.89  ? 235  ARG F CZ    1 
ATOM   9869  N NH1   . ARG H 3 35  ? 50.425  28.250 -71.069 1.00 85.99  ? 235  ARG F NH1   1 
ATOM   9870  N NH2   . ARG H 3 35  ? 52.126  26.821 -71.683 1.00 86.95  ? 235  ARG F NH2   1 
ATOM   9871  N N     . ARG H 3 36  ? 51.438  29.401 -63.628 1.00 35.52  ? 236  ARG F N     1 
ATOM   9872  C CA    . ARG H 3 36  ? 51.058  30.679 -63.079 1.00 38.47  ? 236  ARG F CA    1 
ATOM   9873  C C     . ARG H 3 36  ? 52.193  31.244 -62.252 1.00 38.58  ? 236  ARG F C     1 
ATOM   9874  O O     . ARG H 3 36  ? 52.399  32.446 -62.252 1.00 39.07  ? 236  ARG F O     1 
ATOM   9875  C CB    . ARG H 3 36  ? 49.817  30.545 -62.197 1.00 32.07  ? 236  ARG F CB    1 
ATOM   9876  C CG    . ARG H 3 36  ? 48.529  30.557 -62.928 1.00 31.73  ? 236  ARG F CG    1 
ATOM   9877  C CD    . ARG H 3 36  ? 47.416  30.683 -61.954 1.00 34.32  ? 236  ARG F CD    1 
ATOM   9878  N NE    . ARG H 3 36  ? 47.175  29.481 -61.160 1.00 33.25  ? 236  ARG F NE    1 
ATOM   9879  C CZ    . ARG H 3 36  ? 46.616  28.360 -61.618 1.00 37.33  ? 236  ARG F CZ    1 
ATOM   9880  N NH1   . ARG H 3 36  ? 46.240  28.254 -62.883 1.00 31.28  ? 236  ARG F NH1   1 
ATOM   9881  N NH2   . ARG H 3 36  ? 46.375  27.355 -60.791 1.00 34.30  ? 236  ARG F NH2   1 
ATOM   9882  N N     . LEU H 3 37  ? 52.915  30.384 -61.538 1.00 35.30  ? 237  LEU F N     1 
ATOM   9883  C CA    . LEU H 3 37  ? 54.036  30.822 -60.695 1.00 34.32  ? 237  LEU F CA    1 
ATOM   9884  C C     . LEU H 3 37  ? 55.229  31.308 -61.528 1.00 35.76  ? 237  LEU F C     1 
ATOM   9885  O O     . LEU H 3 37  ? 55.879  32.316 -61.184 1.00 32.72  ? 237  LEU F O     1 
ATOM   9886  C CB    . LEU H 3 37  ? 54.487  29.700 -59.776 1.00 17.25  ? 237  LEU F CB    1 
ATOM   9887  C CG    . LEU H 3 37  ? 53.485  29.249 -58.718 1.00 16.99  ? 237  LEU F CG    1 
ATOM   9888  C CD1   . LEU H 3 37  ? 53.740  27.789 -58.259 1.00 17.35  ? 237  LEU F CD1   1 
ATOM   9889  C CD2   . LEU H 3 37  ? 53.573  30.231 -57.591 1.00 18.78  ? 237  LEU F CD2   1 
ATOM   9890  N N     . ALA H 3 38  ? 55.529  30.613 -62.621 1.00 30.24  ? 238  ALA F N     1 
ATOM   9891  C CA    . ALA H 3 38  ? 56.623  31.065 -63.469 1.00 32.94  ? 238  ALA F CA    1 
ATOM   9892  C C     . ALA H 3 38  ? 56.309  32.484 -64.040 1.00 35.72  ? 238  ALA F C     1 
ATOM   9893  O O     . ALA H 3 38  ? 57.217  33.299 -64.287 1.00 33.84  ? 238  ALA F O     1 
ATOM   9894  C CB    . ALA H 3 38  ? 56.850  30.070 -64.593 1.00 17.28  ? 238  ALA F CB    1 
ATOM   9895  N N     . ARG H 3 39  ? 55.021  32.768 -64.223 1.00 35.80  ? 239  ARG F N     1 
ATOM   9896  C CA    . ARG H 3 39  ? 54.567  34.045 -64.751 1.00 39.40  ? 239  ARG F CA    1 
ATOM   9897  C C     . ARG H 3 39  ? 54.820  35.224 -63.821 1.00 39.79  ? 239  ARG F C     1 
ATOM   9898  O O     . ARG H 3 39  ? 55.255  36.292 -64.264 1.00 41.21  ? 239  ARG F O     1 
ATOM   9899  C CB    . ARG H 3 39  ? 53.077  33.976 -65.054 1.00 32.96  ? 239  ARG F CB    1 
ATOM   9900  C CG    . ARG H 3 39  ? 52.728  33.175 -66.257 1.00 31.81  ? 239  ARG F CG    1 
ATOM   9901  C CD    . ARG H 3 39  ? 53.293  33.738 -67.498 1.00 35.25  ? 239  ARG F CD    1 
ATOM   9902  N NE    . ARG H 3 39  ? 52.726  32.988 -68.590 1.00 34.51  ? 239  ARG F NE    1 
ATOM   9903  C CZ    . ARG H 3 39  ? 53.404  32.117 -69.300 1.00 37.82  ? 239  ARG F CZ    1 
ATOM   9904  N NH1   . ARG H 3 39  ? 54.677  31.922 -69.024 1.00 36.95  ? 239  ARG F NH1   1 
ATOM   9905  N NH2   . ARG H 3 39  ? 52.800  31.410 -70.234 1.00 38.82  ? 239  ARG F NH2   1 
ATOM   9906  N N     . ARG H 3 40  ? 54.506  35.029 -62.542 1.00 28.06  ? 240  ARG F N     1 
ATOM   9907  C CA    . ARG H 3 40  ? 54.714  36.048 -61.547 1.00 28.99  ? 240  ARG F CA    1 
ATOM   9908  C C     . ARG H 3 40  ? 56.202  36.179 -61.434 1.00 29.23  ? 240  ARG F C     1 
ATOM   9909  O O     . ARG H 3 40  ? 56.697  37.230 -61.113 1.00 28.43  ? 240  ARG F O     1 
ATOM   9910  C CB    . ARG H 3 40  ? 54.117  35.620 -60.218 1.00 27.67  ? 240  ARG F CB    1 
ATOM   9911  C CG    . ARG H 3 40  ? 54.262  36.633 -59.067 1.00 22.62  ? 240  ARG F CG    1 
ATOM   9912  C CD    . ARG H 3 40  ? 53.305  36.243 -57.927 1.00 27.66  ? 240  ARG F CD    1 
ATOM   9913  N NE    . ARG H 3 40  ? 51.896  36.584 -58.202 1.00 26.41  ? 240  ARG F NE    1 
ATOM   9914  C CZ    . ARG H 3 40  ? 50.863  36.217 -57.449 1.00 27.56  ? 240  ARG F CZ    1 
ATOM   9915  N NH1   . ARG H 3 40  ? 51.041  35.481 -56.374 1.00 23.65  ? 240  ARG F NH1   1 
ATOM   9916  N NH2   . ARG H 3 40  ? 49.652  36.625 -57.756 1.00 25.02  ? 240  ARG F NH2   1 
ATOM   9917  N N     . GLY H 3 41  ? 56.922  35.100 -61.701 1.00 23.44  ? 241  GLY F N     1 
ATOM   9918  C CA    . GLY H 3 41  ? 58.373  35.140 -61.651 1.00 24.04  ? 241  GLY F CA    1 
ATOM   9919  C C     . GLY H 3 41  ? 58.919  35.789 -62.908 1.00 25.03  ? 241  GLY F C     1 
ATOM   9920  O O     . GLY H 3 41  ? 60.119  35.921 -63.076 1.00 25.11  ? 241  GLY F O     1 
ATOM   9921  N N     . GLY H 3 42  ? 58.030  36.182 -63.811 1.00 28.18  ? 242  GLY F N     1 
ATOM   9922  C CA    . GLY H 3 42  ? 58.449  36.846 -65.034 1.00 25.74  ? 242  GLY F CA    1 
ATOM   9923  C C     . GLY H 3 42  ? 58.828  35.960 -66.198 1.00 29.71  ? 242  GLY F C     1 
ATOM   9924  O O     . GLY H 3 42  ? 59.251  36.458 -67.228 1.00 28.67  ? 242  GLY F O     1 
ATOM   9925  N N     . VAL H 3 43  ? 58.674  34.650 -66.031 1.00 27.23  ? 243  VAL F N     1 
ATOM   9926  C CA    . VAL H 3 43  ? 59.019  33.682 -67.047 1.00 27.09  ? 243  VAL F CA    1 
ATOM   9927  C C     . VAL H 3 43  ? 58.040  33.681 -68.207 1.00 25.11  ? 243  VAL F C     1 
ATOM   9928  O O     . VAL H 3 43  ? 56.846  33.463 -68.029 1.00 27.08  ? 243  VAL F O     1 
ATOM   9929  C CB    . VAL H 3 43  ? 59.061  32.290 -66.435 1.00 28.29  ? 243  VAL F CB    1 
ATOM   9930  C CG1   . VAL H 3 43  ? 59.416  31.246 -67.477 1.00 23.44  ? 243  VAL F CG1   1 
ATOM   9931  C CG2   . VAL H 3 43  ? 60.035  32.281 -65.333 1.00 22.81  ? 243  VAL F CG2   1 
ATOM   9932  N N     . LYS H 3 44  ? 58.571  33.892 -69.405 1.00 41.57  ? 244  LYS F N     1 
ATOM   9933  C CA    . LYS H 3 44  ? 57.778  33.922 -70.615 1.00 44.47  ? 244  LYS F CA    1 
ATOM   9934  C C     . LYS H 3 44  ? 57.549  32.540 -71.262 1.00 45.38  ? 244  LYS F C     1 
ATOM   9935  O O     . LYS H 3 44  ? 56.410  32.132 -71.443 1.00 46.26  ? 244  LYS F O     1 
ATOM   9936  C CB    . LYS H 3 44  ? 58.442  34.864 -71.595 1.00 39.46  ? 244  LYS F CB    1 
ATOM   9937  C CG    . LYS H 3 44  ? 57.584  35.216 -72.760 1.00 41.51  ? 244  LYS F CG    1 
ATOM   9938  C CD    . LYS H 3 44  ? 58.339  36.103 -73.682 1.00 44.17  ? 244  LYS F CD    1 
ATOM   9939  C CE    . LYS H 3 44  ? 57.464  36.541 -74.788 1.00 45.69  ? 244  LYS F CE    1 
ATOM   9940  N NZ    . LYS H 3 44  ? 58.362  37.077 -75.805 1.00 45.49  ? 244  LYS F NZ    1 
ATOM   9941  N N     . ARG H 3 45  ? 58.608  31.822 -71.626 1.00 37.95  ? 245  ARG F N     1 
ATOM   9942  C CA    . ARG H 3 45  ? 58.432  30.492 -72.213 1.00 39.76  ? 245  ARG F CA    1 
ATOM   9943  C C     . ARG H 3 45  ? 58.926  29.397 -71.249 1.00 40.59  ? 245  ARG F C     1 
ATOM   9944  O O     . ARG H 3 45  ? 59.881  29.598 -70.490 1.00 37.53  ? 245  ARG F O     1 
ATOM   9945  C CB    . ARG H 3 45  ? 59.174  30.390 -73.541 1.00 63.70  ? 245  ARG F CB    1 
ATOM   9946  C CG    . ARG H 3 45  ? 58.623  29.350 -74.504 1.00 65.40  ? 245  ARG F CG    1 
ATOM   9947  C CD    . ARG H 3 45  ? 58.796  29.875 -75.904 1.00 66.63  ? 245  ARG F CD    1 
ATOM   9948  N NE    . ARG H 3 45  ? 58.161  29.060 -76.925 1.00 67.59  ? 245  ARG F NE    1 
ATOM   9949  C CZ    . ARG H 3 45  ? 58.584  27.850 -77.270 1.00 69.62  ? 245  ARG F CZ    1 
ATOM   9950  N NH1   . ARG H 3 45  ? 59.648  27.321 -76.658 1.00 63.25  ? 245  ARG F NH1   1 
ATOM   9951  N NH2   . ARG H 3 45  ? 57.959  27.173 -78.236 1.00 68.78  ? 245  ARG F NH2   1 
ATOM   9952  N N     . ILE H 3 46  ? 58.278  28.234 -71.291 1.00 38.57  ? 246  ILE F N     1 
ATOM   9953  C CA    . ILE H 3 46  ? 58.627  27.123 -70.398 1.00 41.10  ? 246  ILE F CA    1 
ATOM   9954  C C     . ILE H 3 46  ? 58.849  25.767 -71.098 1.00 42.30  ? 246  ILE F C     1 
ATOM   9955  O O     . ILE H 3 46  ? 57.926  25.206 -71.705 1.00 42.15  ? 246  ILE F O     1 
ATOM   9956  C CB    . ILE H 3 46  ? 57.501  26.896 -69.342 1.00 23.66  ? 246  ILE F CB    1 
ATOM   9957  C CG1   . ILE H 3 46  ? 57.267  28.141 -68.512 1.00 23.68  ? 246  ILE F CG1   1 
ATOM   9958  C CG2   . ILE H 3 46  ? 57.842  25.747 -68.443 1.00 22.11  ? 246  ILE F CG2   1 
ATOM   9959  C CD1   . ILE H 3 46  ? 56.118  27.994 -67.575 1.00 22.71  ? 246  ILE F CD1   1 
ATOM   9960  N N     . SER H 3 47  ? 60.059  25.230 -70.986 1.00 60.59  ? 247  SER F N     1 
ATOM   9961  C CA    . SER H 3 47  ? 60.368  23.915 -71.546 1.00 60.25  ? 247  SER F CA    1 
ATOM   9962  C C     . SER H 3 47  ? 59.481  22.829 -70.891 1.00 60.96  ? 247  SER F C     1 
ATOM   9963  O O     . SER H 3 47  ? 58.952  23.020 -69.793 1.00 58.06  ? 247  SER F O     1 
ATOM   9964  C CB    . SER H 3 47  ? 61.811  23.561 -71.272 1.00 40.32  ? 247  SER F CB    1 
ATOM   9965  O OG    . SER H 3 47  ? 61.915  22.156 -71.140 1.00 48.77  ? 247  SER F OG    1 
ATOM   9966  N N     . GLY H 3 48  ? 59.362  21.672 -71.536 1.00 69.40  ? 248  GLY F N     1 
ATOM   9967  C CA    . GLY H 3 48  ? 58.514  20.609 -71.009 1.00 66.25  ? 248  GLY F CA    1 
ATOM   9968  C C     . GLY H 3 48  ? 58.885  19.887 -69.718 1.00 66.23  ? 248  GLY F C     1 
ATOM   9969  O O     . GLY H 3 48  ? 57.989  19.434 -68.982 1.00 67.31  ? 248  GLY F O     1 
ATOM   9970  N N     . LEU H 3 49  ? 60.184  19.767 -69.436 1.00 29.92  ? 249  LEU F N     1 
ATOM   9971  C CA    . LEU H 3 49  ? 60.630  19.079 -68.241 1.00 32.07  ? 249  LEU F CA    1 
ATOM   9972  C C     . LEU H 3 49  ? 60.582  19.899 -66.953 1.00 31.30  ? 249  LEU F C     1 
ATOM   9973  O O     . LEU H 3 49  ? 60.885  19.397 -65.866 1.00 28.79  ? 249  LEU F O     1 
ATOM   9974  C CB    . LEU H 3 49  ? 62.034  18.590 -68.473 1.00 37.44  ? 249  LEU F CB    1 
ATOM   9975  C CG    . LEU H 3 49  ? 62.054  17.512 -69.555 1.00 43.31  ? 249  LEU F CG    1 
ATOM   9976  C CD1   . LEU H 3 49  ? 63.513  17.226 -69.938 1.00 44.90  ? 249  LEU F CD1   1 
ATOM   9977  C CD2   . LEU H 3 49  ? 61.276  16.256 -69.062 1.00 42.86  ? 249  LEU F CD2   1 
ATOM   9978  N N     . ILE H 3 50  ? 60.187  21.160 -67.074 1.00 37.47  ? 250  ILE F N     1 
ATOM   9979  C CA    . ILE H 3 50  ? 60.130  22.045 -65.930 1.00 34.18  ? 250  ILE F CA    1 
ATOM   9980  C C     . ILE H 3 50  ? 59.124  21.645 -64.862 1.00 34.90  ? 250  ILE F C     1 
ATOM   9981  O O     . ILE H 3 50  ? 59.378  21.778 -63.662 1.00 35.13  ? 250  ILE F O     1 
ATOM   9982  C CB    . ILE H 3 50  ? 59.825  23.516 -66.402 1.00 36.00  ? 250  ILE F CB    1 
ATOM   9983  C CG1   . ILE H 3 50  ? 61.099  24.159 -66.950 1.00 34.46  ? 250  ILE F CG1   1 
ATOM   9984  C CG2   . ILE H 3 50  ? 59.313  24.373 -65.255 1.00 32.47  ? 250  ILE F CG2   1 
ATOM   9985  C CD1   . ILE H 3 50  ? 62.215  24.270 -65.933 1.00 33.46  ? 250  ILE F CD1   1 
ATOM   9986  N N     . TYR H 3 51  ? 57.977  21.151 -65.293 1.00 36.74  ? 251  TYR F N     1 
ATOM   9987  C CA    . TYR H 3 51  ? 56.935  20.840 -64.340 1.00 36.96  ? 251  TYR F CA    1 
ATOM   9988  C C     . TYR H 3 51  ? 57.324  19.799 -63.324 1.00 38.27  ? 251  TYR F C     1 
ATOM   9989  O O     . TYR H 3 51  ? 56.995  19.954 -62.150 1.00 37.61  ? 251  TYR F O     1 
ATOM   9990  C CB    . TYR H 3 51  ? 55.641  20.481 -65.073 1.00 27.06  ? 251  TYR F CB    1 
ATOM   9991  C CG    . TYR H 3 51  ? 55.288  21.492 -66.126 1.00 30.24  ? 251  TYR F CG    1 
ATOM   9992  C CD1   . TYR H 3 51  ? 55.492  21.197 -67.469 1.00 29.79  ? 251  TYR F CD1   1 
ATOM   9993  C CD2   . TYR H 3 51  ? 54.827  22.772 -65.782 1.00 30.44  ? 251  TYR F CD2   1 
ATOM   9994  C CE1   . TYR H 3 51  ? 55.251  22.123 -68.448 1.00 32.10  ? 251  TYR F CE1   1 
ATOM   9995  C CE2   . TYR H 3 51  ? 54.593  23.727 -66.753 1.00 32.88  ? 251  TYR F CE2   1 
ATOM   9996  C CZ    . TYR H 3 51  ? 54.806  23.385 -68.091 1.00 32.54  ? 251  TYR F CZ    1 
ATOM   9997  O OH    . TYR H 3 51  ? 54.561  24.270 -69.120 1.00 32.27  ? 251  TYR F OH    1 
ATOM   9998  N N     . GLU H 3 52  ? 58.021  18.749 -63.755 1.00 28.37  ? 252  GLU F N     1 
ATOM   9999  C CA    . GLU H 3 52  ? 58.461  17.730 -62.816 1.00 29.72  ? 252  GLU F CA    1 
ATOM   10000 C C     . GLU H 3 52  ? 59.679  18.231 -62.054 1.00 25.51  ? 252  GLU F C     1 
ATOM   10001 O O     . GLU H 3 52  ? 59.848  17.909 -60.886 1.00 28.76  ? 252  GLU F O     1 
ATOM   10002 C CB    . GLU H 3 52  ? 58.802  16.409 -63.507 1.00 51.95  ? 252  GLU F CB    1 
ATOM   10003 C CG    . GLU H 3 52  ? 57.593  15.555 -63.902 1.00 63.60  ? 252  GLU F CG    1 
ATOM   10004 C CD    . GLU H 3 52  ? 56.614  15.255 -62.745 1.00 64.12  ? 252  GLU F CD    1 
ATOM   10005 O OE1   . GLU H 3 52  ? 57.056  15.170 -61.573 1.00 70.83  ? 252  GLU F OE1   1 
ATOM   10006 O OE2   . GLU H 3 52  ? 55.400  15.082 -63.019 1.00 66.65  ? 252  GLU F OE2   1 
ATOM   10007 N N     . GLU H 3 53  ? 60.515  19.039 -62.690 1.00 24.03  ? 253  GLU F N     1 
ATOM   10008 C CA    . GLU H 3 53  ? 61.676  19.535 -61.998 1.00 27.57  ? 253  GLU F CA    1 
ATOM   10009 C C     . GLU H 3 53  ? 61.226  20.394 -60.857 1.00 24.42  ? 253  GLU F C     1 
ATOM   10010 O O     . GLU H 3 53  ? 61.827  20.374 -59.784 1.00 22.89  ? 253  GLU F O     1 
ATOM   10011 C CB    . GLU H 3 53  ? 62.544  20.366 -62.909 1.00 32.34  ? 253  GLU F CB    1 
ATOM   10012 C CG    . GLU H 3 53  ? 63.842  20.797 -62.276 1.00 36.48  ? 253  GLU F CG    1 
ATOM   10013 C CD    . GLU H 3 53  ? 64.743  19.630 -61.992 1.00 42.77  ? 253  GLU F CD    1 
ATOM   10014 O OE1   . GLU H 3 53  ? 64.896  18.765 -62.875 1.00 42.72  ? 253  GLU F OE1   1 
ATOM   10015 O OE2   . GLU H 3 53  ? 65.305  19.578 -60.882 1.00 42.78  ? 253  GLU F OE2   1 
ATOM   10016 N N     . THR H 3 54  ? 60.160  21.144 -61.092 1.00 21.51  ? 254  THR F N     1 
ATOM   10017 C CA    . THR H 3 54  ? 59.596  22.044 -60.090 1.00 21.17  ? 254  THR F CA    1 
ATOM   10018 C C     . THR H 3 54  ? 58.919  21.274 -58.965 1.00 24.28  ? 254  THR F C     1 
ATOM   10019 O O     . THR H 3 54  ? 59.045  21.615 -57.801 1.00 23.78  ? 254  THR F O     1 
ATOM   10020 C CB    . THR H 3 54  ? 58.605  23.043 -60.769 1.00 28.36  ? 254  THR F CB    1 
ATOM   10021 O OG1   . THR H 3 54  ? 59.327  23.845 -61.717 1.00 30.34  ? 254  THR F OG1   1 
ATOM   10022 C CG2   . THR H 3 54  ? 57.978  23.967 -59.768 1.00 26.59  ? 254  THR F CG2   1 
ATOM   10023 N N     . ARG H 3 55  ? 58.204  20.221 -59.299 1.00 29.05  ? 255  ARG F N     1 
ATOM   10024 C CA    . ARG H 3 55  ? 57.558  19.440 -58.268 1.00 25.02  ? 255  ARG F CA    1 
ATOM   10025 C C     . ARG H 3 55  ? 58.632  18.893 -57.317 1.00 26.07  ? 255  ARG F C     1 
ATOM   10026 O O     . ARG H 3 55  ? 58.500  18.970 -56.112 1.00 26.54  ? 255  ARG F O     1 
ATOM   10027 C CB    . ARG H 3 55  ? 56.749  18.302 -58.907 1.00 24.87  ? 255  ARG F CB    1 
ATOM   10028 C CG    . ARG H 3 55  ? 55.615  18.787 -59.755 1.00 25.42  ? 255  ARG F CG    1 
ATOM   10029 C CD    . ARG H 3 55  ? 54.527  17.729 -59.938 1.00 30.32  ? 255  ARG F CD    1 
ATOM   10030 N NE    . ARG H 3 55  ? 53.480  18.214 -60.839 1.00 28.92  ? 255  ARG F NE    1 
ATOM   10031 C CZ    . ARG H 3 55  ? 53.527  18.119 -62.163 1.00 29.16  ? 255  ARG F CZ    1 
ATOM   10032 N NH1   . ARG H 3 55  ? 54.556  17.548 -62.757 1.00 25.41  ? 255  ARG F NH1   1 
ATOM   10033 N NH2   . ARG H 3 55  ? 52.551  18.615 -62.898 1.00 29.96  ? 255  ARG F NH2   1 
ATOM   10034 N N     . GLY H 3 56  ? 59.702  18.353 -57.874 1.00 27.17  ? 256  GLY F N     1 
ATOM   10035 C CA    . GLY H 3 56  ? 60.761  17.821 -57.053 1.00 29.16  ? 256  GLY F CA    1 
ATOM   10036 C C     . GLY H 3 56  ? 61.344  18.875 -56.147 1.00 29.84  ? 256  GLY F C     1 
ATOM   10037 O O     . GLY H 3 56  ? 61.645  18.592 -54.991 1.00 28.38  ? 256  GLY F O     1 
ATOM   10038 N N     . VAL H 3 57  ? 61.516  20.093 -56.647 1.00 32.01  ? 257  VAL F N     1 
ATOM   10039 C CA    . VAL H 3 57  ? 62.058  21.157 -55.823 1.00 31.19  ? 257  VAL F CA    1 
ATOM   10040 C C     . VAL H 3 57  ? 61.085  21.593 -54.719 1.00 29.84  ? 257  VAL F C     1 
ATOM   10041 O O     . VAL H 3 57  ? 61.491  21.761 -53.558 1.00 28.96  ? 257  VAL F O     1 
ATOM   10042 C CB    . VAL H 3 57  ? 62.488  22.346 -56.707 1.00 27.25  ? 257  VAL F CB    1 
ATOM   10043 C CG1   . VAL H 3 57  ? 62.656  23.636 -55.890 1.00 26.74  ? 257  VAL F CG1   1 
ATOM   10044 C CG2   . VAL H 3 57  ? 63.784  21.989 -57.366 1.00 24.41  ? 257  VAL F CG2   1 
ATOM   10045 N N     . LEU H 3 58  ? 59.815  21.778 -55.056 1.00 23.57  ? 258  LEU F N     1 
ATOM   10046 C CA    . LEU H 3 58  ? 58.834  22.152 -54.042 1.00 24.57  ? 258  LEU F CA    1 
ATOM   10047 C C     . LEU H 3 58  ? 58.821  21.108 -52.920 1.00 25.88  ? 258  LEU F C     1 
ATOM   10048 O O     . LEU H 3 58  ? 58.710  21.442 -51.738 1.00 24.71  ? 258  LEU F O     1 
ATOM   10049 C CB    . LEU H 3 58  ? 57.432  22.215 -54.653 1.00 24.11  ? 258  LEU F CB    1 
ATOM   10050 C CG    . LEU H 3 58  ? 56.254  22.394 -53.683 1.00 24.78  ? 258  LEU F CG    1 
ATOM   10051 C CD1   . LEU H 3 58  ? 56.481  23.627 -52.816 1.00 26.63  ? 258  LEU F CD1   1 
ATOM   10052 C CD2   . LEU H 3 58  ? 54.936  22.468 -54.487 1.00 29.35  ? 258  LEU F CD2   1 
ATOM   10053 N N     . LYS H 3 59  ? 58.924  19.838 -53.316 1.00 34.90  ? 259  LYS F N     1 
ATOM   10054 C CA    . LYS H 3 59  ? 58.921  18.697 -52.411 1.00 34.75  ? 259  LYS F CA    1 
ATOM   10055 C C     . LYS H 3 59  ? 59.995  18.797 -51.358 1.00 29.65  ? 259  LYS F C     1 
ATOM   10056 O O     . LYS H 3 59  ? 59.732  18.542 -50.204 1.00 32.01  ? 259  LYS F O     1 
ATOM   10057 C CB    . LYS H 3 59  ? 59.146  17.417 -53.199 1.00 50.49  ? 259  LYS F CB    1 
ATOM   10058 C CG    . LYS H 3 59  ? 59.105  16.166 -52.376 1.00 54.88  ? 259  LYS F CG    1 
ATOM   10059 C CD    . LYS H 3 59  ? 57.685  15.721 -52.156 1.00 58.28  ? 259  LYS F CD    1 
ATOM   10060 C CE    . LYS H 3 59  ? 57.664  14.524 -51.248 1.00 62.72  ? 259  LYS F CE    1 
ATOM   10061 N NZ    . LYS H 3 59  ? 58.715  13.537 -51.633 1.00 61.56  ? 259  LYS F NZ    1 
ATOM   10062 N N     . VAL H 3 60  ? 61.204  19.172 -51.758 1.00 19.81  ? 260  VAL F N     1 
ATOM   10063 C CA    . VAL H 3 60  ? 62.313  19.271 -50.825 1.00 20.73  ? 260  VAL F CA    1 
ATOM   10064 C C     . VAL H 3 60  ? 62.110  20.461 -49.929 1.00 19.60  ? 260  VAL F C     1 
ATOM   10065 O O     . VAL H 3 60  ? 62.459  20.439 -48.760 1.00 21.14  ? 260  VAL F O     1 
ATOM   10066 C CB    . VAL H 3 60  ? 63.619  19.494 -51.556 1.00 17.22  ? 260  VAL F CB    1 
ATOM   10067 C CG1   . VAL H 3 60  ? 64.731  19.660 -50.574 1.00 18.31  ? 260  VAL F CG1   1 
ATOM   10068 C CG2   . VAL H 3 60  ? 63.888  18.350 -52.479 1.00 19.78  ? 260  VAL F CG2   1 
ATOM   10069 N N     . PHE H 3 61  ? 61.571  21.528 -50.503 1.00 22.25  ? 261  PHE F N     1 
ATOM   10070 C CA    . PHE H 3 61  ? 61.314  22.713 -49.729 1.00 19.72  ? 261  PHE F CA    1 
ATOM   10071 C C     . PHE H 3 61  ? 60.332  22.352 -48.621 1.00 20.13  ? 261  PHE F C     1 
ATOM   10072 O O     . PHE H 3 61  ? 60.577  22.588 -47.443 1.00 19.16  ? 261  PHE F O     1 
ATOM   10073 C CB    . PHE H 3 61  ? 60.726  23.806 -50.619 1.00 22.27  ? 261  PHE F CB    1 
ATOM   10074 C CG    . PHE H 3 61  ? 60.408  25.095 -49.878 1.00 23.62  ? 261  PHE F CG    1 
ATOM   10075 C CD1   . PHE H 3 61  ? 61.398  26.063 -49.681 1.00 22.55  ? 261  PHE F CD1   1 
ATOM   10076 C CD2   . PHE H 3 61  ? 59.112  25.316 -49.339 1.00 22.24  ? 261  PHE F CD2   1 
ATOM   10077 C CE1   . PHE H 3 61  ? 61.106  27.228 -48.964 1.00 21.77  ? 261  PHE F CE1   1 
ATOM   10078 C CE2   . PHE H 3 61  ? 58.816  26.480 -48.620 1.00 22.38  ? 261  PHE F CE2   1 
ATOM   10079 C CZ    . PHE H 3 61  ? 59.807  27.436 -48.429 1.00 24.74  ? 261  PHE F CZ    1 
ATOM   10080 N N     . LEU H 3 62  ? 59.210  21.768 -48.983 1.00 27.17  ? 262  LEU F N     1 
ATOM   10081 C CA    . LEU H 3 62  ? 58.278  21.404 -47.954 1.00 27.97  ? 262  LEU F CA    1 
ATOM   10082 C C     . LEU H 3 62  ? 58.847  20.387 -46.920 1.00 25.54  ? 262  LEU F C     1 
ATOM   10083 O O     . LEU H 3 62  ? 58.577  20.495 -45.710 1.00 29.63  ? 262  LEU F O     1 
ATOM   10084 C CB    . LEU H 3 62  ? 57.010  20.892 -48.619 1.00 23.33  ? 262  LEU F CB    1 
ATOM   10085 C CG    . LEU H 3 62  ? 56.147  22.025 -49.167 1.00 25.16  ? 262  LEU F CG    1 
ATOM   10086 C CD1   . LEU H 3 62  ? 54.955  21.502 -49.960 1.00 23.77  ? 262  LEU F CD1   1 
ATOM   10087 C CD2   . LEU H 3 62  ? 55.692  22.843 -47.979 1.00 19.04  ? 262  LEU F CD2   1 
ATOM   10088 N N     . GLU H 3 63  ? 59.633  19.409 -47.368 1.00 25.89  ? 263  GLU F N     1 
ATOM   10089 C CA    . GLU H 3 63  ? 60.176  18.458 -46.416 1.00 26.16  ? 263  GLU F CA    1 
ATOM   10090 C C     . GLU H 3 63  ? 61.068  19.176 -45.414 1.00 25.52  ? 263  GLU F C     1 
ATOM   10091 O O     . GLU H 3 63  ? 61.058  18.862 -44.216 1.00 23.89  ? 263  GLU F O     1 
ATOM   10092 C CB    . GLU H 3 63  ? 61.011  17.399 -47.092 1.00 43.89  ? 263  GLU F CB    1 
ATOM   10093 C CG    . GLU H 3 63  ? 60.272  16.541 -48.075 1.00 49.93  ? 263  GLU F CG    1 
ATOM   10094 C CD    . GLU H 3 63  ? 61.229  15.650 -48.856 1.00 49.52  ? 263  GLU F CD    1 
ATOM   10095 O OE1   . GLU H 3 63  ? 62.449  15.869 -48.729 1.00 50.22  ? 263  GLU F OE1   1 
ATOM   10096 O OE2   . GLU H 3 63  ? 60.769  14.753 -49.590 1.00 55.78  ? 263  GLU F OE2   1 
ATOM   10097 N N     . ASN H 3 64  ? 61.847  20.140 -45.892 1.00 21.08  ? 264  ASN F N     1 
ATOM   10098 C CA    . ASN H 3 64  ? 62.714  20.836 -44.975 1.00 20.63  ? 264  ASN F CA    1 
ATOM   10099 C C     . ASN H 3 64  ? 61.950  21.724 -44.010 1.00 20.79  ? 264  ASN F C     1 
ATOM   10100 O O     . ASN H 3 64  ? 62.213  21.667 -42.823 1.00 19.20  ? 264  ASN F O     1 
ATOM   10101 C CB    . ASN H 3 64  ? 63.786  21.613 -45.722 1.00 37.51  ? 264  ASN F CB    1 
ATOM   10102 C CG    . ASN H 3 64  ? 64.741  20.702 -46.465 1.00 44.47  ? 264  ASN F CG    1 
ATOM   10103 O OD1   . ASN H 3 64  ? 64.793  19.515 -46.208 1.00 49.14  ? 264  ASN F OD1   1 
ATOM   10104 N ND2   . ASN H 3 64  ? 65.505  21.261 -47.385 1.00 45.50  ? 264  ASN F ND2   1 
ATOM   10105 N N     . VAL H 3 65  ? 60.975  22.502 -44.466 1.00 31.96  ? 265  VAL F N     1 
ATOM   10106 C CA    . VAL H 3 65  ? 60.262  23.357 -43.516 1.00 31.34  ? 265  VAL F CA    1 
ATOM   10107 C C     . VAL H 3 65  ? 59.373  22.542 -42.559 1.00 28.59  ? 265  VAL F C     1 
ATOM   10108 O O     . VAL H 3 65  ? 59.333  22.834 -41.358 1.00 27.01  ? 265  VAL F O     1 
ATOM   10109 C CB    . VAL H 3 65  ? 59.404  24.486 -44.249 1.00 24.00  ? 265  VAL F CB    1 
ATOM   10110 C CG1   . VAL H 3 65  ? 58.931  25.546 -43.266 1.00 27.61  ? 265  VAL F CG1   1 
ATOM   10111 C CG2   . VAL H 3 65  ? 60.244  25.172 -45.286 1.00 29.02  ? 265  VAL F CG2   1 
ATOM   10112 N N     . ILE H 3 66  ? 58.689  21.512 -43.064 1.00 35.15  ? 266  ILE F N     1 
ATOM   10113 C CA    . ILE H 3 66  ? 57.799  20.715 -42.213 1.00 33.19  ? 266  ILE F CA    1 
ATOM   10114 C C     . ILE H 3 66  ? 58.544  19.890 -41.155 1.00 35.88  ? 266  ILE F C     1 
ATOM   10115 O O     . ILE H 3 66  ? 58.068  19.743 -40.030 1.00 33.46  ? 266  ILE F O     1 
ATOM   10116 C CB    . ILE H 3 66  ? 56.905  19.799 -43.070 1.00 28.15  ? 266  ILE F CB    1 
ATOM   10117 C CG1   . ILE H 3 66  ? 55.813  20.616 -43.751 1.00 27.20  ? 266  ILE F CG1   1 
ATOM   10118 C CG2   . ILE H 3 66  ? 56.242  18.744 -42.215 1.00 26.05  ? 266  ILE F CG2   1 
ATOM   10119 C CD1   . ILE H 3 66  ? 55.106  19.865 -44.823 1.00 25.64  ? 266  ILE F CD1   1 
ATOM   10120 N N     . ARG H 3 67  ? 59.713  19.351 -41.504 1.00 29.32  ? 267  ARG F N     1 
ATOM   10121 C CA    . ARG H 3 67  ? 60.476  18.588 -40.538 1.00 30.72  ? 267  ARG F CA    1 
ATOM   10122 C C     . ARG H 3 67  ? 60.769  19.491 -39.338 1.00 31.15  ? 267  ARG F C     1 
ATOM   10123 O O     . ARG H 3 67  ? 60.459  19.169 -38.185 1.00 29.28  ? 267  ARG F O     1 
ATOM   10124 C CB    . ARG H 3 67  ? 61.772  18.106 -41.154 1.00 35.62  ? 267  ARG F CB    1 
ATOM   10125 C CG    . ARG H 3 67  ? 62.653  17.420 -40.146 1.00 42.82  ? 267  ARG F CG    1 
ATOM   10126 C CD    . ARG H 3 67  ? 63.955  16.979 -40.745 1.00 48.65  ? 267  ARG F CD    1 
ATOM   10127 N NE    . ARG H 3 67  ? 63.736  16.106 -41.889 1.00 58.51  ? 267  ARG F NE    1 
ATOM   10128 C CZ    . ARG H 3 67  ? 64.006  16.441 -43.147 1.00 60.25  ? 267  ARG F CZ    1 
ATOM   10129 N NH1   . ARG H 3 67  ? 64.518  17.644 -43.416 1.00 60.65  ? 267  ARG F NH1   1 
ATOM   10130 N NH2   . ARG H 3 67  ? 63.745  15.576 -44.135 1.00 60.21  ? 267  ARG F NH2   1 
ATOM   10131 N N     . ASP H 3 68  ? 61.376  20.635 -39.612 1.00 31.92  ? 268  ASP F N     1 
ATOM   10132 C CA    . ASP H 3 68  ? 61.671  21.581 -38.552 1.00 29.70  ? 268  ASP F CA    1 
ATOM   10133 C C     . ASP H 3 68  ? 60.409  22.008 -37.878 1.00 26.84  ? 268  ASP F C     1 
ATOM   10134 O O     . ASP H 3 68  ? 60.345  22.053 -36.669 1.00 28.58  ? 268  ASP F O     1 
ATOM   10135 C CB    . ASP H 3 68  ? 62.350  22.802 -39.100 1.00 48.42  ? 268  ASP F CB    1 
ATOM   10136 C CG    . ASP H 3 68  ? 63.789  22.594 -39.280 1.00 56.11  ? 268  ASP F CG    1 
ATOM   10137 O OD1   . ASP H 3 68  ? 64.183  21.445 -39.563 1.00 50.80  ? 268  ASP F OD1   1 
ATOM   10138 O OD2   . ASP H 3 68  ? 64.519  23.581 -39.141 1.00 52.00  ? 268  ASP F OD2   1 
ATOM   10139 N N     . ALA H 3 69  ? 59.394  22.324 -38.657 1.00 25.90  ? 269  ALA F N     1 
ATOM   10140 C CA    . ALA H 3 69  ? 58.146  22.735 -38.048 1.00 28.50  ? 269  ALA F CA    1 
ATOM   10141 C C     . ALA H 3 69  ? 57.672  21.683 -37.021 1.00 28.40  ? 269  ALA F C     1 
ATOM   10142 O O     . ALA H 3 69  ? 57.444  21.983 -35.842 1.00 28.19  ? 269  ALA F O     1 
ATOM   10143 C CB    . ALA H 3 69  ? 57.123  22.918 -39.104 1.00 18.95  ? 269  ALA F CB    1 
ATOM   10144 N N     . VAL H 3 70  ? 57.556  20.446 -37.491 1.00 28.63  ? 270  VAL F N     1 
ATOM   10145 C CA    . VAL H 3 70  ? 57.122  19.335 -36.675 1.00 29.93  ? 270  VAL F CA    1 
ATOM   10146 C C     . VAL H 3 70  ? 58.089  18.981 -35.547 1.00 30.14  ? 270  VAL F C     1 
ATOM   10147 O O     . VAL H 3 70  ? 57.687  18.410 -34.560 1.00 33.34  ? 270  VAL F O     1 
ATOM   10148 C CB    . VAL H 3 70  ? 56.854  18.117 -37.545 1.00 17.12  ? 270  VAL F CB    1 
ATOM   10149 C CG1   . VAL H 3 70  ? 56.619  16.919 -36.657 1.00 14.58  ? 270  VAL F CG1   1 
ATOM   10150 C CG2   . VAL H 3 70  ? 55.642  18.376 -38.432 1.00 13.51  ? 270  VAL F CG2   1 
ATOM   10151 N N     . THR H 3 71  ? 59.361  19.316 -35.679 1.00 32.09  ? 271  THR F N     1 
ATOM   10152 C CA    . THR H 3 71  ? 60.276  19.074 -34.573 1.00 31.40  ? 271  THR F CA    1 
ATOM   10153 C C     . THR H 3 71  ? 59.868  20.025 -33.437 1.00 34.20  ? 271  THR F C     1 
ATOM   10154 O O     . THR H 3 71  ? 59.920  19.645 -32.276 1.00 32.25  ? 271  THR F O     1 
ATOM   10155 C CB    . THR H 3 71  ? 61.705  19.333 -35.007 1.00 20.50  ? 271  THR F CB    1 
ATOM   10156 O OG1   . THR H 3 71  ? 62.040  18.358 -36.000 1.00 17.44  ? 271  THR F OG1   1 
ATOM   10157 C CG2   . THR H 3 71  ? 62.703  19.263 -33.827 1.00 18.88  ? 271  THR F CG2   1 
ATOM   10158 N N     . TYR H 3 72  ? 59.447  21.248 -33.781 1.00 38.80  ? 272  TYR F N     1 
ATOM   10159 C CA    . TYR H 3 72  ? 58.978  22.233 -32.809 1.00 36.94  ? 272  TYR F CA    1 
ATOM   10160 C C     . TYR H 3 72  ? 57.690  21.749 -32.140 1.00 40.00  ? 272  TYR F C     1 
ATOM   10161 O O     . TYR H 3 72  ? 57.456  21.973 -30.958 1.00 38.60  ? 272  TYR F O     1 
ATOM   10162 C CB    . TYR H 3 72  ? 58.666  23.572 -33.488 1.00 25.35  ? 272  TYR F CB    1 
ATOM   10163 C CG    . TYR H 3 72  ? 59.860  24.477 -33.645 1.00 25.10  ? 272  TYR F CG    1 
ATOM   10164 C CD1   . TYR H 3 72  ? 60.403  24.730 -34.916 1.00 25.60  ? 272  TYR F CD1   1 
ATOM   10165 C CD2   . TYR H 3 72  ? 60.547  24.979 -32.524 1.00 26.80  ? 272  TYR F CD2   1 
ATOM   10166 C CE1   . TYR H 3 72  ? 61.615  25.446 -35.068 1.00 27.03  ? 272  TYR F CE1   1 
ATOM   10167 C CE2   . TYR H 3 72  ? 61.751  25.692 -32.677 1.00 27.19  ? 272  TYR F CE2   1 
ATOM   10168 C CZ    . TYR H 3 72  ? 62.269  25.907 -33.964 1.00 27.51  ? 272  TYR F CZ    1 
ATOM   10169 O OH    . TYR H 3 72  ? 63.446  26.545 -34.161 1.00 30.25  ? 272  TYR F OH    1 
ATOM   10170 N N     . THR H 3 73  ? 56.836  21.093 -32.906 1.00 34.71  ? 273  THR F N     1 
ATOM   10171 C CA    . THR H 3 73  ? 55.584  20.630 -32.363 1.00 39.46  ? 273  THR F CA    1 
ATOM   10172 C C     . THR H 3 73  ? 55.849  19.609 -31.297 1.00 41.11  ? 273  THR F C     1 
ATOM   10173 O O     . THR H 3 73  ? 55.332  19.717 -30.203 1.00 39.14  ? 273  THR F O     1 
ATOM   10174 C CB    . THR H 3 73  ? 54.731  19.974 -33.433 1.00 34.34  ? 273  THR F CB    1 
ATOM   10175 O OG1   . THR H 3 73  ? 54.761  20.765 -34.623 1.00 36.06  ? 273  THR F OG1   1 
ATOM   10176 C CG2   . THR H 3 73  ? 53.301  19.836 -32.936 1.00 31.09  ? 273  THR F CG2   1 
ATOM   10177 N N     . GLU H 3 74  ? 56.655  18.609 -31.640 1.00 42.66  ? 274  GLU F N     1 
ATOM   10178 C CA    . GLU H 3 74  ? 56.994  17.535 -30.719 1.00 45.58  ? 274  GLU F CA    1 
ATOM   10179 C C     . GLU H 3 74  ? 57.647  18.103 -29.480 1.00 46.35  ? 274  GLU F C     1 
ATOM   10180 O O     . GLU H 3 74  ? 57.264  17.753 -28.363 1.00 44.95  ? 274  GLU F O     1 
ATOM   10181 C CB    . GLU H 3 74  ? 57.944  16.502 -31.365 1.00 58.29  ? 274  GLU F CB    1 
ATOM   10182 C CG    . GLU H 3 74  ? 57.398  15.827 -32.636 1.00 70.38  ? 274  GLU F CG    1 
ATOM   10183 C CD    . GLU H 3 74  ? 58.284  14.706 -33.214 1.00 74.92  ? 274  GLU F CD    1 
ATOM   10184 O OE1   . GLU H 3 74  ? 59.528  14.819 -33.194 1.00 79.92  ? 274  GLU F OE1   1 
ATOM   10185 O OE2   . GLU H 3 74  ? 57.726  13.707 -33.722 1.00 78.83  ? 274  GLU F OE2   1 
ATOM   10186 N N     . HIS H 3 75  ? 58.620  18.986 -29.654 1.00 39.27  ? 275  HIS F N     1 
ATOM   10187 C CA    . HIS H 3 75  ? 59.272  19.521 -28.486 1.00 38.08  ? 275  HIS F CA    1 
ATOM   10188 C C     . HIS H 3 75  ? 58.305  20.143 -27.512 1.00 41.77  ? 275  HIS F C     1 
ATOM   10189 O O     . HIS H 3 75  ? 58.541  20.172 -26.315 1.00 39.80  ? 275  HIS F O     1 
ATOM   10190 C CB    . HIS H 3 75  ? 60.284  20.566 -28.834 1.00 43.51  ? 275  HIS F CB    1 
ATOM   10191 C CG    . HIS H 3 75  ? 60.990  21.090 -27.635 1.00 43.76  ? 275  HIS F CG    1 
ATOM   10192 N ND1   . HIS H 3 75  ? 62.065  20.444 -27.066 1.00 42.68  ? 275  HIS F ND1   1 
ATOM   10193 C CD2   . HIS H 3 75  ? 60.739  22.167 -26.854 1.00 45.06  ? 275  HIS F CD2   1 
ATOM   10194 C CE1   . HIS H 3 75  ? 62.453  21.101 -25.987 1.00 46.72  ? 275  HIS F CE1   1 
ATOM   10195 N NE2   . HIS H 3 75  ? 61.664  22.152 -25.836 1.00 45.71  ? 275  HIS F NE2   1 
ATOM   10196 N N     . ALA H 3 76  ? 57.214  20.662 -28.033 1.00 34.21  ? 276  ALA F N     1 
ATOM   10197 C CA    . ALA H 3 76  ? 56.214  21.287 -27.220 1.00 36.37  ? 276  ALA F CA    1 
ATOM   10198 C C     . ALA H 3 76  ? 55.214  20.235 -26.762 1.00 37.05  ? 276  ALA F C     1 
ATOM   10199 O O     . ALA H 3 76  ? 54.193  20.560 -26.146 1.00 37.61  ? 276  ALA F O     1 
ATOM   10200 C CB    . ALA H 3 76  ? 55.522  22.320 -28.024 1.00 17.02  ? 276  ALA F CB    1 
ATOM   10201 N N     . LYS H 3 77  ? 55.493  18.972 -27.071 1.00 47.78  ? 277  LYS F N     1 
ATOM   10202 C CA    . LYS H 3 77  ? 54.587  17.885 -26.703 1.00 48.98  ? 277  LYS F CA    1 
ATOM   10203 C C     . LYS H 3 77  ? 53.150  18.171 -27.132 1.00 49.09  ? 277  LYS F C     1 
ATOM   10204 O O     . LYS H 3 77  ? 52.224  17.925 -26.366 1.00 49.58  ? 277  LYS F O     1 
ATOM   10205 C CB    . LYS H 3 77  ? 54.610  17.645 -25.192 1.00 44.06  ? 277  LYS F CB    1 
ATOM   10206 C CG    . LYS H 3 77  ? 55.954  17.234 -24.629 1.00 48.07  ? 277  LYS F CG    1 
ATOM   10207 C CD    . LYS H 3 77  ? 55.877  17.218 -23.121 1.00 52.93  ? 277  LYS F CD    1 
ATOM   10208 C CE    . LYS H 3 77  ? 57.218  17.003 -22.438 1.00 57.57  ? 277  LYS F CE    1 
ATOM   10209 N NZ    . LYS H 3 77  ? 57.085  17.330 -20.973 1.00 59.58  ? 277  LYS F NZ    1 
ATOM   10210 N N     . ARG H 3 78  ? 52.982  18.707 -28.339 1.00 37.56  ? 278  ARG F N     1 
ATOM   10211 C CA    . ARG H 3 78  ? 51.667  19.010 -28.914 1.00 33.80  ? 278  ARG F CA    1 
ATOM   10212 C C     . ARG H 3 78  ? 51.413  18.040 -30.059 1.00 33.73  ? 278  ARG F C     1 
ATOM   10213 O O     . ARG H 3 78  ? 52.347  17.376 -30.544 1.00 31.83  ? 278  ARG F O     1 
ATOM   10214 C CB    . ARG H 3 78  ? 51.605  20.428 -29.480 1.00 36.06  ? 278  ARG F CB    1 
ATOM   10215 C CG    . ARG H 3 78  ? 50.994  21.437 -28.552 1.00 36.22  ? 278  ARG F CG    1 
ATOM   10216 C CD    . ARG H 3 78  ? 50.865  22.835 -29.157 1.00 37.70  ? 278  ARG F CD    1 
ATOM   10217 N NE    . ARG H 3 78  ? 52.161  23.468 -29.437 1.00 36.58  ? 278  ARG F NE    1 
ATOM   10218 C CZ    . ARG H 3 78  ? 52.765  23.521 -30.634 1.00 35.29  ? 278  ARG F CZ    1 
ATOM   10219 N NH1   . ARG H 3 78  ? 52.217  22.983 -31.729 1.00 31.18  ? 278  ARG F NH1   1 
ATOM   10220 N NH2   . ARG H 3 78  ? 53.941  24.123 -30.719 1.00 34.66  ? 278  ARG F NH2   1 
ATOM   10221 N N     . LYS H 3 79  ? 50.162  17.949 -30.498 1.00 54.27  ? 279  LYS F N     1 
ATOM   10222 C CA    . LYS H 3 79  ? 49.844  17.055 -31.594 1.00 57.54  ? 279  LYS F CA    1 
ATOM   10223 C C     . LYS H 3 79  ? 49.444  17.870 -32.791 1.00 54.80  ? 279  LYS F C     1 
ATOM   10224 O O     . LYS H 3 79  ? 49.317  17.351 -33.898 1.00 55.87  ? 279  LYS F O     1 
ATOM   10225 C CB    . LYS H 3 79  ? 48.698  16.125 -31.231 1.00 55.26  ? 279  LYS F CB    1 
ATOM   10226 C CG    . LYS H 3 79  ? 49.053  14.994 -30.292 1.00 62.18  ? 279  LYS F CG    1 
ATOM   10227 C CD    . LYS H 3 79  ? 47.915  13.993 -30.266 1.00 70.50  ? 279  LYS F CD    1 
ATOM   10228 C CE    . LYS H 3 79  ? 48.144  12.905 -29.248 1.00 73.93  ? 279  LYS F CE    1 
ATOM   10229 N NZ    . LYS H 3 79  ? 47.085  11.855 -29.317 1.00 74.44  ? 279  LYS F NZ    1 
ATOM   10230 N N     . THR H 3 80  ? 49.254  19.161 -32.566 1.00 49.42  ? 280  THR F N     1 
ATOM   10231 C CA    . THR H 3 80  ? 48.839  20.060 -33.629 1.00 49.41  ? 280  THR F CA    1 
ATOM   10232 C C     . THR H 3 80  ? 49.941  21.016 -34.072 1.00 47.34  ? 280  THR F C     1 
ATOM   10233 O O     . THR H 3 80  ? 50.475  21.773 -33.259 1.00 46.19  ? 280  THR F O     1 
ATOM   10234 C CB    . THR H 3 80  ? 47.636  20.910 -33.158 1.00 48.70  ? 280  THR F CB    1 
ATOM   10235 O OG1   . THR H 3 80  ? 46.736  20.094 -32.398 1.00 51.70  ? 280  THR F OG1   1 
ATOM   10236 C CG2   . THR H 3 80  ? 46.910  21.490 -34.328 1.00 51.22  ? 280  THR F CG2   1 
ATOM   10237 N N     . VAL H 3 81  ? 50.278  20.986 -35.357 1.00 38.80  ? 281  VAL F N     1 
ATOM   10238 C CA    . VAL H 3 81  ? 51.271  21.917 -35.916 1.00 37.75  ? 281  VAL F CA    1 
ATOM   10239 C C     . VAL H 3 81  ? 50.572  23.298 -36.022 1.00 37.18  ? 281  VAL F C     1 
ATOM   10240 O O     . VAL H 3 81  ? 49.579  23.465 -36.759 1.00 36.47  ? 281  VAL F O     1 
ATOM   10241 C CB    . VAL H 3 81  ? 51.749  21.510 -37.357 1.00 28.85  ? 281  VAL F CB    1 
ATOM   10242 C CG1   . VAL H 3 81  ? 52.931  22.394 -37.759 1.00 29.04  ? 281  VAL F CG1   1 
ATOM   10243 C CG2   . VAL H 3 81  ? 52.127  20.041 -37.416 1.00 29.33  ? 281  VAL F CG2   1 
ATOM   10244 N N     . THR H 3 82  ? 51.101  24.273 -35.283 1.00 29.70  ? 282  THR F N     1 
ATOM   10245 C CA    . THR H 3 82  ? 50.561  25.633 -35.244 1.00 30.44  ? 282  THR F CA    1 
ATOM   10246 C C     . THR H 3 82  ? 51.303  26.516 -36.218 1.00 30.13  ? 282  THR F C     1 
ATOM   10247 O O     . THR H 3 82  ? 52.363  26.147 -36.692 1.00 25.99  ? 282  THR F O     1 
ATOM   10248 C CB    . THR H 3 82  ? 50.744  26.260 -33.844 1.00 29.95  ? 282  THR F CB    1 
ATOM   10249 O OG1   . THR H 3 82  ? 52.139  26.475 -33.585 1.00 30.85  ? 282  THR F OG1   1 
ATOM   10250 C CG2   . THR H 3 82  ? 50.180  25.336 -32.769 1.00 29.71  ? 282  THR F CG2   1 
ATOM   10251 N N     . ALA H 3 83  ? 50.768  27.708 -36.482 1.00 38.53  ? 283  ALA F N     1 
ATOM   10252 C CA    . ALA H 3 83  ? 51.420  28.646 -37.397 1.00 38.01  ? 283  ALA F CA    1 
ATOM   10253 C C     . ALA H 3 83  ? 52.779  29.097 -36.890 1.00 37.10  ? 283  ALA F C     1 
ATOM   10254 O O     . ALA H 3 83  ? 53.688  29.321 -37.677 1.00 38.16  ? 283  ALA F O     1 
ATOM   10255 C CB    . ALA H 3 83  ? 50.545  29.820 -37.635 1.00 11.78  ? 283  ALA F CB    1 
ATOM   10256 N N     . MET H 3 84  ? 52.920  29.231 -35.578 1.00 27.74  ? 284  MET F N     1 
ATOM   10257 C CA    . MET H 3 84  ? 54.217  29.615 -35.026 1.00 30.03  ? 284  MET F CA    1 
ATOM   10258 C C     . MET H 3 84  ? 55.280  28.545 -35.277 1.00 29.88  ? 284  MET F C     1 
ATOM   10259 O O     . MET H 3 84  ? 56.441  28.878 -35.489 1.00 27.58  ? 284  MET F O     1 
ATOM   10260 C CB    . MET H 3 84  ? 54.134  29.898 -33.521 1.00 15.35  ? 284  MET F CB    1 
ATOM   10261 C CG    . MET H 3 84  ? 53.403  31.166 -33.181 1.00 27.10  ? 284  MET F CG    1 
ATOM   10262 S SD    . MET H 3 84  ? 53.840  32.589 -34.239 1.00 33.00  ? 284  MET F SD    1 
ATOM   10263 C CE    . MET H 3 84  ? 55.562  32.744 -33.873 1.00 31.55  ? 284  MET F CE    1 
ATOM   10264 N N     . ASP H 3 85  ? 54.887  27.271 -35.236 1.00 24.80  ? 285  ASP F N     1 
ATOM   10265 C CA    . ASP H 3 85  ? 55.819  26.200 -35.496 1.00 24.81  ? 285  ASP F CA    1 
ATOM   10266 C C     . ASP H 3 85  ? 56.390  26.434 -36.903 1.00 20.98  ? 285  ASP F C     1 
ATOM   10267 O O     . ASP H 3 85  ? 57.602  26.366 -37.149 1.00 22.29  ? 285  ASP F O     1 
ATOM   10268 C CB    . ASP H 3 85  ? 55.102  24.844 -35.446 1.00 50.79  ? 285  ASP F CB    1 
ATOM   10269 C CG    . ASP H 3 85  ? 54.727  24.418 -34.028 1.00 52.11  ? 285  ASP F CG    1 
ATOM   10270 O OD1   . ASP H 3 85  ? 55.490  24.732 -33.104 1.00 48.88  ? 285  ASP F OD1   1 
ATOM   10271 O OD2   . ASP H 3 85  ? 53.689  23.751 -33.827 1.00 53.07  ? 285  ASP F OD2   1 
ATOM   10272 N N     . VAL H 3 86  ? 55.498  26.713 -37.836 1.00 31.79  ? 286  VAL F N     1 
ATOM   10273 C CA    . VAL H 3 86  ? 55.909  26.949 -39.186 1.00 31.42  ? 286  VAL F CA    1 
ATOM   10274 C C     . VAL H 3 86  ? 56.725  28.250 -39.268 1.00 32.48  ? 286  VAL F C     1 
ATOM   10275 O O     . VAL H 3 86  ? 57.769  28.302 -39.933 1.00 35.23  ? 286  VAL F O     1 
ATOM   10276 C CB    . VAL H 3 86  ? 54.670  26.961 -40.072 1.00 19.55  ? 286  VAL F CB    1 
ATOM   10277 C CG1   . VAL H 3 86  ? 55.006  27.422 -41.473 1.00 19.06  ? 286  VAL F CG1   1 
ATOM   10278 C CG2   . VAL H 3 86  ? 54.106  25.569 -40.105 1.00 20.84  ? 286  VAL F CG2   1 
ATOM   10279 N N     . VAL H 3 87  ? 56.272  29.299 -38.587 1.00 28.51  ? 287  VAL F N     1 
ATOM   10280 C CA    . VAL H 3 87  ? 57.019  30.541 -38.600 1.00 26.95  ? 287  VAL F CA    1 
ATOM   10281 C C     . VAL H 3 87  ? 58.412  30.372 -37.991 1.00 27.68  ? 287  VAL F C     1 
ATOM   10282 O O     . VAL H 3 87  ? 59.347  30.999 -38.455 1.00 26.71  ? 287  VAL F O     1 
ATOM   10283 C CB    . VAL H 3 87  ? 56.269  31.687 -37.869 1.00 29.14  ? 287  VAL F CB    1 
ATOM   10284 C CG1   . VAL H 3 87  ? 57.210  32.870 -37.633 1.00 29.91  ? 287  VAL F CG1   1 
ATOM   10285 C CG2   . VAL H 3 87  ? 55.106  32.148 -38.720 1.00 28.37  ? 287  VAL F CG2   1 
ATOM   10286 N N     . TYR H 3 88  ? 58.578  29.541 -36.972 1.00 21.53  ? 288  TYR F N     1 
ATOM   10287 C CA    . TYR H 3 88  ? 59.909  29.384 -36.408 1.00 21.51  ? 288  TYR F CA    1 
ATOM   10288 C C     . TYR H 3 88  ? 60.767  28.538 -37.318 1.00 19.31  ? 288  TYR F C     1 
ATOM   10289 O O     . TYR H 3 88  ? 61.976  28.767 -37.426 1.00 21.66  ? 288  TYR F O     1 
ATOM   10290 C CB    . TYR H 3 88  ? 59.899  28.755 -35.005 1.00 39.86  ? 288  TYR F CB    1 
ATOM   10291 C CG    . TYR H 3 88  ? 59.237  29.593 -33.951 1.00 43.25  ? 288  TYR F CG    1 
ATOM   10292 C CD1   . TYR H 3 88  ? 58.356  29.025 -33.039 1.00 47.49  ? 288  TYR F CD1   1 
ATOM   10293 C CD2   . TYR H 3 88  ? 59.407  30.966 -33.923 1.00 47.50  ? 288  TYR F CD2   1 
ATOM   10294 C CE1   . TYR H 3 88  ? 57.647  29.802 -32.137 1.00 48.40  ? 288  TYR F CE1   1 
ATOM   10295 C CE2   . TYR H 3 88  ? 58.715  31.752 -33.030 1.00 50.98  ? 288  TYR F CE2   1 
ATOM   10296 C CZ    . TYR H 3 88  ? 57.831  31.168 -32.142 1.00 49.58  ? 288  TYR F CZ    1 
ATOM   10297 O OH    . TYR H 3 88  ? 57.102  31.960 -31.282 1.00 52.04  ? 288  TYR F OH    1 
ATOM   10298 N N     . ALA H 3 89  ? 60.170  27.559 -37.981 1.00 30.72  ? 289  ALA F N     1 
ATOM   10299 C CA    . ALA H 3 89  ? 60.963  26.706 -38.852 1.00 29.94  ? 289  ALA F CA    1 
ATOM   10300 C C     . ALA H 3 89  ? 61.504  27.546 -39.989 1