data_1P3M
# 
_entry.id   1P3M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P3M         
NDB   PD0421       
RCSB  RCSB018965   
WWPDB D_1000018965 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'X-ray structure of the Nucleosome Core Particle at 2.8 A' unspecified 
PDB 1F66 '2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2A.Z' unspecified 
PDB 1ID3 
;Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental 
Differences In Inter-Nucleosome Interactions
;
unspecified 
PDB 1KX3 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution' unspecified 
PDB 1KX4 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146B, At 2.6 A Resolution' unspecified 
PDB 1KX5 'X-Ray Structure Of The Nucleosome Core Particle, Ncp147, At 1.9 A Resolution' unspecified 
PDB 1P34 . unspecified 
PDB 1P3A . unspecified 
PDB 1P3B . unspecified 
PDB 1P3F . unspecified 
PDB 1P3G . unspecified 
PDB 1P3I . unspecified 
PDB 1P3K . unspecified 
PDB 1P3L . unspecified 
PDB 1P3O . unspecified 
PDB 1P3P . unspecified 
# 
_pdbx_database_status.entry_id                        1P3M 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muthurajan, U.M.'       1 
'Bao, Y.'                2 
'Forsberg, L.J.'         3 
'Edayathumangalam, R.S.' 4 
'Dyer, P.N.'             5 
'White, C.L.'            6 
'Luger, K.'              7 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            23 
_citation.page_first                260 
_citation.page_last                 271 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14739929 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muthurajan, U.M.'       1 
primary 'Bao, Y.'                2 
primary 'Forsberg, L.J.'         3 
primary 'Edayathumangalam, R.S.' 4 
primary 'Dyer, P.N.'             5 
primary 'White, C.L.'            6 
primary 'Luger, K.'              7 
# 
_cell.entry_id           1P3M 
_cell.length_a           105.766 
_cell.length_b           109.634 
_cell.length_c           181.508 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P3M 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Palindromic 146bp Human Alpha-Satellite DNA fragment' 45054.844 2   ? ? ? ? 
2 polymer man 'Histone H3'                                           15375.992 2   ? ? ? ? 
3 polymer man 'Histone H4'                                           11263.231 2   ? ? ? ? 
4 polymer man 'Histone H2A'                                          13962.241 2   ? ? ? ? 
5 polymer man 'Histone H2B'                                          13834.070 2   ? ? ? ? 
6 water   nat water                                                  18.015    117 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVIIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVIIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLU n 
2 35  SER n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 ILE n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 ALA n 
4 124 LYS n 
4 125 SER n 
4 126 ALA n 
4 127 LYS n 
4 128 SER n 
4 129 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'HB 101'         ? ? ? ? ? ? Plasmid ? ? ? pUC ? ? 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? 'BL21 DE3 plysS' ? ? ? ? ? ? Plasmid ? ? ? pET ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q7ZT64_9ZZZZ Q7ZT64 2 2 ? ? 
2 UNP H4_XENLA     P62799 3 1 ? ? 
3 UNP Q7ZT66_9ZZZZ Q7ZT66 4 2 ? ? 
4 UNP H2B1_XENLA   P02281 5 1 ? ? 
5 PDB 1P3M         1P3M   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1P3M A 1 ? 135 ? Q7ZT64 2   ? 136 ? 401  535  
2  2 1P3M B 1 ? 102 ? P62799 1   ? 102 ? 1    102  
3  3 1P3M C 1 ? 129 ? Q7ZT66 2   ? 130 ? 801  929  
4  4 1P3M D 1 ? 125 ? P02281 1   ? 125 ? 1198 1322 
5  1 1P3M E 1 ? 135 ? Q7ZT64 2   ? 136 ? 601  735  
6  2 1P3M F 1 ? 102 ? P62799 1   ? 102 ? 201  302  
7  3 1P3M G 1 ? 129 ? Q7ZT66 2   ? 130 ? 1001 1129 
8  4 1P3M H 1 ? 125 ? P02281 1   ? 125 ? 1398 1522 
9  5 1P3M I 1 ? 146 ? 1P3M   1   ? 146 ? 1    146  
10 5 1P3M J 1 ? 146 ? 1P3M   147 ? 292 ? 147  292  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P3M GLU A 34  ? UNP Q7ZT64 GLY 35  CONFLICT 434  1  
1 1P3M SER A 35  ? UNP Q7ZT64 VAL 36  CONFLICT 435  2  
1 1P3M ALA A 102 ? UNP Q7ZT64 GLY 103 CONFLICT 502  3  
1 1P3M ILE A 118 ? UNP Q7ZT64 THR 119 CONFLICT 518  4  
5 1P3M GLU E 34  ? UNP Q7ZT64 GLY 35  CONFLICT 634  5  
5 1P3M SER E 35  ? UNP Q7ZT64 VAL 36  CONFLICT 635  6  
5 1P3M ALA E 102 ? UNP Q7ZT64 GLY 103 CONFLICT 702  7  
5 1P3M ILE E 118 ? UNP Q7ZT64 THR 119 CONFLICT 718  8  
3 1P3M ALA C 14  ? UNP Q7ZT66 SER 15  CONFLICT 814  9  
3 1P3M GLY C 67  ? UNP Q7ZT66 TRP 68  CONFLICT 867  10 
3 1P3M ASN C 68  ? UNP Q7ZT66 GLU 69  CONFLICT 868  11 
3 1P3M ALA C 69  ? UNP Q7ZT66 ARG 70  CONFLICT 869  12 
3 1P3M ALA C 70  ? UNP Q7ZT66 LEU 71  CONFLICT 870  13 
3 1P3M ARG C 71  ? UNP Q7ZT66 PRO 72  CONFLICT 871  14 
3 1P3M ASP C 72  ? UNP Q7ZT66 GLU 73  CONFLICT 872  15 
3 1P3M ASN C 73  ? UNP Q7ZT66 ILE 74  CONFLICT 873  16 
3 1P3M LYS C 74  ? UNP Q7ZT66 TRP 75  CONFLICT 874  17 
3 1P3M THR C 76  ? UNP Q7ZT66 ARG 77  CONFLICT 876  18 
3 1P3M ARG C 77  ? UNP Q7ZT66 PRO 78  CONFLICT 877  19 
3 1P3M ILE C 78  ? UNP Q7ZT66 VAL 79  CONFLICT 878  20 
3 1P3M ILE C 79  ? UNP Q7ZT66 LEU 80  CONFLICT 879  21 
3 1P3M PRO C 80  ? UNP Q7ZT66 SER 81  CONFLICT 880  22 
3 1P3M ARG C 81  ? UNP Q7ZT66 PRO 82  CONFLICT 881  23 
3 1P3M HIS C 82  ? UNP Q7ZT66 GLY 83  CONFLICT 882  24 
3 1P3M LEU C 83  ? UNP Q7ZT66 TRP 84  CONFLICT 883  25 
3 1P3M GLN C 84  ? UNP Q7ZT66 CYS 85  CONFLICT 884  26 
3 1P3M LEU C 85  ? UNP Q7ZT66 ASN 86  CONFLICT 885  27 
3 1P3M ALA C 86  ? UNP Q7ZT66 SER 87  CONFLICT 886  28 
3 1P3M VAL C 87  ? UNP Q7ZT66 LEU 88  CONFLICT 887  29 
3 1P3M ARG C 88  ? UNP Q7ZT66 CYS 89  CONFLICT 888  30 
3 1P3M ALA C 123 ? UNP Q7ZT66 SER 124 CONFLICT 923  31 
3 1P3M ALA C 126 ? UNP Q7ZT66 THR 127 CONFLICT 926  32 
7 1P3M ALA G 14  ? UNP Q7ZT66 SER 15  CONFLICT 1014 33 
7 1P3M GLY G 67  ? UNP Q7ZT66 TRP 68  CONFLICT 1067 34 
7 1P3M ASN G 68  ? UNP Q7ZT66 GLU 69  CONFLICT 1068 35 
7 1P3M ALA G 69  ? UNP Q7ZT66 ARG 70  CONFLICT 1069 36 
7 1P3M ALA G 70  ? UNP Q7ZT66 LEU 71  CONFLICT 1070 37 
7 1P3M ARG G 71  ? UNP Q7ZT66 PRO 72  CONFLICT 1071 38 
7 1P3M ASP G 72  ? UNP Q7ZT66 GLU 73  CONFLICT 1072 39 
7 1P3M ASN G 73  ? UNP Q7ZT66 ILE 74  CONFLICT 1073 40 
7 1P3M LYS G 74  ? UNP Q7ZT66 TRP 75  CONFLICT 1074 41 
7 1P3M THR G 76  ? UNP Q7ZT66 ARG 77  CONFLICT 1076 42 
7 1P3M ARG G 77  ? UNP Q7ZT66 PRO 78  CONFLICT 1077 43 
7 1P3M ILE G 78  ? UNP Q7ZT66 VAL 79  CONFLICT 1078 44 
7 1P3M ILE G 79  ? UNP Q7ZT66 LEU 80  CONFLICT 1079 45 
7 1P3M PRO G 80  ? UNP Q7ZT66 SER 81  CONFLICT 1080 46 
7 1P3M ARG G 81  ? UNP Q7ZT66 PRO 82  CONFLICT 1081 47 
7 1P3M HIS G 82  ? UNP Q7ZT66 GLY 83  CONFLICT 1082 48 
7 1P3M LEU G 83  ? UNP Q7ZT66 TRP 84  CONFLICT 1083 49 
7 1P3M GLN G 84  ? UNP Q7ZT66 CYS 85  CONFLICT 1084 50 
7 1P3M LEU G 85  ? UNP Q7ZT66 ASN 86  CONFLICT 1085 51 
7 1P3M ALA G 86  ? UNP Q7ZT66 SER 87  CONFLICT 1086 52 
7 1P3M VAL G 87  ? UNP Q7ZT66 LEU 88  CONFLICT 1087 53 
7 1P3M ARG G 88  ? UNP Q7ZT66 CYS 89  CONFLICT 1088 54 
7 1P3M ALA G 123 ? UNP Q7ZT66 SER 124 CONFLICT 1123 55 
7 1P3M ALA G 126 ? UNP Q7ZT66 THR 127 CONFLICT 1126 56 
4 1P3M GLN D 22  ? UNP P02281 PRO 23  CONFLICT 1219 57 
4 1P3M LEU D 45  ? UNP P02281 MET 46  CONFLICT 1242 58 
4 1P3M SER D 60  ? UNP P02281 GLY 61  CONFLICT 1257 59 
4 1P3M VAL D 69  ? UNP P02281 ILE 70  CONFLICT 1266 60 
8 1P3M GLN H 22  ? UNP P02281 PRO 23  CONFLICT 1419 61 
8 1P3M LEU H 45  ? UNP P02281 MET 46  CONFLICT 1442 62 
8 1P3M SER H 60  ? UNP P02281 GLY 61  CONFLICT 1457 63 
8 1P3M VAL H 69  ? UNP P02281 ILE 70  CONFLICT 1466 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1P3M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.71 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'MnCl2, KCl, Potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'Potassium cacodylate' ? ? ? 
1 4 2 MnCl2                  ? ? ? 
1 5 2 KCl                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-03-15 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Cu 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1P3M 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3. 
_reflns.d_resolution_high            2.90 
_reflns.d_resolution_low             35. 
_reflns.number_all                   ? 
_reflns.number_obs                   37684 
_reflns.percent_possible_obs         87.6 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.67 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   84.8 
_reflns_shell.Rmerge_I_obs           0.377 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P3M 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             35. 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     39824 
_refine.ls_number_reflns_obs                     38240 
_refine.ls_number_reflns_R_free                  1584 
_refine.ls_percent_reflns_obs                    83.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.27 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 4.1 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5973 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               12070 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        35. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.0092 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d   1.36   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.36   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P3M 
_struct.title                     
;Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
;
_struct.pdbx_descriptor           'Nucleosome Core Particle/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P3M 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
'Sin mutants, Nucleosome Core Particle, chromatin, protein/DNA interaction, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? GLN C 76  ? ARG A 463  GLN A 476  1 ? 14 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 520  ARG A 531  1 ? 12 
HELX_P HELX_P5  5  ASN D 25  ? ILE D 29  ? ASN B 25   ILE B 29   5 ? 5  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLY D 94  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9  9  THR E 16  ? ALA E 21  ? THR C 816  ALA C 821  1 ? 6  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 845  ASN C 873  1 ? 29 
HELX_P HELX_P12 12 ILE E 79  ? ASP E 90  ? ILE C 879  ASP C 890  1 ? 12 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? SER F 123 ? PRO D 1300 SER D 1320 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? ASP G 77  ? ARG E 663  ASP E 677  1 ? 15 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? GLY G 132 ? MET E 720  GLY E 732  1 ? 13 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? ALA I 21  ? THR G 1016 ALA G 1021 1 ? 6  
HELX_P HELX_P28 28 PRO I 26  ? GLY I 37  ? PRO G 1026 GLY G 1037 1 ? 12 
HELX_P HELX_P29 29 GLY I 46  ? ASP I 72  ? GLY G 1046 ASP G 1072 1 ? 27 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P36 36 PRO J 103 ? SER J 123 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B DA 145 N6 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B DT 142 O4 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B DA 139 N1 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B DA 139 N6 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog19  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 137 N1 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B DG 137 O6 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT 136 N3 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DC 12  N3 ? ? ? 1_555 B DG 135 N1 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DC 12  O2 ? ? ? 1_555 B DG 135 N2 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog28  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog31  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DT 130 N3 ? ? I DC 16  J DT 276 1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog32  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog33  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DC 129 N3 ? ? I DA 17  J DC 275 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog34  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog37  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 21  J DA 272 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? A DT 21  O4 ? ? ? 1_555 B DA 126 N6 ? ? I DT 21  J DA 272 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? A DC 22  N3 ? ? ? 1_555 B DG 125 N1 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 125 N2 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DA 24  N6 ? ? ? 1_555 B DT 123 O4 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog47  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT 120 N3 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 120 O4 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DA 28  N1 ? ? ? 1_555 B DT 119 N3 ? ? I DA 28  J DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 28  J DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 29  J DT 263 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog52  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 116 N4 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B DA 115 N1 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B DA 115 N6 ? ? I DT 32  J DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DG 33  N2 ? ? ? 1_555 B DC 114 O2 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? A DG 33  O6 ? ? ? 1_555 B DC 114 N4 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 37  J DA 255 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog71  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DC 108 N3 ? ? I DT 38  J DC 254 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog74  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DC 108 N4 ? ? I DT 38  J DC 254 1_555 ? ? ? ? ? ? TYPE_18_PAIR    ? ? 
hydrog75  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 39  J DC 253 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog78  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog79  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog80  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog81  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog84  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog85  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B DC 101 O2 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B DC 101 N4 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DG 100 N1 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DC 47  N4 ? ? ? 1_555 B DG 100 O6 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DC 49  N3 ? ? ? 1_555 B DG 98  N1 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DC 49  N4 ? ? ? 1_555 B DG 98  O6 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog97  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog102 hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 55  J DT 239 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog107 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DG 58  N1 ? ? ? 1_555 B DC 89  N3 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DG 58  N2 ? ? ? 1_555 B DC 89  O2 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DG 58  O6 ? ? ? 1_555 B DC 89  N4 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DC 60  N3 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog116 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog117 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog118 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DC 79  N3 ? ? I DA 67  J DC 225 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog129 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B DC 77  N3 ? ? I DC 69  J DC 223 1_555 ? ? ? ? ? ? 'DC-DC MISPAIR' ? ? 
hydrog135 hydrog ? ? A DC 69  N3 ? ? ? 1_555 B DG 78  N1 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B DG 78  O6 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog139 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog143 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog150 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 70  N1 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 70  N2 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 58  N1 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 58  O6 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B DA 55  N6 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DC 47  N3 ? ? I DA 99  J DC 193 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog206 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 45  O4 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog217 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N1 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog224 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 111 J DT 183 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog234 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B DG 33  N1 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B DG 33  N2 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog247 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 28  N6 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DG 121 N1 ? ? ? 1_555 B DC 26  N3 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DG 121 O6 ? ? ? 1_555 B DC 26  N4 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B DC 25  N3 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 25  O2 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DA 124 N6 ? ? ? 1_555 B DT 23  O4 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog261 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog262 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog265 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog270 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog271 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog276 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog282 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog283 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog285 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog292 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog293 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog294 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog295 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog296 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC 3   O2 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog297 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC 3   N4 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog298 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog299 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog300 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog301 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 80  ? VAL D 81  ? THR B 80   VAL B 81   
B 1 ILE C 118 ? ILE C 119 ? ILE A 518  ILE A 519  
B 2 ARG D 45  ? ILE D 46  ? ARG B 45   ILE B 46   
C 1 LEU D 97  ? TYR D 98  ? LEU B 97   TYR B 98   
C 2 THR I 101 ? ILE I 102 ? THR G 1101 ILE G 1102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 842  VAL C 843  
D 2 THR F 88  ? ILE F 89  ? THR D 1285 ILE D 1286 
E 1 ARG E 77  ? ILE E 78  ? ARG C 877  ILE C 878  
E 2 GLY F 53  ? ILE F 54  ? GLY D 1250 ILE D 1251 
F 1 VAL E 100 ? ILE E 102 ? VAL C 900  ILE C 902  
F 2 THR H 96  ? TYR H 98  ? THR F 296  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 80  ? VAL H 81  ? THR F 280  VAL F 281  
H 1 ILE G 118 ? ILE G 119 ? ILE E 718  ILE E 719  
H 2 ARG H 45  ? ILE H 46  ? ARG F 245  ILE F 246  
I 1 ARG I 42  ? VAL I 43  ? ARG G 1042 VAL G 1043 
I 2 THR J 88  ? ILE J 89  ? THR H 1485 ILE H 1486 
J 1 ARG I 77  ? ILE I 78  ? ARG G 1077 ILE G 1078 
J 2 GLY J 53  ? ILE J 54  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 81  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O ARG D 45  ? O ARG B 45   
C 1 2 N TYR D 98  ? N TYR B 98   O THR I 101 ? O THR G 1101 
D 1 2 N ARG E 42  ? N ARG C 842  O ILE F 89  ? O ILE D 1286 
E 1 2 N ILE E 78  ? N ILE C 878  O GLY F 53  ? O GLY D 1250 
F 1 2 N THR E 101 ? N THR C 901  O THR H 96  ? O THR F 296  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 81  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O ARG H 45  ? O ARG F 245  
I 1 2 N ARG I 42  ? N ARG G 1042 O ILE J 89  ? O ILE H 1486 
J 1 2 N ILE I 78  ? N ILE G 1078 O GLY J 53  ? O GLY H 1450 
# 
_atom_sites.entry_id                    1P3M 
_atom_sites.fract_transf_matrix[1][1]   0.009455 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009121 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005509 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? 52.093  53.942 -92.293 1.00 129.84 ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? 51.536  54.812 -93.278 1.00 129.04 ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? 50.242  54.286 -93.856 1.00 128.01 ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? 50.443  52.908 -94.257 1.00 127.53 ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? 49.052  54.277 -92.892 1.00 127.43 ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? 47.839  54.639 -93.573 1.00 126.76 ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? 48.993  52.836 -92.417 1.00 127.28 ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? 49.491  52.063 -93.623 1.00 126.31 ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? 50.158  50.805 -93.280 1.00 119.59 ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? 51.437  50.637 -92.810 1.00 118.91 ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? 51.755  49.387 -92.574 1.00 118.22 ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? 50.609  48.682 -92.914 1.00 117.94 ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? 50.299  47.311 -92.886 1.00 117.01 ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? 51.150  46.366 -92.485 1.00 116.44 ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? 49.068  46.940 -93.291 1.00 116.65 ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? 48.213  47.887 -93.696 1.00 117.11 ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? 48.385  49.205 -93.766 1.00 117.68 ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? 49.618  49.543 -93.355 1.00 118.40 ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? 46.410  54.375 -92.869 1.00 140.99 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? 45.442  55.391 -93.350 1.00 132.80 ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? 46.605  54.184 -91.409 1.00 132.42 ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? 45.964  52.978 -93.471 1.00 138.89 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? 45.423  52.897 -94.781 1.00 135.67 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? 44.185  52.040 -94.755 1.00 133.69 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? 44.575  50.702 -94.365 1.00 132.94 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? 43.176  52.502 -93.708 1.00 132.42 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? 41.848  52.245 -94.163 1.00 131.61 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? 43.523  51.665 -92.492 1.00 132.10 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? 44.019  50.362 -93.101 1.00 131.35 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? 45.072  49.685 -92.308 1.00 121.04 ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? 45.057  48.306 -92.228 1.00 119.77 ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? 44.219  47.611 -92.784 1.00 119.42 ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? 46.068  47.767 -91.468 1.00 118.55 ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? 47.063  48.450 -90.796 1.00 117.99 ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? 47.904  47.831 -90.150 1.00 116.89 ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? 47.017  49.885 -90.923 1.00 118.62 ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? 48.052  50.704 -90.222 1.00 117.98 ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? 46.041  50.425 -91.664 1.00 119.71 ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? 40.632  52.274 -93.118 1.00 122.55 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? 39.371  52.574 -93.844 1.00 99.87  ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? 41.054  53.137 -91.983 1.00 100.45 ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? 40.554  50.768 -92.614 1.00 121.04 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? 40.494  49.707 -93.556 1.00 117.55 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? 40.291  48.388 -92.851 1.00 114.60 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? 41.481  48.012 -92.124 1.00 113.29 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? 39.155  48.355 -91.833 1.00 112.77 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? 38.548  47.068 -91.902 1.00 110.32 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? 39.871  48.526 -90.505 1.00 112.13 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? 41.141  47.745 -90.772 1.00 111.27 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? 42.304  48.093 -89.947 1.00 86.06  ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? 43.007  47.062 -89.325 1.00 84.10  ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? 42.592  45.898 -89.446 1.00 83.12  ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? 44.117  47.357 -88.606 1.00 82.91  ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? 44.519  48.625 -88.491 1.00 82.52  ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? 45.629  48.871 -87.782 1.00 81.55  ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? 43.804  49.698 -89.098 1.00 83.05  ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? 42.711  49.390 -89.808 1.00 84.70  ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? 37.264  46.748 -91.007 1.00 117.24 ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? 36.150  46.307 -91.896 1.00 103.33 ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? 37.077  47.901 -90.077 1.00 102.45 ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? 37.718  45.487 -90.160 1.00 112.94 ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? 38.087  44.282 -90.812 1.00 106.18 ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? 38.311  43.201 -89.787 1.00 101.48 ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? 39.440  43.582 -88.969 1.00 99.52  ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? 37.139  43.011 -88.828 1.00 99.07  ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? 36.996  41.619 -88.536 1.00 96.06  ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? 37.530  43.842 -87.616 1.00 98.48  ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? 39.048  43.749 -87.613 1.00 98.04  ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? 39.757  44.926 -87.097 1.00 81.41  ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? 39.360  46.244 -87.131 1.00 80.74  ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? 40.251  47.077 -86.641 1.00 80.30  ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? 41.300  46.252 -86.249 1.00 79.81  ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? 42.557  46.522 -85.675 1.00 79.38  ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? 42.999  47.752 -85.403 1.00 79.02  ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? 43.360  45.470 -85.395 1.00 78.95  ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? 42.929  44.241 -85.683 1.00 78.82  ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? 41.782  43.859 -86.233 1.00 78.47  ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? 41.001  44.924 -86.501 1.00 80.28  ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? 36.141  41.151 -87.263 1.00 102.74 ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? 35.562  39.821 -87.550 1.00 82.03  ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? 35.259  42.256 -86.820 1.00 81.87  ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? 37.261  40.965 -86.161 1.00 101.94 ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? 38.422  40.201 -86.458 1.00 99.12  ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? 39.126  39.816 -85.181 1.00 97.48  ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? 39.912  40.919 -84.687 1.00 94.30  ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? 38.174  39.437 -84.055 1.00 97.36  ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? 38.769  38.373 -83.318 1.00 99.03  ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? 38.047  40.724 -83.258 1.00 94.02  ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? 39.414  41.365 -83.441 1.00 93.32  ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? 39.418  42.820 -83.488 1.00 70.51  ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? 38.485  43.665 -84.033 1.00 70.89  ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? 38.790  44.935 -83.913 1.00 69.26  ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? 40.007  44.921 -83.252 1.00 68.10  ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? 40.850  45.943 -82.829 1.00 66.92  ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? 40.585  47.232 -83.010 1.00 65.47  ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? 41.992  45.596 -82.200 1.00 67.78  ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? 42.252  44.298 -82.018 1.00 67.67  ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? 41.532  43.240 -82.369 1.00 68.25  ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? 40.406  43.627 -82.988 1.00 69.32  ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? 38.043  37.808 -82.013 1.00 99.10  ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? 37.900  36.329 -82.149 1.00 80.07  ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? 36.845  38.668 -81.772 1.00 79.67  ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? 39.106  38.134 -80.884 1.00 98.12  ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? 39.785  39.372 -80.925 1.00 94.74  ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? 40.683  39.519 -79.729 1.00 90.82  ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? 41.145  40.886 -79.750 1.00 90.39  ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? 39.946  39.347 -78.407 1.00 90.08  ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? 40.849  38.838 -77.424 1.00 90.96  ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? 39.480  40.752 -78.090 1.00 88.34  ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? 40.589  41.609 -78.668 1.00 88.20  ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? 40.111  42.903 -79.181 1.00 66.18  ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? 40.748  44.035 -78.737 1.00 64.13  ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? 41.720  43.999 -78.001 1.00 64.22  ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? 40.208  45.214 -79.182 1.00 64.16  ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? 39.128  45.367 -80.012 1.00 66.00  ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? 38.746  46.490 -80.304 1.00 65.95  ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? 38.523  44.136 -80.471 1.00 66.32  ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? 37.345  44.207 -81.384 1.00 67.65  ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? 39.043  42.978 -80.046 1.00 66.57  ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? 40.388  38.731 -75.891 1.00 69.38  ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? 40.572  37.328 -75.450 1.00 77.05  ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? 39.057  39.368 -75.748 1.00 79.81  ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? 41.437  39.658 -75.139 1.00 68.12  ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? 42.772  39.747 -75.606 1.00 67.89  ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? 43.436  40.973 -75.034 1.00 67.49  ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? 42.854  42.159 -75.621 1.00 66.79  ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? 43.239  41.109 -73.531 1.00 67.74  ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? 44.413  41.655 -72.926 1.00 70.97  ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? 42.078  42.077 -73.423 1.00 66.21  ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? 42.311  42.988 -74.607 1.00 66.03  ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? 41.091  43.595 -75.133 1.00 72.58  ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? 39.905  42.968 -75.442 1.00 72.05  ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? 38.993  43.775 -75.936 1.00 72.08  ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? 39.616  45.020 -75.943 1.00 69.47  ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? 39.190  46.296 -76.372 1.00 68.78  ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? 37.990  46.542 -76.898 1.00 66.71  ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? 40.060  47.323 -76.246 1.00 66.66  ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? 41.272  47.077 -75.734 1.00 68.67  ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? 41.792  45.926 -75.306 1.00 67.78  ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? 40.905  44.925 -75.439 1.00 69.47  ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? 44.505  41.751 -71.329 1.00 105.19 ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? 45.800  41.191 -70.870 1.00 70.33  ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? 43.244  41.179 -70.800 1.00 67.69  ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? 44.525  43.322 -71.098 1.00 107.16 ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? 45.454  44.127 -71.811 1.00 109.51 ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? 45.242  45.584 -71.481 1.00 111.06 ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? 44.070  46.083 -72.174 1.00 110.85 ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? 45.015  45.860 -69.994 1.00 112.41 ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? 45.768  47.008 -69.579 1.00 115.03 ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? 43.518  46.108 -69.906 1.00 110.35 ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? 43.212  46.736 -71.254 1.00 108.87 ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? 41.823  46.548 -71.713 1.00 68.85  ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? 41.081  47.660 -72.101 1.00 67.34  ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? 41.518  48.803 -72.099 1.00 66.28  ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? 39.794  47.379 -72.498 1.00 65.12  ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? 39.190  46.136 -72.553 1.00 66.37  ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? 38.021  46.036 -72.935 1.00 63.72  ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? 40.028  45.024 -72.138 1.00 66.15  ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? 39.460  43.639 -72.165 1.00 66.68  ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? 41.283  45.286 -71.747 1.00 66.99  ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? 45.370  47.779 -68.227 1.00 98.52  ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? 46.554  48.562 -67.789 1.00 76.99  ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? 44.736  46.816 -67.293 1.00 75.82  ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? 44.273  48.813 -68.725 1.00 99.17  ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? 44.583  49.719 -69.778 1.00 99.74  ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? 43.747  50.968 -69.651 1.00 99.90  ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? 42.410  50.721 -70.138 1.00 98.36  ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? 43.602  51.454 -68.215 1.00 100.97 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? 43.682  52.880 -68.180 1.00 104.32 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? 42.243  50.920 -67.792 1.00 98.22  ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? 41.458  50.833 -69.097 1.00 95.86  ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? 40.576  49.660 -69.198 1.00 70.33  ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? 39.309  49.811 -69.767 1.00 68.33  ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? 38.960  50.931 -70.165 1.00 69.53  ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? 38.496  48.733 -69.866 1.00 66.40  ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? 38.904  47.545 -69.411 1.00 65.92  ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? 38.062  46.516 -69.504 1.00 64.31  ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? 40.191  47.362 -68.832 1.00 65.44  ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? 40.988  48.436 -68.748 1.00 68.44  ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? 43.681  53.641 -66.770 1.00 101.33 ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? 44.294  54.981 -66.974 1.00 96.75  ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? 44.239  52.717 -65.745 1.00 95.66  ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? 42.132  53.827 -66.477 1.00 100.86 ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? 41.282  54.423 -67.450 1.00 101.54 ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? 39.894  54.561 -66.884 1.00 102.22 ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? 39.041  53.467 -67.287 1.00 100.97 ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? 39.907  54.556 -65.359 1.00 102.99 ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? 39.016  55.552 -64.877 1.00 106.14 ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? 39.392  53.172 -65.013 1.00 101.43 ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? 38.411  52.939 -66.139 1.00 100.07 ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? 38.073  51.534 -66.400 1.00 93.66  ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? 36.871  51.242 -67.078 1.00 93.83  ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? 36.147  52.176 -67.454 1.00 95.19  ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? 36.534  49.953 -67.302 1.00 93.25  ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? 37.338  48.972 -66.883 1.00 92.64  ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? 36.957  47.710 -67.114 1.00 92.37  ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? 38.572  49.241 -66.202 1.00 92.38  ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? 38.896  50.524 -65.987 1.00 92.76  ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? 39.569  56.732 -63.937 1.00 100.89 ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? 40.632  57.490 -64.648 1.00 94.08  ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? 39.860  56.141 -62.606 1.00 94.84  ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? 38.296  57.673 -63.814 1.00 98.51  ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? 37.525  58.000 -64.967 1.00 95.97  ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? 36.074  57.656 -64.732 1.00 95.34  ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? 35.794  56.273 -65.077 1.00 94.20  ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? 35.605  57.847 -63.285 1.00 95.10  ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? 34.338  58.515 -63.269 1.00 94.96  ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? 35.463  56.421 -62.777 1.00 95.17  ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? 35.027  55.692 -64.034 1.00 94.88  ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? 35.253  54.243 -64.036 1.00 88.84  ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? 36.418  53.566 -63.772 1.00 88.83  ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? 36.307  52.261 -63.872 1.00 88.62  ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? 34.975  52.062 -64.217 1.00 88.14  ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? 34.220  50.895 -64.469 1.00 87.94  ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? 34.716  49.662 -64.396 1.00 87.37  ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? 32.919  51.043 -64.797 1.00 87.67  ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? 32.412  52.278 -64.854 1.00 87.34  ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? 33.012  53.450 -64.631 1.00 87.21  ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? 34.311  53.272 -64.317 1.00 88.06  ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? 33.607  58.820 -61.872 1.00 126.86 ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? 33.216  60.251 -61.913 1.00 83.16  ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? 34.459  58.321 -60.763 1.00 82.00  ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? 32.285  57.928 -61.935 1.00 128.73 ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? 31.416  57.975 -63.070 1.00 129.34 ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? 30.357  56.902 -62.965 1.00 130.50 ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? 30.953  55.586 -63.125 1.00 130.38 ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? 29.625  56.867 -61.621 1.00 130.92 ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? 28.240  56.553 -61.812 1.00 132.28 ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? 30.300  55.721 -60.892 1.00 130.59 ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? 30.552  54.762 -62.038 1.00 129.65 ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? 31.604  53.760 -61.774 1.00 80.47  ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? 31.267  52.403 -61.841 1.00 78.46  ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? 30.111  52.092 -62.179 1.00 79.16  ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? 32.205  51.470 -61.540 1.00 76.32  ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? 33.436  51.852 -61.189 1.00 76.41  ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? 34.318  50.907 -60.861 1.00 73.96  ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? 33.815  53.224 -61.146 1.00 77.31  ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? 32.877  54.137 -61.444 1.00 79.59  ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? 27.348  56.087 -60.555 1.00 131.19 ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? 25.911  56.206 -60.909 1.00 91.09  ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? 27.869  56.795 -59.359 1.00 90.22  ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? 27.648  54.527 -60.421 1.00 131.81 ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? 26.857  53.574 -61.129 1.00 134.74 ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? 26.459  52.444 -60.209 1.00 136.93 ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? 27.610  51.609 -59.937 1.00 137.27 ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? 25.941  52.906 -58.848 1.00 138.87 ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? 24.862  52.073 -58.420 1.00 142.90 ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? 27.141  52.737 -57.934 1.00 137.94 ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? 27.846  51.533 -58.537 1.00 136.86 ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? 29.306  51.503 -58.325 1.00 95.27  ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? 29.975  50.276 -58.389 1.00 94.97  ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? 29.323  49.250 -58.611 1.00 95.42  ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? 31.314  50.241 -58.210 1.00 93.86  ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? 31.983  51.370 -57.975 1.00 93.65  ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? 33.299  51.292 -57.814 1.00 92.80  ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? 31.329  52.630 -57.897 1.00 94.17  ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? 30.002  52.651 -58.075 1.00 94.74  ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? 24.092  52.410 -57.050 1.00 200.95 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? 22.647  52.135 -57.268 1.00 99.21  ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? 24.523  53.757 -56.567 1.00 98.26  ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? 24.623  51.292 -56.049 1.00 201.47 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? 24.369  49.913 -56.312 1.00 201.47 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? 24.907  49.054 -55.192 1.00 201.47 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? 26.353  49.131 -55.175 1.00 201.47 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? 24.442  49.453 -53.790 1.00 201.47 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? 24.245  48.273 -53.000 1.00 201.47 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? 25.621  50.245 -53.250 1.00 201.47 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? 26.797  49.518 -53.884 1.00 201.47 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? 28.034  50.312 -54.045 1.00 103.73 ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? 29.201  49.633 -54.320 1.00 103.32 ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? 29.255  48.418 -54.425 1.00 103.42 ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? 30.309  50.432 -54.471 1.00 102.44 ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? 30.366  51.811 -54.378 1.00 102.17 ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? 31.435  52.394 -54.559 1.00 102.11 ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? 29.105  52.460 -54.072 1.00 102.09 ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? 29.067  53.951 -53.931 1.00 101.63 ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? 28.018  51.687 -53.926 1.00 102.56 ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? 22.880  48.076 -52.172 1.00 201.24 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? 21.760  48.263 -53.130 1.00 121.17 ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? 22.941  48.909 -50.939 1.00 120.70 ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? 22.923  46.537 -51.752 1.00 200.51 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? 22.943  45.508 -52.745 1.00 200.04 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? 24.097  44.562 -52.500 1.00 199.74 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? 25.345  45.294 -52.600 1.00 200.09 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? 24.120  43.894 -51.124 1.00 199.30 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? 24.638  42.562 -51.245 1.00 198.43 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? 25.087  44.758 -50.337 1.00 199.52 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? 26.100  45.121 -51.406 1.00 199.53 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? 26.869  46.343 -51.160 1.00 119.20 ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? 26.380  47.604 -50.899 1.00 118.94 ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? 27.322  48.498 -50.735 1.00 118.97 ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? 28.504  47.788 -50.902 1.00 118.27 ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? 29.849  48.226 -50.856 1.00 117.70 ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? 30.275  49.372 -50.684 1.00 117.21 ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? 30.739  47.171 -51.053 1.00 117.39 ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? 30.380  45.862 -51.286 1.00 117.68 ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? 31.381  44.979 -51.444 1.00 117.44 ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? 29.126  45.445 -51.356 1.00 118.25 ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? 28.246  46.454 -51.153 1.00 118.69 ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? 24.888  41.678 -49.924 1.00 148.89 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? 25.020  40.254 -50.354 1.00 111.65 ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? 23.853  42.060 -48.918 1.00 111.36 ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? 26.311  42.165 -49.385 1.00 146.96 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? 27.524  41.597 -49.886 1.00 142.42 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? 28.652  41.807 -48.901 1.00 139.18 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? 29.050  43.198 -48.854 1.00 138.11 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? 28.322  41.421 -47.461 1.00 137.48 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? 29.469  40.848 -46.852 1.00 135.03 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? 28.028  42.752 -46.798 1.00 137.49 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? 29.000  43.668 -47.513 1.00 137.36 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? 28.582  45.075 -47.543 1.00 99.31  ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? 29.489  46.054 -47.158 1.00 99.01  ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? 30.607  45.706 -46.782 1.00 99.69  ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? 29.123  47.355 -47.205 1.00 97.99  ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? 27.897  47.687 -47.619 1.00 97.37  ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? 27.579  48.983 -47.681 1.00 96.08  ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? 26.944  46.705 -47.997 1.00 97.35  ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? 27.325  45.422 -47.948 1.00 98.41  ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? 29.289  39.667 -45.789 1.00 102.10 ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? 28.447  38.642 -46.449 1.00 106.90 ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? 28.863  40.245 -44.482 1.00 106.39 ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? 30.759  39.074 -45.654 1.00 100.63 ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? 31.636  39.056 -46.779 1.00 96.68  ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? 32.860  39.899 -46.501 1.00 94.12  ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? 32.461  41.271 -46.255 1.00 92.86  ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? 33.676  39.482 -45.278 1.00 92.38  ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? 35.065  39.640 -45.551 1.00 91.27  ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? 33.239  40.454 -44.196 1.00 91.79  ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? 32.932  41.710 -44.989 1.00 91.50  ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? 31.894  42.559 -44.404 1.00 94.73  ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? 30.753  42.183 -43.738 1.00 94.38  ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? 30.011  43.190 -43.352 1.00 94.39  ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? 30.714  44.306 -43.787 1.00 95.18  ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? 30.459  45.685 -43.690 1.00 95.34  ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? 29.380  46.204 -43.102 1.00 95.12  ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? 31.363  46.529 -44.226 1.00 95.47  ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? 32.447  46.015 -44.814 1.00 96.08  ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? 32.797  44.744 -44.969 1.00 95.68  ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? 31.877  43.931 -44.429 1.00 95.21  ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? 36.140  38.925 -44.605 1.00 105.02 ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? 36.977  38.064 -45.473 1.00 108.85 ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? 35.443  38.344 -43.429 1.00 109.18 ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? 37.024  40.133 -44.088 1.00 99.93  ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? 37.375  41.172 -44.974 1.00 91.97  ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? 37.405  42.490 -44.244 1.00 87.90  ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? 36.073  42.888 -43.832 1.00 88.05  ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? 38.274  42.532 -42.983 1.00 84.99  ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? 39.082  43.707 -43.045 1.00 80.04  ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? 37.259  42.661 -41.860 1.00 85.71  ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? 36.177  43.463 -42.546 1.00 87.62  ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? 34.865  43.439 -41.910 1.00 92.99  ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? 34.226  42.356 -41.358 1.00 93.88  ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? 33.075  42.660 -40.821 1.00 94.04  ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? 32.942  44.022 -41.041 1.00 94.65  ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? 31.902  44.909 -40.678 1.00 95.52  ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? 30.860  44.663 -40.064 1.00 97.06  ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? 32.165  46.205 -41.100 1.00 95.47  ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? 33.285  46.598 -41.779 1.00 94.86  ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? 33.344  47.890 -42.099 1.00 94.78  ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? 34.269  45.784 -42.119 1.00 94.44  ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? 34.032  44.517 -41.721 1.00 93.89  ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? 40.067  44.072 -41.837 1.00 71.34  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? 41.434  44.169 -42.433 1.00 71.18  ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? 39.808  43.141 -40.706 1.00 71.19  ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? 39.581  45.526 -41.408 1.00 73.22  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? 39.293  46.501 -42.405 1.00 79.78  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? 38.760  47.764 -41.776 1.00 84.68  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? 37.416  47.540 -41.300 1.00 84.49  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? 39.561  48.260 -40.576 1.00 87.55  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? 39.665  49.685 -40.613 1.00 93.19  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? 38.723  47.819 -39.391 1.00 86.53  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? 37.320  47.932 -39.945 1.00 86.97  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? 36.332  47.069 -39.308 1.00 88.69  ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? 36.452  45.749 -38.968 1.00 89.67  ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? 35.371  45.243 -38.426 1.00 90.28  ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? 34.481  46.307 -38.406 1.00 91.59  ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? 33.149  46.427 -37.951 1.00 93.07  ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? 32.453  45.419 -37.423 1.00 92.80  ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? 32.550  47.634 -38.064 1.00 92.84  ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? 33.247  48.644 -38.606 1.00 93.42  ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? 34.498  48.653 -39.074 1.00 92.19  ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? 35.064  47.440 -38.941 1.00 90.75  ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? 40.676  50.437 -39.609 1.00 101.19 ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? 41.603  51.295 -40.409 1.00 81.03  ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? 41.230  49.415 -38.718 1.00 82.05  ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? 39.711  51.356 -38.726 1.00 105.03 ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? 38.798  52.264 -39.408 1.00 109.63 ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? 37.551  52.589 -38.615 1.00 113.75 ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? 36.811  51.412 -38.239 1.00 113.46 ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? 37.756  53.397 -37.323 1.00 116.18 ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? 36.696  54.340 -37.124 1.00 119.84 ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? 37.492  52.385 -36.187 1.00 115.18 ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? 36.456  51.490 -36.878 1.00 113.73 ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? 36.200  50.089 -36.445 1.00 92.54  ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? 34.898  49.810 -36.068 1.00 91.72  ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? 34.012  50.653 -36.078 1.00 92.15  ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? 34.669  48.496 -35.689 1.00 91.28  ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? 35.600  47.472 -35.616 1.00 91.17  ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? 35.254  46.359 -35.238 1.00 90.67  ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? 36.954  47.841 -35.996 1.00 91.05  ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? 38.052  46.839 -35.835 1.00 89.86  ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? 37.177  49.098 -36.429 1.00 91.91  ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? 36.630  55.185 -35.754 1.00 124.22 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? 36.104  56.589 -36.015 1.00 134.39 ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? 37.943  54.984 -35.113 1.00 134.47 ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? 35.465  54.314 -35.125 1.00 125.80 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? 34.171  54.733 -35.032 1.00 128.60 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? 33.777  54.380 -33.607 1.00 130.32 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? 33.420  52.987 -33.274 1.00 130.44 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? 34.564  54.819 -32.380 1.00 131.64 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? 33.443  55.042 -31.516 1.00 133.65 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? 35.391  53.579 -32.173 1.00 131.22 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? 34.241  52.570 -32.168 1.00 130.30 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? 34.658  51.205 -32.399 1.00 139.64 ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? 33.837  50.150 -32.075 1.00 138.94 ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? 32.734  50.282 -31.582 1.00 138.25 ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? 34.371  48.920 -32.340 1.00 138.57 ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? 35.621  48.650 -32.853 1.00 138.16 ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? 35.964  47.482 -33.026 1.00 137.68 ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? 36.435  49.820 -33.147 1.00 137.98 ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? 37.834  49.645 -33.648 1.00 137.42 ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? 35.901  51.015 -32.932 1.00 138.57 ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? 33.424  56.245 -30.465 1.00 143.79 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? 31.927  56.214 -30.264 1.00 119.48 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? 34.091  57.397 -30.917 1.00 119.18 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? 34.162  55.656 -29.250 1.00 144.67 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? 33.461  55.428 -28.041 1.00 146.75 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? 32.475  54.270 -28.083 1.00 147.92 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? 32.868  53.000 -28.696 1.00 148.07 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? 32.292  53.949 -26.613 1.00 149.04 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? 30.939  53.989 -26.303 1.00 151.15 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? 32.957  52.597 -26.414 1.00 148.52 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? 32.719  51.935 -27.744 1.00 148.10 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? 33.704  50.878 -28.041 1.00 124.05 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? 33.263  49.554 -28.159 1.00 123.83 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? 32.058  49.309 -28.007 1.00 123.81 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? 34.160  48.578 -28.430 1.00 123.44 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? 35.451  48.883 -28.572 1.00 123.13 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? 36.303  47.883 -28.827 1.00 122.68 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? 35.928  50.225 -28.455 1.00 122.90 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? 35.027  51.180 -28.192 1.00 123.32 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? 30.528  54.125 -24.786 1.00 193.19 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? 29.183  54.728 -24.734 1.00 114.19 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? 31.660  54.753 -24.054 1.00 113.34 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? 30.439  52.610 -24.346 1.00 194.93 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? 29.200  52.049 -23.951 1.00 197.81 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? 29.386  51.296 -22.658 1.00 199.78 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? 30.377  50.267 -22.895 1.00 200.34 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? 29.948  52.166 -21.536 1.00 201.12 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? 29.435  51.732 -20.271 1.00 201.30 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? 31.447  51.960 -21.650 1.00 201.22 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? 31.561  50.527 -22.152 1.00 201.05 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? 32.716  50.293 -23.046 1.00 121.89 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? 32.849  49.058 -23.650 1.00 122.06 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? 32.069  48.137 -23.472 1.00 122.02 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? 33.939  48.941 -24.474 1.00 122.32 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? 34.893  49.907 -24.743 1.00 122.17 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? 35.817  49.657 -25.518 1.00 122.24 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? 34.700  51.171 -24.060 1.00 121.80 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? 35.691  52.271 -24.267 1.00 121.27 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? 33.635  51.299 -23.263 1.00 121.53 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? 30.331  51.893 -18.949 1.00 161.06 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? 29.457  51.691 -17.765 1.00 200.53 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? 31.117  53.150 -19.078 1.00 199.73 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? 31.327  50.657 -19.042 1.00 161.26 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? 30.821  49.333 -19.189 1.00 161.83 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? 31.862  48.333 -18.751 1.00 162.39 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? 32.884  48.188 -19.769 1.00 162.46 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? 32.586  48.754 -17.474 1.00 162.71 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? 32.805  47.626 -16.633 1.00 162.74 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? 33.912  49.292 -17.980 1.00 162.71 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? 34.162  48.409 -19.190 1.00 162.43 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? 35.042  48.993 -20.208 1.00 201.30 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? 35.320  50.323 -20.422 1.00 201.30 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? 36.181  50.536 -21.389 1.00 200.96 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? 36.487  49.262 -21.849 1.00 200.76 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? 37.344  48.806 -22.864 1.00 200.41 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? 38.087  49.616 -23.624 1.00 199.85 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? 37.416  47.473 -23.074 1.00 200.09 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? 36.676  46.664 -22.307 1.00 200.08 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? 35.836  46.971 -21.320 1.00 200.43 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? 35.786  48.303 -21.138 1.00 200.90 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? 32.927  47.834 -15.049 1.00 132.10 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? 31.552  48.002 -14.513 1.00 132.83 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? 33.955  48.879 -14.789 1.00 133.10 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? 33.486  46.437 -14.542 1.00 131.04 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? 33.090  45.229 -15.178 1.00 129.23 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? 34.309  44.398 -15.494 1.00 127.60 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? 35.010  44.945 -16.641 1.00 127.30 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? 35.327  44.359 -14.354 1.00 126.56 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? 35.863  43.043 -14.232 1.00 125.22 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? 36.404  45.324 -14.812 1.00 126.50 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? 36.379  45.115 -16.312 1.00 126.64 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? 36.919  46.240 -17.097 1.00 127.11 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? 37.501  45.974 -18.345 1.00 126.59 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? 37.506  44.809 -18.770 1.00 126.05 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? 38.042  46.994 -19.053 1.00 126.60 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? 38.014  48.236 -18.563 1.00 126.91 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? 38.581  49.207 -19.285 1.00 126.63 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? 37.408  48.538 -17.307 1.00 126.99 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? 36.876  47.520 -16.616 1.00 127.05 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? 37.094  42.769 -13.237 1.00 129.41 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? 36.712  41.676 -12.308 1.00 140.21 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? 37.551  44.072 -12.688 1.00 139.59 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? 38.227  42.221 -14.212 1.00 127.50 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? 38.870  43.094 -15.129 1.00 124.60 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? 40.359  43.044 -14.908 1.00 121.87 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? 40.990  44.090 -15.677 1.00 121.51 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? 40.731  43.303 -13.454 1.00 120.20 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? 41.823  42.458 -13.084 1.00 117.34 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? 41.096  44.775 -13.434 1.00 120.55 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? 41.644  45.019 -14.829 1.00 120.90 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? 41.370  46.363 -15.358 1.00 130.84 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? 41.270  46.527 -16.736 1.00 130.26 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? 41.437  45.541 -17.467 1.00 130.55 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? 40.995  47.752 -17.241 1.00 129.31 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? 40.830  48.789 -16.421 1.00 128.42 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? 40.558  49.979 -16.966 1.00 126.99 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? 40.938  48.652 -15.008 1.00 129.05 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? 41.208  47.433 -14.524 1.00 130.06 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? 41.522  41.020 -12.419 1.00 114.35 ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? 40.360  40.426 -13.138 1.00 106.90 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? 41.472  41.173 -10.941 1.00 106.85 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? 42.808  40.156 -12.782 1.00 112.21 ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? 42.937  39.555 -14.066 1.00 107.38 ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? 44.354  39.697 -14.562 1.00 104.48 ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? 44.605  41.092 -14.849 1.00 104.17 ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? 45.413  39.269 -13.548 1.00 103.33 ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? 46.442  38.514 -14.206 1.00 102.57 ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? 45.893  40.580 -12.951 1.00 103.64 ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? 45.696  41.575 -14.080 1.00 104.91 ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? 45.371  42.933 -13.628 1.00 98.38  ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? 45.308  43.388 -12.331 1.00 98.81  ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? 45.012  44.662 -12.231 1.00 99.50  ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? 44.863  45.077 -13.548 1.00 99.44  ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? 44.549  46.329 -14.122 1.00 99.91  ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? 44.339  47.441 -13.419 1.00 99.84  ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? 44.468  46.399 -15.466 1.00 100.54 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? 44.701  45.293 -16.180 1.00 100.57 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? 45.014  44.067 -15.762 1.00 100.19 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? 45.077  44.023 -14.419 1.00 99.52  ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? 47.983  38.684 -13.772 1.00 127.16 ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? 48.741  37.542 -14.354 1.00 96.05  ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? 48.088  38.970 -12.316 1.00 96.00  ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? 48.413  39.970 -14.594 1.00 125.93 ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? 47.969  40.119 -15.935 1.00 122.77 ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? 48.691  41.265 -16.591 1.00 120.32 ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? 48.243  42.507 -16.001 1.00 118.82 ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? 50.205  41.220 -16.412 1.00 118.83 ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? 50.818  41.628 -17.635 1.00 117.35 ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? 50.453  42.200 -15.276 1.00 118.37 ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? 49.342  43.224 -15.469 1.00 118.37 ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? 48.879  43.897 -14.254 1.00 86.83  ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? 48.857  43.404 -12.975 1.00 86.52  ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? 48.362  44.242 -12.093 1.00 85.87  ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? 48.041  45.367 -12.842 1.00 85.78  ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? 47.475  46.616 -12.496 1.00 85.66  ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? 47.124  46.961 -11.257 1.00 85.18  ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? 47.286  47.511 -13.483 1.00 86.01  ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? 47.643  47.177 -14.724 1.00 86.56  ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? 48.182  46.047 -15.175 1.00 86.78  ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? 48.358  45.170 -14.173 1.00 86.25  ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? 52.411  41.574 -17.790 1.00 82.48  ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? 52.757  40.833 -19.025 1.00 92.39  ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? 52.986  41.163 -16.483 1.00 92.57  ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? 52.788  43.092 -18.022 1.00 79.46  ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? 52.047  44.091 -17.353 1.00 74.81  ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? 52.104  45.385 -18.115 1.00 71.47  ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? 51.359  46.344 -17.345 1.00 70.42  ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? 53.515  45.940 -18.197 1.00 69.96  ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? 53.620  46.803 -19.326 1.00 68.69  ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? 53.666  46.680 -16.884 1.00 70.42  ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? 52.241  47.130 -16.558 1.00 70.75  ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? 51.864  46.928 -15.158 1.00 79.68  ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? 52.173  45.869 -14.340 1.00 78.86  ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? 51.675  45.970 -13.134 1.00 78.23  ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? 50.994  47.178 -13.156 1.00 79.52  ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? 50.253  47.862 -12.182 1.00 79.63  ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? 50.060  47.410 -10.944 1.00 80.45  ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? 49.704  49.046 -12.529 1.00 80.23  ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? 49.894  49.504 -13.770 1.00 80.01  ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? 50.572  48.955 -14.772 1.00 80.24  ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? 51.103  47.779 -14.395 1.00 79.29  ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? 54.974  47.610 -19.576 1.00 82.39  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? 55.007  47.979 -21.016 1.00 84.27  ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? 56.090  46.824 -18.970 1.00 83.63  ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? 54.787  48.916 -18.704 1.00 77.37  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? 53.663  49.749 -18.899 1.00 74.77  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? 53.734  50.911 -17.944 1.00 72.70  ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? 53.261  50.498 -16.634 1.00 72.86  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? 55.165  51.419 -17.752 1.00 70.96  ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? 55.203  52.843 -17.800 1.00 68.27  ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? 55.554  50.898 -16.379 1.00 72.70  ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? 54.221  50.847 -15.650 1.00 72.95  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? 54.158  49.860 -14.566 1.00 76.44  ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? 54.804  48.650 -14.491 1.00 77.76  ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? 54.600  48.008 -13.365 1.00 77.29  ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? 53.753  48.845 -12.651 1.00 76.18  ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? 53.176  48.740 -11.372 1.00 74.93  ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? 53.399  47.723 -10.541 1.00 73.51  ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? 52.361  49.735 -10.965 1.00 75.00  ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? 52.159  50.772 -11.782 1.00 76.16  ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? 52.655  50.997 -13.000 1.00 76.77  ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? 53.456  49.981 -13.383 1.00 76.87  ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? 56.539  53.618 -17.365 1.00 67.56  ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? 56.724  54.783 -18.268 1.00 72.15  ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? 57.635  52.627 -17.206 1.00 70.86  ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? 56.116  54.199 -15.954 1.00 72.57  ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? 54.818  54.779 -15.789 1.00 77.11  ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? 54.657  55.313 -14.386 1.00 80.56  ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? 54.398  54.231 -13.463 1.00 80.76  ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? 55.914  56.014 -13.885 1.00 82.44  ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? 55.578  57.185 -13.157 1.00 84.92  ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? 56.569  54.978 -12.995 1.00 82.53  ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? 55.382  54.216 -12.448 1.00 82.77  ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? 55.681  52.825 -12.151 1.00 88.25  ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? 56.256  51.902 -12.989 1.00 89.46  ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? 56.404  50.728 -12.436 1.00 89.33  ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? 55.894  50.890 -11.157 1.00 89.98  ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? 55.781  49.964 -10.094 1.00 90.03  ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? 56.128  48.775 -10.070 1.00 88.08  ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? 55.190  50.545 -8.974  1.00 91.13  ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? 54.764  51.854 -8.892  1.00 91.85  ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? 54.206  52.231 -7.735  1.00 92.75  ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? 54.874  52.726 -9.875  1.00 90.84  ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? 55.441  52.180 -10.970 1.00 89.90  ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? 56.748  58.126 -12.605 1.00 82.88  ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? 56.352  59.525 -12.888 1.00 89.91  ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? 58.047  57.622 -13.108 1.00 89.66  ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? 56.669  57.875 -11.033 1.00 89.52  ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? 55.448  58.111 -10.325 1.00 94.92  ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? 55.656  57.942 -8.838  1.00 99.17  ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? 55.697  56.537 -8.503  1.00 99.56  ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? 56.954  58.548 -8.303  1.00 101.42 ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? 56.738  59.198 -7.055  1.00 106.17 ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? 57.853  57.344 -8.099  1.00 100.14 ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? 56.857  56.263 -7.736  1.00 99.58  ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? 57.304  54.901 -8.065  1.00 105.35 ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? 57.236  53.945 -7.081  1.00 105.43 ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? 56.831  54.176 -5.953  1.00 106.04 ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? 57.663  52.701 -7.464  1.00 105.37 ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? 58.146  52.329 -8.702  1.00 105.13 ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? 58.482  51.167 -8.900  1.00 105.05 ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? 58.204  53.386 -9.683  1.00 105.27 ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? 58.741  53.083 -11.045 1.00 104.79 ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? 57.778  54.602 -9.324  1.00 105.43 ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? 57.968  59.915 -6.318  1.00 163.65 ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? 57.408  60.976 -5.456  1.00 92.60  ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? 58.980  60.272 -7.346  1.00 91.33  ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? 58.553  58.762 -5.387  1.00 165.84 ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? 57.818  58.308 -4.250  1.00 168.29 ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? 58.710  57.516 -3.323  1.00 170.16 ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? 58.877  56.167 -3.827  1.00 169.62 ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? 60.118  58.090 -3.140  1.00 171.83 ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? 60.523  58.038 -1.763  1.00 175.51 ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? 60.984  57.176 -3.989  1.00 170.55 ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? 60.258  55.844 -3.884  1.00 169.27 ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? 60.470  54.942 -5.017  1.00 96.30  ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? 60.668  55.296 -6.330  1.00 96.19  ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? 60.832  54.270 -7.118  1.00 96.14  ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? 60.736  53.170 -6.278  1.00 96.30  ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? 60.828  51.781 -6.565  1.00 96.38  ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? 61.018  51.232 -7.651  1.00 96.77  ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? 60.672  51.008 -5.421  1.00 96.97  ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? 60.458  51.502 -4.162  1.00 96.70  ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? 60.336  50.592 -3.193  1.00 96.82  ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? 60.370  52.793 -3.877  1.00 96.28  ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? 60.515  53.565 -4.977  1.00 96.27  ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? 61.813  58.875 -1.275  1.00 171.95 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? 61.789  58.973 0.206   1.00 131.51 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? 61.898  60.115 -2.089  1.00 131.28 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? 63.036  57.944 -1.684  1.00 172.47 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? 64.064  57.632 -0.751  1.00 172.41 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? 63.649  56.459 0.106   1.00 172.47 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? 63.010  55.451 -0.714  1.00 171.78 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? 64.828  55.769 0.785   1.00 172.93 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? 64.497  55.312 2.095   1.00 173.62 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? 65.107  54.587 -0.120  1.00 172.62 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? 63.731  54.228 -0.648  1.00 171.91 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? 63.761  53.640 -2.005  1.00 129.94 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? 63.474  52.297 -2.154  1.00 129.55 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? 63.195  51.561 -1.220  1.00 129.45 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? 63.530  51.842 -3.445  1.00 128.99 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? 63.837  52.572 -4.575  1.00 128.96 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? 63.847  52.024 -5.669  1.00 128.89 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? 64.129  53.968 -4.350  1.00 129.16 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? 64.475  54.836 -5.520  1.00 128.86 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? 64.076  54.425 -3.093  1.00 129.41 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? 65.669  54.778 3.051   1.00 139.54 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? 65.109  54.421 4.376   1.00 84.27  ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? 66.785  55.750 2.967   1.00 84.00  ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? 66.127  53.424 2.357   1.00 139.47 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? 65.480  52.195 2.667   1.00 138.59 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? 66.365  51.034 2.280   1.00 138.37 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? 66.343  50.855 0.841   1.00 138.08 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? 67.835  51.212 2.668   1.00 138.04 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? 68.372  49.981 3.160   1.00 137.56 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? 68.501  51.618 1.365   1.00 137.91 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? 67.668  50.891 0.321   1.00 137.62 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? 67.630  51.560 -0.985  1.00 80.88  ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? 67.460  52.901 -1.239  1.00 80.83  ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? 67.472  53.206 -2.514  1.00 80.05  ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? 67.665  51.986 -3.142  1.00 80.00  ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? 67.772  51.638 -4.484  1.00 79.90  ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? 67.695  52.523 -5.477  1.00 80.27  ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? 67.964  50.339 -4.783  1.00 79.48  ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? 68.044  49.459 -3.787  1.00 79.50  ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? 67.957  49.661 -2.479  1.00 79.97  ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? 67.764  50.964 -2.217  1.00 80.22  ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? 69.964  49.774 3.231   1.00 156.40 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? 70.219  48.742 4.270   1.00 85.63  ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? 70.647  51.095 3.313   1.00 85.82  ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? 70.308  49.147 1.813   1.00 154.78 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? 69.715  47.919 1.406   1.00 151.65 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? 70.606  47.232 0.403   1.00 149.20 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? 70.493  47.887 -0.885  1.00 148.58 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? 72.082  47.295 0.787   1.00 147.03 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? 72.706  46.050 0.485   1.00 143.72 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? 72.622  48.427 -0.071  1.00 147.21 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? 71.775  48.316 -1.328  1.00 147.31 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? 71.607  49.588 -2.077  1.00 75.10  ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? 71.778  49.576 -3.458  1.00 74.11  ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? 72.065  48.564 -4.099  1.00 72.89  ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? 71.598  50.806 -4.061  1.00 73.59  ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? 71.271  52.010 -3.444  1.00 73.98  ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? 71.122  53.028 -4.115  1.00 72.38  ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? 71.122  51.948 -2.006  1.00 74.39  ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? 70.793  53.204 -1.259  1.00 74.05  ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? 71.290  50.757 -1.403  1.00 74.53  ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? 74.296  45.982 0.283   1.00 118.56 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? 74.728  44.648 0.764   1.00 85.26  ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? 74.931  47.211 0.834   1.00 85.92  ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? 74.455  46.001 -1.302  1.00 116.11 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? 73.559  45.254 -2.125  1.00 112.05 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? 74.103  45.147 -3.530  1.00 108.79 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? 73.969  46.423 -4.201  1.00 108.32 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? 75.584  44.773 -3.594  1.00 106.35 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? 75.816  43.813 -4.626  1.00 102.47 ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? 76.276  46.092 -3.887  1.00 106.32 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? 75.230  46.857 -4.684  1.00 107.46 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? 75.296  48.324 -4.522  1.00 75.20  ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? 75.430  49.098 -5.650  1.00 75.39  ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? 75.513  48.630 -6.775  1.00 76.37  ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? 75.471  50.449 -5.411  1.00 74.77  ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? 75.407  51.087 -4.182  1.00 74.09  ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? 75.445  52.313 -4.122  1.00 72.70  ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? 75.290  50.214 -3.045  1.00 74.51  ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? 75.252  50.812 -1.674  1.00 74.38  ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? 75.230  48.894 -3.269  1.00 74.94  ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? 77.322  43.383 -4.989  1.00 79.39  ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? 77.282  42.004 -5.556  1.00 81.61  ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? 78.196  43.678 -3.825  1.00 83.42  ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? 77.708  44.386 -6.168  1.00 78.27  ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? 76.855  44.515 -7.305  1.00 73.52  ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? 77.485  45.410 -8.341  1.00 69.36  ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? 77.352  46.803 -7.972  1.00 68.76  ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? 78.974  45.153 -8.555  1.00 66.86  ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? 79.273  45.172 -9.951  1.00 62.09  ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? 79.630  46.348 -7.884  1.00 67.66  ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? 78.607  47.440 -8.123  1.00 69.06  ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? 78.668  48.579 -7.185  1.00 73.32  ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? 78.556  49.848 -7.706  1.00 73.86  ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? 78.402  50.066 -8.893  1.00 73.06  ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? 78.634  50.857 -6.783  1.00 73.97  ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? 78.804  50.727 -5.417  1.00 74.53  ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? 78.857  51.728 -4.709  1.00 74.57  ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? 78.905  49.370 -4.933  1.00 74.91  ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? 79.077  49.133 -3.465  1.00 75.65  ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? 78.835  48.376 -5.830  1.00 73.93  ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? 79.322  43.798 -10.778 1.00 63.06  ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? 78.175  42.972 -10.345 1.00 74.84  ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? 80.695  43.256 -10.681 1.00 75.62  ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? 79.072  44.269 -12.279 1.00 63.55  ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? 77.833  44.862 -12.661 1.00 59.85  ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? 78.084  46.127 -13.447 1.00 58.09  ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? 78.574  47.162 -12.568 1.00 58.94  ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? 79.126  45.983 -14.552 1.00 56.06  ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? 78.770  46.773 -15.692 1.00 49.69  ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? 80.398  46.495 -13.910 1.00 57.44  ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? 79.899  47.534 -12.923 1.00 61.26  ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? 80.698  47.599 -11.696 1.00 78.53  ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? 81.349  46.559 -11.056 1.00 79.15  ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? 82.014  46.944 -9.999  1.00 80.99  ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? 81.783  48.316 -9.929  1.00 81.08  ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? 82.250  49.286 -9.001  1.00 82.18  ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? 82.977  49.120 -8.010  1.00 83.67  ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? 81.784  50.560 -9.316  1.00 81.48  ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? 80.967  50.864 -10.371 1.00 81.06  ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? 80.620  52.146 -10.503 1.00 80.72  ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? 80.522  49.978 -11.235 1.00 79.35  ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? 80.967  48.733 -10.961 1.00 80.05  ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? 79.540  46.549 -17.084 1.00 58.23  ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? 78.541  46.721 -18.168 1.00 62.63  ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? 80.310  45.275 -16.994 1.00 59.52  ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? 80.577  47.765 -17.103 1.00 60.55  ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? 80.125  49.116 -17.013 1.00 62.31  ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? 81.286  50.055 -16.781 1.00 66.74  ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? 81.817  49.877 -15.447 1.00 67.76  ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? 82.478  49.912 -17.728 1.00 68.64  ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? 83.012  51.200 -18.014 1.00 70.18  ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? 83.502  49.173 -16.889 1.00 69.82  ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? 83.231  49.772 -15.527 1.00 70.35  ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? 83.716  49.011 -14.372 1.00 73.06  ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? 84.002  47.665 -14.304 1.00 72.60  ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? 84.454  47.295 -13.136 1.00 71.95  ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? 84.457  48.462 -12.383 1.00 75.34  ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? 84.836  48.688 -11.025 1.00 75.45  ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? 85.265  47.865 -10.186 1.00 75.00  ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? 84.667  50.031 -10.668 1.00 75.17  ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? 84.196  51.023 -11.502 1.00 77.53  ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? 84.107  52.257 -10.982 1.00 77.42  ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? 83.839  50.819 -12.758 1.00 75.85  ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? 83.996  49.528 -13.130 1.00 74.49  ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? 83.127  51.699 -19.532 1.00 64.33  ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? 81.771  51.559 -20.122 1.00 69.50  ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? 84.296  51.074 -20.209 1.00 70.72  ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? 83.423  53.249 -19.372 1.00 65.73  ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? 82.437  54.119 -18.835 1.00 69.38  ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? 83.070  55.096 -17.873 1.00 72.07  ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? 83.564  54.406 -16.707 1.00 71.75  ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? 84.257  55.875 -18.419 1.00 73.85  ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? 84.193  57.185 -17.871 1.00 78.75  ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? 85.458  55.110 -17.888 1.00 71.76  ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? 84.959  54.603 -16.553 1.00 70.41  ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? 85.521  53.326 -16.120 1.00 76.46  ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? 85.619  52.159 -16.844 1.00 75.86  ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? 86.122  51.154 -16.164 1.00 75.62  ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? 86.387  51.699 -14.912 1.00 77.20  ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? 86.927  51.150 -13.738 1.00 76.58  ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? 87.307  49.880 -13.623 1.00 76.84  ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? 87.062  51.962 -12.670 1.00 75.65  ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? 86.665  53.238 -12.780 1.00 76.20  ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? 86.139  53.870 -13.823 1.00 76.54  ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? 86.027  53.037 -14.873 1.00 76.76  ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? 85.069  58.354 -18.514 1.00 77.43  ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? 84.312  59.613 -18.343 1.00 93.94  ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? 85.504  57.932 -19.871 1.00 92.75  ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? 86.327  58.411 -17.548 1.00 78.90  ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? 86.159  58.724 -16.174 1.00 81.29  ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? 87.493  58.683 -15.467 1.00 82.62  ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? 87.815  57.353 -14.993 1.00 80.43  ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? 88.670  59.128 -16.336 1.00 83.60  ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? 89.553  59.938 -15.564 1.00 87.04  ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? 89.357  57.820 -16.676 1.00 82.36  ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? 89.132  57.033 -15.398 1.00 80.18  ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? 89.217  55.584 -15.559 1.00 93.48  ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? 89.030  54.851 -16.704 1.00 91.88  ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? 89.183  53.561 -16.533 1.00 90.60  ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? 89.490  53.435 -15.186 1.00 89.67  ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? 89.769  52.318 -14.379 1.00 88.06  ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? 89.793  51.066 -14.831 1.00 85.31  ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? 90.025  52.534 -13.074 1.00 87.82  ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? 90.007  53.792 -12.621 1.00 89.18  ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? 89.766  54.926 -13.281 1.00 90.33  ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? 89.511  54.674 -14.573 1.00 91.13  ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? 90.606  60.892 -16.305 1.00 126.99 ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? 90.140  62.291 -16.159 1.00 99.26  ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? 90.860  60.329 -17.663 1.00 99.92  ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? 91.909  60.731 -15.415 1.00 126.67 ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? 91.799  60.623 -14.005 1.00 125.45 ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? 92.917  59.764 -13.471 1.00 124.06 ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? 92.647  58.360 -13.718 1.00 122.89 ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? 94.258  60.066 -14.137 1.00 123.62 ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? 95.293  60.091 -13.161 1.00 123.30 ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? 94.459  58.900 -15.088 1.00 122.35 ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? 93.784  57.771 -14.335 1.00 122.17 ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? 93.334  56.648 -15.163 1.00 93.16  ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? 92.789  56.685 -16.420 1.00 93.23  ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? 92.475  55.506 -16.894 1.00 92.06  ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? 92.839  54.632 -15.882 1.00 91.57  ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? 92.763  53.234 -15.768 1.00 91.23  ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? 92.266  52.442 -16.721 1.00 90.96  ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? 93.221  52.668 -14.626 1.00 90.60  ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? 93.724  53.461 -13.680 1.00 91.02  ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? 93.849  54.785 -13.672 1.00 91.61  ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? 93.378  55.318 -14.815 1.00 92.23  ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? 96.799  60.357 -13.624 1.00 132.75 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? 97.433  61.261 -12.623 1.00 92.27  ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? 96.763  60.751 -15.057 1.00 90.33  ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? 97.463  58.916 -13.528 1.00 132.01 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? 97.713  58.317 -12.266 1.00 133.07 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? 98.662  57.157 -12.434 1.00 134.59 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? 97.961  56.038 -13.029 1.00 134.13 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? 99.844  57.457 -13.357 1.00 135.31 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? 101.035 56.865 -12.828 1.00 137.99 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? 99.440  56.800 -14.665 1.00 134.40 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? 98.677  55.589 -14.167 1.00 133.07 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? 97.714  55.016 -15.121 1.00 91.22  ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? 97.443  53.640 -15.057 1.00 90.26  ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? 97.993  52.961 -14.180 1.00 90.17  ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? 96.588  53.092 -15.948 1.00 89.99  ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? 96.006  53.862 -16.874 1.00 90.50  ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? 95.184  53.276 -17.747 1.00 90.33  ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? 96.247  55.270 -16.949 1.00 90.74  ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? 97.101  55.799 -16.061 1.00 90.81  ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? 102.242 56.487 -13.814 1.00 146.94 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? 103.484 56.334 -13.019 1.00 104.88 ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? 102.209 57.440 -14.952 1.00 104.76 ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? 101.834 55.045 -14.340 1.00 147.65 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? 101.714 53.957 -13.431 1.00 148.52 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? 102.193 52.684 -14.085 1.00 147.87 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? 101.206 52.215 -15.036 1.00 147.27 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? 103.498 52.846 -14.866 1.00 147.80 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? 104.311 51.687 -14.680 1.00 147.26 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? 103.031 52.947 -16.309 1.00 147.52 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? 101.806 52.047 -16.313 1.00 146.96 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? 100.786 52.357 -17.339 1.00 103.01 ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? 100.076 51.306 -17.876 1.00 102.24 ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? 100.268 50.141 -17.562 1.00 101.45 ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? 99.127  51.670 -18.802 1.00 101.77 ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? 98.832  52.949 -19.236 1.00 101.51 ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? 97.943  53.129 -20.064 1.00 101.04 ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? 99.625  53.996 -18.646 1.00 101.50 ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? 99.382  55.408 -19.074 1.00 100.91 ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? 100.549 53.655 -17.738 1.00 102.21 ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? 105.861 51.719 -15.100 1.00 118.37 ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? 106.651 52.099 -13.899 1.00 97.38  ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? 105.990 52.520 -16.346 1.00 96.55  ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? 106.165 50.194 -15.452 1.00 118.24 ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? 105.485 49.135 -14.767 1.00 117.76 ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? 105.260 47.961 -15.696 1.00 118.30 ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? 104.209 48.248 -16.654 1.00 118.47 ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? 106.487 47.578 -16.515 1.00 118.28 ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? 106.593 46.164 -16.624 1.00 118.27 ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? 106.223 48.202 -17.872 1.00 118.25 ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? 104.706 48.165 -17.986 1.00 117.86 ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? 104.172 49.301 -18.735 1.00 95.33  ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? 104.605 50.603 -18.658 1.00 95.59  ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? 103.951 51.410 -19.445 1.00 95.33  ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? 103.027 50.597 -20.082 1.00 95.17  ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? 102.038 50.920 -21.043 1.00 94.99  ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? 101.774 52.024 -21.535 1.00 94.69  ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? 101.314 49.798 -21.427 1.00 95.12  ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? 101.511 48.526 -20.945 1.00 95.49  ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? 100.705 47.573 -21.447 1.00 95.14  ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? 102.431 48.211 -20.039 1.00 95.55  ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? 103.148 49.289 -19.656 1.00 95.25  ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? 107.654 45.534 -17.643 1.00 106.42 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? 108.065 44.189 -17.158 1.00 99.82  ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? 108.686 46.571 -17.915 1.00 99.50  ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? 106.805 45.349 -18.974 1.00 105.10 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? 105.584 44.611 -18.966 1.00 103.29 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? 105.127 44.377 -20.382 1.00 100.37 ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? 104.702 45.636 -20.949 1.00 99.60  ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? 106.255 43.875 -21.273 1.00 98.50  ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? 105.754 42.938 -22.212 1.00 97.00  ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? 106.751 45.128 -21.965 1.00 97.44  ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? 105.487 45.954 -22.084 1.00 96.91  ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? 105.713 47.402 -22.072 1.00 87.73  ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? 104.791 48.227 -22.713 1.00 86.96  ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? 103.815 47.706 -23.278 1.00 86.72  ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? 104.986 49.568 -22.704 1.00 86.42  ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? 106.056 50.082 -22.093 1.00 86.00  ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? 106.218 51.408 -22.118 1.00 84.55  ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? 107.011 49.259 -21.432 1.00 86.03  ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? 106.802 47.937 -21.445 1.00 86.85  ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? 106.542 41.564 -22.444 1.00 82.52  ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? 106.614 40.822 -21.157 1.00 106.70 ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? 107.788 41.897 -23.189 1.00 106.66 ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? 105.597 40.742 -23.412 1.00 79.78  ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? 105.599 40.996 -24.807 1.00 74.16  ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? 104.313 41.674 -25.212 1.00 70.31  ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? 104.380 43.083 -24.892 1.00 69.66  ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? 104.075 41.599 -26.712 1.00 67.72  ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? 102.710 41.304 -26.986 1.00 64.74  ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? 104.510 42.954 -27.231 1.00 68.26  ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? 104.240 43.872 -26.065 1.00 69.42  ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? 105.204 44.969 -25.978 1.00 95.28  ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? 104.800 46.231 -26.343 1.00 96.17  ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? 103.688 46.479 -26.774 1.00 97.61  ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? 105.751 47.198 -26.186 1.00 95.67  ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? 107.037 47.034 -25.713 1.00 95.85  ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? 107.772 48.011 -25.599 1.00 96.92  ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? 107.402 45.675 -25.375 1.00 95.82  ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? 108.782 45.390 -24.872 1.00 95.05  ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? 106.478 44.725 -25.527 1.00 95.39  ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? 102.368 40.238 -28.127 1.00 80.94  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? 101.022 39.662 -27.861 1.00 66.78  ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? 103.549 39.343 -28.166 1.00 68.14  ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? 102.337 41.139 -29.446 1.00 79.09  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? 101.420 42.231 -29.554 1.00 76.77  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? 101.913 43.259 -30.546 1.00 74.36  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? 102.988 44.078 -30.028 1.00 76.68  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? 102.420 42.718 -31.881 1.00 71.86  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? 102.059 43.657 -32.885 1.00 68.00  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? 103.924 42.808 -31.727 1.00 76.07  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? 104.001 44.139 -31.022 1.00 78.56  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? 105.272 44.455 -30.370 1.00 67.76  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? 105.587 45.800 -30.148 1.00 68.41  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? 104.826 46.675 -30.593 1.00 68.09  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? 106.712 46.111 -29.465 1.00 71.85  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? 107.513 45.137 -29.022 1.00 72.49  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? 108.577 45.482 -28.299 1.00 73.93  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? 107.245 43.760 -29.287 1.00 72.31  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? 106.123 43.468 -29.959 1.00 69.90  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? 100.622 43.568 -33.558 1.00 45.82  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? 99.616  43.619 -32.459 1.00 47.54  ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? 100.687 42.389 -34.448 1.00 52.15  ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? 100.539 44.891 -34.435 1.00 44.12  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? 100.080 46.119 -33.872 1.00 45.24  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? 100.923 47.281 -34.356 1.00 46.61  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? 102.193 47.315 -33.662 1.00 51.29  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? 101.260 47.295 -35.849 1.00 47.63  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? 101.184 48.621 -36.352 1.00 43.39  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? 102.709 46.846 -35.895 1.00 50.64  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? 103.246 47.457 -34.616 1.00 52.44  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? 104.470 46.842 -34.058 1.00 63.72  ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? 105.482 47.685 -33.583 1.00 64.88  ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? 105.326 48.904 -33.665 1.00 63.59  ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? 106.595 47.153 -33.050 1.00 64.95  ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? 106.728 45.833 -32.974 1.00 67.20  ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? 107.835 45.356 -32.406 1.00 67.82  ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? 105.725 44.941 -33.465 1.00 66.69  ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? 104.620 45.484 -33.994 1.00 64.58  ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? 100.764 48.854 -37.879 1.00 46.81  ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? 99.291  48.982 -37.982 1.00 60.72  ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? 101.479 47.824 -38.676 1.00 57.47  ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? 101.381 50.266 -38.247 1.00 52.33  ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? 101.447 51.317 -37.293 1.00 58.67  ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? 102.696 52.131 -37.531 1.00 65.58  ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? 103.855 51.411 -37.040 1.00 65.91  ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? 102.967 52.409 -39.010 1.00 68.34  ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? 103.455 53.738 -39.168 1.00 74.53  ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? 104.018 51.376 -39.384 1.00 67.90  ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? 104.794 51.222 -38.087 1.00 69.19  ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? 105.403 49.913 -37.890 1.00 83.04  ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? 104.996 48.698 -38.380 1.00 85.78  ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? 105.742 47.694 -37.988 1.00 86.82  ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? 106.711 48.289 -37.193 1.00 86.04  ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? 107.804 47.766 -36.475 1.00 87.49  ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? 108.120 46.474 -36.443 1.00 86.38  ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? 108.573 48.630 -35.784 1.00 88.05  ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? 108.262 49.933 -35.823 1.00 87.85  ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? 107.265 50.547 -36.461 1.00 87.18  ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? 106.518 49.657 -37.132 1.00 85.93  ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? 104.128 54.175 -40.550 1.00 82.07  ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? 103.984 55.650 -40.606 1.00 76.54  ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? 103.605 53.334 -41.658 1.00 76.35  ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? 105.658 53.805 -40.347 1.00 85.10  ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? 106.397 54.410 -39.302 1.00 89.33  ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? 107.874 54.181 -39.502 1.00 92.70  ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? 108.250 52.856 -39.063 1.00 93.67  ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? 108.384 54.319 -40.939 1.00 95.03  ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? 109.573 55.121 -40.920 1.00 99.99  ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? 108.692 52.883 -41.339 1.00 94.12  ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? 109.124 52.288 -40.016 1.00 93.90  ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? 109.041 50.825 -39.884 1.00 88.16  ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? 109.961 50.203 -39.070 1.00 88.98  ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? 110.840 50.799 -38.475 1.00 89.04  ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? 109.816 48.846 -38.974 1.00 89.29  ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? 108.867 48.065 -39.598 1.00 90.01  ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? 108.854 46.855 -39.408 1.00 90.35  ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? 107.941 48.777 -40.443 1.00 89.78  ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? 106.885 48.004 -41.165 1.00 89.44  ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? 108.071 50.107 -40.543 1.00 89.30  ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? 110.274 55.572 -42.297 1.00 104.93 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? 110.821 56.930 -42.068 1.00 84.47  ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? 109.378 55.332 -43.457 1.00 84.90  ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? 111.502 54.569 -42.390 1.00 108.56 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? 112.467 54.510 -41.343 1.00 114.81 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? 113.557 53.533 -41.709 1.00 119.46 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? 113.151 52.177 -41.400 1.00 120.47 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? 113.884 53.551 -43.203 1.00 122.20 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? 115.289 53.449 -43.413 1.00 125.05 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? 113.198 52.305 -43.727 1.00 122.12 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? 113.348 51.370 -42.546 1.00 121.85 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? 112.401 50.242 -42.500 1.00 102.13 ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? 112.598 49.251 -41.542 1.00 102.46 ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? 113.508 49.396 -40.711 1.00 102.95 ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? 111.794 48.163 -41.541 1.00 102.62 ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? 110.817 48.054 -42.445 1.00 102.65 ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? 110.075 46.945 -42.433 1.00 102.42 ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? 110.564 49.073 -43.405 1.00 102.60 ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? 111.371 50.142 -43.395 1.00 102.44 ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? 115.959 54.197 -44.666 1.00 131.38 ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? 116.343 55.562 -44.219 1.00 133.10 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? 115.060 54.037 -45.836 1.00 131.86 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? 117.268 53.332 -44.934 1.00 132.37 ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? 118.136 52.986 -43.858 1.00 134.30 ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? 118.661 51.582 -44.036 1.00 135.91 ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? 117.595 50.619 -43.843 1.00 136.66 ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? 119.248 51.291 -45.415 1.00 136.78 ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? 120.398 50.460 -45.268 1.00 137.63 ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? 118.139 50.526 -46.111 1.00 137.09 ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? 117.535 49.748 -44.960 1.00 137.87 ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? 116.140 49.358 -45.158 1.00 139.96 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? 115.117 50.101 -45.693 1.00 140.43 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? 113.972 49.464 -45.746 1.00 140.57 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? 114.260 48.217 -45.205 1.00 140.87 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? 113.466 47.074 -44.978 1.00 140.99 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? 112.165 47.006 -45.269 1.00 141.45 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? 114.065 45.990 -44.430 1.00 140.91 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? 115.368 46.063 -44.130 1.00 140.93 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? 116.216 47.082 -44.289 1.00 140.98 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? 115.592 48.139 -44.839 1.00 140.58 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? 121.220 50.001 -46.566 1.00 195.18 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? 122.662 50.148 -46.251 1.00 121.81 ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? 120.645 50.716 -47.737 1.00 121.61 ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? 120.897 48.445 -46.681 1.00 196.09 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? 121.199 47.555 -45.602 1.00 197.71 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? 120.868 46.130 -45.984 1.00 199.42 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? 119.436 46.006 -46.168 1.00 200.77 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? 121.506 45.662 -47.293 1.00 199.89 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? 121.877 44.282 -47.205 1.00 199.23 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? 120.389 45.836 -48.304 1.00 200.65 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? 119.159 45.517 -47.473 1.00 201.17 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? 117.924 46.147 -47.949 1.00 127.93 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? 117.786 47.315 -48.662 1.00 128.05 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? 116.544 47.611 -48.959 1.00 128.07 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? 115.811 46.572 -48.401 1.00 127.75 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? 114.432 46.297 -48.368 1.00 127.16 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? 113.508 47.083 -48.925 1.00 126.92 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? 114.029 45.174 -47.734 1.00 127.06 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? 114.956 44.388 -47.172 1.00 127.49 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? 116.279 44.539 -47.133 1.00 127.76 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? 116.647 45.663 -47.774 1.00 127.94 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? 122.810 43.634 -48.343 1.00 180.42 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? 124.078 43.197 -47.710 1.00 134.57 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? 122.849 44.578 -49.490 1.00 134.68 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? 122.009 42.336 -48.803 1.00 180.08 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? 121.628 41.343 -47.854 1.00 179.40 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? 120.558 40.445 -48.432 1.00 179.19 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? 119.354 41.214 -48.670 1.00 178.95 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? 120.913 39.792 -49.768 1.00 179.04 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? 120.397 38.454 -49.801 1.00 178.84 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? 120.225 40.683 -50.785 1.00 178.83 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? 118.983 41.134 -50.039 1.00 178.56 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? 118.515 42.453 -50.457 1.00 133.04 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? 119.284 43.515 -50.865 1.00 132.96 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? 118.588 44.575 -51.196 1.00 132.65 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? 117.271 44.188 -50.992 1.00 132.66 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? 116.050 44.863 -51.165 1.00 132.48 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? 115.956 46.124 -51.597 1.00 132.00 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? 114.915 44.191 -50.873 1.00 132.69 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? 115.013 42.930 -50.433 1.00 132.94 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? 116.100 42.190 -50.228 1.00 132.99 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? 117.211 42.885 -50.532 1.00 132.86 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? 120.043 37.756 -51.208 1.00 193.28 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? 120.244 36.291 -51.057 1.00 170.95 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? 120.751 38.485 -52.296 1.00 171.52 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? 118.478 38.013 -51.345 1.00 191.93 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? 117.605 37.747 -50.246 1.00 187.56 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? 116.188 37.569 -50.735 1.00 184.40 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? 115.648 38.842 -51.156 1.00 183.54 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? 116.053 36.636 -51.935 1.00 182.54 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? 114.860 35.863 -51.813 1.00 180.04 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? 115.962 37.589 -53.113 1.00 182.22 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? 115.230 38.774 -52.511 1.00 182.21 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? 115.537 40.061 -53.133 1.00 158.84 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? 116.774 40.593 -53.403 1.00 158.60 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? 116.729 41.784 -53.952 1.00 158.29 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? 115.370 42.053 -54.055 1.00 158.21 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? 114.655 43.162 -54.556 1.00 157.84 ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? 115.235 44.252 -55.064 1.00 157.29 ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? 113.306 43.110 -54.514 1.00 157.61 ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? 112.724 42.017 -54.003 1.00 157.68 ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? 113.284 40.916 -53.503 1.00 158.43 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? 114.624 40.998 -53.558 1.00 158.58 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? 114.550 34.715 -52.887 1.00 149.12 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? 113.706 33.679 -52.239 1.00 109.73 ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? 115.840 34.331 -53.506 1.00 110.07 ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? 113.678 35.466 -53.984 1.00 147.20 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? 112.371 35.933 -53.668 1.00 142.89 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? 111.697 36.479 -54.903 1.00 139.69 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? 112.290 37.742 -55.288 1.00 139.19 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? 111.796 35.575 -56.130 1.00 136.85 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? 110.580 35.664 -56.870 1.00 131.51 ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? 112.926 36.201 -56.925 1.00 136.93 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? 112.707 37.676 -56.641 1.00 137.95 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? 113.886 38.523 -56.790 1.00 99.34  ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? 115.204 38.166 -56.612 1.00 99.89  ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? 116.034 39.151 -56.826 1.00 98.94  ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? 115.216 40.223 -57.165 1.00 98.33  ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? 115.547 41.562 -57.509 1.00 97.42  ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? 116.664 42.084 -57.594 1.00 96.01  ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? 114.409 42.319 -57.774 1.00 97.69  ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? 113.119 41.850 -57.722 1.00 97.75  ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? 112.158 42.744 -58.011 1.00 97.07  ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? 112.796 40.602 -57.410 1.00 98.25  ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? 113.888 39.851 -57.144 1.00 98.90  ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? 109.639 34.375 -57.006 1.00 85.62  ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? 109.500 33.800 -55.646 1.00 97.79  ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? 110.127 33.524 -58.124 1.00 96.41  ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? 108.237 34.994 -57.421 1.00 81.65  ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? 107.530 35.830 -56.519 1.00 75.82  ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? 107.203 37.146 -57.182 1.00 71.96  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? 108.437 37.787 -57.585 1.00 74.00  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? 106.346 37.056 -58.448 1.00 68.82  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? 105.484 38.202 -58.516 1.00 60.23  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? 107.377 37.151 -59.551 1.00 71.24  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? 108.343 38.142 -58.949 1.00 76.02  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? 109.683 38.117 -59.519 1.00 90.72  ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? 110.550 37.055 -59.574 1.00 92.60  ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? 111.680 37.349 -60.157 1.00 94.73  ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? 111.549 38.686 -60.507 1.00 96.04  ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? 112.446 39.553 -61.171 1.00 97.65  ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? 113.575 39.305 -61.610 1.00 100.04 ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? 111.908 40.828 -61.318 1.00 98.01  ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? 110.663 41.216 -60.892 1.00 97.55  ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? 110.316 42.491 -61.132 1.00 97.40  ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? 109.817 40.413 -60.278 1.00 95.90  ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? 110.322 39.173 -60.118 1.00 93.61  ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? 104.062 38.109 -59.265 1.00 53.59  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? 103.008 38.297 -58.240 1.00 86.09  ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? 104.031 36.909 -60.136 1.00 82.68  ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? 104.061 39.400 -60.194 1.00 55.53  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? 104.087 40.709 -59.625 1.00 59.11  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? 104.500 41.730 -60.662 1.00 60.08  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? 105.837 41.451 -61.127 1.00 60.84  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? 103.639 41.793 -61.922 1.00 60.38  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? 103.564 43.140 -62.352 1.00 58.68  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? 104.427 40.993 -62.938 1.00 60.05  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? 105.845 41.336 -62.544 1.00 62.78  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? 106.838 40.313 -62.890 1.00 92.05  ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? 108.047 40.712 -63.485 1.00 93.68  ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? 108.221 41.914 -63.749 1.00 90.46  ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? 108.987 39.778 -63.756 1.00 94.15  ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? 108.757 38.495 -63.461 1.00 96.39  ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? 109.725 37.608 -63.715 1.00 97.99  ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? 107.525 38.062 -62.883 1.00 93.55  ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? 106.603 38.994 -62.619 1.00 91.59  ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? 102.286 43.629 -63.166 1.00 68.92  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? 101.387 44.404 -62.272 1.00 75.31  ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? 101.775 42.451 -63.899 1.00 77.01  ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? 102.906 44.623 -64.234 1.00 68.66  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? 103.894 45.570 -63.845 1.00 69.65  ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? 104.787 45.899 -65.016 1.00 70.69  ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? 105.685 44.794 -65.279 1.00 69.91  ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? 104.025 46.160 -66.313 1.00 72.30  ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? 104.532 47.325 -66.967 1.00 77.18  ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? 104.244 44.895 -67.129 1.00 71.70  ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? 105.582 44.386 -66.632 1.00 70.02  ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? 105.707 42.937 -66.645 1.00 78.43  ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? 104.762 42.008 -66.298 1.00 76.95  ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? 105.193 40.770 -66.353 1.00 77.54  ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? 106.508 40.896 -66.775 1.00 79.74  ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? 107.520 39.950 -67.013 1.00 81.61  ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? 107.364 38.633 -66.854 1.00 81.47  ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? 108.720 40.408 -67.424 1.00 83.33  ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? 108.878 41.727 -67.583 1.00 81.41  ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? 108.006 42.713 -67.390 1.00 80.38  ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? 106.829 42.224 -66.977 1.00 80.58  ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? 103.784 47.888 -68.268 1.00 76.18  ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? 104.017 49.355 -68.348 1.00 83.67  ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? 102.392 47.364 -68.287 1.00 82.43  ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? 104.588 47.168 -69.436 1.00 77.03  ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? 106.015 47.225 -69.469 1.00 78.90  ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? 106.542 46.468 -70.665 1.00 80.25  ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? 106.825 45.096 -70.301 1.00 79.23  ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? 105.581 46.421 -71.859 1.00 81.85  ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? 106.252 46.721 -73.088 1.00 85.99  ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? 105.113 44.978 -71.870 1.00 80.66  ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? 106.316 44.252 -71.305 1.00 78.94  ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? 106.031 42.946 -70.702 1.00 87.11  ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? 107.066 42.053 -70.619 1.00 87.04  ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? 108.200 42.320 -70.967 1.00 86.99  ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? 106.727 40.830 -70.112 1.00 86.80  ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? 105.482 40.423 -69.684 1.00 85.18  ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? 105.324 39.281 -69.274 1.00 83.82  ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? 104.446 41.418 -69.769 1.00 85.76  ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? 103.067 41.067 -69.309 1.00 85.58  ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? 104.768 42.619 -70.261 1.00 85.86  ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? 105.524 47.645 -74.188 1.00 113.85 ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? 106.220 48.960 -74.228 1.00 69.59  ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? 104.060 47.591 -73.927 1.00 70.38  ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? 105.814 46.899 -75.563 1.00 113.64 ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? 107.139 46.799 -76.064 1.00 115.08 ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? 107.238 45.664 -77.055 1.00 115.27 ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? 107.104 44.394 -76.373 1.00 115.38 ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? 106.180 45.668 -78.156 1.00 115.88 ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? 106.798 45.334 -79.409 1.00 115.53 ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? 105.184 44.614 -77.698 1.00 115.38 ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? 106.048 43.625 -76.936 1.00 115.37 ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? 105.350 42.957 -75.837 1.00 71.54  ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? 104.513 43.553 -74.920 1.00 70.67  ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? 104.050 42.720 -74.027 1.00 69.61  ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? 104.603 41.495 -74.375 1.00 70.55  ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? 104.457 40.212 -73.766 1.00 70.65  ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? 103.784 39.900 -72.775 1.00 71.92  ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? 105.198 39.241 -74.433 1.00 71.27  ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? 105.974 39.466 -75.539 1.00 71.17  ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? 106.610 38.395 -76.023 1.00 70.86  ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? 106.115 40.653 -76.125 1.00 70.66  ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? 105.406 41.617 -75.493 1.00 70.96  ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? 105.911 44.765 -80.625 1.00 97.22  ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? 106.624 45.076 -81.887 1.00 105.08 ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? 104.497 45.197 -80.460 1.00 104.47 ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? 106.010 43.196 -80.400 1.00 96.41  ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? 107.283 42.587 -80.234 1.00 94.24  ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? 107.257 41.192 -80.804 1.00 93.73  ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? 106.641 40.294 -79.855 1.00 92.31  ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? 106.459 41.065 -82.101 1.00 93.25  ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? 107.143 40.192 -83.006 1.00 92.54  ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? 105.126 40.496 -81.642 1.00 92.70  ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? 105.495 39.676 -80.415 1.00 91.79  ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? 104.462 39.644 -79.362 1.00 98.11  ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? 104.292 38.476 -78.652 1.00 97.26  ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? 104.933 37.459 -78.871 1.00 96.32  ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? 103.336 38.542 -77.668 1.00 96.69  ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? 102.548 39.631 -77.339 1.00 96.62  ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? 101.735 39.542 -76.428 1.00 96.00  ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? 102.767 40.815 -78.133 1.00 96.77  ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? 101.948 42.036 -77.855 1.00 94.54  ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? 103.701 40.763 -79.092 1.00 97.37  ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? 106.491 39.835 -84.429 1.00 109.50 ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? 107.598 39.449 -85.338 1.00 85.37  ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? 105.539 40.905 -84.836 1.00 82.97  ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? 105.664 38.522 -84.095 1.00 106.53 ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? 106.306 37.421 -83.466 1.00 101.85 ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? 105.310 36.321 -83.196 1.00 98.97  ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? 104.449 36.669 -82.085 1.00 96.99  ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? 104.383 36.012 -84.368 1.00 97.75  ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? 104.195 34.603 -84.452 1.00 96.80  ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? 103.082 36.686 -83.971 1.00 96.67  ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? 103.101 36.496 -82.467 1.00 94.59  ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? 102.289 37.442 -81.690 1.00 65.74  ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? 101.807 37.004 -80.481 1.00 62.86  ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? 102.038 35.882 -80.042 1.00 58.19  ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? 101.046 37.929 -79.802 1.00 61.94  ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? 100.736 39.221 -80.208 1.00 63.03  ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? 100.054 39.953 -79.492 1.00 59.47  ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? 101.269 39.608 -81.483 1.00 64.62  ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? 100.966 40.982 -82.001 1.00 64.51  ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? 102.015 38.714 -82.154 1.00 64.30  ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? 103.795 33.942 -85.853 1.00 103.90 ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? 104.928 33.098 -86.307 1.00 69.95  ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? 103.262 35.023 -86.725 1.00 69.90  ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? 102.602 32.969 -85.481 1.00 103.81 ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? 102.735 32.043 -84.415 1.00 101.49 ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? 101.372 31.718 -83.863 1.00 100.43 ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? 100.875 32.832 -83.078 1.00 99.57  ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? 100.340 31.480 -84.964 1.00 98.92  ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? 99.475  30.437 -84.558 1.00 98.75  ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? 99.567  32.784 -85.009 1.00 98.02  ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? 99.578  33.169 -83.539 1.00 99.07  ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? 99.332  34.590 -83.253 1.00 64.27  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? 98.813  34.952 -81.993 1.00 63.90  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? 98.611  34.068 -81.149 1.00 62.68  ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? 98.551  36.255 -81.737 1.00 63.18  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? 98.790  37.177 -82.675 1.00 63.03  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? 98.516  38.447 -82.392 1.00 62.10  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? 99.325  36.836 -83.952 1.00 62.58  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? 99.583  35.545 -84.195 1.00 62.82  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? 99.679  28.975 -85.157 1.00 80.59  ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? 101.142 28.720 -85.206 1.00 76.84  ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? 98.866  28.895 -86.394 1.00 78.72  ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? 99.047  28.021 -84.052 1.00 80.97  ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? 99.551  28.018 -82.716 1.00 76.08  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? 98.409  28.077 -81.726 1.00 72.30  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? 97.876  29.417 -81.622 1.00 71.60  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? 97.223  27.177 -82.061 1.00 69.14  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? 96.728  26.618 -80.844 1.00 68.44  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? 96.227  28.129 -82.705 1.00 68.51  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? 96.499  29.435 -81.974 1.00 69.18  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? 96.276  30.649 -82.753 1.00 64.48  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? 96.566  30.851 -84.072 1.00 65.00  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? 96.315  32.070 -84.490 1.00 64.15  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? 95.817  32.714 -83.368 1.00 62.81  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? 95.373  34.038 -83.145 1.00 63.50  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? 95.373  34.994 -84.074 1.00 64.46  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? 94.928  34.348 -81.914 1.00 63.06  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? 94.930  33.400 -80.977 1.00 61.48  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? 95.323  32.129 -81.058 1.00 63.78  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? 95.766  31.845 -82.295 1.00 63.59  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? 95.677  25.411 -80.889 1.00 78.31  ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? 96.050  24.414 -79.859 1.00 68.65  ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? 95.514  24.987 -82.301 1.00 70.23  ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? 94.333  26.120 -80.441 1.00 79.36  ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? 94.329  27.032 -79.355 1.00 76.24  ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? 93.115  27.922 -79.444 1.00 76.74  ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? 93.332  29.037 -80.338 1.00 75.84  ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? 91.861  27.210 -79.953 1.00 78.02  ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? 90.742  27.655 -79.202 1.00 77.80  ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? 91.717  27.732 -81.367 1.00 77.38  ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? 92.202  29.148 -81.179 1.00 78.87  ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? 92.619  29.801 -82.406 1.00 73.55  ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? 93.338  29.241 -83.431 1.00 73.12  ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? 93.554  30.069 -84.416 1.00 75.72  ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? 92.944  31.247 -84.012 1.00 76.41  ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? 92.859  32.494 -84.665 1.00 78.18  ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? 93.327  32.813 -85.764 1.00 80.86  ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? 92.151  33.425 -83.904 1.00 77.40  ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? 91.601  33.178 -82.664 1.00 76.26  ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? 90.958  34.208 -82.088 1.00 76.54  ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? 91.681  32.009 -82.041 1.00 74.74  ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? 92.362  31.098 -82.769 1.00 74.61  ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? 90.037  26.660 -78.168 1.00 69.40  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? 91.042  26.013 -77.279 1.00 69.17  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? 89.121  25.821 -78.982 1.00 69.90  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? 89.186  27.667 -77.293 1.00 71.50  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? 89.769  28.872 -76.835 1.00 65.43  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? 88.886  30.039 -77.201 1.00 64.74  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? 89.221  30.535 -78.518 1.00 62.22  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? 87.389  29.699 -77.222 1.00 63.09  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? 86.603  30.709 -76.576 1.00 61.60  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? 87.067  29.690 -78.698 1.00 63.34  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? 88.006  30.768 -79.194 1.00 63.59  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? 88.249  30.736 -80.642 1.00 63.20  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? 88.163  31.941 -81.354 1.00 62.21  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? 87.933  32.987 -80.737 1.00 61.85  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? 88.329  31.932 -82.681 1.00 64.50  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? 88.579  30.784 -83.310 1.00 63.52  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? 88.728  30.830 -84.637 1.00 66.76  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? 88.688  29.539 -82.609 1.00 62.55  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? 88.522  29.563 -81.291 1.00 62.78  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? 85.102  30.371 -76.087 1.00 48.93  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? 85.028  30.473 -74.609 1.00 61.08  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? 84.622  29.138 -76.752 1.00 60.44  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? 84.299  31.594 -76.683 1.00 47.83  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? 84.837  32.902 -76.604 1.00 48.79  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? 84.106  33.801 -77.566 1.00 49.53  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? 84.509  33.462 -78.914 1.00 46.80  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? 82.600  33.569 -77.509 1.00 52.35  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? 81.898  34.778 -77.768 1.00 56.78  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? 82.355  32.543 -78.602 1.00 49.04  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? 83.398  32.935 -79.638 1.00 47.46  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? 83.882  31.839 -80.473 1.00 58.88  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? 83.900  30.489 -80.178 1.00 58.32  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? 84.392  29.758 -81.143 1.00 59.28  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? 84.726  30.681 -82.128 1.00 60.30  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? 85.306  30.489 -83.398 1.00 59.47  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? 85.670  29.434 -83.914 1.00 64.10  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? 85.453  31.694 -84.083 1.00 60.67  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? 85.090  32.929 -83.598 1.00 60.47  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? 85.285  33.975 -84.408 1.00 65.86  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? 84.565  33.126 -82.404 1.00 60.52  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? 84.410  31.967 -81.729 1.00 59.11  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? 80.313  34.821 -77.560 1.00 69.10  ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? 80.018  35.729 -76.416 1.00 60.55  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? 79.817  33.414 -77.545 1.00 59.91  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? 79.790  35.538 -78.874 1.00 68.00  ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? 80.436  36.703 -79.361 1.00 68.96  ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? 80.175  36.840 -80.840 1.00 69.70  ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? 80.775  35.737 -81.554 1.00 66.97  ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? 78.699  36.799 -81.210 1.00 72.52  ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? 78.518  37.634 -82.341 1.00 76.95  ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? 78.478  35.350 -81.603 1.00 69.21  ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? 79.780  35.064 -82.309 1.00 67.63  ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? 80.173  33.668 -82.392 1.00 58.35  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? 79.970  32.685 -81.465 1.00 57.79  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? 80.508  31.548 -81.802 1.00 58.75  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? 81.094  31.799 -83.033 1.00 59.77  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? 81.858  30.949 -83.886 1.00 58.94  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? 82.209  29.768 -83.692 1.00 63.57  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? 82.240  31.610 -85.052 1.00 60.14  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? 81.950  32.921 -85.342 1.00 59.94  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? 82.418  33.390 -86.495 1.00 65.33  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? 81.258  33.718 -84.553 1.00 59.99  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? 80.867  33.095 -83.422 1.00 58.58  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? 77.170  38.458 -82.495 1.00 68.69  ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? 77.320  39.780 -81.842 1.00 68.11  ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? 76.065  37.550 -82.099 1.00 69.95  ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? 77.054  38.662 -84.056 1.00 67.57  ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? 78.195  38.963 -84.831 1.00 69.21  ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? 78.043  38.354 -86.202 1.00 71.77  ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? 78.488  36.980 -86.192 1.00 68.85  ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? 76.601  38.335 -86.711 1.00 73.31  ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? 76.571  38.713 -88.091 1.00 78.43  ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? 76.173  36.890 -86.517 1.00 70.09  ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? 77.475  36.140 -86.723 1.00 68.41  ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? 77.583  34.857 -86.035 1.00 70.99  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? 77.316  34.588 -84.721 1.00 69.69  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? 77.596  33.359 -84.367 1.00 67.25  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? 78.055  32.771 -85.532 1.00 66.55  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? 78.515  31.476 -85.817 1.00 65.05  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? 78.561  30.491 -84.922 1.00 61.03  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? 78.920  31.217 -87.078 1.00 65.00  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? 78.838  32.196 -87.987 1.00 67.79  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? 78.408  33.454 -87.842 1.00 68.86  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? 78.034  33.678 -86.573 1.00 68.70  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? 75.223  38.527 -88.930 1.00 84.00  ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? 75.313  39.423 -90.107 1.00 104.52 ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? 74.084  38.653 -87.985 1.00 103.82 ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? 75.324  37.021 -89.422 1.00 82.22  ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? 76.369  36.639 -90.298 1.00 81.86  ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? 75.902  35.520 -91.195 1.00 81.37  ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? 76.084  34.242 -90.552 1.00 80.13  ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? 74.426  35.603 -91.569 1.00 81.49  ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? 74.277  35.195 -92.933 1.00 82.57  ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? 73.762  34.655 -90.583 1.00 80.65  ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? 74.835  33.597 -90.360 1.00 80.30  ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? 74.852  33.013 -89.018 1.00 98.23  ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? 74.418  33.573 -87.840 1.00 97.97  ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? 74.585  32.800 -86.794 1.00 97.27  ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? 75.164  31.653 -87.317 1.00 96.21  ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? 75.581  30.453 -86.725 1.00 96.63  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? 75.465  30.198 -85.426 1.00 94.91  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? 76.124  29.509 -87.524 1.00 97.89  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? 76.229  29.763 -88.830 1.00 98.47  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? 75.866  30.849 -89.509 1.00 97.79  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? 75.334  31.769 -88.684 1.00 96.92  ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 74  ? 72.817  34.942 -93.543 1.00 91.02  ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 74  ? 72.886  35.325 -94.973 1.00 72.17  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 74  ? 71.780  35.537 -92.661 1.00 70.22  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 74  ? 72.689  33.366 -93.456 1.00 89.29  ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 74  ? 73.736  32.554 -93.947 1.00 86.21  ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 74  ? 73.272  31.125 -94.027 1.00 86.37  ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 74  ? 73.451  30.456 -92.757 1.00 85.07  ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 74  ? 71.796  30.990 -94.388 1.00 87.60  ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 74  ? 71.653  30.021 -95.431 1.00 90.84  ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 74  ? 71.144  30.559 -93.081 1.00 85.87  ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 74  ? 72.258  29.783 -92.395 1.00 83.78  ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 74  ? 72.199  29.750 -90.917 1.00 58.47  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 74  ? 72.638  28.614 -90.243 1.00 57.57  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 74  ? 73.025  27.595 -90.800 1.00 55.71  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 74  ? 72.594  28.718 -88.875 1.00 56.96  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 74  ? 72.154  29.798 -88.127 1.00 56.35  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 74  ? 72.192  29.747 -86.893 1.00 58.78  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 74  ? 71.678  30.928 -88.896 1.00 56.33  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 74  ? 71.151  32.129 -88.178 1.00 52.64  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 74  ? 71.730  30.848 -90.230 1.00 56.37  ? 74   DT  I C6    1 
ATOM   1512  P P     . DT  A 1 75  ? 70.227  29.361 -95.712 1.00 105.45 ? 75   DT  I P     1 
ATOM   1513  O OP1   . DT  A 1 75  ? 70.275  28.689 -97.031 1.00 93.82  ? 75   DT  I OP1   1 
ATOM   1514  O OP2   . DT  A 1 75  ? 69.190  30.389 -95.444 1.00 91.91  ? 75   DT  I OP2   1 
ATOM   1515  O "O5'" . DT  A 1 75  ? 70.153  28.248 -94.586 1.00 102.27 ? 75   DT  I "O5'" 1 
ATOM   1516  C "C5'" . DT  A 1 75  ? 69.021  27.421 -94.456 1.00 102.02 ? 75   DT  I "C5'" 1 
ATOM   1517  C "C4'" . DT  A 1 75  ? 69.423  26.109 -93.834 1.00 101.18 ? 75   DT  I "C4'" 1 
ATOM   1518  O "O4'" . DT  A 1 75  ? 70.098  26.339 -92.576 1.00 99.43  ? 75   DT  I "O4'" 1 
ATOM   1519  C "C3'" . DT  A 1 75  ? 68.236  25.214 -93.524 1.00 100.56 ? 75   DT  I "C3'" 1 
ATOM   1520  O "O3'" . DT  A 1 75  ? 68.591  23.887 -93.817 1.00 103.20 ? 75   DT  I "O3'" 1 
ATOM   1521  C "C2'" . DT  A 1 75  ? 68.008  25.403 -92.041 1.00 98.62  ? 75   DT  I "C2'" 1 
ATOM   1522  C "C1'" . DT  A 1 75  ? 69.385  25.732 -91.503 1.00 97.15  ? 75   DT  I "C1'" 1 
ATOM   1523  N N1    . DT  A 1 75  ? 69.314  26.710 -90.412 1.00 80.91  ? 75   DT  I N1    1 
ATOM   1524  C C2    . DT  A 1 75  ? 69.866  26.401 -89.193 1.00 79.10  ? 75   DT  I C2    1 
ATOM   1525  O O2    . DT  A 1 75  ? 70.424  25.346 -88.961 1.00 79.31  ? 75   DT  I O2    1 
ATOM   1526  N N3    . DT  A 1 75  ? 69.738  27.385 -88.248 1.00 75.94  ? 75   DT  I N3    1 
ATOM   1527  C C4    . DT  A 1 75  ? 69.127  28.616 -88.404 1.00 74.61  ? 75   DT  I C4    1 
ATOM   1528  O O4    . DT  A 1 75  ? 69.091  29.415 -87.470 1.00 72.23  ? 75   DT  I O4    1 
ATOM   1529  C C5    . DT  A 1 75  ? 68.570  28.862 -89.705 1.00 75.15  ? 75   DT  I C5    1 
ATOM   1530  C C7    . DT  A 1 75  ? 67.880  30.162 -89.958 1.00 73.29  ? 75   DT  I C7    1 
ATOM   1531  C C6    . DT  A 1 75  ? 68.692  27.913 -90.632 1.00 77.96  ? 75   DT  I C6    1 
ATOM   1532  P P     . DC  A 1 76  ? 68.226  23.298 -95.245 1.00 96.47  ? 76   DC  I P     1 
ATOM   1533  O OP1   . DC  A 1 76  ? 69.473  23.231 -96.036 1.00 99.54  ? 76   DC  I OP1   1 
ATOM   1534  O OP2   . DC  A 1 76  ? 67.067  24.089 -95.736 1.00 98.35  ? 76   DC  I OP2   1 
ATOM   1535  O "O5'" . DC  A 1 76  ? 67.748  21.826 -94.916 1.00 94.94  ? 76   DC  I "O5'" 1 
ATOM   1536  C "C5'" . DC  A 1 76  ? 66.489  21.607 -94.303 1.00 91.61  ? 76   DC  I "C5'" 1 
ATOM   1537  C "C4'" . DC  A 1 76  ? 66.662  20.864 -92.999 1.00 89.36  ? 76   DC  I "C4'" 1 
ATOM   1538  O "O4'" . DC  A 1 76  ? 67.023  21.766 -91.921 1.00 84.96  ? 76   DC  I "O4'" 1 
ATOM   1539  C "C3'" . DC  A 1 76  ? 65.365  20.204 -92.560 1.00 87.79  ? 76   DC  I "C3'" 1 
ATOM   1540  O "O3'" . DC  A 1 76  ? 65.668  18.967 -91.956 1.00 89.32  ? 76   DC  I "O3'" 1 
ATOM   1541  C "C2'" . DC  A 1 76  ? 64.792  21.169 -91.544 1.00 85.97  ? 76   DC  I "C2'" 1 
ATOM   1542  C "C1'" . DC  A 1 76  ? 66.045  21.693 -90.885 1.00 82.43  ? 76   DC  I "C1'" 1 
ATOM   1543  N N1    . DC  A 1 76  ? 65.885  23.034 -90.298 1.00 80.31  ? 76   DC  I N1    1 
ATOM   1544  C C2    . DC  A 1 76  ? 66.207  23.223 -88.944 1.00 78.02  ? 76   DC  I C2    1 
ATOM   1545  O O2    . DC  A 1 76  ? 66.568  22.243 -88.268 1.00 74.60  ? 76   DC  I O2    1 
ATOM   1546  N N3    . DC  A 1 76  ? 66.109  24.463 -88.410 1.00 75.50  ? 76   DC  I N3    1 
ATOM   1547  C C4    . DC  A 1 76  ? 65.697  25.483 -89.168 1.00 74.36  ? 76   DC  I C4    1 
ATOM   1548  N N4    . DC  A 1 76  ? 65.643  26.692 -88.615 1.00 67.68  ? 76   DC  I N4    1 
ATOM   1549  C C5    . DC  A 1 76  ? 65.329  25.309 -90.533 1.00 75.03  ? 76   DC  I C5    1 
ATOM   1550  C C6    . DC  A 1 76  ? 65.439  24.081 -91.053 1.00 76.95  ? 76   DC  I C6    1 
ATOM   1551  P P     . DC  A 1 77  ? 64.476  18.043 -91.452 1.00 100.20 ? 77   DC  I P     1 
ATOM   1552  O OP1   . DC  A 1 77  ? 64.581  16.739 -92.165 1.00 75.76  ? 77   DC  I OP1   1 
ATOM   1553  O OP2   . DC  A 1 77  ? 63.214  18.841 -91.541 1.00 74.57  ? 77   DC  I OP2   1 
ATOM   1554  O "O5'" . DC  A 1 77  ? 64.833  17.861 -89.916 1.00 88.54  ? 77   DC  I "O5'" 1 
ATOM   1555  C "C5'" . DC  A 1 77  ? 65.137  19.003 -89.134 1.00 85.21  ? 77   DC  I "C5'" 1 
ATOM   1556  C "C4'" . DC  A 1 77  ? 64.748  18.772 -87.698 1.00 82.96  ? 77   DC  I "C4'" 1 
ATOM   1557  O "O4'" . DC  A 1 77  ? 64.502  20.067 -87.122 1.00 78.56  ? 77   DC  I "O4'" 1 
ATOM   1558  C "C3'" . DC  A 1 77  ? 63.449  18.004 -87.508 1.00 81.39  ? 77   DC  I "C3'" 1 
ATOM   1559  O "O3'" . DC  A 1 77  ? 63.517  17.395 -86.221 1.00 82.92  ? 77   DC  I "O3'" 1 
ATOM   1560  C "C2'" . DC  A 1 77  ? 62.403  19.103 -87.537 1.00 79.57  ? 77   DC  I "C2'" 1 
ATOM   1561  C "C1'" . DC  A 1 77  ? 63.120  20.241 -86.841 1.00 76.03  ? 77   DC  I "C1'" 1 
ATOM   1562  N N1    . DC  A 1 77  ? 62.756  21.584 -87.308 1.00 56.53  ? 77   DC  I N1    1 
ATOM   1563  C C2    . DC  A 1 77  ? 63.087  22.702 -86.490 1.00 54.24  ? 77   DC  I C2    1 
ATOM   1564  O O2    . DC  A 1 77  ? 63.599  22.505 -85.362 1.00 50.82  ? 77   DC  I O2    1 
ATOM   1565  N N3    . DC  A 1 77  ? 62.836  23.953 -86.951 1.00 51.72  ? 77   DC  I N3    1 
ATOM   1566  C C4    . DC  A 1 77  ? 62.268  24.118 -88.151 1.00 50.58  ? 77   DC  I C4    1 
ATOM   1567  N N4    . DC  A 1 77  ? 62.064  25.368 -88.577 1.00 43.90  ? 77   DC  I N4    1 
ATOM   1568  C C5    . DC  A 1 77  ? 61.886  23.002 -88.974 1.00 51.25  ? 77   DC  I C5    1 
ATOM   1569  C C6    . DC  A 1 77  ? 62.144  21.769 -88.514 1.00 53.17  ? 77   DC  I C6    1 
ATOM   1570  P P     . DG  A 1 78  ? 62.685  16.063 -85.908 1.00 102.65 ? 78   DG  I P     1 
ATOM   1571  O OP1   . DG  A 1 78  ? 63.612  14.913 -86.040 1.00 91.84  ? 78   DG  I OP1   1 
ATOM   1572  O OP2   . DG  A 1 78  ? 61.408  16.076 -86.661 1.00 89.86  ? 78   DG  I OP2   1 
ATOM   1573  O "O5'" . DG  A 1 78  ? 62.334  16.247 -84.372 1.00 101.50 ? 78   DG  I "O5'" 1 
ATOM   1574  C "C5'" . DG  A 1 78  ? 63.246  16.903 -83.502 1.00 97.89  ? 78   DG  I "C5'" 1 
ATOM   1575  C "C4'" . DG  A 1 78  ? 62.514  17.930 -82.676 1.00 97.21  ? 78   DG  I "C4'" 1 
ATOM   1576  O "O4'" . DG  A 1 78  ? 62.201  19.112 -83.457 1.00 95.30  ? 78   DG  I "O4'" 1 
ATOM   1577  C "C3'" . DG  A 1 78  ? 61.181  17.432 -82.122 1.00 96.85  ? 78   DG  I "C3'" 1 
ATOM   1578  O "O3'" . DG  A 1 78  ? 61.033  17.932 -80.804 1.00 95.18  ? 78   DG  I "O3'" 1 
ATOM   1579  C "C2'" . DG  A 1 78  ? 60.155  18.115 -83.006 1.00 96.70  ? 78   DG  I "C2'" 1 
ATOM   1580  C "C1'" . DG  A 1 78  ? 60.841  19.445 -83.223 1.00 95.76  ? 78   DG  I "C1'" 1 
ATOM   1581  N N9    . DG  A 1 78  ? 60.351  20.249 -84.339 1.00 84.17  ? 78   DG  I N9    1 
ATOM   1582  C C8    . DG  A 1 78  ? 59.914  19.805 -85.564 1.00 83.43  ? 78   DG  I C8    1 
ATOM   1583  N N7    . DG  A 1 78  ? 59.515  20.771 -86.348 1.00 84.61  ? 78   DG  I N7    1 
ATOM   1584  C C5    . DG  A 1 78  ? 59.697  21.921 -85.593 1.00 85.19  ? 78   DG  I C5    1 
ATOM   1585  C C6    . DG  A 1 78  ? 59.429  23.272 -85.910 1.00 86.13  ? 78   DG  I C6    1 
ATOM   1586  O O6    . DG  A 1 78  ? 58.936  23.733 -86.947 1.00 85.61  ? 78   DG  I O6    1 
ATOM   1587  N N1    . DG  A 1 78  ? 59.785  24.124 -84.868 1.00 87.29  ? 78   DG  I N1    1 
ATOM   1588  C C2    . DG  A 1 78  ? 60.322  23.722 -83.668 1.00 88.00  ? 78   DG  I C2    1 
ATOM   1589  N N2    . DG  A 1 78  ? 60.625  24.697 -82.797 1.00 86.30  ? 78   DG  I N2    1 
ATOM   1590  N N3    . DG  A 1 78  ? 60.554  22.459 -83.349 1.00 85.09  ? 78   DG  I N3    1 
ATOM   1591  C C4    . DG  A 1 78  ? 60.224  21.618 -84.355 1.00 85.47  ? 78   DG  I C4    1 
ATOM   1592  P P     . DC  A 1 79  ? 60.844  16.911 -79.586 1.00 52.44  ? 79   DC  I P     1 
ATOM   1593  O OP1   . DC  A 1 79  ? 62.046  16.037 -79.564 1.00 74.24  ? 79   DC  I OP1   1 
ATOM   1594  O OP2   . DC  A 1 79  ? 59.477  16.311 -79.689 1.00 73.15  ? 79   DC  I OP2   1 
ATOM   1595  O "O5'" . DC  A 1 79  ? 60.931  17.861 -78.320 1.00 50.10  ? 79   DC  I "O5'" 1 
ATOM   1596  C "C5'" . DC  A 1 79  ? 61.601  19.099 -78.429 1.00 43.97  ? 79   DC  I "C5'" 1 
ATOM   1597  C "C4'" . DC  A 1 79  ? 60.606  20.232 -78.392 1.00 43.70  ? 79   DC  I "C4'" 1 
ATOM   1598  O "O4'" . DC  A 1 79  ? 59.982  20.481 -79.670 1.00 42.25  ? 79   DC  I "O4'" 1 
ATOM   1599  C "C3'" . DC  A 1 79  ? 59.461  20.061 -77.400 1.00 39.39  ? 79   DC  I "C3'" 1 
ATOM   1600  O "O3'" . DC  A 1 79  ? 59.368  21.227 -76.624 1.00 42.92  ? 79   DC  I "O3'" 1 
ATOM   1601  C "C2'" . DC  A 1 79  ? 58.228  20.013 -78.280 1.00 42.43  ? 79   DC  I "C2'" 1 
ATOM   1602  C "C1'" . DC  A 1 79  ? 58.669  20.913 -79.391 1.00 41.26  ? 79   DC  I "C1'" 1 
ATOM   1603  N N1    . DC  A 1 79  ? 57.886  20.879 -80.628 1.00 62.71  ? 79   DC  I N1    1 
ATOM   1604  C C2    . DC  A 1 79  ? 57.601  22.092 -81.251 1.00 63.63  ? 79   DC  I C2    1 
ATOM   1605  O O2    . DC  A 1 79  ? 57.980  23.137 -80.722 1.00 65.03  ? 79   DC  I O2    1 
ATOM   1606  N N3    . DC  A 1 79  ? 56.918  22.097 -82.402 1.00 64.86  ? 79   DC  I N3    1 
ATOM   1607  C C4    . DC  A 1 79  ? 56.503  20.954 -82.931 1.00 65.66  ? 79   DC  I C4    1 
ATOM   1608  N N4    . DC  A 1 79  ? 55.838  21.023 -84.073 1.00 66.14  ? 79   DC  I N4    1 
ATOM   1609  C C5    . DC  A 1 79  ? 56.756  19.695 -82.311 1.00 65.70  ? 79   DC  I C5    1 
ATOM   1610  C C6    . DC  A 1 79  ? 57.448  19.703 -81.170 1.00 64.41  ? 79   DC  I C6    1 
ATOM   1611  P P     . DT  A 1 80  ? 58.735  21.147 -75.167 1.00 46.55  ? 80   DT  I P     1 
ATOM   1612  O OP1   . DT  A 1 80  ? 59.880  21.081 -74.218 1.00 45.73  ? 80   DT  I OP1   1 
ATOM   1613  O OP2   . DT  A 1 80  ? 57.679  20.105 -75.115 1.00 43.62  ? 80   DT  I OP2   1 
ATOM   1614  O "O5'" . DT  A 1 80  ? 58.068  22.583 -75.075 1.00 43.31  ? 80   DT  I "O5'" 1 
ATOM   1615  C "C5'" . DT  A 1 80  ? 58.868  23.733 -75.298 1.00 39.35  ? 80   DT  I "C5'" 1 
ATOM   1616  C "C4'" . DT  A 1 80  ? 58.035  24.870 -75.825 1.00 37.25  ? 80   DT  I "C4'" 1 
ATOM   1617  O "O4'" . DT  A 1 80  ? 57.541  24.496 -77.131 1.00 37.16  ? 80   DT  I "O4'" 1 
ATOM   1618  C "C3'" . DT  A 1 80  ? 56.815  25.220 -74.974 1.00 37.02  ? 80   DT  I "C3'" 1 
ATOM   1619  O "O3'" . DT  A 1 80  ? 56.740  26.630 -74.727 1.00 32.17  ? 80   DT  I "O3'" 1 
ATOM   1620  C "C2'" . DT  A 1 80  ? 55.636  24.738 -75.805 1.00 38.65  ? 80   DT  I "C2'" 1 
ATOM   1621  C "C1'" . DT  A 1 80  ? 56.154  24.768 -77.228 1.00 41.27  ? 80   DT  I "C1'" 1 
ATOM   1622  N N1    . DT  A 1 80  ? 55.549  23.750 -78.119 1.00 42.47  ? 80   DT  I N1    1 
ATOM   1623  C C2    . DT  A 1 80  ? 55.044  24.156 -79.341 1.00 43.95  ? 80   DT  I C2    1 
ATOM   1624  O O2    . DT  A 1 80  ? 55.101  25.298 -79.744 1.00 38.09  ? 80   DT  I O2    1 
ATOM   1625  N N3    . DT  A 1 80  ? 54.469  23.169 -80.081 1.00 47.57  ? 80   DT  I N3    1 
ATOM   1626  C C4    . DT  A 1 80  ? 54.351  21.844 -79.744 1.00 49.30  ? 80   DT  I C4    1 
ATOM   1627  O O4    . DT  A 1 80  ? 53.787  21.069 -80.514 1.00 54.14  ? 80   DT  I O4    1 
ATOM   1628  C C5    . DT  A 1 80  ? 54.922  21.478 -78.464 1.00 48.58  ? 80   DT  I C5    1 
ATOM   1629  C C7    . DT  A 1 80  ? 54.856  20.052 -78.025 1.00 45.36  ? 80   DT  I C7    1 
ATOM   1630  C C6    . DT  A 1 80  ? 55.484  22.437 -77.727 1.00 43.03  ? 80   DT  I C6    1 
ATOM   1631  P P     . DG  A 1 81  ? 55.656  27.203 -73.686 1.00 46.74  ? 81   DG  I P     1 
ATOM   1632  O OP1   . DG  A 1 81  ? 56.302  28.246 -72.836 1.00 56.50  ? 81   DG  I OP1   1 
ATOM   1633  O OP2   . DG  A 1 81  ? 54.936  26.077 -73.038 1.00 56.76  ? 81   DG  I OP2   1 
ATOM   1634  O "O5'" . DG  A 1 81  ? 54.648  27.909 -74.669 1.00 48.58  ? 81   DG  I "O5'" 1 
ATOM   1635  C "C5'" . DG  A 1 81  ? 55.150  28.504 -75.843 1.00 46.27  ? 81   DG  I "C5'" 1 
ATOM   1636  C "C4'" . DG  A 1 81  ? 54.019  29.137 -76.602 1.00 49.01  ? 81   DG  I "C4'" 1 
ATOM   1637  O "O4'" . DG  A 1 81  ? 53.417  28.232 -77.548 1.00 46.25  ? 81   DG  I "O4'" 1 
ATOM   1638  C "C3'" . DG  A 1 81  ? 52.918  29.590 -75.669 1.00 50.81  ? 81   DG  I "C3'" 1 
ATOM   1639  O "O3'" . DG  A 1 81  ? 52.569  30.895 -76.053 1.00 50.62  ? 81   DG  I "O3'" 1 
ATOM   1640  C "C2'" . DG  A 1 81  ? 51.821  28.546 -75.828 1.00 47.51  ? 81   DG  I "C2'" 1 
ATOM   1641  C "C1'" . DG  A 1 81  ? 52.106  27.865 -77.160 1.00 50.10  ? 81   DG  I "C1'" 1 
ATOM   1642  N N9    . DG  A 1 81  ? 52.092  26.404 -77.110 1.00 58.79  ? 81   DG  I N9    1 
ATOM   1643  C C8    . DG  A 1 81  ? 52.570  25.611 -76.097 1.00 62.79  ? 81   DG  I C8    1 
ATOM   1644  N N7    . DG  A 1 81  ? 52.474  24.334 -76.354 1.00 62.06  ? 81   DG  I N7    1 
ATOM   1645  C C5    . DG  A 1 81  ? 51.886  24.276 -77.607 1.00 65.32  ? 81   DG  I C5    1 
ATOM   1646  C C6    . DG  A 1 81  ? 51.540  23.158 -78.404 1.00 65.72  ? 81   DG  I C6    1 
ATOM   1647  O O6    . DG  A 1 81  ? 51.692  21.953 -78.152 1.00 63.44  ? 81   DG  I O6    1 
ATOM   1648  N N1    . DG  A 1 81  ? 50.963  23.551 -79.608 1.00 65.32  ? 81   DG  I N1    1 
ATOM   1649  C C2    . DG  A 1 81  ? 50.751  24.851 -79.997 1.00 64.88  ? 81   DG  I C2    1 
ATOM   1650  N N2    . DG  A 1 81  ? 50.191  25.026 -81.195 1.00 61.10  ? 81   DG  I N2    1 
ATOM   1651  N N3    . DG  A 1 81  ? 51.067  25.901 -79.264 1.00 61.87  ? 81   DG  I N3    1 
ATOM   1652  C C4    . DG  A 1 81  ? 51.630  25.543 -78.087 1.00 62.53  ? 81   DG  I C4    1 
ATOM   1653  P P     . DA  A 1 82  ? 51.192  31.507 -75.582 1.00 43.03  ? 82   DA  I P     1 
ATOM   1654  O OP1   . DA  A 1 82  ? 51.325  32.997 -75.513 1.00 49.04  ? 82   DA  I OP1   1 
ATOM   1655  O OP2   . DA  A 1 82  ? 50.629  30.735 -74.445 1.00 44.51  ? 82   DA  I OP2   1 
ATOM   1656  O "O5'" . DA  A 1 82  ? 50.262  31.166 -76.804 1.00 48.18  ? 82   DA  I "O5'" 1 
ATOM   1657  C "C5'" . DA  A 1 82  ? 48.934  31.583 -76.785 1.00 49.95  ? 82   DA  I "C5'" 1 
ATOM   1658  C "C4'" . DA  A 1 82  ? 48.351  31.443 -78.156 1.00 48.97  ? 82   DA  I "C4'" 1 
ATOM   1659  O "O4'" . DA  A 1 82  ? 48.617  30.113 -78.625 1.00 48.56  ? 82   DA  I "O4'" 1 
ATOM   1660  C "C3'" . DA  A 1 82  ? 46.857  31.565 -78.052 1.00 47.63  ? 82   DA  I "C3'" 1 
ATOM   1661  O "O3'" . DA  A 1 82  ? 46.361  32.237 -79.181 1.00 45.69  ? 82   DA  I "O3'" 1 
ATOM   1662  C "C2'" . DA  A 1 82  ? 46.383  30.135 -77.937 1.00 46.19  ? 82   DA  I "C2'" 1 
ATOM   1663  C "C1'" . DA  A 1 82  ? 47.430  29.360 -78.695 1.00 47.49  ? 82   DA  I "C1'" 1 
ATOM   1664  N N9    . DA  A 1 82  ? 47.710  28.046 -78.121 1.00 52.81  ? 82   DA  I N9    1 
ATOM   1665  C C8    . DA  A 1 82  ? 48.264  27.766 -76.899 1.00 51.87  ? 82   DA  I C8    1 
ATOM   1666  N N7    . DA  A 1 82  ? 48.395  26.485 -76.661 1.00 51.63  ? 82   DA  I N7    1 
ATOM   1667  C C5    . DA  A 1 82  ? 47.900  25.879 -77.806 1.00 53.22  ? 82   DA  I C5    1 
ATOM   1668  C C6    . DA  A 1 82  ? 47.773  24.530 -78.190 1.00 51.84  ? 82   DA  I C6    1 
ATOM   1669  N N6    . DA  A 1 82  ? 48.160  23.501 -77.442 1.00 46.24  ? 82   DA  I N6    1 
ATOM   1670  N N1    . DA  A 1 82  ? 47.230  24.272 -79.393 1.00 49.52  ? 82   DA  I N1    1 
ATOM   1671  C C2    . DA  A 1 82  ? 46.853  25.299 -80.159 1.00 50.98  ? 82   DA  I C2    1 
ATOM   1672  N N3    . DA  A 1 82  ? 46.929  26.601 -79.920 1.00 53.64  ? 82   DA  I N3    1 
ATOM   1673  C C4    . DA  A 1 82  ? 47.468  26.829 -78.711 1.00 51.70  ? 82   DA  I C4    1 
ATOM   1674  P P     . DA  A 1 83  ? 44.887  32.814 -79.126 1.00 48.68  ? 83   DA  I P     1 
ATOM   1675  O OP1   . DA  A 1 83  ? 44.735  33.891 -80.156 1.00 40.08  ? 83   DA  I OP1   1 
ATOM   1676  O OP2   . DA  A 1 83  ? 44.638  33.112 -77.677 1.00 37.00  ? 83   DA  I OP2   1 
ATOM   1677  O "O5'" . DA  A 1 83  ? 44.020  31.526 -79.465 1.00 50.09  ? 83   DA  I "O5'" 1 
ATOM   1678  C "C5'" . DA  A 1 83  ? 44.311  30.728 -80.605 1.00 54.27  ? 83   DA  I "C5'" 1 
ATOM   1679  C "C4'" . DA  A 1 83  ? 43.286  29.628 -80.726 1.00 58.12  ? 83   DA  I "C4'" 1 
ATOM   1680  O "O4'" . DA  A 1 83  ? 43.767  28.405 -80.127 1.00 55.82  ? 83   DA  I "O4'" 1 
ATOM   1681  C "C3'" . DA  A 1 83  ? 41.936  29.927 -80.068 1.00 57.79  ? 83   DA  I "C3'" 1 
ATOM   1682  O "O3'" . DA  A 1 83  ? 40.882  29.516 -80.952 1.00 66.06  ? 83   DA  I "O3'" 1 
ATOM   1683  C "C2'" . DA  A 1 83  ? 41.983  29.114 -78.782 1.00 57.42  ? 83   DA  I "C2'" 1 
ATOM   1684  C "C1'" . DA  A 1 83  ? 42.816  27.913 -79.197 1.00 59.36  ? 83   DA  I "C1'" 1 
ATOM   1685  N N9    . DA  A 1 83  ? 43.569  27.227 -78.152 1.00 46.99  ? 83   DA  I N9    1 
ATOM   1686  C C8    . DA  A 1 83  ? 44.331  27.758 -77.145 1.00 47.81  ? 83   DA  I C8    1 
ATOM   1687  N N7    . DA  A 1 83  ? 44.992  26.862 -76.461 1.00 46.40  ? 83   DA  I N7    1 
ATOM   1688  C C5    . DA  A 1 83  ? 44.614  25.660 -77.035 1.00 46.43  ? 83   DA  I C5    1 
ATOM   1689  C C6    . DA  A 1 83  ? 44.987  24.334 -76.781 1.00 46.68  ? 83   DA  I C6    1 
ATOM   1690  N N6    . DA  A 1 83  ? 45.884  23.980 -75.880 1.00 44.52  ? 83   DA  I N6    1 
ATOM   1691  N N1    . DA  A 1 83  ? 44.413  23.368 -77.514 1.00 47.68  ? 83   DA  I N1    1 
ATOM   1692  C C2    . DA  A 1 83  ? 43.540  23.724 -78.461 1.00 46.65  ? 83   DA  I C2    1 
ATOM   1693  N N3    . DA  A 1 83  ? 43.125  24.940 -78.811 1.00 47.92  ? 83   DA  I N3    1 
ATOM   1694  C C4    . DA  A 1 83  ? 43.710  25.871 -78.050 1.00 46.14  ? 83   DA  I C4    1 
ATOM   1695  P P     . DC  A 1 84  ? 39.351  29.595 -80.473 1.00 73.36  ? 84   DC  I P     1 
ATOM   1696  O OP1   . DC  A 1 84  ? 38.525  29.696 -81.697 1.00 66.41  ? 84   DC  I OP1   1 
ATOM   1697  O OP2   . DC  A 1 84  ? 39.197  30.610 -79.392 1.00 61.65  ? 84   DC  I OP2   1 
ATOM   1698  O "O5'" . DC  A 1 84  ? 39.091  28.138 -79.904 1.00 73.93  ? 84   DC  I "O5'" 1 
ATOM   1699  C "C5'" . DC  A 1 84  ? 39.262  27.018 -80.764 1.00 79.15  ? 84   DC  I "C5'" 1 
ATOM   1700  C "C4'" . DC  A 1 84  ? 38.673  25.786 -80.131 1.00 79.82  ? 84   DC  I "C4'" 1 
ATOM   1701  O "O4'" . DC  A 1 84  ? 39.628  25.143 -79.252 1.00 80.24  ? 84   DC  I "O4'" 1 
ATOM   1702  C "C3'" . DC  A 1 84  ? 37.435  26.082 -79.289 1.00 79.82  ? 84   DC  I "C3'" 1 
ATOM   1703  O "O3'" . DC  A 1 84  ? 36.497  25.043 -79.513 1.00 82.36  ? 84   DC  I "O3'" 1 
ATOM   1704  C "C2'" . DC  A 1 84  ? 37.966  26.012 -77.871 1.00 79.45  ? 84   DC  I "C2'" 1 
ATOM   1705  C "C1'" . DC  A 1 84  ? 39.013  24.919 -78.000 1.00 78.36  ? 84   DC  I "C1'" 1 
ATOM   1706  N N1    . DC  A 1 84  ? 40.055  24.901 -76.951 1.00 64.11  ? 84   DC  I N1    1 
ATOM   1707  C C2    . DC  A 1 84  ? 40.609  23.670 -76.568 1.00 65.03  ? 84   DC  I C2    1 
ATOM   1708  O O2    . DC  A 1 84  ? 40.261  22.643 -77.159 1.00 61.13  ? 84   DC  I O2    1 
ATOM   1709  N N3    . DC  A 1 84  ? 41.513  23.633 -75.569 1.00 64.53  ? 84   DC  I N3    1 
ATOM   1710  C C4    . DC  A 1 84  ? 41.881  24.758 -74.963 1.00 62.52  ? 84   DC  I C4    1 
ATOM   1711  N N4    . DC  A 1 84  ? 42.760  24.668 -73.972 1.00 59.50  ? 84   DC  I N4    1 
ATOM   1712  C C5    . DC  A 1 84  ? 41.360  26.026 -75.346 1.00 61.29  ? 84   DC  I C5    1 
ATOM   1713  C C6    . DC  A 1 84  ? 40.459  26.053 -76.339 1.00 61.88  ? 84   DC  I C6    1 
ATOM   1714  P P     . DA  A 1 85  ? 34.988  25.181 -78.985 1.00 66.75  ? 85   DA  I P     1 
ATOM   1715  O OP1   . DA  A 1 85  ? 34.113  25.448 -80.155 1.00 65.39  ? 85   DA  I OP1   1 
ATOM   1716  O OP2   . DA  A 1 85  ? 34.919  26.069 -77.796 1.00 60.57  ? 85   DA  I OP2   1 
ATOM   1717  O "O5'" . DA  A 1 85  ? 34.708  23.683 -78.540 1.00 65.83  ? 85   DA  I "O5'" 1 
ATOM   1718  C "C5'" . DA  A 1 85  ? 35.212  22.616 -79.336 1.00 61.21  ? 85   DA  I "C5'" 1 
ATOM   1719  C "C4'" . DA  A 1 85  ? 35.277  21.348 -78.524 1.00 63.51  ? 85   DA  I "C4'" 1 
ATOM   1720  O "O4'" . DA  A 1 85  ? 36.401  21.405 -77.618 1.00 63.14  ? 85   DA  I "O4'" 1 
ATOM   1721  C "C3'" . DA  A 1 85  ? 34.031  21.126 -77.672 1.00 64.51  ? 85   DA  I "C3'" 1 
ATOM   1722  O "O3'" . DA  A 1 85  ? 33.643  19.748 -77.714 1.00 67.46  ? 85   DA  I "O3'" 1 
ATOM   1723  C "C2'" . DA  A 1 85  ? 34.464  21.570 -76.286 1.00 61.96  ? 85   DA  I "C2'" 1 
ATOM   1724  C "C1'" . DA  A 1 85  ? 35.961  21.276 -76.275 1.00 63.19  ? 85   DA  I "C1'" 1 
ATOM   1725  N N9    . DA  A 1 85  ? 36.736  22.210 -75.449 1.00 57.49  ? 85   DA  I N9    1 
ATOM   1726  C C8    . DA  A 1 85  ? 36.597  23.574 -75.382 1.00 56.59  ? 85   DA  I C8    1 
ATOM   1727  N N7    . DA  A 1 85  ? 37.388  24.142 -74.509 1.00 55.16  ? 85   DA  I N7    1 
ATOM   1728  C C5    . DA  A 1 85  ? 38.104  23.083 -73.964 1.00 55.33  ? 85   DA  I C5    1 
ATOM   1729  C C6    . DA  A 1 85  ? 39.096  23.017 -72.956 1.00 55.55  ? 85   DA  I C6    1 
ATOM   1730  N N6    . DA  A 1 85  ? 39.521  24.077 -72.257 1.00 47.86  ? 85   DA  I N6    1 
ATOM   1731  N N1    . DA  A 1 85  ? 39.631  21.805 -72.678 1.00 55.61  ? 85   DA  I N1    1 
ATOM   1732  C C2    . DA  A 1 85  ? 39.183  20.743 -73.345 1.00 55.82  ? 85   DA  I C2    1 
ATOM   1733  N N3    . DA  A 1 85  ? 38.241  20.671 -74.285 1.00 54.53  ? 85   DA  I N3    1 
ATOM   1734  C C4    . DA  A 1 85  ? 37.734  21.890 -74.553 1.00 57.01  ? 85   DA  I C4    1 
ATOM   1735  P P     . DT  A 1 86  ? 32.344  19.260 -76.907 1.00 91.14  ? 86   DT  I P     1 
ATOM   1736  O OP1   . DT  A 1 86  ? 31.792  18.080 -77.617 1.00 64.84  ? 86   DT  I OP1   1 
ATOM   1737  O OP2   . DT  A 1 86  ? 31.483  20.448 -76.644 1.00 61.24  ? 86   DT  I OP2   1 
ATOM   1738  O "O5'" . DT  A 1 86  ? 32.943  18.765 -75.521 1.00 91.14  ? 86   DT  I "O5'" 1 
ATOM   1739  C "C5'" . DT  A 1 86  ? 34.024  17.847 -75.508 1.00 87.20  ? 86   DT  I "C5'" 1 
ATOM   1740  C "C4'" . DT  A 1 86  ? 34.356  17.462 -74.091 1.00 86.93  ? 86   DT  I "C4'" 1 
ATOM   1741  O "O4'" . DT  A 1 86  ? 35.214  18.448 -73.474 1.00 87.14  ? 86   DT  I "O4'" 1 
ATOM   1742  C "C3'" . DT  A 1 86  ? 33.136  17.313 -73.184 1.00 86.03  ? 86   DT  I "C3'" 1 
ATOM   1743  O "O3'" . DT  A 1 86  ? 33.297  16.108 -72.433 1.00 86.28  ? 86   DT  I "O3'" 1 
ATOM   1744  C "C2'" . DT  A 1 86  ? 33.205  18.550 -72.297 1.00 85.38  ? 86   DT  I "C2'" 1 
ATOM   1745  C "C1'" . DT  A 1 86  ? 34.707  18.761 -72.189 1.00 86.63  ? 86   DT  I "C1'" 1 
ATOM   1746  N N1    . DT  A 1 86  ? 35.186  20.119 -71.818 1.00 57.11  ? 86   DT  I N1    1 
ATOM   1747  C C2    . DT  A 1 86  ? 36.276  20.210 -70.957 1.00 55.95  ? 86   DT  I C2    1 
ATOM   1748  O O2    . DT  A 1 86  ? 36.858  19.233 -70.492 1.00 54.48  ? 86   DT  I O2    1 
ATOM   1749  N N3    . DT  A 1 86  ? 36.668  21.494 -70.670 1.00 56.44  ? 86   DT  I N3    1 
ATOM   1750  C C4    . DT  A 1 86  ? 36.112  22.663 -71.141 1.00 56.80  ? 86   DT  I C4    1 
ATOM   1751  O O4    . DT  A 1 86  ? 36.587  23.736 -70.803 1.00 55.28  ? 86   DT  I O4    1 
ATOM   1752  C C5    . DT  A 1 86  ? 34.979  22.502 -72.025 1.00 56.26  ? 86   DT  I C5    1 
ATOM   1753  C C7    . DT  A 1 86  ? 34.306  23.721 -72.564 1.00 51.40  ? 86   DT  I C7    1 
ATOM   1754  C C6    . DT  A 1 86  ? 34.578  21.256 -72.319 1.00 56.37  ? 86   DT  I C6    1 
ATOM   1755  P P     . DG  A 1 87  ? 32.056  15.482 -71.631 1.00 51.34  ? 87   DG  I P     1 
ATOM   1756  O OP1   . DG  A 1 87  ? 31.979  14.032 -71.919 1.00 76.09  ? 87   DG  I OP1   1 
ATOM   1757  O OP2   . DG  A 1 87  ? 30.868  16.350 -71.815 1.00 75.10  ? 87   DG  I OP2   1 
ATOM   1758  O "O5'" . DG  A 1 87  ? 32.492  15.642 -70.117 1.00 49.89  ? 87   DG  I "O5'" 1 
ATOM   1759  C "C5'" . DG  A 1 87  ? 33.799  15.278 -69.696 1.00 50.19  ? 87   DG  I "C5'" 1 
ATOM   1760  C "C4'" . DG  A 1 87  ? 34.074  15.889 -68.346 1.00 52.04  ? 87   DG  I "C4'" 1 
ATOM   1761  O "O4'" . DG  A 1 87  ? 34.416  17.286 -68.490 1.00 51.87  ? 87   DG  I "O4'" 1 
ATOM   1762  C "C3'" . DG  A 1 87  ? 32.866  15.848 -67.409 1.00 53.12  ? 87   DG  I "C3'" 1 
ATOM   1763  O "O3'" . DG  A 1 87  ? 33.324  15.636 -66.086 1.00 58.01  ? 87   DG  I "O3'" 1 
ATOM   1764  C "C2'" . DG  A 1 87  ? 32.304  17.250 -67.511 1.00 52.96  ? 87   DG  I "C2'" 1 
ATOM   1765  C "C1'" . DG  A 1 87  ? 33.601  18.021 -67.597 1.00 52.50  ? 87   DG  I "C1'" 1 
ATOM   1766  N N9    . DG  A 1 87  ? 33.530  19.399 -68.060 1.00 78.98  ? 87   DG  I N9    1 
ATOM   1767  C C8    . DG  A 1 87  ? 32.625  19.965 -68.926 1.00 79.24  ? 87   DG  I C8    1 
ATOM   1768  N N7    . DG  A 1 87  ? 32.828  21.240 -69.110 1.00 80.33  ? 87   DG  I N7    1 
ATOM   1769  C C5    . DG  A 1 87  ? 33.934  21.525 -68.322 1.00 80.04  ? 87   DG  I C5    1 
ATOM   1770  C C6    . DG  A 1 87  ? 34.612  22.738 -68.107 1.00 81.03  ? 87   DG  I C6    1 
ATOM   1771  O O6    . DG  A 1 87  ? 34.356  23.851 -68.574 1.00 78.38  ? 87   DG  I O6    1 
ATOM   1772  N N1    . DG  A 1 87  ? 35.690  22.577 -67.240 1.00 81.90  ? 87   DG  I N1    1 
ATOM   1773  C C2    . DG  A 1 87  ? 36.061  21.394 -66.649 1.00 82.28  ? 87   DG  I C2    1 
ATOM   1774  N N2    . DG  A 1 87  ? 37.134  21.439 -65.848 1.00 76.76  ? 87   DG  I N2    1 
ATOM   1775  N N3    . DG  A 1 87  ? 35.426  20.255 -66.834 1.00 80.94  ? 87   DG  I N3    1 
ATOM   1776  C C4    . DG  A 1 87  ? 34.381  20.394 -67.678 1.00 80.31  ? 87   DG  I C4    1 
ATOM   1777  P P     . DC  A 1 88  ? 33.263  14.172 -65.469 1.00 61.74  ? 88   DC  I P     1 
ATOM   1778  O OP1   . DC  A 1 88  ? 33.549  13.198 -66.549 1.00 68.48  ? 88   DC  I OP1   1 
ATOM   1779  O OP2   . DC  A 1 88  ? 31.994  14.091 -64.700 1.00 70.75  ? 88   DC  I OP2   1 
ATOM   1780  O "O5'" . DC  A 1 88  ? 34.480  14.150 -64.446 1.00 67.09  ? 88   DC  I "O5'" 1 
ATOM   1781  C "C5'" . DC  A 1 88  ? 35.822  14.277 -64.909 1.00 62.55  ? 88   DC  I "C5'" 1 
ATOM   1782  C "C4'" . DC  A 1 88  ? 36.591  15.228 -64.021 1.00 63.41  ? 88   DC  I "C4'" 1 
ATOM   1783  O "O4'" . DC  A 1 88  ? 36.148  16.593 -64.206 1.00 63.20  ? 88   DC  I "O4'" 1 
ATOM   1784  C "C3'" . DC  A 1 88  ? 36.466  14.960 -62.526 1.00 62.40  ? 88   DC  I "C3'" 1 
ATOM   1785  O "O3'" . DC  A 1 88  ? 37.725  15.254 -61.931 1.00 61.39  ? 88   DC  I "O3'" 1 
ATOM   1786  C "C2'" . DC  A 1 88  ? 35.429  15.977 -62.075 1.00 63.50  ? 88   DC  I "C2'" 1 
ATOM   1787  C "C1'" . DC  A 1 88  ? 35.804  17.156 -62.946 1.00 64.86  ? 88   DC  I "C1'" 1 
ATOM   1788  N N1    . DC  A 1 88  ? 34.769  18.170 -63.185 1.00 70.47  ? 88   DC  I N1    1 
ATOM   1789  C C2    . DC  A 1 88  ? 35.166  19.508 -63.316 1.00 73.96  ? 88   DC  I C2    1 
ATOM   1790  O O2    . DC  A 1 88  ? 36.358  19.802 -63.130 1.00 76.09  ? 88   DC  I O2    1 
ATOM   1791  N N3    . DC  A 1 88  ? 34.244  20.441 -63.645 1.00 74.77  ? 88   DC  I N3    1 
ATOM   1792  C C4    . DC  A 1 88  ? 32.973  20.082 -63.837 1.00 76.74  ? 88   DC  I C4    1 
ATOM   1793  N N4    . DC  A 1 88  ? 32.111  21.023 -64.224 1.00 78.23  ? 88   DC  I N4    1 
ATOM   1794  C C5    . DC  A 1 88  ? 32.533  18.737 -63.654 1.00 74.37  ? 88   DC  I C5    1 
ATOM   1795  C C6    . DC  A 1 88  ? 33.455  17.823 -63.324 1.00 73.71  ? 88   DC  I C6    1 
ATOM   1796  P P     . DC  A 1 89  ? 38.300  14.302 -60.786 1.00 59.65  ? 89   DC  I P     1 
ATOM   1797  O OP1   . DC  A 1 89  ? 39.395  13.479 -61.362 1.00 74.69  ? 89   DC  I OP1   1 
ATOM   1798  O OP2   . DC  A 1 89  ? 37.157  13.648 -60.095 1.00 73.48  ? 89   DC  I OP2   1 
ATOM   1799  O "O5'" . DC  A 1 89  ? 38.942  15.321 -59.764 1.00 55.43  ? 89   DC  I "O5'" 1 
ATOM   1800  C "C5'" . DC  A 1 89  ? 39.784  16.340 -60.227 1.00 52.50  ? 89   DC  I "C5'" 1 
ATOM   1801  C "C4'" . DC  A 1 89  ? 39.506  17.614 -59.472 1.00 49.65  ? 89   DC  I "C4'" 1 
ATOM   1802  O "O4'" . DC  A 1 89  ? 38.202  18.137 -59.813 1.00 48.54  ? 89   DC  I "O4'" 1 
ATOM   1803  C "C3'" . DC  A 1 89  ? 39.529  17.491 -57.952 1.00 50.72  ? 89   DC  I "C3'" 1 
ATOM   1804  O "O3'" . DC  A 1 89  ? 40.284  18.574 -57.456 1.00 52.61  ? 89   DC  I "O3'" 1 
ATOM   1805  C "C2'" . DC  A 1 89  ? 38.072  17.661 -57.544 1.00 51.67  ? 89   DC  I "C2'" 1 
ATOM   1806  C "C1'" . DC  A 1 89  ? 37.564  18.590 -58.626 1.00 49.79  ? 89   DC  I "C1'" 1 
ATOM   1807  N N1    . DC  A 1 89  ? 36.102  18.613 -58.869 1.00 69.17  ? 89   DC  I N1    1 
ATOM   1808  C C2    . DC  A 1 89  ? 35.459  19.858 -59.003 1.00 71.68  ? 89   DC  I C2    1 
ATOM   1809  O O2    . DC  A 1 89  ? 36.126  20.903 -58.870 1.00 66.89  ? 89   DC  I O2    1 
ATOM   1810  N N3    . DC  A 1 89  ? 34.132  19.885 -59.271 1.00 73.23  ? 89   DC  I N3    1 
ATOM   1811  C C4    . DC  A 1 89  ? 33.450  18.742 -59.392 1.00 72.89  ? 89   DC  I C4    1 
ATOM   1812  N N4    . DC  A 1 89  ? 32.147  18.814 -59.673 1.00 73.37  ? 89   DC  I N4    1 
ATOM   1813  C C5    . DC  A 1 89  ? 34.072  17.473 -59.238 1.00 70.01  ? 89   DC  I C5    1 
ATOM   1814  C C6    . DC  A 1 89  ? 35.384  17.453 -58.980 1.00 71.39  ? 89   DC  I C6    1 
ATOM   1815  P P     . DT  A 1 90  ? 40.778  18.570 -55.942 1.00 52.10  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 90  ? 42.181  18.084 -55.945 1.00 41.82  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 90  ? 39.767  17.912 -55.062 1.00 42.98  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 90  ? 40.797  20.122 -55.636 1.00 47.91  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 90  ? 41.225  21.012 -56.644 1.00 43.54  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 90  ? 40.360  22.243 -56.657 1.00 43.86  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 90  ? 38.990  21.903 -56.989 1.00 44.95  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 90  ? 40.315  22.963 -55.314 1.00 46.48  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 90  ? 40.526  24.355 -55.508 1.00 35.38  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 90  ? 38.910  22.692 -54.799 1.00 44.35  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 90  ? 38.123  22.568 -56.082 1.00 46.28  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 90  ? 36.864  21.803 -55.983 1.00 47.37  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 90  ? 35.687  22.472 -56.261 1.00 51.84  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 90  ? 35.640  23.657 -56.565 1.00 48.74  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 90  ? 34.555  21.699 -56.167 1.00 53.90  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 90  ? 34.477  20.363 -55.826 1.00 53.61  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 90  ? 33.380  19.809 -55.790 1.00 54.20  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 90  ? 35.748  19.729 -55.537 1.00 52.88  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 90  ? 35.769  18.289 -55.152 1.00 49.21  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 90  ? 36.861  20.470 -55.631 1.00 49.05  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 91  ? 41.054  25.238 -54.294 1.00 35.00  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 91  ? 42.265  25.961 -54.747 1.00 63.72  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 91  ? 41.093  24.394 -53.066 1.00 58.57  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 91  ? 39.876  26.275 -54.093 1.00 37.49  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 91  ? 39.257  26.866 -55.213 1.00 40.39  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 91  ? 37.840  27.259 -54.883 1.00 42.88  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 91  ? 36.977  26.098 -54.885 1.00 42.19  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 91  ? 37.650  27.935 -53.528 1.00 47.81  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 91  ? 36.938  29.151 -53.697 1.00 52.51  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 91  ? 36.819  26.935 -52.728 1.00 46.91  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 91  ? 36.051  26.222 -53.819 1.00 44.99  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 91  ? 35.513  24.875 -53.514 1.00 74.17  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 91  ? 34.218  24.604 -53.914 1.00 74.83  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 91  ? 33.504  25.426 -54.467 1.00 76.09  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 91  ? 33.787  23.330 -53.640 1.00 73.27  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 91  ? 34.501  22.326 -53.015 1.00 73.18  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 91  ? 33.990  21.229 -52.840 1.00 70.70  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 91  ? 35.839  22.677 -52.610 1.00 71.42  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 91  ? 36.673  21.641 -51.926 1.00 63.33  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 91  ? 36.276  23.921 -52.872 1.00 71.10  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 92  ? 36.449  29.952 -52.408 1.00 75.28  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 92  ? 36.333  31.376 -52.777 1.00 68.82  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 92  ? 37.306  29.561 -51.272 1.00 66.70  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 92  ? 35.006  29.340 -52.159 1.00 78.01  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 92  ? 34.010  29.415 -53.174 1.00 80.04  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 92  ? 32.643  29.467 -52.538 1.00 81.09  ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 92  ? 32.164  28.128 -52.278 1.00 79.69  ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 92  ? 32.648  30.189 -51.194 1.00 82.48  ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 92  ? 31.465  30.974 -51.049 1.00 86.10  ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 92  ? 32.719  29.058 -50.183 1.00 80.35  ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 92  ? 31.976  27.928 -50.884 1.00 79.44  ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 92  ? 32.472  26.574 -50.571 1.00 71.31  ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 92  ? 31.621  25.516 -50.790 1.00 71.61  ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 92  ? 30.480  25.658 -51.200 1.00 72.67  ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 92  ? 32.158  24.276 -50.511 1.00 70.69  ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 92  ? 33.432  24.004 -50.043 1.00 70.54  ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 92  ? 33.778  22.838 -49.846 1.00 71.81  ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 92  ? 34.267  25.171 -49.824 1.00 69.76  ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 92  ? 35.660  24.984 -49.317 1.00 67.62  ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 92  ? 33.749  26.378 -50.091 1.00 70.80  ? 92   DT  I C6    1 
ATOM   1875  P P     . DT  A 1 93  ? 31.179  31.728 -49.663 1.00 87.68  ? 93   DT  I P     1 
ATOM   1876  O OP1   . DT  A 1 93  ? 30.425  32.978 -49.947 1.00 72.35  ? 93   DT  I OP1   1 
ATOM   1877  O OP2   . DT  A 1 93  ? 32.466  31.806 -48.929 1.00 73.28  ? 93   DT  I OP2   1 
ATOM   1878  O "O5'" . DT  A 1 93  ? 30.236  30.691 -48.908 1.00 90.69  ? 93   DT  I "O5'" 1 
ATOM   1879  C "C5'" . DT  A 1 93  ? 28.991  30.287 -49.478 1.00 96.21  ? 93   DT  I "C5'" 1 
ATOM   1880  C "C4'" . DT  A 1 93  ? 28.193  29.509 -48.462 1.00 99.40  ? 93   DT  I "C4'" 1 
ATOM   1881  O "O4'" . DT  A 1 93  ? 28.615  28.125 -48.454 1.00 98.24  ? 93   DT  I "O4'" 1 
ATOM   1882  C "C3'" . DT  A 1 93  ? 28.402  30.026 -47.035 1.00 102.63 ? 93   DT  I "C3'" 1 
ATOM   1883  O "O3'" . DT  A 1 93  ? 27.187  29.936 -46.277 1.00 109.01 ? 93   DT  I "O3'" 1 
ATOM   1884  C "C2'" . DT  A 1 93  ? 29.434  29.065 -46.483 1.00 100.58 ? 93   DT  I "C2'" 1 
ATOM   1885  C "C1'" . DT  A 1 93  ? 28.974  27.777 -47.129 1.00 98.26  ? 93   DT  I "C1'" 1 
ATOM   1886  N N1    . DT  A 1 93  ? 29.969  26.696 -47.177 1.00 81.90  ? 93   DT  I N1    1 
ATOM   1887  C C2    . DT  A 1 93  ? 29.513  25.433 -47.489 1.00 81.72  ? 93   DT  I C2    1 
ATOM   1888  O O2    . DT  A 1 93  ? 28.351  25.206 -47.802 1.00 83.54  ? 93   DT  I O2    1 
ATOM   1889  N N3    . DT  A 1 93  ? 30.471  24.446 -47.436 1.00 80.05  ? 93   DT  I N3    1 
ATOM   1890  C C4    . DT  A 1 93  ? 31.814  24.605 -47.146 1.00 78.67  ? 93   DT  I C4    1 
ATOM   1891  O O4    . DT  A 1 93  ? 32.559  23.625 -47.134 1.00 76.08  ? 93   DT  I O4    1 
ATOM   1892  C C5    . DT  A 1 93  ? 32.229  25.971 -46.873 1.00 79.64  ? 93   DT  I C5    1 
ATOM   1893  C C7    . DT  A 1 93  ? 33.670  26.248 -46.585 1.00 79.34  ? 93   DT  I C7    1 
ATOM   1894  C C6    . DT  A 1 93  ? 31.297  26.932 -46.895 1.00 81.12  ? 93   DT  I C6    1 
ATOM   1895  P P     . DG  A 1 94  ? 27.012  30.810 -44.931 1.00 161.95 ? 94   DG  I P     1 
ATOM   1896  O OP1   . DG  A 1 94  ? 25.613  31.311 -44.896 1.00 106.00 ? 94   DG  I OP1   1 
ATOM   1897  O OP2   . DG  A 1 94  ? 28.143  31.773 -44.840 1.00 105.63 ? 94   DG  I OP2   1 
ATOM   1898  O "O5'" . DG  A 1 94  ? 27.176  29.744 -43.762 1.00 161.28 ? 94   DG  I "O5'" 1 
ATOM   1899  C "C5'" . DG  A 1 94  ? 27.651  28.437 -44.047 1.00 162.57 ? 94   DG  I "C5'" 1 
ATOM   1900  C "C4'" . DG  A 1 94  ? 26.670  27.406 -43.550 1.00 163.37 ? 94   DG  I "C4'" 1 
ATOM   1901  O "O4'" . DG  A 1 94  ? 27.115  26.100 -43.979 1.00 162.79 ? 94   DG  I "O4'" 1 
ATOM   1902  C "C3'" . DG  A 1 94  ? 26.596  27.347 -42.031 1.00 164.12 ? 94   DG  I "C3'" 1 
ATOM   1903  O "O3'" . DG  A 1 94  ? 25.284  26.986 -41.610 1.00 166.36 ? 94   DG  I "O3'" 1 
ATOM   1904  C "C2'" . DG  A 1 94  ? 27.602  26.274 -41.676 1.00 163.14 ? 94   DG  I "C2'" 1 
ATOM   1905  C "C1'" . DG  A 1 94  ? 27.565  25.332 -42.872 1.00 162.29 ? 94   DG  I "C1'" 1 
ATOM   1906  N N9    . DG  A 1 94  ? 28.892  24.825 -43.204 1.00 104.87 ? 94   DG  I N9    1 
ATOM   1907  C C8    . DG  A 1 94  ? 30.027  25.578 -43.364 1.00 103.86 ? 94   DG  I C8    1 
ATOM   1908  N N7    . DG  A 1 94  ? 31.084  24.864 -43.627 1.00 102.57 ? 94   DG  I N7    1 
ATOM   1909  C C5    . DG  A 1 94  ? 30.622  23.561 -43.652 1.00 102.91 ? 94   DG  I C5    1 
ATOM   1910  C C6    . DG  A 1 94  ? 31.316  22.363 -43.885 1.00 102.33 ? 94   DG  I C6    1 
ATOM   1911  O O6    . DG  A 1 94  ? 32.516  22.206 -44.127 1.00 102.23 ? 94   DG  I O6    1 
ATOM   1912  N N1    . DG  A 1 94  ? 30.471  21.264 -43.815 1.00 102.41 ? 94   DG  I N1    1 
ATOM   1913  C C2    . DG  A 1 94  ? 29.126  21.317 -43.556 1.00 103.22 ? 94   DG  I C2    1 
ATOM   1914  N N2    . DG  A 1 94  ? 28.490  20.139 -43.526 1.00 103.34 ? 94   DG  I N2    1 
ATOM   1915  N N3    . DG  A 1 94  ? 28.459  22.440 -43.342 1.00 103.18 ? 94   DG  I N3    1 
ATOM   1916  C C4    . DG  A 1 94  ? 29.266  23.516 -43.401 1.00 103.54 ? 94   DG  I C4    1 
ATOM   1917  P P     . DA  A 1 95  ? 24.890  27.091 -40.056 1.00 131.97 ? 95   DA  I P     1 
ATOM   1918  O OP1   . DA  A 1 95  ? 23.460  27.483 -40.002 1.00 108.11 ? 95   DA  I OP1   1 
ATOM   1919  O OP2   . DA  A 1 95  ? 25.910  27.917 -39.348 1.00 107.83 ? 95   DA  I OP2   1 
ATOM   1920  O "O5'" . DA  A 1 95  ? 25.002  25.590 -39.546 1.00 130.15 ? 95   DA  I "O5'" 1 
ATOM   1921  C "C5'" . DA  A 1 95  ? 24.172  24.584 -40.107 1.00 129.54 ? 95   DA  I "C5'" 1 
ATOM   1922  C "C4'" . DA  A 1 95  ? 24.622  23.225 -39.636 1.00 129.72 ? 95   DA  I "C4'" 1 
ATOM   1923  O "O4'" . DA  A 1 95  ? 25.915  22.916 -40.211 1.00 129.58 ? 95   DA  I "O4'" 1 
ATOM   1924  C "C3'" . DA  A 1 95  ? 24.800  23.130 -38.122 1.00 129.86 ? 95   DA  I "C3'" 1 
ATOM   1925  O "O3'" . DA  A 1 95  ? 24.326  21.859 -37.676 1.00 130.08 ? 95   DA  I "O3'" 1 
ATOM   1926  C "C2'" . DA  A 1 95  ? 26.301  23.256 -37.935 1.00 128.99 ? 95   DA  I "C2'" 1 
ATOM   1927  C "C1'" . DA  A 1 95  ? 26.821  22.564 -39.178 1.00 128.36 ? 95   DA  I "C1'" 1 
ATOM   1928  N N9    . DA  A 1 95  ? 28.172  22.956 -39.590 1.00 103.94 ? 95   DA  I N9    1 
ATOM   1929  C C8    . DA  A 1 95  ? 28.692  24.220 -39.734 1.00 103.35 ? 95   DA  I C8    1 
ATOM   1930  N N7    . DA  A 1 95  ? 29.949  24.237 -40.103 1.00 101.73 ? 95   DA  I N7    1 
ATOM   1931  C C5    . DA  A 1 95  ? 30.282  22.894 -40.208 1.00 102.54 ? 95   DA  I C5    1 
ATOM   1932  C C6    . DA  A 1 95  ? 31.473  22.243 -40.549 1.00 102.79 ? 95   DA  I C6    1 
ATOM   1933  N N6    . DA  A 1 95  ? 32.599  22.889 -40.862 1.00 101.65 ? 95   DA  I N6    1 
ATOM   1934  N N1    . DA  A 1 95  ? 31.474  20.889 -40.560 1.00 103.10 ? 95   DA  I N1    1 
ATOM   1935  C C2    . DA  A 1 95  ? 30.345  20.245 -40.243 1.00 103.22 ? 95   DA  I C2    1 
ATOM   1936  N N3    . DA  A 1 95  ? 29.161  20.746 -39.901 1.00 103.16 ? 95   DA  I N3    1 
ATOM   1937  C C4    . DA  A 1 95  ? 29.197  22.093 -39.902 1.00 103.00 ? 95   DA  I C4    1 
ATOM   1938  P P     . DT  A 1 96  ? 24.765  21.298 -36.239 1.00 148.16 ? 96   DT  I P     1 
ATOM   1939  O OP1   . DT  A 1 96  ? 23.807  20.219 -35.897 1.00 91.51  ? 96   DT  I OP1   1 
ATOM   1940  O OP2   . DT  A 1 96  ? 24.990  22.424 -35.290 1.00 90.27  ? 96   DT  I OP2   1 
ATOM   1941  O "O5'" . DT  A 1 96  ? 26.164  20.609 -36.534 1.00 146.55 ? 96   DT  I "O5'" 1 
ATOM   1942  C "C5'" . DT  A 1 96  ? 26.217  19.260 -36.972 1.00 144.57 ? 96   DT  I "C5'" 1 
ATOM   1943  C "C4'" . DT  A 1 96  ? 27.296  18.531 -36.216 1.00 144.02 ? 96   DT  I "C4'" 1 
ATOM   1944  O "O4'" . DT  A 1 96  ? 28.585  18.994 -36.686 1.00 142.36 ? 96   DT  I "O4'" 1 
ATOM   1945  C "C3'" . DT  A 1 96  ? 27.259  18.814 -34.712 1.00 144.23 ? 96   DT  I "C3'" 1 
ATOM   1946  O "O3'" . DT  A 1 96  ? 27.618  17.639 -33.976 1.00 144.85 ? 96   DT  I "O3'" 1 
ATOM   1947  C "C2'" . DT  A 1 96  ? 28.311  19.893 -34.540 1.00 142.77 ? 96   DT  I "C2'" 1 
ATOM   1948  C "C1'" . DT  A 1 96  ? 29.330  19.499 -35.596 1.00 141.16 ? 96   DT  I "C1'" 1 
ATOM   1949  N N1    . DT  A 1 96  ? 30.173  20.602 -36.083 1.00 82.20  ? 96   DT  I N1    1 
ATOM   1950  C C2    . DT  A 1 96  ? 31.425  20.283 -36.542 1.00 80.69  ? 96   DT  I C2    1 
ATOM   1951  O O2    . DT  A 1 96  ? 31.829  19.142 -36.604 1.00 80.78  ? 96   DT  I O2    1 
ATOM   1952  N N3    . DT  A 1 96  ? 32.185  21.353 -36.925 1.00 78.73  ? 96   DT  I N3    1 
ATOM   1953  C C4    . DT  A 1 96  ? 31.818  22.686 -36.907 1.00 78.79  ? 96   DT  I C4    1 
ATOM   1954  O O4    . DT  A 1 96  ? 32.612  23.543 -37.288 1.00 76.25  ? 96   DT  I O4    1 
ATOM   1955  C C5    . DT  A 1 96  ? 30.478  22.952 -36.426 1.00 78.69  ? 96   DT  I C5    1 
ATOM   1956  C C7    . DT  A 1 96  ? 29.993  24.367 -36.359 1.00 77.99  ? 96   DT  I C7    1 
ATOM   1957  C C6    . DT  A 1 96  ? 29.729  21.908 -36.053 1.00 80.16  ? 96   DT  I C6    1 
ATOM   1958  P P     . DG  A 1 97  ? 27.102  17.444 -32.460 1.00 120.50 ? 97   DG  I P     1 
ATOM   1959  O OP1   . DG  A 1 97  ? 25.622  17.307 -32.438 1.00 79.04  ? 97   DG  I OP1   1 
ATOM   1960  O OP2   . DG  A 1 97  ? 27.760  18.476 -31.611 1.00 77.36  ? 97   DG  I OP2   1 
ATOM   1961  O "O5'" . DG  A 1 97  ? 27.700  16.028 -32.062 1.00 118.54 ? 97   DG  I "O5'" 1 
ATOM   1962  C "C5'" . DG  A 1 97  ? 28.068  15.099 -33.068 1.00 116.09 ? 97   DG  I "C5'" 1 
ATOM   1963  C "C4'" . DG  A 1 97  ? 29.548  14.820 -32.980 1.00 114.04 ? 97   DG  I "C4'" 1 
ATOM   1964  O "O4'" . DG  A 1 97  ? 30.328  15.953 -33.439 1.00 113.52 ? 97   DG  I "O4'" 1 
ATOM   1965  C "C3'" . DG  A 1 97  ? 30.026  14.539 -31.560 1.00 111.85 ? 97   DG  I "C3'" 1 
ATOM   1966  O "O3'" . DG  A 1 97  ? 30.994  13.503 -31.613 1.00 109.82 ? 97   DG  I "O3'" 1 
ATOM   1967  C "C2'" . DG  A 1 97  ? 30.674  15.847 -31.137 1.00 112.62 ? 97   DG  I "C2'" 1 
ATOM   1968  C "C1'" . DG  A 1 97  ? 31.281  16.309 -32.444 1.00 112.73 ? 97   DG  I "C1'" 1 
ATOM   1969  N N9    . DG  A 1 97  ? 31.542  17.742 -32.559 1.00 69.80  ? 97   DG  I N9    1 
ATOM   1970  C C8    . DG  A 1 97  ? 30.735  18.778 -32.144 1.00 69.66  ? 97   DG  I C8    1 
ATOM   1971  N N7    . DG  A 1 97  ? 31.221  19.958 -32.433 1.00 68.68  ? 97   DG  I N7    1 
ATOM   1972  C C5    . DG  A 1 97  ? 32.427  19.685 -33.070 1.00 68.78  ? 97   DG  I C5    1 
ATOM   1973  C C6    . DG  A 1 97  ? 33.398  20.563 -33.618 1.00 67.60  ? 97   DG  I C6    1 
ATOM   1974  O O6    . DG  A 1 97  ? 33.387  21.799 -33.656 1.00 66.20  ? 97   DG  I O6    1 
ATOM   1975  N N1    . DG  A 1 97  ? 34.470  19.865 -34.162 1.00 66.85  ? 97   DG  I N1    1 
ATOM   1976  C C2    . DG  A 1 97  ? 34.602  18.504 -34.182 1.00 68.56  ? 97   DG  I C2    1 
ATOM   1977  N N2    . DG  A 1 97  ? 35.717  18.029 -34.760 1.00 67.21  ? 97   DG  I N2    1 
ATOM   1978  N N3    . DG  A 1 97  ? 33.708  17.669 -33.674 1.00 69.07  ? 97   DG  I N3    1 
ATOM   1979  C C4    . DG  A 1 97  ? 32.650  18.324 -33.140 1.00 69.37  ? 97   DG  I C4    1 
ATOM   1980  P P     . DG  A 1 98  ? 31.535  12.867 -30.255 1.00 91.94  ? 98   DG  I P     1 
ATOM   1981  O OP1   . DG  A 1 98  ? 31.706  11.407 -30.489 1.00 82.46  ? 98   DG  I OP1   1 
ATOM   1982  O OP2   . DG  A 1 98  ? 30.653  13.357 -29.154 1.00 82.42  ? 98   DG  I OP2   1 
ATOM   1983  O "O5'" . DG  A 1 98  ? 32.969  13.535 -30.075 1.00 91.02  ? 98   DG  I "O5'" 1 
ATOM   1984  C "C5'" . DG  A 1 98  ? 33.992  13.321 -31.040 1.00 87.99  ? 98   DG  I "C5'" 1 
ATOM   1985  C "C4'" . DG  A 1 98  ? 35.177  14.210 -30.751 1.00 86.45  ? 98   DG  I "C4'" 1 
ATOM   1986  O "O4'" . DG  A 1 98  ? 34.881  15.592 -31.068 1.00 85.95  ? 98   DG  I "O4'" 1 
ATOM   1987  C "C3'" . DG  A 1 98  ? 35.629  14.200 -29.296 1.00 85.75  ? 98   DG  I "C3'" 1 
ATOM   1988  O "O3'" . DG  A 1 98  ? 37.044  14.184 -29.257 1.00 86.60  ? 98   DG  I "O3'" 1 
ATOM   1989  C "C2'" . DG  A 1 98  ? 35.141  15.533 -28.765 1.00 85.91  ? 98   DG  I "C2'" 1 
ATOM   1990  C "C1'" . DG  A 1 98  ? 35.281  16.411 -29.986 1.00 86.41  ? 98   DG  I "C1'" 1 
ATOM   1991  N N9    . DG  A 1 98  ? 34.445  17.606 -29.981 1.00 78.99  ? 98   DG  I N9    1 
ATOM   1992  C C8    . DG  A 1 98  ? 33.163  17.724 -29.502 1.00 79.79  ? 98   DG  I C8    1 
ATOM   1993  N N7    . DG  A 1 98  ? 32.688  18.935 -29.601 1.00 79.69  ? 98   DG  I N7    1 
ATOM   1994  C C5    . DG  A 1 98  ? 33.715  19.656 -30.192 1.00 79.91  ? 98   DG  I C5    1 
ATOM   1995  C C6    . DG  A 1 98  ? 33.783  21.025 -30.555 1.00 80.70  ? 98   DG  I C6    1 
ATOM   1996  O O6    . DG  A 1 98  ? 32.916  21.903 -30.427 1.00 81.39  ? 98   DG  I O6    1 
ATOM   1997  N N1    . DG  A 1 98  ? 35.011  21.337 -31.129 1.00 80.43  ? 98   DG  I N1    1 
ATOM   1998  C C2    . DG  A 1 98  ? 36.034  20.448 -31.333 1.00 80.54  ? 98   DG  I C2    1 
ATOM   1999  N N2    . DG  A 1 98  ? 37.132  20.941 -31.900 1.00 80.23  ? 98   DG  I N2    1 
ATOM   2000  N N3    . DG  A 1 98  ? 35.981  19.171 -31.005 1.00 79.96  ? 98   DG  I N3    1 
ATOM   2001  C C4    . DG  A 1 98  ? 34.802  18.847 -30.441 1.00 80.23  ? 98   DG  I C4    1 
ATOM   2002  P P     . DA  A 1 99  ? 37.799  12.838 -28.859 1.00 85.27  ? 99   DA  I P     1 
ATOM   2003  O OP1   . DA  A 1 99  ? 37.138  11.733 -29.604 1.00 77.68  ? 99   DA  I OP1   1 
ATOM   2004  O OP2   . DA  A 1 99  ? 37.888  12.794 -27.382 1.00 77.17  ? 99   DA  I OP2   1 
ATOM   2005  O "O5'" . DA  A 1 99  ? 39.261  13.056 -29.434 1.00 83.68  ? 99   DA  I "O5'" 1 
ATOM   2006  C "C5'" . DA  A 1 99  ? 39.478  13.152 -30.836 1.00 79.52  ? 99   DA  I "C5'" 1 
ATOM   2007  C "C4'" . DA  A 1 99  ? 40.407  14.304 -31.136 1.00 78.02  ? 99   DA  I "C4'" 1 
ATOM   2008  O "O4'" . DA  A 1 99  ? 39.731  15.559 -30.888 1.00 76.65  ? 99   DA  I "O4'" 1 
ATOM   2009  C "C3'" . DA  A 1 99  ? 41.674  14.332 -30.288 1.00 76.24  ? 99   DA  I "C3'" 1 
ATOM   2010  O "O3'" . DA  A 1 99  ? 42.783  14.703 -31.098 1.00 75.22  ? 99   DA  I "O3'" 1 
ATOM   2011  C "C2'" . DA  A 1 99  ? 41.387  15.390 -29.239 1.00 75.81  ? 99   DA  I "C2'" 1 
ATOM   2012  C "C1'" . DA  A 1 99  ? 40.458  16.347 -29.960 1.00 75.57  ? 99   DA  I "C1'" 1 
ATOM   2013  N N9    . DA  A 1 99  ? 39.480  17.005 -29.096 1.00 66.88  ? 99   DA  I N9    1 
ATOM   2014  C C8    . DA  A 1 99  ? 38.686  16.437 -28.123 1.00 66.65  ? 99   DA  I C8    1 
ATOM   2015  N N7    . DA  A 1 99  ? 37.884  17.290 -27.532 1.00 66.19  ? 99   DA  I N7    1 
ATOM   2016  C C5    . DA  A 1 99  ? 38.172  18.502 -28.150 1.00 66.04  ? 99   DA  I C5    1 
ATOM   2017  C C6    . DA  A 1 99  ? 37.667  19.808 -27.971 1.00 65.76  ? 99   DA  I C6    1 
ATOM   2018  N N6    . DA  A 1 99  ? 36.725  20.131 -27.081 1.00 65.19  ? 99   DA  I N6    1 
ATOM   2019  N N1    . DA  A 1 99  ? 38.175  20.789 -28.748 1.00 64.68  ? 99   DA  I N1    1 
ATOM   2020  C C2    . DA  A 1 99  ? 39.126  20.474 -29.632 1.00 65.23  ? 99   DA  I C2    1 
ATOM   2021  N N3    . DA  A 1 99  ? 39.682  19.294 -29.892 1.00 65.69  ? 99   DA  I N3    1 
ATOM   2022  C C4    . DA  A 1 99  ? 39.155  18.340 -29.110 1.00 66.14  ? 99   DA  I C4    1 
ATOM   2023  P P     . DG  A 1 100 ? 44.267  14.487 -30.544 1.00 77.64  ? 100  DG  I P     1 
ATOM   2024  O OP1   . DG  A 1 100 ? 45.159  14.189 -31.694 1.00 80.41  ? 100  DG  I OP1   1 
ATOM   2025  O OP2   . DG  A 1 100 ? 44.189  13.539 -29.409 1.00 78.51  ? 100  DG  I OP2   1 
ATOM   2026  O "O5'" . DG  A 1 100 ? 44.624  15.910 -29.936 1.00 73.21  ? 100  DG  I "O5'" 1 
ATOM   2027  C "C5'" . DG  A 1 100 ? 44.437  17.086 -30.706 1.00 68.21  ? 100  DG  I "C5'" 1 
ATOM   2028  C "C4'" . DG  A 1 100 ? 44.556  18.304 -29.825 1.00 62.26  ? 100  DG  I "C4'" 1 
ATOM   2029  O "O4'" . DG  A 1 100 ? 43.340  18.499 -29.067 1.00 61.60  ? 100  DG  I "O4'" 1 
ATOM   2030  C "C3'" . DG  A 1 100 ? 45.697  18.258 -28.810 1.00 61.33  ? 100  DG  I "C3'" 1 
ATOM   2031  O "O3'" . DG  A 1 100 ? 46.268  19.556 -28.726 1.00 56.39  ? 100  DG  I "O3'" 1 
ATOM   2032  C "C2'" . DG  A 1 100 ? 44.971  17.981 -27.507 1.00 58.76  ? 100  DG  I "C2'" 1 
ATOM   2033  C "C1'" . DG  A 1 100 ? 43.689  18.768 -27.724 1.00 62.94  ? 100  DG  I "C1'" 1 
ATOM   2034  N N9    . DG  A 1 100 ? 42.549  18.431 -26.867 1.00 64.92  ? 100  DG  I N9    1 
ATOM   2035  C C8    . DG  A 1 100 ? 42.224  17.193 -26.370 1.00 64.77  ? 100  DG  I C8    1 
ATOM   2036  N N7    . DG  A 1 100 ? 41.149  17.202 -25.629 1.00 66.00  ? 100  DG  I N7    1 
ATOM   2037  C C5    . DG  A 1 100 ? 40.735  18.523 -25.639 1.00 68.03  ? 100  DG  I C5    1 
ATOM   2038  C C6    . DG  A 1 100 ? 39.623  19.133 -25.011 1.00 68.48  ? 100  DG  I C6    1 
ATOM   2039  O O6    . DG  A 1 100 ? 38.761  18.603 -24.295 1.00 70.63  ? 100  DG  I O6    1 
ATOM   2040  N N1    . DG  A 1 100 ? 39.569  20.498 -25.278 1.00 70.14  ? 100  DG  I N1    1 
ATOM   2041  C C2    . DG  A 1 100 ? 40.480  21.185 -26.044 1.00 69.47  ? 100  DG  I C2    1 
ATOM   2042  N N2    . DG  A 1 100 ? 40.274  22.507 -26.173 1.00 68.79  ? 100  DG  I N2    1 
ATOM   2043  N N3    . DG  A 1 100 ? 41.522  20.621 -26.638 1.00 68.42  ? 100  DG  I N3    1 
ATOM   2044  C C4    . DG  A 1 100 ? 41.586  19.299 -26.395 1.00 66.98  ? 100  DG  I C4    1 
ATOM   2045  P P     . DC  A 1 101 ? 47.838  19.769 -28.958 1.00 47.59  ? 101  DC  I P     1 
ATOM   2046  O OP1   . DC  A 1 101 ? 48.187  19.431 -30.355 1.00 37.41  ? 101  DC  I OP1   1 
ATOM   2047  O OP2   . DC  A 1 101 ? 48.593  19.165 -27.847 1.00 35.70  ? 101  DC  I OP2   1 
ATOM   2048  O "O5'" . DC  A 1 101 ? 47.975  21.339 -28.815 1.00 52.10  ? 101  DC  I "O5'" 1 
ATOM   2049  C "C5'" . DC  A 1 101 ? 47.344  22.184 -29.759 1.00 56.43  ? 101  DC  I "C5'" 1 
ATOM   2050  C "C4'" . DC  A 1 101 ? 46.623  23.315 -29.064 1.00 61.47  ? 101  DC  I "C4'" 1 
ATOM   2051  O "O4'" . DC  A 1 101 ? 45.524  22.818 -28.260 1.00 61.38  ? 101  DC  I "O4'" 1 
ATOM   2052  C "C3'" . DC  A 1 101 ? 47.465  24.191 -28.133 1.00 64.61  ? 101  DC  I "C3'" 1 
ATOM   2053  O "O3'" . DC  A 1 101 ? 47.088  25.558 -28.347 1.00 69.38  ? 101  DC  I "O3'" 1 
ATOM   2054  C "C2'" . DC  A 1 101 ? 47.056  23.723 -26.745 1.00 63.42  ? 101  DC  I "C2'" 1 
ATOM   2055  C "C1'" . DC  A 1 101 ? 45.591  23.401 -26.965 1.00 62.37  ? 101  DC  I "C1'" 1 
ATOM   2056  N N1    . DC  A 1 101 ? 44.992  22.454 -26.018 1.00 50.64  ? 101  DC  I N1    1 
ATOM   2057  C C2    . DC  A 1 101 ? 43.936  22.892 -25.194 1.00 50.93  ? 101  DC  I C2    1 
ATOM   2058  O O2    . DC  A 1 101 ? 43.554  24.080 -25.275 1.00 49.91  ? 101  DC  I O2    1 
ATOM   2059  N N3    . DC  A 1 101 ? 43.362  22.011 -24.337 1.00 49.93  ? 101  DC  I N3    1 
ATOM   2060  C C4    . DC  A 1 101 ? 43.805  20.748 -24.280 1.00 50.67  ? 101  DC  I C4    1 
ATOM   2061  N N4    . DC  A 1 101 ? 43.217  19.908 -23.412 1.00 52.40  ? 101  DC  I N4    1 
ATOM   2062  C C5    . DC  A 1 101 ? 44.875  20.286 -25.105 1.00 50.54  ? 101  DC  I C5    1 
ATOM   2063  C C6    . DC  A 1 101 ? 45.436  21.164 -25.945 1.00 51.57  ? 101  DC  I C6    1 
ATOM   2064  P P     . DA  A 1 102 ? 47.865  26.729 -27.586 1.00 78.62  ? 102  DA  I P     1 
ATOM   2065  O OP1   . DA  A 1 102 ? 47.654  27.961 -28.382 1.00 76.15  ? 102  DA  I OP1   1 
ATOM   2066  O OP2   . DA  A 1 102 ? 49.245  26.278 -27.262 1.00 78.31  ? 102  DA  I OP2   1 
ATOM   2067  O "O5'" . DA  A 1 102 ? 47.064  26.873 -26.221 1.00 78.23  ? 102  DA  I "O5'" 1 
ATOM   2068  C "C5'" . DA  A 1 102 ? 45.758  27.448 -26.203 1.00 78.58  ? 102  DA  I "C5'" 1 
ATOM   2069  C "C4'" . DA  A 1 102 ? 45.283  27.624 -24.780 1.00 78.61  ? 102  DA  I "C4'" 1 
ATOM   2070  O "O4'" . DA  A 1 102 ? 44.900  26.353 -24.198 1.00 76.16  ? 102  DA  I "O4'" 1 
ATOM   2071  C "C3'" . DA  A 1 102 ? 46.308  28.228 -23.819 1.00 77.98  ? 102  DA  I "C3'" 1 
ATOM   2072  O "O3'" . DA  A 1 102 ? 45.619  29.119 -22.937 1.00 79.95  ? 102  DA  I "O3'" 1 
ATOM   2073  C "C2'" . DA  A 1 102 ? 46.806  27.015 -23.050 1.00 76.07  ? 102  DA  I "C2'" 1 
ATOM   2074  C "C1'" . DA  A 1 102 ? 45.523  26.231 -22.933 1.00 74.94  ? 102  DA  I "C1'" 1 
ATOM   2075  N N9    . DA  A 1 102 ? 45.631  24.812 -22.618 1.00 72.29  ? 102  DA  I N9    1 
ATOM   2076  C C8    . DA  A 1 102 ? 46.582  23.892 -22.988 1.00 73.19  ? 102  DA  I C8    1 
ATOM   2077  N N7    . DA  A 1 102 ? 46.336  22.677 -22.556 1.00 70.68  ? 102  DA  I N7    1 
ATOM   2078  C C5    . DA  A 1 102 ? 45.148  22.813 -21.846 1.00 70.01  ? 102  DA  I C5    1 
ATOM   2079  C C6    . DA  A 1 102 ? 44.347  21.892 -21.148 1.00 68.27  ? 102  DA  I C6    1 
ATOM   2080  N N6    . DA  A 1 102 ? 44.623  20.587 -21.055 1.00 66.22  ? 102  DA  I N6    1 
ATOM   2081  N N1    . DA  A 1 102 ? 43.232  22.363 -20.542 1.00 67.27  ? 102  DA  I N1    1 
ATOM   2082  C C2    . DA  A 1 102 ? 42.948  23.663 -20.642 1.00 66.85  ? 102  DA  I C2    1 
ATOM   2083  N N3    . DA  A 1 102 ? 43.613  24.621 -21.276 1.00 68.87  ? 102  DA  I N3    1 
ATOM   2084  C C4    . DA  A 1 102 ? 44.715  24.124 -21.865 1.00 70.48  ? 102  DA  I C4    1 
ATOM   2085  P P     . DG  A 1 103 ? 46.448  30.065 -21.939 1.00 72.61  ? 103  DG  I P     1 
ATOM   2086  O OP1   . DG  A 1 103 ? 46.476  31.425 -22.526 1.00 62.15  ? 103  DG  I OP1   1 
ATOM   2087  O OP2   . DG  A 1 103 ? 47.709  29.401 -21.540 1.00 59.56  ? 103  DG  I OP2   1 
ATOM   2088  O "O5'" . DG  A 1 103 ? 45.557  30.106 -20.628 1.00 73.87  ? 103  DG  I "O5'" 1 
ATOM   2089  C "C5'" . DG  A 1 103 ? 44.183  30.459 -20.683 1.00 74.10  ? 103  DG  I "C5'" 1 
ATOM   2090  C "C4'" . DG  A 1 103 ? 43.511  30.013 -19.412 1.00 76.20  ? 103  DG  I "C4'" 1 
ATOM   2091  O "O4'" . DG  A 1 103 ? 43.597  28.572 -19.348 1.00 75.70  ? 103  DG  I "O4'" 1 
ATOM   2092  C "C3'" . DG  A 1 103 ? 44.219  30.520 -18.161 1.00 78.22  ? 103  DG  I "C3'" 1 
ATOM   2093  O "O3'" . DG  A 1 103 ? 43.255  30.753 -17.140 1.00 83.24  ? 103  DG  I "O3'" 1 
ATOM   2094  C "C2'" . DG  A 1 103 ? 45.136  29.371 -17.784 1.00 76.79  ? 103  DG  I "C2'" 1 
ATOM   2095  C "C1'" . DG  A 1 103 ? 44.311  28.174 -18.197 1.00 76.20  ? 103  DG  I "C1'" 1 
ATOM   2096  N N9    . DG  A 1 103 ? 45.073  26.992 -18.556 1.00 65.78  ? 103  DG  I N9    1 
ATOM   2097  C C8    . DG  A 1 103 ? 46.078  26.903 -19.480 1.00 65.06  ? 103  DG  I C8    1 
ATOM   2098  N N7    . DG  A 1 103 ? 46.541  25.692 -19.614 1.00 65.14  ? 103  DG  I N7    1 
ATOM   2099  C C5    . DG  A 1 103 ? 45.795  24.941 -18.720 1.00 66.03  ? 103  DG  I C5    1 
ATOM   2100  C C6    . DG  A 1 103 ? 45.823  23.547 -18.438 1.00 67.07  ? 103  DG  I C6    1 
ATOM   2101  O O6    . DG  A 1 103 ? 46.524  22.661 -18.966 1.00 67.27  ? 103  DG  I O6    1 
ATOM   2102  N N1    . DG  A 1 103 ? 44.906  23.210 -17.441 1.00 68.51  ? 103  DG  I N1    1 
ATOM   2103  C C2    . DG  A 1 103 ? 44.060  24.097 -16.812 1.00 69.51  ? 103  DG  I C2    1 
ATOM   2104  N N2    . DG  A 1 103 ? 43.257  23.591 -15.860 1.00 70.29  ? 103  DG  I N2    1 
ATOM   2105  N N3    . DG  A 1 103 ? 44.009  25.390 -17.094 1.00 68.23  ? 103  DG  I N3    1 
ATOM   2106  C C4    . DG  A 1 103 ? 44.898  25.737 -18.047 1.00 66.29  ? 103  DG  I C4    1 
ATOM   2107  P P     . DT  A 1 104 ? 43.671  31.573 -15.833 1.00 118.78 ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 104 ? 42.578  32.536 -15.538 1.00 78.96  ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 104 ? 45.052  32.067 -16.043 1.00 79.37  ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 104 ? 43.700  30.458 -14.700 1.00 122.17 ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 104 ? 42.488  29.854 -14.257 1.00 124.81 ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 104 ? 42.757  28.945 -13.084 1.00 126.30 ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 104 ? 43.293  27.672 -13.523 1.00 125.08 ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 104 ? 43.764  29.512 -12.090 1.00 127.57 ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 104 ? 43.331  29.222 -10.769 1.00 130.78 ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 104 ? 45.039  28.752 -12.410 1.00 125.80 ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 104 ? 44.504  27.397 -12.839 1.00 124.53 ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 104 ? 45.382  26.656 -13.762 1.00 81.80  ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 104 ? 45.514  25.290 -13.601 1.00 81.56  ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 104 ? 44.929  24.661 -12.749 1.00 82.21  ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 104 ? 46.362  24.685 -14.491 1.00 81.35  ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 104 ? 47.067  25.289 -15.510 1.00 79.94  ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 104 ? 47.782  24.617 -16.231 1.00 79.70  ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 104 ? 46.879  26.721 -15.632 1.00 79.74  ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 104 ? 47.603  27.461 -16.713 1.00 78.50  ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 104 ? 46.057  27.324 -14.761 1.00 80.95  ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 105 ? 44.074  29.899 -9.524  1.00 122.09 ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 105 ? 43.214  31.015 -9.054  1.00 112.78 ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 105 ? 45.491  30.166 -9.882  1.00 113.13 ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 105 ? 44.055  28.733 -8.448  1.00 122.25 ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 105 ? 43.087  27.696 -8.540  1.00 123.63 ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 105 ? 43.706  26.373 -8.159  1.00 124.59 ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 105 ? 44.497  25.825 -9.243  1.00 123.70 ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 105 ? 44.635  26.446 -6.948  1.00 125.31 ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 105 ? 44.371  25.355 -6.070  1.00 127.21 ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 105 ? 46.023  26.312 -7.554  1.00 123.87 ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 105 ? 45.749  25.395 -8.729  1.00 122.08 ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 105 ? 46.749  25.436 -9.825  1.00 109.62 ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 105 ? 47.357  24.247 -10.204 1.00 108.39 ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 105 ? 47.109  23.169 -9.686  1.00 108.03 ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 105 ? 48.274  24.371 -11.221 1.00 106.55 ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 105 ? 48.641  25.528 -11.880 1.00 105.42 ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 105 ? 49.489  25.480 -12.767 1.00 104.19 ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 105 ? 47.964  26.735 -11.436 1.00 105.62 ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 105 ? 48.293  28.038 -12.094 1.00 104.43 ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 105 ? 47.065  26.628 -10.446 1.00 107.54 ? 105  DT  I C6    1 
ATOM   2147  P P     . DT  A 1 106 ? 45.289  25.152 -4.776  1.00 193.86 ? 106  DT  I P     1 
ATOM   2148  O OP1   . DT  A 1 106 ? 44.441  24.614 -3.681  1.00 94.66  ? 106  DT  I OP1   1 
ATOM   2149  O OP2   . DT  A 1 106 ? 46.057  26.412 -4.569  1.00 93.95  ? 106  DT  I OP2   1 
ATOM   2150  O "O5'" . DT  A 1 106 ? 46.283  24.003 -5.235  1.00 193.89 ? 106  DT  I "O5'" 1 
ATOM   2151  C "C5'" . DT  A 1 106 ? 45.775  22.742 -5.649  1.00 193.40 ? 106  DT  I "C5'" 1 
ATOM   2152  C "C4'" . DT  A 1 106 ? 46.879  21.717 -5.617  1.00 193.03 ? 106  DT  I "C4'" 1 
ATOM   2153  O "O4'" . DT  A 1 106 ? 47.740  21.890 -6.769  1.00 193.06 ? 106  DT  I "O4'" 1 
ATOM   2154  C "C3'" . DT  A 1 106 ? 47.774  21.860 -4.389  1.00 192.67 ? 106  DT  I "C3'" 1 
ATOM   2155  O "O3'" . DT  A 1 106 ? 48.128  20.576 -3.880  1.00 192.33 ? 106  DT  I "O3'" 1 
ATOM   2156  C "C2'" . DT  A 1 106 ? 48.991  22.598 -4.918  1.00 192.49 ? 106  DT  I "C2'" 1 
ATOM   2157  C "C1'" . DT  A 1 106 ? 49.079  22.094 -6.347  1.00 191.64 ? 106  DT  I "C1'" 1 
ATOM   2158  N N1    . DT  A 1 106 ? 49.726  23.024 -7.300  1.00 90.62  ? 106  DT  I N1    1 
ATOM   2159  C C2    . DT  A 1 106 ? 50.581  22.486 -8.241  1.00 89.56  ? 106  DT  I C2    1 
ATOM   2160  O O2    . DT  A 1 106 ? 50.783  21.285 -8.352  1.00 88.57  ? 106  DT  I O2    1 
ATOM   2161  N N3    . DT  A 1 106 ? 51.185  23.409 -9.062  1.00 88.19  ? 106  DT  I N3    1 
ATOM   2162  C C4    . DT  A 1 106 ? 51.004  24.779 -9.055  1.00 87.86  ? 106  DT  I C4    1 
ATOM   2163  O O4    . DT  A 1 106 ? 51.626  25.481 -9.853  1.00 87.22  ? 106  DT  I O4    1 
ATOM   2164  C C5    . DT  A 1 106 ? 50.062  25.272 -8.067  1.00 87.99  ? 106  DT  I C5    1 
ATOM   2165  C C7    . DT  A 1 106 ? 49.764  26.739 -8.013  1.00 87.58  ? 106  DT  I C7    1 
ATOM   2166  C C6    . DT  A 1 106 ? 49.487  24.382 -7.244  1.00 89.02  ? 106  DT  I C6    1 
ATOM   2167  P P     . DC  A 1 107 ? 49.125  20.473 -2.630  1.00 130.02 ? 107  DC  I P     1 
ATOM   2168  O OP1   . DC  A 1 107 ? 48.865  19.172 -1.957  1.00 89.85  ? 107  DC  I OP1   1 
ATOM   2169  O OP2   . DC  A 1 107 ? 49.037  21.736 -1.853  1.00 88.42  ? 107  DC  I OP2   1 
ATOM   2170  O "O5'" . DC  A 1 107 ? 50.556  20.421 -3.323  1.00 129.08 ? 107  DC  I "O5'" 1 
ATOM   2171  C "C5'" . DC  A 1 107 ? 50.829  19.468 -4.345  1.00 128.42 ? 107  DC  I "C5'" 1 
ATOM   2172  C "C4'" . DC  A 1 107 ? 52.301  19.472 -4.677  1.00 128.05 ? 107  DC  I "C4'" 1 
ATOM   2173  O "O4'" . DC  A 1 107 ? 52.636  20.598 -5.521  1.00 127.53 ? 107  DC  I "O4'" 1 
ATOM   2174  C "C3'" . DC  A 1 107 ? 53.200  19.583 -3.449  1.00 127.22 ? 107  DC  I "C3'" 1 
ATOM   2175  O "O3'" . DC  A 1 107 ? 54.357  18.775 -3.630  1.00 126.02 ? 107  DC  I "O3'" 1 
ATOM   2176  C "C2'" . DC  A 1 107 ? 53.587  21.049 -3.433  1.00 127.30 ? 107  DC  I "C2'" 1 
ATOM   2177  C "C1'" . DC  A 1 107 ? 53.680  21.346 -4.918  1.00 126.26 ? 107  DC  I "C1'" 1 
ATOM   2178  N N1    . DC  A 1 107 ? 53.512  22.757 -5.306  1.00 83.81  ? 107  DC  I N1    1 
ATOM   2179  C C2    . DC  A 1 107 ? 53.882  23.131 -6.593  1.00 82.14  ? 107  DC  I C2    1 
ATOM   2180  O O2    . DC  A 1 107 ? 54.339  22.260 -7.346  1.00 80.63  ? 107  DC  I O2    1 
ATOM   2181  N N3    . DC  A 1 107 ? 53.736  24.425 -6.984  1.00 80.63  ? 107  DC  I N3    1 
ATOM   2182  C C4    . DC  A 1 107 ? 53.247  25.328 -6.128  1.00 81.23  ? 107  DC  I C4    1 
ATOM   2183  N N4    . DC  A 1 107 ? 53.118  26.592 -6.548  1.00 79.94  ? 107  DC  I N4    1 
ATOM   2184  C C5    . DC  A 1 107 ? 52.864  24.973 -4.800  1.00 82.27  ? 107  DC  I C5    1 
ATOM   2185  C C6    . DC  A 1 107 ? 53.010  23.687 -4.435  1.00 82.95  ? 107  DC  I C6    1 
ATOM   2186  P P     . DC  A 1 108 ? 54.870  17.866 -2.420  1.00 96.95  ? 108  DC  I P     1 
ATOM   2187  O OP1   . DC  A 1 108 ? 53.987  16.668 -2.324  1.00 93.17  ? 108  DC  I OP1   1 
ATOM   2188  O OP2   . DC  A 1 108 ? 55.006  18.795 -1.262  1.00 91.39  ? 108  DC  I OP2   1 
ATOM   2189  O "O5'" . DC  A 1 108 ? 56.313  17.371 -2.874  1.00 95.09  ? 108  DC  I "O5'" 1 
ATOM   2190  C "C5'" . DC  A 1 108 ? 56.462  16.382 -3.892  1.00 91.34  ? 108  DC  I "C5'" 1 
ATOM   2191  C "C4'" . DC  A 1 108 ? 57.737  16.634 -4.660  1.00 88.54  ? 108  DC  I "C4'" 1 
ATOM   2192  O "O4'" . DC  A 1 108 ? 57.631  17.911 -5.327  1.00 87.05  ? 108  DC  I "O4'" 1 
ATOM   2193  C "C3'" . DC  A 1 108 ? 58.978  16.732 -3.778  1.00 86.59  ? 108  DC  I "C3'" 1 
ATOM   2194  O "O3'" . DC  A 1 108 ? 60.102  16.288 -4.519  1.00 84.02  ? 108  DC  I "O3'" 1 
ATOM   2195  C "C2'" . DC  A 1 108 ? 59.099  18.220 -3.528  1.00 86.29  ? 108  DC  I "C2'" 1 
ATOM   2196  C "C1'" . DC  A 1 108 ? 58.651  18.772 -4.861  1.00 87.30  ? 108  DC  I "C1'" 1 
ATOM   2197  N N1    . DC  A 1 108 ? 58.124  20.143 -4.851  1.00 82.30  ? 108  DC  I N1    1 
ATOM   2198  C C2    . DC  A 1 108 ? 58.414  20.948 -5.938  1.00 81.70  ? 108  DC  I C2    1 
ATOM   2199  O O2    . DC  A 1 108 ? 59.032  20.443 -6.891  1.00 81.42  ? 108  DC  I O2    1 
ATOM   2200  N N3    . DC  A 1 108 ? 58.013  22.242 -5.941  1.00 81.54  ? 108  DC  I N3    1 
ATOM   2201  C C4    . DC  A 1 108 ? 57.315  22.719 -4.918  1.00 81.52  ? 108  DC  I C4    1 
ATOM   2202  N N4    . DC  A 1 108 ? 56.944  23.995 -4.960  1.00 80.78  ? 108  DC  I N4    1 
ATOM   2203  C C5    . DC  A 1 108 ? 56.967  21.904 -3.806  1.00 81.99  ? 108  DC  I C5    1 
ATOM   2204  C C6    . DC  A 1 108 ? 57.391  20.631 -3.809  1.00 82.33  ? 108  DC  I C6    1 
ATOM   2205  P P     . DA  A 1 109 ? 60.374  14.721 -4.675  1.00 93.60  ? 109  DA  I P     1 
ATOM   2206  O OP1   . DA  A 1 109 ? 59.072  14.075 -4.966  1.00 85.88  ? 109  DA  I OP1   1 
ATOM   2207  O OP2   . DA  A 1 109 ? 61.170  14.266 -3.511  1.00 86.72  ? 109  DA  I OP2   1 
ATOM   2208  O "O5'" . DA  A 1 109 ? 61.284  14.634 -5.977  1.00 93.17  ? 109  DA  I "O5'" 1 
ATOM   2209  C "C5'" . DA  A 1 109 ? 60.703  14.681 -7.278  1.00 90.00  ? 109  DA  I "C5'" 1 
ATOM   2210  C "C4'" . DA  A 1 109 ? 61.469  15.639 -8.160  1.00 88.42  ? 109  DA  I "C4'" 1 
ATOM   2211  O "O4'" . DA  A 1 109 ? 61.186  17.007 -7.783  1.00 86.70  ? 109  DA  I "O4'" 1 
ATOM   2212  C "C3'" . DA  A 1 109 ? 62.988  15.488 -8.091  1.00 87.84  ? 109  DA  I "C3'" 1 
ATOM   2213  O "O3'" . DA  A 1 109 ? 63.551  15.657 -9.397  1.00 86.89  ? 109  DA  I "O3'" 1 
ATOM   2214  C "C2'" . DA  A 1 109 ? 63.414  16.613 -7.166  1.00 86.48  ? 109  DA  I "C2'" 1 
ATOM   2215  C "C1'" . DA  A 1 109 ? 62.398  17.691 -7.483  1.00 86.20  ? 109  DA  I "C1'" 1 
ATOM   2216  N N9    . DA  A 1 109 ? 62.131  18.603 -6.372  1.00 78.21  ? 109  DA  I N9    1 
ATOM   2217  C C8    . DA  A 1 109 ? 62.166  18.314 -5.030  1.00 78.79  ? 109  DA  I C8    1 
ATOM   2218  N N7    . DA  A 1 109 ? 61.825  19.322 -4.263  1.00 78.95  ? 109  DA  I N7    1 
ATOM   2219  C C5    . DA  A 1 109 ? 61.557  20.350 -5.159  1.00 77.84  ? 109  DA  I C5    1 
ATOM   2220  C C6    . DA  A 1 109 ? 61.120  21.687 -4.978  1.00 77.27  ? 109  DA  I C6    1 
ATOM   2221  N N6    . DA  A 1 109 ? 60.817  22.227 -3.794  1.00 75.73  ? 109  DA  I N6    1 
ATOM   2222  N N1    . DA  A 1 109 ? 60.981  22.450 -6.080  1.00 76.97  ? 109  DA  I N1    1 
ATOM   2223  C C2    . DA  A 1 109 ? 61.232  21.898 -7.276  1.00 77.10  ? 109  DA  I C2    1 
ATOM   2224  N N3    . DA  A 1 109 ? 61.614  20.655 -7.576  1.00 77.65  ? 109  DA  I N3    1 
ATOM   2225  C C4    . DA  A 1 109 ? 61.764  19.925 -6.461  1.00 77.89  ? 109  DA  I C4    1 
ATOM   2226  P P     . DA  A 1 110 ? 65.146  15.656 -9.585  1.00 89.36  ? 110  DA  I P     1 
ATOM   2227  O OP1   . DA  A 1 110 ? 65.442  14.896 -10.825 1.00 82.55  ? 110  DA  I OP1   1 
ATOM   2228  O OP2   . DA  A 1 110 ? 65.799  15.264 -8.311  1.00 82.27  ? 110  DA  I OP2   1 
ATOM   2229  O "O5'" . DA  A 1 110 ? 65.467  17.190 -9.839  1.00 89.65  ? 110  DA  I "O5'" 1 
ATOM   2230  C "C5'" . DA  A 1 110 ? 64.840  17.888 -10.906 1.00 86.65  ? 110  DA  I "C5'" 1 
ATOM   2231  C "C4'" . DA  A 1 110 ? 65.292  19.326 -10.911 1.00 86.14  ? 110  DA  I "C4'" 1 
ATOM   2232  O "O4'" . DA  A 1 110 ? 64.742  19.992 -9.755  1.00 86.39  ? 110  DA  I "O4'" 1 
ATOM   2233  C "C3'" . DA  A 1 110 ? 66.806  19.496 -10.809 1.00 86.01  ? 110  DA  I "C3'" 1 
ATOM   2234  O "O3'" . DA  A 1 110 ? 67.195  20.659 -11.534 1.00 85.02  ? 110  DA  I "O3'" 1 
ATOM   2235  C "C2'" . DA  A 1 110 ? 67.025  19.719 -9.327  1.00 85.85  ? 110  DA  I "C2'" 1 
ATOM   2236  C "C1'" . DA  A 1 110 ? 65.793  20.520 -8.966  1.00 85.50  ? 110  DA  I "C1'" 1 
ATOM   2237  N N9    . DA  A 1 110 ? 65.392  20.424 -7.569  1.00 77.27  ? 110  DA  I N9    1 
ATOM   2238  C C8    . DA  A 1 110 ? 65.343  19.315 -6.769  1.00 77.61  ? 110  DA  I C8    1 
ATOM   2239  N N7    . DA  A 1 110 ? 64.951  19.567 -5.547  1.00 77.88  ? 110  DA  I N7    1 
ATOM   2240  C C5    . DA  A 1 110 ? 64.728  20.937 -5.546  1.00 77.91  ? 110  DA  I C5    1 
ATOM   2241  C C6    . DA  A 1 110 ? 64.305  21.831 -4.543  1.00 77.83  ? 110  DA  I C6    1 
ATOM   2242  N N6    . DA  A 1 110 ? 64.032  21.461 -3.286  1.00 78.05  ? 110  DA  I N6    1 
ATOM   2243  N N1    . DA  A 1 110 ? 64.173  23.136 -4.879  1.00 76.71  ? 110  DA  I N1    1 
ATOM   2244  C C2    . DA  A 1 110 ? 64.456  23.502 -6.130  1.00 76.49  ? 110  DA  I C2    1 
ATOM   2245  N N3    . DA  A 1 110 ? 64.868  22.759 -7.150  1.00 76.74  ? 110  DA  I N3    1 
ATOM   2246  C C4    . DA  A 1 110 ? 64.986  21.472 -6.786  1.00 76.98  ? 110  DA  I C4    1 
ATOM   2247  P P     . DA  A 1 111 ? 68.726  20.859 -11.968 1.00 86.05  ? 111  DA  I P     1 
ATOM   2248  O OP1   . DA  A 1 111 ? 68.969  20.097 -13.221 1.00 74.40  ? 111  DA  I OP1   1 
ATOM   2249  O OP2   . DA  A 1 111 ? 69.580  20.608 -10.784 1.00 75.36  ? 111  DA  I OP2   1 
ATOM   2250  O "O5'" . DA  A 1 111 ? 68.792  22.419 -12.262 1.00 84.13  ? 111  DA  I "O5'" 1 
ATOM   2251  C "C5'" . DA  A 1 111 ? 67.608  23.157 -12.557 1.00 81.53  ? 111  DA  I "C5'" 1 
ATOM   2252  C "C4'" . DA  A 1 111 ? 67.646  24.494 -11.859 1.00 81.19  ? 111  DA  I "C4'" 1 
ATOM   2253  O "O4'" . DA  A 1 111 ? 67.106  24.376 -10.521 1.00 81.71  ? 111  DA  I "O4'" 1 
ATOM   2254  C "C3'" . DA  A 1 111 ? 69.065  25.037 -11.708 1.00 78.57  ? 111  DA  I "C3'" 1 
ATOM   2255  O "O3'" . DA  A 1 111 ? 69.131  26.432 -11.964 1.00 74.23  ? 111  DA  I "O3'" 1 
ATOM   2256  C "C2'" . DA  A 1 111 ? 69.402  24.766 -10.259 1.00 81.20  ? 111  DA  I "C2'" 1 
ATOM   2257  C "C1'" . DA  A 1 111 ? 68.057  24.806 -9.560  1.00 82.79  ? 111  DA  I "C1'" 1 
ATOM   2258  N N9    . DA  A 1 111 ? 68.010  23.872 -8.434  1.00 74.04  ? 111  DA  I N9    1 
ATOM   2259  C C8    . DA  A 1 111 ? 68.297  22.530 -8.469  1.00 74.15  ? 111  DA  I C8    1 
ATOM   2260  N N7    . DA  A 1 111 ? 68.214  21.937 -7.302  1.00 75.73  ? 111  DA  I N7    1 
ATOM   2261  C C5    . DA  A 1 111 ? 67.840  22.955 -6.441  1.00 74.87  ? 111  DA  I C5    1 
ATOM   2262  C C6    . DA  A 1 111 ? 67.593  22.974 -5.066  1.00 75.00  ? 111  DA  I C6    1 
ATOM   2263  N N6    . DA  A 1 111 ? 67.707  21.903 -4.290  1.00 73.45  ? 111  DA  I N6    1 
ATOM   2264  N N1    . DA  A 1 111 ? 67.224  24.144 -4.507  1.00 74.89  ? 111  DA  I N1    1 
ATOM   2265  C C2    . DA  A 1 111 ? 67.123  25.223 -5.291  1.00 75.80  ? 111  DA  I C2    1 
ATOM   2266  N N3    . DA  A 1 111 ? 67.339  25.336 -6.601  1.00 74.71  ? 111  DA  I N3    1 
ATOM   2267  C C4    . DA  A 1 111 ? 67.698  24.151 -7.124  1.00 74.31  ? 111  DA  I C4    1 
ATOM   2268  P P     . DT  A 1 112 ? 70.517  27.202 -11.749 1.00 55.02  ? 112  DT  I P     1 
ATOM   2269  O OP1   . DT  A 1 112 ? 70.719  28.173 -12.850 1.00 69.16  ? 112  DT  I OP1   1 
ATOM   2270  O OP2   . DT  A 1 112 ? 71.550  26.184 -11.484 1.00 67.24  ? 112  DT  I OP2   1 
ATOM   2271  O "O5'" . DT  A 1 112 ? 70.235  28.031 -10.427 1.00 58.85  ? 112  DT  I "O5'" 1 
ATOM   2272  C "C5'" . DT  A 1 112 ? 69.074  28.853 -10.345 1.00 66.75  ? 112  DT  I "C5'" 1 
ATOM   2273  C "C4'" . DT  A 1 112 ? 69.062  29.648 -9.060  1.00 70.71  ? 112  DT  I "C4'" 1 
ATOM   2274  O "O4'" . DT  A 1 112 ? 68.857  28.771 -7.927  1.00 70.80  ? 112  DT  I "O4'" 1 
ATOM   2275  C "C3'" . DT  A 1 112 ? 70.323  30.456 -8.758  1.00 73.84  ? 112  DT  I "C3'" 1 
ATOM   2276  O "O3'" . DT  A 1 112 ? 69.942  31.725 -8.235  1.00 79.56  ? 112  DT  I "O3'" 1 
ATOM   2277  C "C2'" . DT  A 1 112 ? 71.045  29.627 -7.708  1.00 73.85  ? 112  DT  I "C2'" 1 
ATOM   2278  C "C1'" . DT  A 1 112 ? 69.910  28.920 -6.981  1.00 72.21  ? 112  DT  I "C1'" 1 
ATOM   2279  N N1    . DT  A 1 112 ? 70.232  27.570 -6.470  1.00 82.61  ? 112  DT  I N1    1 
ATOM   2280  C C2    . DT  A 1 112 ? 70.101  27.347 -5.116  1.00 82.66  ? 112  DT  I C2    1 
ATOM   2281  O O2    . DT  A 1 112 ? 69.787  28.224 -4.323  1.00 82.54  ? 112  DT  I O2    1 
ATOM   2282  N N3    . DT  A 1 112 ? 70.352  26.054 -4.722  1.00 81.97  ? 112  DT  I N3    1 
ATOM   2283  C C4    . DT  A 1 112 ? 70.716  24.995 -5.525  1.00 81.39  ? 112  DT  I C4    1 
ATOM   2284  O O4    . DT  A 1 112 ? 70.873  23.884 -5.036  1.00 80.38  ? 112  DT  I O4    1 
ATOM   2285  C C5    . DT  A 1 112 ? 70.872  25.306 -6.922  1.00 81.57  ? 112  DT  I C5    1 
ATOM   2286  C C7    . DT  A 1 112 ? 71.297  24.216 -7.853  1.00 81.65  ? 112  DT  I C7    1 
ATOM   2287  C C6    . DT  A 1 112 ? 70.627  26.561 -7.325  1.00 82.86  ? 112  DT  I C6    1 
ATOM   2288  P P     . DA  A 1 113 ? 71.039  32.876 -8.076  1.00 124.79 ? 113  DA  I P     1 
ATOM   2289  O OP1   . DA  A 1 113 ? 70.344  34.185 -8.196  1.00 67.41  ? 113  DA  I OP1   1 
ATOM   2290  O OP2   . DA  A 1 113 ? 72.174  32.561 -8.975  1.00 65.75  ? 113  DA  I OP2   1 
ATOM   2291  O "O5'" . DA  A 1 113 ? 71.535  32.676 -6.581  1.00 127.89 ? 113  DA  I "O5'" 1 
ATOM   2292  C "C5'" . DA  A 1 113 ? 70.664  32.947 -5.493  1.00 131.39 ? 113  DA  I "C5'" 1 
ATOM   2293  C "C4'" . DA  A 1 113 ? 71.419  32.835 -4.192  1.00 133.86 ? 113  DA  I "C4'" 1 
ATOM   2294  O "O4'" . DA  A 1 113 ? 71.565  31.440 -3.828  1.00 134.21 ? 113  DA  I "O4'" 1 
ATOM   2295  C "C3'" . DA  A 1 113 ? 72.834  33.420 -4.251  1.00 135.68 ? 113  DA  I "C3'" 1 
ATOM   2296  O "O3'" . DA  A 1 113 ? 73.131  34.175 -3.061  1.00 139.46 ? 113  DA  I "O3'" 1 
ATOM   2297  C "C2'" . DA  A 1 113 ? 73.714  32.186 -4.360  1.00 134.52 ? 113  DA  I "C2'" 1 
ATOM   2298  C "C1'" . DA  A 1 113 ? 72.930  31.157 -3.564  1.00 133.93 ? 113  DA  I "C1'" 1 
ATOM   2299  N N9    . DA  A 1 113 ? 73.189  29.766 -3.939  1.00 76.13  ? 113  DA  I N9    1 
ATOM   2300  C C8    . DA  A 1 113 ? 73.443  29.261 -5.194  1.00 76.23  ? 113  DA  I C8    1 
ATOM   2301  N N7    . DA  A 1 113 ? 73.626  27.963 -5.216  1.00 76.47  ? 113  DA  I N7    1 
ATOM   2302  C C5    . DA  A 1 113 ? 73.485  27.586 -3.889  1.00 76.57  ? 113  DA  I C5    1 
ATOM   2303  C C6    . DA  A 1 113 ? 73.553  26.336 -3.253  1.00 76.99  ? 113  DA  I C6    1 
ATOM   2304  N N6    . DA  A 1 113 ? 73.807  25.196 -3.900  1.00 76.97  ? 113  DA  I N6    1 
ATOM   2305  N N1    . DA  A 1 113 ? 73.355  26.296 -1.916  1.00 77.19  ? 113  DA  I N1    1 
ATOM   2306  C C2    . DA  A 1 113 ? 73.119  27.448 -1.271  1.00 76.96  ? 113  DA  I C2    1 
ATOM   2307  N N3    . DA  A 1 113 ? 73.035  28.689 -1.759  1.00 76.70  ? 113  DA  I N3    1 
ATOM   2308  C C4    . DA  A 1 113 ? 73.224  28.687 -3.090  1.00 76.18  ? 113  DA  I C4    1 
ATOM   2309  P P     . DC  A 1 114 ? 74.357  35.227 -3.056  1.00 136.48 ? 114  DC  I P     1 
ATOM   2310  O OP1   . DC  A 1 114 ? 74.586  35.613 -1.649  1.00 79.80  ? 114  DC  I OP1   1 
ATOM   2311  O OP2   . DC  A 1 114 ? 74.135  36.290 -4.070  1.00 79.87  ? 114  DC  I OP2   1 
ATOM   2312  O "O5'" . DC  A 1 114 ? 75.593  34.346 -3.535  1.00 138.88 ? 114  DC  I "O5'" 1 
ATOM   2313  C "C5'" . DC  A 1 114 ? 76.828  34.384 -2.834  1.00 142.06 ? 114  DC  I "C5'" 1 
ATOM   2314  C "C4'" . DC  A 1 114 ? 76.661  33.819 -1.444  1.00 144.12 ? 114  DC  I "C4'" 1 
ATOM   2315  O "O4'" . DC  A 1 114 ? 76.206  32.442 -1.480  1.00 143.76 ? 114  DC  I "O4'" 1 
ATOM   2316  C "C3'" . DC  A 1 114 ? 77.968  33.804 -0.661  1.00 145.81 ? 114  DC  I "C3'" 1 
ATOM   2317  O "O3'" . DC  A 1 114 ? 77.734  34.134 0.700   1.00 149.78 ? 114  DC  I "O3'" 1 
ATOM   2318  C "C2'" . DC  A 1 114 ? 78.435  32.370 -0.775  1.00 144.32 ? 114  DC  I "C2'" 1 
ATOM   2319  C "C1'" . DC  A 1 114 ? 77.121  31.616 -0.777  1.00 142.43 ? 114  DC  I "C1'" 1 
ATOM   2320  N N1    . DC  A 1 114 ? 77.213  30.336 -1.485  1.00 83.58  ? 114  DC  I N1    1 
ATOM   2321  C C2    . DC  A 1 114 ? 77.086  29.142 -0.752  1.00 82.48  ? 114  DC  I C2    1 
ATOM   2322  O O2    . DC  A 1 114 ? 76.871  29.205 0.465   1.00 82.46  ? 114  DC  I O2    1 
ATOM   2323  N N3    . DC  A 1 114 ? 77.211  27.957 -1.393  1.00 80.83  ? 114  DC  I N3    1 
ATOM   2324  C C4    . DC  A 1 114 ? 77.462  27.937 -2.706  1.00 80.26  ? 114  DC  I C4    1 
ATOM   2325  N N4    . DC  A 1 114 ? 77.621  26.753 -3.287  1.00 79.23  ? 114  DC  I N4    1 
ATOM   2326  C C5    . DC  A 1 114 ? 77.574  29.135 -3.476  1.00 80.32  ? 114  DC  I C5    1 
ATOM   2327  C C6    . DC  A 1 114 ? 77.440  30.300 -2.832  1.00 81.85  ? 114  DC  I C6    1 
ATOM   2328  P P     . DA  A 1 115 ? 78.972  34.181 1.707   1.00 164.66 ? 115  DA  I P     1 
ATOM   2329  O OP1   . DA  A 1 115 ? 78.528  34.801 2.981   1.00 122.93 ? 115  DA  I OP1   1 
ATOM   2330  O OP2   . DA  A 1 115 ? 80.094  34.783 0.947   1.00 122.36 ? 115  DA  I OP2   1 
ATOM   2331  O "O5'" . DA  A 1 115 ? 79.308  32.643 1.943   1.00 165.69 ? 115  DA  I "O5'" 1 
ATOM   2332  C "C5'" . DA  A 1 115 ? 78.609  31.887 2.925   1.00 166.90 ? 115  DA  I "C5'" 1 
ATOM   2333  C "C4'" . DA  A 1 115 ? 79.451  30.713 3.364   1.00 167.72 ? 115  DA  I "C4'" 1 
ATOM   2334  O "O4'" . DA  A 1 115 ? 79.407  29.670 2.359   1.00 167.36 ? 115  DA  I "O4'" 1 
ATOM   2335  C "C3'" . DA  A 1 115 ? 80.930  31.047 3.570   1.00 168.52 ? 115  DA  I "C3'" 1 
ATOM   2336  O "O3'" . DA  A 1 115 ? 81.428  30.401 4.745   1.00 169.74 ? 115  DA  I "O3'" 1 
ATOM   2337  C "C2'" . DA  A 1 115 ? 81.599  30.490 2.325   1.00 168.15 ? 115  DA  I "C2'" 1 
ATOM   2338  C "C1'" . DA  A 1 115 ? 80.729  29.286 2.006   1.00 167.36 ? 115  DA  I "C1'" 1 
ATOM   2339  N N9    . DA  A 1 115 ? 80.736  28.878 0.596   1.00 124.37 ? 115  DA  I N9    1 
ATOM   2340  C C8    . DA  A 1 115 ? 80.746  29.691 -0.513  1.00 123.70 ? 115  DA  I C8    1 
ATOM   2341  N N7    . DA  A 1 115 ? 80.785  29.035 -1.648  1.00 123.34 ? 115  DA  I N7    1 
ATOM   2342  C C5    . DA  A 1 115 ? 80.792  27.698 -1.263  1.00 123.34 ? 115  DA  I C5    1 
ATOM   2343  C C6    . DA  A 1 115 ? 80.832  26.496 -2.001  1.00 122.99 ? 115  DA  I C6    1 
ATOM   2344  N N6    . DA  A 1 115 ? 80.879  26.449 -3.332  1.00 122.68 ? 115  DA  I N6    1 
ATOM   2345  N N1    . DA  A 1 115 ? 80.826  25.332 -1.315  1.00 122.73 ? 115  DA  I N1    1 
ATOM   2346  C C2    . DA  A 1 115 ? 80.785  25.379 0.017   1.00 123.07 ? 115  DA  I C2    1 
ATOM   2347  N N3    . DA  A 1 115 ? 80.748  26.441 0.824   1.00 123.28 ? 115  DA  I N3    1 
ATOM   2348  C C4    . DA  A 1 115 ? 80.754  27.585 0.114   1.00 123.58 ? 115  DA  I C4    1 
ATOM   2349  P P     . DC  A 1 116 ? 82.965  30.599 5.179   1.00 154.81 ? 116  DC  I P     1 
ATOM   2350  O OP1   . DC  A 1 116 ? 83.014  30.710 6.664   1.00 104.94 ? 116  DC  I OP1   1 
ATOM   2351  O OP2   . DC  A 1 116 ? 83.590  31.660 4.339   1.00 104.95 ? 116  DC  I OP2   1 
ATOM   2352  O "O5'" . DC  A 1 116 ? 83.623  29.214 4.766   1.00 153.97 ? 116  DC  I "O5'" 1 
ATOM   2353  C "C5'" . DC  A 1 116 ? 83.071  27.989 5.230   1.00 152.59 ? 116  DC  I "C5'" 1 
ATOM   2354  C "C4'" . DC  A 1 116 ? 83.900  26.835 4.728   1.00 151.29 ? 116  DC  I "C4'" 1 
ATOM   2355  O "O4'" . DC  A 1 116 ? 83.624  26.579 3.328   1.00 151.16 ? 116  DC  I "O4'" 1 
ATOM   2356  C "C3'" . DC  A 1 116 ? 85.400  27.102 4.819   1.00 150.26 ? 116  DC  I "C3'" 1 
ATOM   2357  O "O3'" . DC  A 1 116 ? 86.068  25.912 5.213   1.00 148.22 ? 116  DC  I "O3'" 1 
ATOM   2358  C "C2'" . DC  A 1 116 ? 85.776  27.470 3.396   1.00 150.28 ? 116  DC  I "C2'" 1 
ATOM   2359  C "C1'" . DC  A 1 116 ? 84.846  26.574 2.605   1.00 150.32 ? 116  DC  I "C1'" 1 
ATOM   2360  N N1    . DC  A 1 116 ? 84.581  27.008 1.219   1.00 99.32  ? 116  DC  I N1    1 
ATOM   2361  C C2    . DC  A 1 116 ? 84.282  26.029 0.252   1.00 98.47  ? 116  DC  I C2    1 
ATOM   2362  O O2    . DC  A 1 116 ? 84.197  24.834 0.610   1.00 97.98  ? 116  DC  I O2    1 
ATOM   2363  N N3    . DC  A 1 116 ? 84.093  26.414 -1.043  1.00 97.73  ? 116  DC  I N3    1 
ATOM   2364  C C4    . DC  A 1 116 ? 84.182  27.710 -1.377  1.00 97.69  ? 116  DC  I C4    1 
ATOM   2365  N N4    . DC  A 1 116 ? 84.010  28.046 -2.663  1.00 96.64  ? 116  DC  I N4    1 
ATOM   2366  C C5    . DC  A 1 116 ? 84.455  28.722 -0.406  1.00 97.92  ? 116  DC  I C5    1 
ATOM   2367  C C6    . DC  A 1 116 ? 84.645  28.331 0.866   1.00 98.72  ? 116  DC  I C6    1 
ATOM   2368  P P     . DT  A 1 117 ? 87.586  25.678 4.771   1.00 134.69 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 117 ? 88.156  24.717 5.742   1.00 93.94  ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 117 ? 88.243  26.994 4.556   1.00 93.06  ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 117 ? 87.449  24.967 3.357   1.00 133.24 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 117 ? 86.720  23.754 3.227   1.00 131.69 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 117 ? 87.314  22.916 2.123   1.00 130.61 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 117 ? 87.008  23.530 0.849   1.00 130.45 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 117 ? 88.838  22.816 2.195   1.00 129.75 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 117 ? 89.268  21.516 1.792   1.00 128.41 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 117 ? 89.306  23.861 1.201   1.00 129.55 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 117 ? 88.207  23.834 0.150   1.00 128.86 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 117 ? 88.015  25.124 -0.548  1.00 86.20  ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 117 ? 87.676  25.114 -1.891  1.00 84.87  ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 117 ? 87.523  24.090 -2.544  1.00 83.20  ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 117 ? 87.522  26.361 -2.443  1.00 84.01  ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 117 ? 87.669  27.583 -1.808  1.00 84.34  ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 117 ? 87.485  28.622 -2.435  1.00 83.43  ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 117 ? 88.033  27.516 -0.411  1.00 84.44  ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 117 ? 88.231  28.785 0.353   1.00 83.92  ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 117 ? 88.180  26.309 0.141   1.00 84.93  ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? 90.813  21.096 1.954   1.00 109.97 ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? 90.866  20.035 2.993   1.00 117.91 ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? 91.651  22.314 2.099   1.00 118.12 ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? 91.146  20.426 0.551   1.00 107.00 ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? 90.192  19.575 -0.076  1.00 101.27 ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? 90.358  19.608 -1.576  1.00 96.87  ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? 89.988  20.904 -2.112  1.00 96.39  ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? 91.780  19.341 -2.061  1.00 94.44  ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? 91.712  18.468 -3.187  1.00 91.56  ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? 92.279  20.718 -2.464  1.00 94.46  ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? 91.007  21.337 -2.993  1.00 95.34  ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? 90.985  22.806 -3.044  1.00 103.46 ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? 90.780  23.394 -4.270  1.00 103.50 ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? 90.633  22.753 -5.300  1.00 102.91 ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? 90.763  24.766 -4.252  1.00 103.62 ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? 90.932  25.589 -3.159  1.00 103.86 ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? 90.894  26.806 -3.300  1.00 103.26 ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? 91.148  24.907 -1.904  1.00 104.16 ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? 91.343  25.721 -0.663  1.00 104.57 ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? 91.163  23.564 -1.908  1.00 103.99 ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 119 ? 93.006  18.251 -4.103  1.00 87.61  ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 119 ? 93.134  16.797 -4.388  1.00 99.71  ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 119 ? 94.142  18.992 -3.500  1.00 100.07 ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 119 ? 92.621  19.002 -5.449  1.00 88.20  ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 119 ? 91.626  18.469 -6.305  1.00 87.83  ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 119 ? 91.950  18.811 -7.737  1.00 87.14  ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 119 ? 91.681  20.220 -7.885  1.00 87.36  ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 119 ? 93.419  18.606 -8.112  1.00 87.18  ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 119 ? 93.641  17.709 -9.218  1.00 86.07  ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 119 ? 94.001  20.001 -8.260  1.00 87.83  ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 119 ? 92.799  20.917 -8.398  1.00 88.01  ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 119 ? 92.931  22.158 -7.620  1.00 101.15 ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 119 ? 92.486  23.337 -8.177  1.00 101.79 ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 119 ? 91.950  23.400 -9.273  1.00 102.83 ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 119 ? 92.688  24.449 -7.395  1.00 101.92 ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 119 ? 93.266  24.495 -6.138  1.00 101.87 ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 119 ? 93.387  25.574 -5.557  1.00 100.94 ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 119 ? 93.689  23.216 -5.609  1.00 102.40 ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 119 ? 94.311  23.161 -4.248  1.00 102.90 ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 119 ? 93.501  22.128 -6.367  1.00 102.14 ? 119  DT  I C6    1 
ATOM   2428  P P     . DT  A 1 120 ? 92.799  17.843 -10.575 1.00 87.74  ? 120  DT  I P     1 
ATOM   2429  O OP1   . DT  A 1 120 ? 91.404  17.404 -10.312 1.00 96.45  ? 120  DT  I OP1   1 
ATOM   2430  O OP2   . DT  A 1 120 ? 93.603  17.142 -11.600 1.00 96.68  ? 120  DT  I OP2   1 
ATOM   2431  O "O5'" . DT  A 1 120 ? 92.800  19.394 -10.928 1.00 86.62  ? 120  DT  I "O5'" 1 
ATOM   2432  C "C5'" . DT  A 1 120 ? 91.677  19.976 -11.590 1.00 83.21  ? 120  DT  I "C5'" 1 
ATOM   2433  C "C4'" . DT  A 1 120 ? 92.121  21.061 -12.542 1.00 80.36  ? 120  DT  I "C4'" 1 
ATOM   2434  O "O4'" . DT  A 1 120 ? 92.651  22.191 -11.809 1.00 80.20  ? 120  DT  I "O4'" 1 
ATOM   2435  C "C3'" . DT  A 1 120 ? 93.205  20.672 -13.551 1.00 79.48  ? 120  DT  I "C3'" 1 
ATOM   2436  O "O3'" . DT  A 1 120 ? 92.947  21.377 -14.772 1.00 77.33  ? 120  DT  I "O3'" 1 
ATOM   2437  C "C2'" . DT  A 1 120 ? 94.462  21.246 -12.920 1.00 80.53  ? 120  DT  I "C2'" 1 
ATOM   2438  C "C1'" . DT  A 1 120 ? 93.901  22.547 -12.379 1.00 80.71  ? 120  DT  I "C1'" 1 
ATOM   2439  N N1    . DT  A 1 120 ? 94.697  23.258 -11.358 1.00 89.82  ? 120  DT  I N1    1 
ATOM   2440  C C2    . DT  A 1 120 ? 94.659  24.640 -11.371 1.00 89.69  ? 120  DT  I C2    1 
ATOM   2441  O O2    . DT  A 1 120 ? 94.046  25.282 -12.208 1.00 88.39  ? 120  DT  I O2    1 
ATOM   2442  N N3    . DT  A 1 120 ? 95.377  25.241 -10.373 1.00 90.73  ? 120  DT  I N3    1 
ATOM   2443  C C4    . DT  A 1 120 ? 96.129  24.620 -9.396  1.00 91.39  ? 120  DT  I C4    1 
ATOM   2444  O O4    . DT  A 1 120 ? 96.723  25.297 -8.558  1.00 91.25  ? 120  DT  I O4    1 
ATOM   2445  C C5    . DT  A 1 120 ? 96.146  23.171 -9.457  1.00 90.93  ? 120  DT  I C5    1 
ATOM   2446  C C7    . DT  A 1 120 ? 96.947  22.416 -8.448  1.00 90.62  ? 120  DT  I C7    1 
ATOM   2447  C C6    . DT  A 1 120 ? 95.439  22.570 -10.421 1.00 90.51  ? 120  DT  I C6    1 
ATOM   2448  P P     . DG  A 1 121 ? 93.148  20.653 -16.187 1.00 81.50  ? 121  DG  I P     1 
ATOM   2449  O OP1   . DG  A 1 121 ? 92.109  19.603 -16.370 1.00 89.51  ? 121  DG  I OP1   1 
ATOM   2450  O OP2   . DG  A 1 121 ? 94.581  20.316 -16.355 1.00 89.47  ? 121  DG  I OP2   1 
ATOM   2451  O "O5'" . DG  A 1 121 ? 92.848  21.828 -17.203 1.00 77.27  ? 121  DG  I "O5'" 1 
ATOM   2452  C "C5'" . DG  A 1 121 ? 91.817  22.768 -16.937 1.00 72.98  ? 121  DG  I "C5'" 1 
ATOM   2453  C "C4'" . DG  A 1 121 ? 92.339  24.171 -17.140 1.00 69.80  ? 121  DG  I "C4'" 1 
ATOM   2454  O "O4'" . DG  A 1 121 ? 93.226  24.518 -16.055 1.00 70.34  ? 121  DG  I "O4'" 1 
ATOM   2455  C "C3'" . DG  A 1 121 ? 93.154  24.356 -18.415 1.00 67.60  ? 121  DG  I "C3'" 1 
ATOM   2456  O "O3'" . DG  A 1 121 ? 92.903  25.643 -18.965 1.00 62.84  ? 121  DG  I "O3'" 1 
ATOM   2457  C "C2'" . DG  A 1 121 ? 94.593  24.235 -17.944 1.00 69.19  ? 121  DG  I "C2'" 1 
ATOM   2458  C "C1'" . DG  A 1 121 ? 94.530  24.805 -16.542 1.00 71.20  ? 121  DG  I "C1'" 1 
ATOM   2459  N N9    . DG  A 1 121 ? 95.480  24.218 -15.603 1.00 82.39  ? 121  DG  I N9    1 
ATOM   2460  C C8    . DG  A 1 121 ? 95.806  22.891 -15.471 1.00 81.70  ? 121  DG  I C8    1 
ATOM   2461  N N7    . DG  A 1 121 ? 96.658  22.667 -14.508 1.00 82.41  ? 121  DG  I N7    1 
ATOM   2462  C C5    . DG  A 1 121 ? 96.911  23.924 -13.980 1.00 83.68  ? 121  DG  I C5    1 
ATOM   2463  C C6    . DG  A 1 121 ? 97.745  24.313 -12.910 1.00 84.39  ? 121  DG  I C6    1 
ATOM   2464  O O6    . DG  A 1 121 ? 98.437  23.597 -12.177 1.00 85.84  ? 121  DG  I O6    1 
ATOM   2465  N N1    . DG  A 1 121 ? 97.723  25.693 -12.718 1.00 83.36  ? 121  DG  I N1    1 
ATOM   2466  C C2    . DG  A 1 121 ? 96.986  26.579 -13.458 1.00 83.13  ? 121  DG  I C2    1 
ATOM   2467  N N2    . DG  A 1 121 ? 97.113  27.865 -13.136 1.00 82.08  ? 121  DG  I N2    1 
ATOM   2468  N N3    . DG  A 1 121 ? 96.189  26.226 -14.447 1.00 83.18  ? 121  DG  I N3    1 
ATOM   2469  C C4    . DG  A 1 121 ? 96.203  24.892 -14.654 1.00 83.51  ? 121  DG  I C4    1 
ATOM   2470  P P     . DG  A 1 122 ? 93.512  26.015 -20.397 1.00 48.41  ? 122  DG  I P     1 
ATOM   2471  O OP1   . DG  A 1 122 ? 92.396  26.448 -21.279 1.00 53.21  ? 122  DG  I OP1   1 
ATOM   2472  O OP2   . DG  A 1 122 ? 94.404  24.901 -20.823 1.00 52.27  ? 122  DG  I OP2   1 
ATOM   2473  O "O5'" . DG  A 1 122 ? 94.441  27.261 -20.076 1.00 48.52  ? 122  DG  I "O5'" 1 
ATOM   2474  C "C5'" . DG  A 1 122 ? 93.880  28.469 -19.595 1.00 55.77  ? 122  DG  I "C5'" 1 
ATOM   2475  C "C4'" . DG  A 1 122 ? 94.969  29.458 -19.253 1.00 60.01  ? 122  DG  I "C4'" 1 
ATOM   2476  O "O4'" . DG  A 1 122 ? 95.752  28.973 -18.141 1.00 60.64  ? 122  DG  I "O4'" 1 
ATOM   2477  C "C3'" . DG  A 1 122 ? 95.966  29.772 -20.365 1.00 63.89  ? 122  DG  I "C3'" 1 
ATOM   2478  O "O3'" . DG  A 1 122 ? 96.173  31.183 -20.406 1.00 67.84  ? 122  DG  I "O3'" 1 
ATOM   2479  C "C2'" . DG  A 1 122 ? 97.224  29.030 -19.945 1.00 62.56  ? 122  DG  I "C2'" 1 
ATOM   2480  C "C1'" . DG  A 1 122 ? 97.131  29.069 -18.436 1.00 62.13  ? 122  DG  I "C1'" 1 
ATOM   2481  N N9    . DG  A 1 122 ? 97.797  27.970 -17.750 1.00 66.85  ? 122  DG  I N9    1 
ATOM   2482  C C8    . DG  A 1 122 ? 97.773  26.642 -18.097 1.00 68.18  ? 122  DG  I C8    1 
ATOM   2483  N N7    . DG  A 1 122 ? 98.452  25.885 -17.279 1.00 69.16  ? 122  DG  I N7    1 
ATOM   2484  C C5    . DG  A 1 122 ? 98.961  26.767 -16.338 1.00 67.65  ? 122  DG  I C5    1 
ATOM   2485  C C6    . DG  A 1 122 ? 99.782  26.529 -15.206 1.00 68.96  ? 122  DG  I C6    1 
ATOM   2486  O O6    . DG  A 1 122 ? 100.253 25.451 -14.807 1.00 67.06  ? 122  DG  I O6    1 
ATOM   2487  N N1    . DG  A 1 122 ? 100.052 27.706 -14.515 1.00 67.67  ? 122  DG  I N1    1 
ATOM   2488  C C2    . DG  A 1 122 ? 99.600  28.952 -14.868 1.00 68.14  ? 122  DG  I C2    1 
ATOM   2489  N N2    . DG  A 1 122 ? 99.961  29.962 -14.061 1.00 67.63  ? 122  DG  I N2    1 
ATOM   2490  N N3    . DG  A 1 122 ? 98.846  29.191 -15.932 1.00 68.28  ? 122  DG  I N3    1 
ATOM   2491  C C4    . DG  A 1 122 ? 98.565  28.060 -16.614 1.00 68.07  ? 122  DG  I C4    1 
ATOM   2492  P P     . DT  A 1 123 ? 97.427  31.779 -21.199 1.00 100.01 ? 123  DT  I P     1 
ATOM   2493  O OP1   . DT  A 1 123 ? 97.026  33.142 -21.640 1.00 67.39  ? 123  DT  I OP1   1 
ATOM   2494  O OP2   . DT  A 1 123 ? 97.932  30.800 -22.191 1.00 67.23  ? 123  DT  I OP2   1 
ATOM   2495  O "O5'" . DT  A 1 123 ? 98.537  31.875 -20.066 1.00 105.34 ? 123  DT  I "O5'" 1 
ATOM   2496  C "C5'" . DT  A 1 123 ? 98.320  32.677 -18.909 1.00 110.25 ? 123  DT  I "C5'" 1 
ATOM   2497  C "C4'" . DT  A 1 123 ? 99.643  33.138 -18.352 1.00 113.81 ? 123  DT  I "C4'" 1 
ATOM   2498  O "O4'" . DT  A 1 123 ? 100.240 32.045 -17.623 1.00 113.58 ? 123  DT  I "O4'" 1 
ATOM   2499  C "C3'" . DT  A 1 123 ? 100.644 33.535 -19.438 1.00 116.51 ? 123  DT  I "C3'" 1 
ATOM   2500  O "O3'" . DT  A 1 123 ? 101.377 34.708 -19.058 1.00 121.47 ? 123  DT  I "O3'" 1 
ATOM   2501  C "C2'" . DT  A 1 123 ? 101.515 32.300 -19.591 1.00 114.67 ? 123  DT  I "C2'" 1 
ATOM   2502  C "C1'" . DT  A 1 123 ? 101.475 31.673 -18.205 1.00 112.78 ? 123  DT  I "C1'" 1 
ATOM   2503  N N1    . DT  A 1 123 ? 101.539 30.204 -18.191 1.00 78.83  ? 123  DT  I N1    1 
ATOM   2504  C C2    . DT  A 1 123 ? 102.281 29.600 -17.188 1.00 78.15  ? 123  DT  I C2    1 
ATOM   2505  O O2    . DT  A 1 123 ? 102.864 30.234 -16.317 1.00 77.80  ? 123  DT  I O2    1 
ATOM   2506  N N3    . DT  A 1 123 ? 102.318 28.218 -17.248 1.00 76.12  ? 123  DT  I N3    1 
ATOM   2507  C C4    . DT  A 1 123 ? 101.712 27.407 -18.194 1.00 76.04  ? 123  DT  I C4    1 
ATOM   2508  O O4    . DT  A 1 123 ? 101.873 26.188 -18.151 1.00 73.99  ? 123  DT  I O4    1 
ATOM   2509  C C5    . DT  A 1 123 ? 100.929 28.110 -19.199 1.00 76.47  ? 123  DT  I C5    1 
ATOM   2510  C C7    . DT  A 1 123 ? 100.212 27.314 -20.240 1.00 76.68  ? 123  DT  I C7    1 
ATOM   2511  C C6    . DT  A 1 123 ? 100.885 29.454 -19.148 1.00 77.41  ? 123  DT  I C6    1 
ATOM   2512  P P     . DA  A 1 124 ? 102.594 35.219 -19.973 1.00 110.41 ? 124  DA  I P     1 
ATOM   2513  O OP1   . DA  A 1 124 ? 102.798 36.684 -19.792 1.00 94.72  ? 124  DA  I OP1   1 
ATOM   2514  O OP2   . DA  A 1 124 ? 102.383 34.674 -21.333 1.00 95.51  ? 124  DA  I OP2   1 
ATOM   2515  O "O5'" . DA  A 1 124 ? 103.820 34.453 -19.319 1.00 113.60 ? 124  DA  I "O5'" 1 
ATOM   2516  C "C5'" . DA  A 1 124 ? 103.986 34.455 -17.904 1.00 117.29 ? 124  DA  I "C5'" 1 
ATOM   2517  C "C4'" . DA  A 1 124 ? 105.306 33.825 -17.537 1.00 119.96 ? 124  DA  I "C4'" 1 
ATOM   2518  O "O4'" . DA  A 1 124 ? 105.185 32.385 -17.443 1.00 118.82 ? 124  DA  I "O4'" 1 
ATOM   2519  C "C3'" . DA  A 1 124 ? 106.402 34.098 -18.564 1.00 122.62 ? 124  DA  I "C3'" 1 
ATOM   2520  O "O3'" . DA  A 1 124 ? 107.621 34.436 -17.911 1.00 127.59 ? 124  DA  I "O3'" 1 
ATOM   2521  C "C2'" . DA  A 1 124 ? 106.540 32.775 -19.296 1.00 121.01 ? 124  DA  I "C2'" 1 
ATOM   2522  C "C1'" . DA  A 1 124 ? 106.224 31.786 -18.195 1.00 118.77 ? 124  DA  I "C1'" 1 
ATOM   2523  N N9    . DA  A 1 124 ? 105.758 30.478 -18.650 1.00 101.45 ? 124  DA  I N9    1 
ATOM   2524  C C8    . DA  A 1 124 ? 105.065 30.173 -19.798 1.00 100.64 ? 124  DA  I C8    1 
ATOM   2525  N N7    . DA  A 1 124 ? 104.781 28.898 -19.922 1.00 99.84  ? 124  DA  I N7    1 
ATOM   2526  C C5    . DA  A 1 124 ? 105.319 28.325 -18.775 1.00 99.96  ? 124  DA  I C5    1 
ATOM   2527  C C6    . DA  A 1 124 ? 105.341 27.004 -18.303 1.00 99.73  ? 124  DA  I C6    1 
ATOM   2528  N N6    . DA  A 1 124 ? 104.764 25.984 -18.942 1.00 99.79  ? 124  DA  I N6    1 
ATOM   2529  N N1    . DA  A 1 124 ? 105.976 26.765 -17.134 1.00 99.62  ? 124  DA  I N1    1 
ATOM   2530  C C2    . DA  A 1 124 ? 106.534 27.794 -16.486 1.00 98.87  ? 124  DA  I C2    1 
ATOM   2531  N N3    . DA  A 1 124 ? 106.565 29.081 -16.819 1.00 99.16  ? 124  DA  I N3    1 
ATOM   2532  C C4    . DA  A 1 124 ? 105.933 29.284 -17.988 1.00 100.18 ? 124  DA  I C4    1 
ATOM   2533  P P     . DG  A 1 125 ? 108.668 35.403 -18.647 1.00 169.26 ? 125  DG  I P     1 
ATOM   2534  O OP1   . DG  A 1 125 ? 108.918 36.570 -17.757 1.00 164.95 ? 125  DG  I OP1   1 
ATOM   2535  O OP2   . DG  A 1 125 ? 108.208 35.627 -20.040 1.00 164.25 ? 125  DG  I OP2   1 
ATOM   2536  O "O5'" . DG  A 1 125 ? 109.987 34.523 -18.694 1.00 170.28 ? 125  DG  I "O5'" 1 
ATOM   2537  C "C5'" . DG  A 1 125 ? 110.626 34.128 -17.490 1.00 172.14 ? 125  DG  I "C5'" 1 
ATOM   2538  C "C4'" . DG  A 1 125 ? 111.617 33.029 -17.775 1.00 173.46 ? 125  DG  I "C4'" 1 
ATOM   2539  O "O4'" . DG  A 1 125 ? 110.921 31.769 -17.941 1.00 173.26 ? 125  DG  I "O4'" 1 
ATOM   2540  C "C3'" . DG  A 1 125 ? 112.412 33.256 -19.061 1.00 174.66 ? 125  DG  I "C3'" 1 
ATOM   2541  O "O3'" . DG  A 1 125 ? 113.795 32.983 -18.832 1.00 176.84 ? 125  DG  I "O3'" 1 
ATOM   2542  C "C2'" . DG  A 1 125 ? 111.784 32.284 -20.045 1.00 174.20 ? 125  DG  I "C2'" 1 
ATOM   2543  C "C1'" . DG  A 1 125 ? 111.343 31.150 -19.142 1.00 173.41 ? 125  DG  I "C1'" 1 
ATOM   2544  N N9    . DG  A 1 125 ? 110.233 30.358 -19.667 1.00 168.47 ? 125  DG  I N9    1 
ATOM   2545  C C8    . DG  A 1 125 ? 109.361 30.724 -20.664 1.00 168.38 ? 125  DG  I C8    1 
ATOM   2546  N N7    . DG  A 1 125 ? 108.495 29.792 -20.959 1.00 168.54 ? 125  DG  I N7    1 
ATOM   2547  C C5    . DG  A 1 125 ? 108.804 28.746 -20.098 1.00 168.62 ? 125  DG  I C5    1 
ATOM   2548  C C6    . DG  A 1 125 ? 108.212 27.458 -19.962 1.00 168.57 ? 125  DG  I C6    1 
ATOM   2549  O O6    . DG  A 1 125 ? 107.273 26.968 -20.605 1.00 168.68 ? 125  DG  I O6    1 
ATOM   2550  N N1    . DG  A 1 125 ? 108.830 26.714 -18.961 1.00 168.04 ? 125  DG  I N1    1 
ATOM   2551  C C2    . DG  A 1 125 ? 109.884 27.142 -18.194 1.00 167.67 ? 125  DG  I C2    1 
ATOM   2552  N N2    . DG  A 1 125 ? 110.337 26.271 -17.277 1.00 167.08 ? 125  DG  I N2    1 
ATOM   2553  N N3    . DG  A 1 125 ? 110.453 28.335 -18.316 1.00 167.85 ? 125  DG  I N3    1 
ATOM   2554  C C4    . DG  A 1 125 ? 109.866 29.081 -19.282 1.00 168.39 ? 125  DG  I C4    1 
ATOM   2555  P P     . DA  A 1 126 ? 114.704 32.407 -20.020 1.00 166.99 ? 126  DA  I P     1 
ATOM   2556  O OP1   . DA  A 1 126 ? 116.116 32.719 -19.679 1.00 136.52 ? 126  DA  I OP1   1 
ATOM   2557  O OP2   . DA  A 1 126 ? 114.147 32.852 -21.323 1.00 136.08 ? 126  DA  I OP2   1 
ATOM   2558  O "O5'" . DA  A 1 126 ? 114.495 30.838 -19.870 1.00 167.61 ? 126  DA  I "O5'" 1 
ATOM   2559  C "C5'" . DA  A 1 126 ? 114.647 30.220 -18.594 1.00 168.89 ? 126  DA  I "C5'" 1 
ATOM   2560  C "C4'" . DA  A 1 126 ? 115.326 28.882 -18.745 1.00 169.51 ? 126  DA  I "C4'" 1 
ATOM   2561  O "O4'" . DA  A 1 126 ? 114.346 27.864 -19.062 1.00 169.36 ? 126  DA  I "O4'" 1 
ATOM   2562  C "C3'" . DA  A 1 126 ? 116.361 28.856 -19.872 1.00 170.19 ? 126  DA  I "C3'" 1 
ATOM   2563  O "O3'" . DA  A 1 126 ? 117.530 28.129 -19.474 1.00 171.42 ? 126  DA  I "O3'" 1 
ATOM   2564  C "C2'" . DA  A 1 126 ? 115.626 28.154 -20.999 1.00 169.81 ? 126  DA  I "C2'" 1 
ATOM   2565  C "C1'" . DA  A 1 126 ? 114.730 27.187 -20.245 1.00 169.49 ? 126  DA  I "C1'" 1 
ATOM   2566  N N9    . DA  A 1 126 ? 113.517 26.803 -20.964 1.00 138.89 ? 126  DA  I N9    1 
ATOM   2567  C C8    . DA  A 1 126 ? 112.947 27.431 -22.046 1.00 138.65 ? 126  DA  I C8    1 
ATOM   2568  N N7    . DA  A 1 126 ? 111.875 26.830 -22.503 1.00 138.48 ? 126  DA  I N7    1 
ATOM   2569  C C5    . DA  A 1 126 ? 111.720 25.738 -21.660 1.00 138.60 ? 126  DA  I C5    1 
ATOM   2570  C C6    . DA  A 1 126 ? 110.768 24.707 -21.617 1.00 138.54 ? 126  DA  I C6    1 
ATOM   2571  N N6    . DA  A 1 126 ? 109.750 24.604 -22.477 1.00 138.50 ? 126  DA  I N6    1 
ATOM   2572  N N1    . DA  A 1 126 ? 110.898 23.773 -20.648 1.00 138.52 ? 126  DA  I N1    1 
ATOM   2573  C C2    . DA  A 1 126 ? 111.919 23.880 -19.788 1.00 138.32 ? 126  DA  I C2    1 
ATOM   2574  N N3    . DA  A 1 126 ? 112.877 24.801 -19.727 1.00 138.33 ? 126  DA  I N3    1 
ATOM   2575  C C4    . DA  A 1 126 ? 112.720 25.713 -20.703 1.00 138.66 ? 126  DA  I C4    1 
ATOM   2576  P P     . DA  A 1 127 ? 118.552 27.590 -20.592 1.00 171.26 ? 127  DA  I P     1 
ATOM   2577  O OP1   . DA  A 1 127 ? 119.849 27.266 -19.941 1.00 127.96 ? 127  DA  I OP1   1 
ATOM   2578  O OP2   . DA  A 1 127 ? 118.519 28.552 -21.728 1.00 127.38 ? 127  DA  I OP2   1 
ATOM   2579  O "O5'" . DA  A 1 127 ? 117.879 26.220 -21.041 1.00 171.18 ? 127  DA  I "O5'" 1 
ATOM   2580  C "C5'" . DA  A 1 127 ? 117.419 25.297 -20.058 1.00 170.47 ? 127  DA  I "C5'" 1 
ATOM   2581  C "C4'" . DA  A 1 127 ? 117.178 23.944 -20.681 1.00 170.07 ? 127  DA  I "C4'" 1 
ATOM   2582  O "O4'" . DA  A 1 127 ? 115.896 23.900 -21.359 1.00 170.49 ? 127  DA  I "O4'" 1 
ATOM   2583  C "C3'" . DA  A 1 127 ? 118.226 23.542 -21.715 1.00 169.68 ? 127  DA  I "C3'" 1 
ATOM   2584  O "O3'" . DA  A 1 127 ? 118.603 22.183 -21.504 1.00 168.03 ? 127  DA  I "O3'" 1 
ATOM   2585  C "C2'" . DA  A 1 127 ? 117.502 23.711 -23.041 1.00 170.11 ? 127  DA  I "C2'" 1 
ATOM   2586  C "C1'" . DA  A 1 127 ? 116.068 23.378 -22.669 1.00 170.63 ? 127  DA  I "C1'" 1 
ATOM   2587  N N9    . DA  A 1 127 ? 115.043 23.965 -23.540 1.00 127.07 ? 127  DA  I N9    1 
ATOM   2588  C C8    . DA  A 1 127 ? 115.099 25.156 -24.229 1.00 126.91 ? 127  DA  I C8    1 
ATOM   2589  N N7    . DA  A 1 127 ? 114.023 25.412 -24.935 1.00 126.72 ? 127  DA  I N7    1 
ATOM   2590  C C5    . DA  A 1 127 ? 113.198 24.319 -24.696 1.00 126.47 ? 127  DA  I C5    1 
ATOM   2591  C C6    . DA  A 1 127 ? 111.913 23.983 -25.162 1.00 125.86 ? 127  DA  I C6    1 
ATOM   2592  N N6    . DA  A 1 127 ? 111.207 24.744 -25.997 1.00 125.43 ? 127  DA  I N6    1 
ATOM   2593  N N1    . DA  A 1 127 ? 111.374 22.820 -24.737 1.00 125.43 ? 127  DA  I N1    1 
ATOM   2594  C C2    . DA  A 1 127 ? 112.086 22.052 -23.904 1.00 125.54 ? 127  DA  I C2    1 
ATOM   2595  N N3    . DA  A 1 127 ? 113.303 22.255 -23.400 1.00 126.20 ? 127  DA  I N3    1 
ATOM   2596  C C4    . DA  A 1 127 ? 113.812 23.420 -23.839 1.00 126.72 ? 127  DA  I C4    1 
ATOM   2597  P P     . DT  A 1 128 ? 119.468 21.417 -22.616 1.00 171.55 ? 128  DT  I P     1 
ATOM   2598  O OP1   . DT  A 1 128 ? 120.386 20.494 -21.898 1.00 122.57 ? 128  DT  I OP1   1 
ATOM   2599  O OP2   . DT  A 1 128 ? 120.027 22.420 -23.562 1.00 123.47 ? 128  DT  I OP2   1 
ATOM   2600  O "O5'" . DT  A 1 128 ? 118.370 20.543 -23.368 1.00 170.11 ? 128  DT  I "O5'" 1 
ATOM   2601  C "C5'" . DT  A 1 128 ? 117.487 19.709 -22.622 1.00 168.10 ? 128  DT  I "C5'" 1 
ATOM   2602  C "C4'" . DT  A 1 128 ? 116.644 18.873 -23.553 1.00 166.32 ? 128  DT  I "C4'" 1 
ATOM   2603  O "O4'" . DT  A 1 128 ? 115.617 19.688 -24.167 1.00 165.98 ? 128  DT  I "O4'" 1 
ATOM   2604  C "C3'" . DT  A 1 128 ? 117.421 18.226 -24.698 1.00 165.31 ? 128  DT  I "C3'" 1 
ATOM   2605  O "O3'" . DT  A 1 128 ? 116.974 16.880 -24.870 1.00 163.93 ? 128  DT  I "O3'" 1 
ATOM   2606  C "C2'" . DT  A 1 128 ? 117.075 19.092 -25.898 1.00 165.24 ? 128  DT  I "C2'" 1 
ATOM   2607  C "C1'" . DT  A 1 128 ? 115.660 19.540 -25.576 1.00 165.59 ? 128  DT  I "C1'" 1 
ATOM   2608  N N1    . DT  A 1 128 ? 115.267 20.829 -26.180 1.00 117.29 ? 128  DT  I N1    1 
ATOM   2609  C C2    . DT  A 1 128 ? 113.955 20.989 -26.594 1.00 116.82 ? 128  DT  I C2    1 
ATOM   2610  O O2    . DT  A 1 128 ? 113.096 20.126 -26.467 1.00 116.31 ? 128  DT  I O2    1 
ATOM   2611  N N3    . DT  A 1 128 ? 113.684 22.213 -27.166 1.00 116.51 ? 128  DT  I N3    1 
ATOM   2612  C C4    . DT  A 1 128 ? 114.567 23.266 -27.354 1.00 116.40 ? 128  DT  I C4    1 
ATOM   2613  O O4    . DT  A 1 128 ? 114.182 24.302 -27.889 1.00 115.55 ? 128  DT  I O4    1 
ATOM   2614  C C5    . DT  A 1 128 ? 115.913 23.036 -26.883 1.00 116.54 ? 128  DT  I C5    1 
ATOM   2615  C C7    . DT  A 1 128 ? 116.925 24.129 -27.029 1.00 116.61 ? 128  DT  I C7    1 
ATOM   2616  C C6    . DT  A 1 128 ? 116.194 21.844 -26.330 1.00 117.00 ? 128  DT  I C6    1 
ATOM   2617  P P     . DC  A 1 129 ? 117.337 16.083 -26.215 1.00 156.86 ? 129  DC  I P     1 
ATOM   2618  O OP1   . DC  A 1 129 ? 117.459 14.640 -25.866 1.00 130.30 ? 129  DC  I OP1   1 
ATOM   2619  O OP2   . DC  A 1 129 ? 118.471 16.780 -26.881 1.00 131.04 ? 129  DC  I OP2   1 
ATOM   2620  O "O5'" . DC  A 1 129 ? 116.029 16.278 -27.104 1.00 154.40 ? 129  DC  I "O5'" 1 
ATOM   2621  C "C5'" . DC  A 1 129 ? 114.729 16.145 -26.520 1.00 148.41 ? 129  DC  I "C5'" 1 
ATOM   2622  C "C4'" . DC  A 1 129 ? 113.667 16.061 -27.592 1.00 144.17 ? 129  DC  I "C4'" 1 
ATOM   2623  O "O4'" . DC  A 1 129 ? 113.425 17.360 -28.180 1.00 143.09 ? 129  DC  I "O4'" 1 
ATOM   2624  C "C3'" . DC  A 1 129 ? 114.004 15.127 -28.749 1.00 140.62 ? 129  DC  I "C3'" 1 
ATOM   2625  O "O3'" . DC  A 1 129 ? 112.847 14.392 -29.128 1.00 135.01 ? 129  DC  I "O3'" 1 
ATOM   2626  C "C2'" . DC  A 1 129 ? 114.426 16.070 -29.862 1.00 140.56 ? 129  DC  I "C2'" 1 
ATOM   2627  C "C1'" . DC  A 1 129 ? 113.571 17.289 -29.592 1.00 141.47 ? 129  DC  I "C1'" 1 
ATOM   2628  N N1    . DC  A 1 129 ? 114.164 18.555 -30.041 1.00 114.18 ? 129  DC  I N1    1 
ATOM   2629  C C2    . DC  A 1 129 ? 113.423 19.379 -30.892 1.00 113.65 ? 129  DC  I C2    1 
ATOM   2630  O O2    . DC  A 1 129 ? 112.303 19.000 -31.269 1.00 113.44 ? 129  DC  I O2    1 
ATOM   2631  N N3    . DC  A 1 129 ? 113.944 20.563 -31.282 1.00 112.96 ? 129  DC  I N3    1 
ATOM   2632  C C4    . DC  A 1 129 ? 115.158 20.928 -30.862 1.00 112.72 ? 129  DC  I C4    1 
ATOM   2633  N N4    . DC  A 1 129 ? 115.629 22.112 -31.263 1.00 112.38 ? 129  DC  I N4    1 
ATOM   2634  C C5    . DC  A 1 129 ? 115.943 20.097 -30.009 1.00 112.67 ? 129  DC  I C5    1 
ATOM   2635  C C6    . DC  A 1 129 ? 115.411 18.931 -29.627 1.00 113.54 ? 129  DC  I C6    1 
ATOM   2636  P P     . DT  A 1 130 ? 112.873 13.530 -30.473 1.00 94.49  ? 130  DT  I P     1 
ATOM   2637  O OP1   . DT  A 1 130 ? 111.959 12.364 -30.330 1.00 91.25  ? 130  DT  I OP1   1 
ATOM   2638  O OP2   . DT  A 1 130 ? 114.289 13.310 -30.844 1.00 91.87  ? 130  DT  I OP2   1 
ATOM   2639  O "O5'" . DT  A 1 130 ? 112.278 14.536 -31.546 1.00 91.41  ? 130  DT  I "O5'" 1 
ATOM   2640  C "C5'" . DT  A 1 130 ? 110.874 14.697 -31.686 1.00 84.16  ? 130  DT  I "C5'" 1 
ATOM   2641  C "C4'" . DT  A 1 130 ? 110.550 15.100 -33.101 1.00 79.24  ? 130  DT  I "C4'" 1 
ATOM   2642  O "O4'" . DT  A 1 130 ? 111.196 16.362 -33.367 1.00 78.12  ? 130  DT  I "O4'" 1 
ATOM   2643  C "C3'" . DT  A 1 130 ? 111.060 14.145 -34.178 1.00 75.57  ? 130  DT  I "C3'" 1 
ATOM   2644  O "O3'" . DT  A 1 130 ? 110.168 14.222 -35.277 1.00 69.99  ? 130  DT  I "O3'" 1 
ATOM   2645  C "C2'" . DT  A 1 130 ? 112.371 14.780 -34.598 1.00 76.54  ? 130  DT  I "C2'" 1 
ATOM   2646  C "C1'" . DT  A 1 130 ? 112.001 16.245 -34.525 1.00 79.08  ? 130  DT  I "C1'" 1 
ATOM   2647  N N1    . DT  A 1 130 ? 113.107 17.184 -34.374 1.00 78.63  ? 130  DT  I N1    1 
ATOM   2648  C C2    . DT  A 1 130 ? 112.952 18.451 -34.891 1.00 80.07  ? 130  DT  I C2    1 
ATOM   2649  O O2    . DT  A 1 130 ? 111.956 18.807 -35.509 1.00 79.95  ? 130  DT  I O2    1 
ATOM   2650  N N3    . DT  A 1 130 ? 114.008 19.293 -34.657 1.00 81.43  ? 130  DT  I N3    1 
ATOM   2651  C C4    . DT  A 1 130 ? 115.174 18.996 -33.985 1.00 81.82  ? 130  DT  I C4    1 
ATOM   2652  O O4    . DT  A 1 130 ? 116.029 19.858 -33.845 1.00 81.84  ? 130  DT  I O4    1 
ATOM   2653  C C5    . DT  A 1 130 ? 115.275 17.638 -33.493 1.00 81.31  ? 130  DT  I C5    1 
ATOM   2654  C C7    . DT  A 1 130 ? 116.511 17.212 -32.767 1.00 82.29  ? 130  DT  I C7    1 
ATOM   2655  C C6    . DT  A 1 130 ? 114.249 16.813 -33.713 1.00 80.23  ? 130  DT  I C6    1 
ATOM   2656  P P     . DG  A 1 131 ? 109.122 13.046 -35.535 1.00 72.87  ? 131  DG  I P     1 
ATOM   2657  O OP1   . DG  A 1 131 ? 108.367 12.771 -34.285 1.00 74.79  ? 131  DG  I OP1   1 
ATOM   2658  O OP2   . DG  A 1 131 ? 109.870 11.951 -36.203 1.00 76.10  ? 131  DG  I OP2   1 
ATOM   2659  O "O5'" . DG  A 1 131 ? 108.134 13.691 -36.605 1.00 73.14  ? 131  DG  I "O5'" 1 
ATOM   2660  C "C5'" . DG  A 1 131 ? 107.045 14.519 -36.198 1.00 67.02  ? 131  DG  I "C5'" 1 
ATOM   2661  C "C4'" . DG  A 1 131 ? 106.702 15.522 -37.277 1.00 65.28  ? 131  DG  I "C4'" 1 
ATOM   2662  O "O4'" . DG  A 1 131 ? 107.768 16.483 -37.413 1.00 63.19  ? 131  DG  I "O4'" 1 
ATOM   2663  C "C3'" . DG  A 1 131 ? 106.454 14.976 -38.679 1.00 63.01  ? 131  DG  I "C3'" 1 
ATOM   2664  O "O3'" . DG  A 1 131 ? 105.417 15.753 -39.272 1.00 59.46  ? 131  DG  I "O3'" 1 
ATOM   2665  C "C2'" . DG  A 1 131 ? 107.782 15.194 -39.384 1.00 62.37  ? 131  DG  I "C2'" 1 
ATOM   2666  C "C1'" . DG  A 1 131 ? 108.353 16.426 -38.704 1.00 64.40  ? 131  DG  I "C1'" 1 
ATOM   2667  N N9    . DG  A 1 131 ? 109.798 16.392 -38.501 1.00 69.50  ? 131  DG  I N9    1 
ATOM   2668  C C8    . DG  A 1 131 ? 110.564 15.309 -38.144 1.00 69.20  ? 131  DG  I C8    1 
ATOM   2669  N N7    . DG  A 1 131 ? 111.823 15.607 -37.964 1.00 68.75  ? 131  DG  I N7    1 
ATOM   2670  C C5    . DG  A 1 131 ? 111.897 16.966 -38.234 1.00 70.45  ? 131  DG  I C5    1 
ATOM   2671  C C6    . DG  A 1 131 ? 113.007 17.864 -38.191 1.00 70.78  ? 131  DG  I C6    1 
ATOM   2672  O O6    . DG  A 1 131 ? 114.183 17.633 -37.891 1.00 71.68  ? 131  DG  I O6    1 
ATOM   2673  N N1    . DG  A 1 131 ? 112.629 19.155 -38.536 1.00 71.00  ? 131  DG  I N1    1 
ATOM   2674  C C2    . DG  A 1 131 ? 111.354 19.545 -38.869 1.00 71.19  ? 131  DG  I C2    1 
ATOM   2675  N N2    . DG  A 1 131 ? 111.185 20.840 -39.162 1.00 70.66  ? 131  DG  I N2    1 
ATOM   2676  N N3    . DG  A 1 131 ? 110.316 18.725 -38.909 1.00 69.30  ? 131  DG  I N3    1 
ATOM   2677  C C4    . DG  A 1 131 ? 110.656 17.461 -38.583 1.00 69.82  ? 131  DG  I C4    1 
ATOM   2678  P P     . DC  A 1 132 ? 104.976 15.496 -40.789 1.00 63.74  ? 132  DC  I P     1 
ATOM   2679  O OP1   . DC  A 1 132 ? 103.595 16.034 -40.901 1.00 61.44  ? 132  DC  I OP1   1 
ATOM   2680  O OP2   . DC  A 1 132 ? 105.251 14.086 -41.138 1.00 62.10  ? 132  DC  I OP2   1 
ATOM   2681  O "O5'" . DC  A 1 132 ? 105.971 16.417 -41.624 1.00 62.87  ? 132  DC  I "O5'" 1 
ATOM   2682  C "C5'" . DC  A 1 132 ? 105.989 17.820 -41.412 1.00 64.16  ? 132  DC  I "C5'" 1 
ATOM   2683  C "C4'" . DC  A 1 132 ? 106.999 18.488 -42.314 1.00 67.70  ? 132  DC  I "C4'" 1 
ATOM   2684  O "O4'" . DC  A 1 132 ? 108.347 18.307 -41.831 1.00 67.12  ? 132  DC  I "O4'" 1 
ATOM   2685  C "C3'" . DC  A 1 132 ? 107.016 18.054 -43.779 1.00 67.04  ? 132  DC  I "C3'" 1 
ATOM   2686  O "O3'" . DC  A 1 132 ? 107.239 19.218 -44.572 1.00 68.80  ? 132  DC  I "O3'" 1 
ATOM   2687  C "C2'" . DC  A 1 132 ? 108.266 17.198 -43.863 1.00 67.13  ? 132  DC  I "C2'" 1 
ATOM   2688  C "C1'" . DC  A 1 132 ? 109.174 17.970 -42.929 1.00 68.22  ? 132  DC  I "C1'" 1 
ATOM   2689  N N1    . DC  A 1 132 ? 110.361 17.278 -42.404 1.00 65.81  ? 132  DC  I N1    1 
ATOM   2690  C C2    . DC  A 1 132 ? 111.421 18.059 -41.958 1.00 67.10  ? 132  DC  I C2    1 
ATOM   2691  O O2    . DC  A 1 132 ? 111.333 19.293 -42.067 1.00 65.22  ? 132  DC  I O2    1 
ATOM   2692  N N3    . DC  A 1 132 ? 112.513 17.461 -41.424 1.00 66.97  ? 132  DC  I N3    1 
ATOM   2693  C C4    . DC  A 1 132 ? 112.570 16.132 -41.347 1.00 67.97  ? 132  DC  I C4    1 
ATOM   2694  N N4    . DC  A 1 132 ? 113.662 15.586 -40.810 1.00 68.28  ? 132  DC  I N4    1 
ATOM   2695  C C5    . DC  A 1 132 ? 111.508 15.305 -41.817 1.00 66.50  ? 132  DC  I C5    1 
ATOM   2696  C C6    . DC  A 1 132 ? 110.431 15.915 -42.333 1.00 65.59  ? 132  DC  I C6    1 
ATOM   2697  P P     . DA  A 1 133 ? 106.082 19.762 -45.544 1.00 57.70  ? 133  DA  I P     1 
ATOM   2698  O OP1   . DA  A 1 133 ? 104.845 19.873 -44.723 1.00 71.61  ? 133  DA  I OP1   1 
ATOM   2699  O OP2   . DA  A 1 133 ? 106.075 18.927 -46.772 1.00 71.41  ? 133  DA  I OP2   1 
ATOM   2700  O "O5'" . DA  A 1 133 ? 106.613 21.212 -45.938 1.00 59.51  ? 133  DA  I "O5'" 1 
ATOM   2701  C "C5'" . DA  A 1 133 ? 107.041 22.134 -44.930 1.00 62.98  ? 133  DA  I "C5'" 1 
ATOM   2702  C "C4'" . DA  A 1 133 ? 108.405 22.698 -45.258 1.00 67.44  ? 133  DA  I "C4'" 1 
ATOM   2703  O "O4'" . DA  A 1 133 ? 109.440 21.732 -44.981 1.00 67.29  ? 133  DA  I "O4'" 1 
ATOM   2704  C "C3'" . DA  A 1 133 ? 108.607 23.118 -46.712 1.00 70.88  ? 133  DA  I "C3'" 1 
ATOM   2705  O "O3'" . DA  A 1 133 ? 109.397 24.299 -46.771 1.00 76.33  ? 133  DA  I "O3'" 1 
ATOM   2706  C "C2'" . DA  A 1 133 ? 109.380 21.962 -47.318 1.00 68.57  ? 133  DA  I "C2'" 1 
ATOM   2707  C "C1'" . DA  A 1 133 ? 110.226 21.500 -46.149 1.00 67.54  ? 133  DA  I "C1'" 1 
ATOM   2708  N N9    . DA  A 1 133 ? 110.551 20.077 -46.169 1.00 80.04  ? 133  DA  I N9    1 
ATOM   2709  C C8    . DA  A 1 133 ? 109.807 19.025 -46.654 1.00 79.36  ? 133  DA  I C8    1 
ATOM   2710  N N7    . DA  A 1 133 ? 110.351 17.854 -46.434 1.00 79.00  ? 133  DA  I N7    1 
ATOM   2711  C C5    . DA  A 1 133 ? 111.541 18.156 -45.778 1.00 77.86  ? 133  DA  I C5    1 
ATOM   2712  C C6    . DA  A 1 133 ? 112.579 17.352 -45.263 1.00 76.99  ? 133  DA  I C6    1 
ATOM   2713  N N6    . DA  A 1 133 ? 112.590 16.025 -45.317 1.00 76.97  ? 133  DA  I N6    1 
ATOM   2714  N N1    . DA  A 1 133 ? 113.624 17.974 -44.683 1.00 76.51  ? 133  DA  I N1    1 
ATOM   2715  C C2    . DA  A 1 133 ? 113.629 19.309 -44.630 1.00 76.42  ? 133  DA  I C2    1 
ATOM   2716  N N3    . DA  A 1 133 ? 112.719 20.173 -45.071 1.00 76.46  ? 133  DA  I N3    1 
ATOM   2717  C C4    . DA  A 1 133 ? 111.687 19.523 -45.636 1.00 78.72  ? 133  DA  I C4    1 
ATOM   2718  P P     . DG  A 1 134 ? 109.066 25.411 -47.872 1.00 96.07  ? 134  DG  I P     1 
ATOM   2719  O OP1   . DG  A 1 134 ? 108.492 26.579 -47.160 1.00 79.33  ? 134  DG  I OP1   1 
ATOM   2720  O OP2   . DG  A 1 134 ? 108.320 24.798 -49.003 1.00 77.42  ? 134  DG  I OP2   1 
ATOM   2721  O "O5'" . DG  A 1 134 ? 110.498 25.796 -48.420 1.00 97.79  ? 134  DG  I "O5'" 1 
ATOM   2722  C "C5'" . DG  A 1 134 ? 110.941 25.282 -49.654 1.00 99.76  ? 134  DG  I "C5'" 1 
ATOM   2723  C "C4'" . DG  A 1 134 ? 112.374 24.834 -49.532 1.00 100.09 ? 134  DG  I "C4'" 1 
ATOM   2724  O "O4'" . DG  A 1 134 ? 112.438 23.514 -48.934 1.00 98.79  ? 134  DG  I "O4'" 1 
ATOM   2725  C "C3'" . DG  A 1 134 ? 113.035 24.713 -50.895 1.00 100.94 ? 134  DG  I "C3'" 1 
ATOM   2726  O "O3'" . DG  A 1 134 ? 114.338 25.253 -50.861 1.00 103.69 ? 134  DG  I "O3'" 1 
ATOM   2727  C "C2'" . DG  A 1 134 ? 113.082 23.225 -51.166 1.00 98.69  ? 134  DG  I "C2'" 1 
ATOM   2728  C "C1'" . DG  A 1 134 ? 113.151 22.622 -49.781 1.00 96.04  ? 134  DG  I "C1'" 1 
ATOM   2729  N N9    . DG  A 1 134 ? 112.492 21.320 -49.742 1.00 74.35  ? 134  DG  I N9    1 
ATOM   2730  C C8    . DG  A 1 134 ? 111.245 21.012 -50.239 1.00 72.90  ? 134  DG  I C8    1 
ATOM   2731  N N7    . DG  A 1 134 ? 110.938 19.750 -50.116 1.00 69.58  ? 134  DG  I N7    1 
ATOM   2732  C C5    . DG  A 1 134 ? 112.040 19.192 -49.489 1.00 68.51  ? 134  DG  I C5    1 
ATOM   2733  C C6    . DG  A 1 134 ? 112.283 17.858 -49.102 1.00 65.95  ? 134  DG  I C6    1 
ATOM   2734  O O6    . DG  A 1 134 ? 111.546 16.869 -49.251 1.00 59.27  ? 134  DG  I O6    1 
ATOM   2735  N N1    . DG  A 1 134 ? 113.532 17.724 -48.487 1.00 66.22  ? 134  DG  I N1    1 
ATOM   2736  C C2    . DG  A 1 134 ? 114.429 18.751 -48.281 1.00 67.72  ? 134  DG  I C2    1 
ATOM   2737  N N2    . DG  A 1 134 ? 115.578 18.423 -47.672 1.00 68.06  ? 134  DG  I N2    1 
ATOM   2738  N N3    . DG  A 1 134 ? 114.211 20.004 -48.646 1.00 68.99  ? 134  DG  I N3    1 
ATOM   2739  C C4    . DG  A 1 134 ? 113.005 20.151 -49.239 1.00 71.09  ? 134  DG  I C4    1 
ATOM   2740  P P     . DG  A 1 135 ? 115.186 25.286 -52.206 1.00 96.01  ? 135  DG  I P     1 
ATOM   2741  O OP1   . DG  A 1 135 ? 116.075 26.478 -52.152 1.00 96.50  ? 135  DG  I OP1   1 
ATOM   2742  O OP2   . DG  A 1 135 ? 114.254 25.099 -53.356 1.00 95.78  ? 135  DG  I OP2   1 
ATOM   2743  O "O5'" . DG  A 1 135 ? 116.064 23.980 -52.075 1.00 95.57  ? 135  DG  I "O5'" 1 
ATOM   2744  C "C5'" . DG  A 1 135 ? 117.180 23.964 -51.213 1.00 94.49  ? 135  DG  I "C5'" 1 
ATOM   2745  C "C4'" . DG  A 1 135 ? 118.168 22.952 -51.722 1.00 94.00  ? 135  DG  I "C4'" 1 
ATOM   2746  O "O4'" . DG  A 1 135 ? 117.756 21.627 -51.304 1.00 92.93  ? 135  DG  I "O4'" 1 
ATOM   2747  C "C3'" . DG  A 1 135 ? 118.190 22.940 -53.247 1.00 94.20  ? 135  DG  I "C3'" 1 
ATOM   2748  O "O3'" . DG  A 1 135 ? 119.523 22.796 -53.720 1.00 96.30  ? 135  DG  I "O3'" 1 
ATOM   2749  C "C2'" . DG  A 1 135 ? 117.311 21.756 -53.608 1.00 92.75  ? 135  DG  I "C2'" 1 
ATOM   2750  C "C1'" . DG  A 1 135 ? 117.514 20.808 -52.434 1.00 90.82  ? 135  DG  I "C1'" 1 
ATOM   2751  N N9    . DG  A 1 135 ? 116.358 19.966 -52.139 1.00 87.42  ? 135  DG  I N9    1 
ATOM   2752  C C8    . DG  A 1 135 ? 115.035 20.331 -52.176 1.00 85.84  ? 135  DG  I C8    1 
ATOM   2753  N N7    . DG  A 1 135 ? 114.224 19.348 -51.902 1.00 84.75  ? 135  DG  I N7    1 
ATOM   2754  C C5    . DG  A 1 135 ? 115.061 18.269 -51.660 1.00 84.75  ? 135  DG  I C5    1 
ATOM   2755  C C6    . DG  A 1 135 ? 114.755 16.922 -51.321 1.00 84.34  ? 135  DG  I C6    1 
ATOM   2756  O O6    . DG  A 1 135 ? 113.648 16.397 -51.174 1.00 82.79  ? 135  DG  I O6    1 
ATOM   2757  N N1    . DG  A 1 135 ? 115.906 16.162 -51.155 1.00 84.77  ? 135  DG  I N1    1 
ATOM   2758  C C2    . DG  A 1 135 ? 117.187 16.631 -51.305 1.00 84.88  ? 135  DG  I C2    1 
ATOM   2759  N N2    . DG  A 1 135 ? 118.164 15.740 -51.104 1.00 84.77  ? 135  DG  I N2    1 
ATOM   2760  N N3    . DG  A 1 135 ? 117.488 17.879 -51.630 1.00 84.49  ? 135  DG  I N3    1 
ATOM   2761  C C4    . DG  A 1 135 ? 116.383 18.638 -51.790 1.00 85.96  ? 135  DG  I C4    1 
ATOM   2762  P P     . DT  A 1 136 ? 119.781 22.262 -55.201 1.00 128.66 ? 136  DT  I P     1 
ATOM   2763  O OP1   . DT  A 1 136 ? 121.079 22.819 -55.647 1.00 85.77  ? 136  DT  I OP1   1 
ATOM   2764  O OP2   . DT  A 1 136 ? 118.558 22.484 -56.012 1.00 85.85  ? 136  DT  I OP2   1 
ATOM   2765  O "O5'" . DT  A 1 136 ? 119.943 20.700 -54.976 1.00 128.13 ? 136  DT  I "O5'" 1 
ATOM   2766  C "C5'" . DT  A 1 136 ? 120.950 20.203 -54.106 1.00 127.93 ? 136  DT  I "C5'" 1 
ATOM   2767  C "C4'" . DT  A 1 136 ? 121.379 18.837 -54.573 1.00 128.66 ? 136  DT  I "C4'" 1 
ATOM   2768  O "O4'" . DT  A 1 136 ? 120.388 17.865 -54.163 1.00 127.08 ? 136  DT  I "O4'" 1 
ATOM   2769  C "C3'" . DT  A 1 136 ? 121.446 18.768 -56.097 1.00 129.26 ? 136  DT  I "C3'" 1 
ATOM   2770  O "O3'" . DT  A 1 136 ? 122.561 18.000 -56.537 1.00 131.78 ? 136  DT  I "O3'" 1 
ATOM   2771  C "C2'" . DT  A 1 136 ? 120.142 18.100 -56.483 1.00 128.57 ? 136  DT  I "C2'" 1 
ATOM   2772  C "C1'" . DT  A 1 136 ? 119.859 17.200 -55.295 1.00 126.96 ? 136  DT  I "C1'" 1 
ATOM   2773  N N1    . DT  A 1 136 ? 118.423 16.978 -55.062 1.00 82.54  ? 136  DT  I N1    1 
ATOM   2774  C C2    . DT  A 1 136 ? 118.013 15.720 -54.678 1.00 81.87  ? 136  DT  I C2    1 
ATOM   2775  O O2    . DT  A 1 136 ? 118.792 14.802 -54.462 1.00 81.56  ? 136  DT  I O2    1 
ATOM   2776  N N3    . DT  A 1 136 ? 116.654 15.574 -54.548 1.00 80.75  ? 136  DT  I N3    1 
ATOM   2777  C C4    . DT  A 1 136 ? 115.693 16.543 -54.741 1.00 81.36  ? 136  DT  I C4    1 
ATOM   2778  O O4    . DT  A 1 136 ? 114.506 16.259 -54.595 1.00 81.71  ? 136  DT  I O4    1 
ATOM   2779  C C5    . DT  A 1 136 ? 116.200 17.852 -55.113 1.00 81.34  ? 136  DT  I C5    1 
ATOM   2780  C C7    . DT  A 1 136 ? 115.237 18.973 -55.331 1.00 80.89  ? 136  DT  I C7    1 
ATOM   2781  C C6    . DT  A 1 136 ? 117.520 18.000 -55.248 1.00 81.38  ? 136  DT  I C6    1 
ATOM   2782  P P     . DG  A 1 137 ? 122.656 17.565 -58.075 1.00 112.97 ? 137  DG  I P     1 
ATOM   2783  O OP1   . DG  A 1 137 ? 124.075 17.307 -58.414 1.00 106.99 ? 137  DG  I OP1   1 
ATOM   2784  O OP2   . DG  A 1 137 ? 121.878 18.543 -58.876 1.00 106.74 ? 137  DG  I OP2   1 
ATOM   2785  O "O5'" . DG  A 1 137 ? 121.882 16.183 -58.078 1.00 111.82 ? 137  DG  I "O5'" 1 
ATOM   2786  C "C5'" . DG  A 1 137 ? 122.279 15.140 -57.203 1.00 109.26 ? 137  DG  I "C5'" 1 
ATOM   2787  C "C4'" . DG  A 1 137 ? 121.749 13.829 -57.721 1.00 107.32 ? 137  DG  I "C4'" 1 
ATOM   2788  O "O4'" . DG  A 1 137 ? 120.325 13.751 -57.479 1.00 105.88 ? 137  DG  I "O4'" 1 
ATOM   2789  C "C3'" . DG  A 1 137 ? 121.922 13.704 -59.230 1.00 106.82 ? 137  DG  I "C3'" 1 
ATOM   2790  O "O3'" . DG  A 1 137 ? 122.129 12.342 -59.568 1.00 106.85 ? 137  DG  I "O3'" 1 
ATOM   2791  C "C2'" . DG  A 1 137 ? 120.589 14.184 -59.773 1.00 105.35 ? 137  DG  I "C2'" 1 
ATOM   2792  C "C1'" . DG  A 1 137 ? 119.626 13.663 -58.718 1.00 104.35 ? 137  DG  I "C1'" 1 
ATOM   2793  N N9    . DG  A 1 137 ? 118.358 14.388 -58.581 1.00 95.28  ? 137  DG  I N9    1 
ATOM   2794  C C8    . DG  A 1 137 ? 118.133 15.745 -58.716 1.00 94.75  ? 137  DG  I C8    1 
ATOM   2795  N N7    . DG  A 1 137 ? 116.887 16.081 -58.501 1.00 93.14  ? 137  DG  I N7    1 
ATOM   2796  C C5    . DG  A 1 137 ? 116.250 14.878 -58.212 1.00 92.77  ? 137  DG  I C5    1 
ATOM   2797  C C6    . DG  A 1 137 ? 114.898 14.608 -57.888 1.00 91.27  ? 137  DG  I C6    1 
ATOM   2798  O O6    . DG  A 1 137 ? 113.961 15.399 -57.772 1.00 89.37  ? 137  DG  I O6    1 
ATOM   2799  N N1    . DG  A 1 137 ? 114.686 13.251 -57.685 1.00 91.03  ? 137  DG  I N1    1 
ATOM   2800  C C2    . DG  A 1 137 ? 115.650 12.275 -57.774 1.00 91.28  ? 137  DG  I C2    1 
ATOM   2801  N N2    . DG  A 1 137 ? 115.254 11.018 -57.545 1.00 91.19  ? 137  DG  I N2    1 
ATOM   2802  N N3    . DG  A 1 137 ? 116.909 12.511 -58.066 1.00 91.72  ? 137  DG  I N3    1 
ATOM   2803  C C4    . DG  A 1 137 ? 117.140 13.824 -58.271 1.00 93.52  ? 137  DG  I C4    1 
ATOM   2804  P P     . DG  A 1 138 ? 122.823 11.973 -60.959 1.00 115.12 ? 138  DG  I P     1 
ATOM   2805  O OP1   . DG  A 1 138 ? 124.217 11.536 -60.678 1.00 73.36  ? 138  DG  I OP1   1 
ATOM   2806  O OP2   . DG  A 1 138 ? 122.572 13.101 -61.900 1.00 72.64  ? 138  DG  I OP2   1 
ATOM   2807  O "O5'" . DG  A 1 138 ? 121.998 10.707 -61.440 1.00 113.00 ? 138  DG  I "O5'" 1 
ATOM   2808  C "C5'" . DG  A 1 138 ? 121.419 9.827  -60.487 1.00 109.76 ? 138  DG  I "C5'" 1 
ATOM   2809  C "C4'" . DG  A 1 138 ? 120.065 9.387  -60.977 1.00 108.02 ? 138  DG  I "C4'" 1 
ATOM   2810  O "O4'" . DG  A 1 138 ? 119.073 10.421 -60.760 1.00 106.99 ? 138  DG  I "O4'" 1 
ATOM   2811  C "C3'" . DG  A 1 138 ? 120.077 9.135  -62.481 1.00 107.24 ? 138  DG  I "C3'" 1 
ATOM   2812  O "O3'" . DG  A 1 138 ? 119.217 8.052  -62.782 1.00 107.74 ? 138  DG  I "O3'" 1 
ATOM   2813  C "C2'" . DG  A 1 138 ? 119.472 10.402 -63.046 1.00 106.31 ? 138  DG  I "C2'" 1 
ATOM   2814  C "C1'" . DG  A 1 138 ? 118.429 10.696 -61.993 1.00 104.87 ? 138  DG  I "C1'" 1 
ATOM   2815  N N9    . DG  A 1 138 ? 117.969 12.078 -61.976 1.00 60.33  ? 138  DG  I N9    1 
ATOM   2816  C C8    . DG  A 1 138 ? 118.690 13.197 -62.329 1.00 58.84  ? 138  DG  I C8    1 
ATOM   2817  N N7    . DG  A 1 138 ? 118.006 14.305 -62.227 1.00 56.80  ? 138  DG  I N7    1 
ATOM   2818  C C5    . DG  A 1 138 ? 116.757 13.893 -61.775 1.00 56.78  ? 138  DG  I C5    1 
ATOM   2819  C C6    . DG  A 1 138 ? 115.597 14.650 -61.483 1.00 55.86  ? 138  DG  I C6    1 
ATOM   2820  O O6    . DG  A 1 138 ? 115.445 15.882 -61.557 1.00 53.46  ? 138  DG  I O6    1 
ATOM   2821  N N1    . DG  A 1 138 ? 114.547 13.830 -61.069 1.00 55.05  ? 138  DG  I N1    1 
ATOM   2822  C C2    . DG  A 1 138 ? 114.611 12.459 -60.957 1.00 56.31  ? 138  DG  I C2    1 
ATOM   2823  N N2    . DG  A 1 138 ? 113.499 11.842 -60.581 1.00 56.08  ? 138  DG  I N2    1 
ATOM   2824  N N3    . DG  A 1 138 ? 115.690 11.746 -61.209 1.00 57.47  ? 138  DG  I N3    1 
ATOM   2825  C C4    . DG  A 1 138 ? 116.719 12.520 -61.615 1.00 58.21  ? 138  DG  I C4    1 
ATOM   2826  P P     . DA  A 1 139 ? 119.084 7.557  -64.294 1.00 85.06  ? 139  DA  I P     1 
ATOM   2827  O OP1   . DA  A 1 139 ? 120.157 6.559  -64.537 1.00 85.70  ? 139  DA  I OP1   1 
ATOM   2828  O OP2   . DA  A 1 139 ? 118.975 8.750  -65.174 1.00 86.10  ? 139  DA  I OP2   1 
ATOM   2829  O "O5'" . DA  A 1 139 ? 117.685 6.811  -64.302 1.00 81.80  ? 139  DA  I "O5'" 1 
ATOM   2830  C "C5'" . DA  A 1 139 ? 117.129 6.296  -63.106 1.00 76.99  ? 139  DA  I "C5'" 1 
ATOM   2831  C "C4'" . DA  A 1 139 ? 115.626 6.381  -63.185 1.00 74.75  ? 139  DA  I "C4'" 1 
ATOM   2832  O "O4'" . DA  A 1 139 ? 115.208 7.750  -62.950 1.00 72.83  ? 139  DA  I "O4'" 1 
ATOM   2833  C "C3'" . DA  A 1 139 ? 115.106 6.005  -64.570 1.00 74.25  ? 139  DA  I "C3'" 1 
ATOM   2834  O "O3'" . DA  A 1 139 ? 113.916 5.223  -64.466 1.00 75.60  ? 139  DA  I "O3'" 1 
ATOM   2835  C "C2'" . DA  A 1 139 ? 114.841 7.349  -65.229 1.00 72.20  ? 139  DA  I "C2'" 1 
ATOM   2836  C "C1'" . DA  A 1 139 ? 114.446 8.227  -64.051 1.00 70.52  ? 139  DA  I "C1'" 1 
ATOM   2837  N N9    . DA  A 1 139 ? 114.724 9.661  -64.208 1.00 66.45  ? 139  DA  I N9    1 
ATOM   2838  C C8    . DA  A 1 139 ? 115.934 10.266 -64.473 1.00 66.60  ? 139  DA  I C8    1 
ATOM   2839  N N7    . DA  A 1 139 ? 115.871 11.578 -64.545 1.00 64.20  ? 139  DA  I N7    1 
ATOM   2840  C C5    . DA  A 1 139 ? 114.530 11.860 -64.312 1.00 63.22  ? 139  DA  I C5    1 
ATOM   2841  C C6    . DA  A 1 139 ? 113.816 13.069 -64.254 1.00 60.82  ? 139  DA  I C6    1 
ATOM   2842  N N6    . DA  A 1 139 ? 114.370 14.266 -64.429 1.00 56.70  ? 139  DA  I N6    1 
ATOM   2843  N N1    . DA  A 1 139 ? 112.493 13.002 -64.008 1.00 58.09  ? 139  DA  I N1    1 
ATOM   2844  C C2    . DA  A 1 139 ? 111.930 11.800 -63.836 1.00 60.64  ? 139  DA  I C2    1 
ATOM   2845  N N3    . DA  A 1 139 ? 112.489 10.594 -63.866 1.00 62.81  ? 139  DA  I N3    1 
ATOM   2846  C C4    . DA  A 1 139 ? 113.809 10.690 -64.109 1.00 64.26  ? 139  DA  I C4    1 
ATOM   2847  P P     . DT  A 1 140 ? 113.281 4.571  -65.790 1.00 107.76 ? 140  DT  I P     1 
ATOM   2848  O OP1   . DT  A 1 140 ? 112.765 3.203  -65.500 1.00 75.97  ? 140  DT  I OP1   1 
ATOM   2849  O OP2   . DT  A 1 140 ? 114.246 4.782  -66.905 1.00 73.82  ? 140  DT  I OP2   1 
ATOM   2850  O "O5'" . DT  A 1 140 ? 112.023 5.493  -66.065 1.00 105.35 ? 140  DT  I "O5'" 1 
ATOM   2851  C "C5'" . DT  A 1 140 ? 111.065 5.725  -65.044 1.00 101.50 ? 140  DT  I "C5'" 1 
ATOM   2852  C "C4'" . DT  A 1 140 ? 110.064 6.743  -65.525 1.00 99.79  ? 140  DT  I "C4'" 1 
ATOM   2853  O "O4'" . DT  A 1 140 ? 110.639 8.073  -65.495 1.00 97.84  ? 140  DT  I "O4'" 1 
ATOM   2854  C "C3'" . DT  A 1 140 ? 109.612 6.515  -66.969 1.00 99.04  ? 140  DT  I "C3'" 1 
ATOM   2855  O "O3'" . DT  A 1 140 ? 108.243 6.869  -67.062 1.00 101.44 ? 140  DT  I "O3'" 1 
ATOM   2856  C "C2'" . DT  A 1 140 ? 110.416 7.542  -67.743 1.00 96.19  ? 140  DT  I "C2'" 1 
ATOM   2857  C "C1'" . DT  A 1 140 ? 110.391 8.679  -66.747 1.00 94.76  ? 140  DT  I "C1'" 1 
ATOM   2858  N N1    . DT  A 1 140 ? 111.363 9.759  -66.952 1.00 60.05  ? 140  DT  I N1    1 
ATOM   2859  C C2    . DT  A 1 140 ? 110.891 11.049 -66.817 1.00 57.83  ? 140  DT  I C2    1 
ATOM   2860  O O2    . DT  A 1 140 ? 109.755 11.308 -66.451 1.00 57.95  ? 140  DT  I O2    1 
ATOM   2861  N N3    . DT  A 1 140 ? 111.805 12.027 -67.109 1.00 55.75  ? 140  DT  I N3    1 
ATOM   2862  C C4    . DT  A 1 140 ? 113.121 11.849 -67.478 1.00 55.42  ? 140  DT  I C4    1 
ATOM   2863  O O4    . DT  A 1 140 ? 113.818 12.830 -67.728 1.00 52.21  ? 140  DT  I O4    1 
ATOM   2864  C C5    . DT  A 1 140 ? 113.566 10.470 -67.538 1.00 55.49  ? 140  DT  I C5    1 
ATOM   2865  C C7    . DT  A 1 140 ? 114.995 10.185 -67.864 1.00 55.54  ? 140  DT  I C7    1 
ATOM   2866  C C6    . DT  A 1 140 ? 112.672 9.505  -67.285 1.00 56.05  ? 140  DT  I C6    1 
ATOM   2867  P P     . DA  A 1 141 ? 107.184 5.837  -67.673 1.00 108.01 ? 141  DA  I P     1 
ATOM   2868  O OP1   . DA  A 1 141 ? 107.111 4.639  -66.789 1.00 70.94  ? 141  DA  I OP1   1 
ATOM   2869  O OP2   . DA  A 1 141 ? 107.495 5.676  -69.116 1.00 70.55  ? 141  DA  I OP2   1 
ATOM   2870  O "O5'" . DA  A 1 141 ? 105.824 6.647  -67.527 1.00 107.02 ? 141  DA  I "O5'" 1 
ATOM   2871  C "C5'" . DA  A 1 141 ? 105.602 7.470  -66.379 1.00 102.58 ? 141  DA  I "C5'" 1 
ATOM   2872  C "C4'" . DA  A 1 141 ? 105.131 8.850  -66.789 1.00 100.30 ? 141  DA  I "C4'" 1 
ATOM   2873  O "O4'" . DA  A 1 141 ? 106.213 9.779  -67.063 1.00 97.58  ? 141  DA  I "O4'" 1 
ATOM   2874  C "C3'" . DA  A 1 141 ? 104.217 8.882  -68.006 1.00 98.62  ? 141  DA  I "C3'" 1 
ATOM   2875  O "O3'" . DA  A 1 141 ? 103.079 9.665  -67.704 1.00 98.54  ? 141  DA  I "O3'" 1 
ATOM   2876  C "C2'" . DA  A 1 141 ? 105.063 9.540  -69.085 1.00 96.28  ? 141  DA  I "C2'" 1 
ATOM   2877  C "C1'" . DA  A 1 141 ? 105.982 10.453 -68.293 1.00 94.03  ? 141  DA  I "C1'" 1 
ATOM   2878  N N9    . DA  A 1 141 ? 107.286 10.690 -68.923 1.00 55.13  ? 141  DA  I N9    1 
ATOM   2879  C C8    . DA  A 1 141 ? 108.215 9.742  -69.288 1.00 55.64  ? 141  DA  I C8    1 
ATOM   2880  N N7    . DA  A 1 141 ? 109.310 10.241 -69.811 1.00 54.82  ? 141  DA  I N7    1 
ATOM   2881  C C5    . DA  A 1 141 ? 109.092 11.606 -69.790 1.00 53.21  ? 141  DA  I C5    1 
ATOM   2882  C C6    . DA  A 1 141 ? 109.886 12.675 -70.183 1.00 52.13  ? 141  DA  I C6    1 
ATOM   2883  N N6    . DA  A 1 141 ? 111.124 12.524 -70.642 1.00 51.56  ? 141  DA  I N6    1 
ATOM   2884  N N1    . DA  A 1 141 ? 109.374 13.922 -70.068 1.00 49.96  ? 141  DA  I N1    1 
ATOM   2885  C C2    . DA  A 1 141 ? 108.147 14.065 -69.554 1.00 51.06  ? 141  DA  I C2    1 
ATOM   2886  N N3    . DA  A 1 141 ? 107.309 13.131 -69.114 1.00 52.78  ? 141  DA  I N3    1 
ATOM   2887  C C4    . DA  A 1 141 ? 107.845 11.903 -69.264 1.00 53.04  ? 141  DA  I C4    1 
ATOM   2888  P P     . DT  A 1 142 ? 102.132 10.143 -68.884 1.00 89.21  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 142 ? 100.832 10.477 -68.261 1.00 60.74  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 142 ? 102.183 9.166  -69.995 1.00 59.45  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 142 ? 102.842 11.482 -69.337 1.00 86.52  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 142 ? 102.913 12.564 -68.435 1.00 83.01  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 142 ? 102.807 13.863 -69.188 1.00 82.46  ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 142 ? 104.102 14.193 -69.727 1.00 81.10  ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 142 ? 101.831 13.855 -70.366 1.00 81.22  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 142 ? 101.104 15.086 -70.392 1.00 81.81  ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 142 ? 102.740 13.716 -71.577 1.00 81.48  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 142 ? 104.017 14.405 -71.120 1.00 82.36  ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 142 ? 105.248 13.873 -71.704 1.00 52.96  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 142 ? 106.226 14.761 -72.082 1.00 53.35  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 142 ? 106.118 15.971 -71.964 1.00 53.14  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 142 ? 107.341 14.177 -72.617 1.00 54.24  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 142 ? 107.560 12.831 -72.819 1.00 53.14  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 142 ? 108.598 12.458 -73.341 1.00 53.89  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 142 ? 106.498 11.962 -72.391 1.00 52.41  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 142 ? 106.660 10.489 -72.550 1.00 50.96  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 142 ? 105.410 12.518 -71.861 1.00 51.46  ? 142  DT  I C6    1 
ATOM   2908  P P     . DT  A 1 143 ? 100.123 15.411 -71.616 1.00 83.57  ? 143  DT  I P     1 
ATOM   2909  O OP1   . DT  A 1 143 ? 98.950  16.147 -71.073 1.00 70.54  ? 143  DT  I OP1   1 
ATOM   2910  O OP2   . DT  A 1 143 ? 99.916  14.160 -72.390 1.00 67.61  ? 143  DT  I OP2   1 
ATOM   2911  O "O5'" . DT  A 1 143 ? 100.997 16.396 -72.503 1.00 82.78  ? 143  DT  I "O5'" 1 
ATOM   2912  C "C5'" . DT  A 1 143 ? 101.696 17.469 -71.890 1.00 81.29  ? 143  DT  I "C5'" 1 
ATOM   2913  C "C4'" . DT  A 1 143 ? 102.532 18.198 -72.912 1.00 82.29  ? 143  DT  I "C4'" 1 
ATOM   2914  O "O4'" . DT  A 1 143 ? 103.683 17.400 -73.273 1.00 80.81  ? 143  DT  I "O4'" 1 
ATOM   2915  C "C3'" . DT  A 1 143 ? 101.798 18.507 -74.216 1.00 81.47  ? 143  DT  I "C3'" 1 
ATOM   2916  O "O3'" . DT  A 1 143 ? 102.105 19.829 -74.636 1.00 82.10  ? 143  DT  I "O3'" 1 
ATOM   2917  C "C2'" . DT  A 1 143 ? 102.358 17.486 -75.191 1.00 81.68  ? 143  DT  I "C2'" 1 
ATOM   2918  C "C1'" . DT  A 1 143 ? 103.775 17.318 -74.682 1.00 81.27  ? 143  DT  I "C1'" 1 
ATOM   2919  N N1    . DT  A 1 143 ? 104.439 16.045 -75.029 1.00 60.93  ? 143  DT  I N1    1 
ATOM   2920  C C2    . DT  A 1 143 ? 105.709 16.126 -75.564 1.00 61.22  ? 143  DT  I C2    1 
ATOM   2921  O O2    . DT  A 1 143 ? 106.277 17.184 -75.775 1.00 59.76  ? 143  DT  I O2    1 
ATOM   2922  N N3    . DT  A 1 143 ? 106.288 14.916 -75.851 1.00 60.42  ? 143  DT  I N3    1 
ATOM   2923  C C4    . DT  A 1 143 ? 105.735 13.663 -75.673 1.00 62.07  ? 143  DT  I C4    1 
ATOM   2924  O O4    . DT  A 1 143 ? 106.381 12.664 -75.959 1.00 64.86  ? 143  DT  I O4    1 
ATOM   2925  C C5    . DT  A 1 143 ? 104.398 13.648 -75.138 1.00 61.39  ? 143  DT  I C5    1 
ATOM   2926  C C7    . DT  A 1 143 ? 103.720 12.327 -74.955 1.00 62.05  ? 143  DT  I C7    1 
ATOM   2927  C C6    . DT  A 1 143 ? 103.822 14.826 -74.833 1.00 60.62  ? 143  DT  I C6    1 
ATOM   2928  P P     . DG  A 1 144 ? 101.268 20.493 -75.828 1.00 67.68  ? 144  DG  I P     1 
ATOM   2929  O OP1   . DG  A 1 144 ? 100.896 21.883 -75.454 1.00 41.48  ? 144  DG  I OP1   1 
ATOM   2930  O OP2   . DG  A 1 144 ? 100.221 19.538 -76.264 1.00 39.91  ? 144  DG  I OP2   1 
ATOM   2931  O "O5'" . DG  A 1 144 ? 102.346 20.609 -76.984 1.00 69.45  ? 144  DG  I "O5'" 1 
ATOM   2932  C "C5'" . DG  A 1 144 ? 103.547 21.352 -76.772 1.00 74.54  ? 144  DG  I "C5'" 1 
ATOM   2933  C "C4'" . DG  A 1 144 ? 104.509 21.127 -77.914 1.00 76.62  ? 144  DG  I "C4'" 1 
ATOM   2934  O "O4'" . DG  A 1 144 ? 104.987 19.761 -77.909 1.00 75.33  ? 144  DG  I "O4'" 1 
ATOM   2935  C "C3'" . DG  A 1 144 ? 103.917 21.348 -79.303 1.00 78.46  ? 144  DG  I "C3'" 1 
ATOM   2936  O "O3'" . DG  A 1 144 ? 104.947 21.879 -80.124 1.00 84.47  ? 144  DG  I "O3'" 1 
ATOM   2937  C "C2'" . DG  A 1 144 ? 103.571 19.941 -79.755 1.00 76.92  ? 144  DG  I "C2'" 1 
ATOM   2938  C "C1'" . DG  A 1 144 ? 104.748 19.186 -79.181 1.00 75.59  ? 144  DG  I "C1'" 1 
ATOM   2939  N N9    . DG  A 1 144 ? 104.622 17.740 -79.016 1.00 49.45  ? 144  DG  I N9    1 
ATOM   2940  C C8    . DG  A 1 144 ? 103.520 17.005 -78.636 1.00 49.75  ? 144  DG  I C8    1 
ATOM   2941  N N7    . DG  A 1 144 ? 103.756 15.717 -78.581 1.00 49.21  ? 144  DG  I N7    1 
ATOM   2942  C C5    . DG  A 1 144 ? 105.090 15.596 -78.948 1.00 49.73  ? 144  DG  I C5    1 
ATOM   2943  C C6    . DG  A 1 144 ? 105.913 14.443 -79.084 1.00 49.13  ? 144  DG  I C6    1 
ATOM   2944  O O6    . DG  A 1 144 ? 105.614 13.257 -78.899 1.00 49.37  ? 144  DG  I O6    1 
ATOM   2945  N N1    . DG  A 1 144 ? 107.208 14.780 -79.487 1.00 47.58  ? 144  DG  I N1    1 
ATOM   2946  C C2    . DG  A 1 144 ? 107.657 16.063 -79.734 1.00 49.84  ? 144  DG  I C2    1 
ATOM   2947  N N2    . DG  A 1 144 ? 108.936 16.194 -80.111 1.00 50.40  ? 144  DG  I N2    1 
ATOM   2948  N N3    . DG  A 1 144 ? 106.902 17.142 -79.617 1.00 50.94  ? 144  DG  I N3    1 
ATOM   2949  C C4    . DG  A 1 144 ? 105.638 16.836 -79.222 1.00 49.84  ? 144  DG  I C4    1 
ATOM   2950  P P     . DA  A 1 145 ? 104.600 22.393 -81.597 1.00 107.39 ? 145  DA  I P     1 
ATOM   2951  O OP1   . DA  A 1 145 ? 104.788 23.869 -81.599 1.00 67.82  ? 145  DA  I OP1   1 
ATOM   2952  O OP2   . DA  A 1 145 ? 103.306 21.803 -82.046 1.00 65.75  ? 145  DA  I OP2   1 
ATOM   2953  O "O5'" . DA  A 1 145 ? 105.721 21.718 -82.491 1.00 105.95 ? 145  DA  I "O5'" 1 
ATOM   2954  C "C5'" . DA  A 1 145 ? 107.094 22.032 -82.319 1.00 106.73 ? 145  DA  I "C5'" 1 
ATOM   2955  C "C4'" . DA  A 1 145 ? 107.884 21.292 -83.362 1.00 107.34 ? 145  DA  I "C4'" 1 
ATOM   2956  O "O4'" . DA  A 1 145 ? 107.899 19.888 -82.998 1.00 104.38 ? 145  DA  I "O4'" 1 
ATOM   2957  C "C3'" . DA  A 1 145 ? 107.167 21.383 -84.705 1.00 108.66 ? 145  DA  I "C3'" 1 
ATOM   2958  O "O3'" . DA  A 1 145 ? 108.063 21.667 -85.774 1.00 112.37 ? 145  DA  I "O3'" 1 
ATOM   2959  C "C2'" . DA  A 1 145 ? 106.475 20.040 -84.857 1.00 105.85 ? 145  DA  I "C2'" 1 
ATOM   2960  C "C1'" . DA  A 1 145 ? 107.296 19.094 -84.001 1.00 102.28 ? 145  DA  I "C1'" 1 
ATOM   2961  N N9    . DA  A 1 145 ? 106.465 18.077 -83.350 1.00 59.22  ? 145  DA  I N9    1 
ATOM   2962  C C8    . DA  A 1 145 ? 105.211 18.261 -82.824 1.00 58.31  ? 145  DA  I C8    1 
ATOM   2963  N N7    . DA  A 1 145 ? 104.645 17.154 -82.390 1.00 55.95  ? 145  DA  I N7    1 
ATOM   2964  C C5    . DA  A 1 145 ? 105.597 16.174 -82.623 1.00 55.56  ? 145  DA  I C5    1 
ATOM   2965  C C6    . DA  A 1 145 ? 105.596 14.779 -82.403 1.00 56.06  ? 145  DA  I C6    1 
ATOM   2966  N N6    . DA  A 1 145 ? 104.552 14.099 -81.933 1.00 55.19  ? 145  DA  I N6    1 
ATOM   2967  N N1    . DA  A 1 145 ? 106.714 14.096 -82.714 1.00 56.06  ? 145  DA  I N1    1 
ATOM   2968  C C2    . DA  A 1 145 ? 107.748 14.769 -83.249 1.00 54.46  ? 145  DA  I C2    1 
ATOM   2969  N N3    . DA  A 1 145 ? 107.860 16.071 -83.537 1.00 56.84  ? 145  DA  I N3    1 
ATOM   2970  C C4    . DA  A 1 145 ? 106.738 16.731 -83.191 1.00 57.22  ? 145  DA  I C4    1 
ATOM   2971  P P     . DT  A 1 146 ? 107.477 21.837 -87.259 1.00 112.68 ? 146  DT  I P     1 
ATOM   2972  O OP1   . DT  A 1 146 ? 108.208 22.955 -87.933 1.00 62.45  ? 146  DT  I OP1   1 
ATOM   2973  O OP2   . DT  A 1 146 ? 105.979 21.890 -87.152 1.00 63.48  ? 146  DT  I OP2   1 
ATOM   2974  O "O5'" . DT  A 1 146 ? 107.821 20.435 -87.936 1.00 112.26 ? 146  DT  I "O5'" 1 
ATOM   2975  C "C5'" . DT  A 1 146 ? 109.083 19.821 -87.729 1.00 112.88 ? 146  DT  I "C5'" 1 
ATOM   2976  C "C4'" . DT  A 1 146 ? 109.048 18.381 -88.182 1.00 114.25 ? 146  DT  I "C4'" 1 
ATOM   2977  O "O4'" . DT  A 1 146 ? 108.506 17.492 -87.171 1.00 112.53 ? 146  DT  I "O4'" 1 
ATOM   2978  C "C3'" . DT  A 1 146 ? 108.251 18.112 -89.463 1.00 114.72 ? 146  DT  I "C3'" 1 
ATOM   2979  O "O3'" . DT  A 1 146 ? 108.993 17.237 -90.296 1.00 115.78 ? 146  DT  I "O3'" 1 
ATOM   2980  C "C2'" . DT  A 1 146 ? 107.085 17.272 -88.979 1.00 113.22 ? 146  DT  I "C2'" 1 
ATOM   2981  C "C1'" . DT  A 1 146 ? 107.748 16.515 -87.857 1.00 111.50 ? 146  DT  I "C1'" 1 
ATOM   2982  N N1    . DT  A 1 146 ? 106.809 15.852 -86.933 1.00 63.56  ? 146  DT  I N1    1 
ATOM   2983  C C2    . DT  A 1 146 ? 107.115 14.568 -86.535 1.00 62.04  ? 146  DT  I C2    1 
ATOM   2984  O O2    . DT  A 1 146 ? 108.186 14.021 -86.779 1.00 61.43  ? 146  DT  I O2    1 
ATOM   2985  N N3    . DT  A 1 146 ? 106.126 13.946 -85.822 1.00 60.20  ? 146  DT  I N3    1 
ATOM   2986  C C4    . DT  A 1 146 ? 104.913 14.483 -85.429 1.00 59.91  ? 146  DT  I C4    1 
ATOM   2987  O O4    . DT  A 1 146 ? 104.113 13.793 -84.786 1.00 60.13  ? 146  DT  I O4    1 
ATOM   2988  C C5    . DT  A 1 146 ? 104.693 15.858 -85.817 1.00 60.81  ? 146  DT  I C5    1 
ATOM   2989  C C7    . DT  A 1 146 ? 103.427 16.536 -85.403 1.00 59.82  ? 146  DT  I C7    1 
ATOM   2990  C C6    . DT  A 1 146 ? 105.642 16.465 -86.535 1.00 62.99  ? 146  DT  I C6    1 
ATOM   2991  O "O5'" . DA  B 1 1   ? 103.174 4.781  -84.571 1.00 132.72 ? 147  DA  J "O5'" 1 
ATOM   2992  C "C5'" . DA  B 1 1   ? 104.013 3.849  -85.258 1.00 131.82 ? 147  DA  J "C5'" 1 
ATOM   2993  C "C4'" . DA  B 1 1   ? 105.392 4.397  -85.544 1.00 131.34 ? 147  DA  J "C4'" 1 
ATOM   2994  O "O4'" . DA  B 1 1   ? 105.248 5.695  -86.175 1.00 130.34 ? 147  DA  J "O4'" 1 
ATOM   2995  C "C3'" . DA  B 1 1   ? 106.252 4.618  -84.300 1.00 131.94 ? 147  DA  J "C3'" 1 
ATOM   2996  O "O3'" . DA  B 1 1   ? 107.618 4.257  -84.526 1.00 133.25 ? 147  DA  J "O3'" 1 
ATOM   2997  C "C2'" . DA  B 1 1   ? 106.119 6.102  -84.024 1.00 130.96 ? 147  DA  J "C2'" 1 
ATOM   2998  C "C1'" . DA  B 1 1   ? 105.829 6.721  -85.384 1.00 127.98 ? 147  DA  J "C1'" 1 
ATOM   2999  N N9    . DA  B 1 1   ? 104.849 7.804  -85.269 1.00 63.63  ? 147  DA  J N9    1 
ATOM   3000  C C8    . DA  B 1 1   ? 103.575 7.693  -84.751 1.00 62.02  ? 147  DA  J C8    1 
ATOM   3001  N N7    . DA  B 1 1   ? 102.922 8.833  -84.696 1.00 60.76  ? 147  DA  J N7    1 
ATOM   3002  C C5    . DA  B 1 1   ? 103.814 9.759  -85.232 1.00 59.17  ? 147  DA  J C5    1 
ATOM   3003  C C6    . DA  B 1 1   ? 103.723 11.161 -85.448 1.00 57.23  ? 147  DA  J C6    1 
ATOM   3004  N N6    . DA  B 1 1   ? 102.663 11.905 -85.113 1.00 54.56  ? 147  DA  J N6    1 
ATOM   3005  N N1    . DA  B 1 1   ? 104.785 11.778 -86.018 1.00 56.83  ? 147  DA  J N1    1 
ATOM   3006  C C2    . DA  B 1 1   ? 105.866 11.043 -86.325 1.00 58.30  ? 147  DA  J C2    1 
ATOM   3007  N N3    . DA  B 1 1   ? 106.079 9.727  -86.157 1.00 59.06  ? 147  DA  J N3    1 
ATOM   3008  C C4    . DA  B 1 1   ? 105.002 9.135  -85.603 1.00 60.71  ? 147  DA  J C4    1 
ATOM   3009  P P     . DT  B 1 2   ? 108.760 4.856  -83.570 1.00 120.22 ? 148  DT  J P     1 
ATOM   3010  O OP1   . DT  B 1 2   ? 109.995 4.041  -83.684 1.00 109.84 ? 148  DT  J OP1   1 
ATOM   3011  O OP2   . DT  B 1 2   ? 108.151 5.076  -82.238 1.00 108.24 ? 148  DT  J OP2   1 
ATOM   3012  O "O5'" . DT  B 1 2   ? 109.049 6.273  -84.224 1.00 118.06 ? 148  DT  J "O5'" 1 
ATOM   3013  C "C5'" . DT  B 1 2   ? 109.576 6.364  -85.540 1.00 116.39 ? 148  DT  J "C5'" 1 
ATOM   3014  C "C4'" . DT  B 1 2   ? 110.529 7.527  -85.610 1.00 115.08 ? 148  DT  J "C4'" 1 
ATOM   3015  O "O4'" . DT  B 1 2   ? 109.750 8.735  -85.462 1.00 113.15 ? 148  DT  J "O4'" 1 
ATOM   3016  C "C3'" . DT  B 1 2   ? 111.507 7.517  -84.440 1.00 115.77 ? 148  DT  J "C3'" 1 
ATOM   3017  O "O3'" . DT  B 1 2   ? 112.745 8.128  -84.816 1.00 118.55 ? 148  DT  J "O3'" 1 
ATOM   3018  C "C2'" . DT  B 1 2   ? 110.779 8.327  -83.383 1.00 113.93 ? 148  DT  J "C2'" 1 
ATOM   3019  C "C1'" . DT  B 1 2   ? 110.050 9.363  -84.223 1.00 111.39 ? 148  DT  J "C1'" 1 
ATOM   3020  N N1    . DT  B 1 2   ? 108.784 9.868  -83.655 1.00 96.50  ? 148  DT  J N1    1 
ATOM   3021  C C2    . DT  B 1 2   ? 108.599 11.233 -83.639 1.00 95.42  ? 148  DT  J C2    1 
ATOM   3022  O O2    . DT  B 1 2   ? 109.440 12.025 -84.043 1.00 94.86  ? 148  DT  J O2    1 
ATOM   3023  N N3    . DT  B 1 2   ? 107.388 11.640 -83.131 1.00 94.16  ? 148  DT  J N3    1 
ATOM   3024  C C4    . DT  B 1 2   ? 106.370 10.836 -82.642 1.00 93.34  ? 148  DT  J C4    1 
ATOM   3025  O O4    . DT  B 1 2   ? 105.327 11.344 -82.230 1.00 92.70  ? 148  DT  J O4    1 
ATOM   3026  C C5    . DT  B 1 2   ? 106.639 9.418  -82.668 1.00 93.47  ? 148  DT  J C5    1 
ATOM   3027  C C7    . DT  B 1 2   ? 105.602 8.481  -82.136 1.00 93.61  ? 148  DT  J C7    1 
ATOM   3028  C C6    . DT  B 1 2   ? 107.817 9.007  -83.169 1.00 94.33  ? 148  DT  J C6    1 
ATOM   3029  P P     . DC  B 1 3   ? 113.968 8.146  -83.773 1.00 169.17 ? 149  DC  J P     1 
ATOM   3030  O OP1   . DC  B 1 3   ? 115.169 8.731  -84.430 1.00 86.26  ? 149  DC  J OP1   1 
ATOM   3031  O OP2   . DC  B 1 3   ? 114.033 6.775  -83.189 1.00 86.32  ? 149  DC  J OP2   1 
ATOM   3032  O "O5'" . DC  B 1 3   ? 113.492 9.174  -82.653 1.00 167.60 ? 149  DC  J "O5'" 1 
ATOM   3033  C "C5'" . DC  B 1 3   ? 114.377 9.620  -81.625 1.00 165.22 ? 149  DC  J "C5'" 1 
ATOM   3034  C "C4'" . DC  B 1 3   ? 114.819 11.038 -81.901 1.00 163.25 ? 149  DC  J "C4'" 1 
ATOM   3035  O "O4'" . DC  B 1 3   ? 113.675 11.771 -82.395 1.00 161.30 ? 149  DC  J "O4'" 1 
ATOM   3036  C "C3'" . DC  B 1 3   ? 115.320 11.792 -80.670 1.00 162.15 ? 149  DC  J "C3'" 1 
ATOM   3037  O "O3'" . DC  B 1 3   ? 116.572 12.473 -80.889 1.00 162.76 ? 149  DC  J "O3'" 1 
ATOM   3038  C "C2'" . DC  B 1 3   ? 114.142 12.642 -80.237 1.00 160.70 ? 149  DC  J "C2'" 1 
ATOM   3039  C "C1'" . DC  B 1 3   ? 113.248 12.760 -81.470 1.00 158.28 ? 149  DC  J "C1'" 1 
ATOM   3040  N N1    . DC  B 1 3   ? 111.841 12.477 -81.128 1.00 73.09  ? 149  DC  J N1    1 
ATOM   3041  C C2    . DC  B 1 3   ? 110.920 13.534 -81.065 1.00 71.05  ? 149  DC  J C2    1 
ATOM   3042  O O2    . DC  B 1 3   ? 111.281 14.672 -81.403 1.00 70.79  ? 149  DC  J O2    1 
ATOM   3043  N N3    . DC  B 1 3   ? 109.661 13.282 -80.638 1.00 67.60  ? 149  DC  J N3    1 
ATOM   3044  C C4    . DC  B 1 3   ? 109.308 12.041 -80.293 1.00 66.51  ? 149  DC  J C4    1 
ATOM   3045  N N4    . DC  B 1 3   ? 108.081 11.850 -79.815 1.00 64.24  ? 149  DC  J N4    1 
ATOM   3046  C C5    . DC  B 1 3   ? 110.203 10.942 -80.406 1.00 67.56  ? 149  DC  J C5    1 
ATOM   3047  C C6    . DC  B 1 3   ? 111.446 11.201 -80.827 1.00 69.86  ? 149  DC  J C6    1 
ATOM   3048  P P     . DA  B 1 4   ? 116.620 13.989 -81.443 1.00 126.68 ? 150  DA  J P     1 
ATOM   3049  O OP1   . DA  B 1 4   ? 116.426 13.917 -82.909 1.00 85.68  ? 150  DA  J OP1   1 
ATOM   3050  O OP2   . DA  B 1 4   ? 117.828 14.666 -80.894 1.00 85.24  ? 150  DA  J OP2   1 
ATOM   3051  O "O5'" . DA  B 1 4   ? 115.379 14.759 -80.819 1.00 122.83 ? 150  DA  J "O5'" 1 
ATOM   3052  C "C5'" . DA  B 1 4   ? 114.913 15.945 -81.446 1.00 118.37 ? 150  DA  J "C5'" 1 
ATOM   3053  C "C4'" . DA  B 1 4   ? 114.611 17.007 -80.418 1.00 114.62 ? 150  DA  J "C4'" 1 
ATOM   3054  O "O4'" . DA  B 1 4   ? 113.379 16.705 -79.731 1.00 111.46 ? 150  DA  J "O4'" 1 
ATOM   3055  C "C3'" . DA  B 1 4   ? 115.655 17.237 -79.332 1.00 113.19 ? 150  DA  J "C3'" 1 
ATOM   3056  O "O3'" . DA  B 1 4   ? 115.697 18.651 -79.106 1.00 113.53 ? 150  DA  J "O3'" 1 
ATOM   3057  C "C2'" . DA  B 1 4   ? 115.095 16.460 -78.147 1.00 109.74 ? 150  DA  J "C2'" 1 
ATOM   3058  C "C1'" . DA  B 1 4   ? 113.590 16.614 -78.330 1.00 107.55 ? 150  DA  J "C1'" 1 
ATOM   3059  N N9    . DA  B 1 4   ? 112.736 15.524 -77.852 1.00 62.77  ? 150  DA  J N9    1 
ATOM   3060  C C8    . DA  B 1 4   ? 113.032 14.193 -77.696 1.00 60.70  ? 150  DA  J C8    1 
ATOM   3061  N N7    . DA  B 1 4   ? 111.995 13.456 -77.370 1.00 58.89  ? 150  DA  J N7    1 
ATOM   3062  C C5    . DA  B 1 4   ? 110.949 14.370 -77.272 1.00 56.64  ? 150  DA  J C5    1 
ATOM   3063  C C6    . DA  B 1 4   ? 109.575 14.225 -76.967 1.00 53.64  ? 150  DA  J C6    1 
ATOM   3064  N N6    . DA  B 1 4   ? 108.986 13.057 -76.715 1.00 49.22  ? 150  DA  J N6    1 
ATOM   3065  N N1    . DA  B 1 4   ? 108.817 15.342 -76.939 1.00 52.58  ? 150  DA  J N1    1 
ATOM   3066  C C2    . DA  B 1 4   ? 109.395 16.519 -77.205 1.00 53.81  ? 150  DA  J C2    1 
ATOM   3067  N N3    . DA  B 1 4   ? 110.663 16.785 -77.511 1.00 56.57  ? 150  DA  J N3    1 
ATOM   3068  C C4    . DA  B 1 4   ? 111.398 15.651 -77.532 1.00 59.47  ? 150  DA  J C4    1 
ATOM   3069  P P     . DA  B 1 5   ? 116.554 19.255 -77.895 1.00 109.06 ? 151  DA  J P     1 
ATOM   3070  O OP1   . DA  B 1 5   ? 117.332 20.410 -78.404 1.00 80.14  ? 151  DA  J OP1   1 
ATOM   3071  O OP2   . DA  B 1 5   ? 117.253 18.140 -77.220 1.00 80.35  ? 151  DA  J OP2   1 
ATOM   3072  O "O5'" . DA  B 1 5   ? 115.434 19.835 -76.927 1.00 109.52 ? 151  DA  J "O5'" 1 
ATOM   3073  C "C5'" . DA  B 1 5   ? 114.424 20.699 -77.446 1.00 107.65 ? 151  DA  J "C5'" 1 
ATOM   3074  C "C4'" . DA  B 1 5   ? 113.359 20.965 -76.407 1.00 105.59 ? 151  DA  J "C4'" 1 
ATOM   3075  O "O4'" . DA  B 1 5   ? 112.557 19.787 -76.148 1.00 103.83 ? 151  DA  J "O4'" 1 
ATOM   3076  C "C3'" . DA  B 1 5   ? 113.877 21.427 -75.050 1.00 104.97 ? 151  DA  J "C3'" 1 
ATOM   3077  O "O3'" . DA  B 1 5   ? 113.007 22.456 -74.577 1.00 105.63 ? 151  DA  J "O3'" 1 
ATOM   3078  C "C2'" . DA  B 1 5   ? 113.784 20.170 -74.200 1.00 102.57 ? 151  DA  J "C2'" 1 
ATOM   3079  C "C1'" . DA  B 1 5   ? 112.537 19.513 -74.758 1.00 100.70 ? 151  DA  J "C1'" 1 
ATOM   3080  N N9    . DA  B 1 5   ? 112.461 18.064 -74.608 1.00 68.47  ? 151  DA  J N9    1 
ATOM   3081  C C8    . DA  B 1 5   ? 113.409 17.138 -74.947 1.00 67.23  ? 151  DA  J C8    1 
ATOM   3082  N N7    . DA  B 1 5   ? 113.027 15.895 -74.764 1.00 65.79  ? 151  DA  J N7    1 
ATOM   3083  C C5    . DA  B 1 5   ? 111.743 16.011 -74.258 1.00 63.49  ? 151  DA  J C5    1 
ATOM   3084  C C6    . DA  B 1 5   ? 110.789 15.055 -73.886 1.00 62.79  ? 151  DA  J C6    1 
ATOM   3085  N N6    . DA  B 1 5   ? 110.982 13.749 -73.992 1.00 60.20  ? 151  DA  J N6    1 
ATOM   3086  N N1    . DA  B 1 5   ? 109.609 15.493 -73.409 1.00 62.99  ? 151  DA  J N1    1 
ATOM   3087  C C2    . DA  B 1 5   ? 109.404 16.812 -73.328 1.00 62.15  ? 151  DA  J C2    1 
ATOM   3088  N N3    . DA  B 1 5   ? 110.217 17.817 -73.663 1.00 62.97  ? 151  DA  J N3    1 
ATOM   3089  C C4    . DA  B 1 5   ? 111.387 17.342 -74.131 1.00 65.45  ? 151  DA  J C4    1 
ATOM   3090  P P     . DT  B 1 6   ? 113.571 23.575 -73.582 1.00 101.98 ? 152  DT  J P     1 
ATOM   3091  O OP1   . DT  B 1 6   ? 113.102 24.919 -74.017 1.00 81.01  ? 152  DT  J OP1   1 
ATOM   3092  O OP2   . DT  B 1 6   ? 115.021 23.314 -73.415 1.00 82.27  ? 152  DT  J OP2   1 
ATOM   3093  O "O5'" . DT  B 1 6   ? 112.864 23.188 -72.218 1.00 101.05 ? 152  DT  J "O5'" 1 
ATOM   3094  C "C5'" . DT  B 1 6   ? 112.479 21.843 -71.995 1.00 94.66  ? 152  DT  J "C5'" 1 
ATOM   3095  C "C4'" . DT  B 1 6   ? 111.076 21.782 -71.448 1.00 88.57  ? 152  DT  J "C4'" 1 
ATOM   3096  O "O4'" . DT  B 1 6   ? 110.597 20.433 -71.629 1.00 87.07  ? 152  DT  J "O4'" 1 
ATOM   3097  C "C3'" . DT  B 1 6   ? 110.995 22.066 -69.950 1.00 85.56  ? 152  DT  J "C3'" 1 
ATOM   3098  O "O3'" . DT  B 1 6   ? 109.741 22.688 -69.632 1.00 84.26  ? 152  DT  J "O3'" 1 
ATOM   3099  C "C2'" . DT  B 1 6   ? 111.129 20.683 -69.344 1.00 84.45  ? 152  DT  J "C2'" 1 
ATOM   3100  C "C1'" . DT  B 1 6   ? 110.442 19.797 -70.373 1.00 86.20  ? 152  DT  J "C1'" 1 
ATOM   3101  N N1    . DT  B 1 6   ? 111.000 18.439 -70.488 1.00 62.46  ? 152  DT  J N1    1 
ATOM   3102  C C2    . DT  B 1 6   ? 110.146 17.387 -70.279 1.00 62.20  ? 152  DT  J C2    1 
ATOM   3103  O O2    . DT  B 1 6   ? 108.965 17.542 -70.002 1.00 61.10  ? 152  DT  J O2    1 
ATOM   3104  N N3    . DT  B 1 6   ? 110.721 16.147 -70.401 1.00 62.16  ? 152  DT  J N3    1 
ATOM   3105  C C4    . DT  B 1 6   ? 112.031 15.868 -70.689 1.00 62.46  ? 152  DT  J C4    1 
ATOM   3106  O O4    . DT  B 1 6   ? 112.405 14.710 -70.751 1.00 61.48  ? 152  DT  J O4    1 
ATOM   3107  C C5    . DT  B 1 6   ? 112.874 17.017 -70.892 1.00 63.81  ? 152  DT  J C5    1 
ATOM   3108  C C7    . DT  B 1 6   ? 114.321 16.805 -71.196 1.00 65.04  ? 152  DT  J C7    1 
ATOM   3109  C C6    . DT  B 1 6   ? 112.323 18.232 -70.792 1.00 63.23  ? 152  DT  J C6    1 
ATOM   3110  P P     . DA  B 1 7   ? 109.365 23.009 -68.098 1.00 65.82  ? 153  DA  J P     1 
ATOM   3111  O OP1   . DA  B 1 7   ? 108.535 24.243 -68.085 1.00 52.26  ? 153  DA  J OP1   1 
ATOM   3112  O OP2   . DA  B 1 7   ? 110.591 22.936 -67.264 1.00 49.81  ? 153  DA  J OP2   1 
ATOM   3113  O "O5'" . DA  B 1 7   ? 108.420 21.802 -67.691 1.00 63.00  ? 153  DA  J "O5'" 1 
ATOM   3114  C "C5'" . DA  B 1 7   ? 107.305 21.458 -68.508 1.00 62.46  ? 153  DA  J "C5'" 1 
ATOM   3115  C "C4'" . DA  B 1 7   ? 106.511 20.360 -67.850 1.00 62.82  ? 153  DA  J "C4'" 1 
ATOM   3116  O "O4'" . DA  B 1 7   ? 107.219 19.099 -67.919 1.00 62.79  ? 153  DA  J "O4'" 1 
ATOM   3117  C "C3'" . DA  B 1 7   ? 106.306 20.633 -66.370 1.00 62.03  ? 153  DA  J "C3'" 1 
ATOM   3118  O "O3'" . DA  B 1 7   ? 105.039 20.119 -65.973 1.00 61.62  ? 153  DA  J "O3'" 1 
ATOM   3119  C "C2'" . DA  B 1 7   ? 107.464 19.897 -65.717 1.00 60.36  ? 153  DA  J "C2'" 1 
ATOM   3120  C "C1'" . DA  B 1 7   ? 107.647 18.689 -66.619 1.00 61.34  ? 153  DA  J "C1'" 1 
ATOM   3121  N N9    . DA  B 1 7   ? 109.033 18.234 -66.736 1.00 48.30  ? 153  DA  J N9    1 
ATOM   3122  C C8    . DA  B 1 7   ? 110.151 19.016 -66.857 1.00 47.03  ? 153  DA  J C8    1 
ATOM   3123  N N7    . DA  B 1 7   ? 111.261 18.340 -67.015 1.00 48.85  ? 153  DA  J N7    1 
ATOM   3124  C C5    . DA  B 1 7   ? 110.851 17.019 -66.975 1.00 45.83  ? 153  DA  J C5    1 
ATOM   3125  C C6    . DA  B 1 7   ? 111.563 15.805 -67.084 1.00 46.32  ? 153  DA  J C6    1 
ATOM   3126  N N6    . DA  B 1 7   ? 112.893 15.732 -67.258 1.00 42.36  ? 153  DA  J N6    1 
ATOM   3127  N N1    . DA  B 1 7   ? 110.850 14.654 -67.002 1.00 43.47  ? 153  DA  J N1    1 
ATOM   3128  C C2    . DA  B 1 7   ? 109.516 14.736 -66.814 1.00 45.90  ? 153  DA  J C2    1 
ATOM   3129  N N3    . DA  B 1 7   ? 108.742 15.818 -66.694 1.00 45.64  ? 153  DA  J N3    1 
ATOM   3130  C C4    . DA  B 1 7   ? 109.480 16.938 -66.787 1.00 47.07  ? 153  DA  J C4    1 
ATOM   3131  P P     . DT  B 1 8   ? 104.704 19.983 -64.423 1.00 74.57  ? 154  DT  J P     1 
ATOM   3132  O OP1   . DT  B 1 8   ? 103.238 20.026 -64.238 1.00 62.93  ? 154  DT  J OP1   1 
ATOM   3133  O OP2   . DT  B 1 8   ? 105.577 20.971 -63.722 1.00 57.23  ? 154  DT  J OP2   1 
ATOM   3134  O "O5'" . DT  B 1 8   ? 105.162 18.498 -64.108 1.00 73.10  ? 154  DT  J "O5'" 1 
ATOM   3135  C "C5'" . DT  B 1 8   ? 104.629 17.426 -64.869 1.00 74.83  ? 154  DT  J "C5'" 1 
ATOM   3136  C "C4'" . DT  B 1 8   ? 104.980 16.114 -64.220 1.00 77.48  ? 154  DT  J "C4'" 1 
ATOM   3137  O "O4'" . DT  B 1 8   ? 106.368 15.806 -64.474 1.00 77.91  ? 154  DT  J "O4'" 1 
ATOM   3138  C "C3'" . DT  B 1 8   ? 104.824 16.147 -62.703 1.00 78.90  ? 154  DT  J "C3'" 1 
ATOM   3139  O "O3'" . DT  B 1 8   ? 104.264 14.914 -62.252 1.00 84.14  ? 154  DT  J "O3'" 1 
ATOM   3140  C "C2'" . DT  B 1 8   ? 106.249 16.316 -62.209 1.00 77.99  ? 154  DT  J "C2'" 1 
ATOM   3141  C "C1'" . DT  B 1 8   ? 107.016 15.535 -63.250 1.00 78.12  ? 154  DT  J "C1'" 1 
ATOM   3142  N N1    . DT  B 1 8   ? 108.438 15.877 -63.398 1.00 63.10  ? 154  DT  J N1    1 
ATOM   3143  C C2    . DT  B 1 8   ? 109.328 14.832 -63.523 1.00 63.37  ? 154  DT  J C2    1 
ATOM   3144  O O2    . DT  B 1 8   ? 108.984 13.657 -63.543 1.00 64.71  ? 154  DT  J O2    1 
ATOM   3145  N N3    . DT  B 1 8   ? 110.643 15.212 -63.635 1.00 61.56  ? 154  DT  J N3    1 
ATOM   3146  C C4    . DT  B 1 8   ? 111.140 16.498 -63.656 1.00 62.10  ? 154  DT  J C4    1 
ATOM   3147  O O4    . DT  B 1 8   ? 112.352 16.687 -63.779 1.00 59.34  ? 154  DT  J O4    1 
ATOM   3148  C C5    . DT  B 1 8   ? 110.150 17.541 -63.535 1.00 61.60  ? 154  DT  J C5    1 
ATOM   3149  C C7    . DT  B 1 8   ? 110.601 18.964 -63.565 1.00 58.32  ? 154  DT  J C7    1 
ATOM   3150  C C6    . DT  B 1 8   ? 108.865 17.184 -63.409 1.00 61.77  ? 154  DT  J C6    1 
ATOM   3151  P P     . DC  B 1 9   ? 103.396 14.882 -60.902 1.00 97.27  ? 155  DC  J P     1 
ATOM   3152  O OP1   . DC  B 1 9   ? 102.160 14.095 -61.160 1.00 80.54  ? 155  DC  J OP1   1 
ATOM   3153  O OP2   . DC  B 1 9   ? 103.302 16.278 -60.398 1.00 77.99  ? 155  DC  J OP2   1 
ATOM   3154  O "O5'" . DC  B 1 9   ? 104.318 14.054 -59.916 1.00 97.39  ? 155  DC  J "O5'" 1 
ATOM   3155  C "C5'" . DC  B 1 9   ? 105.647 13.787 -60.290 1.00 96.33  ? 155  DC  J "C5'" 1 
ATOM   3156  C "C4'" . DC  B 1 9   ? 105.925 12.309 -60.211 1.00 96.12  ? 155  DC  J "C4'" 1 
ATOM   3157  O "O4'" . DC  B 1 9   ? 107.235 12.119 -60.777 1.00 95.16  ? 155  DC  J "O4'" 1 
ATOM   3158  C "C3'" . DC  B 1 9   ? 106.014 11.814 -58.773 1.00 95.02  ? 155  DC  J "C3'" 1 
ATOM   3159  O "O3'" . DC  B 1 9   ? 105.647 10.430 -58.668 1.00 95.05  ? 155  DC  J "O3'" 1 
ATOM   3160  C "C2'" . DC  B 1 9   ? 107.462 12.079 -58.415 1.00 95.88  ? 155  DC  J "C2'" 1 
ATOM   3161  C "C1'" . DC  B 1 9   ? 108.206 12.025 -59.748 1.00 93.61  ? 155  DC  J "C1'" 1 
ATOM   3162  N N1    . DC  B 1 9   ? 109.152 13.141 -59.934 1.00 72.38  ? 155  DC  J N1    1 
ATOM   3163  C C2    . DC  B 1 9   ? 110.499 12.855 -60.170 1.00 72.22  ? 155  DC  J C2    1 
ATOM   3164  O O2    . DC  B 1 9   ? 110.863 11.664 -60.208 1.00 75.15  ? 155  DC  J O2    1 
ATOM   3165  N N3    . DC  B 1 9   ? 111.375 13.879 -60.346 1.00 70.64  ? 155  DC  J N3    1 
ATOM   3166  C C4    . DC  B 1 9   ? 110.947 15.142 -60.286 1.00 70.29  ? 155  DC  J C4    1 
ATOM   3167  N N4    . DC  B 1 9   ? 111.846 16.119 -60.456 1.00 68.22  ? 155  DC  J N4    1 
ATOM   3168  C C5    . DC  B 1 9   ? 109.579 15.458 -60.044 1.00 70.01  ? 155  DC  J C5    1 
ATOM   3169  C C6    . DC  B 1 9   ? 108.725 14.437 -59.876 1.00 70.76  ? 155  DC  J C6    1 
ATOM   3170  P P     . DC  B 1 10  ? 105.440 9.757  -57.214 1.00 105.96 ? 156  DC  J P     1 
ATOM   3171  O OP1   . DC  B 1 10  ? 104.517 8.606  -57.356 1.00 65.91  ? 156  DC  J OP1   1 
ATOM   3172  O OP2   . DC  B 1 10  ? 105.152 10.801 -56.195 1.00 65.30  ? 156  DC  J OP2   1 
ATOM   3173  O "O5'" . DC  B 1 10  ? 106.878 9.172  -56.894 1.00 104.35 ? 156  DC  J "O5'" 1 
ATOM   3174  C "C5'" . DC  B 1 10  ? 107.468 8.215  -57.757 1.00 104.06 ? 156  DC  J "C5'" 1 
ATOM   3175  C "C4'" . DC  B 1 10  ? 108.802 7.791  -57.199 1.00 104.28 ? 156  DC  J "C4'" 1 
ATOM   3176  O "O4'" . DC  B 1 10  ? 109.813 8.777  -57.522 1.00 102.37 ? 156  DC  J "O4'" 1 
ATOM   3177  C "C3'" . DC  B 1 10  ? 108.792 7.660  -55.678 1.00 105.31 ? 156  DC  J "C3'" 1 
ATOM   3178  O "O3'" . DC  B 1 10  ? 109.494 6.477  -55.302 1.00 108.68 ? 156  DC  J "O3'" 1 
ATOM   3179  C "C2'" . DC  B 1 10  ? 109.480 8.928  -55.203 1.00 103.37 ? 156  DC  J "C2'" 1 
ATOM   3180  C "C1'" . DC  B 1 10  ? 110.441 9.245  -56.338 1.00 101.74 ? 156  DC  J "C1'" 1 
ATOM   3181  N N1    . DC  B 1 10  ? 110.729 10.681 -56.517 1.00 61.84  ? 156  DC  J N1    1 
ATOM   3182  C C2    . DC  B 1 10  ? 112.022 11.070 -56.884 1.00 60.80  ? 156  DC  J C2    1 
ATOM   3183  O O2    . DC  B 1 10  ? 112.893 10.191 -57.009 1.00 62.88  ? 156  DC  J O2    1 
ATOM   3184  N N3    . DC  B 1 10  ? 112.289 12.394 -57.086 1.00 60.67  ? 156  DC  J N3    1 
ATOM   3185  C C4    . DC  B 1 10  ? 111.321 13.304 -56.922 1.00 59.34  ? 156  DC  J C4    1 
ATOM   3186  N N4    . DC  B 1 10  ? 111.614 14.590 -57.137 1.00 56.59  ? 156  DC  J N4    1 
ATOM   3187  C C5    . DC  B 1 10  ? 110.004 12.935 -56.527 1.00 60.54  ? 156  DC  J C5    1 
ATOM   3188  C C6    . DC  B 1 10  ? 109.754 11.624 -56.337 1.00 61.55  ? 156  DC  J C6    1 
ATOM   3189  P P     . DA  B 1 11  ? 110.031 6.295  -53.801 1.00 80.98  ? 157  DA  J P     1 
ATOM   3190  O OP1   . DA  B 1 11  ? 110.209 4.831  -53.649 1.00 70.19  ? 157  DA  J OP1   1 
ATOM   3191  O OP2   . DA  B 1 11  ? 109.224 7.058  -52.801 1.00 67.01  ? 157  DA  J OP2   1 
ATOM   3192  O "O5'" . DA  B 1 11  ? 111.478 6.940  -53.864 1.00 81.99  ? 157  DA  J "O5'" 1 
ATOM   3193  C "C5'" . DA  B 1 11  ? 112.510 6.265  -54.556 1.00 78.89  ? 157  DA  J "C5'" 1 
ATOM   3194  C "C4'" . DA  B 1 11  ? 113.798 6.391  -53.787 1.00 77.88  ? 157  DA  J "C4'" 1 
ATOM   3195  O "O4'" . DA  B 1 11  ? 114.324 7.717  -53.989 1.00 76.04  ? 157  DA  J "O4'" 1 
ATOM   3196  C "C3'" . DA  B 1 11  ? 113.625 6.218  -52.285 1.00 76.64  ? 157  DA  J "C3'" 1 
ATOM   3197  O "O3'" . DA  B 1 11  ? 114.742 5.503  -51.762 1.00 78.36  ? 157  DA  J "O3'" 1 
ATOM   3198  C "C2'" . DA  B 1 11  ? 113.508 7.643  -51.778 1.00 75.49  ? 157  DA  J "C2'" 1 
ATOM   3199  C "C1'" . DA  B 1 11  ? 114.262 8.478  -52.805 1.00 74.19  ? 157  DA  J "C1'" 1 
ATOM   3200  N N9    . DA  B 1 11  ? 113.598 9.738  -53.145 1.00 59.63  ? 157  DA  J N9    1 
ATOM   3201  C C8    . DA  B 1 11  ? 112.252 10.016 -53.092 1.00 57.87  ? 157  DA  J C8    1 
ATOM   3202  N N7    . DA  B 1 11  ? 111.958 11.254 -53.409 1.00 56.12  ? 157  DA  J N7    1 
ATOM   3203  C C5    . DA  B 1 11  ? 113.189 11.824 -53.704 1.00 58.29  ? 157  DA  J C5    1 
ATOM   3204  C C6    . DA  B 1 11  ? 113.558 13.119 -54.081 1.00 58.01  ? 157  DA  J C6    1 
ATOM   3205  N N6    . DA  B 1 11  ? 112.688 14.118 -54.227 1.00 58.10  ? 157  DA  J N6    1 
ATOM   3206  N N1    . DA  B 1 11  ? 114.867 13.365 -54.295 1.00 57.30  ? 157  DA  J N1    1 
ATOM   3207  C C2    . DA  B 1 11  ? 115.733 12.372 -54.129 1.00 56.97  ? 157  DA  J C2    1 
ATOM   3208  N N3    . DA  B 1 11  ? 115.511 11.112 -53.767 1.00 58.40  ? 157  DA  J N3    1 
ATOM   3209  C C4    . DA  B 1 11  ? 114.204 10.900 -53.565 1.00 58.64  ? 157  DA  J C4    1 
ATOM   3210  P P     . DC  B 1 12  ? 114.951 5.366  -50.174 1.00 67.86  ? 158  DC  J P     1 
ATOM   3211  O OP1   . DC  B 1 12  ? 115.489 4.000  -49.925 1.00 54.36  ? 158  DC  J OP1   1 
ATOM   3212  O OP2   . DC  B 1 12  ? 113.745 5.811  -49.434 1.00 51.49  ? 158  DC  J OP2   1 
ATOM   3213  O "O5'" . DC  B 1 12  ? 116.089 6.450  -49.921 1.00 67.66  ? 158  DC  J "O5'" 1 
ATOM   3214  C "C5'" . DC  B 1 12  ? 117.077 6.673  -50.924 1.00 70.00  ? 158  DC  J "C5'" 1 
ATOM   3215  C "C4'" . DC  B 1 12  ? 117.870 7.920  -50.626 1.00 71.71  ? 158  DC  J "C4'" 1 
ATOM   3216  O "O4'" . DC  B 1 12  ? 117.193 9.094  -51.138 1.00 73.07  ? 158  DC  J "O4'" 1 
ATOM   3217  C "C3'" . DC  B 1 12  ? 118.120 8.172  -49.139 1.00 71.96  ? 158  DC  J "C3'" 1 
ATOM   3218  O "O3'" . DC  B 1 12  ? 119.478 8.563  -48.915 1.00 73.55  ? 158  DC  J "O3'" 1 
ATOM   3219  C "C2'" . DC  B 1 12  ? 117.204 9.340  -48.833 1.00 72.63  ? 158  DC  J "C2'" 1 
ATOM   3220  C "C1'" . DC  B 1 12  ? 117.249 10.096 -50.146 1.00 72.44  ? 158  DC  J "C1'" 1 
ATOM   3221  N N1    . DC  B 1 12  ? 116.130 11.032 -50.346 1.00 55.41  ? 158  DC  J N1    1 
ATOM   3222  C C2    . DC  B 1 12  ? 116.419 12.363 -50.713 1.00 53.85  ? 158  DC  J C2    1 
ATOM   3223  O O2    . DC  B 1 12  ? 117.602 12.686 -50.921 1.00 53.89  ? 158  DC  J O2    1 
ATOM   3224  N N3    . DC  B 1 12  ? 115.403 13.252 -50.820 1.00 52.49  ? 158  DC  J N3    1 
ATOM   3225  C C4    . DC  B 1 12  ? 114.150 12.862 -50.579 1.00 52.24  ? 158  DC  J C4    1 
ATOM   3226  N N4    . DC  B 1 12  ? 113.197 13.771 -50.645 1.00 49.17  ? 158  DC  J N4    1 
ATOM   3227  C C5    . DC  B 1 12  ? 113.826 11.512 -50.244 1.00 52.88  ? 158  DC  J C5    1 
ATOM   3228  C C6    . DC  B 1 12  ? 114.834 10.638 -50.144 1.00 54.25  ? 158  DC  J C6    1 
ATOM   3229  P P     . DC  B 1 13  ? 119.943 9.018  -47.445 1.00 81.14  ? 159  DC  J P     1 
ATOM   3230  O OP1   . DC  B 1 13  ? 121.368 8.654  -47.266 1.00 80.66  ? 159  DC  J OP1   1 
ATOM   3231  O OP2   . DC  B 1 13  ? 118.935 8.562  -46.455 1.00 79.31  ? 159  DC  J OP2   1 
ATOM   3232  O "O5'" . DC  B 1 13  ? 119.864 10.595 -47.532 1.00 82.78  ? 159  DC  J "O5'" 1 
ATOM   3233  C "C5'" . DC  B 1 13  ? 120.713 11.293 -48.420 1.00 84.72  ? 159  DC  J "C5'" 1 
ATOM   3234  C "C4'" . DC  B 1 13  ? 120.932 12.689 -47.903 1.00 87.76  ? 159  DC  J "C4'" 1 
ATOM   3235  O "O4'" . DC  B 1 13  ? 119.796 13.528 -48.234 1.00 88.26  ? 159  DC  J "O4'" 1 
ATOM   3236  C "C3'" . DC  B 1 13  ? 121.084 12.741 -46.385 1.00 88.39  ? 159  DC  J "C3'" 1 
ATOM   3237  O "O3'" . DC  B 1 13  ? 122.072 13.711 -46.057 1.00 91.29  ? 159  DC  J "O3'" 1 
ATOM   3238  C "C2'" . DC  B 1 13  ? 119.713 13.187 -45.912 1.00 88.62  ? 159  DC  J "C2'" 1 
ATOM   3239  C "C1'" . DC  B 1 13  ? 119.256 14.096 -47.051 1.00 87.35  ? 159  DC  J "C1'" 1 
ATOM   3240  N N1    . DC  B 1 13  ? 117.789 14.194 -47.221 1.00 83.44  ? 159  DC  J N1    1 
ATOM   3241  C C2    . DC  B 1 13  ? 117.203 15.464 -47.397 1.00 83.32  ? 159  DC  J C2    1 
ATOM   3242  O O2    . DC  B 1 13  ? 117.937 16.476 -47.412 1.00 81.77  ? 159  DC  J O2    1 
ATOM   3243  N N3    . DC  B 1 13  ? 115.854 15.548 -47.540 1.00 80.23  ? 159  DC  J N3    1 
ATOM   3244  C C4    . DC  B 1 13  ? 115.106 14.438 -47.504 1.00 79.63  ? 159  DC  J C4    1 
ATOM   3245  N N4    . DC  B 1 13  ? 113.789 14.565 -47.629 1.00 74.30  ? 159  DC  J N4    1 
ATOM   3246  C C5    . DC  B 1 13  ? 115.677 13.147 -47.333 1.00 80.43  ? 159  DC  J C5    1 
ATOM   3247  C C6    . DC  B 1 13  ? 117.006 13.070 -47.200 1.00 83.04  ? 159  DC  J C6    1 
ATOM   3248  P P     . DT  B 1 14  ? 122.614 13.828 -44.556 1.00 114.98 ? 160  DT  J P     1 
ATOM   3249  O OP1   . DT  B 1 14  ? 124.088 13.954 -44.643 1.00 77.53  ? 160  DT  J OP1   1 
ATOM   3250  O OP2   . DT  B 1 14  ? 122.014 12.731 -43.751 1.00 76.83  ? 160  DT  J OP2   1 
ATOM   3251  O "O5'" . DT  B 1 14  ? 122.028 15.235 -44.094 1.00 116.87 ? 160  DT  J "O5'" 1 
ATOM   3252  C "C5'" . DT  B 1 14  ? 122.216 16.399 -44.907 1.00 119.33 ? 160  DT  J "C5'" 1 
ATOM   3253  C "C4'" . DT  B 1 14  ? 121.435 17.567 -44.350 1.00 122.35 ? 160  DT  J "C4'" 1 
ATOM   3254  O "O4'" . DT  B 1 14  ? 120.023 17.452 -44.658 1.00 122.22 ? 160  DT  J "O4'" 1 
ATOM   3255  C "C3'" . DT  B 1 14  ? 121.530 17.729 -42.832 1.00 124.02 ? 160  DT  J "C3'" 1 
ATOM   3256  O "O3'" . DT  B 1 14  ? 121.594 19.117 -42.510 1.00 128.15 ? 160  DT  J "O3'" 1 
ATOM   3257  C "C2'" . DT  B 1 14  ? 120.208 17.164 -42.344 1.00 122.81 ? 160  DT  J "C2'" 1 
ATOM   3258  C "C1'" . DT  B 1 14  ? 119.272 17.591 -43.461 1.00 121.36 ? 160  DT  J "C1'" 1 
ATOM   3259  N N1    . DT  B 1 14  ? 118.034 16.792 -43.592 1.00 81.71  ? 160  DT  J N1    1 
ATOM   3260  C C2    . DT  B 1 14  ? 116.881 17.453 -43.938 1.00 79.92  ? 160  DT  J C2    1 
ATOM   3261  O O2    . DT  B 1 14  ? 116.843 18.652 -44.163 1.00 78.72  ? 160  DT  J O2    1 
ATOM   3262  N N3    . DT  B 1 14  ? 115.769 16.660 -44.015 1.00 77.89  ? 160  DT  J N3    1 
ATOM   3263  C C4    . DT  B 1 14  ? 115.696 15.304 -43.801 1.00 77.91  ? 160  DT  J C4    1 
ATOM   3264  O O4    . DT  B 1 14  ? 114.619 14.730 -43.905 1.00 75.39  ? 160  DT  J O4    1 
ATOM   3265  C C5    . DT  B 1 14  ? 116.948 14.665 -43.461 1.00 79.08  ? 160  DT  J C5    1 
ATOM   3266  C C7    . DT  B 1 14  ? 116.977 13.184 -43.239 1.00 77.69  ? 160  DT  J C7    1 
ATOM   3267  C C6    . DT  B 1 14  ? 118.038 15.433 -43.368 1.00 80.10  ? 160  DT  J C6    1 
ATOM   3268  P P     . DG  B 1 15  ? 122.852 19.698 -41.695 1.00 169.67 ? 161  DG  J P     1 
ATOM   3269  O OP1   . DG  B 1 15  ? 124.024 19.736 -42.606 1.00 87.43  ? 161  DG  J OP1   1 
ATOM   3270  O OP2   . DG  B 1 15  ? 122.954 18.988 -40.389 1.00 87.40  ? 161  DG  J OP2   1 
ATOM   3271  O "O5'" . DG  B 1 15  ? 122.416 21.204 -41.434 1.00 169.77 ? 161  DG  J "O5'" 1 
ATOM   3272  C "C5'" . DG  B 1 15  ? 122.036 22.032 -42.530 1.00 169.74 ? 161  DG  J "C5'" 1 
ATOM   3273  C "C4'" . DG  B 1 15  ? 120.741 22.748 -42.228 1.00 169.39 ? 161  DG  J "C4'" 1 
ATOM   3274  O "O4'" . DG  B 1 15  ? 119.620 21.831 -42.190 1.00 168.69 ? 161  DG  J "O4'" 1 
ATOM   3275  C "C3'" . DG  B 1 15  ? 120.719 23.491 -40.899 1.00 169.83 ? 161  DG  J "C3'" 1 
ATOM   3276  O "O3'" . DG  B 1 15  ? 120.065 24.733 -41.102 1.00 170.17 ? 161  DG  J "O3'" 1 
ATOM   3277  C "C2'" . DG  B 1 15  ? 119.895 22.589 -39.996 1.00 169.72 ? 161  DG  J "C2'" 1 
ATOM   3278  C "C1'" . DG  B 1 15  ? 118.905 21.979 -40.968 1.00 168.13 ? 161  DG  J "C1'" 1 
ATOM   3279  N N9    . DG  B 1 15  ? 118.393 20.662 -40.594 1.00 85.01  ? 161  DG  J N9    1 
ATOM   3280  C C8    . DG  B 1 15  ? 119.082 19.651 -39.968 1.00 83.97  ? 161  DG  J C8    1 
ATOM   3281  N N7    . DG  B 1 15  ? 118.382 18.555 -39.841 1.00 83.27  ? 161  DG  J N7    1 
ATOM   3282  C C5    . DG  B 1 15  ? 117.149 18.864 -40.400 1.00 82.55  ? 161  DG  J C5    1 
ATOM   3283  C C6    . DG  B 1 15  ? 115.978 18.060 -40.572 1.00 81.36  ? 161  DG  J C6    1 
ATOM   3284  O O6    . DG  B 1 15  ? 115.804 16.871 -40.284 1.00 78.43  ? 161  DG  J O6    1 
ATOM   3285  N N1    . DG  B 1 15  ? 114.950 18.779 -41.163 1.00 81.70  ? 161  DG  J N1    1 
ATOM   3286  C C2    . DG  B 1 15  ? 115.031 20.095 -41.553 1.00 82.79  ? 161  DG  J C2    1 
ATOM   3287  N N2    . DG  B 1 15  ? 113.919 20.621 -42.084 1.00 83.13  ? 161  DG  J N2    1 
ATOM   3288  N N3    . DG  B 1 15  ? 116.117 20.844 -41.426 1.00 83.41  ? 161  DG  J N3    1 
ATOM   3289  C C4    . DG  B 1 15  ? 117.130 20.170 -40.844 1.00 83.62  ? 161  DG  J C4    1 
ATOM   3290  P P     . DC  B 1 16  ? 120.173 25.874 -39.992 1.00 106.13 ? 162  DC  J P     1 
ATOM   3291  O OP1   . DC  B 1 16  ? 120.442 27.125 -40.748 1.00 103.33 ? 162  DC  J OP1   1 
ATOM   3292  O OP2   . DC  B 1 16  ? 121.102 25.451 -38.906 1.00 102.59 ? 162  DC  J OP2   1 
ATOM   3293  O "O5'" . DC  B 1 16  ? 118.696 25.914 -39.401 1.00 105.50 ? 162  DC  J "O5'" 1 
ATOM   3294  C "C5'" . DC  B 1 16  ? 117.602 26.288 -40.229 1.00 104.90 ? 162  DC  J "C5'" 1 
ATOM   3295  C "C4'" . DC  B 1 16  ? 116.309 26.175 -39.462 1.00 104.35 ? 162  DC  J "C4'" 1 
ATOM   3296  O "O4'" . DC  B 1 16  ? 115.922 24.791 -39.331 1.00 104.12 ? 162  DC  J "O4'" 1 
ATOM   3297  C "C3'" . DC  B 1 16  ? 116.376 26.732 -38.042 1.00 104.36 ? 162  DC  J "C3'" 1 
ATOM   3298  O "O3'" . DC  B 1 16  ? 115.133 27.349 -37.742 1.00 104.66 ? 162  DC  J "O3'" 1 
ATOM   3299  C "C2'" . DC  B 1 16  ? 116.528 25.484 -37.194 1.00 104.37 ? 162  DC  J "C2'" 1 
ATOM   3300  C "C1'" . DC  B 1 16  ? 115.656 24.524 -37.971 1.00 104.78 ? 162  DC  J "C1'" 1 
ATOM   3301  N N1    . DC  B 1 16  ? 115.885 23.096 -37.736 1.00 102.63 ? 162  DC  J N1    1 
ATOM   3302  C C2    . DC  B 1 16  ? 114.832 22.220 -37.975 1.00 102.63 ? 162  DC  J C2    1 
ATOM   3303  O O2    . DC  B 1 16  ? 113.760 22.682 -38.396 1.00 102.69 ? 162  DC  J O2    1 
ATOM   3304  N N3    . DC  B 1 16  ? 115.001 20.901 -37.749 1.00 102.30 ? 162  DC  J N3    1 
ATOM   3305  C C4    . DC  B 1 16  ? 116.172 20.449 -37.312 1.00 102.87 ? 162  DC  J C4    1 
ATOM   3306  N N4    . DC  B 1 16  ? 116.285 19.141 -37.107 1.00 102.20 ? 162  DC  J N4    1 
ATOM   3307  C C5    . DC  B 1 16  ? 117.274 21.320 -37.067 1.00 102.70 ? 162  DC  J C5    1 
ATOM   3308  C C6    . DC  B 1 16  ? 117.087 22.627 -37.290 1.00 102.61 ? 162  DC  J C6    1 
ATOM   3309  P P     . DA  B 1 17  ? 114.910 28.885 -38.116 1.00 109.65 ? 163  DA  J P     1 
ATOM   3310  O OP1   . DA  B 1 17  ? 115.552 29.130 -39.429 1.00 85.76  ? 163  DA  J OP1   1 
ATOM   3311  O OP2   . DA  B 1 17  ? 115.314 29.691 -36.938 1.00 86.10  ? 163  DA  J OP2   1 
ATOM   3312  O "O5'" . DA  B 1 17  ? 113.336 28.991 -38.312 1.00 109.65 ? 163  DA  J "O5'" 1 
ATOM   3313  C "C5'" . DA  B 1 17  ? 112.703 28.448 -39.469 1.00 108.15 ? 163  DA  J "C5'" 1 
ATOM   3314  C "C4'" . DA  B 1 17  ? 111.507 27.617 -39.064 1.00 107.71 ? 163  DA  J "C4'" 1 
ATOM   3315  O "O4'" . DA  B 1 17  ? 111.945 26.379 -38.450 1.00 107.46 ? 163  DA  J "O4'" 1 
ATOM   3316  C "C3'" . DA  B 1 17  ? 110.597 28.294 -38.040 1.00 106.87 ? 163  DA  J "C3'" 1 
ATOM   3317  O "O3'" . DA  B 1 17  ? 109.234 27.942 -38.286 1.00 107.48 ? 163  DA  J "O3'" 1 
ATOM   3318  C "C2'" . DA  B 1 17  ? 111.056 27.696 -36.724 1.00 106.44 ? 163  DA  J "C2'" 1 
ATOM   3319  C "C1'" . DA  B 1 17  ? 111.427 26.282 -37.132 1.00 105.99 ? 163  DA  J "C1'" 1 
ATOM   3320  N N9    . DA  B 1 17  ? 112.453 25.669 -36.291 1.00 82.20  ? 163  DA  J N9    1 
ATOM   3321  C C8    . DA  B 1 17  ? 113.491 26.282 -35.630 1.00 81.71  ? 163  DA  J C8    1 
ATOM   3322  N N7    . DA  B 1 17  ? 114.244 25.455 -34.946 1.00 81.19  ? 163  DA  J N7    1 
ATOM   3323  C C5    . DA  B 1 17  ? 113.667 24.211 -35.175 1.00 81.76  ? 163  DA  J C5    1 
ATOM   3324  C C6    . DA  B 1 17  ? 113.991 22.915 -34.726 1.00 81.88  ? 163  DA  J C6    1 
ATOM   3325  N N6    . DA  B 1 17  ? 115.025 22.644 -33.933 1.00 81.94  ? 163  DA  J N6    1 
ATOM   3326  N N1    . DA  B 1 17  ? 113.204 21.896 -35.128 1.00 81.48  ? 163  DA  J N1    1 
ATOM   3327  C C2    . DA  B 1 17  ? 112.166 22.166 -35.927 1.00 81.29  ? 163  DA  J C2    1 
ATOM   3328  N N3    . DA  B 1 17  ? 111.760 23.337 -36.420 1.00 81.57  ? 163  DA  J N3    1 
ATOM   3329  C C4    . DA  B 1 17  ? 112.562 24.330 -36.001 1.00 81.90  ? 163  DA  J C4    1 
ATOM   3330  P P     . DG  B 1 18  ? 108.060 28.860 -37.695 1.00 91.76  ? 164  DG  J P     1 
ATOM   3331  O OP1   . DG  B 1 18  ? 107.395 29.551 -38.824 1.00 92.35  ? 164  DG  J OP1   1 
ATOM   3332  O OP2   . DG  B 1 18  ? 108.653 29.652 -36.587 1.00 92.42  ? 164  DG  J OP2   1 
ATOM   3333  O "O5'" . DG  B 1 18  ? 107.042 27.815 -37.068 1.00 88.40  ? 164  DG  J "O5'" 1 
ATOM   3334  C "C5'" . DG  B 1 18  ? 106.876 26.542 -37.655 1.00 86.14  ? 164  DG  J "C5'" 1 
ATOM   3335  C "C4'" . DG  B 1 18  ? 106.923 25.471 -36.592 1.00 85.31  ? 164  DG  J "C4'" 1 
ATOM   3336  O "O4'" . DG  B 1 18  ? 108.255 25.304 -36.047 1.00 85.01  ? 164  DG  J "O4'" 1 
ATOM   3337  C "C3'" . DG  B 1 18  ? 106.012 25.690 -35.385 1.00 84.65  ? 164  DG  J "C3'" 1 
ATOM   3338  O "O3'" . DG  B 1 18  ? 105.378 24.463 -35.076 1.00 83.63  ? 164  DG  J "O3'" 1 
ATOM   3339  C "C2'" . DG  B 1 18  ? 106.979 26.000 -34.257 1.00 84.48  ? 164  DG  J "C2'" 1 
ATOM   3340  C "C1'" . DG  B 1 18  ? 108.132 25.111 -34.649 1.00 85.27  ? 164  DG  J "C1'" 1 
ATOM   3341  N N9    . DG  B 1 18  ? 109.421 25.392 -34.023 1.00 86.63  ? 164  DG  J N9    1 
ATOM   3342  C C8    . DG  B 1 18  ? 110.023 26.614 -33.875 1.00 86.04  ? 164  DG  J C8    1 
ATOM   3343  N N7    . DG  B 1 18  ? 111.181 26.546 -33.275 1.00 86.51  ? 164  DG  J N7    1 
ATOM   3344  C C5    . DG  B 1 18  ? 111.354 25.197 -33.009 1.00 86.15  ? 164  DG  J C5    1 
ATOM   3345  C C6    . DG  B 1 18  ? 112.424 24.521 -32.386 1.00 85.90  ? 164  DG  J C6    1 
ATOM   3346  O O6    . DG  B 1 18  ? 113.473 24.995 -31.946 1.00 85.99  ? 164  DG  J O6    1 
ATOM   3347  N N1    . DG  B 1 18  ? 112.197 23.150 -32.312 1.00 85.42  ? 164  DG  J N1    1 
ATOM   3348  C C2    . DG  B 1 18  ? 111.088 22.510 -32.797 1.00 84.62  ? 164  DG  J C2    1 
ATOM   3349  N N2    . DG  B 1 18  ? 111.055 21.185 -32.632 1.00 82.83  ? 164  DG  J N2    1 
ATOM   3350  N N3    . DG  B 1 18  ? 110.083 23.128 -33.398 1.00 85.21  ? 164  DG  J N3    1 
ATOM   3351  C C4    . DG  B 1 18  ? 110.280 24.466 -33.463 1.00 86.14  ? 164  DG  J C4    1 
ATOM   3352  P P     . DA  B 1 19  ? 103.952 24.483 -34.381 1.00 76.83  ? 165  DA  J P     1 
ATOM   3353  O OP1   . DA  B 1 19  ? 102.927 24.529 -35.454 1.00 63.54  ? 165  DA  J OP1   1 
ATOM   3354  O OP2   . DA  B 1 19  ? 104.011 25.562 -33.367 1.00 63.79  ? 165  DA  J OP2   1 
ATOM   3355  O "O5'" . DA  B 1 19  ? 103.873 23.079 -33.642 1.00 78.30  ? 165  DA  J "O5'" 1 
ATOM   3356  C "C5'" . DA  B 1 19  ? 104.025 21.871 -34.368 1.00 81.92  ? 165  DA  J "C5'" 1 
ATOM   3357  C "C4'" . DA  B 1 19  ? 104.708 20.830 -33.513 1.00 84.24  ? 165  DA  J "C4'" 1 
ATOM   3358  O "O4'" . DA  B 1 19  ? 106.056 21.254 -33.197 1.00 83.97  ? 165  DA  J "O4'" 1 
ATOM   3359  C "C3'" . DA  B 1 19  ? 104.038 20.529 -32.175 1.00 86.49  ? 165  DA  J "C3'" 1 
ATOM   3360  O "O3'" . DA  B 1 19  ? 104.100 19.123 -31.937 1.00 90.79  ? 165  DA  J "O3'" 1 
ATOM   3361  C "C2'" . DA  B 1 19  ? 104.897 21.278 -31.172 1.00 85.91  ? 165  DA  J "C2'" 1 
ATOM   3362  C "C1'" . DA  B 1 19  ? 106.277 21.183 -31.801 1.00 84.89  ? 165  DA  J "C1'" 1 
ATOM   3363  N N9    . DA  B 1 19  ? 107.207 22.259 -31.444 1.00 71.24  ? 165  DA  J N9    1 
ATOM   3364  C C8    . DA  B 1 19  ? 107.114 23.589 -31.784 1.00 71.93  ? 165  DA  J C8    1 
ATOM   3365  N N7    . DA  B 1 19  ? 108.079 24.331 -31.288 1.00 72.03  ? 165  DA  J N7    1 
ATOM   3366  C C5    . DA  B 1 19  ? 108.867 23.429 -30.582 1.00 71.95  ? 165  DA  J C5    1 
ATOM   3367  C C6    . DA  B 1 19  ? 110.030 23.594 -29.811 1.00 72.41  ? 165  DA  J C6    1 
ATOM   3368  N N6    . DA  B 1 19  ? 110.614 24.774 -29.604 1.00 72.99  ? 165  DA  J N6    1 
ATOM   3369  N N1    . DA  B 1 19  ? 110.572 22.494 -29.244 1.00 71.75  ? 165  DA  J N1    1 
ATOM   3370  C C2    . DA  B 1 19  ? 109.972 21.316 -29.434 1.00 71.83  ? 165  DA  J C2    1 
ATOM   3371  N N3    . DA  B 1 19  ? 108.868 21.031 -30.126 1.00 71.64  ? 165  DA  J N3    1 
ATOM   3372  C C4    . DA  B 1 19  ? 108.355 22.146 -30.684 1.00 71.70  ? 165  DA  J C4    1 
ATOM   3373  P P     . DT  B 1 20  ? 103.472 18.524 -30.595 1.00 79.30  ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 20  ? 102.991 17.136 -30.838 1.00 79.57  ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 20  ? 102.522 19.555 -30.123 1.00 79.14  ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 20  ? 104.726 18.456 -29.613 1.00 81.93  ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 20  ? 105.852 17.647 -29.941 1.00 85.68  ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 20  ? 106.787 17.532 -28.759 1.00 88.99  ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 20  ? 107.594 18.726 -28.617 1.00 89.38  ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 20  ? 106.114 17.306 -27.403 1.00 90.80  ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 20  ? 106.879 16.378 -26.625 1.00 93.27  ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 20  ? 106.194 18.674 -26.755 1.00 90.30  ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 20  ? 107.536 19.157 -27.265 1.00 89.73  ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 20  ? 107.714 20.619 -27.235 1.00 89.32  ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 20  ? 108.703 21.136 -26.424 1.00 90.10  ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 20  ? 109.418 20.442 -25.718 1.00 90.70  ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 20  ? 108.820 22.503 -26.467 1.00 89.91  ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 20  ? 108.063 23.383 -27.219 1.00 89.12  ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 20  ? 108.292 24.589 -27.169 1.00 88.77  ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 20  ? 107.033 22.772 -28.032 1.00 88.78  ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 20  ? 106.151 23.647 -28.867 1.00 87.98  ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 20  ? 106.915 21.437 -28.000 1.00 88.83  ? 166  DT  J C6    1 
ATOM   3393  P P     . DT  B 1 21  ? 106.140 15.398 -25.585 1.00 131.17 ? 167  DT  J P     1 
ATOM   3394  O OP1   . DT  B 1 21  ? 106.083 14.041 -26.181 1.00 107.83 ? 167  DT  J OP1   1 
ATOM   3395  O OP2   . DT  B 1 21  ? 104.895 16.041 -25.096 1.00 107.98 ? 167  DT  J OP2   1 
ATOM   3396  O "O5'" . DT  B 1 21  ? 107.154 15.342 -24.370 1.00 134.00 ? 167  DT  J "O5'" 1 
ATOM   3397  C "C5'" . DT  B 1 21  ? 108.536 15.136 -24.607 1.00 137.97 ? 167  DT  J "C5'" 1 
ATOM   3398  C "C4'" . DT  B 1 21  ? 109.344 15.790 -23.515 1.00 139.98 ? 167  DT  J "C4'" 1 
ATOM   3399  O "O4'" . DT  B 1 21  ? 109.406 17.228 -23.702 1.00 139.87 ? 167  DT  J "O4'" 1 
ATOM   3400  C "C3'" . DT  B 1 21  ? 108.755 15.573 -22.123 1.00 141.55 ? 167  DT  J "C3'" 1 
ATOM   3401  O "O3'" . DT  B 1 21  ? 109.803 15.315 -21.194 1.00 144.13 ? 167  DT  J "O3'" 1 
ATOM   3402  C "C2'" . DT  B 1 21  ? 108.099 16.906 -21.810 1.00 140.92 ? 167  DT  J "C2'" 1 
ATOM   3403  C "C1'" . DT  B 1 21  ? 109.062 17.859 -22.481 1.00 139.68 ? 167  DT  J "C1'" 1 
ATOM   3404  N N1    . DT  B 1 21  ? 108.536 19.206 -22.779 1.00 115.70 ? 167  DT  J N1    1 
ATOM   3405  C C2    . DT  B 1 21  ? 109.307 20.286 -22.400 1.00 114.76 ? 167  DT  J C2    1 
ATOM   3406  O O2    . DT  B 1 21  ? 110.375 20.172 -21.818 1.00 114.61 ? 167  DT  J O2    1 
ATOM   3407  N N3    . DT  B 1 21  ? 108.777 21.510 -22.726 1.00 113.87 ? 167  DT  J N3    1 
ATOM   3408  C C4    . DT  B 1 21  ? 107.581 21.757 -23.368 1.00 113.33 ? 167  DT  J C4    1 
ATOM   3409  O O4    . DT  B 1 21  ? 107.245 22.908 -23.609 1.00 112.70 ? 167  DT  J O4    1 
ATOM   3410  C C5    . DT  B 1 21  ? 106.813 20.585 -23.716 1.00 113.49 ? 167  DT  J C5    1 
ATOM   3411  C C7    . DT  B 1 21  ? 105.490 20.764 -24.392 1.00 113.10 ? 167  DT  J C7    1 
ATOM   3412  C C6    . DT  B 1 21  ? 107.323 19.381 -23.413 1.00 114.55 ? 167  DT  J C6    1 
ATOM   3413  P P     . DC  B 1 22  ? 109.529 15.511 -19.631 1.00 141.05 ? 168  DC  J P     1 
ATOM   3414  O OP1   . DC  B 1 22  ? 110.434 14.589 -18.903 1.00 118.68 ? 168  DC  J OP1   1 
ATOM   3415  O OP2   . DC  B 1 22  ? 108.065 15.448 -19.398 1.00 117.81 ? 168  DC  J OP2   1 
ATOM   3416  O "O5'" . DC  B 1 22  ? 110.022 16.994 -19.358 1.00 142.59 ? 168  DC  J "O5'" 1 
ATOM   3417  C "C5'" . DC  B 1 22  ? 111.388 17.243 -19.079 1.00 145.02 ? 168  DC  J "C5'" 1 
ATOM   3418  C "C4'" . DC  B 1 22  ? 111.509 18.025 -17.795 1.00 146.62 ? 168  DC  J "C4'" 1 
ATOM   3419  O "O4'" . DC  B 1 22  ? 111.176 19.404 -18.061 1.00 146.99 ? 168  DC  J "O4'" 1 
ATOM   3420  C "C3'" . DC  B 1 22  ? 110.573 17.561 -16.678 1.00 147.47 ? 168  DC  J "C3'" 1 
ATOM   3421  O "O3'" . DC  B 1 22  ? 111.263 17.611 -15.419 1.00 148.55 ? 168  DC  J "O3'" 1 
ATOM   3422  C "C2'" . DC  B 1 22  ? 109.413 18.540 -16.765 1.00 147.52 ? 168  DC  J "C2'" 1 
ATOM   3423  C "C1'" . DC  B 1 22  ? 110.080 19.814 -17.268 1.00 147.21 ? 168  DC  J "C1'" 1 
ATOM   3424  N N1    . DC  B 1 22  ? 109.238 20.682 -18.106 1.00 124.62 ? 168  DC  J N1    1 
ATOM   3425  C C2    . DC  B 1 22  ? 109.565 22.043 -18.209 1.00 124.57 ? 168  DC  J C2    1 
ATOM   3426  O O2    . DC  B 1 22  ? 110.583 22.462 -17.645 1.00 124.60 ? 168  DC  J O2    1 
ATOM   3427  N N3    . DC  B 1 22  ? 108.772 22.861 -18.930 1.00 124.25 ? 168  DC  J N3    1 
ATOM   3428  C C4    . DC  B 1 22  ? 107.700 22.369 -19.554 1.00 124.14 ? 168  DC  J C4    1 
ATOM   3429  N N4    . DC  B 1 22  ? 106.924 23.223 -20.227 1.00 123.90 ? 168  DC  J N4    1 
ATOM   3430  C C5    . DC  B 1 22  ? 107.368 20.980 -19.506 1.00 124.05 ? 168  DC  J C5    1 
ATOM   3431  C C6    . DC  B 1 22  ? 108.154 20.181 -18.770 1.00 124.28 ? 168  DC  J C6    1 
ATOM   3432  P P     . DT  B 1 23  ? 110.440 17.806 -14.051 1.00 148.40 ? 169  DT  J P     1 
ATOM   3433  O OP1   . DT  B 1 23  ? 111.347 17.484 -12.920 1.00 134.27 ? 169  DT  J OP1   1 
ATOM   3434  O OP2   . DT  B 1 23  ? 109.135 17.110 -14.167 1.00 133.94 ? 169  DT  J OP2   1 
ATOM   3435  O "O5'" . DT  B 1 23  ? 110.188 19.372 -14.025 1.00 148.96 ? 169  DT  J "O5'" 1 
ATOM   3436  C "C5'" . DT  B 1 23  ? 111.294 20.262 -14.029 1.00 150.23 ? 169  DT  J "C5'" 1 
ATOM   3437  C "C4'" . DT  B 1 23  ? 110.922 21.537 -13.317 1.00 151.33 ? 169  DT  J "C4'" 1 
ATOM   3438  O "O4'" . DT  B 1 23  ? 110.271 22.447 -14.239 1.00 151.52 ? 169  DT  J "O4'" 1 
ATOM   3439  C "C3'" . DT  B 1 23  ? 109.946 21.311 -12.160 1.00 151.86 ? 169  DT  J "C3'" 1 
ATOM   3440  O "O3'" . DT  B 1 23  ? 110.307 22.132 -11.047 1.00 152.46 ? 169  DT  J "O3'" 1 
ATOM   3441  C "C2'" . DT  B 1 23  ? 108.618 21.761 -12.740 1.00 151.65 ? 169  DT  J "C2'" 1 
ATOM   3442  C "C1'" . DT  B 1 23  ? 109.048 22.879 -13.675 1.00 151.33 ? 169  DT  J "C1'" 1 
ATOM   3443  N N1    . DT  B 1 23  ? 108.092 23.155 -14.765 1.00 136.98 ? 169  DT  J N1    1 
ATOM   3444  C C2    . DT  B 1 23  ? 107.765 24.469 -15.027 1.00 137.14 ? 169  DT  J C2    1 
ATOM   3445  O O2    . DT  B 1 23  ? 108.223 25.408 -14.403 1.00 137.44 ? 169  DT  J O2    1 
ATOM   3446  N N3    . DT  B 1 23  ? 106.857 24.642 -16.037 1.00 136.97 ? 169  DT  J N3    1 
ATOM   3447  C C4    . DT  B 1 23  ? 106.227 23.657 -16.768 1.00 136.68 ? 169  DT  J C4    1 
ATOM   3448  O O4    . DT  B 1 23  ? 105.426 23.968 -17.647 1.00 136.87 ? 169  DT  J O4    1 
ATOM   3449  C C5    . DT  B 1 23  ? 106.585 22.300 -16.413 1.00 136.48 ? 169  DT  J C5    1 
ATOM   3450  C C7    . DT  B 1 23  ? 105.870 21.163 -17.070 1.00 136.06 ? 169  DT  J C7    1 
ATOM   3451  C C6    . DT  B 1 23  ? 107.520 22.122 -15.474 1.00 136.58 ? 169  DT  J C6    1 
ATOM   3452  P P     . DA  B 1 24  ? 109.786 21.766 -9.570  1.00 159.50 ? 170  DA  J P     1 
ATOM   3453  O OP1   . DA  B 1 24  ? 110.900 21.140 -8.814  1.00 106.97 ? 170  DA  J OP1   1 
ATOM   3454  O OP2   . DA  B 1 24  ? 108.484 21.057 -9.670  1.00 106.95 ? 170  DA  J OP2   1 
ATOM   3455  O "O5'" . DA  B 1 24  ? 109.526 23.207 -8.953  1.00 158.88 ? 170  DA  J "O5'" 1 
ATOM   3456  C "C5'" . DA  B 1 24  ? 110.406 24.286 -9.258  1.00 157.96 ? 170  DA  J "C5'" 1 
ATOM   3457  C "C4'" . DA  B 1 24  ? 109.638 25.585 -9.296  1.00 157.04 ? 170  DA  J "C4'" 1 
ATOM   3458  O "O4'" . DA  B 1 24  ? 108.898 25.709 -10.538 1.00 157.40 ? 170  DA  J "O4'" 1 
ATOM   3459  C "C3'" . DA  B 1 24  ? 108.609 25.711 -8.173  1.00 156.39 ? 170  DA  J "C3'" 1 
ATOM   3460  O "O3'" . DA  B 1 24  ? 108.628 27.030 -7.629  1.00 154.80 ? 170  DA  J "O3'" 1 
ATOM   3461  C "C2'" . DA  B 1 24  ? 107.289 25.441 -8.874  1.00 156.63 ? 170  DA  J "C2'" 1 
ATOM   3462  C "C1'" . DA  B 1 24  ? 107.543 26.023 -10.249 1.00 157.30 ? 170  DA  J "C1'" 1 
ATOM   3463  N N9    . DA  B 1 24  ? 106.693 25.467 -11.308 1.00 104.71 ? 170  DA  J N9    1 
ATOM   3464  C C8    . DA  B 1 24  ? 106.423 24.145 -11.565 1.00 104.98 ? 170  DA  J C8    1 
ATOM   3465  N N7    . DA  B 1 24  ? 105.599 23.957 -12.570 1.00 104.83 ? 170  DA  J N7    1 
ATOM   3466  C C5    . DA  B 1 24  ? 105.311 25.241 -13.010 1.00 104.61 ? 170  DA  J C5    1 
ATOM   3467  C C6    . DA  B 1 24  ? 104.495 25.721 -14.046 1.00 104.35 ? 170  DA  J C6    1 
ATOM   3468  N N6    . DA  B 1 24  ? 103.797 24.931 -14.865 1.00 103.74 ? 170  DA  J N6    1 
ATOM   3469  N N1    . DA  B 1 24  ? 104.420 27.058 -14.217 1.00 104.29 ? 170  DA  J N1    1 
ATOM   3470  C C2    . DA  B 1 24  ? 105.124 27.848 -13.403 1.00 104.46 ? 170  DA  J C2    1 
ATOM   3471  N N3    . DA  B 1 24  ? 105.931 27.517 -12.395 1.00 104.58 ? 170  DA  J N3    1 
ATOM   3472  C C4    . DA  B 1 24  ? 105.981 26.181 -12.246 1.00 104.66 ? 170  DA  J C4    1 
ATOM   3473  P P     . DC  B 1 25  ? 107.398 27.531 -6.726  1.00 148.51 ? 171  DC  J P     1 
ATOM   3474  O OP1   . DC  B 1 25  ? 107.898 28.539 -5.754  1.00 123.04 ? 171  DC  J OP1   1 
ATOM   3475  O OP2   . DC  B 1 25  ? 106.676 26.324 -6.234  1.00 122.89 ? 171  DC  J OP2   1 
ATOM   3476  O "O5'" . DC  B 1 25  ? 106.472 28.285 -7.775  1.00 147.30 ? 171  DC  J "O5'" 1 
ATOM   3477  C "C5'" . DC  B 1 25  ? 106.937 29.459 -8.429  1.00 145.24 ? 171  DC  J "C5'" 1 
ATOM   3478  C "C4'" . DC  B 1 25  ? 105.774 30.374 -8.714  1.00 143.94 ? 171  DC  J "C4'" 1 
ATOM   3479  O "O4'" . DC  B 1 25  ? 104.981 29.809 -9.784  1.00 143.48 ? 171  DC  J "O4'" 1 
ATOM   3480  C "C3'" . DC  B 1 25  ? 104.832 30.527 -7.521  1.00 143.13 ? 171  DC  J "C3'" 1 
ATOM   3481  O "O3'" . DC  B 1 25  ? 104.352 31.870 -7.437  1.00 141.73 ? 171  DC  J "O3'" 1 
ATOM   3482  C "C2'" . DC  B 1 25  ? 103.708 29.553 -7.830  1.00 142.85 ? 171  DC  J "C2'" 1 
ATOM   3483  C "C1'" . DC  B 1 25  ? 103.646 29.593 -9.348  1.00 142.69 ? 171  DC  J "C1'" 1 
ATOM   3484  N N1    . DC  B 1 25  ? 103.155 28.356 -9.986  1.00 116.32 ? 171  DC  J N1    1 
ATOM   3485  C C2    . DC  B 1 25  ? 102.470 28.452 -11.206 1.00 115.58 ? 171  DC  J C2    1 
ATOM   3486  O O2    . DC  B 1 25  ? 102.292 29.573 -11.706 1.00 114.93 ? 171  DC  J O2    1 
ATOM   3487  N N3    . DC  B 1 25  ? 102.024 27.321 -11.807 1.00 114.90 ? 171  DC  J N3    1 
ATOM   3488  C C4    . DC  B 1 25  ? 102.241 26.132 -11.236 1.00 115.12 ? 171  DC  J C4    1 
ATOM   3489  N N4    . DC  B 1 25  ? 101.795 25.041 -11.867 1.00 114.28 ? 171  DC  J N4    1 
ATOM   3490  C C5    . DC  B 1 25  ? 102.929 26.008 -9.993  1.00 115.42 ? 171  DC  J C5    1 
ATOM   3491  C C6    . DC  B 1 25  ? 103.364 27.134 -9.408  1.00 116.10 ? 171  DC  J C6    1 
ATOM   3492  P P     . DC  B 1 26  ? 103.208 32.239 -6.372  1.00 108.03 ? 172  DC  J P     1 
ATOM   3493  O OP1   . DC  B 1 26  ? 103.162 33.722 -6.259  1.00 113.28 ? 172  DC  J OP1   1 
ATOM   3494  O OP2   . DC  B 1 26  ? 103.418 31.413 -5.157  1.00 113.02 ? 172  DC  J OP2   1 
ATOM   3495  O "O5'" . DC  B 1 26  ? 101.866 31.757 -7.085  1.00 107.32 ? 172  DC  J "O5'" 1 
ATOM   3496  C "C5'" . DC  B 1 26  ? 101.395 32.414 -8.263  1.00 105.32 ? 172  DC  J "C5'" 1 
ATOM   3497  C "C4'" . DC  B 1 26  ? 99.952  32.058 -8.526  1.00 104.20 ? 172  DC  J "C4'" 1 
ATOM   3498  O "O4'" . DC  B 1 26  ? 99.840  30.758 -9.155  1.00 104.86 ? 172  DC  J "O4'" 1 
ATOM   3499  C "C3'" . DC  B 1 26  ? 99.066  32.011 -7.282  1.00 102.98 ? 172  DC  J "C3'" 1 
ATOM   3500  O "O3'" . DC  B 1 26  ? 97.861  32.724 -7.530  1.00 100.72 ? 172  DC  J "O3'" 1 
ATOM   3501  C "C2'" . DC  B 1 26  ? 98.775  30.531 -7.104  1.00 103.39 ? 172  DC  J "C2'" 1 
ATOM   3502  C "C1'" . DC  B 1 26  ? 98.795  30.038 -8.535  1.00 103.91 ? 172  DC  J "C1'" 1 
ATOM   3503  N N1    . DC  B 1 26  ? 99.055  28.603 -8.725  1.00 108.38 ? 172  DC  J N1    1 
ATOM   3504  C C2    . DC  B 1 26  ? 98.898  28.062 -10.000 1.00 108.26 ? 172  DC  J C2    1 
ATOM   3505  O O2    . DC  B 1 26  ? 98.579  28.814 -10.932 1.00 108.78 ? 172  DC  J O2    1 
ATOM   3506  N N3    . DC  B 1 26  ? 99.097  26.738 -10.188 1.00 107.16 ? 172  DC  J N3    1 
ATOM   3507  C C4    . DC  B 1 26  ? 99.448  25.967 -9.161  1.00 106.70 ? 172  DC  J C4    1 
ATOM   3508  N N4    . DC  B 1 26  ? 99.622  24.664 -9.385  1.00 105.74 ? 172  DC  J N4    1 
ATOM   3509  C C5    . DC  B 1 26  ? 99.634  26.496 -7.855  1.00 107.16 ? 172  DC  J C5    1 
ATOM   3510  C C6    . DC  B 1 26  ? 99.430  27.807 -7.683  1.00 107.78 ? 172  DC  J C6    1 
ATOM   3511  P P     . DA  B 1 27  ? 97.695  34.199 -6.937  1.00 112.04 ? 173  DA  J P     1 
ATOM   3512  O OP1   . DA  B 1 27  ? 98.947  34.914 -7.288  1.00 84.93  ? 173  DA  J OP1   1 
ATOM   3513  O OP2   . DA  B 1 27  ? 97.268  34.091 -5.515  1.00 84.52  ? 173  DA  J OP2   1 
ATOM   3514  O "O5'" . DA  B 1 27  ? 96.489  34.824 -7.764  1.00 109.41 ? 173  DA  J "O5'" 1 
ATOM   3515  C "C5'" . DA  B 1 27  ? 96.644  35.151 -9.142  1.00 104.81 ? 173  DA  J "C5'" 1 
ATOM   3516  C "C4'" . DA  B 1 27  ? 95.493  34.582 -9.938  1.00 102.14 ? 173  DA  J "C4'" 1 
ATOM   3517  O "O4'" . DA  B 1 27  ? 95.561  33.140 -9.893  1.00 100.77 ? 173  DA  J "O4'" 1 
ATOM   3518  C "C3'" . DA  B 1 27  ? 94.116  34.951 -9.392  1.00 101.13 ? 173  DA  J "C3'" 1 
ATOM   3519  O "O3'" . DA  B 1 27  ? 93.199  35.072 -10.480 1.00 99.93  ? 173  DA  J "O3'" 1 
ATOM   3520  C "C2'" . DA  B 1 27  ? 93.761  33.759 -8.523  1.00 100.80 ? 173  DA  J "C2'" 1 
ATOM   3521  C "C1'" . DA  B 1 27  ? 94.384  32.617 -9.300  1.00 100.82 ? 173  DA  J "C1'" 1 
ATOM   3522  N N9    . DA  B 1 27  ? 94.770  31.461 -8.494  1.00 73.94  ? 173  DA  J N9    1 
ATOM   3523  C C8    . DA  B 1 27  ? 94.887  31.366 -7.128  1.00 74.43  ? 173  DA  J C8    1 
ATOM   3524  N N7    . DA  B 1 27  ? 95.276  30.180 -6.712  1.00 74.87  ? 173  DA  J N7    1 
ATOM   3525  C C5    . DA  B 1 27  ? 95.420  29.448 -7.883  1.00 74.69  ? 173  DA  J C5    1 
ATOM   3526  C C6    . DA  B 1 27  ? 95.816  28.122 -8.130  1.00 74.92  ? 173  DA  J C6    1 
ATOM   3527  N N6    . DA  B 1 27  ? 96.163  27.264 -7.180  1.00 74.29  ? 173  DA  J N6    1 
ATOM   3528  N N1    . DA  B 1 27  ? 95.847  27.706 -9.409  1.00 74.70  ? 173  DA  J N1    1 
ATOM   3529  C C2    . DA  B 1 27  ? 95.505  28.570 -10.373 1.00 74.98  ? 173  DA  J C2    1 
ATOM   3530  N N3    . DA  B 1 27  ? 95.124  29.838 -10.272 1.00 74.93  ? 173  DA  J N3    1 
ATOM   3531  C C4    . DA  B 1 27  ? 95.103  30.222 -8.986  1.00 74.51  ? 173  DA  J C4    1 
ATOM   3532  P P     . DA  B 1 28  ? 91.800  35.836 -10.271 1.00 118.49 ? 174  DA  J P     1 
ATOM   3533  O OP1   . DA  B 1 28  ? 91.943  37.240 -10.749 1.00 84.73  ? 174  DA  J OP1   1 
ATOM   3534  O OP2   . DA  B 1 28  ? 91.318  35.570 -8.886  1.00 84.65  ? 174  DA  J OP2   1 
ATOM   3535  O "O5'" . DA  B 1 28  ? 90.844  35.064 -11.277 1.00 116.77 ? 174  DA  J "O5'" 1 
ATOM   3536  C "C5'" . DA  B 1 28  ? 91.355  34.593 -12.517 1.00 114.39 ? 174  DA  J "C5'" 1 
ATOM   3537  C "C4'" . DA  B 1 28  ? 90.928  33.164 -12.755 1.00 112.83 ? 174  DA  J "C4'" 1 
ATOM   3538  O "O4'" . DA  B 1 28  ? 91.544  32.295 -11.772 1.00 111.85 ? 174  DA  J "O4'" 1 
ATOM   3539  C "C3'" . DA  B 1 28  ? 89.421  32.911 -12.665 1.00 111.93 ? 174  DA  J "C3'" 1 
ATOM   3540  O "O3'" . DA  B 1 28  ? 89.002  32.058 -13.735 1.00 111.27 ? 174  DA  J "O3'" 1 
ATOM   3541  C "C2'" . DA  B 1 28  ? 89.262  32.198 -11.333 1.00 111.22 ? 174  DA  J "C2'" 1 
ATOM   3542  C "C1'" . DA  B 1 28  ? 90.559  31.418 -11.256 1.00 111.38 ? 174  DA  J "C1'" 1 
ATOM   3543  N N9    . DA  B 1 28  ? 90.960  31.014 -9.908  1.00 77.51  ? 174  DA  J N9    1 
ATOM   3544  C C8    . DA  B 1 28  ? 90.951  31.774 -8.770  1.00 77.94  ? 174  DA  J C8    1 
ATOM   3545  N N7    . DA  B 1 28  ? 91.335  31.124 -7.697  1.00 77.57  ? 174  DA  J N7    1 
ATOM   3546  C C5    . DA  B 1 28  ? 91.625  29.852 -8.164  1.00 77.39  ? 174  DA  J C5    1 
ATOM   3547  C C6    . DA  B 1 28  ? 92.068  28.689 -7.518  1.00 77.57  ? 174  DA  J C6    1 
ATOM   3548  N N6    . DA  B 1 28  ? 92.304  28.616 -6.211  1.00 78.00  ? 174  DA  J N6    1 
ATOM   3549  N N1    . DA  B 1 28  ? 92.254  27.588 -8.264  1.00 77.10  ? 174  DA  J N1    1 
ATOM   3550  C C2    . DA  B 1 28  ? 92.007  27.656 -9.565  1.00 76.34  ? 174  DA  J C2    1 
ATOM   3551  N N3    . DA  B 1 28  ? 91.585  28.686 -10.292 1.00 76.60  ? 174  DA  J N3    1 
ATOM   3552  C C4    . DA  B 1 28  ? 91.409  29.770 -9.522  1.00 76.99  ? 174  DA  J C4    1 
ATOM   3553  P P     . DA  B 1 29  ? 87.476  32.104 -14.238 1.00 101.23 ? 175  DA  J P     1 
ATOM   3554  O OP1   . DA  B 1 29  ? 87.443  32.028 -15.719 1.00 110.10 ? 175  DA  J OP1   1 
ATOM   3555  O OP2   . DA  B 1 29  ? 86.806  33.228 -13.540 1.00 109.62 ? 175  DA  J OP2   1 
ATOM   3556  O "O5'" . DA  B 1 29  ? 86.869  30.758 -13.674 1.00 97.47  ? 175  DA  J "O5'" 1 
ATOM   3557  C "C5'" . DA  B 1 29  ? 87.603  30.020 -12.736 1.00 93.80  ? 175  DA  J "C5'" 1 
ATOM   3558  C "C4'" . DA  B 1 29  ? 87.913  28.651 -13.281 1.00 90.55  ? 175  DA  J "C4'" 1 
ATOM   3559  O "O4'" . DA  B 1 29  ? 88.801  28.025 -12.338 1.00 89.55  ? 175  DA  J "O4'" 1 
ATOM   3560  C "C3'" . DA  B 1 29  ? 86.683  27.760 -13.333 1.00 89.37  ? 175  DA  J "C3'" 1 
ATOM   3561  O "O3'" . DA  B 1 29  ? 86.876  26.720 -14.297 1.00 87.61  ? 175  DA  J "O3'" 1 
ATOM   3562  C "C2'" . DA  B 1 29  ? 86.606  27.227 -11.917 1.00 89.23  ? 175  DA  J "C2'" 1 
ATOM   3563  C "C1'" . DA  B 1 29  ? 88.061  27.195 -11.452 1.00 89.67  ? 175  DA  J "C1'" 1 
ATOM   3564  N N9    . DA  B 1 29  ? 88.260  27.720 -10.098 1.00 97.12  ? 175  DA  J N9    1 
ATOM   3565  C C8    . DA  B 1 29  ? 88.021  28.997 -9.647  1.00 96.54  ? 175  DA  J C8    1 
ATOM   3566  N N7    . DA  B 1 29  ? 88.329  29.177 -8.388  1.00 95.59  ? 175  DA  J N7    1 
ATOM   3567  C C5    . DA  B 1 29  ? 88.795  27.936 -7.980  1.00 96.81  ? 175  DA  J C5    1 
ATOM   3568  C C6    . DA  B 1 29  ? 89.284  27.473 -6.758  1.00 96.51  ? 175  DA  J C6    1 
ATOM   3569  N N6    . DA  B 1 29  ? 89.407  28.234 -5.673  1.00 98.16  ? 175  DA  J N6    1 
ATOM   3570  N N1    . DA  B 1 29  ? 89.657  26.183 -6.682  1.00 96.74  ? 175  DA  J N1    1 
ATOM   3571  C C2    . DA  B 1 29  ? 89.546  25.420 -7.769  1.00 97.11  ? 175  DA  J C2    1 
ATOM   3572  N N3    . DA  B 1 29  ? 89.110  25.740 -8.975  1.00 95.95  ? 175  DA  J N3    1 
ATOM   3573  C C4    . DA  B 1 29  ? 88.746  27.029 -9.017  1.00 96.47  ? 175  DA  J C4    1 
ATOM   3574  P P     . DA  B 1 30  ? 85.664  25.722 -14.661 1.00 81.47  ? 176  DA  J P     1 
ATOM   3575  O OP1   . DA  B 1 30  ? 86.034  25.024 -15.927 1.00 91.93  ? 176  DA  J OP1   1 
ATOM   3576  O OP2   . DA  B 1 30  ? 84.390  26.492 -14.575 1.00 90.51  ? 176  DA  J OP2   1 
ATOM   3577  O "O5'" . DA  B 1 30  ? 85.674  24.649 -13.487 1.00 80.50  ? 176  DA  J "O5'" 1 
ATOM   3578  C "C5'" . DA  B 1 30  ? 86.686  23.658 -13.426 1.00 78.83  ? 176  DA  J "C5'" 1 
ATOM   3579  C "C4'" . DA  B 1 30  ? 86.423  22.736 -12.264 1.00 78.47  ? 176  DA  J "C4'" 1 
ATOM   3580  O "O4'" . DA  B 1 30  ? 86.748  23.410 -11.027 1.00 77.82  ? 176  DA  J "O4'" 1 
ATOM   3581  C "C3'" . DA  B 1 30  ? 84.960  22.313 -12.140 1.00 78.38  ? 176  DA  J "C3'" 1 
ATOM   3582  O "O3'" . DA  B 1 30  ? 84.891  20.947 -11.739 1.00 78.66  ? 176  DA  J "O3'" 1 
ATOM   3583  C "C2'" . DA  B 1 30  ? 84.428  23.207 -11.036 1.00 78.12  ? 176  DA  J "C2'" 1 
ATOM   3584  C "C1'" . DA  B 1 30  ? 85.642  23.323 -10.142 1.00 79.12  ? 176  DA  J "C1'" 1 
ATOM   3585  N N9    . DA  B 1 30  ? 85.662  24.493 -9.263  1.00 90.43  ? 176  DA  J N9    1 
ATOM   3586  C C8    . DA  B 1 30  ? 85.264  25.775 -9.546  1.00 91.82  ? 176  DA  J C8    1 
ATOM   3587  N N7    . DA  B 1 30  ? 85.402  26.608 -8.544  1.00 91.60  ? 176  DA  J N7    1 
ATOM   3588  C C5    . DA  B 1 30  ? 85.926  25.822 -7.529  1.00 91.41  ? 176  DA  J C5    1 
ATOM   3589  C C6    . DA  B 1 30  ? 86.290  26.109 -6.204  1.00 90.11  ? 176  DA  J C6    1 
ATOM   3590  N N6    . DA  B 1 30  ? 86.196  27.322 -5.654  1.00 88.25  ? 176  DA  J N6    1 
ATOM   3591  N N1    . DA  B 1 30  ? 86.763  25.095 -5.451  1.00 90.02  ? 176  DA  J N1    1 
ATOM   3592  C C2    . DA  B 1 30  ? 86.868  23.883 -6.003  1.00 90.24  ? 176  DA  J C2    1 
ATOM   3593  N N3    . DA  B 1 30  ? 86.566  23.490 -7.236  1.00 91.46  ? 176  DA  J N3    1 
ATOM   3594  C C4    . DA  B 1 30  ? 86.092  24.518 -7.957  1.00 91.20  ? 176  DA  J C4    1 
ATOM   3595  P P     . DG  B 1 31  ? 83.464  20.270 -11.456 1.00 90.37  ? 177  DG  J P     1 
ATOM   3596  O OP1   . DG  B 1 31  ? 83.278  19.091 -12.355 1.00 65.85  ? 177  DG  J OP1   1 
ATOM   3597  O OP2   . DG  B 1 31  ? 82.441  21.348 -11.421 1.00 66.41  ? 177  DG  J OP2   1 
ATOM   3598  O "O5'" . DG  B 1 31  ? 83.639  19.725 -9.980  1.00 94.39  ? 177  DG  J "O5'" 1 
ATOM   3599  C "C5'" . DG  B 1 31  ? 84.878  19.165 -9.574  1.00 98.59  ? 177  DG  J "C5'" 1 
ATOM   3600  C "C4'" . DG  B 1 31  ? 84.879  18.970 -8.082  1.00 101.46 ? 177  DG  J "C4'" 1 
ATOM   3601  O "O4'" . DG  B 1 31  ? 85.091  20.239 -7.418  1.00 102.10 ? 177  DG  J "O4'" 1 
ATOM   3602  C "C3'" . DG  B 1 31  ? 83.546  18.432 -7.570  1.00 103.46 ? 177  DG  J "C3'" 1 
ATOM   3603  O "O3'" . DG  B 1 31  ? 83.767  17.403 -6.614  1.00 106.24 ? 177  DG  J "O3'" 1 
ATOM   3604  C "C2'" . DG  B 1 31  ? 82.883  19.643 -6.940  1.00 103.04 ? 177  DG  J "C2'" 1 
ATOM   3605  C "C1'" . DG  B 1 31  ? 84.069  20.462 -6.464  1.00 103.57 ? 177  DG  J "C1'" 1 
ATOM   3606  N N9    . DG  B 1 31  ? 83.828  21.902 -6.383  1.00 79.53  ? 177  DG  J N9    1 
ATOM   3607  C C8    . DG  B 1 31  ? 83.411  22.732 -7.395  1.00 80.08  ? 177  DG  J C8    1 
ATOM   3608  N N7    . DG  B 1 31  ? 83.235  23.967 -7.007  1.00 79.52  ? 177  DG  J N7    1 
ATOM   3609  C C5    . DG  B 1 31  ? 83.571  23.956 -5.659  1.00 80.12  ? 177  DG  J C5    1 
ATOM   3610  C C6    . DG  B 1 31  ? 83.555  25.001 -4.698  1.00 80.70  ? 177  DG  J C6    1 
ATOM   3611  O O6    . DG  B 1 31  ? 83.241  26.178 -4.848  1.00 80.72  ? 177  DG  J O6    1 
ATOM   3612  N N1    . DG  B 1 31  ? 83.955  24.555 -3.448  1.00 81.78  ? 177  DG  J N1    1 
ATOM   3613  C C2    . DG  B 1 31  ? 84.329  23.273 -3.152  1.00 82.64  ? 177  DG  J C2    1 
ATOM   3614  N N2    . DG  B 1 31  ? 84.695  23.045 -1.878  1.00 84.13  ? 177  DG  J N2    1 
ATOM   3615  N N3    . DG  B 1 31  ? 84.345  22.285 -4.035  1.00 82.20  ? 177  DG  J N3    1 
ATOM   3616  C C4    . DG  B 1 31  ? 83.954  22.696 -5.261  1.00 80.55  ? 177  DG  J C4    1 
ATOM   3617  P P     . DT  B 1 32  ? 82.514  16.668 -5.945  1.00 98.39  ? 178  DT  J P     1 
ATOM   3618  O OP1   . DT  B 1 32  ? 82.881  15.240 -5.791  1.00 98.21  ? 178  DT  J OP1   1 
ATOM   3619  O OP2   . DT  B 1 32  ? 81.275  17.033 -6.667  1.00 97.30  ? 178  DT  J OP2   1 
ATOM   3620  O "O5'" . DT  B 1 32  ? 82.470  17.334 -4.511  1.00 100.68 ? 178  DT  J "O5'" 1 
ATOM   3621  C "C5'" . DT  B 1 32  ? 83.604  17.256 -3.667  1.00 102.07 ? 178  DT  J "C5'" 1 
ATOM   3622  C "C4'" . DT  B 1 32  ? 83.230  17.703 -2.279  1.00 103.10 ? 178  DT  J "C4'" 1 
ATOM   3623  O "O4'" . DT  B 1 32  ? 83.126  19.145 -2.255  1.00 102.94 ? 178  DT  J "O4'" 1 
ATOM   3624  C "C3'" . DT  B 1 32  ? 81.875  17.169 -1.824  1.00 104.31 ? 178  DT  J "C3'" 1 
ATOM   3625  O "O3'" . DT  B 1 32  ? 81.956  16.794 -0.449  1.00 106.71 ? 178  DT  J "O3'" 1 
ATOM   3626  C "C2'" . DT  B 1 32  ? 80.936  18.345 -2.050  1.00 103.32 ? 178  DT  J "C2'" 1 
ATOM   3627  C "C1'" . DT  B 1 32  ? 81.844  19.533 -1.791  1.00 102.97 ? 178  DT  J "C1'" 1 
ATOM   3628  N N1    . DT  B 1 32  ? 81.480  20.783 -2.481  1.00 101.94 ? 178  DT  J N1    1 
ATOM   3629  C C2    . DT  B 1 32  ? 81.314  21.916 -1.717  1.00 102.62 ? 178  DT  J C2    1 
ATOM   3630  O O2    . DT  B 1 32  ? 81.388  21.920 -0.504  1.00 103.33 ? 178  DT  J O2    1 
ATOM   3631  N N3    . DT  B 1 32  ? 81.046  23.051 -2.428  1.00 102.32 ? 178  DT  J N3    1 
ATOM   3632  C C4    . DT  B 1 32  ? 80.904  23.163 -3.787  1.00 102.69 ? 178  DT  J C4    1 
ATOM   3633  O O4    . DT  B 1 32  ? 80.694  24.255 -4.284  1.00 103.01 ? 178  DT  J O4    1 
ATOM   3634  C C5    . DT  B 1 32  ? 81.034  21.931 -4.527  1.00 102.75 ? 178  DT  J C5    1 
ATOM   3635  C C7    . DT  B 1 32  ? 80.825  21.954 -6.009  1.00 102.24 ? 178  DT  J C7    1 
ATOM   3636  C C6    . DT  B 1 32  ? 81.326  20.815 -3.847  1.00 102.49 ? 178  DT  J C6    1 
ATOM   3637  P P     . DG  B 1 33  ? 80.628  16.391 0.346   1.00 153.24 ? 179  DG  J P     1 
ATOM   3638  O OP1   . DG  B 1 33  ? 81.052  15.598 1.519   1.00 98.59  ? 179  DG  J OP1   1 
ATOM   3639  O OP2   . DG  B 1 33  ? 79.644  15.822 -0.611  1.00 99.02  ? 179  DG  J OP2   1 
ATOM   3640  O "O5'" . DG  B 1 33  ? 80.100  17.795 0.865   1.00 154.74 ? 179  DG  J "O5'" 1 
ATOM   3641  C "C5'" . DG  B 1 33  ? 80.899  18.570 1.749   1.00 157.01 ? 179  DG  J "C5'" 1 
ATOM   3642  C "C4'" . DG  B 1 33  ? 80.036  19.571 2.475   1.00 158.80 ? 179  DG  J "C4'" 1 
ATOM   3643  O "O4'" . DG  B 1 33  ? 79.807  20.734 1.640   1.00 159.08 ? 179  DG  J "O4'" 1 
ATOM   3644  C "C3'" . DG  B 1 33  ? 78.658  19.018 2.834   1.00 159.78 ? 179  DG  J "C3'" 1 
ATOM   3645  O "O3'" . DG  B 1 33  ? 78.284  19.420 4.147   1.00 161.65 ? 179  DG  J "O3'" 1 
ATOM   3646  C "C2'" . DG  B 1 33  ? 77.741  19.657 1.806   1.00 159.51 ? 179  DG  J "C2'" 1 
ATOM   3647  C "C1'" . DG  B 1 33  ? 78.415  20.995 1.556   1.00 158.84 ? 179  DG  J "C1'" 1 
ATOM   3648  N N9    . DG  B 1 33  ? 78.132  21.560 0.238   1.00 102.37 ? 179  DG  J N9    1 
ATOM   3649  C C8    . DG  B 1 33  ? 78.196  20.903 -0.967  1.00 101.80 ? 179  DG  J C8    1 
ATOM   3650  N N7    . DG  B 1 33  ? 77.830  21.645 -1.976  1.00 101.24 ? 179  DG  J N7    1 
ATOM   3651  C C5    . DG  B 1 33  ? 77.512  22.872 -1.407  1.00 101.11 ? 179  DG  J C5    1 
ATOM   3652  C C6    . DG  B 1 33  ? 77.026  24.070 -2.006  1.00 101.12 ? 179  DG  J C6    1 
ATOM   3653  O O6    . DG  B 1 33  ? 76.754  24.285 -3.190  1.00 100.46 ? 179  DG  J O6    1 
ATOM   3654  N N1    . DG  B 1 33  ? 76.848  25.078 -1.067  1.00 100.83 ? 179  DG  J N1    1 
ATOM   3655  C C2    . DG  B 1 33  ? 77.094  24.956 0.273   1.00 100.96 ? 179  DG  J C2    1 
ATOM   3656  N N2    . DG  B 1 33  ? 76.866  26.051 1.003   1.00 101.02 ? 179  DG  J N2    1 
ATOM   3657  N N3    . DG  B 1 33  ? 77.530  23.844 0.851   1.00 101.10 ? 179  DG  J N3    1 
ATOM   3658  C C4    . DG  B 1 33  ? 77.715  22.847 -0.044  1.00 101.65 ? 179  DG  J C4    1 
ATOM   3659  P P     . DT  B 1 34  ? 76.812  19.084 4.684   1.00 146.54 ? 180  DT  J P     1 
ATOM   3660  O OP1   . DT  B 1 34  ? 76.970  18.692 6.103   1.00 135.82 ? 180  DT  J OP1   1 
ATOM   3661  O OP2   . DT  B 1 34  ? 76.148  18.148 3.735   1.00 135.38 ? 180  DT  J OP2   1 
ATOM   3662  O "O5'" . DT  B 1 34  ? 76.079  20.497 4.627   1.00 146.00 ? 180  DT  J "O5'" 1 
ATOM   3663  C "C5'" . DT  B 1 34  ? 76.653  21.636 5.267   1.00 144.17 ? 180  DT  J "C5'" 1 
ATOM   3664  C "C4'" . DT  B 1 34  ? 75.676  22.787 5.265   1.00 142.74 ? 180  DT  J "C4'" 1 
ATOM   3665  O "O4'" . DT  B 1 34  ? 75.594  23.365 3.938   1.00 142.34 ? 180  DT  J "O4'" 1 
ATOM   3666  C "C3'" . DT  B 1 34  ? 74.248  22.400 5.653   1.00 142.21 ? 180  DT  J "C3'" 1 
ATOM   3667  O "O3'" . DT  B 1 34  ? 73.671  23.399 6.497   1.00 141.59 ? 180  DT  J "O3'" 1 
ATOM   3668  C "C2'" . DT  B 1 34  ? 73.523  22.351 4.321   1.00 142.11 ? 180  DT  J "C2'" 1 
ATOM   3669  C "C1'" . DT  B 1 34  ? 74.235  23.436 3.535   1.00 142.03 ? 180  DT  J "C1'" 1 
ATOM   3670  N N1    . DT  B 1 34  ? 74.170  23.273 2.064   1.00 130.22 ? 180  DT  J N1    1 
ATOM   3671  C C2    . DT  B 1 34  ? 73.913  24.390 1.294   1.00 130.14 ? 180  DT  J C2    1 
ATOM   3672  O O2    . DT  B 1 34  ? 73.765  25.507 1.762   1.00 130.00 ? 180  DT  J O2    1 
ATOM   3673  N N3    . DT  B 1 34  ? 73.835  24.149 -0.055  1.00 129.86 ? 180  DT  J N3    1 
ATOM   3674  C C4    . DT  B 1 34  ? 73.988  22.936 -0.698  1.00 129.47 ? 180  DT  J C4    1 
ATOM   3675  O O4    . DT  B 1 34  ? 73.878  22.876 -1.920  1.00 129.16 ? 180  DT  J O4    1 
ATOM   3676  C C5    . DT  B 1 34  ? 74.272  21.811 0.167   1.00 129.49 ? 180  DT  J C5    1 
ATOM   3677  C C7    . DT  B 1 34  ? 74.465  20.456 -0.441  1.00 129.02 ? 180  DT  J C7    1 
ATOM   3678  C C6    . DT  B 1 34  ? 74.348  22.034 1.485   1.00 129.68 ? 180  DT  J C6    1 
ATOM   3679  P P     . DA  B 1 35  ? 72.104  23.338 6.849   1.00 133.08 ? 181  DA  J P     1 
ATOM   3680  O OP1   . DA  B 1 35  ? 71.923  23.805 8.245   1.00 85.82  ? 181  DA  J OP1   1 
ATOM   3681  O OP2   . DA  B 1 35  ? 71.563  22.013 6.439   1.00 85.64  ? 181  DA  J OP2   1 
ATOM   3682  O "O5'" . DA  B 1 35  ? 71.481  24.438 5.889   1.00 132.56 ? 181  DA  J "O5'" 1 
ATOM   3683  C "C5'" . DA  B 1 35  ? 71.975  25.774 5.911   1.00 131.94 ? 181  DA  J "C5'" 1 
ATOM   3684  C "C4'" . DA  B 1 35  ? 70.995  26.698 5.228   1.00 131.44 ? 181  DA  J "C4'" 1 
ATOM   3685  O "O4'" . DA  B 1 35  ? 71.036  26.508 3.790   1.00 130.89 ? 181  DA  J "O4'" 1 
ATOM   3686  C "C3'" . DA  B 1 35  ? 69.545  26.465 5.647   1.00 131.01 ? 181  DA  J "C3'" 1 
ATOM   3687  O "O3'" . DA  B 1 35  ? 68.879  27.721 5.787   1.00 131.17 ? 181  DA  J "O3'" 1 
ATOM   3688  C "C2'" . DA  B 1 35  ? 68.978  25.629 4.511   1.00 130.19 ? 181  DA  J "C2'" 1 
ATOM   3689  C "C1'" . DA  B 1 35  ? 69.752  26.135 3.302   1.00 129.23 ? 181  DA  J "C1'" 1 
ATOM   3690  N N9    . DA  B 1 35  ? 69.943  25.143 2.236   1.00 80.15  ? 181  DA  J N9    1 
ATOM   3691  C C8    . DA  B 1 35  ? 70.083  23.779 2.363   1.00 79.24  ? 181  DA  J C8    1 
ATOM   3692  N N7    . DA  B 1 35  ? 70.264  23.158 1.224   1.00 77.32  ? 181  DA  J N7    1 
ATOM   3693  C C5    . DA  B 1 35  ? 70.234  24.175 0.284   1.00 77.06  ? 181  DA  J C5    1 
ATOM   3694  C C6    . DA  B 1 35  ? 70.377  24.169 -1.106  1.00 75.92  ? 181  DA  J C6    1 
ATOM   3695  N N6    . DA  B 1 35  ? 70.589  23.058 -1.820  1.00 74.35  ? 181  DA  J N6    1 
ATOM   3696  N N1    . DA  B 1 35  ? 70.298  25.355 -1.750  1.00 75.33  ? 181  DA  J N1    1 
ATOM   3697  C C2    . DA  B 1 35  ? 70.086  26.465 -1.031  1.00 75.77  ? 181  DA  J C2    1 
ATOM   3698  N N3    . DA  B 1 35  ? 69.938  26.599 0.282   1.00 76.94  ? 181  DA  J N3    1 
ATOM   3699  C C4    . DA  B 1 35  ? 70.028  25.403 0.889   1.00 78.00  ? 181  DA  J C4    1 
ATOM   3700  P P     . DT  B 1 36  ? 67.301  27.813 5.545   1.00 139.20 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 36  ? 66.832  29.076 6.155   1.00 86.10  ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 36  ? 66.690  26.518 5.956   1.00 86.18  ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 36  ? 67.212  28.012 3.972   1.00 137.94 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 36  ? 67.908  29.099 3.365   1.00 135.22 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 36  ? 67.149  29.605 2.163   1.00 133.14 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 36  ? 67.426  28.768 1.016   1.00 131.53 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 36  ? 65.632  29.619 2.336   1.00 131.45 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 36  ? 65.091  30.831 1.803   1.00 128.94 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 36  ? 65.176  28.396 1.560   1.00 130.90 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 36  ? 66.216  28.285 0.460   1.00 129.95 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 36  ? 66.463  26.911 0.005   1.00 75.21  ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 36  ? 66.713  26.695 -1.342  1.00 73.73  ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 36  ? 66.724  27.585 -2.188  1.00 72.90  ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 36  ? 66.950  25.383 -1.665  1.00 72.31  ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 36  ? 66.953  24.297 -0.811  1.00 72.51  ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 36  ? 67.181  23.177 -1.249  1.00 70.07  ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 36  ? 66.679  24.595 0.572   1.00 73.65  ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 36  ? 66.670  23.474 1.559   1.00 74.25  ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 36  ? 66.448  25.869 0.909   1.00 74.48  ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 37  ? 63.530  30.920 1.441   1.00 92.57  ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 37  ? 63.063  32.318 1.658   1.00 88.47  ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 37  ? 62.821  29.794 2.108   1.00 87.10  ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 37  ? 63.546  30.665 -0.128  1.00 89.40  ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 37  ? 64.554  31.274 -0.933  1.00 85.03  ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 37  ? 64.365  30.909 -2.384  1.00 81.91  ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 37  ? 64.704  29.522 -2.612  1.00 80.22  ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 37  ? 62.950  31.100 -2.924  1.00 80.83  ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 37  ? 63.045  31.704 -4.212  1.00 78.96  ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 37  ? 62.411  29.682 -3.017  1.00 79.95  ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 37  ? 63.664  28.890 -3.327  1.00 80.06  ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 37  ? 63.638  27.487 -2.911  1.00 76.59  ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 37  ? 64.235  26.559 -3.732  1.00 76.98  ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 37  ? 64.777  26.848 -4.783  1.00 77.21  ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 37  ? 64.185  25.271 -3.272  1.00 77.30  ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 37  ? 63.621  24.826 -2.092  1.00 77.54  ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 37  ? 63.683  23.631 -1.791  1.00 77.38  ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 37  ? 62.996  25.853 -1.285  1.00 77.75  ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 37  ? 62.326  25.461 -0.005  1.00 77.64  ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 37  ? 63.041  27.118 -1.730  1.00 77.19  ? 183  DT  J C6    1 
ATOM   3740  P P     . DT  B 1 38  ? 61.732  32.269 -4.932  1.00 79.90  ? 184  DT  J P     1 
ATOM   3741  O OP1   . DT  B 1 38  ? 62.040  33.601 -5.523  1.00 63.26  ? 184  DT  J OP1   1 
ATOM   3742  O OP2   . DT  B 1 38  ? 60.595  32.124 -3.995  1.00 64.29  ? 184  DT  J OP2   1 
ATOM   3743  O "O5'" . DT  B 1 38  ? 61.511  31.226 -6.112  1.00 78.46  ? 184  DT  J "O5'" 1 
ATOM   3744  C "C5'" . DT  B 1 38  ? 62.568  30.931 -7.014  1.00 75.16  ? 184  DT  J "C5'" 1 
ATOM   3745  C "C4'" . DT  B 1 38  ? 62.161  29.816 -7.942  1.00 73.69  ? 184  DT  J "C4'" 1 
ATOM   3746  O "O4'" . DT  B 1 38  ? 62.241  28.539 -7.270  1.00 73.09  ? 184  DT  J "O4'" 1 
ATOM   3747  C "C3'" . DT  B 1 38  ? 60.737  29.935 -8.488  1.00 72.14  ? 184  DT  J "C3'" 1 
ATOM   3748  O "O3'" . DT  B 1 38  ? 60.724  29.569 -9.867  1.00 68.86  ? 184  DT  J "O3'" 1 
ATOM   3749  C "C2'" . DT  B 1 38  ? 59.975  28.894 -7.690  1.00 72.77  ? 184  DT  J "C2'" 1 
ATOM   3750  C "C1'" . DT  B 1 38  ? 61.036  27.832 -7.481  1.00 73.50  ? 184  DT  J "C1'" 1 
ATOM   3751  N N1    . DT  B 1 38  ? 60.809  26.991 -6.312  1.00 60.16  ? 184  DT  J N1    1 
ATOM   3752  C C2    . DT  B 1 38  ? 60.894  25.628 -6.458  1.00 61.89  ? 184  DT  J C2    1 
ATOM   3753  O O2    . DT  B 1 38  ? 61.170  25.088 -7.511  1.00 63.94  ? 184  DT  J O2    1 
ATOM   3754  N N3    . DT  B 1 38  ? 60.643  24.915 -5.319  1.00 62.25  ? 184  DT  J N3    1 
ATOM   3755  C C4    . DT  B 1 38  ? 60.323  25.417 -4.078  1.00 62.66  ? 184  DT  J C4    1 
ATOM   3756  O O4    . DT  B 1 38  ? 60.094  24.643 -3.152  1.00 62.33  ? 184  DT  J O4    1 
ATOM   3757  C C5    . DT  B 1 38  ? 60.275  26.866 -3.996  1.00 62.43  ? 184  DT  J C5    1 
ATOM   3758  C C7    . DT  B 1 38  ? 59.958  27.518 -2.692  1.00 63.69  ? 184  DT  J C7    1 
ATOM   3759  C C6    . DT  B 1 38  ? 60.516  27.564 -5.102  1.00 61.41  ? 184  DT  J C6    1 
ATOM   3760  P P     . DG  B 1 39  ? 60.524  30.692 -10.996 1.00 74.48  ? 185  DG  J P     1 
ATOM   3761  O OP1   . DG  B 1 39  ? 61.551  31.760 -10.850 1.00 73.70  ? 185  DG  J OP1   1 
ATOM   3762  O OP2   . DG  B 1 39  ? 59.088  31.050 -10.967 1.00 73.81  ? 185  DG  J OP2   1 
ATOM   3763  O "O5'" . DG  B 1 39  ? 60.843  29.885 -12.332 1.00 73.29  ? 185  DG  J "O5'" 1 
ATOM   3764  C "C5'" . DG  B 1 39  ? 62.150  29.348 -12.565 1.00 69.17  ? 185  DG  J "C5'" 1 
ATOM   3765  C "C4'" . DG  B 1 39  ? 62.057  27.941 -13.114 1.00 67.09  ? 185  DG  J "C4'" 1 
ATOM   3766  O "O4'" . DG  B 1 39  ? 61.579  27.018 -12.111 1.00 66.93  ? 185  DG  J "O4'" 1 
ATOM   3767  C "C3'" . DG  B 1 39  ? 61.104  27.778 -14.290 1.00 65.43  ? 185  DG  J "C3'" 1 
ATOM   3768  O "O3'" . DG  B 1 39  ? 61.582  26.732 -15.130 1.00 59.61  ? 185  DG  J "O3'" 1 
ATOM   3769  C "C2'" . DG  B 1 39  ? 59.806  27.367 -13.623 1.00 66.53  ? 185  DG  J "C2'" 1 
ATOM   3770  C "C1'" . DG  B 1 39  ? 60.300  26.508 -12.478 1.00 66.77  ? 185  DG  J "C1'" 1 
ATOM   3771  N N9    . DG  B 1 39  ? 59.462  26.578 -11.292 1.00 67.54  ? 185  DG  J N9    1 
ATOM   3772  C C8    . DG  B 1 39  ? 58.823  27.685 -10.773 1.00 68.45  ? 185  DG  J C8    1 
ATOM   3773  N N7    . DG  B 1 39  ? 58.209  27.440 -9.646  1.00 70.95  ? 185  DG  J N7    1 
ATOM   3774  C C5    . DG  B 1 39  ? 58.445  26.088 -9.421  1.00 69.24  ? 185  DG  J C5    1 
ATOM   3775  C C6    . DG  B 1 39  ? 58.041  25.256 -8.356  1.00 68.50  ? 185  DG  J C6    1 
ATOM   3776  O O6    . DG  B 1 39  ? 57.395  25.561 -7.352  1.00 68.75  ? 185  DG  J O6    1 
ATOM   3777  N N1    . DG  B 1 39  ? 58.472  23.942 -8.541  1.00 67.69  ? 185  DG  J N1    1 
ATOM   3778  C C2    . DG  B 1 39  ? 59.208  23.493 -9.621  1.00 68.05  ? 185  DG  J C2    1 
ATOM   3779  N N2    . DG  B 1 39  ? 59.503  22.183 -9.655  1.00 66.25  ? 185  DG  J N2    1 
ATOM   3780  N N3    . DG  B 1 39  ? 59.614  24.272 -10.607 1.00 67.45  ? 185  DG  J N3    1 
ATOM   3781  C C4    . DG  B 1 39  ? 59.197  25.543 -10.445 1.00 67.80  ? 185  DG  J C4    1 
ATOM   3782  P P     . DG  B 1 40  ? 60.844  26.443 -16.509 1.00 59.93  ? 186  DG  J P     1 
ATOM   3783  O OP1   . DG  B 1 40  ? 61.865  25.944 -17.450 1.00 50.33  ? 186  DG  J OP1   1 
ATOM   3784  O OP2   . DG  B 1 40  ? 60.036  27.638 -16.846 1.00 48.16  ? 186  DG  J OP2   1 
ATOM   3785  O "O5'" . DG  B 1 40  ? 59.853  25.255 -16.172 1.00 60.38  ? 186  DG  J "O5'" 1 
ATOM   3786  C "C5'" . DG  B 1 40  ? 60.352  23.957 -15.909 1.00 66.68  ? 186  DG  J "C5'" 1 
ATOM   3787  C "C4'" . DG  B 1 40  ? 59.212  23.050 -15.523 1.00 70.31  ? 186  DG  J "C4'" 1 
ATOM   3788  O "O4'" . DG  B 1 40  ? 58.622  23.544 -14.297 1.00 70.20  ? 186  DG  J "O4'" 1 
ATOM   3789  C "C3'" . DG  B 1 40  ? 58.081  23.035 -16.553 1.00 73.61  ? 186  DG  J "C3'" 1 
ATOM   3790  O "O3'" . DG  B 1 40  ? 57.478  21.746 -16.574 1.00 79.01  ? 186  DG  J "O3'" 1 
ATOM   3791  C "C2'" . DG  B 1 40  ? 57.085  24.022 -15.979 1.00 72.38  ? 186  DG  J "C2'" 1 
ATOM   3792  C "C1'" . DG  B 1 40  ? 57.236  23.709 -14.509 1.00 71.38  ? 186  DG  J "C1'" 1 
ATOM   3793  N N9    . DG  B 1 40  ? 56.724  24.697 -13.566 1.00 65.10  ? 186  DG  J N9    1 
ATOM   3794  C C8    . DG  B 1 40  ? 56.459  26.029 -13.782 1.00 64.13  ? 186  DG  J C8    1 
ATOM   3795  N N7    . DG  B 1 40  ? 55.940  26.620 -12.740 1.00 63.62  ? 186  DG  J N7    1 
ATOM   3796  C C5    . DG  B 1 40  ? 55.877  25.620 -11.778 1.00 64.67  ? 186  DG  J C5    1 
ATOM   3797  C C6    . DG  B 1 40  ? 55.401  25.655 -10.441 1.00 65.32  ? 186  DG  J C6    1 
ATOM   3798  O O6    . DG  B 1 40  ? 54.944  26.623 -9.800  1.00 64.43  ? 186  DG  J O6    1 
ATOM   3799  N N1    . DG  B 1 40  ? 55.507  24.406 -9.837  1.00 63.92  ? 186  DG  J N1    1 
ATOM   3800  C C2    . DG  B 1 40  ? 56.024  23.277 -10.432 1.00 64.48  ? 186  DG  J C2    1 
ATOM   3801  N N2    . DG  B 1 40  ? 56.058  22.162 -9.687  1.00 63.17  ? 186  DG  J N2    1 
ATOM   3802  N N3    . DG  B 1 40  ? 56.479  23.240 -11.665 1.00 63.41  ? 186  DG  J N3    1 
ATOM   3803  C C4    . DG  B 1 40  ? 56.371  24.435 -12.275 1.00 64.19  ? 186  DG  J C4    1 
ATOM   3804  P P     . DA  B 1 41  ? 57.686  20.791 -17.840 1.00 77.22  ? 187  DA  J P     1 
ATOM   3805  O OP1   . DA  B 1 41  ? 59.143  20.752 -18.098 1.00 83.16  ? 187  DA  J OP1   1 
ATOM   3806  O OP2   . DA  B 1 41  ? 56.752  21.203 -18.920 1.00 84.20  ? 187  DA  J OP2   1 
ATOM   3807  O "O5'" . DA  B 1 41  ? 57.236  19.372 -17.288 1.00 79.19  ? 187  DA  J "O5'" 1 
ATOM   3808  C "C5'" . DA  B 1 41  ? 58.031  18.687 -16.325 1.00 82.32  ? 187  DA  J "C5'" 1 
ATOM   3809  C "C4'" . DA  B 1 41  ? 57.152  18.040 -15.281 1.00 84.61  ? 187  DA  J "C4'" 1 
ATOM   3810  O "O4'" . DA  B 1 41  ? 56.617  19.048 -14.395 1.00 84.83  ? 187  DA  J "O4'" 1 
ATOM   3811  C "C3'" . DA  B 1 41  ? 55.945  17.279 -15.831 1.00 85.64  ? 187  DA  J "C3'" 1 
ATOM   3812  O "O3'" . DA  B 1 41  ? 55.719  16.097 -15.050 1.00 89.51  ? 187  DA  J "O3'" 1 
ATOM   3813  C "C2'" . DA  B 1 41  ? 54.806  18.262 -15.645 1.00 84.97  ? 187  DA  J "C2'" 1 
ATOM   3814  C "C1'" . DA  B 1 41  ? 55.204  18.947 -14.354 1.00 83.26  ? 187  DA  J "C1'" 1 
ATOM   3815  N N9    . DA  B 1 41  ? 54.668  20.293 -14.179 1.00 85.79  ? 187  DA  J N9    1 
ATOM   3816  C C8    . DA  B 1 41  ? 54.701  21.342 -15.060 1.00 84.34  ? 187  DA  J C8    1 
ATOM   3817  N N7    . DA  B 1 41  ? 54.153  22.438 -14.597 1.00 83.59  ? 187  DA  J N7    1 
ATOM   3818  C C5    . DA  B 1 41  ? 53.727  22.086 -13.323 1.00 84.07  ? 187  DA  J C5    1 
ATOM   3819  C C6    . DA  B 1 41  ? 53.068  22.809 -12.303 1.00 83.59  ? 187  DA  J C6    1 
ATOM   3820  N N6    . DA  B 1 41  ? 52.721  24.096 -12.404 1.00 84.03  ? 187  DA  J N6    1 
ATOM   3821  N N1    . DA  B 1 41  ? 52.778  22.155 -11.161 1.00 83.39  ? 187  DA  J N1    1 
ATOM   3822  C C2    . DA  B 1 41  ? 53.130  20.867 -11.055 1.00 83.33  ? 187  DA  J C2    1 
ATOM   3823  N N3    . DA  B 1 41  ? 53.755  20.084 -11.934 1.00 83.58  ? 187  DA  J N3    1 
ATOM   3824  C C4    . DA  B 1 41  ? 54.030  20.763 -13.059 1.00 84.43  ? 187  DA  J C4    1 
ATOM   3825  P P     . DA  B 1 42  ? 54.709  14.964 -15.584 1.00 90.34  ? 188  DA  J P     1 
ATOM   3826  O OP1   . DA  B 1 42  ? 55.361  13.642 -15.412 1.00 85.80  ? 188  DA  J OP1   1 
ATOM   3827  O OP2   . DA  B 1 42  ? 54.189  15.371 -16.916 1.00 86.98  ? 188  DA  J OP2   1 
ATOM   3828  O "O5'" . DA  B 1 42  ? 53.488  15.048 -14.578 1.00 89.32  ? 188  DA  J "O5'" 1 
ATOM   3829  C "C5'" . DA  B 1 42  ? 53.702  14.923 -13.185 1.00 89.73  ? 188  DA  J "C5'" 1 
ATOM   3830  C "C4'" . DA  B 1 42  ? 52.419  15.203 -12.446 1.00 89.63  ? 188  DA  J "C4'" 1 
ATOM   3831  O "O4'" . DA  B 1 42  ? 52.186  16.628 -12.351 1.00 88.41  ? 188  DA  J "O4'" 1 
ATOM   3832  C "C3'" . DA  B 1 42  ? 51.191  14.608 -13.127 1.00 90.09  ? 188  DA  J "C3'" 1 
ATOM   3833  O "O3'" . DA  B 1 42  ? 50.336  14.047 -12.139 1.00 91.70  ? 188  DA  J "O3'" 1 
ATOM   3834  C "C2'" . DA  B 1 42  ? 50.547  15.806 -13.802 1.00 88.62  ? 188  DA  J "C2'" 1 
ATOM   3835  C "C1'" . DA  B 1 42  ? 50.904  16.946 -12.865 1.00 88.13  ? 188  DA  J "C1'" 1 
ATOM   3836  N N9    . DA  B 1 42  ? 50.992  18.269 -13.492 1.00 84.45  ? 188  DA  J N9    1 
ATOM   3837  C C8    . DA  B 1 42  ? 51.694  18.627 -14.619 1.00 84.15  ? 188  DA  J C8    1 
ATOM   3838  N N7    . DA  B 1 42  ? 51.599  19.900 -14.920 1.00 83.25  ? 188  DA  J N7    1 
ATOM   3839  C C5    . DA  B 1 42  ? 50.774  20.416 -13.931 1.00 83.05  ? 188  DA  J C5    1 
ATOM   3840  C C6    . DA  B 1 42  ? 50.294  21.711 -13.684 1.00 82.90  ? 188  DA  J C6    1 
ATOM   3841  N N6    . DA  B 1 42  ? 50.590  22.765 -14.447 1.00 82.47  ? 188  DA  J N6    1 
ATOM   3842  N N1    . DA  B 1 42  ? 49.490  21.890 -12.610 1.00 82.81  ? 188  DA  J N1    1 
ATOM   3843  C C2    . DA  B 1 42  ? 49.198  20.831 -11.842 1.00 82.58  ? 188  DA  J C2    1 
ATOM   3844  N N3    . DA  B 1 42  ? 49.591  19.567 -11.970 1.00 83.57  ? 188  DA  J N3    1 
ATOM   3845  C C4    . DA  B 1 42  ? 50.387  19.423 -13.047 1.00 83.84  ? 188  DA  J C4    1 
ATOM   3846  P P     . DA  B 1 43  ? 49.345  12.845 -12.526 1.00 132.59 ? 189  DA  J P     1 
ATOM   3847  O OP1   . DA  B 1 43  ? 49.580  11.725 -11.578 1.00 91.13  ? 189  DA  J OP1   1 
ATOM   3848  O OP2   . DA  B 1 43  ? 49.428  12.593 -13.986 1.00 91.54  ? 189  DA  J OP2   1 
ATOM   3849  O "O5'" . DA  B 1 43  ? 47.929  13.493 -12.214 1.00 133.13 ? 189  DA  J "O5'" 1 
ATOM   3850  C "C5'" . DA  B 1 43  ? 47.746  14.257 -11.025 1.00 132.28 ? 189  DA  J "C5'" 1 
ATOM   3851  C "C4'" . DA  B 1 43  ? 46.622  15.248 -11.207 1.00 131.85 ? 189  DA  J "C4'" 1 
ATOM   3852  O "O4'" . DA  B 1 43  ? 47.084  16.489 -11.796 1.00 130.78 ? 189  DA  J "O4'" 1 
ATOM   3853  C "C3'" . DA  B 1 43  ? 45.481  14.750 -12.094 1.00 132.47 ? 189  DA  J "C3'" 1 
ATOM   3854  O "O3'" . DA  B 1 43  ? 44.240  15.094 -11.499 1.00 134.16 ? 189  DA  J "O3'" 1 
ATOM   3855  C "C2'" . DA  B 1 43  ? 45.647  15.561 -13.365 1.00 131.23 ? 189  DA  J "C2'" 1 
ATOM   3856  C "C1'" . DA  B 1 43  ? 46.162  16.867 -12.801 1.00 129.66 ? 189  DA  J "C1'" 1 
ATOM   3857  N N9    . DA  B 1 43  ? 46.852  17.726 -13.759 1.00 87.27  ? 189  DA  J N9    1 
ATOM   3858  C C8    . DA  B 1 43  ? 47.776  17.373 -14.707 1.00 86.27  ? 189  DA  J C8    1 
ATOM   3859  N N7    . DA  B 1 43  ? 48.203  18.380 -15.428 1.00 85.55  ? 189  DA  J N7    1 
ATOM   3860  C C5    . DA  B 1 43  ? 47.512  19.468 -14.920 1.00 85.44  ? 189  DA  J C5    1 
ATOM   3861  C C6    . DA  B 1 43  ? 47.518  20.824 -15.259 1.00 85.07  ? 189  DA  J C6    1 
ATOM   3862  N N6    . DA  B 1 43  ? 48.263  21.331 -16.237 1.00 86.46  ? 189  DA  J N6    1 
ATOM   3863  N N1    . DA  B 1 43  ? 46.722  21.654 -14.553 1.00 85.39  ? 189  DA  J N1    1 
ATOM   3864  C C2    . DA  B 1 43  ? 45.973  21.138 -13.574 1.00 85.64  ? 189  DA  J C2    1 
ATOM   3865  N N3    . DA  B 1 43  ? 45.877  19.875 -13.164 1.00 86.37  ? 189  DA  J N3    1 
ATOM   3866  C C4    . DA  B 1 43  ? 46.683  19.082 -13.889 1.00 86.36  ? 189  DA  J C4    1 
ATOM   3867  P P     . DC  B 1 44  ? 42.943  14.218 -11.818 1.00 111.96 ? 190  DC  J P     1 
ATOM   3868  O OP1   . DC  B 1 44  ? 42.630  13.472 -10.583 1.00 79.49  ? 190  DC  J OP1   1 
ATOM   3869  O OP2   . DC  B 1 44  ? 43.133  13.481 -13.095 1.00 78.52  ? 190  DC  J OP2   1 
ATOM   3870  O "O5'" . DC  B 1 44  ? 41.819  15.327 -11.994 1.00 112.52 ? 190  DC  J "O5'" 1 
ATOM   3871  C "C5'" . DC  B 1 44  ? 41.582  16.275 -10.959 1.00 111.65 ? 190  DC  J "C5'" 1 
ATOM   3872  C "C4'" . DC  B 1 44  ? 40.896  17.499 -11.516 1.00 111.06 ? 190  DC  J "C4'" 1 
ATOM   3873  O "O4'" . DC  B 1 44  ? 41.836  18.303 -12.272 1.00 110.63 ? 190  DC  J "O4'" 1 
ATOM   3874  C "C3'" . DC  B 1 44  ? 39.725  17.206 -12.461 1.00 111.05 ? 190  DC  J "C3'" 1 
ATOM   3875  O "O3'" . DC  B 1 44  ? 38.637  18.102 -12.199 1.00 111.71 ? 190  DC  J "O3'" 1 
ATOM   3876  C "C2'" . DC  B 1 44  ? 40.306  17.490 -13.833 1.00 110.37 ? 190  DC  J "C2'" 1 
ATOM   3877  C "C1'" . DC  B 1 44  ? 41.241  18.639 -13.514 1.00 109.47 ? 190  DC  J "C1'" 1 
ATOM   3878  N N1    . DC  B 1 44  ? 42.306  18.892 -14.500 1.00 73.67  ? 190  DC  J N1    1 
ATOM   3879  C C2    . DC  B 1 44  ? 42.563  20.216 -14.866 1.00 72.36  ? 190  DC  J C2    1 
ATOM   3880  O O2    . DC  B 1 44  ? 41.921  21.124 -14.308 1.00 71.13  ? 190  DC  J O2    1 
ATOM   3881  N N3    . DC  B 1 44  ? 43.501  20.474 -15.807 1.00 72.22  ? 190  DC  J N3    1 
ATOM   3882  C C4    . DC  B 1 44  ? 44.182  19.468 -16.361 1.00 72.52  ? 190  DC  J C4    1 
ATOM   3883  N N4    . DC  B 1 44  ? 45.093  19.771 -17.288 1.00 72.14  ? 190  DC  J N4    1 
ATOM   3884  C C5    . DC  B 1 44  ? 43.959  18.108 -15.989 1.00 72.55  ? 190  DC  J C5    1 
ATOM   3885  C C6    . DC  B 1 44  ? 43.020  17.868 -15.064 1.00 72.98  ? 190  DC  J C6    1 
ATOM   3886  P P     . DT  B 1 45  ? 37.414  18.193 -13.237 1.00 116.06 ? 191  DT  J P     1 
ATOM   3887  O OP1   . DT  B 1 45  ? 36.237  18.800 -12.559 1.00 93.29  ? 191  DT  J OP1   1 
ATOM   3888  O OP2   . DT  B 1 45  ? 37.294  16.857 -13.879 1.00 94.14  ? 191  DT  J OP2   1 
ATOM   3889  O "O5'" . DT  B 1 45  ? 37.934  19.219 -14.335 1.00 115.79 ? 191  DT  J "O5'" 1 
ATOM   3890  C "C5'" . DT  B 1 45  ? 38.161  20.581 -13.995 1.00 113.58 ? 191  DT  J "C5'" 1 
ATOM   3891  C "C4'" . DT  B 1 45  ? 38.123  21.432 -15.239 1.00 111.94 ? 191  DT  J "C4'" 1 
ATOM   3892  O "O4'" . DT  B 1 45  ? 39.363  21.315 -15.977 1.00 110.41 ? 191  DT  J "O4'" 1 
ATOM   3893  C "C3'" . DT  B 1 45  ? 37.010  21.032 -16.209 1.00 111.38 ? 191  DT  J "C3'" 1 
ATOM   3894  O "O3'" . DT  B 1 45  ? 36.475  22.209 -16.806 1.00 112.69 ? 191  DT  J "O3'" 1 
ATOM   3895  C "C2'" . DT  B 1 45  ? 37.755  20.248 -17.274 1.00 109.71 ? 191  DT  J "C2'" 1 
ATOM   3896  C "C1'" . DT  B 1 45  ? 39.050  21.034 -17.331 1.00 109.05 ? 191  DT  J "C1'" 1 
ATOM   3897  N N1    . DT  B 1 45  ? 40.205  20.358 -17.960 1.00 85.05  ? 191  DT  J N1    1 
ATOM   3898  C C2    . DT  B 1 45  ? 41.235  21.146 -18.420 1.00 83.58  ? 191  DT  J C2    1 
ATOM   3899  O O2    . DT  B 1 45  ? 41.230  22.368 -18.347 1.00 83.50  ? 191  DT  J O2    1 
ATOM   3900  N N3    . DT  B 1 45  ? 42.270  20.455 -18.983 1.00 82.94  ? 191  DT  J N3    1 
ATOM   3901  C C4    . DT  B 1 45  ? 42.375  19.092 -19.144 1.00 83.79  ? 191  DT  J C4    1 
ATOM   3902  O O4    . DT  B 1 45  ? 43.373  18.618 -19.669 1.00 82.99  ? 191  DT  J O4    1 
ATOM   3903  C C5    . DT  B 1 45  ? 41.256  18.325 -18.658 1.00 83.71  ? 191  DT  J C5    1 
ATOM   3904  C C7    . DT  B 1 45  ? 41.270  16.837 -18.816 1.00 84.01  ? 191  DT  J C7    1 
ATOM   3905  C C6    . DT  B 1 45  ? 40.244  18.987 -18.088 1.00 84.75  ? 191  DT  J C6    1 
ATOM   3906  P P     . DG  B 1 46  ? 34.899  22.336 -17.055 1.00 103.07 ? 192  DG  J P     1 
ATOM   3907  O OP1   . DG  B 1 46  ? 34.235  22.239 -15.731 1.00 86.48  ? 192  DG  J OP1   1 
ATOM   3908  O OP2   . DG  B 1 46  ? 34.514  21.404 -18.153 1.00 85.34  ? 192  DG  J OP2   1 
ATOM   3909  O "O5'" . DG  B 1 46  ? 34.746  23.832 -17.573 1.00 102.33 ? 192  DG  J "O5'" 1 
ATOM   3910  C "C5'" . DG  B 1 46  ? 35.475  24.887 -16.948 1.00 100.08 ? 192  DG  J "C5'" 1 
ATOM   3911  C "C4'" . DG  B 1 46  ? 36.116  25.774 -17.991 1.00 98.99  ? 192  DG  J "C4'" 1 
ATOM   3912  O "O4'" . DG  B 1 46  ? 37.199  25.095 -18.671 1.00 98.58  ? 192  DG  J "O4'" 1 
ATOM   3913  C "C3'" . DG  B 1 46  ? 35.169  26.248 -19.087 1.00 98.59  ? 192  DG  J "C3'" 1 
ATOM   3914  O "O3'" . DG  B 1 46  ? 35.508  27.588 -19.417 1.00 98.71  ? 192  DG  J "O3'" 1 
ATOM   3915  C "C2'" . DG  B 1 46  ? 35.466  25.310 -20.243 1.00 98.14  ? 192  DG  J "C2'" 1 
ATOM   3916  C "C1'" . DG  B 1 46  ? 36.955  25.060 -20.075 1.00 98.11  ? 192  DG  J "C1'" 1 
ATOM   3917  N N9    . DG  B 1 46  ? 37.432  23.771 -20.571 1.00 79.16  ? 192  DG  J N9    1 
ATOM   3918  C C8    . DG  B 1 46  ? 36.905  22.530 -20.299 1.00 79.48  ? 192  DG  J C8    1 
ATOM   3919  N N7    . DG  B 1 46  ? 37.602  21.552 -20.813 1.00 78.75  ? 192  DG  J N7    1 
ATOM   3920  C C5    . DG  B 1 46  ? 38.646  22.187 -21.480 1.00 78.72  ? 192  DG  J C5    1 
ATOM   3921  C C6    . DG  B 1 46  ? 39.754  21.644 -22.215 1.00 78.37  ? 192  DG  J C6    1 
ATOM   3922  O O6    . DG  B 1 46  ? 40.064  20.453 -22.396 1.00 76.85  ? 192  DG  J O6    1 
ATOM   3923  N N1    . DG  B 1 46  ? 40.550  22.650 -22.746 1.00 77.78  ? 192  DG  J N1    1 
ATOM   3924  C C2    . DG  B 1 46  ? 40.336  23.993 -22.584 1.00 77.43  ? 192  DG  J C2    1 
ATOM   3925  N N2    . DG  B 1 46  ? 41.217  24.798 -23.191 1.00 76.56  ? 192  DG  J N2    1 
ATOM   3926  N N3    . DG  B 1 46  ? 39.336  24.510 -21.885 1.00 78.60  ? 192  DG  J N3    1 
ATOM   3927  C C4    . DG  B 1 46  ? 38.536  23.557 -21.367 1.00 78.75  ? 192  DG  J C4    1 
ATOM   3928  P P     . DC  B 1 47  ? 34.604  28.398 -20.457 1.00 110.23 ? 193  DC  J P     1 
ATOM   3929  O OP1   . DC  B 1 47  ? 34.796  29.846 -20.174 1.00 97.21  ? 193  DC  J OP1   1 
ATOM   3930  O OP2   . DC  B 1 47  ? 33.233  27.813 -20.473 1.00 98.51  ? 193  DC  J OP2   1 
ATOM   3931  O "O5'" . DC  B 1 47  ? 35.291  28.078 -21.850 1.00 109.25 ? 193  DC  J "O5'" 1 
ATOM   3932  C "C5'" . DC  B 1 47  ? 36.612  28.528 -22.115 1.00 106.35 ? 193  DC  J "C5'" 1 
ATOM   3933  C "C4'" . DC  B 1 47  ? 37.034  28.084 -23.490 1.00 103.09 ? 193  DC  J "C4'" 1 
ATOM   3934  O "O4'" . DC  B 1 47  ? 37.345  26.670 -23.498 1.00 102.28 ? 193  DC  J "O4'" 1 
ATOM   3935  C "C3'" . DC  B 1 47  ? 35.962  28.282 -24.560 1.00 101.25 ? 193  DC  J "C3'" 1 
ATOM   3936  O "O3'" . DC  B 1 47  ? 36.625  28.632 -25.759 1.00 100.35 ? 193  DC  J "O3'" 1 
ATOM   3937  C "C2'" . DC  B 1 47  ? 35.409  26.884 -24.746 1.00 101.09 ? 193  DC  J "C2'" 1 
ATOM   3938  C "C1'" . DC  B 1 47  ? 36.681  26.081 -24.598 1.00 101.54 ? 193  DC  J "C1'" 1 
ATOM   3939  N N1    . DC  B 1 47  ? 36.515  24.646 -24.331 1.00 88.71  ? 193  DC  J N1    1 
ATOM   3940  C C2    . DC  B 1 47  ? 37.319  23.728 -25.034 1.00 88.66  ? 193  DC  J C2    1 
ATOM   3941  O O2    . DC  B 1 47  ? 38.169  24.156 -25.829 1.00 87.90  ? 193  DC  J O2    1 
ATOM   3942  N N3    . DC  B 1 47  ? 37.149  22.403 -24.823 1.00 88.30  ? 193  DC  J N3    1 
ATOM   3943  C C4    . DC  B 1 47  ? 36.231  21.983 -23.945 1.00 88.32  ? 193  DC  J C4    1 
ATOM   3944  N N4    . DC  B 1 47  ? 36.084  20.667 -23.774 1.00 87.02  ? 193  DC  J N4    1 
ATOM   3945  C C5    . DC  B 1 47  ? 35.418  22.894 -23.206 1.00 87.83  ? 193  DC  J C5    1 
ATOM   3946  C C6    . DC  B 1 47  ? 35.592  24.203 -23.428 1.00 87.49  ? 193  DC  J C6    1 
ATOM   3947  P P     . DT  B 1 48  ? 36.030  29.772 -26.710 1.00 93.27  ? 194  DT  J P     1 
ATOM   3948  O OP1   . DT  B 1 48  ? 35.962  31.019 -25.895 1.00 80.35  ? 194  DT  J OP1   1 
ATOM   3949  O OP2   . DT  B 1 48  ? 34.814  29.267 -27.420 1.00 81.00  ? 194  DT  J OP2   1 
ATOM   3950  O "O5'" . DT  B 1 48  ? 37.199  29.934 -27.775 1.00 92.69  ? 194  DT  J "O5'" 1 
ATOM   3951  C "C5'" . DT  B 1 48  ? 38.560  29.925 -27.346 1.00 88.03  ? 194  DT  J "C5'" 1 
ATOM   3952  C "C4'" . DT  B 1 48  ? 39.395  29.041 -28.243 1.00 84.16  ? 194  DT  J "C4'" 1 
ATOM   3953  O "O4'" . DT  B 1 48  ? 39.154  27.635 -27.995 1.00 83.26  ? 194  DT  J "O4'" 1 
ATOM   3954  C "C3'" . DT  B 1 48  ? 39.181  29.250 -29.740 1.00 81.31  ? 194  DT  J "C3'" 1 
ATOM   3955  O "O3'" . DT  B 1 48  ? 40.456  29.246 -30.371 1.00 79.02  ? 194  DT  J "O3'" 1 
ATOM   3956  C "C2'" . DT  B 1 48  ? 38.374  28.033 -30.159 1.00 81.30  ? 194  DT  J "C2'" 1 
ATOM   3957  C "C1'" . DT  B 1 48  ? 38.937  26.976 -29.233 1.00 82.95  ? 194  DT  J "C1'" 1 
ATOM   3958  N N1    . DT  B 1 48  ? 38.081  25.799 -28.985 1.00 70.71  ? 194  DT  J N1    1 
ATOM   3959  C C2    . DT  B 1 48  ? 38.582  24.557 -29.330 1.00 72.48  ? 194  DT  J C2    1 
ATOM   3960  O O2    . DT  B 1 48  ? 39.680  24.398 -29.848 1.00 72.08  ? 194  DT  J O2    1 
ATOM   3961  N N3    . DT  B 1 48  ? 37.751  23.499 -29.039 1.00 72.25  ? 194  DT  J N3    1 
ATOM   3962  C C4    . DT  B 1 48  ? 36.507  23.555 -28.443 1.00 72.08  ? 194  DT  J C4    1 
ATOM   3963  O O4    . DT  B 1 48  ? 35.885  22.519 -28.223 1.00 71.66  ? 194  DT  J O4    1 
ATOM   3964  C C5    . DT  B 1 48  ? 36.042  24.886 -28.116 1.00 72.96  ? 194  DT  J C5    1 
ATOM   3965  C C7    . DT  B 1 48  ? 34.707  25.040 -27.453 1.00 73.89  ? 194  DT  J C7    1 
ATOM   3966  C C6    . DT  B 1 48  ? 36.837  25.930 -28.412 1.00 71.22  ? 194  DT  J C6    1 
ATOM   3967  P P     . DC  B 1 49  ? 40.587  29.698 -31.895 1.00 76.90  ? 195  DC  J P     1 
ATOM   3968  O OP1   . DC  B 1 49  ? 41.903  30.363 -32.070 1.00 73.51  ? 195  DC  J OP1   1 
ATOM   3969  O OP2   . DC  B 1 49  ? 39.347  30.419 -32.270 1.00 73.74  ? 195  DC  J OP2   1 
ATOM   3970  O "O5'" . DC  B 1 49  ? 40.580  28.304 -32.655 1.00 72.75  ? 195  DC  J "O5'" 1 
ATOM   3971  C "C5'" . DC  B 1 49  ? 41.627  27.359 -32.470 1.00 66.32  ? 195  DC  J "C5'" 1 
ATOM   3972  C "C4'" . DC  B 1 49  ? 41.346  26.137 -33.303 1.00 63.62  ? 195  DC  J "C4'" 1 
ATOM   3973  O "O4'" . DC  B 1 49  ? 40.212  25.462 -32.716 1.00 63.29  ? 195  DC  J "O4'" 1 
ATOM   3974  C "C3'" . DC  B 1 49  ? 40.933  26.471 -34.743 1.00 63.38  ? 195  DC  J "C3'" 1 
ATOM   3975  O "O3'" . DC  B 1 49  ? 41.344  25.433 -35.644 1.00 59.28  ? 195  DC  J "O3'" 1 
ATOM   3976  C "C2'" . DC  B 1 49  ? 39.417  26.444 -34.670 1.00 65.56  ? 195  DC  J "C2'" 1 
ATOM   3977  C "C1'" . DC  B 1 49  ? 39.242  25.275 -33.731 1.00 67.37  ? 195  DC  J "C1'" 1 
ATOM   3978  N N1    . DC  B 1 49  ? 37.924  25.088 -33.107 1.00 62.74  ? 195  DC  J N1    1 
ATOM   3979  C C2    . DC  B 1 49  ? 37.605  23.818 -32.636 1.00 62.26  ? 195  DC  J C2    1 
ATOM   3980  O O2    . DC  B 1 49  ? 38.440  22.920 -32.759 1.00 56.47  ? 195  DC  J O2    1 
ATOM   3981  N N3    . DC  B 1 49  ? 36.404  23.598 -32.066 1.00 64.33  ? 195  DC  J N3    1 
ATOM   3982  C C4    . DC  B 1 49  ? 35.529  24.596 -31.959 1.00 65.77  ? 195  DC  J C4    1 
ATOM   3983  N N4    . DC  B 1 49  ? 34.354  24.331 -31.385 1.00 69.75  ? 195  DC  J N4    1 
ATOM   3984  C C5    . DC  B 1 49  ? 35.823  25.914 -32.434 1.00 65.82  ? 195  DC  J C5    1 
ATOM   3985  C C6    . DC  B 1 49  ? 37.026  26.114 -32.993 1.00 65.10  ? 195  DC  J C6    1 
ATOM   3986  P P     . DC  B 1 50  ? 42.838  25.421 -36.233 1.00 46.96  ? 196  DC  J P     1 
ATOM   3987  O OP1   . DC  B 1 50  ? 43.738  25.697 -35.081 1.00 43.82  ? 196  DC  J OP1   1 
ATOM   3988  O OP2   . DC  B 1 50  ? 42.918  26.242 -37.468 1.00 47.86  ? 196  DC  J OP2   1 
ATOM   3989  O "O5'" . DC  B 1 50  ? 43.076  23.900 -36.613 1.00 47.17  ? 196  DC  J "O5'" 1 
ATOM   3990  C "C5'" . DC  B 1 50  ? 43.383  22.949 -35.608 1.00 44.62  ? 196  DC  J "C5'" 1 
ATOM   3991  C "C4'" . DC  B 1 50  ? 42.607  21.674 -35.837 1.00 47.72  ? 196  DC  J "C4'" 1 
ATOM   3992  O "O4'" . DC  B 1 50  ? 41.268  21.799 -35.303 1.00 48.58  ? 196  DC  J "O4'" 1 
ATOM   3993  C "C3'" . DC  B 1 50  ? 42.447  21.247 -37.303 1.00 42.78  ? 196  DC  J "C3'" 1 
ATOM   3994  O "O3'" . DC  B 1 50  ? 42.817  19.886 -37.503 1.00 39.08  ? 196  DC  J "O3'" 1 
ATOM   3995  C "C2'" . DC  B 1 50  ? 40.962  21.409 -37.579 1.00 47.60  ? 196  DC  J "C2'" 1 
ATOM   3996  C "C1'" . DC  B 1 50  ? 40.359  21.189 -36.210 1.00 48.14  ? 196  DC  J "C1'" 1 
ATOM   3997  N N1    . DC  B 1 50  ? 39.035  21.801 -36.012 1.00 53.08  ? 196  DC  J N1    1 
ATOM   3998  C C2    . DC  B 1 50  ? 37.970  20.984 -35.616 1.00 51.71  ? 196  DC  J C2    1 
ATOM   3999  O O2    . DC  B 1 50  ? 38.163  19.765 -35.482 1.00 53.20  ? 196  DC  J O2    1 
ATOM   4000  N N3    . DC  B 1 50  ? 36.756  21.549 -35.395 1.00 50.79  ? 196  DC  J N3    1 
ATOM   4001  C C4    . DC  B 1 50  ? 36.587  22.866 -35.556 1.00 54.62  ? 196  DC  J C4    1 
ATOM   4002  N N4    . DC  B 1 50  ? 35.390  23.377 -35.288 1.00 52.34  ? 196  DC  J N4    1 
ATOM   4003  C C5    . DC  B 1 50  ? 37.644  23.713 -35.987 1.00 54.80  ? 196  DC  J C5    1 
ATOM   4004  C C6    . DC  B 1 50  ? 38.842  23.147 -36.201 1.00 53.40  ? 196  DC  J C6    1 
ATOM   4005  P P     . DA  B 1 51  ? 43.195  19.381 -38.981 1.00 32.14  ? 197  DA  J P     1 
ATOM   4006  O OP1   . DA  B 1 51  ? 44.628  18.959 -39.034 1.00 34.35  ? 197  DA  J OP1   1 
ATOM   4007  O OP2   . DA  B 1 51  ? 42.681  20.349 -39.979 1.00 38.15  ? 197  DA  J OP2   1 
ATOM   4008  O "O5'" . DA  B 1 51  ? 42.283  18.087 -39.111 1.00 39.63  ? 197  DA  J "O5'" 1 
ATOM   4009  C "C5'" . DA  B 1 51  ? 42.043  17.239 -37.986 1.00 43.16  ? 197  DA  J "C5'" 1 
ATOM   4010  C "C4'" . DA  B 1 51  ? 40.800  16.411 -38.214 1.00 49.00  ? 197  DA  J "C4'" 1 
ATOM   4011  O "O4'" . DA  B 1 51  ? 39.617  17.193 -37.947 1.00 50.92  ? 197  DA  J "O4'" 1 
ATOM   4012  C "C3'" . DA  B 1 51  ? 40.640  15.870 -39.630 1.00 51.79  ? 197  DA  J "C3'" 1 
ATOM   4013  O "O3'" . DA  B 1 51  ? 40.212  14.508 -39.582 1.00 56.51  ? 197  DA  J "O3'" 1 
ATOM   4014  C "C2'" . DA  B 1 51  ? 39.584  16.775 -40.249 1.00 49.91  ? 197  DA  J "C2'" 1 
ATOM   4015  C "C1'" . DA  B 1 51  ? 38.738  17.178 -39.058 1.00 49.91  ? 197  DA  J "C1'" 1 
ATOM   4016  N N9    . DA  B 1 51  ? 38.130  18.505 -39.124 1.00 55.12  ? 197  DA  J N9    1 
ATOM   4017  C C8    . DA  B 1 51  ? 38.682  19.662 -39.613 1.00 55.76  ? 197  DA  J C8    1 
ATOM   4018  N N7    . DA  B 1 51  ? 37.924  20.722 -39.445 1.00 56.42  ? 197  DA  J N7    1 
ATOM   4019  C C5    . DA  B 1 51  ? 36.788  20.224 -38.823 1.00 54.20  ? 197  DA  J C5    1 
ATOM   4020  C C6    . DA  B 1 51  ? 35.605  20.845 -38.360 1.00 55.82  ? 197  DA  J C6    1 
ATOM   4021  N N6    . DA  B 1 51  ? 35.364  22.152 -38.433 1.00 53.47  ? 197  DA  J N6    1 
ATOM   4022  N N1    . DA  B 1 51  ? 34.670  20.060 -37.801 1.00 57.43  ? 197  DA  J N1    1 
ATOM   4023  C C2    . DA  B 1 51  ? 34.913  18.746 -37.703 1.00 59.83  ? 197  DA  J C2    1 
ATOM   4024  N N3    . DA  B 1 51  ? 35.982  18.050 -38.084 1.00 57.44  ? 197  DA  J N3    1 
ATOM   4025  C C4    . DA  B 1 51  ? 36.893  18.856 -38.643 1.00 55.67  ? 197  DA  J C4    1 
ATOM   4026  P P     . DT  B 1 52  ? 39.796  13.769 -40.940 1.00 63.73  ? 198  DT  J P     1 
ATOM   4027  O OP1   . DT  B 1 52  ? 39.829  12.311 -40.702 1.00 77.50  ? 198  DT  J OP1   1 
ATOM   4028  O OP2   . DT  B 1 52  ? 40.590  14.356 -42.055 1.00 76.04  ? 198  DT  J OP2   1 
ATOM   4029  O "O5'" . DT  B 1 52  ? 38.280  14.201 -41.108 1.00 66.29  ? 198  DT  J "O5'" 1 
ATOM   4030  C "C5'" . DT  B 1 52  ? 37.363  14.000 -40.048 1.00 67.88  ? 198  DT  J "C5'" 1 
ATOM   4031  C "C4'" . DT  B 1 52  ? 35.962  14.249 -40.542 1.00 69.95  ? 198  DT  J "C4'" 1 
ATOM   4032  O "O4'" . DT  B 1 52  ? 35.567  15.627 -40.317 1.00 67.78  ? 198  DT  J "O4'" 1 
ATOM   4033  C "C3'" . DT  B 1 52  ? 35.805  13.990 -42.042 1.00 71.57  ? 198  DT  J "C3'" 1 
ATOM   4034  O "O3'" . DT  B 1 52  ? 34.613  13.255 -42.306 1.00 79.74  ? 198  DT  J "O3'" 1 
ATOM   4035  C "C2'" . DT  B 1 52  ? 35.670  15.386 -42.621 1.00 69.93  ? 198  DT  J "C2'" 1 
ATOM   4036  C "C1'" . DT  B 1 52  ? 34.961  16.112 -41.494 1.00 66.58  ? 198  DT  J "C1'" 1 
ATOM   4037  N N1    . DT  B 1 52  ? 35.082  17.584 -41.522 1.00 74.70  ? 198  DT  J N1    1 
ATOM   4038  C C2    . DT  B 1 52  ? 34.050  18.331 -40.993 1.00 73.01  ? 198  DT  J C2    1 
ATOM   4039  O O2    . DT  B 1 52  ? 33.083  17.837 -40.429 1.00 69.33  ? 198  DT  J O2    1 
ATOM   4040  N N3    . DT  B 1 52  ? 34.192  19.687 -41.148 1.00 72.15  ? 198  DT  J N3    1 
ATOM   4041  C C4    . DT  B 1 52  ? 35.236  20.352 -41.750 1.00 72.31  ? 198  DT  J C4    1 
ATOM   4042  O O4    . DT  B 1 52  ? 35.207  21.568 -41.851 1.00 71.18  ? 198  DT  J O4    1 
ATOM   4043  C C5    . DT  B 1 52  ? 36.299  19.518 -42.232 1.00 71.90  ? 198  DT  J C5    1 
ATOM   4044  C C7    . DT  B 1 52  ? 37.486  20.164 -42.868 1.00 70.30  ? 198  DT  J C7    1 
ATOM   4045  C C6    . DT  B 1 52  ? 36.178  18.193 -42.094 1.00 72.56  ? 198  DT  J C6    1 
ATOM   4046  P P     . DC  B 1 53  ? 34.579  12.208 -43.517 1.00 122.30 ? 199  DC  J P     1 
ATOM   4047  O OP1   . DC  B 1 53  ? 35.020  10.891 -42.997 1.00 88.26  ? 199  DC  J OP1   1 
ATOM   4048  O OP2   . DC  B 1 53  ? 35.257  12.801 -44.699 1.00 88.85  ? 199  DC  J OP2   1 
ATOM   4049  O "O5'" . DC  B 1 53  ? 33.032  12.112 -43.833 1.00 122.50 ? 199  DC  J "O5'" 1 
ATOM   4050  C "C5'" . DC  B 1 53  ? 32.092  12.001 -42.776 1.00 124.13 ? 199  DC  J "C5'" 1 
ATOM   4051  C "C4'" . DC  B 1 53  ? 30.836  12.742 -43.148 1.00 124.59 ? 199  DC  J "C4'" 1 
ATOM   4052  O "O4'" . DC  B 1 53  ? 31.021  14.160 -42.896 1.00 123.44 ? 199  DC  J "O4'" 1 
ATOM   4053  C "C3'" . DC  B 1 53  ? 30.526  12.600 -44.641 1.00 126.22 ? 199  DC  J "C3'" 1 
ATOM   4054  O "O3'" . DC  B 1 53  ? 29.134  12.358 -44.870 1.00 129.41 ? 199  DC  J "O3'" 1 
ATOM   4055  C "C2'" . DC  B 1 53  ? 30.970  13.931 -45.220 1.00 124.50 ? 199  DC  J "C2'" 1 
ATOM   4056  C "C1'" . DC  B 1 53  ? 30.696  14.886 -44.071 1.00 121.90 ? 199  DC  J "C1'" 1 
ATOM   4057  N N1    . DC  B 1 53  ? 31.500  16.126 -44.109 1.00 84.81  ? 199  DC  J N1    1 
ATOM   4058  C C2    . DC  B 1 53  ? 30.922  17.329 -43.662 1.00 83.24  ? 199  DC  J C2    1 
ATOM   4059  O O2    . DC  B 1 53  ? 29.763  17.314 -43.221 1.00 83.80  ? 199  DC  J O2    1 
ATOM   4060  N N3    . DC  B 1 53  ? 31.641  18.474 -43.730 1.00 80.83  ? 199  DC  J N3    1 
ATOM   4061  C C4    . DC  B 1 53  ? 32.881  18.455 -44.223 1.00 79.55  ? 199  DC  J C4    1 
ATOM   4062  N N4    . DC  B 1 53  ? 33.544  19.614 -44.296 1.00 77.33  ? 199  DC  J N4    1 
ATOM   4063  C C5    . DC  B 1 53  ? 33.497  17.247 -44.670 1.00 80.14  ? 199  DC  J C5    1 
ATOM   4064  C C6    . DC  B 1 53  ? 32.780  16.117 -44.592 1.00 82.55  ? 199  DC  J C6    1 
ATOM   4065  P P     . DA  B 1 54  ? 28.469  12.785 -46.271 1.00 102.80 ? 200  DA  J P     1 
ATOM   4066  O OP1   . DA  B 1 54  ? 27.151  12.119 -46.383 1.00 87.81  ? 200  DA  J OP1   1 
ATOM   4067  O OP2   . DA  B 1 54  ? 29.464  12.634 -47.367 1.00 86.42  ? 200  DA  J OP2   1 
ATOM   4068  O "O5'" . DA  B 1 54  ? 28.187  14.333 -46.061 1.00 100.54 ? 200  DA  J "O5'" 1 
ATOM   4069  C "C5'" . DA  B 1 54  ? 27.118  14.768 -45.228 1.00 97.54  ? 200  DA  J "C5'" 1 
ATOM   4070  C "C4'" . DA  B 1 54  ? 26.250  15.727 -45.999 1.00 96.73  ? 200  DA  J "C4'" 1 
ATOM   4071  O "O4'" . DA  B 1 54  ? 26.868  17.037 -46.009 1.00 94.98  ? 200  DA  J "O4'" 1 
ATOM   4072  C "C3'" . DA  B 1 54  ? 26.139  15.290 -47.456 1.00 97.15  ? 200  DA  J "C3'" 1 
ATOM   4073  O "O3'" . DA  B 1 54  ? 24.825  15.504 -47.965 1.00 99.84  ? 200  DA  J "O3'" 1 
ATOM   4074  C "C2'" . DA  B 1 54  ? 27.178  16.140 -48.165 1.00 94.37  ? 200  DA  J "C2'" 1 
ATOM   4075  C "C1'" . DA  B 1 54  ? 27.227  17.412 -47.330 1.00 92.31  ? 200  DA  J "C1'" 1 
ATOM   4076  N N9    . DA  B 1 54  ? 28.556  18.028 -47.278 1.00 73.10  ? 200  DA  J N9    1 
ATOM   4077  C C8    . DA  B 1 54  ? 29.774  17.398 -47.365 1.00 70.71  ? 200  DA  J C8    1 
ATOM   4078  N N7    . DA  B 1 54  ? 30.796  18.213 -47.307 1.00 69.01  ? 200  DA  J N7    1 
ATOM   4079  C C5    . DA  B 1 54  ? 30.218  19.464 -47.169 1.00 68.19  ? 200  DA  J C5    1 
ATOM   4080  C C6    . DA  B 1 54  ? 30.770  20.752 -47.057 1.00 67.77  ? 200  DA  J C6    1 
ATOM   4081  N N6    . DA  B 1 54  ? 32.084  20.997 -47.079 1.00 66.03  ? 200  DA  J N6    1 
ATOM   4082  N N1    . DA  B 1 54  ? 29.918  21.794 -46.923 1.00 69.43  ? 200  DA  J N1    1 
ATOM   4083  C C2    . DA  B 1 54  ? 28.602  21.543 -46.908 1.00 70.57  ? 200  DA  J C2    1 
ATOM   4084  N N3    . DA  B 1 54  ? 27.961  20.374 -47.013 1.00 70.86  ? 200  DA  J N3    1 
ATOM   4085  C C4    . DA  B 1 54  ? 28.838  19.365 -47.142 1.00 70.08  ? 200  DA  J C4    1 
ATOM   4086  P P     . DA  B 1 55  ? 24.494  15.110 -49.483 1.00 146.99 ? 201  DA  J P     1 
ATOM   4087  O OP1   . DA  B 1 55  ? 23.056  14.774 -49.588 1.00 104.95 ? 201  DA  J OP1   1 
ATOM   4088  O OP2   . DA  B 1 55  ? 25.510  14.117 -49.918 1.00 104.13 ? 201  DA  J OP2   1 
ATOM   4089  O "O5'" . DA  B 1 55  ? 24.743  16.476 -50.258 1.00 146.52 ? 201  DA  J "O5'" 1 
ATOM   4090  C "C5'" . DA  B 1 55  ? 24.100  17.676 -49.835 1.00 145.38 ? 201  DA  J "C5'" 1 
ATOM   4091  C "C4'" . DA  B 1 55  ? 24.452  18.803 -50.773 1.00 145.36 ? 201  DA  J "C4'" 1 
ATOM   4092  O "O4'" . DA  B 1 55  ? 25.784  19.306 -50.494 1.00 144.40 ? 201  DA  J "O4'" 1 
ATOM   4093  C "C3'" . DA  B 1 55  ? 24.458  18.373 -52.241 1.00 146.04 ? 201  DA  J "C3'" 1 
ATOM   4094  O "O3'" . DA  B 1 55  ? 23.941  19.429 -53.050 1.00 148.48 ? 201  DA  J "O3'" 1 
ATOM   4095  C "C2'" . DA  B 1 55  ? 25.937  18.184 -52.534 1.00 144.98 ? 201  DA  J "C2'" 1 
ATOM   4096  C "C1'" . DA  B 1 55  ? 26.540  19.299 -51.697 1.00 143.11 ? 201  DA  J "C1'" 1 
ATOM   4097  N N9    . DA  B 1 55  ? 27.963  19.160 -51.365 1.00 98.32  ? 201  DA  J N9    1 
ATOM   4098  C C8    . DA  B 1 55  ? 28.717  18.013 -51.285 1.00 96.56  ? 201  DA  J C8    1 
ATOM   4099  N N7    . DA  B 1 55  ? 29.976  18.228 -50.989 1.00 95.16  ? 201  DA  J N7    1 
ATOM   4100  C C5    . DA  B 1 55  ? 30.059  19.608 -50.860 1.00 94.75  ? 201  DA  J C5    1 
ATOM   4101  C C6    . DA  B 1 55  ? 31.132  20.471 -50.558 1.00 92.23  ? 201  DA  J C6    1 
ATOM   4102  N N6    . DA  B 1 55  ? 32.375  20.054 -50.315 1.00 90.64  ? 201  DA  J N6    1 
ATOM   4103  N N1    . DA  B 1 55  ? 30.879  21.796 -50.510 1.00 91.63  ? 201  DA  J N1    1 
ATOM   4104  C C2    . DA  B 1 55  ? 29.631  22.217 -50.747 1.00 92.92  ? 201  DA  J C2    1 
ATOM   4105  N N3    . DA  B 1 55  ? 28.541  21.507 -51.040 1.00 94.25  ? 201  DA  J N3    1 
ATOM   4106  C C4    . DA  B 1 55  ? 28.826  20.194 -51.083 1.00 95.63  ? 201  DA  J C4    1 
ATOM   4107  P P     . DA  B 1 56  ? 22.818  19.120 -54.157 1.00 152.76 ? 202  DA  J P     1 
ATOM   4108  O OP1   . DA  B 1 56  ? 21.512  19.069 -53.448 1.00 89.45  ? 202  DA  J OP1   1 
ATOM   4109  O OP2   . DA  B 1 56  ? 23.246  17.966 -55.004 1.00 89.63  ? 202  DA  J OP2   1 
ATOM   4110  O "O5'" . DA  B 1 56  ? 22.856  20.434 -55.051 1.00 150.80 ? 202  DA  J "O5'" 1 
ATOM   4111  C "C5'" . DA  B 1 56  ? 22.832  21.719 -54.438 1.00 148.55 ? 202  DA  J "C5'" 1 
ATOM   4112  C "C4'" . DA  B 1 56  ? 23.898  22.607 -55.036 1.00 147.84 ? 202  DA  J "C4'" 1 
ATOM   4113  O "O4'" . DA  B 1 56  ? 25.216  22.314 -54.512 1.00 146.58 ? 202  DA  J "O4'" 1 
ATOM   4114  C "C3'" . DA  B 1 56  ? 24.029  22.536 -56.557 1.00 148.11 ? 202  DA  J "C3'" 1 
ATOM   4115  O "O3'" . DA  B 1 56  ? 24.249  23.852 -57.047 1.00 150.50 ? 202  DA  J "O3'" 1 
ATOM   4116  C "C2'" . DA  B 1 56  ? 25.305  21.742 -56.758 1.00 146.06 ? 202  DA  J "C2'" 1 
ATOM   4117  C "C1'" . DA  B 1 56  ? 26.125  22.269 -55.602 1.00 144.32 ? 202  DA  J "C1'" 1 
ATOM   4118  N N9    . DA  B 1 56  ? 27.279  21.461 -55.212 1.00 76.94  ? 202  DA  J N9    1 
ATOM   4119  C C8    . DA  B 1 56  ? 27.401  20.093 -55.205 1.00 76.58  ? 202  DA  J C8    1 
ATOM   4120  N N7    . DA  B 1 56  ? 28.570  19.670 -54.785 1.00 73.29  ? 202  DA  J N7    1 
ATOM   4121  C C5    . DA  B 1 56  ? 29.265  20.836 -54.502 1.00 71.84  ? 202  DA  J C5    1 
ATOM   4122  C C6    . DA  B 1 56  ? 30.561  21.063 -54.036 1.00 69.47  ? 202  DA  J C6    1 
ATOM   4123  N N6    . DA  B 1 56  ? 31.418  20.089 -53.759 1.00 64.89  ? 202  DA  J N6    1 
ATOM   4124  N N1    . DA  B 1 56  ? 30.956  22.343 -53.868 1.00 68.73  ? 202  DA  J N1    1 
ATOM   4125  C C2    . DA  B 1 56  ? 30.094  23.320 -54.160 1.00 70.04  ? 202  DA  J C2    1 
ATOM   4126  N N3    . DA  B 1 56  ? 28.844  23.233 -54.613 1.00 71.52  ? 202  DA  J N3    1 
ATOM   4127  C C4    . DA  B 1 56  ? 28.485  21.946 -54.763 1.00 73.85  ? 202  DA  J C4    1 
ATOM   4128  P P     . DA  B 1 57  ? 23.534  24.323 -58.394 1.00 146.37 ? 203  DA  J P     1 
ATOM   4129  O OP1   . DA  B 1 57  ? 22.142  24.722 -58.060 1.00 78.36  ? 203  DA  J OP1   1 
ATOM   4130  O OP2   . DA  B 1 57  ? 23.783  23.263 -59.408 1.00 78.94  ? 203  DA  J OP2   1 
ATOM   4131  O "O5'" . DA  B 1 57  ? 24.360  25.615 -58.806 1.00 145.41 ? 203  DA  J "O5'" 1 
ATOM   4132  C "C5'" . DA  B 1 57  ? 25.180  26.288 -57.856 1.00 142.19 ? 203  DA  J "C5'" 1 
ATOM   4133  C "C4'" . DA  B 1 57  ? 26.533  26.575 -58.462 1.00 140.12 ? 203  DA  J "C4'" 1 
ATOM   4134  O "O4'" . DA  B 1 57  ? 27.528  25.587 -58.092 1.00 138.17 ? 203  DA  J "O4'" 1 
ATOM   4135  C "C3'" . DA  B 1 57  ? 26.520  26.615 -59.989 1.00 139.34 ? 203  DA  J "C3'" 1 
ATOM   4136  O "O3'" . DA  B 1 57  ? 27.297  27.717 -60.432 1.00 139.30 ? 203  DA  J "O3'" 1 
ATOM   4137  C "C2'" . DA  B 1 57  ? 27.203  25.317 -60.386 1.00 137.56 ? 203  DA  J "C2'" 1 
ATOM   4138  C "C1'" . DA  B 1 57  ? 28.212  25.159 -59.263 1.00 136.24 ? 203  DA  J "C1'" 1 
ATOM   4139  N N9    . DA  B 1 57  ? 28.691  23.795 -59.040 1.00 65.84  ? 203  DA  J N9    1 
ATOM   4140  C C8    . DA  B 1 57  ? 28.101  22.616 -59.424 1.00 64.97  ? 203  DA  J C8    1 
ATOM   4141  N N7    . DA  B 1 57  ? 28.762  21.543 -59.051 1.00 64.47  ? 203  DA  J N7    1 
ATOM   4142  C C5    . DA  B 1 57  ? 29.865  22.049 -58.384 1.00 63.01  ? 203  DA  J C5    1 
ATOM   4143  C C6    . DA  B 1 57  ? 30.957  21.423 -57.752 1.00 61.57  ? 203  DA  J C6    1 
ATOM   4144  N N6    . DA  B 1 57  ? 31.125  20.106 -57.691 1.00 57.68  ? 203  DA  J N6    1 
ATOM   4145  N N1    . DA  B 1 57  ? 31.885  22.215 -57.182 1.00 61.05  ? 203  DA  J N1    1 
ATOM   4146  C C2    . DA  B 1 57  ? 31.722  23.547 -57.251 1.00 62.87  ? 203  DA  J C2    1 
ATOM   4147  N N3    . DA  B 1 57  ? 30.744  24.254 -57.821 1.00 63.42  ? 203  DA  J N3    1 
ATOM   4148  C C4    . DA  B 1 57  ? 29.837  23.436 -58.375 1.00 64.26  ? 203  DA  J C4    1 
ATOM   4149  P P     . DG  B 1 58  ? 27.100  28.274 -61.915 1.00 108.34 ? 204  DG  J P     1 
ATOM   4150  O OP1   . DG  B 1 58  ? 26.105  29.380 -61.888 1.00 94.97  ? 204  DG  J OP1   1 
ATOM   4151  O OP2   . DG  B 1 58  ? 26.876  27.084 -62.787 1.00 93.61  ? 204  DG  J OP2   1 
ATOM   4152  O "O5'" . DG  B 1 58  ? 28.516  28.906 -62.236 1.00 105.41 ? 204  DG  J "O5'" 1 
ATOM   4153  C "C5'" . DG  B 1 58  ? 29.356  29.329 -61.180 1.00 99.82  ? 204  DG  J "C5'" 1 
ATOM   4154  C "C4'" . DG  B 1 58  ? 30.742  28.772 -61.381 1.00 96.71  ? 204  DG  J "C4'" 1 
ATOM   4155  O "O4'" . DG  B 1 58  ? 30.802  27.359 -61.065 1.00 94.70  ? 204  DG  J "O4'" 1 
ATOM   4156  C "C3'" . DG  B 1 58  ? 31.248  28.903 -62.815 1.00 93.70  ? 204  DG  J "C3'" 1 
ATOM   4157  O "O3'" . DG  B 1 58  ? 32.598  29.319 -62.767 1.00 92.26  ? 204  DG  J "O3'" 1 
ATOM   4158  C "C2'" . DG  B 1 58  ? 31.170  27.486 -63.353 1.00 94.17  ? 204  DG  J "C2'" 1 
ATOM   4159  C "C1'" . DG  B 1 58  ? 31.506  26.700 -62.105 1.00 93.70  ? 204  DG  J "C1'" 1 
ATOM   4160  N N9    . DG  B 1 58  ? 31.118  25.293 -62.116 1.00 80.17  ? 204  DG  J N9    1 
ATOM   4161  C C8    . DG  B 1 58  ? 29.996  24.741 -62.683 1.00 80.18  ? 204  DG  J C8    1 
ATOM   4162  N N7    . DG  B 1 58  ? 29.940  23.443 -62.550 1.00 81.13  ? 204  DG  J N7    1 
ATOM   4163  C C5    . DG  B 1 58  ? 31.093  23.118 -61.851 1.00 81.55  ? 204  DG  J C5    1 
ATOM   4164  C C6    . DG  B 1 58  ? 31.585  21.852 -61.416 1.00 80.93  ? 204  DG  J C6    1 
ATOM   4165  O O6    . DG  B 1 58  ? 31.083  20.732 -61.566 1.00 77.15  ? 204  DG  J O6    1 
ATOM   4166  N N1    . DG  B 1 58  ? 32.792  21.981 -60.738 1.00 81.61  ? 204  DG  J N1    1 
ATOM   4167  C C2    . DG  B 1 58  ? 33.439  23.169 -60.495 1.00 81.52  ? 204  DG  J C2    1 
ATOM   4168  N N2    . DG  B 1 58  ? 34.582  23.081 -59.799 1.00 79.94  ? 204  DG  J N2    1 
ATOM   4169  N N3    . DG  B 1 58  ? 32.996  24.353 -60.897 1.00 81.32  ? 204  DG  J N3    1 
ATOM   4170  C C4    . DG  B 1 58  ? 31.826  24.252 -61.566 1.00 81.50  ? 204  DG  J C4    1 
ATOM   4171  P P     . DG  B 1 59  ? 32.976  30.776 -63.285 1.00 58.27  ? 205  DG  J P     1 
ATOM   4172  O OP1   . DG  B 1 59  ? 31.960  31.717 -62.751 1.00 64.48  ? 205  DG  J OP1   1 
ATOM   4173  O OP2   . DG  B 1 59  ? 33.190  30.643 -64.757 1.00 64.44  ? 205  DG  J OP2   1 
ATOM   4174  O "O5'" . DG  B 1 59  ? 34.365  31.111 -62.581 1.00 56.41  ? 205  DG  J "O5'" 1 
ATOM   4175  C "C5'" . DG  B 1 59  ? 34.551  30.928 -61.177 1.00 52.81  ? 205  DG  J "C5'" 1 
ATOM   4176  C "C4'" . DG  B 1 59  ? 35.698  29.974 -60.936 1.00 49.28  ? 205  DG  J "C4'" 1 
ATOM   4177  O "O4'" . DG  B 1 59  ? 35.304  28.631 -61.311 1.00 49.26  ? 205  DG  J "O4'" 1 
ATOM   4178  C "C3'" . DG  B 1 59  ? 36.959  30.280 -61.746 1.00 46.96  ? 205  DG  J "C3'" 1 
ATOM   4179  O "O3'" . DG  B 1 59  ? 38.105  29.975 -60.953 1.00 47.31  ? 205  DG  J "O3'" 1 
ATOM   4180  C "C2'" . DG  B 1 59  ? 36.855  29.330 -62.924 1.00 47.25  ? 205  DG  J "C2'" 1 
ATOM   4181  C "C1'" . DG  B 1 59  ? 36.186  28.116 -62.304 1.00 48.80  ? 205  DG  J "C1'" 1 
ATOM   4182  N N9    . DG  B 1 59  ? 35.382  27.328 -63.232 1.00 60.09  ? 205  DG  J N9    1 
ATOM   4183  C C8    . DG  B 1 59  ? 34.541  27.816 -64.201 1.00 61.67  ? 205  DG  J C8    1 
ATOM   4184  N N7    . DG  B 1 59  ? 33.898  26.880 -64.845 1.00 63.26  ? 205  DG  J N7    1 
ATOM   4185  C C5    . DG  B 1 59  ? 34.351  25.697 -64.278 1.00 63.24  ? 205  DG  J C5    1 
ATOM   4186  C C6    . DG  B 1 59  ? 34.001  24.342 -64.564 1.00 63.71  ? 205  DG  J C6    1 
ATOM   4187  O O6    . DG  B 1 59  ? 33.175  23.911 -65.383 1.00 64.22  ? 205  DG  J O6    1 
ATOM   4188  N N1    . DG  B 1 59  ? 34.722  23.452 -63.773 1.00 62.20  ? 205  DG  J N1    1 
ATOM   4189  C C2    . DG  B 1 59  ? 35.648  23.809 -62.827 1.00 61.68  ? 205  DG  J C2    1 
ATOM   4190  N N2    . DG  B 1 59  ? 36.252  22.790 -62.197 1.00 59.78  ? 205  DG  J N2    1 
ATOM   4191  N N3    . DG  B 1 59  ? 35.965  25.068 -62.529 1.00 61.98  ? 205  DG  J N3    1 
ATOM   4192  C C4    . DG  B 1 59  ? 35.285  25.953 -63.292 1.00 61.16  ? 205  DG  J C4    1 
ATOM   4193  P P     . DC  B 1 60  ? 39.557  30.471 -61.417 1.00 54.83  ? 206  DC  J P     1 
ATOM   4194  O OP1   . DC  B 1 60  ? 40.284  31.010 -60.236 1.00 59.21  ? 206  DC  J OP1   1 
ATOM   4195  O OP2   . DC  B 1 60  ? 39.388  31.293 -62.638 1.00 55.75  ? 206  DC  J OP2   1 
ATOM   4196  O "O5'" . DC  B 1 60  ? 40.283  29.143 -61.862 1.00 55.48  ? 206  DC  J "O5'" 1 
ATOM   4197  C "C5'" . DC  B 1 60  ? 39.551  28.173 -62.544 1.00 51.54  ? 206  DC  J "C5'" 1 
ATOM   4198  C "C4'" . DC  B 1 60  ? 40.169  26.820 -62.351 1.00 48.68  ? 206  DC  J "C4'" 1 
ATOM   4199  O "O4'" . DC  B 1 60  ? 39.217  25.941 -62.972 1.00 47.07  ? 206  DC  J "O4'" 1 
ATOM   4200  C "C3'" . DC  B 1 60  ? 41.480  26.647 -63.117 1.00 46.47  ? 206  DC  J "C3'" 1 
ATOM   4201  O "O3'" . DC  B 1 60  ? 42.284  25.613 -62.525 1.00 40.48  ? 206  DC  J "O3'" 1 
ATOM   4202  C "C2'" . DC  B 1 60  ? 40.998  26.265 -64.505 1.00 45.33  ? 206  DC  J "C2'" 1 
ATOM   4203  C "C1'" . DC  B 1 60  ? 39.706  25.499 -64.227 1.00 47.07  ? 206  DC  J "C1'" 1 
ATOM   4204  N N1    . DC  B 1 60  ? 38.653  25.744 -65.206 1.00 52.68  ? 206  DC  J N1    1 
ATOM   4205  C C2    . DC  B 1 60  ? 37.716  24.739 -65.457 1.00 53.23  ? 206  DC  J C2    1 
ATOM   4206  O O2    . DC  B 1 60  ? 37.812  23.662 -64.858 1.00 50.92  ? 206  DC  J O2    1 
ATOM   4207  N N3    . DC  B 1 60  ? 36.731  24.968 -66.354 1.00 54.79  ? 206  DC  J N3    1 
ATOM   4208  C C4    . DC  B 1 60  ? 36.667  26.142 -66.996 1.00 54.46  ? 206  DC  J C4    1 
ATOM   4209  N N4    . DC  B 1 60  ? 35.675  26.322 -67.878 1.00 51.34  ? 206  DC  J N4    1 
ATOM   4210  C C5    . DC  B 1 60  ? 37.616  27.178 -66.763 1.00 51.74  ? 206  DC  J C5    1 
ATOM   4211  C C6    . DC  B 1 60  ? 38.582  26.939 -65.866 1.00 51.76  ? 206  DC  J C6    1 
ATOM   4212  P P     . DA  B 1 61  ? 43.827  25.437 -62.942 1.00 36.90  ? 207  DA  J P     1 
ATOM   4213  O OP1   . DA  B 1 61  ? 44.588  25.666 -61.696 1.00 31.97  ? 207  DA  J OP1   1 
ATOM   4214  O OP2   . DA  B 1 61  ? 44.176  26.181 -64.174 1.00 34.53  ? 207  DA  J OP2   1 
ATOM   4215  O "O5'" . DA  B 1 61  ? 43.960  23.905 -63.316 1.00 37.02  ? 207  DA  J "O5'" 1 
ATOM   4216  C "C5'" . DA  B 1 61  ? 43.722  22.903 -62.344 1.00 39.39  ? 207  DA  J "C5'" 1 
ATOM   4217  C "C4'" . DA  B 1 61  ? 43.489  21.568 -63.014 1.00 35.47  ? 207  DA  J "C4'" 1 
ATOM   4218  O "O4'" . DA  B 1 61  ? 42.346  21.690 -63.886 1.00 37.73  ? 207  DA  J "O4'" 1 
ATOM   4219  C "C3'" . DA  B 1 61  ? 44.628  21.040 -63.887 1.00 37.70  ? 207  DA  J "C3'" 1 
ATOM   4220  O "O3'" . DA  B 1 61  ? 44.722  19.624 -63.704 1.00 39.58  ? 207  DA  J "O3'" 1 
ATOM   4221  C "C2'" . DA  B 1 61  ? 44.224  21.443 -65.297 1.00 37.59  ? 207  DA  J "C2'" 1 
ATOM   4222  C "C1'" . DA  B 1 61  ? 42.704  21.392 -65.237 1.00 38.04  ? 207  DA  J "C1'" 1 
ATOM   4223  N N9    . DA  B 1 61  ? 42.005  22.357 -66.089 1.00 43.12  ? 207  DA  J N9    1 
ATOM   4224  C C8    . DA  B 1 61  ? 42.182  23.712 -66.104 1.00 46.61  ? 207  DA  J C8    1 
ATOM   4225  N N7    . DA  B 1 61  ? 41.363  24.342 -66.905 1.00 46.75  ? 207  DA  J N7    1 
ATOM   4226  C C5    . DA  B 1 61  ? 40.612  23.329 -67.477 1.00 50.86  ? 207  DA  J C5    1 
ATOM   4227  C C6    . DA  B 1 61  ? 39.581  23.345 -68.408 1.00 51.09  ? 207  DA  J C6    1 
ATOM   4228  N N6    . DA  B 1 61  ? 39.111  24.459 -68.958 1.00 49.40  ? 207  DA  J N6    1 
ATOM   4229  N N1    . DA  B 1 61  ? 39.042  22.165 -68.767 1.00 50.59  ? 207  DA  J N1    1 
ATOM   4230  C C2    . DA  B 1 61  ? 39.524  21.050 -68.223 1.00 48.37  ? 207  DA  J C2    1 
ATOM   4231  N N3    . DA  B 1 61  ? 40.496  20.905 -67.340 1.00 48.50  ? 207  DA  J N3    1 
ATOM   4232  C C4    . DA  B 1 61  ? 41.006  22.099 -66.997 1.00 48.63  ? 207  DA  J C4    1 
ATOM   4233  P P     . DT  B 1 62  ? 45.828  18.772 -64.495 1.00 42.30  ? 208  DT  J P     1 
ATOM   4234  O OP1   . DT  B 1 62  ? 46.123  17.590 -63.641 1.00 42.63  ? 208  DT  J OP1   1 
ATOM   4235  O OP2   . DT  B 1 62  ? 46.939  19.597 -65.035 1.00 41.48  ? 208  DT  J OP2   1 
ATOM   4236  O "O5'" . DT  B 1 62  ? 45.015  18.283 -65.764 1.00 44.65  ? 208  DT  J "O5'" 1 
ATOM   4237  C "C5'" . DT  B 1 62  ? 43.841  17.508 -65.585 1.00 43.79  ? 208  DT  J "C5'" 1 
ATOM   4238  C "C4'" . DT  B 1 62  ? 43.373  16.956 -66.904 1.00 44.90  ? 208  DT  J "C4'" 1 
ATOM   4239  O "O4'" . DT  B 1 62  ? 42.653  17.968 -67.638 1.00 44.45  ? 208  DT  J "O4'" 1 
ATOM   4240  C "C3'" . DT  B 1 62  ? 44.484  16.454 -67.820 1.00 45.36  ? 208  DT  J "C3'" 1 
ATOM   4241  O "O3'" . DT  B 1 62  ? 44.079  15.190 -68.344 1.00 50.25  ? 208  DT  J "O3'" 1 
ATOM   4242  C "C2'" . DT  B 1 62  ? 44.572  17.523 -68.902 1.00 40.63  ? 208  DT  J "C2'" 1 
ATOM   4243  C "C1'" . DT  B 1 62  ? 43.144  18.029 -68.966 1.00 43.40  ? 208  DT  J "C1'" 1 
ATOM   4244  N N1    . DT  B 1 62  ? 42.938  19.407 -69.440 1.00 46.82  ? 208  DT  J N1    1 
ATOM   4245  C C2    . DT  B 1 62  ? 41.959  19.592 -70.375 1.00 50.48  ? 208  DT  J C2    1 
ATOM   4246  O O2    . DT  B 1 62  ? 41.321  18.680 -70.837 1.00 52.42  ? 208  DT  J O2    1 
ATOM   4247  N N3    . DT  B 1 62  ? 41.747  20.882 -70.745 1.00 51.68  ? 208  DT  J N3    1 
ATOM   4248  C C4    . DT  B 1 62  ? 42.395  21.991 -70.276 1.00 51.04  ? 208  DT  J C4    1 
ATOM   4249  O O4    . DT  B 1 62  ? 42.061  23.089 -70.681 1.00 46.30  ? 208  DT  J O4    1 
ATOM   4250  C C5    . DT  B 1 62  ? 43.439  21.735 -69.304 1.00 46.98  ? 208  DT  J C5    1 
ATOM   4251  C C7    . DT  B 1 62  ? 44.211  22.885 -68.741 1.00 50.88  ? 208  DT  J C7    1 
ATOM   4252  C C6    . DT  B 1 62  ? 43.663  20.465 -68.947 1.00 46.51  ? 208  DT  J C6    1 
ATOM   4253  P P     . DG  B 1 63  ? 45.125  14.269 -69.128 1.00 48.67  ? 209  DG  J P     1 
ATOM   4254  O OP1   . DG  B 1 63  ? 44.795  12.877 -68.729 1.00 67.12  ? 209  DG  J OP1   1 
ATOM   4255  O OP2   . DG  B 1 63  ? 46.496  14.784 -68.935 1.00 62.93  ? 209  DG  J OP2   1 
ATOM   4256  O "O5'" . DG  B 1 63  ? 44.716  14.502 -70.650 1.00 49.33  ? 209  DG  J "O5'" 1 
ATOM   4257  C "C5'" . DG  B 1 63  ? 43.348  14.385 -71.046 1.00 52.29  ? 209  DG  J "C5'" 1 
ATOM   4258  C "C4'" . DG  B 1 63  ? 43.190  14.719 -72.509 1.00 55.05  ? 209  DG  J "C4'" 1 
ATOM   4259  O "O4'" . DG  B 1 63  ? 42.907  16.120 -72.723 1.00 52.76  ? 209  DG  J "O4'" 1 
ATOM   4260  C "C3'" . DG  B 1 63  ? 44.402  14.390 -73.371 1.00 55.60  ? 209  DG  J "C3'" 1 
ATOM   4261  O "O3'" . DG  B 1 63  ? 43.930  13.865 -74.596 1.00 57.14  ? 209  DG  J "O3'" 1 
ATOM   4262  C "C2'" . DG  B 1 63  ? 45.040  15.746 -73.614 1.00 55.39  ? 209  DG  J "C2'" 1 
ATOM   4263  C "C1'" . DG  B 1 63  ? 43.827  16.657 -73.672 1.00 54.28  ? 209  DG  J "C1'" 1 
ATOM   4264  N N9    . DG  B 1 63  ? 44.083  18.048 -73.303 1.00 68.61  ? 209  DG  J N9    1 
ATOM   4265  C C8    . DG  B 1 63  ? 44.961  18.500 -72.349 1.00 67.69  ? 209  DG  J C8    1 
ATOM   4266  N N7    . DG  B 1 63  ? 44.945  19.797 -72.211 1.00 66.01  ? 209  DG  J N7    1 
ATOM   4267  C C5    . DG  B 1 63  ? 44.006  20.230 -73.134 1.00 67.64  ? 209  DG  J C5    1 
ATOM   4268  C C6    . DG  B 1 63  ? 43.555  21.535 -73.437 1.00 69.26  ? 209  DG  J C6    1 
ATOM   4269  O O6    . DG  B 1 63  ? 43.905  22.611 -72.938 1.00 64.03  ? 209  DG  J O6    1 
ATOM   4270  N N1    . DG  B 1 63  ? 42.593  21.521 -74.434 1.00 71.80  ? 209  DG  J N1    1 
ATOM   4271  C C2    . DG  B 1 63  ? 42.126  20.404 -75.060 1.00 71.31  ? 209  DG  J C2    1 
ATOM   4272  N N2    . DG  B 1 63  ? 41.198  20.616 -75.981 1.00 70.67  ? 209  DG  J N2    1 
ATOM   4273  N N3    . DG  B 1 63  ? 42.538  19.178 -74.797 1.00 67.91  ? 209  DG  J N3    1 
ATOM   4274  C C4    . DG  B 1 63  ? 43.471  19.165 -73.826 1.00 69.52  ? 209  DG  J C4    1 
ATOM   4275  P P     . DT  B 1 64  ? 44.961  13.242 -75.634 1.00 58.12  ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 64  ? 44.606  11.815 -75.760 1.00 58.03  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 64  ? 46.321  13.629 -75.204 1.00 54.68  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 64  ? 44.588  14.008 -76.975 1.00 58.36  ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 64  ? 43.220  14.216 -77.307 1.00 62.13  ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 64  ? 43.083  15.279 -78.371 1.00 64.93  ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 64  ? 43.118  16.614 -77.804 1.00 65.54  ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 64  ? 44.143  15.246 -79.471 1.00 65.92  ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 64  ? 43.516  15.367 -80.740 1.00 70.03  ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 64  ? 44.973  16.490 -79.211 1.00 65.00  ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 64  ? 43.953  17.440 -78.601 1.00 64.96  ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 64  ? 44.543  18.488 -77.729 1.00 63.74  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 64  ? 44.164  19.813 -77.899 1.00 63.85  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 64  ? 43.321  20.186 -78.706 1.00 65.55  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 64  ? 44.818  20.693 -77.080 1.00 61.31  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 64  ? 45.785  20.399 -76.140 1.00 61.45  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 64  ? 46.300  21.299 -75.489 1.00 56.44  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 64  ? 46.114  19.006 -76.007 1.00 59.73  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 64  ? 47.155  18.602 -75.016 1.00 57.29  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 64  ? 45.478  18.131 -76.785 1.00 61.12  ? 210  DT  J C6    1 
ATOM   4295  P P     . DT  B 1 65  ? 44.295  14.885 -82.051 1.00 85.87  ? 211  DT  J P     1 
ATOM   4296  O OP1   . DT  B 1 65  ? 43.410  13.929 -82.756 1.00 80.92  ? 211  DT  J OP1   1 
ATOM   4297  O OP2   . DT  B 1 65  ? 45.677  14.484 -81.672 1.00 81.15  ? 211  DT  J OP2   1 
ATOM   4298  O "O5'" . DT  B 1 65  ? 44.415  16.211 -82.913 1.00 85.36  ? 211  DT  J "O5'" 1 
ATOM   4299  C "C5'" . DT  B 1 65  ? 43.275  17.021 -83.144 1.00 82.61  ? 211  DT  J "C5'" 1 
ATOM   4300  C "C4'" . DT  B 1 65  ? 43.710  18.383 -83.617 1.00 81.50  ? 211  DT  J "C4'" 1 
ATOM   4301  O "O4'" . DT  B 1 65  ? 44.231  19.171 -82.523 1.00 80.17  ? 211  DT  J "O4'" 1 
ATOM   4302  C "C3'" . DT  B 1 65  ? 44.819  18.342 -84.660 1.00 82.13  ? 211  DT  J "C3'" 1 
ATOM   4303  O "O3'" . DT  B 1 65  ? 44.562  19.374 -85.599 1.00 84.92  ? 211  DT  J "O3'" 1 
ATOM   4304  C "C2'" . DT  B 1 65  ? 46.065  18.676 -83.860 1.00 78.31  ? 211  DT  J "C2'" 1 
ATOM   4305  C "C1'" . DT  B 1 65  ? 45.504  19.683 -82.880 1.00 76.13  ? 211  DT  J "C1'" 1 
ATOM   4306  N N1    . DT  B 1 65  ? 46.278  19.907 -81.635 1.00 68.12  ? 211  DT  J N1    1 
ATOM   4307  C C2    . DT  B 1 65  ? 46.505  21.209 -81.251 1.00 65.17  ? 211  DT  J C2    1 
ATOM   4308  O O2    . DT  B 1 65  ? 46.095  22.161 -81.879 1.00 63.45  ? 211  DT  J O2    1 
ATOM   4309  N N3    . DT  B 1 65  ? 47.229  21.354 -80.100 1.00 61.41  ? 211  DT  J N3    1 
ATOM   4310  C C4    . DT  B 1 65  ? 47.737  20.353 -79.303 1.00 62.68  ? 211  DT  J C4    1 
ATOM   4311  O O4    . DT  B 1 65  ? 48.376  20.643 -78.298 1.00 56.62  ? 211  DT  J O4    1 
ATOM   4312  C C5    . DT  B 1 65  ? 47.457  19.004 -79.754 1.00 62.89  ? 211  DT  J C5    1 
ATOM   4313  C C7    . DT  B 1 65  ? 47.963  17.848 -78.949 1.00 59.30  ? 211  DT  J C7    1 
ATOM   4314  C C6    . DT  B 1 65  ? 46.753  18.850 -80.884 1.00 64.68  ? 211  DT  J C6    1 
ATOM   4315  P P     . DC  B 1 66  ? 44.972  19.171 -87.123 1.00 74.90  ? 212  DC  J P     1 
ATOM   4316  O OP1   . DC  B 1 66  ? 43.729  19.215 -87.921 1.00 63.58  ? 212  DC  J OP1   1 
ATOM   4317  O OP2   . DC  B 1 66  ? 45.876  18.004 -87.206 1.00 66.73  ? 212  DC  J OP2   1 
ATOM   4318  O "O5'" . DC  B 1 66  ? 45.833  20.463 -87.429 1.00 77.49  ? 212  DC  J "O5'" 1 
ATOM   4319  C "C5'" . DC  B 1 66  ? 45.406  21.732 -86.968 1.00 73.07  ? 212  DC  J "C5'" 1 
ATOM   4320  C "C4'" . DC  B 1 66  ? 46.606  22.600 -86.684 1.00 70.60  ? 212  DC  J "C4'" 1 
ATOM   4321  O "O4'" . DC  B 1 66  ? 47.136  22.393 -85.352 1.00 69.96  ? 212  DC  J "O4'" 1 
ATOM   4322  C "C3'" . DC  B 1 66  ? 47.775  22.369 -87.643 1.00 68.80  ? 212  DC  J "C3'" 1 
ATOM   4323  O "O3'" . DC  B 1 66  ? 48.325  23.636 -87.992 1.00 65.49  ? 212  DC  J "O3'" 1 
ATOM   4324  C "C2'" . DC  B 1 66  ? 48.777  21.615 -86.787 1.00 70.39  ? 212  DC  J "C2'" 1 
ATOM   4325  C "C1'" . DC  B 1 66  ? 48.545  22.311 -85.468 1.00 68.61  ? 212  DC  J "C1'" 1 
ATOM   4326  N N1    . DC  B 1 66  ? 49.087  21.671 -84.263 1.00 56.36  ? 212  DC  J N1    1 
ATOM   4327  C C2    . DC  B 1 66  ? 49.451  22.498 -83.180 1.00 55.03  ? 212  DC  J C2    1 
ATOM   4328  O O2    . DC  B 1 66  ? 49.285  23.715 -83.272 1.00 49.39  ? 212  DC  J O2    1 
ATOM   4329  N N3    . DC  B 1 66  ? 49.974  21.945 -82.068 1.00 52.24  ? 212  DC  J N3    1 
ATOM   4330  C C4    . DC  B 1 66  ? 50.148  20.625 -82.002 1.00 55.31  ? 212  DC  J C4    1 
ATOM   4331  N N4    . DC  B 1 66  ? 50.695  20.138 -80.887 1.00 54.30  ? 212  DC  J N4    1 
ATOM   4332  C C5    . DC  B 1 66  ? 49.775  19.751 -83.079 1.00 54.78  ? 212  DC  J C5    1 
ATOM   4333  C C6    . DC  B 1 66  ? 49.251  20.314 -84.182 1.00 54.45  ? 212  DC  J C6    1 
ATOM   4334  P P     . DA  B 1 67  ? 48.694  23.944 -89.513 1.00 63.29  ? 213  DA  J P     1 
ATOM   4335  O OP1   . DA  B 1 67  ? 47.436  24.306 -90.209 1.00 62.41  ? 213  DA  J OP1   1 
ATOM   4336  O OP2   . DA  B 1 67  ? 49.514  22.802 -89.989 1.00 61.19  ? 213  DA  J OP2   1 
ATOM   4337  O "O5'" . DA  B 1 67  ? 49.601  25.240 -89.421 1.00 62.81  ? 213  DA  J "O5'" 1 
ATOM   4338  C "C5'" . DA  B 1 67  ? 49.133  26.411 -88.754 1.00 59.88  ? 213  DA  J "C5'" 1 
ATOM   4339  C "C4'" . DA  B 1 67  ? 50.283  27.091 -88.047 1.00 61.01  ? 213  DA  J "C4'" 1 
ATOM   4340  O "O4'" . DA  B 1 67  ? 50.629  26.319 -86.873 1.00 58.23  ? 213  DA  J "O4'" 1 
ATOM   4341  C "C3'" . DA  B 1 67  ? 51.551  27.143 -88.911 1.00 60.32  ? 213  DA  J "C3'" 1 
ATOM   4342  O "O3'" . DA  B 1 67  ? 52.379  28.252 -88.533 1.00 61.92  ? 213  DA  J "O3'" 1 
ATOM   4343  C "C2'" . DA  B 1 67  ? 52.261  25.867 -88.500 1.00 59.91  ? 213  DA  J "C2'" 1 
ATOM   4344  C "C1'" . DA  B 1 67  ? 51.957  25.857 -87.012 1.00 58.68  ? 213  DA  J "C1'" 1 
ATOM   4345  N N9    . DA  B 1 67  ? 52.053  24.565 -86.351 1.00 61.83  ? 213  DA  J N9    1 
ATOM   4346  C C8    . DA  B 1 67  ? 51.926  23.296 -86.858 1.00 61.31  ? 213  DA  J C8    1 
ATOM   4347  N N7    . DA  B 1 67  ? 52.115  22.354 -85.967 1.00 64.88  ? 213  DA  J N7    1 
ATOM   4348  C C5    . DA  B 1 67  ? 52.382  23.054 -84.797 1.00 63.36  ? 213  DA  J C5    1 
ATOM   4349  C C6    . DA  B 1 67  ? 52.685  22.640 -83.501 1.00 64.30  ? 213  DA  J C6    1 
ATOM   4350  N N6    . DA  B 1 67  ? 52.815  21.366 -83.149 1.00 62.12  ? 213  DA  J N6    1 
ATOM   4351  N N1    . DA  B 1 67  ? 52.869  23.595 -82.563 1.00 64.12  ? 213  DA  J N1    1 
ATOM   4352  C C2    . DA  B 1 67  ? 52.776  24.883 -82.926 1.00 65.15  ? 213  DA  J C2    1 
ATOM   4353  N N3    . DA  B 1 67  ? 52.521  25.397 -84.117 1.00 60.50  ? 213  DA  J N3    1 
ATOM   4354  C C4    . DA  B 1 67  ? 52.329  24.416 -85.018 1.00 63.21  ? 213  DA  J C4    1 
ATOM   4355  P P     . DG  B 1 68  ? 52.001  29.741 -88.984 1.00 101.61 ? 214  DG  J P     1 
ATOM   4356  O OP1   . DG  B 1 68  ? 50.559  29.969 -88.704 1.00 70.12  ? 214  DG  J OP1   1 
ATOM   4357  O OP2   . DG  B 1 68  ? 52.556  29.957 -90.350 1.00 73.00  ? 214  DG  J OP2   1 
ATOM   4358  O "O5'" . DG  B 1 68  ? 52.800  30.654 -87.962 1.00 103.15 ? 214  DG  J "O5'" 1 
ATOM   4359  C "C5'" . DG  B 1 68  ? 52.406  30.732 -86.591 1.00 99.70  ? 214  DG  J "C5'" 1 
ATOM   4360  C "C4'" . DG  B 1 68  ? 53.615  30.556 -85.704 1.00 98.70  ? 214  DG  J "C4'" 1 
ATOM   4361  O "O4'" . DG  B 1 68  ? 53.893  29.159 -85.437 1.00 97.41  ? 214  DG  J "O4'" 1 
ATOM   4362  C "C3'" . DG  B 1 68  ? 54.892  31.122 -86.326 1.00 96.03  ? 214  DG  J "C3'" 1 
ATOM   4363  O "O3'" . DG  B 1 68  ? 55.694  31.668 -85.287 1.00 96.02  ? 214  DG  J "O3'" 1 
ATOM   4364  C "C2'" . DG  B 1 68  ? 55.568  29.888 -86.892 1.00 95.72  ? 214  DG  J "C2'" 1 
ATOM   4365  C "C1'" . DG  B 1 68  ? 55.241  28.894 -85.801 1.00 96.83  ? 214  DG  J "C1'" 1 
ATOM   4366  N N9    . DG  B 1 68  ? 55.357  27.480 -86.135 1.00 70.06  ? 214  DG  J N9    1 
ATOM   4367  C C8    . DG  B 1 68  ? 55.086  26.863 -87.332 1.00 68.74  ? 214  DG  J C8    1 
ATOM   4368  N N7    . DG  B 1 68  ? 55.260  25.568 -87.294 1.00 69.27  ? 214  DG  J N7    1 
ATOM   4369  C C5    . DG  B 1 68  ? 55.680  25.321 -85.991 1.00 67.55  ? 214  DG  J C5    1 
ATOM   4370  C C6    . DG  B 1 68  ? 56.016  24.105 -85.344 1.00 70.00  ? 214  DG  J C6    1 
ATOM   4371  O O6    . DG  B 1 68  ? 55.986  22.963 -85.789 1.00 68.59  ? 214  DG  J O6    1 
ATOM   4372  N N1    . DG  B 1 68  ? 56.408  24.317 -84.034 1.00 69.25  ? 214  DG  J N1    1 
ATOM   4373  C C2    . DG  B 1 68  ? 56.459  25.536 -83.411 1.00 69.85  ? 214  DG  J C2    1 
ATOM   4374  N N2    . DG  B 1 68  ? 56.870  25.536 -82.141 1.00 68.35  ? 214  DG  J N2    1 
ATOM   4375  N N3    . DG  B 1 68  ? 56.132  26.671 -83.990 1.00 70.70  ? 214  DG  J N3    1 
ATOM   4376  C C4    . DG  B 1 68  ? 55.757  26.492 -85.272 1.00 70.37  ? 214  DG  J C4    1 
ATOM   4377  P P     . DC  B 1 69  ? 56.617  32.944 -85.575 1.00 85.79  ? 215  DC  J P     1 
ATOM   4378  O OP1   . DC  B 1 69  ? 55.741  34.151 -85.612 1.00 65.16  ? 215  DC  J OP1   1 
ATOM   4379  O OP2   . DC  B 1 69  ? 57.506  32.627 -86.736 1.00 67.21  ? 215  DC  J OP2   1 
ATOM   4380  O "O5'" . DC  B 1 69  ? 57.500  33.017 -84.255 1.00 85.41  ? 215  DC  J "O5'" 1 
ATOM   4381  C "C5'" . DC  B 1 69  ? 57.130  32.286 -83.085 1.00 83.92  ? 215  DC  J "C5'" 1 
ATOM   4382  C "C4'" . DC  B 1 69  ? 58.269  31.389 -82.663 1.00 86.90  ? 215  DC  J "C4'" 1 
ATOM   4383  O "O4'" . DC  B 1 69  ? 58.175  30.069 -83.250 1.00 85.69  ? 215  DC  J "O4'" 1 
ATOM   4384  C "C3'" . DC  B 1 69  ? 59.636  31.933 -83.075 1.00 86.55  ? 215  DC  J "C3'" 1 
ATOM   4385  O "O3'" . DC  B 1 69  ? 60.576  31.666 -82.047 1.00 87.88  ? 215  DC  J "O3'" 1 
ATOM   4386  C "C2'" . DC  B 1 69  ? 59.984  31.103 -84.295 1.00 87.00  ? 215  DC  J "C2'" 1 
ATOM   4387  C "C1'" . DC  B 1 69  ? 59.406  29.762 -83.892 1.00 88.65  ? 215  DC  J "C1'" 1 
ATOM   4388  N N1    . DC  B 1 69  ? 59.133  28.848 -85.010 1.00 72.65  ? 215  DC  J N1    1 
ATOM   4389  C C2    . DC  B 1 69  ? 59.398  27.485 -84.846 1.00 73.02  ? 215  DC  J C2    1 
ATOM   4390  O O2    . DC  B 1 69  ? 59.846  27.086 -83.764 1.00 66.43  ? 215  DC  J O2    1 
ATOM   4391  N N3    . DC  B 1 69  ? 59.157  26.637 -85.868 1.00 70.95  ? 215  DC  J N3    1 
ATOM   4392  C C4    . DC  B 1 69  ? 58.664  27.105 -87.019 1.00 72.67  ? 215  DC  J C4    1 
ATOM   4393  N N4    . DC  B 1 69  ? 58.434  26.230 -88.007 1.00 75.62  ? 215  DC  J N4    1 
ATOM   4394  C C5    . DC  B 1 69  ? 58.383  28.489 -87.211 1.00 72.45  ? 215  DC  J C5    1 
ATOM   4395  C C6    . DC  B 1 69  ? 58.632  29.316 -86.191 1.00 72.79  ? 215  DC  J C6    1 
ATOM   4396  P P     . DG  B 1 70  ? 61.204  32.876 -81.213 1.00 60.77  ? 216  DG  J P     1 
ATOM   4397  O OP1   . DG  B 1 70  ? 60.125  33.609 -80.495 1.00 66.96  ? 216  DG  J OP1   1 
ATOM   4398  O OP2   . DG  B 1 70  ? 62.113  33.605 -82.128 1.00 65.64  ? 216  DG  J OP2   1 
ATOM   4399  O "O5'" . DG  B 1 70  ? 62.061  32.108 -80.122 1.00 61.19  ? 216  DG  J "O5'" 1 
ATOM   4400  C "C5'" . DG  B 1 70  ? 61.443  31.134 -79.286 1.00 59.73  ? 216  DG  J "C5'" 1 
ATOM   4401  C "C4'" . DG  B 1 70  ? 62.286  29.885 -79.253 1.00 68.31  ? 216  DG  J "C4'" 1 
ATOM   4402  O "O4'" . DG  B 1 70  ? 62.099  29.085 -80.447 1.00 69.95  ? 216  DG  J "O4'" 1 
ATOM   4403  C "C3'" . DG  B 1 70  ? 63.773  30.200 -79.185 1.00 68.36  ? 216  DG  J "C3'" 1 
ATOM   4404  O "O3'" . DG  B 1 70  ? 64.400  29.241 -78.360 1.00 72.60  ? 216  DG  J "O3'" 1 
ATOM   4405  C "C2'" . DG  B 1 70  ? 64.230  30.014 -80.616 1.00 69.16  ? 216  DG  J "C2'" 1 
ATOM   4406  C "C1'" . DG  B 1 70  ? 63.357  28.858 -81.062 1.00 69.93  ? 216  DG  J "C1'" 1 
ATOM   4407  N N9    . DG  B 1 70  ? 63.152  28.789 -82.506 1.00 74.00  ? 216  DG  J N9    1 
ATOM   4408  C C8    . DG  B 1 70  ? 62.712  29.799 -83.327 1.00 71.28  ? 216  DG  J C8    1 
ATOM   4409  N N7    . DG  B 1 70  ? 62.623  29.442 -84.580 1.00 74.67  ? 216  DG  J N7    1 
ATOM   4410  C C5    . DG  B 1 70  ? 63.023  28.115 -84.586 1.00 77.80  ? 216  DG  J C5    1 
ATOM   4411  C C6    . DG  B 1 70  ? 63.112  27.208 -85.647 1.00 76.12  ? 216  DG  J C6    1 
ATOM   4412  O O6    . DG  B 1 70  ? 62.817  27.389 -86.827 1.00 75.56  ? 216  DG  J O6    1 
ATOM   4413  N N1    . DG  B 1 70  ? 63.592  25.970 -85.226 1.00 76.08  ? 216  DG  J N1    1 
ATOM   4414  C C2    . DG  B 1 70  ? 63.928  25.652 -83.930 1.00 77.50  ? 216  DG  J C2    1 
ATOM   4415  N N2    . DG  B 1 70  ? 64.411  24.418 -83.722 1.00 77.32  ? 216  DG  J N2    1 
ATOM   4416  N N3    . DG  B 1 70  ? 63.811  26.488 -82.916 1.00 75.90  ? 216  DG  J N3    1 
ATOM   4417  C C4    . DG  B 1 70  ? 63.363  27.698 -83.315 1.00 76.45  ? 216  DG  J C4    1 
ATOM   4418  P P     . DG  B 1 71  ? 65.754  29.609 -77.605 1.00 41.91  ? 217  DG  J P     1 
ATOM   4419  O OP1   . DG  B 1 71  ? 65.436  29.927 -76.196 1.00 48.04  ? 217  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 1 71  ? 66.514  30.568 -78.405 1.00 46.72  ? 217  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 1 71  ? 66.502  28.221 -77.655 1.00 42.33  ? 217  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 1 71  ? 65.785  27.041 -77.358 1.00 40.87  ? 217  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 1 71  ? 66.416  25.880 -78.072 1.00 49.45  ? 217  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 1 71  ? 66.115  25.960 -79.488 1.00 51.09  ? 217  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 1 71  ? 67.935  25.913 -77.950 1.00 49.50  ? 217  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 1 71  ? 68.425  24.583 -77.771 1.00 53.74  ? 217  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 1 71  ? 68.382  26.530 -79.265 1.00 50.30  ? 217  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 1 71  ? 67.327  26.007 -80.227 1.00 51.07  ? 217  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 1 71  ? 67.107  26.801 -81.440 1.00 55.08  ? 217  DG  J N9    1 
ATOM   4430  C C8    . DG  B 1 71  ? 66.792  28.139 -81.533 1.00 52.36  ? 217  DG  J C8    1 
ATOM   4431  N N7    . DG  B 1 71  ? 66.690  28.559 -82.765 1.00 55.75  ? 217  DG  J N7    1 
ATOM   4432  C C5    . DG  B 1 71  ? 66.950  27.430 -83.534 1.00 58.88  ? 217  DG  J C5    1 
ATOM   4433  C C6    . DG  B 1 71  ? 66.985  27.267 -84.934 1.00 57.20  ? 217  DG  J C6    1 
ATOM   4434  O O6    . DG  B 1 71  ? 66.789  28.103 -85.803 1.00 56.64  ? 217  DG  J O6    1 
ATOM   4435  N N1    . DG  B 1 71  ? 67.285  25.963 -85.291 1.00 57.16  ? 217  DG  J N1    1 
ATOM   4436  C C2    . DG  B 1 71  ? 67.517  24.938 -84.412 1.00 58.58  ? 217  DG  J C2    1 
ATOM   4437  N N2    . DG  B 1 71  ? 67.806  23.752 -84.954 1.00 58.40  ? 217  DG  J N2    1 
ATOM   4438  N N3    . DG  B 1 71  ? 67.474  25.067 -83.102 1.00 56.98  ? 217  DG  J N3    1 
ATOM   4439  C C4    . DG  B 1 71  ? 67.195  26.336 -82.733 1.00 57.53  ? 217  DG  J C4    1 
ATOM   4440  P P     . DA  B 1 72  ? 69.926  24.350 -77.256 1.00 106.43 ? 218  DA  J P     1 
ATOM   4441  O OP1   . DA  B 1 72  ? 69.862  23.692 -75.929 1.00 62.54  ? 218  DA  J OP1   1 
ATOM   4442  O OP2   . DA  B 1 72  ? 70.703  25.610 -77.424 1.00 66.81  ? 218  DA  J OP2   1 
ATOM   4443  O "O5'" . DA  B 1 72  ? 70.476  23.294 -78.303 1.00 109.32 ? 218  DA  J "O5'" 1 
ATOM   4444  C "C5'" . DA  B 1 72  ? 69.607  22.302 -78.832 1.00 111.73 ? 218  DA  J "C5'" 1 
ATOM   4445  C "C4'" . DA  B 1 72  ? 70.136  21.809 -80.155 1.00 116.55 ? 218  DA  J "C4'" 1 
ATOM   4446  O "O4'" . DA  B 1 72  ? 69.890  22.778 -81.200 1.00 116.99 ? 218  DA  J "O4'" 1 
ATOM   4447  C "C3'" . DA  B 1 72  ? 71.641  21.567 -80.146 1.00 118.62 ? 218  DA  J "C3'" 1 
ATOM   4448  O "O3'" . DA  B 1 72  ? 71.925  20.402 -80.908 1.00 124.70 ? 218  DA  J "O3'" 1 
ATOM   4449  C "C2'" . DA  B 1 72  ? 72.198  22.801 -80.829 1.00 114.98 ? 218  DA  J "C2'" 1 
ATOM   4450  C "C1'" . DA  B 1 72  ? 71.111  23.098 -81.843 1.00 113.85 ? 218  DA  J "C1'" 1 
ATOM   4451  N N9    . DA  B 1 72  ? 71.034  24.487 -82.289 1.00 69.27  ? 218  DA  J N9    1 
ATOM   4452  C C8    . DA  B 1 72  ? 71.010  25.631 -81.530 1.00 69.76  ? 218  DA  J C8    1 
ATOM   4453  N N7    . DA  B 1 72  ? 70.914  26.732 -82.235 1.00 67.91  ? 218  DA  J N7    1 
ATOM   4454  C C5    . DA  B 1 72  ? 70.875  26.282 -83.548 1.00 67.87  ? 218  DA  J C5    1 
ATOM   4455  C C6    . DA  B 1 72  ? 70.779  26.953 -84.771 1.00 67.29  ? 218  DA  J C6    1 
ATOM   4456  N N6    . DA  B 1 72  ? 70.691  28.276 -84.881 1.00 67.41  ? 218  DA  J N6    1 
ATOM   4457  N N1    . DA  B 1 72  ? 70.777  26.209 -85.897 1.00 69.96  ? 218  DA  J N1    1 
ATOM   4458  C C2    . DA  B 1 72  ? 70.861  24.882 -85.787 1.00 70.52  ? 218  DA  J C2    1 
ATOM   4459  N N3    . DA  B 1 72  ? 70.955  24.135 -84.698 1.00 68.92  ? 218  DA  J N3    1 
ATOM   4460  C C4    . DA  B 1 72  ? 70.956  24.904 -83.596 1.00 69.62  ? 218  DA  J C4    1 
ATOM   4461  P P     . DA  B 1 73  ? 73.353  19.703 -80.772 1.00 83.37  ? 219  DA  J P     1 
ATOM   4462  O OP1   . DA  B 1 73  ? 73.145  18.316 -80.288 1.00 81.80  ? 219  DA  J OP1   1 
ATOM   4463  O OP2   . DA  B 1 73  ? 74.213  20.630 -80.008 1.00 82.07  ? 219  DA  J OP2   1 
ATOM   4464  O "O5'" . DA  B 1 73  ? 73.881  19.686 -82.268 1.00 80.75  ? 219  DA  J "O5'" 1 
ATOM   4465  C "C5'" . DA  B 1 73  ? 72.989  19.405 -83.338 1.00 79.75  ? 219  DA  J "C5'" 1 
ATOM   4466  C "C4'" . DA  B 1 73  ? 73.583  19.864 -84.647 1.00 78.97  ? 219  DA  J "C4'" 1 
ATOM   4467  O "O4'" . DA  B 1 73  ? 73.281  21.255 -84.907 1.00 76.91  ? 219  DA  J "O4'" 1 
ATOM   4468  C "C3'" . DA  B 1 73  ? 75.103  19.729 -84.731 1.00 79.23  ? 219  DA  J "C3'" 1 
ATOM   4469  O "O3'" . DA  B 1 73  ? 75.472  19.123 -85.971 1.00 83.30  ? 219  DA  J "O3'" 1 
ATOM   4470  C "C2'" . DA  B 1 73  ? 75.600  21.164 -84.646 1.00 76.60  ? 219  DA  J "C2'" 1 
ATOM   4471  C "C1'" . DA  B 1 73  ? 74.465  21.929 -85.299 1.00 75.07  ? 219  DA  J "C1'" 1 
ATOM   4472  N N9    . DA  B 1 73  ? 74.341  23.332 -84.895 1.00 74.25  ? 219  DA  J N9    1 
ATOM   4473  C C8    . DA  B 1 73  ? 74.480  23.871 -83.646 1.00 74.40  ? 219  DA  J C8    1 
ATOM   4474  N N7    . DA  B 1 73  ? 74.321  25.173 -83.613 1.00 72.40  ? 219  DA  J N7    1 
ATOM   4475  C C5    . DA  B 1 73  ? 74.059  25.512 -84.931 1.00 71.52  ? 219  DA  J C5    1 
ATOM   4476  C C6    . DA  B 1 73  ? 73.801  26.744 -85.563 1.00 71.49  ? 219  DA  J C6    1 
ATOM   4477  N N6    . DA  B 1 73  ? 73.785  27.913 -84.933 1.00 68.55  ? 219  DA  J N6    1 
ATOM   4478  N N1    . DA  B 1 73  ? 73.561  26.732 -86.888 1.00 73.21  ? 219  DA  J N1    1 
ATOM   4479  C C2    . DA  B 1 73  ? 73.587  25.562 -87.532 1.00 71.57  ? 219  DA  J C2    1 
ATOM   4480  N N3    . DA  B 1 73  ? 73.828  24.342 -87.052 1.00 73.33  ? 219  DA  J N3    1 
ATOM   4481  C C4    . DA  B 1 73  ? 74.058  24.387 -85.730 1.00 74.04  ? 219  DA  J C4    1 
ATOM   4482  P P     . DT  B 1 74  ? 77.019  18.921 -86.316 1.00 75.74  ? 220  DT  J P     1 
ATOM   4483  O OP1   . DT  B 1 74  ? 77.146  17.706 -87.146 1.00 95.23  ? 220  DT  J OP1   1 
ATOM   4484  O OP2   . DT  B 1 74  ? 77.787  19.037 -85.056 1.00 92.98  ? 220  DT  J OP2   1 
ATOM   4485  O "O5'" . DT  B 1 74  ? 77.318  20.185 -87.219 1.00 76.04  ? 220  DT  J "O5'" 1 
ATOM   4486  C "C5'" . DT  B 1 74  ? 76.403  20.549 -88.234 1.00 74.02  ? 220  DT  J "C5'" 1 
ATOM   4487  C "C4'" . DT  B 1 74  ? 76.979  21.675 -89.049 1.00 74.30  ? 220  DT  J "C4'" 1 
ATOM   4488  O "O4'" . DT  B 1 74  ? 76.609  22.966 -88.501 1.00 71.93  ? 220  DT  J "O4'" 1 
ATOM   4489  C "C3'" . DT  B 1 74  ? 78.505  21.648 -89.100 1.00 75.16  ? 220  DT  J "C3'" 1 
ATOM   4490  O "O3'" . DT  B 1 74  ? 78.934  21.870 -90.439 1.00 79.17  ? 220  DT  J "O3'" 1 
ATOM   4491  C "C2'" . DT  B 1 74  ? 78.905  22.825 -88.227 1.00 73.37  ? 220  DT  J "C2'" 1 
ATOM   4492  C "C1'" . DT  B 1 74  ? 77.759  23.788 -88.475 1.00 72.36  ? 220  DT  J "C1'" 1 
ATOM   4493  N N1    . DT  B 1 74  ? 77.566  24.858 -87.458 1.00 85.65  ? 220  DT  J N1    1 
ATOM   4494  C C2    . DT  B 1 74  ? 77.273  26.131 -87.905 1.00 84.63  ? 220  DT  J C2    1 
ATOM   4495  O O2    . DT  B 1 74  ? 77.135  26.409 -89.083 1.00 85.64  ? 220  DT  J O2    1 
ATOM   4496  N N3    . DT  B 1 74  ? 77.153  27.075 -86.914 1.00 85.00  ? 220  DT  J N3    1 
ATOM   4497  C C4    . DT  B 1 74  ? 77.298  26.884 -85.553 1.00 85.04  ? 220  DT  J C4    1 
ATOM   4498  O O4    . DT  B 1 74  ? 77.189  27.838 -84.780 1.00 85.19  ? 220  DT  J O4    1 
ATOM   4499  C C5    . DT  B 1 74  ? 77.585  25.528 -85.153 1.00 84.51  ? 220  DT  J C5    1 
ATOM   4500  C C7    . DT  B 1 74  ? 77.747  25.227 -83.697 1.00 81.75  ? 220  DT  J C7    1 
ATOM   4501  C C6    . DT  B 1 74  ? 77.697  24.594 -86.111 1.00 84.98  ? 220  DT  J C6    1 
ATOM   4502  P P     . DT  B 1 75  ? 80.461  21.601 -90.847 1.00 87.29  ? 221  DT  J P     1 
ATOM   4503  O OP1   . DT  B 1 75  ? 80.490  20.431 -91.766 1.00 105.07 ? 221  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 1 75  ? 81.299  21.603 -89.620 1.00 105.00 ? 221  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 1 75  ? 80.798  22.908 -91.672 1.00 84.34  ? 221  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 1 75  ? 79.789  23.503 -92.461 1.00 83.64  ? 221  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 1 75  ? 80.078  24.969 -92.636 1.00 84.87  ? 221  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 1 75  ? 79.729  25.686 -91.432 1.00 82.70  ? 221  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 1 75  ? 81.552  25.271 -92.911 1.00 86.63  ? 221  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 1 75  ? 81.652  26.212 -93.982 1.00 90.86  ? 221  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 1 75  ? 82.037  25.875 -91.606 1.00 83.41  ? 221  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 1 75  ? 80.784  26.572 -91.119 1.00 80.51  ? 221  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 1 75  ? 80.729  26.858 -89.675 1.00 95.64  ? 221  DT  J N1    1 
ATOM   4514  C C2    . DT  B 1 75  ? 80.408  28.142 -89.281 1.00 94.68  ? 221  DT  J C2    1 
ATOM   4515  O O2    . DT  B 1 75  ? 80.184  29.048 -90.064 1.00 92.91  ? 221  DT  J O2    1 
ATOM   4516  N N3    . DT  B 1 75  ? 80.366  28.332 -87.931 1.00 94.47  ? 221  DT  J N3    1 
ATOM   4517  C C4    . DT  B 1 75  ? 80.613  27.397 -86.955 1.00 93.59  ? 221  DT  J C4    1 
ATOM   4518  O O4    . DT  B 1 75  ? 80.531  27.720 -85.776 1.00 94.07  ? 221  DT  J O4    1 
ATOM   4519  C C5    . DT  B 1 75  ? 80.955  26.076 -87.433 1.00 93.10  ? 221  DT  J C5    1 
ATOM   4520  C C7    . DT  B 1 75  ? 81.257  25.001 -86.439 1.00 92.68  ? 221  DT  J C7    1 
ATOM   4521  C C6    . DT  B 1 75  ? 80.990  25.874 -88.753 1.00 94.81  ? 221  DT  J C6    1 
ATOM   4522  P P     . DC  B 1 76  ? 83.093  26.715 -94.467 1.00 102.05 ? 222  DC  J P     1 
ATOM   4523  O OP1   . DC  B 1 76  ? 83.064  26.889 -95.949 1.00 73.33  ? 222  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 1 76  ? 84.087  25.804 -93.838 1.00 70.54  ? 222  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 1 76  ? 83.197  28.150 -93.797 1.00 101.93 ? 222  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 1 76  ? 82.124  29.073 -93.939 1.00 101.61 ? 222  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 1 76  ? 82.513  30.407 -93.357 1.00 100.51 ? 222  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 1 76  ? 82.281  30.457 -91.929 1.00 98.13  ? 222  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 1 76  ? 83.987  30.724 -93.562 1.00 100.61 ? 222  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 1 76  ? 84.115  32.097 -93.872 1.00 102.55 ? 222  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 1 76  ? 84.602  30.436 -92.207 1.00 99.29  ? 222  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 1 76  ? 83.478  30.831 -91.267 1.00 95.76  ? 222  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 1 76  ? 83.506  30.149 -89.962 1.00 61.36  ? 222  DC  J N1    1 
ATOM   4534  C C2    . DC  B 1 76  ? 83.399  30.919 -88.802 1.00 58.96  ? 222  DC  J C2    1 
ATOM   4535  O O2    . DC  B 1 76  ? 83.278  32.149 -88.923 1.00 57.50  ? 222  DC  J O2    1 
ATOM   4536  N N3    . DC  B 1 76  ? 83.435  30.303 -87.587 1.00 55.75  ? 222  DC  J N3    1 
ATOM   4537  C C4    . DC  B 1 76  ? 83.572  28.975 -87.519 1.00 55.63  ? 222  DC  J C4    1 
ATOM   4538  N N4    . DC  B 1 76  ? 83.607  28.401 -86.324 1.00 52.71  ? 222  DC  J N4    1 
ATOM   4539  C C5    . DC  B 1 76  ? 83.680  28.170 -88.687 1.00 56.06  ? 222  DC  J C5    1 
ATOM   4540  C C6    . DC  B 1 76  ? 83.642  28.791 -89.878 1.00 58.36  ? 222  DC  J C6    1 
ATOM   4541  P P     . DC  B 1 77  ? 85.464  32.631 -94.540 1.00 96.32  ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 77  ? 85.103  33.262 -95.851 1.00 65.45  ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 77  ? 86.458  31.517 -94.493 1.00 62.66  ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 77  ? 85.918  33.765 -93.523 1.00 96.20  ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 77  ? 84.959  34.658 -92.967 1.00 95.88  ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 77  ? 85.510  35.278 -91.710 1.00 94.78  ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 77  ? 85.381  34.395 -90.571 1.00 92.40  ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 77  ? 86.994  35.593 -91.833 1.00 94.88  ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 77  ? 87.237  36.803 -91.162 1.00 96.82  ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 77  ? 87.652  34.471 -91.061 1.00 93.56  ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 77  ? 86.646  34.273 -89.953 1.00 90.03  ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 77  ? 86.713  32.962 -89.308 1.00 53.48  ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 77  ? 86.645  32.902 -87.929 1.00 51.08  ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 77  ? 86.517  33.957 -87.303 1.00 49.62  ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 77  ? 86.717  31.704 -87.309 1.00 47.87  ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 77  ? 86.844  30.590 -88.030 1.00 47.75  ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 77  ? 86.897  29.426 -87.390 1.00 44.83  ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 77  ? 86.918  30.619 -89.446 1.00 48.18  ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 77  ? 86.847  31.819 -90.042 1.00 50.48  ? 223  DC  J C6    1 
ATOM   4560  P P     . DG  B 1 78  ? 88.183  37.889 -91.831 1.00 89.46  ? 224  DG  J P     1 
ATOM   4561  O OP1   . DG  B 1 78  ? 87.586  38.296 -93.127 1.00 84.89  ? 224  DG  J OP1   1 
ATOM   4562  O OP2   . DG  B 1 78  ? 89.557  37.328 -91.785 1.00 83.60  ? 224  DG  J OP2   1 
ATOM   4563  O "O5'" . DG  B 1 78  ? 88.066  39.106 -90.819 1.00 88.77  ? 224  DG  J "O5'" 1 
ATOM   4564  C "C5'" . DG  B 1 78  ? 86.810  39.427 -90.234 1.00 86.19  ? 224  DG  J "C5'" 1 
ATOM   4565  C "C4'" . DG  B 1 78  ? 86.956  39.577 -88.738 1.00 84.33  ? 224  DG  J "C4'" 1 
ATOM   4566  O "O4'" . DG  B 1 78  ? 87.202  38.300 -88.108 1.00 83.42  ? 224  DG  J "O4'" 1 
ATOM   4567  C "C3'" . DG  B 1 78  ? 88.099  40.483 -88.302 1.00 83.35  ? 224  DG  J "C3'" 1 
ATOM   4568  O "O3'" . DG  B 1 78  ? 87.651  41.265 -87.211 1.00 84.56  ? 224  DG  J "O3'" 1 
ATOM   4569  C "C2'" . DG  B 1 78  ? 89.189  39.518 -87.866 1.00 81.36  ? 224  DG  J "C2'" 1 
ATOM   4570  C "C1'" . DG  B 1 78  ? 88.393  38.344 -87.330 1.00 81.70  ? 224  DG  J "C1'" 1 
ATOM   4571  N N9    . DG  B 1 78  ? 89.044  37.043 -87.464 1.00 76.60  ? 224  DG  J N9    1 
ATOM   4572  C C8    . DG  B 1 78  ? 89.830  36.616 -88.506 1.00 76.14  ? 224  DG  J C8    1 
ATOM   4573  N N7    . DG  B 1 78  ? 90.218  35.376 -88.383 1.00 76.28  ? 224  DG  J N7    1 
ATOM   4574  C C5    . DG  B 1 78  ? 89.667  34.961 -87.181 1.00 76.37  ? 224  DG  J C5    1 
ATOM   4575  C C6    . DG  B 1 78  ? 89.730  33.707 -86.536 1.00 76.28  ? 224  DG  J C6    1 
ATOM   4576  O O6    . DG  B 1 78  ? 90.281  32.671 -86.928 1.00 76.58  ? 224  DG  J O6    1 
ATOM   4577  N N1    . DG  B 1 78  ? 89.047  33.720 -85.322 1.00 76.71  ? 224  DG  J N1    1 
ATOM   4578  C C2    . DG  B 1 78  ? 88.373  34.798 -84.808 1.00 76.43  ? 224  DG  J C2    1 
ATOM   4579  N N2    . DG  B 1 78  ? 87.770  34.610 -83.627 1.00 78.32  ? 224  DG  J N2    1 
ATOM   4580  N N3    . DG  B 1 78  ? 88.293  35.973 -85.409 1.00 76.42  ? 224  DG  J N3    1 
ATOM   4581  C C4    . DG  B 1 78  ? 88.959  35.983 -86.586 1.00 76.34  ? 224  DG  J C4    1 
ATOM   4582  P P     . DC  B 1 79  ? 88.633  42.334 -86.561 1.00 94.37  ? 225  DC  J P     1 
ATOM   4583  O OP1   . DC  B 1 79  ? 87.910  43.634 -86.463 1.00 77.29  ? 225  DC  J OP1   1 
ATOM   4584  O OP2   . DC  B 1 79  ? 89.920  42.251 -87.298 1.00 78.72  ? 225  DC  J OP2   1 
ATOM   4585  O "O5'" . DC  B 1 79  ? 88.861  41.734 -85.113 1.00 94.68  ? 225  DC  J "O5'" 1 
ATOM   4586  C "C5'" . DC  B 1 79  ? 87.787  41.121 -84.425 1.00 94.17  ? 225  DC  J "C5'" 1 
ATOM   4587  C "C4'" . DC  B 1 79  ? 88.302  40.480 -83.165 1.00 93.58  ? 225  DC  J "C4'" 1 
ATOM   4588  O "O4'" . DC  B 1 79  ? 88.918  39.203 -83.460 1.00 93.39  ? 225  DC  J "O4'" 1 
ATOM   4589  C "C3'" . DC  B 1 79  ? 89.373  41.330 -82.490 1.00 93.77  ? 225  DC  J "C3'" 1 
ATOM   4590  O "O3'" . DC  B 1 79  ? 89.148  41.317 -81.093 1.00 91.91  ? 225  DC  J "O3'" 1 
ATOM   4591  C "C2'" . DC  B 1 79  ? 90.669  40.616 -82.836 1.00 94.52  ? 225  DC  J "C2'" 1 
ATOM   4592  C "C1'" . DC  B 1 79  ? 90.225  39.167 -82.920 1.00 94.79  ? 225  DC  J "C1'" 1 
ATOM   4593  N N1    . DC  B 1 79  ? 91.045  38.322 -83.795 1.00 80.23  ? 225  DC  J N1    1 
ATOM   4594  C C2    . DC  B 1 79  ? 91.575  37.133 -83.285 1.00 80.78  ? 225  DC  J C2    1 
ATOM   4595  O O2    . DC  B 1 79  ? 91.319  36.816 -82.121 1.00 79.54  ? 225  DC  J O2    1 
ATOM   4596  N N3    . DC  B 1 79  ? 92.345  36.358 -84.073 1.00 81.31  ? 225  DC  J N3    1 
ATOM   4597  C C4    . DC  B 1 79  ? 92.582  36.724 -85.332 1.00 81.85  ? 225  DC  J C4    1 
ATOM   4598  N N4    . DC  B 1 79  ? 93.348  35.927 -86.082 1.00 82.73  ? 225  DC  J N4    1 
ATOM   4599  C C5    . DC  B 1 79  ? 92.044  37.924 -85.884 1.00 81.81  ? 225  DC  J C5    1 
ATOM   4600  C C6    . DC  B 1 79  ? 91.289  38.686 -85.087 1.00 80.95  ? 225  DC  J C6    1 
ATOM   4601  P P     . DT  B 1 80  ? 89.836  42.424 -80.168 1.00 71.15  ? 226  DT  J P     1 
ATOM   4602  O OP1   . DT  B 1 80  ? 88.819  43.449 -79.840 1.00 88.82  ? 226  DT  J OP1   1 
ATOM   4603  O OP2   . DT  B 1 80  ? 91.112  42.823 -80.814 1.00 86.72  ? 226  DT  J OP2   1 
ATOM   4604  O "O5'" . DT  B 1 80  ? 90.156  41.591 -78.852 1.00 67.94  ? 226  DT  J "O5'" 1 
ATOM   4605  C "C5'" . DT  B 1 80  ? 89.372  40.446 -78.536 1.00 61.12  ? 226  DT  J "C5'" 1 
ATOM   4606  C "C4'" . DT  B 1 80  ? 90.248  39.347 -77.990 1.00 58.30  ? 226  DT  J "C4'" 1 
ATOM   4607  O "O4'" . DT  B 1 80  ? 90.947  38.619 -79.030 1.00 56.79  ? 226  DT  J "O4'" 1 
ATOM   4608  C "C3'" . DT  B 1 80  ? 91.323  39.850 -77.030 1.00 56.46  ? 226  DT  J "C3'" 1 
ATOM   4609  O "O3'" . DT  B 1 80  ? 91.434  38.915 -75.972 1.00 53.88  ? 226  DT  J "O3'" 1 
ATOM   4610  C "C2'" . DT  B 1 80  ? 92.587  39.768 -77.863 1.00 57.36  ? 226  DT  J "C2'" 1 
ATOM   4611  C "C1'" . DT  B 1 80  ? 92.306  38.502 -78.640 1.00 57.23  ? 226  DT  J "C1'" 1 
ATOM   4612  N N1    . DT  B 1 80  ? 93.131  38.281 -79.839 1.00 74.99  ? 226  DT  J N1    1 
ATOM   4613  C C2    . DT  B 1 80  ? 93.444  36.982 -80.148 1.00 73.87  ? 226  DT  J C2    1 
ATOM   4614  O O2    . DT  B 1 80  ? 93.073  36.037 -79.476 1.00 75.84  ? 226  DT  J O2    1 
ATOM   4615  N N3    . DT  B 1 80  ? 94.205  36.827 -81.282 1.00 76.11  ? 226  DT  J N3    1 
ATOM   4616  C C4    . DT  B 1 80  ? 94.667  37.824 -82.126 1.00 76.84  ? 226  DT  J C4    1 
ATOM   4617  O O4    . DT  B 1 80  ? 95.324  37.526 -83.135 1.00 78.91  ? 226  DT  J O4    1 
ATOM   4618  C C5    . DT  B 1 80  ? 94.308  39.174 -81.730 1.00 76.39  ? 226  DT  J C5    1 
ATOM   4619  C C7    . DT  B 1 80  ? 94.764  40.326 -82.570 1.00 77.60  ? 226  DT  J C7    1 
ATOM   4620  C C6    . DT  B 1 80  ? 93.571  39.330 -80.620 1.00 75.61  ? 226  DT  J C6    1 
ATOM   4621  P P     . DG  B 1 81  ? 90.761  39.231 -74.562 1.00 57.98  ? 227  DG  J P     1 
ATOM   4622  O OP1   . DG  B 1 81  ? 89.358  39.696 -74.697 1.00 66.27  ? 227  DG  J OP1   1 
ATOM   4623  O OP2   . DG  B 1 81  ? 91.745  40.036 -73.800 1.00 61.62  ? 227  DG  J OP2   1 
ATOM   4624  O "O5'" . DG  B 1 81  ? 90.703  37.800 -73.921 1.00 54.43  ? 227  DG  J "O5'" 1 
ATOM   4625  C "C5'" . DG  B 1 81  ? 91.799  37.352 -73.195 1.00 51.17  ? 227  DG  J "C5'" 1 
ATOM   4626  C "C4'" . DG  B 1 81  ? 92.306  36.058 -73.764 1.00 51.10  ? 227  DG  J "C4'" 1 
ATOM   4627  O "O4'" . DG  B 1 81  ? 92.815  36.254 -75.098 1.00 52.82  ? 227  DG  J "O4'" 1 
ATOM   4628  C "C3'" . DG  B 1 81  ? 93.489  35.608 -72.934 1.00 48.38  ? 227  DG  J "C3'" 1 
ATOM   4629  O "O3'" . DG  B 1 81  ? 93.395  34.254 -72.610 1.00 41.28  ? 227  DG  J "O3'" 1 
ATOM   4630  C "C2'" . DG  B 1 81  ? 94.706  35.890 -73.782 1.00 49.42  ? 227  DG  J "C2'" 1 
ATOM   4631  C "C1'" . DG  B 1 81  ? 94.161  35.791 -75.180 1.00 52.49  ? 227  DG  J "C1'" 1 
ATOM   4632  N N9    . DG  B 1 81  ? 94.881  36.655 -76.106 1.00 61.12  ? 227  DG  J N9    1 
ATOM   4633  C C8    . DG  B 1 81  ? 94.851  38.027 -76.139 1.00 62.24  ? 227  DG  J C8    1 
ATOM   4634  N N7    . DG  B 1 81  ? 95.554  38.532 -77.113 1.00 62.84  ? 227  DG  J N7    1 
ATOM   4635  C C5    . DG  B 1 81  ? 96.088  37.425 -77.757 1.00 63.11  ? 227  DG  J C5    1 
ATOM   4636  C C6    . DG  B 1 81  ? 96.913  37.344 -78.914 1.00 63.86  ? 227  DG  J C6    1 
ATOM   4637  O O6    . DG  B 1 81  ? 97.315  38.261 -79.643 1.00 69.06  ? 227  DG  J O6    1 
ATOM   4638  N N1    . DG  B 1 81  ? 97.245  36.027 -79.209 1.00 62.32  ? 227  DG  J N1    1 
ATOM   4639  C C2    . DG  B 1 81  ? 96.814  34.928 -78.504 1.00 62.77  ? 227  DG  J C2    1 
ATOM   4640  N N2    . DG  B 1 81  ? 97.249  33.740 -78.950 1.00 61.41  ? 227  DG  J N2    1 
ATOM   4641  N N3    . DG  B 1 81  ? 96.017  34.989 -77.444 1.00 58.83  ? 227  DG  J N3    1 
ATOM   4642  C C4    . DG  B 1 81  ? 95.701  36.260 -77.129 1.00 61.39  ? 227  DG  J C4    1 
ATOM   4643  P P     . DA  B 1 82  ? 94.064  33.780 -71.267 1.00 47.62  ? 228  DA  J P     1 
ATOM   4644  O OP1   . DA  B 1 82  ? 93.174  32.859 -70.507 1.00 52.11  ? 228  DA  J OP1   1 
ATOM   4645  O OP2   . DA  B 1 82  ? 94.529  35.038 -70.641 1.00 50.09  ? 228  DA  J OP2   1 
ATOM   4646  O "O5'" . DA  B 1 82  ? 95.341  33.023 -71.809 1.00 43.71  ? 228  DA  J "O5'" 1 
ATOM   4647  C "C5'" . DA  B 1 82  ? 95.245  32.065 -72.848 1.00 43.07  ? 228  DA  J "C5'" 1 
ATOM   4648  C "C4'" . DA  B 1 82  ? 96.629  31.782 -73.372 1.00 47.15  ? 228  DA  J "C4'" 1 
ATOM   4649  O "O4'" . DA  B 1 82  ? 97.028  32.797 -74.325 1.00 50.84  ? 228  DA  J "O4'" 1 
ATOM   4650  C "C3'" . DA  B 1 82  ? 97.700  31.786 -72.277 1.00 46.68  ? 228  DA  J "C3'" 1 
ATOM   4651  O "O3'" . DA  B 1 82  ? 98.642  30.784 -72.572 1.00 47.04  ? 228  DA  J "O3'" 1 
ATOM   4652  C "C2'" . DA  B 1 82  ? 98.379  33.132 -72.446 1.00 46.61  ? 228  DA  J "C2'" 1 
ATOM   4653  C "C1'" . DA  B 1 82  ? 98.292  33.316 -73.948 1.00 50.63  ? 228  DA  J "C1'" 1 
ATOM   4654  N N9    . DA  B 1 82  ? 98.380  34.692 -74.439 1.00 62.52  ? 228  DA  J N9    1 
ATOM   4655  C C8    . DA  B 1 82  ? 97.894  35.853 -73.885 1.00 63.66  ? 228  DA  J C8    1 
ATOM   4656  N N7    . DA  B 1 82  ? 98.132  36.924 -74.609 1.00 63.91  ? 228  DA  J N7    1 
ATOM   4657  C C5    . DA  B 1 82  ? 98.827  36.433 -75.709 1.00 63.22  ? 228  DA  J C5    1 
ATOM   4658  C C6    . DA  B 1 82  ? 99.367  37.057 -76.839 1.00 63.19  ? 228  DA  J C6    1 
ATOM   4659  N N6    . DA  B 1 82  ? 99.293  38.367 -77.066 1.00 61.54  ? 228  DA  J N6    1 
ATOM   4660  N N1    . DA  B 1 82  ? 99.995  36.282 -77.742 1.00 64.23  ? 228  DA  J N1    1 
ATOM   4661  C C2    . DA  B 1 82  ? 100.077 34.964 -77.515 1.00 64.95  ? 228  DA  J C2    1 
ATOM   4662  N N3    . DA  B 1 82  ? 99.617  34.259 -76.492 1.00 65.84  ? 228  DA  J N3    1 
ATOM   4663  C C4    . DA  B 1 82  ? 98.992  35.062 -75.614 1.00 64.17  ? 228  DA  J C4    1 
ATOM   4664  P P     . DA  B 1 83  ? 99.361  29.998 -71.392 1.00 57.97  ? 229  DA  J P     1 
ATOM   4665  O OP1   . DA  B 1 83  ? 98.533  28.807 -71.048 1.00 54.65  ? 229  DA  J OP1   1 
ATOM   4666  O OP2   . DA  B 1 83  ? 99.757  30.992 -70.355 1.00 53.23  ? 229  DA  J OP2   1 
ATOM   4667  O "O5'" . DA  B 1 83  ? 100.706 29.493 -72.063 1.00 62.04  ? 229  DA  J "O5'" 1 
ATOM   4668  C "C5'" . DA  B 1 83  ? 100.716 29.007 -73.399 1.00 61.53  ? 229  DA  J "C5'" 1 
ATOM   4669  C "C4'" . DA  B 1 83  ? 101.953 29.489 -74.121 1.00 62.77  ? 229  DA  J "C4'" 1 
ATOM   4670  O "O4'" . DA  B 1 83  ? 101.800 30.858 -74.541 1.00 59.51  ? 229  DA  J "O4'" 1 
ATOM   4671  C "C3'" . DA  B 1 83  ? 103.253 29.427 -73.327 1.00 64.75  ? 229  DA  J "C3'" 1 
ATOM   4672  O "O3'" . DA  B 1 83  ? 104.244 28.732 -74.079 1.00 71.78  ? 229  DA  J "O3'" 1 
ATOM   4673  C "C2'" . DA  B 1 83  ? 103.628 30.883 -73.103 1.00 62.01  ? 229  DA  J "C2'" 1 
ATOM   4674  C "C1'" . DA  B 1 83  ? 102.964 31.597 -74.255 1.00 62.78  ? 229  DA  J "C1'" 1 
ATOM   4675  N N9    . DA  B 1 83  ? 102.528 32.963 -73.968 1.00 61.37  ? 229  DA  J N9    1 
ATOM   4676  C C8    . DA  B 1 83  ? 101.779 33.383 -72.894 1.00 64.11  ? 229  DA  J C8    1 
ATOM   4677  N N7    . DA  B 1 83  ? 101.482 34.662 -72.924 1.00 61.31  ? 229  DA  J N7    1 
ATOM   4678  C C5    . DA  B 1 83  ? 102.085 35.122 -74.089 1.00 61.74  ? 229  DA  J C5    1 
ATOM   4679  C C6    . DA  B 1 83  ? 102.143 36.401 -74.692 1.00 62.80  ? 229  DA  J C6    1 
ATOM   4680  N N6    . DA  B 1 83  ? 101.555 37.483 -74.188 1.00 60.74  ? 229  DA  J N6    1 
ATOM   4681  N N1    . DA  B 1 83  ? 102.838 36.525 -75.841 1.00 63.07  ? 229  DA  J N1    1 
ATOM   4682  C C2    . DA  B 1 83  ? 103.431 35.441 -76.345 1.00 63.29  ? 229  DA  J C2    1 
ATOM   4683  N N3    . DA  B 1 83  ? 103.448 34.187 -75.880 1.00 64.41  ? 229  DA  J N3    1 
ATOM   4684  C C4    . DA  B 1 83  ? 102.747 34.092 -74.736 1.00 63.01  ? 229  DA  J C4    1 
ATOM   4685  P P     . DC  B 1 84  ? 105.639 28.368 -73.392 1.00 56.19  ? 230  DC  J P     1 
ATOM   4686  O OP1   . DC  B 1 84  ? 106.300 27.271 -74.137 1.00 50.27  ? 230  DC  J OP1   1 
ATOM   4687  O OP2   . DC  B 1 84  ? 105.371 28.196 -71.939 1.00 48.41  ? 230  DC  J OP2   1 
ATOM   4688  O "O5'" . DC  B 1 84  ? 106.440 29.722 -73.621 1.00 57.17  ? 230  DC  J "O5'" 1 
ATOM   4689  C "C5'" . DC  B 1 84  ? 106.689 30.198 -74.937 1.00 62.57  ? 230  DC  J "C5'" 1 
ATOM   4690  C "C4'" . DC  B 1 84  ? 107.710 31.307 -74.894 1.00 66.41  ? 230  DC  J "C4'" 1 
ATOM   4691  O "O4'" . DC  B 1 84  ? 107.052 32.595 -74.872 1.00 66.72  ? 230  DC  J "O4'" 1 
ATOM   4692  C "C3'" . DC  B 1 84  ? 108.620 31.265 -73.664 1.00 70.65  ? 230  DC  J "C3'" 1 
ATOM   4693  O "O3'" . DC  B 1 84  ? 109.985 31.499 -74.022 1.00 79.46  ? 230  DC  J "O3'" 1 
ATOM   4694  C "C2'" . DC  B 1 84  ? 108.100 32.404 -72.808 1.00 69.03  ? 230  DC  J "C2'" 1 
ATOM   4695  C "C1'" . DC  B 1 84  ? 107.618 33.389 -73.851 1.00 65.69  ? 230  DC  J "C1'" 1 
ATOM   4696  N N1    . DC  B 1 84  ? 106.603 34.364 -73.398 1.00 58.16  ? 230  DC  J N1    1 
ATOM   4697  C C2    . DC  B 1 84  ? 106.439 35.560 -74.125 1.00 57.35  ? 230  DC  J C2    1 
ATOM   4698  O O2    . DC  B 1 84  ? 107.094 35.729 -75.159 1.00 59.09  ? 230  DC  J O2    1 
ATOM   4699  N N3    . DC  B 1 84  ? 105.568 36.494 -73.689 1.00 56.92  ? 230  DC  J N3    1 
ATOM   4700  C C4    . DC  B 1 84  ? 104.855 36.271 -72.589 1.00 55.75  ? 230  DC  J C4    1 
ATOM   4701  N N4    . DC  B 1 84  ? 104.026 37.239 -72.186 1.00 53.28  ? 230  DC  J N4    1 
ATOM   4702  C C5    . DC  B 1 84  ? 104.965 35.048 -71.850 1.00 56.27  ? 230  DC  J C5    1 
ATOM   4703  C C6    . DC  B 1 84  ? 105.845 34.132 -72.284 1.00 56.09  ? 230  DC  J C6    1 
ATOM   4704  P P     . DA  B 1 85  ? 111.167 30.820 -73.162 1.00 158.44 ? 231  DA  J P     1 
ATOM   4705  O OP1   . DA  B 1 85  ? 111.429 29.472 -73.728 1.00 128.69 ? 231  DA  J OP1   1 
ATOM   4706  O OP2   . DA  B 1 85  ? 110.849 30.955 -71.721 1.00 129.11 ? 231  DA  J OP2   1 
ATOM   4707  O "O5'" . DA  B 1 85  ? 112.414 31.759 -73.472 1.00 163.46 ? 231  DA  J "O5'" 1 
ATOM   4708  C "C5'" . DA  B 1 85  ? 112.550 32.371 -74.753 1.00 173.10 ? 231  DA  J "C5'" 1 
ATOM   4709  C "C4'" . DA  B 1 85  ? 112.740 33.865 -74.616 1.00 179.55 ? 231  DA  J "C4'" 1 
ATOM   4710  O "O4'" . DA  B 1 85  ? 111.583 34.460 -73.975 1.00 181.33 ? 231  DA  J "O4'" 1 
ATOM   4711  C "C3'" . DA  B 1 85  ? 113.953 34.311 -73.794 1.00 183.19 ? 231  DA  J "C3'" 1 
ATOM   4712  O "O3'" . DA  B 1 85  ? 114.565 35.446 -74.415 1.00 188.04 ? 231  DA  J "O3'" 1 
ATOM   4713  C "C2'" . DA  B 1 85  ? 113.347 34.721 -72.466 1.00 182.94 ? 231  DA  J "C2'" 1 
ATOM   4714  C "C1'" . DA  B 1 85  ? 112.011 35.286 -72.904 1.00 182.57 ? 231  DA  J "C1'" 1 
ATOM   4715  N N9    . DA  B 1 85  ? 110.990 35.259 -71.858 1.00 154.59 ? 231  DA  J N9    1 
ATOM   4716  C C8    . DA  B 1 85  ? 110.797 34.305 -70.888 1.00 154.62 ? 231  DA  J C8    1 
ATOM   4717  N N7    . DA  B 1 85  ? 109.822 34.585 -70.058 1.00 154.21 ? 231  DA  J N7    1 
ATOM   4718  C C5    . DA  B 1 85  ? 109.331 35.799 -70.518 1.00 154.55 ? 231  DA  J C5    1 
ATOM   4719  C C6    . DA  B 1 85  ? 108.296 36.635 -70.063 1.00 154.61 ? 231  DA  J C6    1 
ATOM   4720  N N6    . DA  B 1 85  ? 107.534 36.362 -69.000 1.00 153.67 ? 231  DA  J N6    1 
ATOM   4721  N N1    . DA  B 1 85  ? 108.066 37.778 -70.745 1.00 155.37 ? 231  DA  J N1    1 
ATOM   4722  C C2    . DA  B 1 85  ? 108.829 38.052 -71.812 1.00 155.84 ? 231  DA  J C2    1 
ATOM   4723  N N3    . DA  B 1 85  ? 109.829 37.347 -72.337 1.00 155.28 ? 231  DA  J N3    1 
ATOM   4724  C C4    . DA  B 1 85  ? 110.034 36.220 -71.633 1.00 154.90 ? 231  DA  J C4    1 
ATOM   4725  P P     . DT  B 1 86  ? 115.732 36.243 -73.651 1.00 200.42 ? 232  DT  J P     1 
ATOM   4726  O OP1   . DT  B 1 86  ? 116.723 36.638 -74.685 1.00 157.07 ? 232  DT  J OP1   1 
ATOM   4727  O OP2   . DT  B 1 86  ? 116.174 35.460 -72.464 1.00 156.74 ? 232  DT  J OP2   1 
ATOM   4728  O "O5'" . DT  B 1 86  ? 115.005 37.563 -73.136 1.00 201.47 ? 232  DT  J "O5'" 1 
ATOM   4729  C "C5'" . DT  B 1 86  ? 114.482 38.515 -74.062 1.00 201.47 ? 232  DT  J "C5'" 1 
ATOM   4730  C "C4'" . DT  B 1 86  ? 114.278 39.848 -73.380 1.00 201.47 ? 232  DT  J "C4'" 1 
ATOM   4731  O "O4'" . DT  B 1 86  ? 113.146 39.771 -72.479 1.00 201.47 ? 232  DT  J "O4'" 1 
ATOM   4732  C "C3'" . DT  B 1 86  ? 115.469 40.297 -72.532 1.00 201.47 ? 232  DT  J "C3'" 1 
ATOM   4733  O "O3'" . DT  B 1 86  ? 115.676 41.706 -72.653 1.00 201.47 ? 232  DT  J "O3'" 1 
ATOM   4734  C "C2'" . DT  B 1 86  ? 115.047 39.946 -71.117 1.00 201.47 ? 232  DT  J "C2'" 1 
ATOM   4735  C "C1'" . DT  B 1 86  ? 113.542 40.158 -71.171 1.00 201.47 ? 232  DT  J "C1'" 1 
ATOM   4736  N N1    . DT  B 1 86  ? 112.766 39.358 -70.192 1.00 172.78 ? 232  DT  J N1    1 
ATOM   4737  C C2    . DT  B 1 86  ? 111.499 39.790 -69.854 1.00 173.16 ? 232  DT  J C2    1 
ATOM   4738  O O2    . DT  B 1 86  ? 110.975 40.776 -70.350 1.00 172.92 ? 232  DT  J O2    1 
ATOM   4739  N N3    . DT  B 1 86  ? 110.864 39.018 -68.909 1.00 173.62 ? 232  DT  J N3    1 
ATOM   4740  C C4    . DT  B 1 86  ? 111.353 37.880 -68.292 1.00 173.91 ? 232  DT  J C4    1 
ATOM   4741  O O4    . DT  B 1 86  ? 110.673 37.301 -67.450 1.00 174.08 ? 232  DT  J O4    1 
ATOM   4742  C C5    . DT  B 1 86  ? 112.674 37.470 -68.713 1.00 173.91 ? 232  DT  J C5    1 
ATOM   4743  C C7    . DT  B 1 86  ? 113.274 36.234 -68.123 1.00 174.03 ? 232  DT  J C7    1 
ATOM   4744  C C6    . DT  B 1 86  ? 113.306 38.219 -69.626 1.00 173.70 ? 232  DT  J C6    1 
ATOM   4745  P P     . DG  B 1 87  ? 116.983 42.373 -71.999 1.00 200.94 ? 233  DG  J P     1 
ATOM   4746  O OP1   . DG  B 1 87  ? 117.446 43.460 -72.898 1.00 178.51 ? 233  DG  J OP1   1 
ATOM   4747  O OP2   . DG  B 1 87  ? 117.916 41.280 -71.623 1.00 177.83 ? 233  DG  J OP2   1 
ATOM   4748  O "O5'" . DG  B 1 87  ? 116.441 43.035 -70.657 1.00 201.47 ? 233  DG  J "O5'" 1 
ATOM   4749  C "C5'" . DG  B 1 87  ? 115.458 44.067 -70.688 1.00 201.47 ? 233  DG  J "C5'" 1 
ATOM   4750  C "C4'" . DG  B 1 87  ? 115.149 44.522 -69.282 1.00 201.47 ? 233  DG  J "C4'" 1 
ATOM   4751  O "O4'" . DG  B 1 87  ? 114.525 43.437 -68.552 1.00 201.47 ? 233  DG  J "O4'" 1 
ATOM   4752  C "C3'" . DG  B 1 87  ? 116.389 44.901 -68.473 1.00 201.47 ? 233  DG  J "C3'" 1 
ATOM   4753  O "O3'" . DG  B 1 87  ? 116.056 45.944 -67.558 1.00 201.47 ? 233  DG  J "O3'" 1 
ATOM   4754  C "C2'" . DG  B 1 87  ? 116.703 43.630 -67.708 1.00 201.47 ? 233  DG  J "C2'" 1 
ATOM   4755  C "C1'" . DG  B 1 87  ? 115.312 43.107 -67.414 1.00 201.47 ? 233  DG  J "C1'" 1 
ATOM   4756  N N9    . DG  B 1 87  ? 115.233 41.664 -67.207 1.00 185.64 ? 233  DG  J N9    1 
ATOM   4757  C C8    . DG  B 1 87  ? 115.987 40.683 -67.811 1.00 186.17 ? 233  DG  J C8    1 
ATOM   4758  N N7    . DG  B 1 87  ? 115.669 39.478 -67.417 1.00 186.19 ? 233  DG  J N7    1 
ATOM   4759  C C5    . DG  B 1 87  ? 114.647 39.678 -66.498 1.00 186.51 ? 233  DG  J C5    1 
ATOM   4760  C C6    . DG  B 1 87  ? 113.898 38.744 -65.736 1.00 186.70 ? 233  DG  J C6    1 
ATOM   4761  O O6    . DG  B 1 87  ? 113.987 37.513 -65.721 1.00 186.50 ? 233  DG  J O6    1 
ATOM   4762  N N1    . DG  B 1 87  ? 112.962 39.380 -64.927 1.00 187.09 ? 233  DG  J N1    1 
ATOM   4763  C C2    . DG  B 1 87  ? 112.768 40.738 -64.859 1.00 186.90 ? 233  DG  J C2    1 
ATOM   4764  N N2    . DG  B 1 87  ? 111.815 41.161 -64.021 1.00 187.17 ? 233  DG  J N2    1 
ATOM   4765  N N3    . DG  B 1 87  ? 113.456 41.617 -65.562 1.00 186.51 ? 233  DG  J N3    1 
ATOM   4766  C C4    . DG  B 1 87  ? 114.371 41.022 -66.355 1.00 186.28 ? 233  DG  J C4    1 
ATOM   4767  P P     . DC  B 1 88  ? 117.203 46.611 -66.653 1.00 163.96 ? 234  DC  J P     1 
ATOM   4768  O OP1   . DC  B 1 88  ? 117.811 47.696 -67.464 1.00 162.42 ? 234  DC  J OP1   1 
ATOM   4769  O OP2   . DC  B 1 88  ? 118.068 45.543 -66.082 1.00 162.50 ? 234  DC  J OP2   1 
ATOM   4770  O "O5'" . DC  B 1 88  ? 116.380 47.271 -65.463 1.00 162.76 ? 234  DC  J "O5'" 1 
ATOM   4771  C "C5'" . DC  B 1 88  ? 115.079 47.801 -65.699 1.00 159.01 ? 234  DC  J "C5'" 1 
ATOM   4772  C "C4'" . DC  B 1 88  ? 114.258 47.775 -64.432 1.00 156.31 ? 234  DC  J "C4'" 1 
ATOM   4773  O "O4'" . DC  B 1 88  ? 113.928 46.419 -64.055 1.00 156.84 ? 234  DC  J "O4'" 1 
ATOM   4774  C "C3'" . DC  B 1 88  ? 114.927 48.408 -63.215 1.00 153.74 ? 234  DC  J "C3'" 1 
ATOM   4775  O "O3'" . DC  B 1 88  ? 113.936 49.121 -62.486 1.00 149.16 ? 234  DC  J "O3'" 1 
ATOM   4776  C "C2'" . DC  B 1 88  ? 115.397 47.206 -62.415 1.00 155.04 ? 234  DC  J "C2'" 1 
ATOM   4777  C "C1'" . DC  B 1 88  ? 114.302 46.194 -62.707 1.00 157.20 ? 234  DC  J "C1'" 1 
ATOM   4778  N N1    . DC  B 1 88  ? 114.689 44.779 -62.586 1.00 157.01 ? 234  DC  J N1    1 
ATOM   4779  C C2    . DC  B 1 88  ? 113.845 43.910 -61.893 1.00 157.87 ? 234  DC  J C2    1 
ATOM   4780  O O2    . DC  B 1 88  ? 112.813 44.362 -61.382 1.00 158.23 ? 234  DC  J O2    1 
ATOM   4781  N N3    . DC  B 1 88  ? 114.172 42.602 -61.799 1.00 158.39 ? 234  DC  J N3    1 
ATOM   4782  C C4    . DC  B 1 88  ? 115.291 42.154 -62.368 1.00 158.83 ? 234  DC  J C4    1 
ATOM   4783  N N4    . DC  B 1 88  ? 115.567 40.853 -62.268 1.00 159.85 ? 234  DC  J N4    1 
ATOM   4784  C C5    . DC  B 1 88  ? 116.178 43.020 -63.069 1.00 158.47 ? 234  DC  J C5    1 
ATOM   4785  C C6    . DC  B 1 88  ? 115.842 44.314 -63.152 1.00 157.50 ? 234  DC  J C6    1 
ATOM   4786  P P     . DC  B 1 89  ? 113.252 50.418 -63.142 1.00 117.27 ? 235  DC  J P     1 
ATOM   4787  O OP1   . DC  B 1 89  ? 112.936 50.109 -64.555 1.00 112.84 ? 235  DC  J OP1   1 
ATOM   4788  O OP2   . DC  B 1 89  ? 114.057 51.619 -62.816 1.00 112.66 ? 235  DC  J OP2   1 
ATOM   4789  O "O5'" . DC  B 1 89  ? 111.870 50.532 -62.370 1.00 114.02 ? 235  DC  J "O5'" 1 
ATOM   4790  C "C5'" . DC  B 1 89  ? 110.791 49.663 -62.691 1.00 107.96 ? 235  DC  J "C5'" 1 
ATOM   4791  C "C4'" . DC  B 1 89  ? 110.255 49.012 -61.436 1.00 103.88 ? 235  DC  J "C4'" 1 
ATOM   4792  O "O4'" . DC  B 1 89  ? 111.081 47.901 -61.007 1.00 102.48 ? 235  DC  J "O4'" 1 
ATOM   4793  C "C3'" . DC  B 1 89  ? 110.131 49.937 -60.223 1.00 101.83 ? 235  DC  J "C3'" 1 
ATOM   4794  O "O3'" . DC  B 1 89  ? 108.909 49.652 -59.558 1.00 98.16  ? 235  DC  J "O3'" 1 
ATOM   4795  C "C2'" . DC  B 1 89  ? 111.280 49.502 -59.331 1.00 101.99 ? 235  DC  J "C2'" 1 
ATOM   4796  C "C1'" . DC  B 1 89  ? 111.299 48.016 -59.612 1.00 102.72 ? 235  DC  J "C1'" 1 
ATOM   4797  N N1    . DC  B 1 89  ? 112.550 47.328 -59.287 1.00 99.58  ? 235  DC  J N1    1 
ATOM   4798  C C2    . DC  B 1 89  ? 112.508 45.957 -59.043 1.00 100.60 ? 235  DC  J C2    1 
ATOM   4799  O O2    . DC  B 1 89  ? 111.419 45.372 -59.110 1.00 101.60 ? 235  DC  J O2    1 
ATOM   4800  N N3    . DC  B 1 89  ? 113.648 45.303 -58.737 1.00 101.43 ? 235  DC  J N3    1 
ATOM   4801  C C4    . DC  B 1 89  ? 114.800 45.975 -58.664 1.00 102.29 ? 235  DC  J C4    1 
ATOM   4802  N N4    . DC  B 1 89  ? 115.904 45.289 -58.346 1.00 102.83 ? 235  DC  J N4    1 
ATOM   4803  C C5    . DC  B 1 89  ? 114.872 47.377 -58.910 1.00 101.50 ? 235  DC  J C5    1 
ATOM   4804  C C6    . DC  B 1 89  ? 113.733 48.008 -59.217 1.00 100.33 ? 235  DC  J C6    1 
ATOM   4805  P P     . DT  B 1 90  ? 108.406 50.602 -58.382 1.00 94.83  ? 236  DT  J P     1 
ATOM   4806  O OP1   . DT  B 1 90  ? 107.559 51.665 -58.978 1.00 115.55 ? 236  DT  J OP1   1 
ATOM   4807  O OP2   . DT  B 1 90  ? 109.572 50.961 -57.539 1.00 115.22 ? 236  DT  J OP2   1 
ATOM   4808  O "O5'" . DT  B 1 90  ? 107.488 49.631 -57.531 1.00 92.25  ? 236  DT  J "O5'" 1 
ATOM   4809  C "C5'" . DT  B 1 90  ? 106.817 48.551 -58.162 1.00 85.59  ? 236  DT  J "C5'" 1 
ATOM   4810  C "C4'" . DT  B 1 90  ? 106.858 47.329 -57.278 1.00 80.84  ? 236  DT  J "C4'" 1 
ATOM   4811  O "O4'" . DT  B 1 90  ? 108.211 46.813 -57.221 1.00 80.40  ? 236  DT  J "O4'" 1 
ATOM   4812  C "C3'" . DT  B 1 90  ? 106.436 47.581 -55.827 1.00 77.46  ? 236  DT  J "C3'" 1 
ATOM   4813  O "O3'" . DT  B 1 90  ? 105.621 46.501 -55.361 1.00 73.15  ? 236  DT  J "O3'" 1 
ATOM   4814  C "C2'" . DT  B 1 90  ? 107.756 47.585 -55.076 1.00 77.99  ? 236  DT  J "C2'" 1 
ATOM   4815  C "C1'" . DT  B 1 90  ? 108.533 46.556 -55.866 1.00 79.80  ? 236  DT  J "C1'" 1 
ATOM   4816  N N1    . DT  B 1 90  ? 109.991 46.614 -55.712 1.00 100.93 ? 236  DT  J N1    1 
ATOM   4817  C C2    . DT  B 1 90  ? 110.631 45.453 -55.339 1.00 101.01 ? 236  DT  J C2    1 
ATOM   4818  O O2    . DT  B 1 90  ? 110.046 44.398 -55.174 1.00 100.04 ? 236  DT  J O2    1 
ATOM   4819  N N3    . DT  B 1 90  ? 111.988 45.573 -55.171 1.00 101.97 ? 236  DT  J N3    1 
ATOM   4820  C C4    . DT  B 1 90  ? 112.753 46.712 -55.349 1.00 103.59 ? 236  DT  J C4    1 
ATOM   4821  O O4    . DT  B 1 90  ? 113.968 46.669 -55.153 1.00 104.31 ? 236  DT  J O4    1 
ATOM   4822  C C5    . DT  B 1 90  ? 112.014 47.894 -55.767 1.00 102.43 ? 236  DT  J C5    1 
ATOM   4823  C C7    . DT  B 1 90  ? 112.757 49.169 -56.011 1.00 102.52 ? 236  DT  J C7    1 
ATOM   4824  C C6    . DT  B 1 90  ? 110.686 47.785 -55.921 1.00 101.59 ? 236  DT  J C6    1 
ATOM   4825  P P     . DT  B 1 91  ? 104.924 46.595 -53.921 1.00 65.49  ? 237  DT  J P     1 
ATOM   4826  O OP1   . DT  B 1 91  ? 103.475 46.782 -54.143 1.00 75.45  ? 237  DT  J OP1   1 
ATOM   4827  O OP2   . DT  B 1 91  ? 105.669 47.583 -53.101 1.00 75.73  ? 237  DT  J OP2   1 
ATOM   4828  O "O5'" . DT  B 1 91  ? 105.200 45.158 -53.299 1.00 64.25  ? 237  DT  J "O5'" 1 
ATOM   4829  C "C5'" . DT  B 1 91  ? 105.316 44.026 -54.145 1.00 60.61  ? 237  DT  J "C5'" 1 
ATOM   4830  C "C4'" . DT  B 1 91  ? 106.123 42.942 -53.471 1.00 58.74  ? 237  DT  J "C4'" 1 
ATOM   4831  O "O4'" . DT  B 1 91  ? 107.542 43.224 -53.511 1.00 61.04  ? 237  DT  J "O4'" 1 
ATOM   4832  C "C3'" . DT  B 1 91  ? 105.782 42.685 -52.007 1.00 55.96  ? 237  DT  J "C3'" 1 
ATOM   4833  O "O3'" . DT  B 1 91  ? 105.784 41.281 -51.779 1.00 48.64  ? 237  DT  J "O3'" 1 
ATOM   4834  C "C2'" . DT  B 1 91  ? 106.933 43.323 -51.255 1.00 58.67  ? 237  DT  J "C2'" 1 
ATOM   4835  C "C1'" . DT  B 1 91  ? 108.092 43.080 -52.205 1.00 62.53  ? 237  DT  J "C1'" 1 
ATOM   4836  N N1    . DT  B 1 91  ? 109.230 44.029 -52.073 1.00 72.67  ? 237  DT  J N1    1 
ATOM   4837  C C2    . DT  B 1 91  ? 110.505 43.520 -51.883 1.00 74.16  ? 237  DT  J C2    1 
ATOM   4838  O O2    . DT  B 1 91  ? 110.747 42.330 -51.774 1.00 73.86  ? 237  DT  J O2    1 
ATOM   4839  N N3    . DT  B 1 91  ? 111.492 44.466 -51.815 1.00 75.53  ? 237  DT  J N3    1 
ATOM   4840  C C4    . DT  B 1 91  ? 111.343 45.834 -51.902 1.00 76.81  ? 237  DT  J C4    1 
ATOM   4841  O O4    . DT  B 1 91  ? 112.329 46.555 -51.859 1.00 76.53  ? 237  DT  J O4    1 
ATOM   4842  C C5    . DT  B 1 91  ? 109.986 46.302 -52.056 1.00 77.11  ? 237  DT  J C5    1 
ATOM   4843  C C7    . DT  B 1 91  ? 109.727 47.773 -52.102 1.00 78.12  ? 237  DT  J C7    1 
ATOM   4844  C C6    . DT  B 1 91  ? 109.011 45.390 -52.145 1.00 75.22  ? 237  DT  J C6    1 
ATOM   4845  P P     . DT  B 1 92  ? 105.430 40.722 -50.327 1.00 49.51  ? 238  DT  J P     1 
ATOM   4846  O OP1   . DT  B 1 92  ? 104.586 39.508 -50.503 1.00 69.56  ? 238  DT  J OP1   1 
ATOM   4847  O OP2   . DT  B 1 92  ? 104.961 41.830 -49.451 1.00 64.68  ? 238  DT  J OP2   1 
ATOM   4848  O "O5'" . DT  B 1 92  ? 106.846 40.251 -49.798 1.00 56.42  ? 238  DT  J "O5'" 1 
ATOM   4849  C "C5'" . DT  B 1 92  ? 107.612 39.334 -50.546 1.00 60.17  ? 238  DT  J "C5'" 1 
ATOM   4850  C "C4'" . DT  B 1 92  ? 108.940 39.120 -49.872 1.00 67.19  ? 238  DT  J "C4'" 1 
ATOM   4851  O "O4'" . DT  B 1 92  ? 109.679 40.364 -49.886 1.00 68.39  ? 238  DT  J "O4'" 1 
ATOM   4852  C "C3'" . DT  B 1 92  ? 108.836 38.709 -48.405 1.00 68.74  ? 238  DT  J "C3'" 1 
ATOM   4853  O "O3'" . DT  B 1 92  ? 109.795 37.692 -48.136 1.00 72.78  ? 238  DT  J "O3'" 1 
ATOM   4854  C "C2'" . DT  B 1 92  ? 109.189 39.982 -47.654 1.00 71.25  ? 238  DT  J "C2'" 1 
ATOM   4855  C "C1'" . DT  B 1 92  ? 110.189 40.615 -48.591 1.00 71.39  ? 238  DT  J "C1'" 1 
ATOM   4856  N N1    . DT  B 1 92  ? 110.397 42.071 -48.459 1.00 91.46  ? 238  DT  J N1    1 
ATOM   4857  C C2    . DT  B 1 92  ? 111.663 42.533 -48.134 1.00 93.32  ? 238  DT  J C2    1 
ATOM   4858  O O2    . DT  B 1 92  ? 112.604 41.800 -47.873 1.00 92.28  ? 238  DT  J O2    1 
ATOM   4859  N N3    . DT  B 1 92  ? 111.782 43.896 -48.116 1.00 93.15  ? 238  DT  J N3    1 
ATOM   4860  C C4    . DT  B 1 92  ? 110.792 44.823 -48.363 1.00 94.00  ? 238  DT  J C4    1 
ATOM   4861  O O4    . DT  B 1 92  ? 111.055 46.019 -48.351 1.00 93.51  ? 238  DT  J O4    1 
ATOM   4862  C C5    . DT  B 1 92  ? 109.491 44.277 -48.639 1.00 93.12  ? 238  DT  J C5    1 
ATOM   4863  C C7    . DT  B 1 92  ? 108.352 45.220 -48.860 1.00 93.93  ? 238  DT  J C7    1 
ATOM   4864  C C6    . DT  B 1 92  ? 109.357 42.945 -48.679 1.00 92.73  ? 238  DT  J C6    1 
ATOM   4865  P P     . DT  B 1 93  ? 109.803 36.965 -46.706 1.00 104.32 ? 239  DT  J P     1 
ATOM   4866  O OP1   . DT  B 1 93  ? 110.080 35.519 -46.954 1.00 76.99  ? 239  DT  J OP1   1 
ATOM   4867  O OP2   . DT  B 1 93  ? 108.565 37.367 -45.972 1.00 79.57  ? 239  DT  J OP2   1 
ATOM   4868  O "O5'" . DT  B 1 93  ? 111.076 37.600 -45.987 1.00 110.15 ? 239  DT  J "O5'" 1 
ATOM   4869  C "C5'" . DT  B 1 93  ? 112.386 37.306 -46.467 1.00 116.55 ? 239  DT  J "C5'" 1 
ATOM   4870  C "C4'" . DT  B 1 93  ? 113.433 37.880 -45.544 1.00 121.48 ? 239  DT  J "C4'" 1 
ATOM   4871  O "O4'" . DT  B 1 93  ? 113.490 39.314 -45.702 1.00 120.90 ? 239  DT  J "O4'" 1 
ATOM   4872  C "C3'" . DT  B 1 93  ? 113.197 37.621 -44.056 1.00 125.31 ? 239  DT  J "C3'" 1 
ATOM   4873  O "O3'" . DT  B 1 93  ? 114.448 37.392 -43.398 1.00 133.09 ? 239  DT  J "O3'" 1 
ATOM   4874  C "C2'" . DT  B 1 93  ? 112.596 38.929 -43.583 1.00 123.40 ? 239  DT  J "C2'" 1 
ATOM   4875  C "C1'" . DT  B 1 93  ? 113.336 39.934 -44.444 1.00 121.36 ? 239  DT  J "C1'" 1 
ATOM   4876  N N1    . DT  B 1 93  ? 112.639 41.210 -44.658 1.00 94.93  ? 239  DT  J N1    1 
ATOM   4877  C C2    . DT  B 1 93  ? 113.406 42.330 -44.882 1.00 95.26  ? 239  DT  J C2    1 
ATOM   4878  O O2    . DT  B 1 93  ? 114.627 42.306 -44.902 1.00 96.29  ? 239  DT  J O2    1 
ATOM   4879  N N3    . DT  B 1 93  ? 112.688 43.486 -45.079 1.00 94.51  ? 239  DT  J N3    1 
ATOM   4880  C C4    . DT  B 1 93  ? 111.312 43.626 -45.061 1.00 94.26  ? 239  DT  J C4    1 
ATOM   4881  O O4    . DT  B 1 93  ? 110.807 44.724 -45.253 1.00 93.45  ? 239  DT  J O4    1 
ATOM   4882  C C5    . DT  B 1 93  ? 110.572 42.409 -44.806 1.00 94.54  ? 239  DT  J C5    1 
ATOM   4883  C C7    . DT  B 1 93  ? 109.080 42.466 -44.739 1.00 94.23  ? 239  DT  J C7    1 
ATOM   4884  C C6    . DT  B 1 93  ? 111.263 41.277 -44.632 1.00 94.88  ? 239  DT  J C6    1 
ATOM   4885  P P     . DG  B 1 94  ? 114.543 36.327 -42.192 1.00 114.41 ? 240  DG  J P     1 
ATOM   4886  O OP1   . DG  B 1 94  ? 115.267 35.123 -42.677 1.00 127.70 ? 240  DG  J OP1   1 
ATOM   4887  O OP2   . DG  B 1 94  ? 113.201 36.176 -41.571 1.00 127.51 ? 240  DG  J OP2   1 
ATOM   4888  O "O5'" . DG  B 1 94  ? 115.496 37.061 -41.153 1.00 116.88 ? 240  DG  J "O5'" 1 
ATOM   4889  C "C5'" . DG  B 1 94  ? 116.696 37.676 -41.599 1.00 120.82 ? 240  DG  J "C5'" 1 
ATOM   4890  C "C4'" . DG  B 1 94  ? 116.874 39.021 -40.936 1.00 123.14 ? 240  DG  J "C4'" 1 
ATOM   4891  O "O4'" . DG  B 1 94  ? 115.913 39.988 -41.431 1.00 123.13 ? 240  DG  J "O4'" 1 
ATOM   4892  C "C3'" . DG  B 1 94  ? 116.719 39.014 -39.417 1.00 124.65 ? 240  DG  J "C3'" 1 
ATOM   4893  O "O3'" . DG  B 1 94  ? 117.731 39.841 -38.852 1.00 126.90 ? 240  DG  J "O3'" 1 
ATOM   4894  C "C2'" . DG  B 1 94  ? 115.362 39.659 -39.200 1.00 123.80 ? 240  DG  J "C2'" 1 
ATOM   4895  C "C1'" . DG  B 1 94  ? 115.343 40.671 -40.323 1.00 123.48 ? 240  DG  J "C1'" 1 
ATOM   4896  N N9    . DG  B 1 94  ? 114.019 41.158 -40.705 1.00 136.82 ? 240  DG  J N9    1 
ATOM   4897  C C8    . DG  B 1 94  ? 112.873 40.414 -40.850 1.00 136.59 ? 240  DG  J C8    1 
ATOM   4898  N N7    . DG  B 1 94  ? 111.839 41.128 -41.210 1.00 136.42 ? 240  DG  J N7    1 
ATOM   4899  C C5    . DG  B 1 94  ? 112.329 42.426 -41.307 1.00 136.48 ? 240  DG  J C5    1 
ATOM   4900  C C6    . DG  B 1 94  ? 111.671 43.642 -41.663 1.00 136.58 ? 240  DG  J C6    1 
ATOM   4901  O O6    . DG  B 1 94  ? 110.489 43.817 -41.986 1.00 136.74 ? 240  DG  J O6    1 
ATOM   4902  N N1    . DG  B 1 94  ? 112.540 44.724 -41.620 1.00 136.60 ? 240  DG  J N1    1 
ATOM   4903  C C2    . DG  B 1 94  ? 113.866 44.657 -41.284 1.00 136.41 ? 240  DG  J C2    1 
ATOM   4904  N N2    . DG  B 1 94  ? 114.531 45.819 -41.287 1.00 135.88 ? 240  DG  J N2    1 
ATOM   4905  N N3    . DG  B 1 94  ? 114.495 43.535 -40.963 1.00 136.36 ? 240  DG  J N3    1 
ATOM   4906  C C4    . DG  B 1 94  ? 113.671 42.465 -40.993 1.00 136.56 ? 240  DG  J C4    1 
ATOM   4907  P P     . DA  B 1 95  ? 117.789 40.051 -37.269 1.00 170.90 ? 241  DA  J P     1 
ATOM   4908  O OP1   . DA  B 1 95  ? 119.103 39.540 -36.820 1.00 100.47 ? 241  DA  J OP1   1 
ATOM   4909  O OP2   . DA  B 1 95  ? 116.548 39.509 -36.669 1.00 100.07 ? 241  DA  J OP2   1 
ATOM   4910  O "O5'" . DA  B 1 95  ? 117.767 41.632 -37.111 1.00 171.45 ? 241  DA  J "O5'" 1 
ATOM   4911  C "C5'" . DA  B 1 95  ? 118.736 42.445 -37.763 1.00 172.35 ? 241  DA  J "C5'" 1 
ATOM   4912  C "C4'" . DA  B 1 95  ? 118.553 43.882 -37.344 1.00 173.35 ? 241  DA  J "C4'" 1 
ATOM   4913  O "O4'" . DA  B 1 95  ? 117.309 44.374 -37.898 1.00 173.64 ? 241  DA  J "O4'" 1 
ATOM   4914  C "C3'" . DA  B 1 95  ? 118.428 44.045 -35.830 1.00 173.50 ? 241  DA  J "C3'" 1 
ATOM   4915  O "O3'" . DA  B 1 95  ? 119.008 45.279 -35.407 1.00 172.94 ? 241  DA  J "O3'" 1 
ATOM   4916  C "C2'" . DA  B 1 95  ? 116.929 44.069 -35.606 1.00 173.90 ? 241  DA  J "C2'" 1 
ATOM   4917  C "C1'" . DA  B 1 95  ? 116.450 44.792 -36.848 1.00 174.02 ? 241  DA  J "C1'" 1 
ATOM   4918  N N9    . DA  B 1 95  ? 115.076 44.479 -37.230 1.00 103.28 ? 241  DA  J N9    1 
ATOM   4919  C C8    . DA  B 1 95  ? 114.499 43.246 -37.417 1.00 103.30 ? 241  DA  J C8    1 
ATOM   4920  N N7    . DA  B 1 95  ? 113.230 43.303 -37.741 1.00 103.06 ? 241  DA  J N7    1 
ATOM   4921  C C5    . DA  B 1 95  ? 112.952 44.666 -37.772 1.00 102.93 ? 241  DA  J C5    1 
ATOM   4922  C C6    . DA  B 1 95  ? 111.776 45.391 -38.041 1.00 102.60 ? 241  DA  J C6    1 
ATOM   4923  N N6    . DA  B 1 95  ? 110.610 44.824 -38.350 1.00 101.94 ? 241  DA  J N6    1 
ATOM   4924  N N1    . DA  B 1 95  ? 111.842 46.739 -37.980 1.00 102.49 ? 241  DA  J N1    1 
ATOM   4925  C C2    . DA  B 1 95  ? 113.011 47.311 -37.674 1.00 102.77 ? 241  DA  J C2    1 
ATOM   4926  N N3    . DA  B 1 95  ? 114.181 46.741 -37.402 1.00 102.97 ? 241  DA  J N3    1 
ATOM   4927  C C4    . DA  B 1 95  ? 114.082 45.400 -37.465 1.00 103.16 ? 241  DA  J C4    1 
ATOM   4928  P P     . DT  B 1 96  ? 118.838 45.749 -33.883 1.00 114.12 ? 242  DT  J P     1 
ATOM   4929  O OP1   . DT  B 1 96  ? 120.087 46.433 -33.495 1.00 108.17 ? 242  DT  J OP1   1 
ATOM   4930  O OP2   . DT  B 1 96  ? 118.354 44.593 -33.087 1.00 107.89 ? 242  DT  J OP2   1 
ATOM   4931  O "O5'" . DT  B 1 96  ? 117.682 46.842 -33.943 1.00 113.00 ? 242  DT  J "O5'" 1 
ATOM   4932  C "C5'" . DT  B 1 96  ? 117.843 48.036 -34.705 1.00 111.25 ? 242  DT  J "C5'" 1 
ATOM   4933  C "C4'" . DT  B 1 96  ? 116.810 49.063 -34.301 1.00 109.99 ? 242  DT  J "C4'" 1 
ATOM   4934  O "O4'" . DT  B 1 96  ? 115.489 48.691 -34.772 1.00 110.09 ? 242  DT  J "O4'" 1 
ATOM   4935  C "C3'" . DT  B 1 96  ? 116.671 49.292 -32.795 1.00 108.90 ? 242  DT  J "C3'" 1 
ATOM   4936  O "O3'" . DT  B 1 96  ? 116.470 50.682 -32.547 1.00 106.53 ? 242  DT  J "O3'" 1 
ATOM   4937  C "C2'" . DT  B 1 96  ? 115.399 48.543 -32.440 1.00 109.20 ? 242  DT  J "C2'" 1 
ATOM   4938  C "C1'" . DT  B 1 96  ? 114.564 48.756 -33.692 1.00 109.81 ? 242  DT  J "C1'" 1 
ATOM   4939  N N1    . DT  B 1 96  ? 113.511 47.740 -33.922 1.00 103.84 ? 242  DT  J N1    1 
ATOM   4940  C C2    . DT  B 1 96  ? 112.267 48.167 -34.344 1.00 103.73 ? 242  DT  J C2    1 
ATOM   4941  O O2    . DT  B 1 96  ? 111.988 49.341 -34.532 1.00 103.06 ? 242  DT  J O2    1 
ATOM   4942  N N3    . DT  B 1 96  ? 111.354 47.157 -34.537 1.00 104.11 ? 242  DT  J N3    1 
ATOM   4943  C C4    . DT  B 1 96  ? 111.554 45.796 -34.350 1.00 104.45 ? 242  DT  J C4    1 
ATOM   4944  O O4    . DT  B 1 96  ? 110.638 45.007 -34.564 1.00 104.86 ? 242  DT  J O4    1 
ATOM   4945  C C5    . DT  B 1 96  ? 112.878 45.422 -33.900 1.00 104.48 ? 242  DT  J C5    1 
ATOM   4946  C C7    . DT  B 1 96  ? 113.187 43.977 -33.661 1.00 104.09 ? 242  DT  J C7    1 
ATOM   4947  C C6    . DT  B 1 96  ? 113.775 46.399 -33.715 1.00 104.43 ? 242  DT  J C6    1 
ATOM   4948  P P     . DG  B 1 97  ? 116.975 51.323 -31.169 1.00 122.64 ? 243  DG  J P     1 
ATOM   4949  O OP1   . DG  B 1 97  ? 118.461 51.265 -31.221 1.00 120.04 ? 243  DG  J OP1   1 
ATOM   4950  O OP2   . DG  B 1 97  ? 116.251 50.668 -30.043 1.00 119.24 ? 243  DG  J OP2   1 
ATOM   4951  O "O5'" . DG  B 1 97  ? 116.497 52.843 -31.277 1.00 120.42 ? 243  DG  J "O5'" 1 
ATOM   4952  C "C5'" . DG  B 1 97  ? 115.660 53.432 -30.278 1.00 116.84 ? 243  DG  J "C5'" 1 
ATOM   4953  C "C4'" . DG  B 1 97  ? 114.421 54.020 -30.915 1.00 114.10 ? 243  DG  J "C4'" 1 
ATOM   4954  O "O4'" . DG  B 1 97  ? 113.719 52.968 -31.620 1.00 113.76 ? 243  DG  J "O4'" 1 
ATOM   4955  C "C3'" . DG  B 1 97  ? 113.418 54.595 -29.918 1.00 111.93 ? 243  DG  J "C3'" 1 
ATOM   4956  O "O3'" . DG  B 1 97  ? 112.751 55.741 -30.458 1.00 108.59 ? 243  DG  J "O3'" 1 
ATOM   4957  C "C2'" . DG  B 1 97  ? 112.444 53.451 -29.696 1.00 112.35 ? 243  DG  J "C2'" 1 
ATOM   4958  C "C1'" . DG  B 1 97  ? 112.446 52.724 -31.032 1.00 112.50 ? 243  DG  J "C1'" 1 
ATOM   4959  N N9    . DG  B 1 97  ? 112.287 51.276 -30.906 1.00 108.97 ? 243  DG  J N9    1 
ATOM   4960  C C8    . DG  B 1 97  ? 113.180 50.391 -30.345 1.00 108.93 ? 243  DG  J C8    1 
ATOM   4961  N N7    . DG  B 1 97  ? 112.774 49.151 -30.388 1.00 108.33 ? 243  DG  J N7    1 
ATOM   4962  C C5    . DG  B 1 97  ? 111.537 49.218 -31.015 1.00 108.90 ? 243  DG  J C5    1 
ATOM   4963  C C6    . DG  B 1 97  ? 110.626 48.186 -31.356 1.00 108.30 ? 243  DG  J C6    1 
ATOM   4964  O O6    . DG  B 1 97  ? 110.737 46.966 -31.168 1.00 108.37 ? 243  DG  J O6    1 
ATOM   4965  N N1    . DG  B 1 97  ? 109.489 48.695 -31.983 1.00 108.10 ? 243  DG  J N1    1 
ATOM   4966  C C2    . DG  B 1 97  ? 109.260 50.026 -32.247 1.00 107.70 ? 243  DG  J C2    1 
ATOM   4967  N N2    . DG  B 1 97  ? 108.103 50.317 -32.843 1.00 106.61 ? 243  DG  J N2    1 
ATOM   4968  N N3    . DG  B 1 97  ? 110.106 50.997 -31.944 1.00 108.64 ? 243  DG  J N3    1 
ATOM   4969  C C4    . DG  B 1 97  ? 111.217 50.525 -31.334 1.00 109.16 ? 243  DG  J C4    1 
ATOM   4970  P P     . DG  B 1 98  ? 111.866 56.674 -29.488 1.00 116.82 ? 244  DG  J P     1 
ATOM   4971  O OP1   . DG  B 1 98  ? 111.735 58.025 -30.094 1.00 101.56 ? 244  DG  J OP1   1 
ATOM   4972  O OP2   . DG  B 1 98  ? 112.397 56.536 -28.109 1.00 102.76 ? 244  DG  J OP2   1 
ATOM   4973  O "O5'" . DG  B 1 98  ? 110.432 55.990 -29.497 1.00 115.19 ? 244  DG  J "O5'" 1 
ATOM   4974  C "C5'" . DG  B 1 98  ? 109.548 56.175 -30.595 1.00 111.66 ? 244  DG  J "C5'" 1 
ATOM   4975  C "C4'" . DG  B 1 98  ? 108.209 55.549 -30.291 1.00 108.66 ? 244  DG  J "C4'" 1 
ATOM   4976  O "O4'" . DG  B 1 98  ? 108.331 54.107 -30.242 1.00 107.89 ? 244  DG  J "O4'" 1 
ATOM   4977  C "C3'" . DG  B 1 98  ? 107.637 55.961 -28.936 1.00 107.07 ? 244  DG  J "C3'" 1 
ATOM   4978  O "O3'" . DG  B 1 98  ? 106.223 56.027 -29.036 1.00 104.60 ? 244  DG  J "O3'" 1 
ATOM   4979  C "C2'" . DG  B 1 98  ? 108.005 54.795 -28.045 1.00 106.93 ? 244  DG  J "C2'" 1 
ATOM   4980  C "C1'" . DG  B 1 98  ? 107.811 53.653 -29.007 1.00 107.16 ? 244  DG  J "C1'" 1 
ATOM   4981  N N9    . DG  B 1 98  ? 108.510 52.435 -28.646 1.00 92.58  ? 244  DG  J N9    1 
ATOM   4982  C C8    . DG  B 1 98  ? 109.648 52.315 -27.892 1.00 92.69  ? 244  DG  J C8    1 
ATOM   4983  N N7    . DG  B 1 98  ? 110.020 51.076 -27.722 1.00 92.87  ? 244  DG  J N7    1 
ATOM   4984  C C5    . DG  B 1 98  ? 109.069 50.339 -28.414 1.00 92.20  ? 244  DG  J C5    1 
ATOM   4985  C C6    . DG  B 1 98  ? 108.945 48.944 -28.592 1.00 91.76  ? 244  DG  J C6    1 
ATOM   4986  O O6    . DG  B 1 98  ? 109.672 48.047 -28.161 1.00 89.76  ? 244  DG  J O6    1 
ATOM   4987  N N1    . DG  B 1 98  ? 107.836 48.626 -29.369 1.00 91.66  ? 244  DG  J N1    1 
ATOM   4988  C C2    . DG  B 1 98  ? 106.962 49.537 -29.911 1.00 91.94  ? 244  DG  J C2    1 
ATOM   4989  N N2    . DG  B 1 98  ? 105.961 49.034 -30.642 1.00 91.31  ? 244  DG  J N2    1 
ATOM   4990  N N3    . DG  B 1 98  ? 107.066 50.841 -29.750 1.00 91.62  ? 244  DG  J N3    1 
ATOM   4991  C C4    . DG  B 1 98  ? 108.136 51.168 -28.994 1.00 92.70  ? 244  DG  J C4    1 
ATOM   4992  P P     . DA  B 1 99  ? 105.532 57.427 -29.350 1.00 93.35  ? 245  DA  J P     1 
ATOM   4993  O OP1   . DA  B 1 99  ? 106.243 58.008 -30.519 1.00 87.40  ? 245  DA  J OP1   1 
ATOM   4994  O OP2   . DA  B 1 99  ? 105.474 58.171 -28.070 1.00 86.54  ? 245  DA  J OP2   1 
ATOM   4995  O "O5'" . DA  B 1 99  ? 104.058 57.031 -29.795 1.00 91.28  ? 245  DA  J "O5'" 1 
ATOM   4996  C "C5'" . DA  B 1 99  ? 103.830 56.422 -31.061 1.00 88.12  ? 245  DA  J "C5'" 1 
ATOM   4997  C "C4'" . DA  B 1 99  ? 102.886 55.251 -30.918 1.00 86.10  ? 245  DA  J "C4'" 1 
ATOM   4998  O "O4'" . DA  B 1 99  ? 103.519 54.165 -30.197 1.00 85.02  ? 245  DA  J "O4'" 1 
ATOM   4999  C "C3'" . DA  B 1 99  ? 101.599 55.565 -30.157 1.00 83.58  ? 245  DA  J "C3'" 1 
ATOM   5000  O "O3'" . DA  B 1 99  ? 100.521 54.831 -30.738 1.00 82.50  ? 245  DA  J "O3'" 1 
ATOM   5001  C "C2'" . DA  B 1 99  ? 101.885 55.038 -28.764 1.00 83.77  ? 245  DA  J "C2'" 1 
ATOM   5002  C "C1'" . DA  B 1 99  ? 102.721 53.810 -29.073 1.00 84.78  ? 245  DA  J "C1'" 1 
ATOM   5003  N N9    . DA  B 1 99  ? 103.623 53.400 -28.001 1.00 79.36  ? 245  DA  J N9    1 
ATOM   5004  C C8    . DA  B 1 99  ? 104.321 54.213 -27.144 1.00 79.65  ? 245  DA  J C8    1 
ATOM   5005  N N7    . DA  B 1 99  ? 105.099 53.560 -26.315 1.00 80.94  ? 245  DA  J N7    1 
ATOM   5006  C C5    . DA  B 1 99  ? 104.895 52.226 -26.645 1.00 80.81  ? 245  DA  J C5    1 
ATOM   5007  C C6    . DA  B 1 99  ? 105.444 51.040 -26.145 1.00 81.32  ? 245  DA  J C6    1 
ATOM   5008  N N6    . DA  B 1 99  ? 106.361 51.009 -25.177 1.00 83.99  ? 245  DA  J N6    1 
ATOM   5009  N N1    . DA  B 1 99  ? 105.021 49.875 -26.681 1.00 80.92  ? 245  DA  J N1    1 
ATOM   5010  C C2    . DA  B 1 99  ? 104.113 49.917 -27.658 1.00 79.54  ? 245  DA  J C2    1 
ATOM   5011  N N3    . DA  B 1 99  ? 103.529 50.970 -28.221 1.00 79.39  ? 245  DA  J N3    1 
ATOM   5012  C C4    . DA  B 1 99  ? 103.971 52.111 -27.665 1.00 80.46  ? 245  DA  J C4    1 
ATOM   5013  P P     . DG  B 1 100 ? 99.060  55.482 -30.797 1.00 69.66  ? 246  DG  J P     1 
ATOM   5014  O OP1   . DG  B 1 100 ? 98.925  56.331 -32.011 1.00 77.69  ? 246  DG  J OP1   1 
ATOM   5015  O OP2   . DG  B 1 100 ? 98.774  56.055 -29.452 1.00 76.37  ? 246  DG  J OP2   1 
ATOM   5016  O "O5'" . DG  B 1 100 ? 98.112  54.225 -30.950 1.00 67.71  ? 246  DG  J "O5'" 1 
ATOM   5017  C "C5'" . DG  B 1 100 ? 97.252  53.871 -29.881 1.00 64.12  ? 246  DG  J "C5'" 1 
ATOM   5018  C "C4'" . DG  B 1 100 ? 97.616  52.510 -29.340 1.00 59.82  ? 246  DG  J "C4'" 1 
ATOM   5019  O "O4'" . DG  B 1 100 ? 98.919  52.521 -28.705 1.00 61.01  ? 246  DG  J "O4'" 1 
ATOM   5020  C "C3'" . DG  B 1 100 ? 96.642  52.042 -28.271 1.00 56.98  ? 246  DG  J "C3'" 1 
ATOM   5021  O "O3'" . DG  B 1 100 ? 96.325  50.683 -28.488 1.00 52.95  ? 246  DG  J "O3'" 1 
ATOM   5022  C "C2'" . DG  B 1 100 ? 97.418  52.192 -26.986 1.00 59.23  ? 246  DG  J "C2'" 1 
ATOM   5023  C "C1'" . DG  B 1 100 ? 98.811  51.874 -27.447 1.00 60.37  ? 246  DG  J "C1'" 1 
ATOM   5024  N N9    . DG  B 1 100 ? 99.857  52.381 -26.563 1.00 66.91  ? 246  DG  J N9    1 
ATOM   5025  C C8    . DG  B 1 100 ? 100.174 53.695 -26.308 1.00 66.91  ? 246  DG  J C8    1 
ATOM   5026  N N7    . DG  B 1 100 ? 101.155 53.830 -25.461 1.00 67.08  ? 246  DG  J N7    1 
ATOM   5027  C C5    . DG  B 1 100 ? 101.511 52.529 -25.142 1.00 68.02  ? 246  DG  J C5    1 
ATOM   5028  C C6    . DG  B 1 100 ? 102.519 52.041 -24.274 1.00 68.26  ? 246  DG  J C6    1 
ATOM   5029  O O6    . DG  B 1 100 ? 103.331 52.687 -23.582 1.00 71.07  ? 246  DG  J O6    1 
ATOM   5030  N N1    . DG  B 1 100 ? 102.536 50.650 -24.248 1.00 67.70  ? 246  DG  J N1    1 
ATOM   5031  C C2    . DG  B 1 100 ? 101.692 49.837 -24.961 1.00 67.47  ? 246  DG  J C2    1 
ATOM   5032  N N2    . DG  B 1 100 ? 101.876 48.519 -24.810 1.00 65.12  ? 246  DG  J N2    1 
ATOM   5033  N N3    . DG  B 1 100 ? 100.745 50.282 -25.764 1.00 65.29  ? 246  DG  J N3    1 
ATOM   5034  C C4    . DG  B 1 100 ? 100.715 51.626 -25.810 1.00 67.12  ? 246  DG  J C4    1 
ATOM   5035  P P     . DC  B 1 101 ? 94.800  50.271 -28.664 1.00 54.04  ? 247  DC  J P     1 
ATOM   5036  O OP1   . DC  B 1 101 ? 94.348  50.927 -29.913 1.00 41.72  ? 247  DC  J OP1   1 
ATOM   5037  O OP2   . DC  B 1 101 ? 94.077  50.505 -27.385 1.00 41.38  ? 247  DC  J OP2   1 
ATOM   5038  O "O5'" . DC  B 1 101 ? 94.863  48.713 -28.907 1.00 58.38  ? 247  DC  J "O5'" 1 
ATOM   5039  C "C5'" . DC  B 1 101 ? 96.089  48.080 -29.214 1.00 60.26  ? 247  DC  J "C5'" 1 
ATOM   5040  C "C4'" . DC  B 1 101 ? 96.433  47.105 -28.119 1.00 64.00  ? 247  DC  J "C4'" 1 
ATOM   5041  O "O4'" . DC  B 1 101 ? 97.270  47.732 -27.123 1.00 64.28  ? 247  DC  J "O4'" 1 
ATOM   5042  C "C3'" . DC  B 1 101 ? 95.212  46.573 -27.367 1.00 65.06  ? 247  DC  J "C3'" 1 
ATOM   5043  O "O3'" . DC  B 1 101 ? 95.430  45.193 -27.073 1.00 64.89  ? 247  DC  J "O3'" 1 
ATOM   5044  C "C2'" . DC  B 1 101 ? 95.206  47.404 -26.092 1.00 64.31  ? 247  DC  J "C2'" 1 
ATOM   5045  C "C1'" . DC  B 1 101 ? 96.696  47.523 -25.839 1.00 64.49  ? 247  DC  J "C1'" 1 
ATOM   5046  N N1    . DC  B 1 101 ? 97.155  48.611 -24.959 1.00 53.09  ? 247  DC  J N1    1 
ATOM   5047  C C2    . DC  B 1 101 ? 98.246  48.371 -24.125 1.00 53.62  ? 247  DC  J C2    1 
ATOM   5048  O O2    . DC  B 1 101 ? 98.705  47.221 -24.063 1.00 52.17  ? 247  DC  J O2    1 
ATOM   5049  N N3    . DC  B 1 101 ? 98.765  49.393 -23.404 1.00 54.17  ? 247  DC  J N3    1 
ATOM   5050  C C4    . DC  B 1 101 ? 98.216  50.607 -23.481 1.00 55.64  ? 247  DC  J C4    1 
ATOM   5051  N N4    . DC  B 1 101 ? 98.789  51.603 -22.798 1.00 57.79  ? 247  DC  J N4    1 
ATOM   5052  C C5    . DC  B 1 101 ? 97.060  50.859 -24.271 1.00 54.59  ? 247  DC  J C5    1 
ATOM   5053  C C6    . DC  B 1 101 ? 96.564  49.842 -24.984 1.00 54.56  ? 247  DC  J C6    1 
ATOM   5054  P P     . DA  B 1 102 ? 94.359  44.379 -26.198 1.00 69.90  ? 248  DA  J P     1 
ATOM   5055  O OP1   . DA  B 1 102 ? 93.638  43.438 -27.091 1.00 72.31  ? 248  DA  J OP1   1 
ATOM   5056  O OP2   . DA  B 1 102 ? 93.583  45.323 -25.327 1.00 70.67  ? 248  DA  J OP2   1 
ATOM   5057  O "O5'" . DA  B 1 102 ? 95.271  43.492 -25.254 1.00 71.90  ? 248  DA  J "O5'" 1 
ATOM   5058  C "C5'" . DA  B 1 102 ? 94.771  43.086 -24.001 1.00 76.71  ? 248  DA  J "C5'" 1 
ATOM   5059  C "C4'" . DA  B 1 102 ? 95.772  43.368 -22.907 1.00 79.25  ? 248  DA  J "C4'" 1 
ATOM   5060  O "O4'" . DA  B 1 102 ? 96.237  44.740 -22.945 1.00 79.18  ? 248  DA  J "O4'" 1 
ATOM   5061  C "C3'" . DA  B 1 102 ? 95.142  43.178 -21.536 1.00 81.21  ? 248  DA  J "C3'" 1 
ATOM   5062  O "O3'" . DA  B 1 102 ? 96.045  42.514 -20.679 1.00 85.32  ? 248  DA  J "O3'" 1 
ATOM   5063  C "C2'" . DA  B 1 102 ? 94.872  44.590 -21.058 1.00 80.09  ? 248  DA  J "C2'" 1 
ATOM   5064  C "C1'" . DA  B 1 102 ? 96.009  45.358 -21.689 1.00 80.34  ? 248  DA  J "C1'" 1 
ATOM   5065  N N9    . DA  B 1 102 ? 95.670  46.754 -21.930 1.00 80.36  ? 248  DA  J N9    1 
ATOM   5066  C C8    . DA  B 1 102 ? 94.680  47.238 -22.741 1.00 79.63  ? 248  DA  J C8    1 
ATOM   5067  N N7    . DA  B 1 102 ? 94.575  48.542 -22.724 1.00 79.37  ? 248  DA  J N7    1 
ATOM   5068  C C5    . DA  B 1 102 ? 95.570  48.943 -21.847 1.00 80.24  ? 248  DA  J C5    1 
ATOM   5069  C C6    . DA  B 1 102 ? 95.961  50.200 -21.391 1.00 80.53  ? 248  DA  J C6    1 
ATOM   5070  N N6    . DA  B 1 102 ? 95.361  51.331 -21.765 1.00 78.59  ? 248  DA  J N6    1 
ATOM   5071  N N1    . DA  B 1 102 ? 96.997  50.262 -20.529 1.00 80.70  ? 248  DA  J N1    1 
ATOM   5072  C C2    . DA  B 1 102 ? 97.584  49.122 -20.154 1.00 80.82  ? 248  DA  J C2    1 
ATOM   5073  N N3    . DA  B 1 102 ? 97.296  47.875 -20.506 1.00 81.04  ? 248  DA  J N3    1 
ATOM   5074  C C4    . DA  B 1 102 ? 96.265  47.854 -21.364 1.00 80.69  ? 248  DA  J C4    1 
ATOM   5075  P P     . DG  B 1 103 ? 95.465  41.623 -19.493 1.00 85.42  ? 249  DG  J P     1 
ATOM   5076  O OP1   . DG  B 1 103 ? 95.982  40.233 -19.667 1.00 95.44  ? 249  DG  J OP1   1 
ATOM   5077  O OP2   . DG  B 1 103 ? 94.003  41.867 -19.429 1.00 93.71  ? 249  DG  J OP2   1 
ATOM   5078  O "O5'" . DG  B 1 103 ? 96.113  42.282 -18.205 1.00 86.91  ? 249  DG  J "O5'" 1 
ATOM   5079  C "C5'" . DG  B 1 103 ? 97.513  42.242 -18.002 1.00 89.18  ? 249  DG  J "C5'" 1 
ATOM   5080  C "C4'" . DG  B 1 103 ? 97.834  42.892 -16.685 1.00 90.18  ? 249  DG  J "C4'" 1 
ATOM   5081  O "O4'" . DG  B 1 103 ? 97.695  44.323 -16.825 1.00 90.54  ? 249  DG  J "O4'" 1 
ATOM   5082  C "C3'" . DG  B 1 103 ? 96.852  42.479 -15.597 1.00 91.91  ? 249  DG  J "C3'" 1 
ATOM   5083  O "O3'" . DG  B 1 103 ? 97.532  42.354 -14.347 1.00 95.19  ? 249  DG  J "O3'" 1 
ATOM   5084  C "C2'" . DG  B 1 103 ? 95.822  43.596 -15.607 1.00 90.44  ? 249  DG  J "C2'" 1 
ATOM   5085  C "C1'" . DG  B 1 103 ? 96.627  44.812 -16.026 1.00 90.80  ? 249  DG  J "C1'" 1 
ATOM   5086  N N9    . DG  B 1 103 ? 95.878  45.754 -16.848 1.00 99.44  ? 249  DG  J N9    1 
ATOM   5087  C C8    . DG  B 1 103 ? 95.046  45.441 -17.893 1.00 99.53  ? 249  DG  J C8    1 
ATOM   5088  N N7    . DG  B 1 103 ? 94.536  46.490 -18.476 1.00 99.63  ? 249  DG  J N7    1 
ATOM   5089  C C5    . DG  B 1 103 ? 95.052  47.562 -17.764 1.00 99.41  ? 249  DG  J C5    1 
ATOM   5090  C C6    . DG  B 1 103 ? 94.854  48.951 -17.936 1.00 99.31  ? 249  DG  J C6    1 
ATOM   5091  O O6    . DG  B 1 103 ? 94.162  49.531 -18.779 1.00 99.29  ? 249  DG  J O6    1 
ATOM   5092  N N1    . DG  B 1 103 ? 95.565  49.687 -16.999 1.00 99.66  ? 249  DG  J N1    1 
ATOM   5093  C C2    . DG  B 1 103 ? 96.371  49.156 -16.026 1.00 99.38  ? 249  DG  J C2    1 
ATOM   5094  N N2    . DG  B 1 103 ? 96.977  50.038 -15.226 1.00 98.78  ? 249  DG  J N2    1 
ATOM   5095  N N3    . DG  B 1 103 ? 96.567  47.858 -15.854 1.00 98.67  ? 249  DG  J N3    1 
ATOM   5096  C C4    . DG  B 1 103 ? 95.880  47.125 -16.752 1.00 99.45  ? 249  DG  J C4    1 
ATOM   5097  P P     . DT  B 1 104 ? 96.702  42.407 -12.976 1.00 94.63  ? 250  DT  J P     1 
ATOM   5098  O OP1   . DT  B 1 104 ? 97.604  41.835 -11.956 1.00 78.59  ? 250  DT  J OP1   1 
ATOM   5099  O OP2   . DT  B 1 104 ? 95.340  41.831 -13.161 1.00 79.49  ? 250  DT  J OP2   1 
ATOM   5100  O "O5'" . DT  B 1 104 ? 96.586  43.965 -12.690 1.00 96.86  ? 250  DT  J "O5'" 1 
ATOM   5101  C "C5'" . DT  B 1 104 ? 97.753  44.715 -12.376 1.00 100.13 ? 250  DT  J "C5'" 1 
ATOM   5102  C "C4'" . DT  B 1 104 ? 97.438  45.712 -11.293 1.00 102.91 ? 250  DT  J "C4'" 1 
ATOM   5103  O "O4'" . DT  B 1 104 ? 96.876  46.902 -11.882 1.00 102.78 ? 250  DT  J "O4'" 1 
ATOM   5104  C "C3'" . DT  B 1 104 ? 96.401  45.195 -10.300 1.00 104.80 ? 250  DT  J "C3'" 1 
ATOM   5105  O "O3'" . DT  B 1 104 ? 96.722  45.654 -8.985  1.00 109.29 ? 250  DT  J "O3'" 1 
ATOM   5106  C "C2'" . DT  B 1 104 ? 95.102  45.785 -10.820 1.00 103.89 ? 250  DT  J "C2'" 1 
ATOM   5107  C "C1'" . DT  B 1 104 ? 95.556  47.110 -11.408 1.00 102.84 ? 250  DT  J "C1'" 1 
ATOM   5108  N N1    . DT  B 1 104 ? 94.757  47.592 -12.547 1.00 86.35  ? 250  DT  J N1    1 
ATOM   5109  C C2    . DT  B 1 104 ? 94.844  48.925 -12.862 1.00 86.27  ? 250  DT  J C2    1 
ATOM   5110  O O2    . DT  B 1 104 ? 95.530  49.709 -12.232 1.00 86.51  ? 250  DT  J O2    1 
ATOM   5111  N N3    . DT  B 1 104 ? 94.096  49.308 -13.945 1.00 85.82  ? 250  DT  J N3    1 
ATOM   5112  C C4    . DT  B 1 104 ? 93.290  48.508 -14.719 1.00 85.51  ? 250  DT  J C4    1 
ATOM   5113  O O4    . DT  B 1 104 ? 92.690  48.988 -15.662 1.00 85.50  ? 250  DT  J O4    1 
ATOM   5114  C C5    . DT  B 1 104 ? 93.236  47.122 -14.327 1.00 85.48  ? 250  DT  J C5    1 
ATOM   5115  C C7    . DT  B 1 104 ? 92.376  46.182 -15.107 1.00 85.67  ? 250  DT  J C7    1 
ATOM   5116  C C6    . DT  B 1 104 ? 93.963  46.736 -13.275 1.00 85.65  ? 250  DT  J C6    1 
ATOM   5117  P P     . DT  B 1 105 ? 95.590  45.672 -7.853  1.00 129.23 ? 251  DT  J P     1 
ATOM   5118  O OP1   . DT  B 1 105 ? 96.229  45.377 -6.546  1.00 106.24 ? 251  DT  J OP1   1 
ATOM   5119  O OP2   . DT  B 1 105 ? 94.461  44.828 -8.326  1.00 106.02 ? 251  DT  J OP2   1 
ATOM   5120  O "O5'" . DT  B 1 105 ? 95.117  47.190 -7.852  1.00 130.28 ? 251  DT  J "O5'" 1 
ATOM   5121  C "C5'" . DT  B 1 105 ? 96.073  48.244 -7.846  1.00 131.32 ? 251  DT  J "C5'" 1 
ATOM   5122  C "C4'" . DT  B 1 105 ? 95.380  49.564 -7.616  1.00 132.00 ? 251  DT  J "C4'" 1 
ATOM   5123  O "O4'" . DT  B 1 105 ? 94.694  49.983 -8.822  1.00 131.94 ? 251  DT  J "O4'" 1 
ATOM   5124  C "C3'" . DT  B 1 105 ? 94.317  49.500 -6.518  1.00 132.40 ? 251  DT  J "C3'" 1 
ATOM   5125  O "O3'" . DT  B 1 105 ? 94.347  50.699 -5.736  1.00 132.34 ? 251  DT  J "O3'" 1 
ATOM   5126  C "C2'" . DT  B 1 105 ? 93.020  49.393 -7.299  1.00 132.16 ? 251  DT  J "C2'" 1 
ATOM   5127  C "C1'" . DT  B 1 105 ? 93.327  50.226 -8.532  1.00 132.16 ? 251  DT  J "C1'" 1 
ATOM   5128  N N1    . DT  B 1 105 ? 92.523  49.888 -9.731  1.00 107.97 ? 251  DT  J N1    1 
ATOM   5129  C C2    . DT  B 1 105 ? 92.024  50.924 -10.489 1.00 107.60 ? 251  DT  J C2    1 
ATOM   5130  O O2    . DT  B 1 105 ? 92.216  52.095 -10.219 1.00 107.45 ? 251  DT  J O2    1 
ATOM   5131  N N3    . DT  B 1 105 ? 91.281  50.534 -11.578 1.00 107.29 ? 251  DT  J N3    1 
ATOM   5132  C C4    . DT  B 1 105 ? 90.990  49.241 -11.969 1.00 107.31 ? 251  DT  J C4    1 
ATOM   5133  O O4    . DT  B 1 105 ? 90.313  49.041 -12.968 1.00 106.74 ? 251  DT  J O4    1 
ATOM   5134  C C5    . DT  B 1 105 ? 91.536  48.208 -11.129 1.00 107.50 ? 251  DT  J C5    1 
ATOM   5135  C C7    . DT  B 1 105 ? 91.251  46.781 -11.468 1.00 107.46 ? 251  DT  J C7    1 
ATOM   5136  C C6    . DT  B 1 105 ? 92.273  48.574 -10.071 1.00 107.76 ? 251  DT  J C6    1 
ATOM   5137  P P     . DT  B 1 106 ? 93.376  50.851 -4.459  1.00 105.71 ? 252  DT  J P     1 
ATOM   5138  O OP1   . DT  B 1 106 ? 94.211  51.161 -3.272  1.00 102.72 ? 252  DT  J OP1   1 
ATOM   5139  O OP2   . DT  B 1 106 ? 92.450  49.680 -4.424  1.00 102.15 ? 252  DT  J OP2   1 
ATOM   5140  O "O5'" . DT  B 1 106 ? 92.531  52.148 -4.816  1.00 105.45 ? 252  DT  J "O5'" 1 
ATOM   5141  C "C5'" . DT  B 1 106 ? 93.117  53.207 -5.569  1.00 104.54 ? 252  DT  J "C5'" 1 
ATOM   5142  C "C4'" . DT  B 1 106 ? 92.033  54.068 -6.170  1.00 103.59 ? 252  DT  J "C4'" 1 
ATOM   5143  O "O4'" . DT  B 1 106 ? 91.471  53.455 -7.360  1.00 102.91 ? 252  DT  J "O4'" 1 
ATOM   5144  C "C3'" . DT  B 1 106 ? 90.861  54.299 -5.218  1.00 102.91 ? 252  DT  J "C3'" 1 
ATOM   5145  O "O3'" . DT  B 1 106 ? 90.428  55.652 -5.296  1.00 101.96 ? 252  DT  J "O3'" 1 
ATOM   5146  C "C2'" . DT  B 1 106 ? 89.781  53.373 -5.750  1.00 102.93 ? 252  DT  J "C2'" 1 
ATOM   5147  C "C1'" . DT  B 1 106 ? 90.056  53.414 -7.240  1.00 102.77 ? 252  DT  J "C1'" 1 
ATOM   5148  N N1    . DT  B 1 106 ? 89.556  52.256 -8.013  1.00 99.54  ? 252  DT  J N1    1 
ATOM   5149  C C2    . DT  B 1 106 ? 88.870  52.517 -9.175  1.00 99.34  ? 252  DT  J C2    1 
ATOM   5150  O O2    . DT  B 1 106 ? 88.639  53.648 -9.562  1.00 99.57  ? 252  DT  J O2    1 
ATOM   5151  N N3    . DT  B 1 106 ? 88.458  51.403 -9.867  1.00 99.00  ? 252  DT  J N3    1 
ATOM   5152  C C4    . DT  B 1 106 ? 88.655  50.084 -9.514  1.00 98.59  ? 252  DT  J C4    1 
ATOM   5153  O O4    . DT  B 1 106 ? 88.237  49.190 -10.241 1.00 97.89  ? 252  DT  J O4    1 
ATOM   5154  C C5    . DT  B 1 106 ? 89.370  49.882 -8.267  1.00 98.79  ? 252  DT  J C5    1 
ATOM   5155  C C7    . DT  B 1 106 ? 89.626  48.487 -7.791  1.00 98.57  ? 252  DT  J C7    1 
ATOM   5156  C C6    . DT  B 1 106 ? 89.777  50.964 -7.590  1.00 99.29  ? 252  DT  J C6    1 
ATOM   5157  P P     . DC  B 1 107 ? 89.516  56.247 -4.128  1.00 128.02 ? 253  DC  J P     1 
ATOM   5158  O OP1   . DC  B 1 107 ? 89.889  57.675 -3.959  1.00 102.15 ? 253  DC  J OP1   1 
ATOM   5159  O OP2   . DC  B 1 107 ? 89.593  55.313 -2.975  1.00 101.57 ? 253  DC  J OP2   1 
ATOM   5160  O "O5'" . DC  B 1 107 ? 88.049  56.179 -4.726  1.00 127.19 ? 253  DC  J "O5'" 1 
ATOM   5161  C "C5'" . DC  B 1 107 ? 87.644  57.078 -5.746  1.00 124.17 ? 253  DC  J "C5'" 1 
ATOM   5162  C "C4'" . DC  B 1 107 ? 86.199  56.827 -6.094  1.00 122.52 ? 253  DC  J "C4'" 1 
ATOM   5163  O "O4'" . DC  B 1 107 ? 86.087  55.579 -6.814  1.00 121.83 ? 253  DC  J "O4'" 1 
ATOM   5164  C "C3'" . DC  B 1 107 ? 85.289  56.696 -4.871  1.00 121.33 ? 253  DC  J "C3'" 1 
ATOM   5165  O "O3'" . DC  B 1 107 ? 84.032  57.294 -5.168  1.00 119.82 ? 253  DC  J "O3'" 1 
ATOM   5166  C "C2'" . DC  B 1 107 ? 85.128  55.195 -4.717  1.00 121.09 ? 253  DC  J "C2'" 1 
ATOM   5167  C "C1'" . DC  B 1 107 ? 85.137  54.757 -6.168  1.00 120.92 ? 253  DC  J "C1'" 1 
ATOM   5168  N N1    . DC  B 1 107 ? 85.507  53.362 -6.418  1.00 93.01  ? 253  DC  J N1    1 
ATOM   5169  C C2    . DC  B 1 107 ? 84.881  52.701 -7.462  1.00 92.94  ? 253  DC  J C2    1 
ATOM   5170  O O2    . DC  B 1 107 ? 84.061  53.327 -8.147  1.00 92.62  ? 253  DC  J O2    1 
ATOM   5171  N N3    . DC  B 1 107 ? 85.180  51.406 -7.706  1.00 92.33  ? 253  DC  J N3    1 
ATOM   5172  C C4    . DC  B 1 107 ? 86.078  50.779 -6.948  1.00 92.45  ? 253  DC  J C4    1 
ATOM   5173  N N4    . DC  B 1 107 ? 86.335  49.494 -7.212  1.00 91.73  ? 253  DC  J N4    1 
ATOM   5174  C C5    . DC  B 1 107 ? 86.750  51.440 -5.880  1.00 92.71  ? 253  DC  J C5    1 
ATOM   5175  C C6    . DC  B 1 107 ? 86.435  52.721 -5.651  1.00 93.07  ? 253  DC  J C6    1 
ATOM   5176  P P     . DC  B 1 108 ? 83.833  58.866 -4.925  1.00 102.67 ? 254  DC  J P     1 
ATOM   5177  O OP1   . DC  B 1 108 ? 85.077  59.550 -5.371  1.00 95.20  ? 254  DC  J OP1   1 
ATOM   5178  O OP2   . DC  B 1 108 ? 83.341  59.039 -3.537  1.00 94.73  ? 254  DC  J OP2   1 
ATOM   5179  O "O5'" . DC  B 1 108 ? 82.671  59.280 -5.928  1.00 100.88 ? 254  DC  J "O5'" 1 
ATOM   5180  C "C5'" . DC  B 1 108 ? 82.946  59.495 -7.309  1.00 97.27  ? 254  DC  J "C5'" 1 
ATOM   5181  C "C4'" . DC  B 1 108 ? 81.872  58.853 -8.155  1.00 95.49  ? 254  DC  J "C4'" 1 
ATOM   5182  O "O4'" . DC  B 1 108 ? 82.043  57.413 -8.224  1.00 94.09  ? 254  DC  J "O4'" 1 
ATOM   5183  C "C3'" . DC  B 1 108 ? 80.456  59.079 -7.627  1.00 94.52  ? 254  DC  J "C3'" 1 
ATOM   5184  O "O3'" . DC  B 1 108 ? 79.578  59.229 -8.736  1.00 93.43  ? 254  DC  J "O3'" 1 
ATOM   5185  C "C2'" . DC  B 1 108 ? 80.142  57.772 -6.921  1.00 94.07  ? 254  DC  J "C2'" 1 
ATOM   5186  C "C1'" . DC  B 1 108 ? 80.822  56.792 -7.851  1.00 93.89  ? 254  DC  J "C1'" 1 
ATOM   5187  N N1    . DC  B 1 108 ? 81.116  55.460 -7.299  1.00 84.71  ? 254  DC  J N1    1 
ATOM   5188  C C2    . DC  B 1 108 ? 80.682  54.348 -8.013  1.00 84.09  ? 254  DC  J C2    1 
ATOM   5189  O O2    . DC  B 1 108 ? 80.106  54.523 -9.099  1.00 81.94  ? 254  DC  J O2    1 
ATOM   5190  N N3    . DC  B 1 108 ? 80.902  53.114 -7.520  1.00 83.83  ? 254  DC  J N3    1 
ATOM   5191  C C4    . DC  B 1 108 ? 81.551  52.966 -6.372  1.00 84.42  ? 254  DC  J C4    1 
ATOM   5192  N N4    . DC  B 1 108 ? 81.752  51.722 -5.933  1.00 84.47  ? 254  DC  J N4    1 
ATOM   5193  C C5    . DC  B 1 108 ? 82.026  54.084 -5.627  1.00 84.68  ? 254  DC  J C5    1 
ATOM   5194  C C6    . DC  B 1 108 ? 81.786  55.303 -6.122  1.00 84.79  ? 254  DC  J C6    1 
ATOM   5195  P P     . DA  B 1 109 ? 78.583  60.481 -8.803  1.00 84.99  ? 255  DA  J P     1 
ATOM   5196  O OP1   . DA  B 1 109 ? 79.430  61.695 -8.816  1.00 61.48  ? 255  DA  J OP1   1 
ATOM   5197  O OP2   . DA  B 1 109 ? 77.517  60.315 -7.772  1.00 59.82  ? 255  DA  J OP2   1 
ATOM   5198  O "O5'" . DA  B 1 109 ? 77.915  60.343 -10.238 1.00 83.17  ? 255  DA  J "O5'" 1 
ATOM   5199  C "C5'" . DA  B 1 109 ? 78.703  60.015 -11.379 1.00 78.61  ? 255  DA  J "C5'" 1 
ATOM   5200  C "C4'" . DA  B 1 109 ? 78.059  58.885 -12.150 1.00 75.29  ? 255  DA  J "C4'" 1 
ATOM   5201  O "O4'" . DA  B 1 109 ? 78.252  57.616 -11.474 1.00 73.67  ? 255  DA  J "O4'" 1 
ATOM   5202  C "C3'" . DA  B 1 109 ? 76.555  59.047 -12.328 1.00 73.91  ? 255  DA  J "C3'" 1 
ATOM   5203  O "O3'" . DA  B 1 109 ? 76.183  58.649 -13.641 1.00 73.26  ? 255  DA  J "O3'" 1 
ATOM   5204  C "C2'" . DA  B 1 109 ? 75.963  58.141 -11.259 1.00 73.18  ? 255  DA  J "C2'" 1 
ATOM   5205  C "C1'" . DA  B 1 109 ? 77.001  57.038 -11.111 1.00 72.48  ? 255  DA  J "C1'" 1 
ATOM   5206  N N9    . DA  B 1 109 ? 77.132  56.533 -9.744  1.00 47.32  ? 255  DA  J N9    1 
ATOM   5207  C C8    . DA  B 1 109 ? 77.172  57.285 -8.601  1.00 46.78  ? 255  DA  J C8    1 
ATOM   5208  N N7    . DA  B 1 109 ? 77.330  56.581 -7.507  1.00 47.70  ? 255  DA  J N7    1 
ATOM   5209  C C5    . DA  B 1 109 ? 77.387  55.272 -7.956  1.00 48.14  ? 255  DA  J C5    1 
ATOM   5210  C C6    . DA  B 1 109 ? 77.548  54.045 -7.281  1.00 48.26  ? 255  DA  J C6    1 
ATOM   5211  N N6    . DA  B 1 109 ? 77.712  53.938 -5.966  1.00 48.17  ? 255  DA  J N6    1 
ATOM   5212  N N1    . DA  B 1 109 ? 77.546  52.916 -8.020  1.00 48.11  ? 255  DA  J N1    1 
ATOM   5213  C C2    . DA  B 1 109 ? 77.408  53.028 -9.346  1.00 47.96  ? 255  DA  J C2    1 
ATOM   5214  N N3    . DA  B 1 109 ? 77.261  54.125 -10.097 1.00 48.13  ? 255  DA  J N3    1 
ATOM   5215  C C4    . DA  B 1 109 ? 77.258  55.226 -9.333  1.00 47.87  ? 255  DA  J C4    1 
ATOM   5216  P P     . DA  B 1 110 ? 74.637  58.463 -13.998 1.00 86.96  ? 256  DA  J P     1 
ATOM   5217  O OP1   . DA  B 1 110 ? 74.451  58.768 -15.438 1.00 76.85  ? 256  DA  J OP1   1 
ATOM   5218  O OP2   . DA  B 1 110 ? 73.825  59.176 -12.987 1.00 77.10  ? 256  DA  J OP2   1 
ATOM   5219  O "O5'" . DA  B 1 110 ? 74.411  56.911 -13.759 1.00 86.42  ? 256  DA  J "O5'" 1 
ATOM   5220  C "C5'" . DA  B 1 110 ? 75.322  55.959 -14.290 1.00 83.33  ? 256  DA  J "C5'" 1 
ATOM   5221  C "C4'" . DA  B 1 110 ? 74.845  54.570 -13.953 1.00 81.33  ? 256  DA  J "C4'" 1 
ATOM   5222  O "O4'" . DA  B 1 110 ? 75.092  54.293 -12.554 1.00 80.76  ? 256  DA  J "O4'" 1 
ATOM   5223  C "C3'" . DA  B 1 110 ? 73.341  54.396 -14.153 1.00 79.85  ? 256  DA  J "C3'" 1 
ATOM   5224  O "O3'" . DA  B 1 110 ? 73.086  53.061 -14.567 1.00 76.32  ? 256  DA  J "O3'" 1 
ATOM   5225  C "C2'" . DA  B 1 110 ? 72.785  54.601 -12.758 1.00 80.75  ? 256  DA  J "C2'" 1 
ATOM   5226  C "C1'" . DA  B 1 110 ? 73.867  53.950 -11.923 1.00 81.87  ? 256  DA  J "C1'" 1 
ATOM   5227  N N9    . DA  B 1 110 ? 73.936  54.373 -10.525 1.00 73.44  ? 256  DA  J N9    1 
ATOM   5228  C C8    . DA  B 1 110 ? 73.910  55.642 -10.000 1.00 74.31  ? 256  DA  J C8    1 
ATOM   5229  N N7    . DA  B 1 110 ? 74.020  55.674 -8.693  1.00 74.68  ? 256  DA  J N7    1 
ATOM   5230  C C5    . DA  B 1 110 ? 74.118  54.336 -8.336  1.00 74.75  ? 256  DA  J C5    1 
ATOM   5231  C C6    . DA  B 1 110 ? 74.271  53.695 -7.095  1.00 75.62  ? 256  DA  J C6    1 
ATOM   5232  N N6    . DA  B 1 110 ? 74.341  54.340 -5.936  1.00 75.47  ? 256  DA  J N6    1 
ATOM   5233  N N1    . DA  B 1 110 ? 74.352  52.348 -7.090  1.00 75.73  ? 256  DA  J N1    1 
ATOM   5234  C C2    . DA  B 1 110 ? 74.277  51.696 -8.256  1.00 75.11  ? 256  DA  J C2    1 
ATOM   5235  N N3    . DA  B 1 110 ? 74.130  52.184 -9.482  1.00 74.25  ? 256  DA  J N3    1 
ATOM   5236  C C4    . DA  B 1 110 ? 74.059  53.525 -9.453  1.00 73.73  ? 256  DA  J C4    1 
ATOM   5237  P P     . DA  B 1 111 ? 71.690  52.693 -15.259 1.00 69.53  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 111 ? 71.911  52.804 -16.726 1.00 59.20  ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 111 ? 70.610  53.472 -14.601 1.00 56.71  ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 111 ? 71.503  51.160 -14.876 1.00 70.07  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 111 ? 72.637  50.291 -14.815 1.00 70.06  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 111 ? 72.359  49.131 -13.889 1.00 69.69  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 111 ? 72.572  49.504 -12.509 1.00 69.57  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 111 ? 70.920  48.644 -13.982 1.00 69.37  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 111 ? 70.834  47.230 -13.928 1.00 68.07  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 111 ? 70.253  49.244 -12.763 1.00 70.67  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 111 ? 71.383  49.312 -11.755 1.00 70.64  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 111 ? 71.254  50.445 -10.835 1.00 61.33  ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 111 ? 71.086  51.779 -11.149 1.00 62.05  ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 111 ? 71.010  52.565 -10.103 1.00 62.74  ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 111 ? 71.130  51.695 -9.028  1.00 63.07  ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 111 ? 71.118  51.905 -7.649  1.00 63.87  ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 111 ? 70.983  53.110 -7.095  1.00 63.37  ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 111 ? 71.253  50.825 -6.844  1.00 62.48  ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 111 ? 71.392  49.619 -7.403  1.00 63.11  ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 111 ? 71.417  49.289 -8.691  1.00 63.46  ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 111 ? 71.279  50.386 -9.462  1.00 62.38  ? 257  DA  J C4    1 
ATOM   5258  P P     . DT  B 1 112 ? 69.402  46.555 -14.054 1.00 52.52  ? 258  DT  J P     1 
ATOM   5259  O OP1   . DT  B 1 112 ? 69.496  45.165 -14.564 1.00 67.27  ? 258  DT  J OP1   1 
ATOM   5260  O OP2   . DT  B 1 112 ? 68.575  47.545 -14.780 1.00 65.11  ? 258  DT  J OP2   1 
ATOM   5261  O "O5'" . DT  B 1 112 ? 68.908  46.563 -12.553 1.00 58.97  ? 258  DT  J "O5'" 1 
ATOM   5262  C "C5'" . DT  B 1 112 ? 68.258  45.440 -12.002 1.00 68.10  ? 258  DT  J "C5'" 1 
ATOM   5263  C "C4'" . DT  B 1 112 ? 69.162  44.779 -10.994 1.00 74.00  ? 258  DT  J "C4'" 1 
ATOM   5264  O "O4'" . DT  B 1 112 ? 69.841  45.804 -10.236 1.00 74.77  ? 258  DT  J "O4'" 1 
ATOM   5265  C "C3'" . DT  B 1 112 ? 68.372  43.953 -9.991  1.00 77.37  ? 258  DT  J "C3'" 1 
ATOM   5266  O "O3'" . DT  B 1 112 ? 69.088  42.790 -9.592  1.00 82.00  ? 258  DT  J "O3'" 1 
ATOM   5267  C "C2'" . DT  B 1 112 ? 68.163  44.904 -8.830  1.00 77.18  ? 258  DT  J "C2'" 1 
ATOM   5268  C "C1'" . DT  B 1 112 ? 69.347  45.859 -8.905  1.00 76.08  ? 258  DT  J "C1'" 1 
ATOM   5269  N N1    . DT  B 1 112 ? 68.933  47.248 -8.639  1.00 88.43  ? 258  DT  J N1    1 
ATOM   5270  C C2    . DT  B 1 112 ? 68.870  47.687 -7.333  1.00 88.05  ? 258  DT  J C2    1 
ATOM   5271  O O2    . DT  B 1 112 ? 69.175  46.998 -6.374  1.00 89.83  ? 258  DT  J O2    1 
ATOM   5272  N N3    . DT  B 1 112 ? 68.434  48.976 -7.188  1.00 86.89  ? 258  DT  J N3    1 
ATOM   5273  C C4    . DT  B 1 112 ? 68.067  49.851 -8.188  1.00 86.52  ? 258  DT  J C4    1 
ATOM   5274  O O4    . DT  B 1 112 ? 67.696  50.981 -7.901  1.00 85.69  ? 258  DT  J O4    1 
ATOM   5275  C C5    . DT  B 1 112 ? 68.163  49.330 -9.528  1.00 86.76  ? 258  DT  J C5    1 
ATOM   5276  C C7    . DT  B 1 112 ? 67.775  50.207 -10.675 1.00 86.49  ? 258  DT  J C7    1 
ATOM   5277  C C6    . DT  B 1 112 ? 68.594  48.074 -9.686  1.00 87.36  ? 258  DT  J C6    1 
ATOM   5278  P P     . DA  B 1 113 ? 68.275  41.531 -9.031  1.00 122.87 ? 259  DA  J P     1 
ATOM   5279  O OP1   . DA  B 1 113 ? 69.277  40.528 -8.568  1.00 78.28  ? 259  DA  J OP1   1 
ATOM   5280  O OP2   . DA  B 1 113 ? 67.268  41.154 -10.062 1.00 76.90  ? 259  DA  J OP2   1 
ATOM   5281  O "O5'" . DA  B 1 113 ? 67.527  42.129 -7.760  1.00 124.90 ? 259  DA  J "O5'" 1 
ATOM   5282  C "C5'" . DA  B 1 113 ? 68.253  42.398 -6.564  1.00 128.89 ? 259  DA  J "C5'" 1 
ATOM   5283  C "C4'" . DA  B 1 113 ? 67.315  42.815 -5.456  1.00 131.44 ? 259  DA  J "C4'" 1 
ATOM   5284  O "O4'" . DA  B 1 113 ? 67.033  44.233 -5.511  1.00 132.09 ? 259  DA  J "O4'" 1 
ATOM   5285  C "C3'" . DA  B 1 113 ? 65.961  42.104 -5.454  1.00 132.87 ? 259  DA  J "C3'" 1 
ATOM   5286  O "O3'" . DA  B 1 113 ? 65.628  41.706 -4.117  1.00 134.39 ? 259  DA  J "O3'" 1 
ATOM   5287  C "C2'" . DA  B 1 113 ? 65.006  43.170 -5.963  1.00 132.66 ? 259  DA  J "C2'" 1 
ATOM   5288  C "C1'" . DA  B 1 113 ? 65.634  44.438 -5.415  1.00 132.93 ? 259  DA  J "C1'" 1 
ATOM   5289  N N9    . DA  B 1 113 ? 65.304  45.653 -6.159  1.00 89.42  ? 259  DA  J N9    1 
ATOM   5290  C C8    . DA  B 1 113 ? 65.133  45.778 -7.516  1.00 89.82  ? 259  DA  J C8    1 
ATOM   5291  N N7    . DA  B 1 113 ? 64.855  46.999 -7.904  1.00 90.18  ? 259  DA  J N7    1 
ATOM   5292  C C5    . DA  B 1 113 ? 64.838  47.727 -6.723  1.00 90.26  ? 259  DA  J C5    1 
ATOM   5293  C C6    . DA  B 1 113 ? 64.599  49.076 -6.461  1.00 90.45  ? 259  DA  J C6    1 
ATOM   5294  N N6    . DA  B 1 113 ? 64.326  49.963 -7.412  1.00 90.60  ? 259  DA  J N6    1 
ATOM   5295  N N1    . DA  B 1 113 ? 64.648  49.489 -5.177  1.00 90.21  ? 259  DA  J N1    1 
ATOM   5296  C C2    . DA  B 1 113 ? 64.914  48.592 -4.231  1.00 90.03  ? 259  DA  J C2    1 
ATOM   5297  N N3    . DA  B 1 113 ? 65.157  47.289 -4.351  1.00 89.78  ? 259  DA  J N3    1 
ATOM   5298  C C4    . DA  B 1 113 ? 65.106  46.913 -5.641  1.00 89.82  ? 259  DA  J C4    1 
ATOM   5299  P P     . DC  B 1 114 ? 64.174  41.099 -3.799  1.00 123.77 ? 260  DC  J P     1 
ATOM   5300  O OP1   . DC  B 1 114 ? 64.324  40.227 -2.604  1.00 100.85 ? 260  DC  J OP1   1 
ATOM   5301  O OP2   . DC  B 1 114 ? 63.567  40.546 -5.048  1.00 100.51 ? 260  DC  J OP2   1 
ATOM   5302  O "O5'" . DC  B 1 114 ? 63.354  42.389 -3.358  1.00 124.86 ? 260  DC  J "O5'" 1 
ATOM   5303  C "C5'" . DC  B 1 114 ? 63.761  43.147 -2.227  1.00 127.83 ? 260  DC  J "C5'" 1 
ATOM   5304  C "C4'" . DC  B 1 114 ? 62.645  44.068 -1.802  1.00 130.08 ? 260  DC  J "C4'" 1 
ATOM   5305  O "O4'" . DC  B 1 114 ? 62.619  45.244 -2.644  1.00 130.37 ? 260  DC  J "O4'" 1 
ATOM   5306  C "C3'" . DC  B 1 114 ? 61.257  43.432 -1.910  1.00 131.35 ? 260  DC  J "C3'" 1 
ATOM   5307  O "O3'" . DC  B 1 114 ? 60.457  43.827 -0.798  1.00 132.82 ? 260  DC  J "O3'" 1 
ATOM   5308  C "C2'" . DC  B 1 114 ? 60.699  44.034 -3.185  1.00 130.98 ? 260  DC  J "C2'" 1 
ATOM   5309  C "C1'" . DC  B 1 114 ? 61.306  45.422 -3.147  1.00 130.87 ? 260  DC  J "C1'" 1 
ATOM   5310  N N1    . DC  B 1 114 ? 61.393  46.108 -4.447  1.00 109.17 ? 260  DC  J N1    1 
ATOM   5311  C C2    . DC  B 1 114 ? 61.587  47.498 -4.462  1.00 109.28 ? 260  DC  J C2    1 
ATOM   5312  O O2    . DC  B 1 114 ? 61.716  48.099 -3.383  1.00 109.35 ? 260  DC  J O2    1 
ATOM   5313  N N3    . DC  B 1 114 ? 61.633  48.145 -5.650  1.00 109.30 ? 260  DC  J N3    1 
ATOM   5314  C C4    . DC  B 1 114 ? 61.510  47.459 -6.789  1.00 108.78 ? 260  DC  J C4    1 
ATOM   5315  N N4    . DC  B 1 114 ? 61.565  48.137 -7.933  1.00 108.24 ? 260  DC  J N4    1 
ATOM   5316  C C5    . DC  B 1 114 ? 61.327  46.043 -6.803  1.00 108.56 ? 260  DC  J C5    1 
ATOM   5317  C C6    . DC  B 1 114 ? 61.276  45.414 -5.622  1.00 108.80 ? 260  DC  J C6    1 
ATOM   5318  P P     . DA  B 1 115 ? 58.979  43.228 -0.621  1.00 124.85 ? 261  DA  J P     1 
ATOM   5319  O OP1   . DA  B 1 115 ? 59.025  42.305 0.539   1.00 122.68 ? 261  DA  J OP1   1 
ATOM   5320  O OP2   . DA  B 1 115 ? 58.461  42.740 -1.928  1.00 121.72 ? 261  DA  J OP2   1 
ATOM   5321  O "O5'" . DA  B 1 115 ? 58.136  44.516 -0.226  1.00 125.14 ? 261  DA  J "O5'" 1 
ATOM   5322  C "C5'" . DA  B 1 115 ? 58.681  45.503 0.648   1.00 125.19 ? 261  DA  J "C5'" 1 
ATOM   5323  C "C4'" . DA  B 1 115 ? 57.856  46.765 0.569   1.00 125.34 ? 261  DA  J "C4'" 1 
ATOM   5324  O "O4'" . DA  B 1 115 ? 58.160  47.482 -0.652  1.00 125.59 ? 261  DA  J "O4'" 1 
ATOM   5325  C "C3'" . DA  B 1 115 ? 56.356  46.479 0.521   1.00 125.63 ? 261  DA  J "C3'" 1 
ATOM   5326  O "O3'" . DA  B 1 115 ? 55.628  47.478 1.237   1.00 125.54 ? 261  DA  J "O3'" 1 
ATOM   5327  C "C2'" . DA  B 1 115 ? 56.040  46.559 -0.960  1.00 125.71 ? 261  DA  J "C2'" 1 
ATOM   5328  C "C1'" . DA  B 1 115 ? 56.963  47.678 -1.393  1.00 126.00 ? 261  DA  J "C1'" 1 
ATOM   5329  N N9    . DA  B 1 115 ? 57.297  47.684 -2.819  1.00 123.18 ? 261  DA  J N9    1 
ATOM   5330  C C8    . DA  B 1 115 ? 57.672  46.623 -3.607  1.00 122.86 ? 261  DA  J C8    1 
ATOM   5331  N N7    . DA  B 1 115 ? 57.916  46.949 -4.853  1.00 122.88 ? 261  DA  J N7    1 
ATOM   5332  C C5    . DA  B 1 115 ? 57.685  48.317 -4.891  1.00 123.15 ? 261  DA  J C5    1 
ATOM   5333  C C6    . DA  B 1 115 ? 57.776  49.263 -5.928  1.00 123.22 ? 261  DA  J C6    1 
ATOM   5334  N N6    . DA  B 1 115 ? 58.145  48.961 -7.177  1.00 122.75 ? 261  DA  J N6    1 
ATOM   5335  N N1    . DA  B 1 115 ? 57.474  50.548 -5.634  1.00 123.09 ? 261  DA  J N1    1 
ATOM   5336  C C2    . DA  B 1 115 ? 57.108  50.850 -4.382  1.00 123.21 ? 261  DA  J C2    1 
ATOM   5337  N N3    . DA  B 1 115 ? 56.989  50.052 -3.323  1.00 123.37 ? 261  DA  J N3    1 
ATOM   5338  C C4    . DA  B 1 115 ? 57.297  48.783 -3.648  1.00 123.11 ? 261  DA  J C4    1 
ATOM   5339  P P     . DC  B 1 116 ? 54.131  47.163 1.727   1.00 125.03 ? 262  DC  J P     1 
ATOM   5340  O OP1   . DC  B 1 116 ? 53.997  47.648 3.122   1.00 140.08 ? 262  DC  J OP1   1 
ATOM   5341  O OP2   . DC  B 1 116 ? 53.835  45.741 1.404   1.00 140.02 ? 262  DC  J OP2   1 
ATOM   5342  O "O5'" . DC  B 1 116 ? 53.219  48.073 0.800   1.00 124.60 ? 262  DC  J "O5'" 1 
ATOM   5343  C "C5'" . DC  B 1 116 ? 53.680  48.469 -0.477  1.00 124.35 ? 262  DC  J "C5'" 1 
ATOM   5344  C "C4'" . DC  B 1 116 ? 53.131  49.828 -0.827  1.00 124.04 ? 262  DC  J "C4'" 1 
ATOM   5345  O "O4'" . DC  B 1 116 ? 53.724  50.246 -2.076  1.00 124.57 ? 262  DC  J "O4'" 1 
ATOM   5346  C "C3'" . DC  B 1 116 ? 51.627  49.821 -1.057  1.00 123.85 ? 262  DC  J "C3'" 1 
ATOM   5347  O "O3'" . DC  B 1 116 ? 51.078  51.076 -0.680  1.00 123.12 ? 262  DC  J "O3'" 1 
ATOM   5348  C "C2'" . DC  B 1 116 ? 51.501  49.580 -2.549  1.00 124.48 ? 262  DC  J "C2'" 1 
ATOM   5349  C "C1'" . DC  B 1 116 ? 52.770  50.201 -3.127  1.00 125.00 ? 262  DC  J "C1'" 1 
ATOM   5350  N N1    . DC  B 1 116 ? 53.366  49.419 -4.222  1.00 141.03 ? 262  DC  J N1    1 
ATOM   5351  C C2    . DC  B 1 116 ? 53.968  50.096 -5.273  1.00 141.43 ? 262  DC  J C2    1 
ATOM   5352  O O2    . DC  B 1 116 ? 53.985  51.333 -5.251  1.00 141.62 ? 262  DC  J O2    1 
ATOM   5353  N N3    . DC  B 1 116 ? 54.519  49.387 -6.286  1.00 141.93 ? 262  DC  J N3    1 
ATOM   5354  C C4    . DC  B 1 116 ? 54.481  48.052 -6.265  1.00 142.10 ? 262  DC  J C4    1 
ATOM   5355  N N4    . DC  B 1 116 ? 55.037  47.390 -7.284  1.00 142.71 ? 262  DC  J N4    1 
ATOM   5356  C C5    . DC  B 1 116 ? 53.871  47.334 -5.199  1.00 141.96 ? 262  DC  J C5    1 
ATOM   5357  C C6    . DC  B 1 116 ? 53.332  48.051 -4.208  1.00 141.61 ? 262  DC  J C6    1 
ATOM   5358  P P     . DT  B 1 117 ? 49.590  51.450 -1.127  1.00 130.01 ? 263  DT  J P     1 
ATOM   5359  O OP1   . DT  B 1 117 ? 49.132  52.527 -0.202  1.00 82.65  ? 263  DT  J OP1   1 
ATOM   5360  O OP2   . DT  B 1 117 ? 48.800  50.191 -1.272  1.00 82.78  ? 263  DT  J OP2   1 
ATOM   5361  O "O5'" . DT  B 1 117 ? 49.788  52.083 -2.570  1.00 128.49 ? 263  DT  J "O5'" 1 
ATOM   5362  C "C5'" . DT  B 1 117 ? 50.643  53.206 -2.744  1.00 126.10 ? 263  DT  J "C5'" 1 
ATOM   5363  C "C4'" . DT  B 1 117 ? 50.352  53.878 -4.062  1.00 124.32 ? 263  DT  J "C4'" 1 
ATOM   5364  O "O4'" . DT  B 1 117 ? 50.920  53.114 -5.152  1.00 123.49 ? 263  DT  J "O4'" 1 
ATOM   5365  C "C3'" . DT  B 1 117 ? 48.861  54.010 -4.358  1.00 123.44 ? 263  DT  J "C3'" 1 
ATOM   5366  O "O3'" . DT  B 1 117 ? 48.619  55.286 -4.947  1.00 122.36 ? 263  DT  J "O3'" 1 
ATOM   5367  C "C2'" . DT  B 1 117 ? 48.592  52.870 -5.324  1.00 123.03 ? 263  DT  J "C2'" 1 
ATOM   5368  C "C1'" . DT  B 1 117 ? 49.906  52.762 -6.082  1.00 123.33 ? 263  DT  J "C1'" 1 
ATOM   5369  N N1    . DT  B 1 117 ? 50.213  51.408 -6.604  1.00 76.06  ? 263  DT  J N1    1 
ATOM   5370  C C2    . DT  B 1 117 ? 50.588  51.281 -7.931  1.00 76.16  ? 263  DT  J C2    1 
ATOM   5371  O O2    . DT  B 1 117 ? 50.671  52.227 -8.706  1.00 76.33  ? 263  DT  J O2    1 
ATOM   5372  N N3    . DT  B 1 117 ? 50.862  49.994 -8.320  1.00 75.70  ? 263  DT  J N3    1 
ATOM   5373  C C4    . DT  B 1 117 ? 50.795  48.851 -7.546  1.00 75.79  ? 263  DT  J C4    1 
ATOM   5374  O O4    . DT  B 1 117 ? 51.082  47.766 -8.031  1.00 75.67  ? 263  DT  J O4    1 
ATOM   5375  C C5    . DT  B 1 117 ? 50.383  49.049 -6.183  1.00 75.67  ? 263  DT  J C5    1 
ATOM   5376  C C7    . DT  B 1 117 ? 50.259  47.855 -5.290  1.00 75.16  ? 263  DT  J C7    1 
ATOM   5377  C C6    . DT  B 1 117 ? 50.123  50.302 -5.778  1.00 75.63  ? 263  DT  J C6    1 
ATOM   5378  P P     . DT  B 1 118 ? 47.221  55.583 -5.672  1.00 97.90  ? 264  DT  J P     1 
ATOM   5379  O OP1   . DT  B 1 118 ? 46.906  57.008 -5.396  1.00 99.96  ? 264  DT  J OP1   1 
ATOM   5380  O OP2   . DT  B 1 118 ? 46.235  54.520 -5.332  1.00 99.04  ? 264  DT  J OP2   1 
ATOM   5381  O "O5'" . DT  B 1 118 ? 47.599  55.468 -7.210  1.00 95.93  ? 264  DT  J "O5'" 1 
ATOM   5382  C "C5'" . DT  B 1 118 ? 48.759  56.131 -7.702  1.00 91.31  ? 264  DT  J "C5'" 1 
ATOM   5383  C "C4'" . DT  B 1 118 ? 48.841  56.003 -9.202  1.00 87.59  ? 264  DT  J "C4'" 1 
ATOM   5384  O "O4'" . DT  B 1 118 ? 49.206  54.656 -9.570  1.00 86.52  ? 264  DT  J "O4'" 1 
ATOM   5385  C "C3'" . DT  B 1 118 ? 47.545  56.315 -9.941  1.00 85.21  ? 264  DT  J "C3'" 1 
ATOM   5386  O "O3'" . DT  B 1 118 ? 47.872  57.046 -11.118 1.00 82.51  ? 264  DT  J "O3'" 1 
ATOM   5387  C "C2'" . DT  B 1 118 ? 46.979  54.943 -10.264 1.00 84.41  ? 264  DT  J "C2'" 1 
ATOM   5388  C "C1'" . DT  B 1 118 ? 48.233  54.105 -10.446 1.00 84.83  ? 264  DT  J "C1'" 1 
ATOM   5389  N N1    . DT  B 1 118 ? 48.101  52.674 -10.105 1.00 84.87  ? 264  DT  J N1    1 
ATOM   5390  C C2    . DT  B 1 118 ? 48.751  51.761 -10.902 1.00 84.17  ? 264  DT  J C2    1 
ATOM   5391  O O2    . DT  B 1 118 ? 49.401  52.075 -11.893 1.00 84.60  ? 264  DT  J O2    1 
ATOM   5392  N N3    . DT  B 1 118 ? 48.613  50.457 -10.498 1.00 82.86  ? 264  DT  J N3    1 
ATOM   5393  C C4    . DT  B 1 118 ? 47.903  49.985 -9.411  1.00 82.10  ? 264  DT  J C4    1 
ATOM   5394  O O4    . DT  B 1 118 ? 47.876  48.782 -9.173  1.00 79.91  ? 264  DT  J O4    1 
ATOM   5395  C C5    . DT  B 1 118 ? 47.236  50.992 -8.631  1.00 82.47  ? 264  DT  J C5    1 
ATOM   5396  C C7    . DT  B 1 118 ? 46.438  50.569 -7.440  1.00 82.63  ? 264  DT  J C7    1 
ATOM   5397  C C6    . DT  B 1 118 ? 47.363  52.270 -9.010  1.00 83.79  ? 264  DT  J C6    1 
ATOM   5398  P P     . DT  B 1 119 ? 46.707  57.630 -12.048 1.00 89.26  ? 265  DT  J P     1 
ATOM   5399  O OP1   . DT  B 1 119 ? 46.866  59.111 -12.138 1.00 87.94  ? 265  DT  J OP1   1 
ATOM   5400  O OP2   . DT  B 1 119 ? 45.413  57.047 -11.622 1.00 88.19  ? 265  DT  J OP2   1 
ATOM   5401  O "O5'" . DT  B 1 119 ? 47.066  57.006 -13.461 1.00 88.28  ? 265  DT  J "O5'" 1 
ATOM   5402  C "C5'" . DT  B 1 119 ? 48.420  56.964 -13.908 1.00 83.45  ? 265  DT  J "C5'" 1 
ATOM   5403  C "C4'" . DT  B 1 119 ? 48.543  56.039 -15.092 1.00 80.55  ? 265  DT  J "C4'" 1 
ATOM   5404  O "O4'" . DT  B 1 119 ? 48.464  54.660 -14.661 1.00 79.49  ? 265  DT  J "O4'" 1 
ATOM   5405  C "C3'" . DT  B 1 119 ? 47.441  56.225 -16.129 1.00 79.02  ? 265  DT  J "C3'" 1 
ATOM   5406  O "O3'" . DT  B 1 119 ? 48.023  56.243 -17.419 1.00 77.07  ? 265  DT  J "O3'" 1 
ATOM   5407  C "C2'" . DT  B 1 119 ? 46.537  55.016 -15.935 1.00 78.67  ? 265  DT  J "C2'" 1 
ATOM   5408  C "C1'" . DT  B 1 119 ? 47.511  53.968 -15.448 1.00 79.76  ? 265  DT  J "C1'" 1 
ATOM   5409  N N1    . DT  B 1 119 ? 46.947  52.895 -14.616 1.00 79.88  ? 265  DT  J N1    1 
ATOM   5410  C C2    . DT  B 1 119 ? 47.140  51.605 -15.043 1.00 81.82  ? 265  DT  J C2    1 
ATOM   5411  O O2    . DT  B 1 119 ? 47.724  51.334 -16.070 1.00 83.97  ? 265  DT  J O2    1 
ATOM   5412  N N3    . DT  B 1 119 ? 46.628  50.640 -14.219 1.00 82.12  ? 265  DT  J N3    1 
ATOM   5413  C C4    . DT  B 1 119 ? 45.957  50.828 -13.030 1.00 83.73  ? 265  DT  J C4    1 
ATOM   5414  O O4    . DT  B 1 119 ? 45.561  49.852 -12.395 1.00 84.65  ? 265  DT  J O4    1 
ATOM   5415  C C5    . DT  B 1 119 ? 45.780  52.218 -12.635 1.00 82.98  ? 265  DT  J C5    1 
ATOM   5416  C C7    . DT  B 1 119 ? 45.074  52.530 -11.353 1.00 83.62  ? 265  DT  J C7    1 
ATOM   5417  C C6    . DT  B 1 119 ? 46.272  53.169 -13.447 1.00 81.66  ? 265  DT  J C6    1 
ATOM   5418  P P     . DT  B 1 120 ? 47.098  56.041 -18.694 1.00 76.65  ? 266  DT  J P     1 
ATOM   5419  O OP1   . DT  B 1 120 ? 47.779  56.729 -19.815 1.00 81.73  ? 266  DT  J OP1   1 
ATOM   5420  O OP2   . DT  B 1 120 ? 45.708  56.398 -18.344 1.00 83.82  ? 266  DT  J OP2   1 
ATOM   5421  O "O5'" . DT  B 1 120 ? 47.131  54.468 -18.893 1.00 76.97  ? 266  DT  J "O5'" 1 
ATOM   5422  C "C5'" . DT  B 1 120 ? 48.353  53.784 -19.154 1.00 75.76  ? 266  DT  J "C5'" 1 
ATOM   5423  C "C4'" . DT  B 1 120 ? 48.062  52.500 -19.893 1.00 74.68  ? 266  DT  J "C4'" 1 
ATOM   5424  O "O4'" . DT  B 1 120 ? 47.517  51.499 -19.004 1.00 74.75  ? 266  DT  J "O4'" 1 
ATOM   5425  C "C3'" . DT  B 1 120 ? 47.020  52.676 -20.995 1.00 74.99  ? 266  DT  J "C3'" 1 
ATOM   5426  O "O3'" . DT  B 1 120 ? 47.328  51.779 -22.050 1.00 74.51  ? 266  DT  J "O3'" 1 
ATOM   5427  C "C2'" . DT  B 1 120 ? 45.728  52.234 -20.327 1.00 75.67  ? 266  DT  J "C2'" 1 
ATOM   5428  C "C1'" . DT  B 1 120 ? 46.221  51.099 -19.453 1.00 75.35  ? 266  DT  J "C1'" 1 
ATOM   5429  N N1    . DT  B 1 120 ? 45.402  50.843 -18.260 1.00 81.86  ? 266  DT  J N1    1 
ATOM   5430  C C2    . DT  B 1 120 ? 45.252  49.542 -17.834 1.00 82.52  ? 266  DT  J C2    1 
ATOM   5431  O O2    . DT  B 1 120 ? 45.711  48.585 -18.431 1.00 80.24  ? 266  DT  J O2    1 
ATOM   5432  N N3    . DT  B 1 120 ? 44.545  49.402 -16.672 1.00 84.30  ? 266  DT  J N3    1 
ATOM   5433  C C4    . DT  B 1 120 ? 43.985  50.407 -15.906 1.00 84.82  ? 266  DT  J C4    1 
ATOM   5434  O O4    . DT  B 1 120 ? 43.400  50.120 -14.859 1.00 86.65  ? 266  DT  J O4    1 
ATOM   5435  C C5    . DT  B 1 120 ? 44.161  51.752 -16.430 1.00 83.81  ? 266  DT  J C5    1 
ATOM   5436  C C7    . DT  B 1 120 ? 43.609  52.918 -15.670 1.00 84.02  ? 266  DT  J C7    1 
ATOM   5437  C C6    . DT  B 1 120 ? 44.834  51.892 -17.574 1.00 82.80  ? 266  DT  J C6    1 
ATOM   5438  P P     . DG  B 1 121 ? 48.067  52.317 -23.349 1.00 78.02  ? 267  DG  J P     1 
ATOM   5439  O OP1   . DG  B 1 121 ? 49.287  53.075 -22.938 1.00 93.76  ? 267  DG  J OP1   1 
ATOM   5440  O OP2   . DG  B 1 121 ? 47.026  52.967 -24.197 1.00 92.44  ? 267  DG  J OP2   1 
ATOM   5441  O "O5'" . DG  B 1 121 ? 48.513  50.964 -24.051 1.00 74.66  ? 267  DG  J "O5'" 1 
ATOM   5442  C "C5'" . DG  B 1 121 ? 49.283  49.997 -23.354 1.00 67.41  ? 267  DG  J "C5'" 1 
ATOM   5443  C "C4'" . DG  B 1 121 ? 48.559  48.672 -23.357 1.00 63.68  ? 267  DG  J "C4'" 1 
ATOM   5444  O "O4'" . DG  B 1 121 ? 47.394  48.754 -22.511 1.00 63.41  ? 267  DG  J "O4'" 1 
ATOM   5445  C "C3'" . DG  B 1 121 ? 48.047  48.223 -24.723 1.00 61.34  ? 267  DG  J "C3'" 1 
ATOM   5446  O "O3'" . DG  B 1 121 ? 48.103  46.811 -24.800 1.00 57.30  ? 267  DG  J "O3'" 1 
ATOM   5447  C "C2'" . DG  B 1 121 ? 46.591  48.633 -24.708 1.00 61.53  ? 267  DG  J "C2'" 1 
ATOM   5448  C "C1'" . DG  B 1 121 ? 46.227  48.438 -23.253 1.00 63.82  ? 267  DG  J "C1'" 1 
ATOM   5449  N N9    . DG  B 1 121 ? 45.163  49.316 -22.787 1.00 81.57  ? 267  DG  J N9    1 
ATOM   5450  C C8    . DG  B 1 121 ? 44.853  50.578 -23.244 1.00 82.35  ? 267  DG  J C8    1 
ATOM   5451  N N7    . DG  B 1 121 ? 43.864  51.128 -22.594 1.00 82.65  ? 267  DG  J N7    1 
ATOM   5452  C C5    . DG  B 1 121 ? 43.499  50.171 -21.655 1.00 82.10  ? 267  DG  J C5    1 
ATOM   5453  C C6    . DG  B 1 121 ? 42.494  50.200 -20.648 1.00 81.95  ? 267  DG  J C6    1 
ATOM   5454  O O6    . DG  B 1 121 ? 41.712  51.120 -20.364 1.00 79.59  ? 267  DG  J O6    1 
ATOM   5455  N N1    . DG  B 1 121 ? 42.457  49.001 -19.931 1.00 82.25  ? 267  DG  J N1    1 
ATOM   5456  C C2    . DG  B 1 121 ? 43.285  47.919 -20.153 1.00 84.24  ? 267  DG  J C2    1 
ATOM   5457  N N2    . DG  B 1 121 ? 43.091  46.842 -19.389 1.00 84.03  ? 267  DG  J N2    1 
ATOM   5458  N N3    . DG  B 1 121 ? 44.234  47.895 -21.068 1.00 84.22  ? 267  DG  J N3    1 
ATOM   5459  C C4    . DG  B 1 121 ? 44.284  49.042 -21.777 1.00 82.63  ? 267  DG  J C4    1 
ATOM   5460  P P     . DG  B 1 122 ? 48.408  46.108 -26.206 1.00 46.65  ? 268  DG  J P     1 
ATOM   5461  O OP1   . DG  B 1 122 ? 49.816  46.363 -26.573 1.00 81.16  ? 268  DG  J OP1   1 
ATOM   5462  O OP2   . DG  B 1 122 ? 47.319  46.494 -27.145 1.00 78.64  ? 268  DG  J OP2   1 
ATOM   5463  O "O5'" . DG  B 1 122 ? 48.266  44.572 -25.853 1.00 50.29  ? 268  DG  J "O5'" 1 
ATOM   5464  C "C5'" . DG  B 1 122 ? 47.205  43.822 -26.409 1.00 52.72  ? 268  DG  J "C5'" 1 
ATOM   5465  C "C4'" . DG  B 1 122 ? 46.423  43.103 -25.334 1.00 56.72  ? 268  DG  J "C4'" 1 
ATOM   5466  O "O4'" . DG  B 1 122 ? 45.879  44.030 -24.367 1.00 58.38  ? 268  DG  J "O4'" 1 
ATOM   5467  C "C3'" . DG  B 1 122 ? 45.223  42.408 -25.956 1.00 57.97  ? 268  DG  J "C3'" 1 
ATOM   5468  O "O3'" . DG  B 1 122 ? 45.082  41.094 -25.506 1.00 60.40  ? 268  DG  J "O3'" 1 
ATOM   5469  C "C2'" . DG  B 1 122 ? 44.030  43.235 -25.543 1.00 60.01  ? 268  DG  J "C2'" 1 
ATOM   5470  C "C1'" . DG  B 1 122 ? 44.481  43.836 -24.243 1.00 61.68  ? 268  DG  J "C1'" 1 
ATOM   5471  N N9    . DG  B 1 122 ? 43.871  45.136 -24.025 1.00 100.84 ? 268  DG  J N9    1 
ATOM   5472  C C8    . DG  B 1 122 ? 44.266  46.336 -24.563 1.00 103.41 ? 268  DG  J C8    1 
ATOM   5473  N N7    . DG  B 1 122 ? 43.509  47.333 -24.201 1.00 105.58 ? 268  DG  J N7    1 
ATOM   5474  C C5    . DG  B 1 122 ? 42.557  46.753 -23.373 1.00 106.14 ? 268  DG  J C5    1 
ATOM   5475  C C6    . DG  B 1 122 ? 41.466  47.334 -22.680 1.00 108.41 ? 268  DG  J C6    1 
ATOM   5476  O O6    . DG  B 1 122 ? 41.103  48.522 -22.667 1.00 109.64 ? 268  DG  J O6    1 
ATOM   5477  N N1    . DG  B 1 122 ? 40.763  46.382 -21.947 1.00 108.22 ? 268  DG  J N1    1 
ATOM   5478  C C2    . DG  B 1 122 ? 41.063  45.046 -21.894 1.00 107.93 ? 268  DG  J C2    1 
ATOM   5479  N N2    . DG  B 1 122 ? 40.257  44.297 -21.137 1.00 109.45 ? 268  DG  J N2    1 
ATOM   5480  N N3    . DG  B 1 122 ? 42.074  44.490 -22.538 1.00 106.24 ? 268  DG  J N3    1 
ATOM   5481  C C4    . DG  B 1 122 ? 42.774  45.397 -23.251 1.00 104.60 ? 268  DG  J C4    1 
ATOM   5482  P P     . DT  B 1 123 ? 44.072  40.151 -26.275 1.00 91.23  ? 269  DT  J P     1 
ATOM   5483  O OP1   . DT  B 1 123 ? 44.403  38.755 -25.885 1.00 76.70  ? 269  DT  J OP1   1 
ATOM   5484  O OP2   . DT  B 1 123 ? 44.090  40.535 -27.706 1.00 76.40  ? 269  DT  J OP2   1 
ATOM   5485  O "O5'" . DT  B 1 123 ? 42.662  40.630 -25.710 1.00 96.72  ? 269  DT  J "O5'" 1 
ATOM   5486  C "C5'" . DT  B 1 123 ? 42.326  40.467 -24.338 1.00 104.47 ? 269  DT  J "C5'" 1 
ATOM   5487  C "C4'" . DT  B 1 123 ? 40.842  40.658 -24.150 1.00 111.26 ? 269  DT  J "C4'" 1 
ATOM   5488  O "O4'" . DT  B 1 123 ? 40.529  42.059 -23.957 1.00 111.33 ? 269  DT  J "O4'" 1 
ATOM   5489  C "C3'" . DT  B 1 123 ? 40.019  40.191 -25.349 1.00 115.75 ? 269  DT  J "C3'" 1 
ATOM   5490  O "O3'" . DT  B 1 123 ? 38.875  39.475 -24.908 1.00 124.27 ? 269  DT  J "O3'" 1 
ATOM   5491  C "C2'" . DT  B 1 123 ? 39.582  41.488 -26.004 1.00 114.77 ? 269  DT  J "C2'" 1 
ATOM   5492  C "C1'" . DT  B 1 123 ? 39.449  42.408 -24.805 1.00 113.87 ? 269  DT  J "C1'" 1 
ATOM   5493  N N1    . DT  B 1 123 ? 39.536  43.855 -25.104 1.00 100.49 ? 269  DT  J N1    1 
ATOM   5494  C C2    . DT  B 1 123 ? 38.553  44.682 -24.601 1.00 100.55 ? 269  DT  J C2    1 
ATOM   5495  O O2    . DT  B 1 123 ? 37.642  44.283 -23.899 1.00 101.19 ? 269  DT  J O2    1 
ATOM   5496  N N3    . DT  B 1 123 ? 38.679  46.002 -24.950 1.00 99.91  ? 269  DT  J N3    1 
ATOM   5497  C C4    . DT  B 1 123 ? 39.670  46.568 -25.726 1.00 100.40 ? 269  DT  J C4    1 
ATOM   5498  O O4    . DT  B 1 123 ? 39.644  47.776 -25.966 1.00 98.22  ? 269  DT  J O4    1 
ATOM   5499  C C5    . DT  B 1 123 ? 40.683  45.644 -26.203 1.00 101.12 ? 269  DT  J C5    1 
ATOM   5500  C C7    . DT  B 1 123 ? 41.810  46.164 -27.041 1.00 103.56 ? 269  DT  J C7    1 
ATOM   5501  C C6    . DT  B 1 123 ? 40.564  44.353 -25.871 1.00 101.13 ? 269  DT  J C6    1 
ATOM   5502  P P     . DA  B 1 124 ? 38.653  37.970 -25.396 1.00 163.01 ? 270  DA  J P     1 
ATOM   5503  O OP1   . DA  B 1 124 ? 39.506  37.085 -24.575 1.00 129.74 ? 270  DA  J OP1   1 
ATOM   5504  O OP2   . DA  B 1 124 ? 38.800  37.972 -26.879 1.00 129.70 ? 270  DA  J OP2   1 
ATOM   5505  O "O5'" . DA  B 1 124 ? 37.142  37.678 -25.004 1.00 166.44 ? 270  DA  J "O5'" 1 
ATOM   5506  C "C5'" . DA  B 1 124 ? 36.745  37.578 -23.649 1.00 170.84 ? 270  DA  J "C5'" 1 
ATOM   5507  C "C4'" . DA  B 1 124 ? 35.333  38.085 -23.496 1.00 173.78 ? 270  DA  J "C4'" 1 
ATOM   5508  O "O4'" . DA  B 1 124 ? 35.336  39.531 -23.567 1.00 173.93 ? 270  DA  J "O4'" 1 
ATOM   5509  C "C3'" . DA  B 1 124 ? 34.417  37.609 -24.616 1.00 175.71 ? 270  DA  J "C3'" 1 
ATOM   5510  O "O3'" . DA  B 1 124 ? 33.136  37.246 -24.133 1.00 178.08 ? 270  DA  J "O3'" 1 
ATOM   5511  C "C2'" . DA  B 1 124 ? 34.376  38.794 -25.558 1.00 175.22 ? 270  DA  J "C2'" 1 
ATOM   5512  C "C1'" . DA  B 1 124 ? 34.459  39.962 -24.596 1.00 174.20 ? 270  DA  J "C1'" 1 
ATOM   5513  N N9    . DA  B 1 124 ? 35.016  41.164 -25.217 1.00 139.58 ? 270  DA  J N9    1 
ATOM   5514  C C8    . DA  B 1 124 ? 36.043  41.232 -26.126 1.00 139.10 ? 270  DA  J C8    1 
ATOM   5515  N N7    . DA  B 1 124 ? 36.332  42.450 -26.505 1.00 138.88 ? 270  DA  J N7    1 
ATOM   5516  C C5    . DA  B 1 124 ? 35.431  43.243 -25.803 1.00 139.06 ? 270  DA  J C5    1 
ATOM   5517  C C6    . DA  B 1 124 ? 35.220  44.641 -25.755 1.00 138.95 ? 270  DA  J C6    1 
ATOM   5518  N N6    . DA  B 1 124 ? 35.941  45.529 -26.448 1.00 138.05 ? 270  DA  J N6    1 
ATOM   5519  N N1    . DA  B 1 124 ? 34.230  45.099 -24.954 1.00 139.23 ? 270  DA  J N1    1 
ATOM   5520  C C2    . DA  B 1 124 ? 33.508  44.213 -24.254 1.00 139.16 ? 270  DA  J C2    1 
ATOM   5521  N N3    . DA  B 1 124 ? 33.613  42.885 -24.214 1.00 139.29 ? 270  DA  J N3    1 
ATOM   5522  C C4    . DA  B 1 124 ? 34.608  42.460 -25.014 1.00 139.23 ? 270  DA  J C4    1 
ATOM   5523  P P     . DG  B 1 125 ? 31.980  36.931 -25.205 1.00 142.52 ? 271  DG  J P     1 
ATOM   5524  O OP1   . DG  B 1 125 ? 30.872  36.156 -24.634 1.00 135.48 ? 271  DG  J OP1   1 
ATOM   5525  O OP2   . DG  B 1 125 ? 32.729  36.382 -26.381 1.00 136.18 ? 271  DG  J OP2   1 
ATOM   5526  O "O5'" . DG  B 1 125 ? 31.441  38.372 -25.651 1.00 144.26 ? 271  DG  J "O5'" 1 
ATOM   5527  C "C5'" . DG  B 1 125 ? 31.011  39.338 -24.665 1.00 147.27 ? 271  DG  J "C5'" 1 
ATOM   5528  C "C4'" . DG  B 1 125 ? 30.333  40.523 -25.313 1.00 149.28 ? 271  DG  J "C4'" 1 
ATOM   5529  O "O4'" . DG  B 1 125 ? 31.308  41.467 -25.790 1.00 149.37 ? 271  DG  J "O4'" 1 
ATOM   5530  C "C3'" . DG  B 1 125 ? 29.643  40.070 -26.599 1.00 150.58 ? 271  DG  J "C3'" 1 
ATOM   5531  O "O3'" . DG  B 1 125 ? 28.577  40.976 -26.786 1.00 152.65 ? 271  DG  J "O3'" 1 
ATOM   5532  C "C2'" . DG  B 1 125 ? 30.733  40.228 -27.630 1.00 150.29 ? 271  DG  J "C2'" 1 
ATOM   5533  C "C1'" . DG  B 1 125 ? 31.062  41.584 -27.196 1.00 149.74 ? 271  DG  J "C1'" 1 
ATOM   5534  N N9    . DG  B 1 125 ? 32.188  42.195 -27.860 1.00 143.10 ? 271  DG  J N9    1 
ATOM   5535  C C8    . DG  B 1 125 ? 33.221  41.535 -28.449 1.00 143.17 ? 271  DG  J C8    1 
ATOM   5536  N N7    . DG  B 1 125 ? 34.111  42.328 -28.955 1.00 142.72 ? 271  DG  J N7    1 
ATOM   5537  C C5    . DG  B 1 125 ? 33.632  43.598 -28.681 1.00 142.31 ? 271  DG  J C5    1 
ATOM   5538  C C6    . DG  B 1 125 ? 34.190  44.841 -28.959 1.00 141.93 ? 271  DG  J C6    1 
ATOM   5539  O O6    . DG  B 1 125 ? 35.254  45.083 -29.531 1.00 141.27 ? 271  DG  J O6    1 
ATOM   5540  N N1    . DG  B 1 125 ? 33.381  45.882 -28.501 1.00 142.22 ? 271  DG  J N1    1 
ATOM   5541  C C2    . DG  B 1 125 ? 32.168  45.725 -27.869 1.00 142.18 ? 271  DG  J C2    1 
ATOM   5542  N N2    . DG  B 1 125 ? 31.522  46.849 -27.522 1.00 142.14 ? 271  DG  J N2    1 
ATOM   5543  N N3    . DG  B 1 125 ? 31.631  44.551 -27.607 1.00 142.32 ? 271  DG  J N3    1 
ATOM   5544  C C4    . DG  B 1 125 ? 32.427  43.534 -28.028 1.00 142.71 ? 271  DG  J C4    1 
ATOM   5545  P P     . DA  B 1 126 ? 27.734  41.006 -28.126 1.00 199.99 ? 272  DA  J P     1 
ATOM   5546  O OP1   . DA  B 1 126 ? 26.683  40.120 -27.519 1.00 193.84 ? 272  DA  J OP1   1 
ATOM   5547  O OP2   . DA  B 1 126 ? 28.406  40.622 -29.383 1.00 193.58 ? 272  DA  J OP2   1 
ATOM   5548  O "O5'" . DA  B 1 126 ? 27.276  42.534 -28.214 1.00 200.15 ? 272  DA  J "O5'" 1 
ATOM   5549  C "C5'" . DA  B 1 126 ? 26.713  43.210 -27.110 1.00 200.15 ? 272  DA  J "C5'" 1 
ATOM   5550  C "C4'" . DA  B 1 126 ? 26.248  44.559 -27.579 1.00 200.15 ? 272  DA  J "C4'" 1 
ATOM   5551  O "O4'" . DA  B 1 126 ? 27.500  45.275 -27.850 1.00 200.15 ? 272  DA  J "O4'" 1 
ATOM   5552  C "C3'" . DA  B 1 126 ? 25.520  44.262 -28.909 1.00 200.15 ? 272  DA  J "C3'" 1 
ATOM   5553  O "O3'" . DA  B 1 126 ? 24.104  44.742 -28.874 1.00 200.15 ? 272  DA  J "O3'" 1 
ATOM   5554  C "C2'" . DA  B 1 126 ? 26.526  44.732 -29.971 1.00 200.15 ? 272  DA  J "C2'" 1 
ATOM   5555  C "C1'" . DA  B 1 126 ? 27.561  45.621 -29.219 1.00 200.15 ? 272  DA  J "C1'" 1 
ATOM   5556  N N9    . DA  B 1 126 ? 28.949  45.486 -29.696 1.00 198.22 ? 272  DA  J N9    1 
ATOM   5557  C C8    . DA  B 1 126 ? 29.627  44.320 -30.003 1.00 198.37 ? 272  DA  J C8    1 
ATOM   5558  N N7    . DA  B 1 126 ? 30.843  44.516 -30.482 1.00 198.55 ? 272  DA  J N7    1 
ATOM   5559  C C5    . DA  B 1 126 ? 30.989  45.903 -30.478 1.00 198.63 ? 272  DA  J C5    1 
ATOM   5560  C C6    . DA  B 1 126 ? 32.064  46.758 -30.853 1.00 198.47 ? 272  DA  J C6    1 
ATOM   5561  N N6    . DA  B 1 126 ? 33.233  46.330 -31.345 1.00 198.31 ? 272  DA  J N6    1 
ATOM   5562  N N1    . DA  B 1 126 ? 31.881  48.086 -30.702 1.00 198.31 ? 272  DA  J N1    1 
ATOM   5563  C C2    . DA  B 1 126 ? 30.712  48.516 -30.212 1.00 198.49 ? 272  DA  J C2    1 
ATOM   5564  N N3    . DA  B 1 126 ? 29.640  47.826 -29.824 1.00 198.56 ? 272  DA  J N3    1 
ATOM   5565  C C4    . DA  B 1 126 ? 29.838  46.504 -29.984 1.00 198.60 ? 272  DA  J C4    1 
ATOM   5566  P P     . DA  B 1 127 ? 23.262  44.958 -30.215 1.00 161.07 ? 273  DA  J P     1 
ATOM   5567  O OP1   . DA  B 1 127 ? 21.798  45.377 -29.948 1.00 184.05 ? 273  DA  J OP1   1 
ATOM   5568  O OP2   . DA  B 1 127 ? 23.536  43.939 -31.205 1.00 184.09 ? 273  DA  J OP2   1 
ATOM   5569  O "O5'" . DA  B 1 127 ? 24.182  46.018 -30.902 1.00 161.03 ? 273  DA  J "O5'" 1 
ATOM   5570  C "C5'" . DA  B 1 127 ? 24.749  47.032 -30.116 1.00 161.14 ? 273  DA  J "C5'" 1 
ATOM   5571  C "C4'" . DA  B 1 127 ? 25.178  48.123 -31.039 1.00 161.12 ? 273  DA  J "C4'" 1 
ATOM   5572  O "O4'" . DA  B 1 127 ? 26.494  47.814 -31.533 1.00 161.85 ? 273  DA  J "O4'" 1 
ATOM   5573  C "C3'" . DA  B 1 127 ? 24.229  48.053 -32.239 1.00 160.75 ? 273  DA  J "C3'" 1 
ATOM   5574  O "O3'" . DA  B 1 127 ? 23.848  49.386 -32.533 1.00 158.73 ? 273  DA  J "O3'" 1 
ATOM   5575  C "C2'" . DA  B 1 127 ? 25.040  47.395 -33.346 1.00 161.51 ? 273  DA  J "C2'" 1 
ATOM   5576  C "C1'" . DA  B 1 127 ? 26.451  47.793 -32.952 1.00 162.18 ? 273  DA  J "C1'" 1 
ATOM   5577  N N9    . DA  B 1 127 ? 27.497  46.890 -33.406 1.00 185.72 ? 273  DA  J N9    1 
ATOM   5578  C C8    . DA  B 1 127 ? 27.365  45.592 -33.809 1.00 185.97 ? 273  DA  J C8    1 
ATOM   5579  N N7    . DA  B 1 127 ? 28.496  45.032 -34.159 1.00 185.84 ? 273  DA  J N7    1 
ATOM   5580  C C5    . DA  B 1 127 ? 29.437  46.033 -33.971 1.00 185.32 ? 273  DA  J C5    1 
ATOM   5581  C C6    . DA  B 1 127 ? 30.829  46.080 -34.165 1.00 185.02 ? 273  DA  J C6    1 
ATOM   5582  N N6    . DA  B 1 127 ? 31.556  45.047 -34.606 1.00 184.79 ? 273  DA  J N6    1 
ATOM   5583  N N1    . DA  B 1 127 ? 31.463  47.240 -33.887 1.00 184.82 ? 273  DA  J N1    1 
ATOM   5584  C C2    . DA  B 1 127 ? 30.745  48.269 -33.440 1.00 184.83 ? 273  DA  J C2    1 
ATOM   5585  N N3    . DA  B 1 127 ? 29.442  48.347 -33.210 1.00 185.16 ? 273  DA  J N3    1 
ATOM   5586  C C4    . DA  B 1 127 ? 28.836  47.184 -33.506 1.00 185.39 ? 273  DA  J C4    1 
ATOM   5587  P P     . DT  B 1 128 ? 23.108  49.756 -33.908 1.00 201.47 ? 274  DT  J P     1 
ATOM   5588  O OP1   . DT  B 1 128 ? 22.008  50.699 -33.538 1.00 145.53 ? 274  DT  J OP1   1 
ATOM   5589  O OP2   . DT  B 1 128 ? 22.790  48.524 -34.648 1.00 145.34 ? 274  DT  J OP2   1 
ATOM   5590  O "O5'" . DT  B 1 128 ? 24.218  50.592 -34.689 1.00 201.47 ? 274  DT  J "O5'" 1 
ATOM   5591  C "C5'" . DT  B 1 128 ? 24.982  51.588 -33.999 1.00 201.47 ? 274  DT  J "C5'" 1 
ATOM   5592  C "C4'" . DT  B 1 128 ? 26.058  52.147 -34.899 1.00 201.47 ? 274  DT  J "C4'" 1 
ATOM   5593  O "O4'" . DT  B 1 128 ? 27.116  51.172 -35.081 1.00 201.47 ? 274  DT  J "O4'" 1 
ATOM   5594  C "C3'" . DT  B 1 128 ? 25.586  52.542 -36.300 1.00 201.47 ? 274  DT  J "C3'" 1 
ATOM   5595  O "O3'" . DT  B 1 128 ? 26.150  53.808 -36.657 1.00 201.47 ? 274  DT  J "O3'" 1 
ATOM   5596  C "C2'" . DT  B 1 128 ? 26.118  51.425 -37.182 1.00 201.47 ? 274  DT  J "C2'" 1 
ATOM   5597  C "C1'" . DT  B 1 128 ? 27.396  51.023 -36.463 1.00 201.47 ? 274  DT  J "C1'" 1 
ATOM   5598  N N1    . DT  B 1 128 ? 27.833  49.626 -36.700 1.00 138.79 ? 274  DT  J N1    1 
ATOM   5599  C C2    . DT  B 1 128 ? 29.143  49.282 -36.413 1.00 138.90 ? 274  DT  J C2    1 
ATOM   5600  O O2    . DT  B 1 128 ? 29.965  50.068 -35.965 1.00 138.83 ? 274  DT  J O2    1 
ATOM   5601  N N3    . DT  B 1 128 ? 29.459  47.974 -36.676 1.00 138.57 ? 274  DT  J N3    1 
ATOM   5602  C C4    . DT  B 1 128 ? 28.625  47.001 -37.192 1.00 138.28 ? 274  DT  J C4    1 
ATOM   5603  O O4    . DT  B 1 128 ? 29.054  45.871 -37.378 1.00 138.22 ? 274  DT  J O4    1 
ATOM   5604  C C5    . DT  B 1 128 ? 27.272  47.427 -37.474 1.00 138.10 ? 274  DT  J C5    1 
ATOM   5605  C C7    . DT  B 1 128 ? 26.304  46.443 -38.051 1.00 137.66 ? 274  DT  J C7    1 
ATOM   5606  C C6    . DT  B 1 128 ? 26.946  48.698 -37.210 1.00 138.33 ? 274  DT  J C6    1 
ATOM   5607  P P     . DC  B 1 129 ? 26.154  54.281 -38.191 1.00 175.07 ? 275  DC  J P     1 
ATOM   5608  O OP1   . DC  B 1 129 ? 26.042  55.764 -38.196 1.00 128.48 ? 275  DC  J OP1   1 
ATOM   5609  O OP2   . DC  B 1 129 ? 25.173  53.468 -38.961 1.00 128.15 ? 275  DC  J OP2   1 
ATOM   5610  O "O5'" . DC  B 1 129 ? 27.623  53.893 -38.668 1.00 172.06 ? 275  DC  J "O5'" 1 
ATOM   5611  C "C5'" . DC  B 1 129 ? 28.747  54.126 -37.815 1.00 165.77 ? 275  DC  J "C5'" 1 
ATOM   5612  C "C4'" . DC  B 1 129 ? 30.035  53.891 -38.568 1.00 160.83 ? 275  DC  J "C4'" 1 
ATOM   5613  O "O4'" . DC  B 1 129 ? 30.257  52.474 -38.761 1.00 159.28 ? 275  DC  J "O4'" 1 
ATOM   5614  C "C3'" . DC  B 1 129 ? 30.051  54.518 -39.958 1.00 157.27 ? 275  DC  J "C3'" 1 
ATOM   5615  O "O3'" . DC  B 1 129 ? 31.333  55.067 -40.231 1.00 151.43 ? 275  DC  J "O3'" 1 
ATOM   5616  C "C2'" . DC  B 1 129 ? 29.756  53.350 -40.880 1.00 157.05 ? 275  DC  J "C2'" 1 
ATOM   5617  C "C1'" . DC  B 1 129 ? 30.381  52.178 -40.144 1.00 157.93 ? 275  DC  J "C1'" 1 
ATOM   5618  N N1    . DC  B 1 129 ? 29.709  50.891 -40.388 1.00 110.64 ? 275  DC  J N1    1 
ATOM   5619  C C2    . DC  B 1 129 ? 30.484  49.778 -40.736 1.00 110.57 ? 275  DC  J C2    1 
ATOM   5620  O O2    . DC  B 1 129 ? 31.713  49.907 -40.820 1.00 110.35 ? 275  DC  J O2    1 
ATOM   5621  N N3    . DC  B 1 129 ? 29.872  48.591 -40.970 1.00 110.27 ? 275  DC  J N3    1 
ATOM   5622  C C4    . DC  B 1 129 ? 28.543  48.494 -40.866 1.00 110.69 ? 275  DC  J C4    1 
ATOM   5623  N N4    . DC  B 1 129 ? 27.977  47.308 -41.107 1.00 110.79 ? 275  DC  J N4    1 
ATOM   5624  C C5    . DC  B 1 129 ? 27.732  49.613 -40.508 1.00 110.51 ? 275  DC  J C5    1 
ATOM   5625  C C6    . DC  B 1 129 ? 28.351  50.780 -40.281 1.00 110.48 ? 275  DC  J C6    1 
ATOM   5626  P P     . DT  B 1 130 ? 31.528  56.000 -41.519 1.00 102.44 ? 276  DT  J P     1 
ATOM   5627  O OP1   . DT  B 1 130 ? 32.488  57.070 -41.153 1.00 110.44 ? 276  DT  J OP1   1 
ATOM   5628  O OP2   . DT  B 1 130 ? 30.190  56.359 -42.044 1.00 111.06 ? 276  DT  J OP2   1 
ATOM   5629  O "O5'" . DT  B 1 130 ? 32.224  55.033 -42.577 1.00 97.41  ? 276  DT  J "O5'" 1 
ATOM   5630  C "C5'" . DT  B 1 130 ? 33.562  54.583 -42.376 1.00 87.00  ? 276  DT  J "C5'" 1 
ATOM   5631  C "C4'" . DT  B 1 130 ? 33.999  53.698 -43.519 1.00 80.29  ? 276  DT  J "C4'" 1 
ATOM   5632  O "O4'" . DT  B 1 130 ? 33.296  52.429 -43.464 1.00 78.67  ? 276  DT  J "O4'" 1 
ATOM   5633  C "C3'" . DT  B 1 130 ? 33.735  54.272 -44.912 1.00 76.29  ? 276  DT  J "C3'" 1 
ATOM   5634  O "O3'" . DT  B 1 130 ? 34.840  53.970 -45.766 1.00 70.17  ? 276  DT  J "O3'" 1 
ATOM   5635  C "C2'" . DT  B 1 130 ? 32.518  53.488 -45.375 1.00 76.17  ? 276  DT  J "C2'" 1 
ATOM   5636  C "C1'" . DT  B 1 130 ? 32.809  52.136 -44.758 1.00 79.21  ? 276  DT  J "C1'" 1 
ATOM   5637  N N1    . DT  B 1 130 ? 31.678  51.197 -44.633 1.00 90.21  ? 276  DT  J N1    1 
ATOM   5638  C C2    . DT  B 1 130 ? 31.892  49.892 -45.020 1.00 92.44  ? 276  DT  J C2    1 
ATOM   5639  O O2    . DT  B 1 130 ? 32.956  49.495 -45.454 1.00 91.96  ? 276  DT  J O2    1 
ATOM   5640  N N3    . DT  B 1 130 ? 30.812  49.064 -44.879 1.00 94.07  ? 276  DT  J N3    1 
ATOM   5641  C C4    . DT  B 1 130 ? 29.564  49.397 -44.398 1.00 96.06  ? 276  DT  J C4    1 
ATOM   5642  O O4    . DT  B 1 130 ? 28.691  48.529 -44.313 1.00 98.12  ? 276  DT  J O4    1 
ATOM   5643  C C5    . DT  B 1 130 ? 29.403  50.791 -44.018 1.00 95.95  ? 276  DT  J C5    1 
ATOM   5644  C C7    . DT  B 1 130 ? 28.079  51.258 -43.501 1.00 96.02  ? 276  DT  J C7    1 
ATOM   5645  C C6    . DT  B 1 130 ? 30.457  51.607 -44.151 1.00 93.72  ? 276  DT  J C6    1 
ATOM   5646  P P     . DG  B 1 131 ? 35.621  55.155 -46.511 1.00 54.49  ? 277  DG  J P     1 
ATOM   5647  O OP1   . DG  B 1 131 ? 36.293  55.937 -45.455 1.00 75.23  ? 277  DG  J OP1   1 
ATOM   5648  O OP2   . DG  B 1 131 ? 34.703  55.826 -47.468 1.00 74.63  ? 277  DG  J OP2   1 
ATOM   5649  O "O5'" . DG  B 1 131 ? 36.748  54.411 -47.355 1.00 53.19  ? 277  DG  J "O5'" 1 
ATOM   5650  C "C5'" . DG  B 1 131 ? 37.875  53.809 -46.710 1.00 45.72  ? 277  DG  J "C5'" 1 
ATOM   5651  C "C4'" . DG  B 1 131 ? 38.136  52.427 -47.268 1.00 42.66  ? 277  DG  J "C4'" 1 
ATOM   5652  O "O4'" . DG  B 1 131 ? 36.956  51.627 -47.070 1.00 44.59  ? 277  DG  J "O4'" 1 
ATOM   5653  C "C3'" . DG  B 1 131 ? 38.459  52.345 -48.765 1.00 40.81  ? 277  DG  J "C3'" 1 
ATOM   5654  O "O3'" . DG  B 1 131 ? 39.386  51.290 -48.983 1.00 35.05  ? 277  DG  J "O3'" 1 
ATOM   5655  C "C2'" . DG  B 1 131 ? 37.138  51.976 -49.403 1.00 41.49  ? 277  DG  J "C2'" 1 
ATOM   5656  C "C1'" . DG  B 1 131 ? 36.505  51.119 -48.322 1.00 46.05  ? 277  DG  J "C1'" 1 
ATOM   5657  N N9    . DG  B 1 131 ? 35.052  51.172 -48.310 1.00 72.20  ? 277  DG  J N9    1 
ATOM   5658  C C8    . DG  B 1 131 ? 34.266  52.295 -48.280 1.00 73.81  ? 277  DG  J C8    1 
ATOM   5659  N N7    . DG  B 1 131 ? 32.993  52.025 -48.259 1.00 75.58  ? 277  DG  J N7    1 
ATOM   5660  C C5    . DG  B 1 131 ? 32.936  50.640 -48.276 1.00 77.65  ? 277  DG  J C5    1 
ATOM   5661  C C6    . DG  B 1 131 ? 31.821  49.768 -48.252 1.00 80.94  ? 277  DG  J C6    1 
ATOM   5662  O O6    . DG  B 1 131 ? 30.612  50.059 -48.207 1.00 83.80  ? 277  DG  J O6    1 
ATOM   5663  N N1    . DG  B 1 131 ? 32.220  48.433 -48.277 1.00 80.54  ? 277  DG  J N1    1 
ATOM   5664  C C2    . DG  B 1 131 ? 33.521  47.998 -48.314 1.00 80.09  ? 277  DG  J C2    1 
ATOM   5665  N N2    . DG  B 1 131 ? 33.698  46.678 -48.324 1.00 79.13  ? 277  DG  J N2    1 
ATOM   5666  N N3    . DG  B 1 131 ? 34.567  48.800 -48.335 1.00 77.87  ? 277  DG  J N3    1 
ATOM   5667  C C4    . DG  B 1 131 ? 34.202  50.100 -48.313 1.00 75.33  ? 277  DG  J C4    1 
ATOM   5668  P P     . DC  B 1 132 ? 40.342  51.321 -50.260 1.00 50.75  ? 278  DC  J P     1 
ATOM   5669  O OP1   . DC  B 1 132 ? 41.722  51.167 -49.744 1.00 46.55  ? 278  DC  J OP1   1 
ATOM   5670  O OP2   . DC  B 1 132 ? 40.001  52.487 -51.101 1.00 48.70  ? 278  DC  J OP2   1 
ATOM   5671  O "O5'" . DC  B 1 132 ? 39.898  50.014 -51.051 1.00 51.22  ? 278  DC  J "O5'" 1 
ATOM   5672  C "C5'" . DC  B 1 132 ? 39.550  48.820 -50.349 1.00 51.70  ? 278  DC  J "C5'" 1 
ATOM   5673  C "C4'" . DC  B 1 132 ? 38.616  47.960 -51.173 1.00 57.48  ? 278  DC  J "C4'" 1 
ATOM   5674  O "O4'" . DC  B 1 132 ? 37.224  48.238 -50.904 1.00 55.54  ? 278  DC  J "O4'" 1 
ATOM   5675  C "C3'" . DC  B 1 132 ? 38.775  48.041 -52.692 1.00 58.15  ? 278  DC  J "C3'" 1 
ATOM   5676  O "O3'" . DC  B 1 132 ? 38.578  46.740 -53.238 1.00 61.29  ? 278  DC  J "O3'" 1 
ATOM   5677  C "C2'" . DC  B 1 132 ? 37.589  48.890 -53.115 1.00 59.03  ? 278  DC  J "C2'" 1 
ATOM   5678  C "C1'" . DC  B 1 132 ? 36.544  48.378 -52.149 1.00 59.19  ? 278  DC  J "C1'" 1 
ATOM   5679  N N1    . DC  B 1 132 ? 35.365  49.230 -51.936 1.00 57.47  ? 278  DC  J N1    1 
ATOM   5680  C C2    . DC  B 1 132 ? 34.142  48.603 -51.705 1.00 58.77  ? 278  DC  J C2    1 
ATOM   5681  O O2    . DC  B 1 132 ? 34.092  47.365 -51.737 1.00 57.17  ? 278  DC  J O2    1 
ATOM   5682  N N3    . DC  B 1 132 ? 33.050  49.352 -51.451 1.00 61.38  ? 278  DC  J N3    1 
ATOM   5683  C C4    . DC  B 1 132 ? 33.146  50.684 -51.429 1.00 61.86  ? 278  DC  J C4    1 
ATOM   5684  N N4    . DC  B 1 132 ? 32.040  51.380 -51.139 1.00 65.12  ? 278  DC  J N4    1 
ATOM   5685  C C5    . DC  B 1 132 ? 34.382  51.356 -51.693 1.00 61.29  ? 278  DC  J C5    1 
ATOM   5686  C C6    . DC  B 1 132 ? 35.455  50.597 -51.941 1.00 58.09  ? 278  DC  J C6    1 
ATOM   5687  P P     . DA  B 1 133 ? 39.837  45.864 -53.680 1.00 66.02  ? 279  DA  J P     1 
ATOM   5688  O OP1   . DA  B 1 133 ? 40.813  45.923 -52.564 1.00 67.46  ? 279  DA  J OP1   1 
ATOM   5689  O OP2   . DA  B 1 133 ? 40.260  46.237 -55.052 1.00 60.01  ? 279  DA  J OP2   1 
ATOM   5690  O "O5'" . DA  B 1 133 ? 39.224  44.401 -53.719 1.00 70.23  ? 279  DA  J "O5'" 1 
ATOM   5691  C "C5'" . DA  B 1 133 ? 38.629  43.833 -52.559 1.00 73.27  ? 279  DA  J "C5'" 1 
ATOM   5692  C "C4'" . DA  B 1 133 ? 37.328  43.160 -52.928 1.00 77.63  ? 279  DA  J "C4'" 1 
ATOM   5693  O "O4'" . DA  B 1 133 ? 36.289  44.151 -53.076 1.00 77.10  ? 279  DA  J "O4'" 1 
ATOM   5694  C "C3'" . DA  B 1 133 ? 37.379  42.403 -54.253 1.00 78.62  ? 279  DA  J "C3'" 1 
ATOM   5695  O "O3'" . DA  B 1 133 ? 36.578  41.222 -54.175 1.00 85.64  ? 279  DA  J "O3'" 1 
ATOM   5696  C "C2'" . DA  B 1 133 ? 36.791  43.392 -55.243 1.00 77.08  ? 279  DA  J "C2'" 1 
ATOM   5697  C "C1'" . DA  B 1 133 ? 35.753  44.108 -54.397 1.00 76.09  ? 279  DA  J "C1'" 1 
ATOM   5698  N N9    . DA  B 1 133 ? 35.449  45.486 -54.792 1.00 72.60  ? 279  DA  J N9    1 
ATOM   5699  C C8    . DA  B 1 133 ? 36.322  46.451 -55.221 1.00 70.06  ? 279  DA  J C8    1 
ATOM   5700  N N7    . DA  B 1 133 ? 35.769  47.627 -55.385 1.00 69.34  ? 279  DA  J N7    1 
ATOM   5701  C C5    . DA  B 1 133 ? 34.435  47.417 -55.068 1.00 72.69  ? 279  DA  J C5    1 
ATOM   5702  C C6    . DA  B 1 133 ? 33.324  48.282 -55.022 1.00 72.88  ? 279  DA  J C6    1 
ATOM   5703  N N6    . DA  B 1 133 ? 33.390  49.585 -55.292 1.00 72.71  ? 279  DA  J N6    1 
ATOM   5704  N N1    . DA  B 1 133 ? 32.131  47.756 -54.679 1.00 74.42  ? 279  DA  J N1    1 
ATOM   5705  C C2    . DA  B 1 133 ? 32.067  46.450 -54.400 1.00 72.33  ? 279  DA  J C2    1 
ATOM   5706  N N3    . DA  B 1 133 ? 33.041  45.537 -54.396 1.00 74.19  ? 279  DA  J N3    1 
ATOM   5707  C C4    . DA  B 1 133 ? 34.216  46.095 -54.738 1.00 72.70  ? 279  DA  J C4    1 
ATOM   5708  P P     . DG  B 1 134 ? 36.745  40.079 -55.285 1.00 103.17 ? 280  DG  J P     1 
ATOM   5709  O OP1   . DG  B 1 134 ? 36.681  38.773 -54.589 1.00 77.22  ? 280  DG  J OP1   1 
ATOM   5710  O OP2   . DG  B 1 134 ? 37.917  40.411 -56.129 1.00 75.12  ? 280  DG  J OP2   1 
ATOM   5711  O "O5'" . DG  B 1 134 ? 35.438  40.232 -56.169 1.00 104.71 ? 280  DG  J "O5'" 1 
ATOM   5712  C "C5'" . DG  B 1 134 ? 34.152  40.143 -55.570 1.00 108.04 ? 280  DG  J "C5'" 1 
ATOM   5713  C "C4'" . DG  B 1 134 ? 33.106  40.615 -56.547 1.00 109.84 ? 280  DG  J "C4'" 1 
ATOM   5714  O "O4'" . DG  B 1 134 ? 33.230  42.050 -56.719 1.00 109.70 ? 280  DG  J "O4'" 1 
ATOM   5715  C "C3'" . DG  B 1 134 ? 33.261  40.003 -57.942 1.00 111.62 ? 280  DG  J "C3'" 1 
ATOM   5716  O "O3'" . DG  B 1 134 ? 31.964  39.718 -58.492 1.00 114.17 ? 280  DG  J "O3'" 1 
ATOM   5717  C "C2'" . DG  B 1 134 ? 33.979  41.093 -58.720 1.00 110.38 ? 280  DG  J "C2'" 1 
ATOM   5718  C "C1'" . DG  B 1 134 ? 33.409  42.355 -58.095 1.00 109.14 ? 280  DG  J "C1'" 1 
ATOM   5719  N N9    . DG  B 1 134 ? 34.268  43.535 -58.213 1.00 80.70  ? 280  DG  J N9    1 
ATOM   5720  C C8    . DG  B 1 134 ? 35.626  43.548 -58.443 1.00 79.38  ? 280  DG  J C8    1 
ATOM   5721  N N7    . DG  B 1 134 ? 36.117  44.754 -58.565 1.00 76.96  ? 280  DG  J N7    1 
ATOM   5722  C C5    . DG  B 1 134 ? 35.025  45.588 -58.390 1.00 77.75  ? 280  DG  J C5    1 
ATOM   5723  C C6    . DG  B 1 134 ? 34.949  46.986 -58.432 1.00 78.00  ? 280  DG  J C6    1 
ATOM   5724  O O6    . DG  B 1 134 ? 35.864  47.788 -58.632 1.00 74.94  ? 280  DG  J O6    1 
ATOM   5725  N N1    . DG  B 1 134 ? 33.644  47.438 -58.221 1.00 79.00  ? 280  DG  J N1    1 
ATOM   5726  C C2    . DG  B 1 134 ? 32.553  46.627 -58.002 1.00 79.34  ? 280  DG  J C2    1 
ATOM   5727  N N2    . DG  B 1 134 ? 31.374  47.239 -57.841 1.00 79.88  ? 280  DG  J N2    1 
ATOM   5728  N N3    . DG  B 1 134 ? 32.616  45.307 -57.954 1.00 79.64  ? 280  DG  J N3    1 
ATOM   5729  C C4    . DG  B 1 134 ? 33.875  44.857 -58.159 1.00 79.17  ? 280  DG  J C4    1 
ATOM   5730  P P     . DG  B 1 135 ? 31.823  39.048 -59.952 1.00 108.86 ? 281  DG  J P     1 
ATOM   5731  O OP1   . DG  B 1 135 ? 31.122  37.759 -59.748 1.00 82.08  ? 281  DG  J OP1   1 
ATOM   5732  O OP2   . DG  B 1 135 ? 33.105  39.079 -60.706 1.00 80.04  ? 281  DG  J OP2   1 
ATOM   5733  O "O5'" . DG  B 1 135 ? 30.810  40.034 -60.677 1.00 112.09 ? 281  DG  J "O5'" 1 
ATOM   5734  C "C5'" . DG  B 1 135 ? 29.618  40.458 -60.019 1.00 116.71 ? 281  DG  J "C5'" 1 
ATOM   5735  C "C4'" . DG  B 1 135 ? 28.942  41.537 -60.828 1.00 120.77 ? 281  DG  J "C4'" 1 
ATOM   5736  O "O4'" . DG  B 1 135 ? 29.542  42.831 -60.556 1.00 120.57 ? 281  DG  J "O4'" 1 
ATOM   5737  C "C3'" . DG  B 1 135 ? 29.063  41.305 -62.335 1.00 123.84 ? 281  DG  J "C3'" 1 
ATOM   5738  O "O3'" . DG  B 1 135 ? 27.801  41.453 -62.985 1.00 129.24 ? 281  DG  J "O3'" 1 
ATOM   5739  C "C2'" . DG  B 1 135 ? 30.067  42.352 -62.793 1.00 122.67 ? 281  DG  J "C2'" 1 
ATOM   5740  C "C1'" . DG  B 1 135 ? 29.914  43.470 -61.772 1.00 120.79 ? 281  DG  J "C1'" 1 
ATOM   5741  N N9    . DG  B 1 135 ? 31.160  44.202 -61.543 1.00 91.02  ? 281  DG  J N9    1 
ATOM   5742  C C8    . DG  B 1 135 ? 32.398  43.650 -61.319 1.00 90.49  ? 281  DG  J C8    1 
ATOM   5743  N N7    . DG  B 1 135 ? 33.346  44.540 -61.197 1.00 90.23  ? 281  DG  J N7    1 
ATOM   5744  C C5    . DG  B 1 135 ? 32.697  45.758 -61.339 1.00 89.85  ? 281  DG  J C5    1 
ATOM   5745  C C6    . DG  B 1 135 ? 33.217  47.082 -61.317 1.00 89.09  ? 281  DG  J C6    1 
ATOM   5746  O O6    . DG  B 1 135 ? 34.391  47.449 -61.171 1.00 88.07  ? 281  DG  J O6    1 
ATOM   5747  N N1    . DG  B 1 135 ? 32.216  48.026 -61.495 1.00 89.75  ? 281  DG  J N1    1 
ATOM   5748  C C2    . DG  B 1 135 ? 30.887  47.743 -61.679 1.00 90.02  ? 281  DG  J C2    1 
ATOM   5749  N N2    . DG  B 1 135 ? 30.080  48.808 -61.827 1.00 90.86  ? 281  DG  J N2    1 
ATOM   5750  N N3    . DG  B 1 135 ? 30.386  46.511 -61.714 1.00 90.16  ? 281  DG  J N3    1 
ATOM   5751  C C4    . DG  B 1 135 ? 31.344  45.574 -61.538 1.00 90.67  ? 281  DG  J C4    1 
ATOM   5752  P P     . DT  B 1 136 ? 27.726  41.458 -64.591 1.00 154.35 ? 282  DT  J P     1 
ATOM   5753  O OP1   . DT  B 1 136 ? 26.367  40.974 -64.970 1.00 86.84  ? 282  DT  J OP1   1 
ATOM   5754  O OP2   . DT  B 1 136 ? 28.935  40.792 -65.161 1.00 86.55  ? 282  DT  J OP2   1 
ATOM   5755  O "O5'" . DT  B 1 136 ? 27.840  43.007 -64.928 1.00 155.16 ? 282  DT  J "O5'" 1 
ATOM   5756  C "C5'" . DT  B 1 136 ? 26.899  43.936 -64.399 1.00 157.54 ? 282  DT  J "C5'" 1 
ATOM   5757  C "C4'" . DT  B 1 136 ? 26.883  45.174 -65.257 1.00 159.22 ? 282  DT  J "C4'" 1 
ATOM   5758  O "O4'" . DT  B 1 136 ? 27.956  46.061 -64.858 1.00 158.52 ? 282  DT  J "O4'" 1 
ATOM   5759  C "C3'" . DT  B 1 136 ? 27.133  44.826 -66.723 1.00 161.08 ? 282  DT  J "C3'" 1 
ATOM   5760  O "O3'" . DT  B 1 136 ? 26.287  45.567 -67.593 1.00 164.93 ? 282  DT  J "O3'" 1 
ATOM   5761  C "C2'" . DT  B 1 136 ? 28.580  45.217 -66.943 1.00 159.58 ? 282  DT  J "C2'" 1 
ATOM   5762  C "C1'" . DT  B 1 136 ? 28.746  46.377 -65.987 1.00 157.51 ? 282  DT  J "C1'" 1 
ATOM   5763  N N1    . DT  B 1 136 ? 30.134  46.569 -65.545 1.00 87.77  ? 282  DT  J N1    1 
ATOM   5764  C C2    . DT  B 1 136 ? 30.591  47.854 -65.436 1.00 86.66  ? 282  DT  J C2    1 
ATOM   5765  O O2    . DT  B 1 136 ? 29.882  48.821 -65.629 1.00 86.74  ? 282  DT  J O2    1 
ATOM   5766  N N3    . DT  B 1 136 ? 31.916  47.970 -65.092 1.00 86.00  ? 282  DT  J N3    1 
ATOM   5767  C C4    . DT  B 1 136 ? 32.807  46.943 -64.853 1.00 85.61  ? 282  DT  J C4    1 
ATOM   5768  O O4    . DT  B 1 136 ? 33.976  47.201 -64.578 1.00 84.89  ? 282  DT  J O4    1 
ATOM   5769  C C5    . DT  B 1 136 ? 32.250  45.610 -64.963 1.00 86.01  ? 282  DT  J C5    1 
ATOM   5770  C C7    . DT  B 1 136 ? 33.136  44.429 -64.727 1.00 85.55  ? 282  DT  J C7    1 
ATOM   5771  C C6    . DT  B 1 136 ? 30.954  45.494 -65.285 1.00 86.82  ? 282  DT  J C6    1 
ATOM   5772  P P     . DG  B 1 137 ? 26.327  45.268 -69.169 1.00 139.86 ? 283  DG  J P     1 
ATOM   5773  O OP1   . DG  B 1 137 ? 24.946  44.911 -69.599 1.00 120.92 ? 283  DG  J OP1   1 
ATOM   5774  O OP2   . DG  B 1 137 ? 27.444  44.325 -69.437 1.00 120.48 ? 283  DG  J OP2   1 
ATOM   5775  O "O5'" . DG  B 1 137 ? 26.721  46.682 -69.781 1.00 140.14 ? 283  DG  J "O5'" 1 
ATOM   5776  C "C5'" . DG  B 1 137 ? 26.260  47.882 -69.172 1.00 141.32 ? 283  DG  J "C5'" 1 
ATOM   5777  C "C4'" . DG  B 1 137 ? 27.104  49.046 -69.626 1.00 142.00 ? 283  DG  J "C4'" 1 
ATOM   5778  O "O4'" . DG  B 1 137 ? 28.416  48.976 -69.017 1.00 141.89 ? 283  DG  J "O4'" 1 
ATOM   5779  C "C3'" . DG  B 1 137 ? 27.336  49.071 -71.135 1.00 142.64 ? 283  DG  J "C3'" 1 
ATOM   5780  O "O3'" . DG  B 1 137 ? 27.294  50.418 -71.603 1.00 143.89 ? 283  DG  J "O3'" 1 
ATOM   5781  C "C2'" . DG  B 1 137 ? 28.732  48.495 -71.285 1.00 142.32 ? 283  DG  J "C2'" 1 
ATOM   5782  C "C1'" . DG  B 1 137 ? 29.415  48.997 -70.025 1.00 141.30 ? 283  DG  J "C1'" 1 
ATOM   5783  N N9    . DG  B 1 137 ? 30.535  48.179 -69.566 1.00 120.43 ? 283  DG  J N9    1 
ATOM   5784  C C8    . DG  B 1 137 ? 30.618  46.803 -69.569 1.00 119.76 ? 283  DG  J C8    1 
ATOM   5785  N N7    . DG  B 1 137 ? 31.749  46.356 -69.092 1.00 119.17 ? 283  DG  J N7    1 
ATOM   5786  C C5    . DG  B 1 137 ? 32.458  47.505 -68.751 1.00 118.69 ? 283  DG  J C5    1 
ATOM   5787  C C6    . DG  B 1 137 ? 33.759  47.657 -68.187 1.00 118.17 ? 283  DG  J C6    1 
ATOM   5788  O O6    . DG  B 1 137 ? 34.569  46.776 -67.861 1.00 117.99 ? 283  DG  J O6    1 
ATOM   5789  N N1    . DG  B 1 137 ? 34.089  49.000 -68.016 1.00 117.19 ? 283  DG  J N1    1 
ATOM   5790  C C2    . DG  B 1 137 ? 33.283  50.060 -68.345 1.00 117.09 ? 283  DG  J C2    1 
ATOM   5791  N N2    . DG  B 1 137 ? 33.792  51.274 -68.114 1.00 115.86 ? 283  DG  J N2    1 
ATOM   5792  N N3    . DG  B 1 137 ? 32.070  49.936 -68.866 1.00 117.72 ? 283  DG  J N3    1 
ATOM   5793  C C4    . DG  B 1 137 ? 31.724  48.640 -69.041 1.00 118.95 ? 283  DG  J C4    1 
ATOM   5794  P P     . DG  B 1 138 ? 27.036  50.707 -73.158 1.00 158.01 ? 284  DG  J P     1 
ATOM   5795  O OP1   . DG  B 1 138 ? 25.744  51.435 -73.303 1.00 92.86  ? 284  DG  J OP1   1 
ATOM   5796  O OP2   . DG  B 1 138 ? 27.235  49.406 -73.853 1.00 93.25  ? 284  DG  J OP2   1 
ATOM   5797  O "O5'" . DG  B 1 138 ? 28.223  51.698 -73.539 1.00 157.85 ? 284  DG  J "O5'" 1 
ATOM   5798  C "C5'" . DG  B 1 138 ? 28.570  52.775 -72.671 1.00 158.60 ? 284  DG  J "C5'" 1 
ATOM   5799  C "C4'" . DG  B 1 138 ? 30.035  53.110 -72.815 1.00 159.45 ? 284  DG  J "C4'" 1 
ATOM   5800  O "O4'" . DG  B 1 138 ? 30.873  52.101 -72.194 1.00 159.81 ? 284  DG  J "O4'" 1 
ATOM   5801  C "C3'" . DG  B 1 138 ? 30.505  53.214 -74.263 1.00 159.70 ? 284  DG  J "C3'" 1 
ATOM   5802  O "O3'" . DG  B 1 138 ? 31.438  54.279 -74.362 1.00 160.08 ? 284  DG  J "O3'" 1 
ATOM   5803  C "C2'" . DG  B 1 138 ? 31.224  51.898 -74.492 1.00 159.56 ? 284  DG  J "C2'" 1 
ATOM   5804  C "C1'" . DG  B 1 138 ? 31.854  51.670 -73.130 1.00 159.26 ? 284  DG  J "C1'" 1 
ATOM   5805  N N9    . DG  B 1 138 ? 32.219  50.287 -72.819 1.00 93.50  ? 284  DG  J N9    1 
ATOM   5806  C C8    . DG  B 1 138 ? 31.501  49.147 -73.107 1.00 93.09  ? 284  DG  J C8    1 
ATOM   5807  N N7    . DG  B 1 138 ? 32.087  48.051 -72.700 1.00 92.50  ? 284  DG  J N7    1 
ATOM   5808  C C5    . DG  B 1 138 ? 33.265  48.492 -72.109 1.00 92.63  ? 284  DG  J C5    1 
ATOM   5809  C C6    . DG  B 1 138 ? 34.307  47.759 -71.482 1.00 92.27  ? 284  DG  J C6    1 
ATOM   5810  O O6    . DG  B 1 138 ? 34.395  46.529 -71.314 1.00 92.37  ? 284  DG  J O6    1 
ATOM   5811  N N1    . DG  B 1 138 ? 35.316  48.603 -71.018 1.00 91.52  ? 284  DG  J N1    1 
ATOM   5812  C C2    . DG  B 1 138 ? 35.319  49.972 -71.135 1.00 91.33  ? 284  DG  J C2    1 
ATOM   5813  N N2    . DG  B 1 138 ? 36.379  50.609 -70.620 1.00 90.72  ? 284  DG  J N2    1 
ATOM   5814  N N3    . DG  B 1 138 ? 34.352  50.666 -71.713 1.00 91.74  ? 284  DG  J N3    1 
ATOM   5815  C C4    . DG  B 1 138 ? 33.363  49.869 -72.175 1.00 92.53  ? 284  DG  J C4    1 
ATOM   5816  P P     . DA  B 1 139 ? 31.334  55.309 -75.579 1.00 147.67 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 139 ? 30.274  56.290 -75.249 1.00 116.10 ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 139 ? 31.243  54.514 -76.831 1.00 115.82 ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 139 ? 32.737  56.052 -75.531 1.00 145.82 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 139 ? 33.224  56.577 -74.304 1.00 142.36 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 139 ? 34.700  56.290 -74.162 1.00 140.17 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 139 ? 34.947  54.907 -73.791 1.00 139.20 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 139 ? 35.511  56.538 -75.432 1.00 138.96 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 139 ? 36.709  57.225 -75.094 1.00 137.35 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 139 ? 35.838  55.140 -75.930 1.00 138.68 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 139 ? 35.970  54.375 -74.627 1.00 138.10 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 139 ? 35.791  52.918 -74.729 1.00 104.68 ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 139 ? 34.768  52.235 -75.344 1.00 104.21 ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 139 ? 34.888  50.929 -75.282 1.00 102.96 ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 139 ? 36.068  50.734 -74.576 1.00 102.28 ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 139 ? 36.753  49.565 -74.177 1.00 101.39 ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 139 ? 36.331  48.325 -74.448 1.00 100.29 ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 139 ? 37.901  49.717 -73.482 1.00 100.77 ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 139 ? 38.328  50.957 -73.217 1.00 101.36 ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 139 ? 37.778  52.129 -73.541 1.00 101.50 ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 139 ? 36.636  51.948 -74.227 1.00 102.82 ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 140 ? 37.901  57.284 -76.155 1.00 162.47 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 140 ? 38.653  58.553 -75.936 1.00 92.03  ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 140 ? 37.320  56.980 -77.498 1.00 91.37  ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 140 ? 38.841  56.093 -75.684 1.00 160.10 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 140 ? 39.521  56.175 -74.437 1.00 155.10 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 140 ? 40.803  55.382 -74.500 1.00 151.93 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 140 ? 40.473  53.975 -74.563 1.00 149.80 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 140 ? 41.647  55.676 -75.739 1.00 150.35 ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 140 ? 43.036  55.637 -75.412 1.00 148.42 ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 140 ? 41.289  54.544 -76.683 1.00 148.80 ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 140 ? 41.044  53.395 -75.723 1.00 147.01 ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 140 ? 40.111  52.367 -76.220 1.00 72.89  ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 140 ? 40.398  51.034 -75.949 1.00 70.65  ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 140 ? 41.379  50.670 -75.296 1.00 68.02  ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 140 ? 39.488  50.138 -76.465 1.00 69.52  ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 140 ? 38.347  50.428 -77.192 1.00 69.58  ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 140 ? 37.622  49.512 -77.580 1.00 68.01  ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 140 ? 38.106  51.845 -77.428 1.00 70.84  ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 140 ? 36.892  52.258 -78.200 1.00 71.43  ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 140 ? 38.990  52.728 -76.937 1.00 71.74  ? 286  DT  J C6    1 
ATOM   5857  P P     . DA  B 1 141 ? 44.130  55.926 -76.552 1.00 126.29 ? 287  DA  J P     1 
ATOM   5858  O OP1   . DA  B 1 141 ? 45.477  55.943 -75.919 1.00 92.85  ? 287  DA  J OP1   1 
ATOM   5859  O OP2   . DA  B 1 141 ? 43.685  57.080 -77.366 1.00 93.37  ? 287  DA  J OP2   1 
ATOM   5860  O "O5'" . DA  B 1 141 ? 44.036  54.654 -77.494 1.00 123.05 ? 287  DA  J "O5'" 1 
ATOM   5861  C "C5'" . DA  B 1 141 ? 45.208  53.946 -77.856 1.00 117.26 ? 287  DA  J "C5'" 1 
ATOM   5862  C "C4'" . DA  B 1 141 ? 45.610  53.005 -76.744 1.00 113.15 ? 287  DA  J "C4'" 1 
ATOM   5863  O "O4'" . DA  B 1 141 ? 44.490  52.176 -76.356 1.00 109.85 ? 287  DA  J "O4'" 1 
ATOM   5864  C "C3'" . DA  B 1 141 ? 46.708  52.044 -77.169 1.00 110.68 ? 287  DA  J "C3'" 1 
ATOM   5865  O "O3'" . DA  B 1 141 ? 47.598  51.762 -76.098 1.00 107.53 ? 287  DA  J "O3'" 1 
ATOM   5866  C "C2'" . DA  B 1 141 ? 45.954  50.813 -77.628 1.00 109.24 ? 287  DA  J "C2'" 1 
ATOM   5867  C "C1'" . DA  B 1 141 ? 44.645  50.853 -76.853 1.00 106.82 ? 287  DA  J "C1'" 1 
ATOM   5868  N N9    . DA  B 1 141 ? 43.490  50.577 -77.708 1.00 70.62  ? 287  DA  J N9    1 
ATOM   5869  C C8    . DA  B 1 141 ? 42.533  51.472 -78.123 1.00 69.87  ? 287  DA  J C8    1 
ATOM   5870  N N7    . DA  B 1 141 ? 41.601  50.941 -78.875 1.00 68.50  ? 287  DA  J N7    1 
ATOM   5871  C C5    . DA  B 1 141 ? 41.970  49.605 -78.970 1.00 68.26  ? 287  DA  J C5    1 
ATOM   5872  C C6    . DA  B 1 141 ? 41.385  48.502 -79.630 1.00 67.59  ? 287  DA  J C6    1 
ATOM   5873  N N6    . DA  B 1 141 ? 40.262  48.574 -80.351 1.00 66.62  ? 287  DA  J N6    1 
ATOM   5874  N N1    . DA  B 1 141 ? 42.005  47.305 -79.517 1.00 67.26  ? 287  DA  J N1    1 
ATOM   5875  C C2    . DA  B 1 141 ? 43.128  47.231 -78.790 1.00 67.42  ? 287  DA  J C2    1 
ATOM   5876  N N3    . DA  B 1 141 ? 43.775  48.192 -78.131 1.00 68.11  ? 287  DA  J N3    1 
ATOM   5877  C C4    . DA  B 1 141 ? 43.136  49.369 -78.259 1.00 69.18  ? 287  DA  J C4    1 
ATOM   5878  P P     . DT  B 1 142 ? 49.030  51.135 -76.431 1.00 84.76  ? 288  DT  J P     1 
ATOM   5879  O OP1   . DT  B 1 142 ? 49.817  50.997 -75.177 1.00 90.86  ? 288  DT  J OP1   1 
ATOM   5880  O OP2   . DT  B 1 142 ? 49.598  51.894 -77.575 1.00 90.53  ? 288  DT  J OP2   1 
ATOM   5881  O "O5'" . DT  B 1 142 ? 48.657  49.668 -76.917 1.00 80.03  ? 288  DT  J "O5'" 1 
ATOM   5882  C "C5'" . DT  B 1 142 ? 48.257  48.676 -75.972 1.00 71.98  ? 288  DT  J "C5'" 1 
ATOM   5883  C "C4'" . DT  B 1 142 ? 48.218  47.323 -76.634 1.00 66.69  ? 288  DT  J "C4'" 1 
ATOM   5884  O "O4'" . DT  B 1 142 ? 47.039  47.195 -77.456 1.00 65.55  ? 288  DT  J "O4'" 1 
ATOM   5885  C "C3'" . DT  B 1 142 ? 49.401  47.058 -77.561 1.00 64.31  ? 288  DT  J "C3'" 1 
ATOM   5886  O "O3'" . DT  B 1 142 ? 49.739  45.678 -77.457 1.00 59.02  ? 288  DT  J "O3'" 1 
ATOM   5887  C "C2'" . DT  B 1 142 ? 48.830  47.351 -78.934 1.00 63.43  ? 288  DT  J "C2'" 1 
ATOM   5888  C "C1'" . DT  B 1 142 ? 47.428  46.813 -78.764 1.00 64.02  ? 288  DT  J "C1'" 1 
ATOM   5889  N N1    . DT  B 1 142 ? 46.415  47.314 -79.710 1.00 69.80  ? 288  DT  J N1    1 
ATOM   5890  C C2    . DT  B 1 142 ? 45.563  46.397 -80.275 1.00 69.34  ? 288  DT  J C2    1 
ATOM   5891  O O2    . DT  B 1 142 ? 45.642  45.202 -80.065 1.00 72.14  ? 288  DT  J O2    1 
ATOM   5892  N N3    . DT  B 1 142 ? 44.606  46.933 -81.093 1.00 70.65  ? 288  DT  J N3    1 
ATOM   5893  C C4    . DT  B 1 142 ? 44.411  48.270 -81.381 1.00 69.98  ? 288  DT  J C4    1 
ATOM   5894  O O4    . DT  B 1 142 ? 43.460  48.610 -82.067 1.00 69.94  ? 288  DT  J O4    1 
ATOM   5895  C C5    . DT  B 1 142 ? 45.368  49.171 -80.793 1.00 69.00  ? 288  DT  J C5    1 
ATOM   5896  C C7    . DT  B 1 142 ? 45.263  50.632 -81.083 1.00 68.00  ? 288  DT  J C7    1 
ATOM   5897  C C6    . DT  B 1 142 ? 46.311  48.655 -79.999 1.00 68.90  ? 288  DT  J C6    1 
ATOM   5898  P P     . DT  B 1 143 ? 51.023  45.103 -78.223 1.00 68.71  ? 289  DT  J P     1 
ATOM   5899  O OP1   . DT  B 1 143 ? 51.997  44.665 -77.189 1.00 74.29  ? 289  DT  J OP1   1 
ATOM   5900  O OP2   . DT  B 1 143 ? 51.435  46.083 -79.260 1.00 68.47  ? 289  DT  J OP2   1 
ATOM   5901  O "O5'" . DT  B 1 143 ? 50.422  43.834 -78.968 1.00 65.68  ? 289  DT  J "O5'" 1 
ATOM   5902  C "C5'" . DT  B 1 143 ? 49.219  43.971 -79.705 1.00 64.08  ? 289  DT  J "C5'" 1 
ATOM   5903  C "C4'" . DT  B 1 143 ? 48.724  42.637 -80.210 1.00 58.55  ? 289  DT  J "C4'" 1 
ATOM   5904  O "O4'" . DT  B 1 143 ? 47.476  42.928 -80.864 1.00 59.48  ? 289  DT  J "O4'" 1 
ATOM   5905  C "C3'" . DT  B 1 143 ? 49.578  41.950 -81.275 1.00 56.76  ? 289  DT  J "C3'" 1 
ATOM   5906  O "O3'" . DT  B 1 143 ? 49.278  40.547 -81.299 1.00 49.05  ? 289  DT  J "O3'" 1 
ATOM   5907  C "C2'" . DT  B 1 143 ? 49.110  42.613 -82.553 1.00 55.61  ? 289  DT  J "C2'" 1 
ATOM   5908  C "C1'" . DT  B 1 143 ? 47.630  42.869 -82.278 1.00 57.42  ? 289  DT  J "C1'" 1 
ATOM   5909  N N1    . DT  B 1 143 ? 47.124  44.142 -82.825 1.00 61.84  ? 289  DT  J N1    1 
ATOM   5910  C C2    . DT  B 1 143 ? 45.994  44.115 -83.612 1.00 61.31  ? 289  DT  J C2    1 
ATOM   5911  O O2    . DT  B 1 143 ? 45.390  43.088 -83.880 1.00 56.98  ? 289  DT  J O2    1 
ATOM   5912  N N3    . DT  B 1 143 ? 45.598  45.340 -84.080 1.00 63.51  ? 289  DT  J N3    1 
ATOM   5913  C C4    . DT  B 1 143 ? 46.205  46.562 -83.848 1.00 63.75  ? 289  DT  J C4    1 
ATOM   5914  O O4    . DT  B 1 143 ? 45.740  47.588 -84.357 1.00 69.33  ? 289  DT  J O4    1 
ATOM   5915  C C5    . DT  B 1 143 ? 47.380  46.513 -83.002 1.00 63.58  ? 289  DT  J C5    1 
ATOM   5916  C C7    . DT  B 1 143 ? 48.090  47.786 -82.673 1.00 61.43  ? 289  DT  J C7    1 
ATOM   5917  C C6    . DT  B 1 143 ? 47.776  45.322 -82.546 1.00 62.14  ? 289  DT  J C6    1 
ATOM   5918  P P     . DG  B 1 144 ? 50.274  39.524 -82.038 1.00 45.82  ? 290  DG  J P     1 
ATOM   5919  O OP1   . DG  B 1 144 ? 50.264  38.234 -81.322 1.00 35.89  ? 290  DG  J OP1   1 
ATOM   5920  O OP2   . DG  B 1 144 ? 51.550  40.196 -82.298 1.00 34.62  ? 290  DG  J OP2   1 
ATOM   5921  O "O5'" . DG  B 1 144 ? 49.579  39.299 -83.443 1.00 44.45  ? 290  DG  J "O5'" 1 
ATOM   5922  C "C5'" . DG  B 1 144 ? 48.260  38.761 -83.521 1.00 48.63  ? 290  DG  J "C5'" 1 
ATOM   5923  C "C4'" . DG  B 1 144 ? 47.693  38.976 -84.903 1.00 55.34  ? 290  DG  J "C4'" 1 
ATOM   5924  O "O4'" . DG  B 1 144 ? 47.380  40.373 -85.114 1.00 55.51  ? 290  DG  J "O4'" 1 
ATOM   5925  C "C3'" . DG  B 1 144 ? 48.640  38.593 -86.041 1.00 57.50  ? 290  DG  J "C3'" 1 
ATOM   5926  O "O3'" . DG  B 1 144 ? 47.852  38.127 -87.126 1.00 62.87  ? 290  DG  J "O3'" 1 
ATOM   5927  C "C2'" . DG  B 1 144 ? 49.233  39.924 -86.452 1.00 55.32  ? 290  DG  J "C2'" 1 
ATOM   5928  C "C1'" . DG  B 1 144 ? 47.993  40.777 -86.326 1.00 55.11  ? 290  DG  J "C1'" 1 
ATOM   5929  N N9    . DG  B 1 144 ? 48.183  42.217 -86.283 1.00 46.94  ? 290  DG  J N9    1 
ATOM   5930  C C8    . DG  B 1 144 ? 49.220  42.927 -85.737 1.00 46.85  ? 290  DG  J C8    1 
ATOM   5931  N N7    . DG  B 1 144 ? 49.070  44.218 -85.852 1.00 48.27  ? 290  DG  J N7    1 
ATOM   5932  C C5    . DG  B 1 144 ? 47.864  44.360 -86.525 1.00 50.10  ? 290  DG  J C5    1 
ATOM   5933  C C6    . DG  B 1 144 ? 47.165  45.526 -86.939 1.00 52.33  ? 290  DG  J C6    1 
ATOM   5934  O O6    . DG  B 1 144 ? 47.486  46.712 -86.807 1.00 55.14  ? 290  DG  J O6    1 
ATOM   5935  N N1    . DG  B 1 144 ? 45.978  45.200 -87.577 1.00 50.21  ? 290  DG  J N1    1 
ATOM   5936  C C2    . DG  B 1 144 ? 45.527  43.915 -87.809 1.00 50.57  ? 290  DG  J C2    1 
ATOM   5937  N N2    . DG  B 1 144 ? 44.367  43.790 -88.473 1.00 49.34  ? 290  DG  J N2    1 
ATOM   5938  N N3    . DG  B 1 144 ? 46.166  42.832 -87.429 1.00 48.31  ? 290  DG  J N3    1 
ATOM   5939  C C4    . DG  B 1 144 ? 47.314  43.127 -86.797 1.00 48.38  ? 290  DG  J C4    1 
ATOM   5940  P P     . DA  B 1 145 ? 48.346  36.882 -87.989 1.00 81.27  ? 291  DA  J P     1 
ATOM   5941  O OP1   . DA  B 1 145 ? 47.875  35.667 -87.267 1.00 55.73  ? 291  DA  J OP1   1 
ATOM   5942  O OP2   . DA  B 1 145 ? 49.790  37.051 -88.342 1.00 50.96  ? 291  DA  J OP2   1 
ATOM   5943  O "O5'" . DA  B 1 145 ? 47.486  37.014 -89.311 1.00 83.29  ? 291  DA  J "O5'" 1 
ATOM   5944  C "C5'" . DA  B 1 145 ? 46.068  36.996 -89.237 1.00 84.83  ? 291  DA  J "C5'" 1 
ATOM   5945  C "C4'" . DA  B 1 145 ? 45.488  37.823 -90.356 1.00 87.24  ? 291  DA  J "C4'" 1 
ATOM   5946  O "O4'" . DA  B 1 145 ? 45.668  39.231 -90.085 1.00 84.67  ? 291  DA  J "O4'" 1 
ATOM   5947  C "C3'" . DA  B 1 145 ? 46.150  37.565 -91.706 1.00 86.68  ? 291  DA  J "C3'" 1 
ATOM   5948  O "O3'" . DA  B 1 145 ? 45.145  37.595 -92.724 1.00 91.87  ? 291  DA  J "O3'" 1 
ATOM   5949  C "C2'" . DA  B 1 145 ? 47.119  38.724 -91.836 1.00 85.61  ? 291  DA  J "C2'" 1 
ATOM   5950  C "C1'" . DA  B 1 145 ? 46.356  39.839 -91.157 1.00 82.00  ? 291  DA  J "C1'" 1 
ATOM   5951  N N9    . DA  B 1 145 ? 47.207  40.885 -90.603 1.00 51.48  ? 291  DA  J N9    1 
ATOM   5952  C C8    . DA  B 1 145 ? 48.350  40.735 -89.855 1.00 49.83  ? 291  DA  J C8    1 
ATOM   5953  N N7    . DA  B 1 145 ? 48.930  41.872 -89.535 1.00 49.11  ? 291  DA  J N7    1 
ATOM   5954  C C5    . DA  B 1 145 ? 48.109  42.836 -90.106 1.00 48.52  ? 291  DA  J C5    1 
ATOM   5955  C C6    . DA  B 1 145 ? 48.182  44.241 -90.148 1.00 47.33  ? 291  DA  J C6    1 
ATOM   5956  N N6    . DA  B 1 145 ? 49.174  44.950 -89.603 1.00 48.30  ? 291  DA  J N6    1 
ATOM   5957  N N1    . DA  B 1 145 ? 47.192  44.901 -90.783 1.00 45.24  ? 291  DA  J N1    1 
ATOM   5958  C C2    . DA  B 1 145 ? 46.205  44.195 -91.339 1.00 47.19  ? 291  DA  J C2    1 
ATOM   5959  N N3    . DA  B 1 145 ? 46.031  42.876 -91.386 1.00 50.08  ? 291  DA  J N3    1 
ATOM   5960  C C4    . DA  B 1 145 ? 47.031  42.244 -90.747 1.00 49.70  ? 291  DA  J C4    1 
ATOM   5961  P P     . DT  B 1 146 ? 45.532  37.272 -94.251 1.00 73.16  ? 292  DT  J P     1 
ATOM   5962  O OP1   . DT  B 1 146 ? 44.369  36.554 -94.846 1.00 70.75  ? 292  DT  J OP1   1 
ATOM   5963  O OP2   . DT  B 1 146 ? 46.885  36.642 -94.270 1.00 67.56  ? 292  DT  J OP2   1 
ATOM   5964  O "O5'" . DT  B 1 146 ? 45.619  38.719 -94.919 1.00 71.66  ? 292  DT  J "O5'" 1 
ATOM   5965  C "C5'" . DT  B 1 146 ? 44.500  39.609 -94.864 1.00 69.45  ? 292  DT  J "C5'" 1 
ATOM   5966  C "C4'" . DT  B 1 146 ? 44.822  40.895 -95.584 1.00 70.24  ? 292  DT  J "C4'" 1 
ATOM   5967  O "O4'" . DT  B 1 146 ? 45.615  41.778 -94.750 1.00 67.98  ? 292  DT  J "O4'" 1 
ATOM   5968  C "C3'" . DT  B 1 146 ? 45.637  40.667 -96.858 1.00 69.95  ? 292  DT  J "C3'" 1 
ATOM   5969  O "O3'" . DT  B 1 146 ? 45.306  41.605 -97.898 1.00 70.94  ? 292  DT  J "O3'" 1 
ATOM   5970  C "C2'" . DT  B 1 146 ? 47.050  40.974 -96.401 1.00 67.80  ? 292  DT  J "C2'" 1 
ATOM   5971  C "C1'" . DT  B 1 146 ? 46.787  42.130 -95.460 1.00 65.55  ? 292  DT  J "C1'" 1 
ATOM   5972  N N1    . DT  B 1 146 ? 47.872  42.398 -94.504 1.00 60.99  ? 292  DT  J N1    1 
ATOM   5973  C C2    . DT  B 1 146 ? 48.145  43.705 -94.200 1.00 61.93  ? 292  DT  J C2    1 
ATOM   5974  O O2    . DT  B 1 146 ? 47.471  44.634 -94.607 1.00 63.63  ? 292  DT  J O2    1 
ATOM   5975  N N3    . DT  B 1 146 ? 49.244  43.889 -93.398 1.00 59.57  ? 292  DT  J N3    1 
ATOM   5976  C C4    . DT  B 1 146 ? 50.070  42.913 -92.878 1.00 57.61  ? 292  DT  J C4    1 
ATOM   5977  O O4    . DT  B 1 146 ? 51.060  43.225 -92.226 1.00 56.83  ? 292  DT  J O4    1 
ATOM   5978  C C5    . DT  B 1 146 ? 49.685  41.564 -93.184 1.00 57.15  ? 292  DT  J C5    1 
ATOM   5979  C C7    . DT  B 1 146 ? 50.491  40.439 -92.613 1.00 56.58  ? 292  DT  J C7    1 
ATOM   5980  C C6    . DT  B 1 146 ? 48.617  41.373 -93.971 1.00 60.85  ? 292  DT  J C6    1 
ATOM   5981  N N     . LYS C 2 37  ? 116.253 26.048 -80.504 1.00 111.69 ? 437  LYS A N     1 
ATOM   5982  C CA    . LYS C 2 37  ? 115.141 25.398 -81.251 1.00 115.16 ? 437  LYS A CA    1 
ATOM   5983  C C     . LYS C 2 37  ? 113.773 25.998 -80.923 1.00 113.03 ? 437  LYS A C     1 
ATOM   5984  O O     . LYS C 2 37  ? 113.542 26.494 -79.818 1.00 114.64 ? 437  LYS A O     1 
ATOM   5985  C CB    . LYS C 2 37  ? 115.114 23.897 -80.957 1.00 121.94 ? 437  LYS A CB    1 
ATOM   5986  C CG    . LYS C 2 37  ? 113.926 23.194 -81.578 1.00 130.42 ? 437  LYS A CG    1 
ATOM   5987  C CD    . LYS C 2 37  ? 114.014 21.693 -81.443 1.00 133.97 ? 437  LYS A CD    1 
ATOM   5988  C CE    . LYS C 2 37  ? 112.838 21.038 -82.148 1.00 137.17 ? 437  LYS A CE    1 
ATOM   5989  N NZ    . LYS C 2 37  ? 112.973 19.560 -82.223 1.00 138.93 ? 437  LYS A NZ    1 
ATOM   5990  N N     . PRO C 2 38  ? 112.851 25.976 -81.900 1.00 162.18 ? 438  PRO A N     1 
ATOM   5991  C CA    . PRO C 2 38  ? 111.501 26.515 -81.713 1.00 160.80 ? 438  PRO A CA    1 
ATOM   5992  C C     . PRO C 2 38  ? 110.599 25.571 -80.919 1.00 158.68 ? 438  PRO A C     1 
ATOM   5993  O O     . PRO C 2 38  ? 110.084 24.586 -81.455 1.00 158.57 ? 438  PRO A O     1 
ATOM   5994  C CB    . PRO C 2 38  ? 111.001 26.712 -83.146 1.00 127.50 ? 438  PRO A CB    1 
ATOM   5995  C CG    . PRO C 2 38  ? 112.262 26.885 -83.936 1.00 128.38 ? 438  PRO A CG    1 
ATOM   5996  C CD    . PRO C 2 38  ? 113.145 25.826 -83.334 1.00 128.51 ? 438  PRO A CD    1 
ATOM   5997  N N     . HIS C 2 39  ? 110.419 25.878 -79.638 1.00 178.58 ? 439  HIS A N     1 
ATOM   5998  C CA    . HIS C 2 39  ? 109.570 25.081 -78.761 1.00 174.93 ? 439  HIS A CA    1 
ATOM   5999  C C     . HIS C 2 39  ? 108.524 25.946 -78.067 1.00 171.41 ? 439  HIS A C     1 
ATOM   6000  O O     . HIS C 2 39  ? 108.841 26.988 -77.495 1.00 171.03 ? 439  HIS A O     1 
ATOM   6001  C CB    . HIS C 2 39  ? 110.399 24.358 -77.697 1.00 113.99 ? 439  HIS A CB    1 
ATOM   6002  C CG    . HIS C 2 39  ? 109.570 23.766 -76.602 1.00 115.31 ? 439  HIS A CG    1 
ATOM   6003  N ND1   . HIS C 2 39  ? 108.998 24.532 -75.608 1.00 115.09 ? 439  HIS A ND1   1 
ATOM   6004  C CD2   . HIS C 2 39  ? 109.151 22.496 -76.387 1.00 115.77 ? 439  HIS A CD2   1 
ATOM   6005  C CE1   . HIS C 2 39  ? 108.260 23.760 -74.831 1.00 115.15 ? 439  HIS A CE1   1 
ATOM   6006  N NE2   . HIS C 2 39  ? 108.335 22.521 -75.283 1.00 115.47 ? 439  HIS A NE2   1 
ATOM   6007  N N     . ARG C 2 40  ? 107.276 25.498 -78.110 1.00 73.05  ? 440  ARG A N     1 
ATOM   6008  C CA    . ARG C 2 40  ? 106.184 26.230 -77.489 1.00 69.00  ? 440  ARG A CA    1 
ATOM   6009  C C     . ARG C 2 40  ? 105.135 25.287 -76.890 1.00 64.96  ? 440  ARG A C     1 
ATOM   6010  O O     . ARG C 2 40  ? 105.030 24.121 -77.286 1.00 63.82  ? 440  ARG A O     1 
ATOM   6011  C CB    . ARG C 2 40  ? 105.528 27.138 -78.531 1.00 86.10  ? 440  ARG A CB    1 
ATOM   6012  C CG    . ARG C 2 40  ? 104.463 28.056 -77.977 1.00 85.77  ? 440  ARG A CG    1 
ATOM   6013  C CD    . ARG C 2 40  ? 103.740 28.790 -79.089 1.00 82.82  ? 440  ARG A CD    1 
ATOM   6014  N NE    . ARG C 2 40  ? 103.279 30.092 -78.633 1.00 80.87  ? 440  ARG A NE    1 
ATOM   6015  C CZ    . ARG C 2 40  ? 104.094 31.062 -78.228 1.00 80.03  ? 440  ARG A CZ    1 
ATOM   6016  N NH1   . ARG C 2 40  ? 105.410 30.874 -78.226 1.00 78.90  ? 440  ARG A NH1   1 
ATOM   6017  N NH2   . ARG C 2 40  ? 103.596 32.219 -77.818 1.00 78.48  ? 440  ARG A NH2   1 
ATOM   6018  N N     . TYR C 2 41  ? 104.374 25.797 -75.921 1.00 64.46  ? 441  TYR A N     1 
ATOM   6019  C CA    . TYR C 2 41  ? 103.306 25.026 -75.276 1.00 59.80  ? 441  TYR A CA    1 
ATOM   6020  C C     . TYR C 2 41  ? 101.974 25.563 -75.773 1.00 56.51  ? 441  TYR A C     1 
ATOM   6021  O O     . TYR C 2 41  ? 101.817 26.770 -75.984 1.00 55.35  ? 441  TYR A O     1 
ATOM   6022  C CB    . TYR C 2 41  ? 103.387 25.148 -73.751 1.00 48.18  ? 441  TYR A CB    1 
ATOM   6023  C CG    . TYR C 2 41  ? 104.197 24.049 -73.116 1.00 46.46  ? 441  TYR A CG    1 
ATOM   6024  C CD1   . TYR C 2 41  ? 105.245 24.346 -72.235 1.00 45.53  ? 441  TYR A CD1   1 
ATOM   6025  C CD2   . TYR C 2 41  ? 103.948 22.708 -73.436 1.00 45.59  ? 441  TYR A CD2   1 
ATOM   6026  C CE1   . TYR C 2 41  ? 106.033 23.331 -71.689 1.00 45.58  ? 441  TYR A CE1   1 
ATOM   6027  C CE2   . TYR C 2 41  ? 104.726 21.686 -72.907 1.00 45.91  ? 441  TYR A CE2   1 
ATOM   6028  C CZ    . TYR C 2 41  ? 105.771 22.003 -72.036 1.00 45.22  ? 441  TYR A CZ    1 
ATOM   6029  O OH    . TYR C 2 41  ? 106.576 20.993 -71.550 1.00 48.40  ? 441  TYR A OH    1 
ATOM   6030  N N     . ARG C 2 42  ? 101.011 24.682 -75.984 1.00 60.01  ? 442  ARG A N     1 
ATOM   6031  C CA    . ARG C 2 42  ? 99.748  25.176 -76.483 1.00 61.68  ? 442  ARG A CA    1 
ATOM   6032  C C     . ARG C 2 42  ? 98.891  25.786 -75.384 1.00 60.26  ? 442  ARG A C     1 
ATOM   6033  O O     . ARG C 2 42  ? 98.951  25.374 -74.214 1.00 58.29  ? 442  ARG A O     1 
ATOM   6034  C CB    . ARG C 2 42  ? 99.003  24.065 -77.217 1.00 66.36  ? 442  ARG A CB    1 
ATOM   6035  C CG    . ARG C 2 42  ? 99.772  23.524 -78.415 1.00 73.27  ? 442  ARG A CG    1 
ATOM   6036  C CD    . ARG C 2 42  ? 98.853  22.714 -79.277 1.00 79.11  ? 442  ARG A CD    1 
ATOM   6037  N NE    . ARG C 2 42  ? 98.080  21.808 -78.440 1.00 85.17  ? 442  ARG A NE    1 
ATOM   6038  C CZ    . ARG C 2 42  ? 96.863  21.367 -78.737 1.00 88.40  ? 442  ARG A CZ    1 
ATOM   6039  N NH1   . ARG C 2 42  ? 96.272  21.751 -79.861 1.00 89.61  ? 442  ARG A NH1   1 
ATOM   6040  N NH2   . ARG C 2 42  ? 96.236  20.544 -77.906 1.00 90.04  ? 442  ARG A NH2   1 
ATOM   6041  N N     . PRO C 2 43  ? 98.094  26.803 -75.745 1.00 81.35  ? 443  PRO A N     1 
ATOM   6042  C CA    . PRO C 2 43  ? 97.199  27.519 -74.837 1.00 79.24  ? 443  PRO A CA    1 
ATOM   6043  C C     . PRO C 2 43  ? 96.330  26.562 -74.051 1.00 77.92  ? 443  PRO A C     1 
ATOM   6044  O O     . PRO C 2 43  ? 95.510  25.847 -74.635 1.00 75.69  ? 443  PRO A O     1 
ATOM   6045  C CB    . PRO C 2 43  ? 96.372  28.375 -75.781 1.00 80.88  ? 443  PRO A CB    1 
ATOM   6046  C CG    . PRO C 2 43  ? 97.330  28.670 -76.874 1.00 79.68  ? 443  PRO A CG    1 
ATOM   6047  C CD    . PRO C 2 43  ? 97.974  27.333 -77.112 1.00 80.55  ? 443  PRO A CD    1 
ATOM   6048  N N     . GLY C 2 44  ? 96.511  26.545 -72.734 1.00 57.05  ? 444  GLY A N     1 
ATOM   6049  C CA    . GLY C 2 44  ? 95.712  25.667 -71.908 1.00 56.61  ? 444  GLY A CA    1 
ATOM   6050  C C     . GLY C 2 44  ? 96.568  24.600 -71.277 1.00 57.03  ? 444  GLY A C     1 
ATOM   6051  O O     . GLY C 2 44  ? 96.352  24.214 -70.128 1.00 56.80  ? 444  GLY A O     1 
ATOM   6052  N N     . THR C 2 45  ? 97.539  24.097 -72.023 1.00 43.99  ? 445  THR A N     1 
ATOM   6053  C CA    . THR C 2 45  ? 98.420  23.077 -71.464 1.00 42.93  ? 445  THR A CA    1 
ATOM   6054  C C     . THR C 2 45  ? 99.051  23.709 -70.216 1.00 42.41  ? 445  THR A C     1 
ATOM   6055  O O     . THR C 2 45  ? 99.213  23.080 -69.159 1.00 42.92  ? 445  THR A O     1 
ATOM   6056  C CB    . THR C 2 45  ? 99.538  22.660 -72.493 1.00 40.44  ? 445  THR A CB    1 
ATOM   6057  O OG1   . THR C 2 45  ? 99.134  21.466 -73.170 1.00 40.73  ? 445  THR A OG1   1 
ATOM   6058  C CG2   . THR C 2 45  ? 100.883 22.396 -71.790 1.00 38.31  ? 445  THR A CG2   1 
ATOM   6059  N N     . VAL C 2 46  ? 99.388  24.979 -70.368 1.00 48.72  ? 446  VAL A N     1 
ATOM   6060  C CA    . VAL C 2 46  ? 99.987  25.730 -69.303 1.00 50.80  ? 446  VAL A CA    1 
ATOM   6061  C C     . VAL C 2 46  ? 98.929  26.058 -68.276 1.00 49.93  ? 446  VAL A C     1 
ATOM   6062  O O     . VAL C 2 46  ? 99.204  26.069 -67.078 1.00 50.67  ? 446  VAL A O     1 
ATOM   6063  C CB    . VAL C 2 46  ? 100.602 27.014 -69.848 1.00 50.26  ? 446  VAL A CB    1 
ATOM   6064  C CG1   . VAL C 2 46  ? 100.969 27.947 -68.717 1.00 52.09  ? 446  VAL A CG1   1 
ATOM   6065  C CG2   . VAL C 2 46  ? 101.810 26.666 -70.670 1.00 52.19  ? 446  VAL A CG2   1 
ATOM   6066  N N     . ALA C 2 47  ? 97.714  26.322 -68.740 1.00 59.71  ? 447  ALA A N     1 
ATOM   6067  C CA    . ALA C 2 47  ? 96.644  26.659 -67.819 1.00 60.15  ? 447  ALA A CA    1 
ATOM   6068  C C     . ALA C 2 47  ? 96.377  25.482 -66.915 1.00 60.84  ? 447  ALA A C     1 
ATOM   6069  O O     . ALA C 2 47  ? 96.648  25.547 -65.716 1.00 59.51  ? 447  ALA A O     1 
ATOM   6070  C CB    . ALA C 2 47  ? 95.387  27.027 -68.568 1.00 50.82  ? 447  ALA A CB    1 
ATOM   6071  N N     . LEU C 2 48  ? 95.862  24.398 -67.486 1.00 51.41  ? 448  LEU A N     1 
ATOM   6072  C CA    . LEU C 2 48  ? 95.547  23.223 -66.688 1.00 51.85  ? 448  LEU A CA    1 
ATOM   6073  C C     . LEU C 2 48  ? 96.657  22.815 -65.756 1.00 52.03  ? 448  LEU A C     1 
ATOM   6074  O O     . LEU C 2 48  ? 96.422  22.231 -64.705 1.00 49.88  ? 448  LEU A O     1 
ATOM   6075  C CB    . LEU C 2 48  ? 95.184  22.045 -67.576 1.00 35.72  ? 448  LEU A CB    1 
ATOM   6076  C CG    . LEU C 2 48  ? 93.688  22.043 -67.814 1.00 39.33  ? 448  LEU A CG    1 
ATOM   6077  C CD1   . LEU C 2 48  ? 93.413  22.977 -68.963 1.00 39.30  ? 448  LEU A CD1   1 
ATOM   6078  C CD2   . LEU C 2 48  ? 93.187  20.650 -68.096 1.00 39.51  ? 448  LEU A CD2   1 
ATOM   6079  N N     . ARG C 2 49  ? 97.875  23.132 -66.148 1.00 48.28  ? 449  ARG A N     1 
ATOM   6080  C CA    . ARG C 2 49  ? 99.029  22.790 -65.347 1.00 48.42  ? 449  ARG A CA    1 
ATOM   6081  C C     . ARG C 2 49  ? 99.004  23.705 -64.131 1.00 46.07  ? 449  ARG A C     1 
ATOM   6082  O O     . ARG C 2 49  ? 99.220  23.270 -63.003 1.00 45.83  ? 449  ARG A O     1 
ATOM   6083  C CB    . ARG C 2 49  ? 100.301 22.993 -66.186 1.00 53.69  ? 449  ARG A CB    1 
ATOM   6084  C CG    . ARG C 2 49  ? 101.489 22.220 -65.701 1.00 56.67  ? 449  ARG A CG    1 
ATOM   6085  C CD    . ARG C 2 49  ? 102.400 21.860 -66.836 1.00 58.54  ? 449  ARG A CD    1 
ATOM   6086  N NE    . ARG C 2 49  ? 103.033 23.038 -67.420 1.00 58.39  ? 449  ARG A NE    1 
ATOM   6087  C CZ    . ARG C 2 49  ? 103.808 23.006 -68.501 1.00 60.23  ? 449  ARG A CZ    1 
ATOM   6088  N NH1   . ARG C 2 49  ? 104.044 21.845 -69.108 1.00 61.70  ? 449  ARG A NH1   1 
ATOM   6089  N NH2   . ARG C 2 49  ? 104.325 24.136 -68.977 1.00 57.58  ? 449  ARG A NH2   1 
ATOM   6090  N N     . GLU C 2 50  ? 98.723  24.978 -64.381 1.00 42.07  ? 450  GLU A N     1 
ATOM   6091  C CA    . GLU C 2 50  ? 98.652  25.963 -63.328 1.00 41.83  ? 450  GLU A CA    1 
ATOM   6092  C C     . GLU C 2 50  ? 97.463  25.645 -62.415 1.00 41.19  ? 450  GLU A C     1 
ATOM   6093  O O     . GLU C 2 50  ? 97.524  25.819 -61.188 1.00 42.03  ? 450  GLU A O     1 
ATOM   6094  C CB    . GLU C 2 50  ? 98.538  27.355 -63.941 1.00 50.27  ? 450  GLU A CB    1 
ATOM   6095  C CG    . GLU C 2 50  ? 99.864  27.888 -64.417 1.00 55.06  ? 450  GLU A CG    1 
ATOM   6096  C CD    . GLU C 2 50  ? 99.764  29.261 -65.075 1.00 58.25  ? 450  GLU A CD    1 
ATOM   6097  O OE1   . GLU C 2 50  ? 99.232  30.195 -64.431 1.00 60.32  ? 450  GLU A OE1   1 
ATOM   6098  O OE2   . GLU C 2 50  ? 100.222 29.415 -66.237 1.00 61.24  ? 450  GLU A OE2   1 
ATOM   6099  N N     . ILE C 2 51  ? 96.380  25.161 -63.003 1.00 35.42  ? 451  ILE A N     1 
ATOM   6100  C CA    . ILE C 2 51  ? 95.232  24.817 -62.198 1.00 33.22  ? 451  ILE A CA    1 
ATOM   6101  C C     . ILE C 2 51  ? 95.657  23.731 -61.232 1.00 34.51  ? 451  ILE A C     1 
ATOM   6102  O O     . ILE C 2 51  ? 95.558  23.891 -60.025 1.00 32.20  ? 451  ILE A O     1 
ATOM   6103  C CB    . ILE C 2 51  ? 94.076  24.323 -63.059 1.00 38.55  ? 451  ILE A CB    1 
ATOM   6104  C CG1   . ILE C 2 51  ? 93.534  25.502 -63.883 1.00 36.28  ? 451  ILE A CG1   1 
ATOM   6105  C CG2   . ILE C 2 51  ? 93.010  23.693 -62.183 1.00 35.26  ? 451  ILE A CG2   1 
ATOM   6106  C CD1   . ILE C 2 51  ? 92.442  25.134 -64.899 1.00 35.95  ? 451  ILE A CD1   1 
ATOM   6107  N N     . ARG C 2 52  ? 96.163  22.626 -61.743 1.00 34.16  ? 452  ARG A N     1 
ATOM   6108  C CA    . ARG C 2 52  ? 96.574  21.574 -60.838 1.00 35.74  ? 452  ARG A CA    1 
ATOM   6109  C C     . ARG C 2 52  ? 97.588  22.065 -59.809 1.00 35.00  ? 452  ARG A C     1 
ATOM   6110  O O     . ARG C 2 52  ? 97.502  21.725 -58.625 1.00 36.22  ? 452  ARG A O     1 
ATOM   6111  C CB    . ARG C 2 52  ? 97.112  20.397 -61.626 1.00 53.98  ? 452  ARG A CB    1 
ATOM   6112  C CG    . ARG C 2 52  ? 96.103  19.902 -62.599 1.00 56.96  ? 452  ARG A CG    1 
ATOM   6113  C CD    . ARG C 2 52  ? 96.325  18.452 -62.946 1.00 62.63  ? 452  ARG A CD    1 
ATOM   6114  N NE    . ARG C 2 52  ? 95.513  18.067 -64.100 1.00 66.32  ? 452  ARG A NE    1 
ATOM   6115  C CZ    . ARG C 2 52  ? 95.816  18.370 -65.360 1.00 67.96  ? 452  ARG A CZ    1 
ATOM   6116  N NH1   . ARG C 2 52  ? 96.925  19.057 -65.643 1.00 69.24  ? 452  ARG A NH1   1 
ATOM   6117  N NH2   . ARG C 2 52  ? 94.992  18.013 -66.337 1.00 69.68  ? 452  ARG A NH2   1 
ATOM   6118  N N     . ARG C 2 53  ? 98.534  22.881 -60.244 1.00 44.56  ? 453  ARG A N     1 
ATOM   6119  C CA    . ARG C 2 53  ? 99.518  23.403 -59.314 1.00 45.81  ? 453  ARG A CA    1 
ATOM   6120  C C     . ARG C 2 53  ? 98.859  24.073 -58.107 1.00 43.51  ? 453  ARG A C     1 
ATOM   6121  O O     . ARG C 2 53  ? 98.954  23.580 -56.979 1.00 42.15  ? 453  ARG A O     1 
ATOM   6122  C CB    . ARG C 2 53  ? 100.425 24.410 -60.003 1.00 70.73  ? 453  ARG A CB    1 
ATOM   6123  C CG    . ARG C 2 53  ? 101.383 25.116 -59.067 1.00 75.44  ? 453  ARG A CG    1 
ATOM   6124  C CD    . ARG C 2 53  ? 102.344 25.947 -59.871 1.00 83.71  ? 453  ARG A CD    1 
ATOM   6125  N NE    . ARG C 2 53  ? 103.243 26.728 -59.034 1.00 89.50  ? 453  ARG A NE    1 
ATOM   6126  C CZ    . ARG C 2 53  ? 104.147 27.580 -59.511 1.00 93.24  ? 453  ARG A CZ    1 
ATOM   6127  N NH1   . ARG C 2 53  ? 104.274 27.759 -60.825 1.00 95.68  ? 453  ARG A NH1   1 
ATOM   6128  N NH2   . ARG C 2 53  ? 104.926 28.255 -58.678 1.00 94.73  ? 453  ARG A NH2   1 
ATOM   6129  N N     . TYR C 2 54  ? 98.179  25.186 -58.345 1.00 46.98  ? 454  TYR A N     1 
ATOM   6130  C CA    . TYR C 2 54  ? 97.546  25.913 -57.261 1.00 46.43  ? 454  TYR A CA    1 
ATOM   6131  C C     . TYR C 2 54  ? 96.436  25.223 -56.480 1.00 46.13  ? 454  TYR A C     1 
ATOM   6132  O O     . TYR C 2 54  ? 96.234  25.530 -55.307 1.00 45.20  ? 454  TYR A O     1 
ATOM   6133  C CB    . TYR C 2 54  ? 97.058  27.250 -57.775 1.00 43.31  ? 454  TYR A CB    1 
ATOM   6134  C CG    . TYR C 2 54  ? 98.191  28.115 -58.253 1.00 44.40  ? 454  TYR A CG    1 
ATOM   6135  C CD1   . TYR C 2 54  ? 98.342  28.404 -59.605 1.00 44.71  ? 454  TYR A CD1   1 
ATOM   6136  C CD2   . TYR C 2 54  ? 99.130  28.627 -57.360 1.00 45.78  ? 454  TYR A CD2   1 
ATOM   6137  C CE1   . TYR C 2 54  ? 99.389  29.176 -60.057 1.00 46.22  ? 454  TYR A CE1   1 
ATOM   6138  C CE2   . TYR C 2 54  ? 100.187 29.399 -57.806 1.00 46.91  ? 454  TYR A CE2   1 
ATOM   6139  C CZ    . TYR C 2 54  ? 100.304 29.664 -59.159 1.00 48.68  ? 454  TYR A CZ    1 
ATOM   6140  O OH    . TYR C 2 54  ? 101.348 30.397 -59.643 1.00 48.94  ? 454  TYR A OH    1 
ATOM   6141  N N     . GLN C 2 55  ? 95.712  24.300 -57.093 1.00 43.33  ? 455  GLN A N     1 
ATOM   6142  C CA    . GLN C 2 55  ? 94.666  23.648 -56.341 1.00 43.55  ? 455  GLN A CA    1 
ATOM   6143  C C     . GLN C 2 55  ? 95.275  22.768 -55.271 1.00 44.60  ? 455  GLN A C     1 
ATOM   6144  O O     . GLN C 2 55  ? 94.610  22.357 -54.314 1.00 43.56  ? 455  GLN A O     1 
ATOM   6145  C CB    . GLN C 2 55  ? 93.772  22.827 -57.249 1.00 38.66  ? 455  GLN A CB    1 
ATOM   6146  C CG    . GLN C 2 55  ? 93.027  23.697 -58.221 1.00 38.87  ? 455  GLN A CG    1 
ATOM   6147  C CD    . GLN C 2 55  ? 91.801  23.031 -58.814 1.00 42.97  ? 455  GLN A CD    1 
ATOM   6148  O OE1   . GLN C 2 55  ? 91.799  21.820 -59.064 1.00 41.66  ? 455  GLN A OE1   1 
ATOM   6149  N NE2   . GLN C 2 55  ? 90.753  23.824 -59.064 1.00 40.14  ? 455  GLN A NE2   1 
ATOM   6150  N N     . LYS C 2 56  ? 96.556  22.490 -55.410 1.00 28.02  ? 456  LYS A N     1 
ATOM   6151  C CA    . LYS C 2 56  ? 97.210  21.654 -54.429 1.00 31.49  ? 456  LYS A CA    1 
ATOM   6152  C C     . LYS C 2 56  ? 97.791  22.473 -53.284 1.00 29.36  ? 456  LYS A C     1 
ATOM   6153  O O     . LYS C 2 56  ? 97.680  22.075 -52.133 1.00 30.97  ? 456  LYS A O     1 
ATOM   6154  C CB    . LYS C 2 56  ? 98.291  20.812 -55.114 1.00 69.10  ? 456  LYS A CB    1 
ATOM   6155  C CG    . LYS C 2 56  ? 97.717  19.892 -56.196 1.00 77.58  ? 456  LYS A CG    1 
ATOM   6156  C CD    . LYS C 2 56  ? 98.787  19.177 -57.028 1.00 81.13  ? 456  LYS A CD    1 
ATOM   6157  C CE    . LYS C 2 56  ? 98.157  18.222 -58.055 1.00 84.33  ? 456  LYS A CE    1 
ATOM   6158  N NZ    . LYS C 2 56  ? 99.150  17.650 -59.013 1.00 86.09  ? 456  LYS A NZ    1 
ATOM   6159  N N     . SER C 2 57  ? 98.393  23.617 -53.579 1.00 51.61  ? 457  SER A N     1 
ATOM   6160  C CA    . SER C 2 57  ? 98.979  24.428 -52.523 1.00 50.17  ? 457  SER A CA    1 
ATOM   6161  C C     . SER C 2 57  ? 97.915  25.218 -51.764 1.00 49.68  ? 457  SER A C     1 
ATOM   6162  O O     . SER C 2 57  ? 96.775  25.302 -52.223 1.00 50.78  ? 457  SER A O     1 
ATOM   6163  C CB    . SER C 2 57  ? 99.996  25.392 -53.117 1.00 55.93  ? 457  SER A CB    1 
ATOM   6164  O OG    . SER C 2 57  ? 99.355  26.343 -53.933 1.00 58.56  ? 457  SER A OG    1 
ATOM   6165  N N     . THR C 2 58  ? 98.282  25.787 -50.609 1.00 30.45  ? 458  THR A N     1 
ATOM   6166  C CA    . THR C 2 58  ? 97.344  26.578 -49.817 1.00 30.79  ? 458  THR A CA    1 
ATOM   6167  C C     . THR C 2 58  ? 97.848  27.983 -49.554 1.00 31.55  ? 458  THR A C     1 
ATOM   6168  O O     . THR C 2 58  ? 97.214  28.752 -48.838 1.00 30.82  ? 458  THR A O     1 
ATOM   6169  C CB    . THR C 2 58  ? 97.043  25.943 -48.433 1.00 39.20  ? 458  THR A CB    1 
ATOM   6170  O OG1   . THR C 2 58  ? 98.233  25.887 -47.654 1.00 41.20  ? 458  THR A OG1   1 
ATOM   6171  C CG2   . THR C 2 58  ? 96.508  24.555 -48.586 1.00 35.37  ? 458  THR A CG2   1 
ATOM   6172  N N     . GLU C 2 59  ? 98.980  28.335 -50.137 1.00 31.52  ? 459  GLU A N     1 
ATOM   6173  C CA    . GLU C 2 59  ? 99.538  29.656 -49.894 1.00 33.50  ? 459  GLU A CA    1 
ATOM   6174  C C     . GLU C 2 59  ? 98.655  30.759 -50.399 1.00 31.58  ? 459  GLU A C     1 
ATOM   6175  O O     . GLU C 2 59  ? 97.828  30.553 -51.281 1.00 30.72  ? 459  GLU A O     1 
ATOM   6176  C CB    . GLU C 2 59  ? 100.939 29.778 -50.509 1.00 88.41  ? 459  GLU A CB    1 
ATOM   6177  C CG    . GLU C 2 59  ? 101.184 28.888 -51.711 1.00 99.74  ? 459  GLU A CG    1 
ATOM   6178  C CD    . GLU C 2 59  ? 100.361 29.283 -52.911 1.00 102.32 ? 459  GLU A CD    1 
ATOM   6179  O OE1   . GLU C 2 59  ? 100.884 29.995 -53.792 1.00 108.53 ? 459  GLU A OE1   1 
ATOM   6180  O OE2   . GLU C 2 59  ? 99.183  28.889 -52.969 1.00 104.04 ? 459  GLU A OE2   1 
ATOM   6181  N N     . LEU C 2 60  ? 98.807  31.938 -49.822 1.00 45.54  ? 460  LEU A N     1 
ATOM   6182  C CA    . LEU C 2 60  ? 98.017  33.059 -50.282 1.00 46.03  ? 460  LEU A CA    1 
ATOM   6183  C C     . LEU C 2 60  ? 98.564  33.388 -51.681 1.00 46.33  ? 460  LEU A C     1 
ATOM   6184  O O     . LEU C 2 60  ? 99.762  33.250 -51.930 1.00 47.06  ? 460  LEU A O     1 
ATOM   6185  C CB    . LEU C 2 60  ? 98.170  34.239 -49.309 1.00 54.78  ? 460  LEU A CB    1 
ATOM   6186  C CG    . LEU C 2 60  ? 97.648  34.036 -47.872 1.00 56.29  ? 460  LEU A CG    1 
ATOM   6187  C CD1   . LEU C 2 60  ? 97.848  35.319 -47.076 1.00 56.08  ? 460  LEU A CD1   1 
ATOM   6188  C CD2   . LEU C 2 60  ? 96.168  33.641 -47.884 1.00 57.74  ? 460  LEU A CD2   1 
ATOM   6189  N N     . LEU C 2 61  ? 97.698  33.814 -52.593 1.00 37.87  ? 461  LEU A N     1 
ATOM   6190  C CA    . LEU C 2 61  ? 98.126  34.102 -53.953 1.00 36.50  ? 461  LEU A CA    1 
ATOM   6191  C C     . LEU C 2 61  ? 98.283  35.583 -54.259 1.00 37.35  ? 461  LEU A C     1 
ATOM   6192  O O     . LEU C 2 61  ? 98.693  35.954 -55.367 1.00 37.55  ? 461  LEU A O     1 
ATOM   6193  C CB    . LEU C 2 61  ? 97.163  33.435 -54.942 1.00 29.01  ? 461  LEU A CB    1 
ATOM   6194  C CG    . LEU C 2 61  ? 96.946  31.941 -54.626 1.00 26.61  ? 461  LEU A CG    1 
ATOM   6195  C CD1   . LEU C 2 61  ? 96.092  31.338 -55.674 1.00 28.57  ? 461  LEU A CD1   1 
ATOM   6196  C CD2   . LEU C 2 61  ? 98.245  31.179 -54.534 1.00 28.38  ? 461  LEU A CD2   1 
ATOM   6197  N N     . ILE C 2 62  ? 97.966  36.441 -53.291 1.00 21.58  ? 462  ILE A N     1 
ATOM   6198  C CA    . ILE C 2 62  ? 98.141  37.883 -53.499 1.00 23.68  ? 462  ILE A CA    1 
ATOM   6199  C C     . ILE C 2 62  ? 99.324  38.356 -52.654 1.00 25.68  ? 462  ILE A C     1 
ATOM   6200  O O     . ILE C 2 62  ? 99.532  37.881 -51.545 1.00 27.28  ? 462  ILE A O     1 
ATOM   6201  C CB    . ILE C 2 62  ? 96.892  38.661 -53.111 1.00 24.67  ? 462  ILE A CB    1 
ATOM   6202  C CG1   . ILE C 2 62  ? 95.730  38.197 -53.965 1.00 26.76  ? 462  ILE A CG1   1 
ATOM   6203  C CG2   . ILE C 2 62  ? 97.100  40.149 -53.323 1.00 23.64  ? 462  ILE A CG2   1 
ATOM   6204  C CD1   . ILE C 2 62  ? 94.447  38.815 -53.516 1.00 21.00  ? 462  ILE A CD1   1 
ATOM   6205  N N     . ARG C 2 63  ? 100.112 39.276 -53.193 1.00 34.04  ? 463  ARG A N     1 
ATOM   6206  C CA    . ARG C 2 63  ? 101.264 39.763 -52.468 1.00 36.10  ? 463  ARG A CA    1 
ATOM   6207  C C     . ARG C 2 63  ? 100.811 40.634 -51.290 1.00 36.46  ? 463  ARG A C     1 
ATOM   6208  O O     . ARG C 2 63  ? 100.072 41.613 -51.465 1.00 35.28  ? 463  ARG A O     1 
ATOM   6209  C CB    . ARG C 2 63  ? 102.194 40.526 -53.421 1.00 85.93  ? 463  ARG A CB    1 
ATOM   6210  C CG    . ARG C 2 63  ? 103.659 40.088 -53.321 1.00 89.18  ? 463  ARG A CG    1 
ATOM   6211  C CD    . ARG C 2 63  ? 104.309 39.793 -54.674 1.00 96.40  ? 463  ARG A CD    1 
ATOM   6212  N NE    . ARG C 2 63  ? 104.434 40.971 -55.533 1.00 104.14 ? 463  ARG A NE    1 
ATOM   6213  C CZ    . ARG C 2 63  ? 103.455 41.480 -56.286 1.00 106.64 ? 463  ARG A CZ    1 
ATOM   6214  N NH1   . ARG C 2 63  ? 102.250 40.916 -56.306 1.00 110.36 ? 463  ARG A NH1   1 
ATOM   6215  N NH2   . ARG C 2 63  ? 103.680 42.566 -57.019 1.00 106.07 ? 463  ARG A NH2   1 
ATOM   6216  N N     . LYS C 2 64  ? 101.270 40.267 -50.093 1.00 36.98  ? 464  LYS A N     1 
ATOM   6217  C CA    . LYS C 2 64  ? 100.903 40.968 -48.867 1.00 38.63  ? 464  LYS A CA    1 
ATOM   6218  C C     . LYS C 2 64  ? 101.063 42.477 -48.780 1.00 37.44  ? 464  LYS A C     1 
ATOM   6219  O O     . LYS C 2 64  ? 100.156 43.160 -48.315 1.00 36.55  ? 464  LYS A O     1 
ATOM   6220  C CB    . LYS C 2 64  ? 101.604 40.318 -47.678 1.00 54.88  ? 464  LYS A CB    1 
ATOM   6221  C CG    . LYS C 2 64  ? 100.916 39.027 -47.257 1.00 63.78  ? 464  LYS A CG    1 
ATOM   6222  C CD    . LYS C 2 64  ? 101.710 38.240 -46.240 1.00 67.63  ? 464  LYS A CD    1 
ATOM   6223  C CE    . LYS C 2 64  ? 101.119 36.855 -46.046 1.00 69.86  ? 464  LYS A CE    1 
ATOM   6224  N NZ    . LYS C 2 64  ? 102.007 35.999 -45.199 1.00 70.40  ? 464  LYS A NZ    1 
ATOM   6225  N N     . LEU C 2 65  ? 102.195 43.016 -49.211 1.00 32.74  ? 465  LEU A N     1 
ATOM   6226  C CA    . LEU C 2 65  ? 102.385 44.454 -49.103 1.00 30.45  ? 465  LEU A CA    1 
ATOM   6227  C C     . LEU C 2 65  ? 101.339 45.223 -49.914 1.00 29.34  ? 465  LEU A C     1 
ATOM   6228  O O     . LEU C 2 65  ? 100.709 46.158 -49.425 1.00 30.48  ? 465  LEU A O     1 
ATOM   6229  C CB    . LEU C 2 65  ? 103.787 44.841 -49.557 1.00 66.08  ? 465  LEU A CB    1 
ATOM   6230  C CG    . LEU C 2 65  ? 104.203 46.267 -49.188 1.00 67.16  ? 465  LEU A CG    1 
ATOM   6231  C CD1   . LEU C 2 65  ? 104.317 46.389 -47.672 1.00 66.38  ? 465  LEU A CD1   1 
ATOM   6232  C CD2   . LEU C 2 65  ? 105.527 46.609 -49.873 1.00 69.61  ? 465  LEU A CD2   1 
ATOM   6233  N N     . PRO C 2 66  ? 101.138 44.840 -51.171 1.00 49.57  ? 466  PRO A N     1 
ATOM   6234  C CA    . PRO C 2 66  ? 100.134 45.568 -51.949 1.00 48.95  ? 466  PRO A CA    1 
ATOM   6235  C C     . PRO C 2 66  ? 98.755  45.415 -51.290 1.00 49.14  ? 466  PRO A C     1 
ATOM   6236  O O     . PRO C 2 66  ? 97.944  46.349 -51.280 1.00 49.26  ? 466  PRO A O     1 
ATOM   6237  C CB    . PRO C 2 66  ? 100.172 44.873 -53.305 1.00 29.84  ? 466  PRO A CB    1 
ATOM   6238  C CG    . PRO C 2 66  ? 101.533 44.214 -53.345 1.00 32.75  ? 466  PRO A CG    1 
ATOM   6239  C CD    . PRO C 2 66  ? 101.753 43.754 -51.948 1.00 31.20  ? 466  PRO A CD    1 
ATOM   6240  N N     . PHE C 2 67  ? 98.502  44.224 -50.743 1.00 29.73  ? 467  PHE A N     1 
ATOM   6241  C CA    . PHE C 2 67  ? 97.231  43.920 -50.119 1.00 29.34  ? 467  PHE A CA    1 
ATOM   6242  C C     . PHE C 2 67  ? 97.024  44.796 -48.919 1.00 28.99  ? 467  PHE A C     1 
ATOM   6243  O O     . PHE C 2 67  ? 96.033  45.522 -48.837 1.00 25.53  ? 467  PHE A O     1 
ATOM   6244  C CB    . PHE C 2 67  ? 97.170  42.451 -49.698 1.00 48.51  ? 467  PHE A CB    1 
ATOM   6245  C CG    . PHE C 2 67  ? 95.846  42.043 -49.111 1.00 48.19  ? 467  PHE A CG    1 
ATOM   6246  C CD1   . PHE C 2 67  ? 94.724  41.911 -49.912 1.00 46.89  ? 467  PHE A CD1   1 
ATOM   6247  C CD2   . PHE C 2 67  ? 95.705  41.860 -47.746 1.00 46.30  ? 467  PHE A CD2   1 
ATOM   6248  C CE1   . PHE C 2 67  ? 93.473  41.612 -49.358 1.00 44.85  ? 467  PHE A CE1   1 
ATOM   6249  C CE2   . PHE C 2 67  ? 94.445  41.559 -47.182 1.00 47.65  ? 467  PHE A CE2   1 
ATOM   6250  C CZ    . PHE C 2 67  ? 93.333  41.437 -47.992 1.00 44.72  ? 467  PHE A CZ    1 
ATOM   6251  N N     . GLN C 2 68  ? 97.975  44.738 -47.994 1.00 36.24  ? 468  GLN A N     1 
ATOM   6252  C CA    . GLN C 2 68  ? 97.913  45.506 -46.767 1.00 38.23  ? 468  GLN A CA    1 
ATOM   6253  C C     . GLN C 2 68  ? 97.677  46.989 -47.033 1.00 36.37  ? 468  GLN A C     1 
ATOM   6254  O O     . GLN C 2 68  ? 96.976  47.657 -46.277 1.00 35.55  ? 468  GLN A O     1 
ATOM   6255  C CB    . GLN C 2 68  ? 99.204  45.324 -46.001 1.00 53.55  ? 468  GLN A CB    1 
ATOM   6256  C CG    . GLN C 2 68  ? 99.145  45.846 -44.604 1.00 61.79  ? 468  GLN A CG    1 
ATOM   6257  C CD    . GLN C 2 68  ? 100.475 45.729 -43.921 1.00 66.06  ? 468  GLN A CD    1 
ATOM   6258  O OE1   . GLN C 2 68  ? 101.429 46.409 -44.298 1.00 71.77  ? 468  GLN A OE1   1 
ATOM   6259  N NE2   . GLN C 2 68  ? 100.558 44.858 -42.915 1.00 69.29  ? 468  GLN A NE2   1 
ATOM   6260  N N     . ARG C 2 69  ? 98.270  47.501 -48.104 1.00 35.72  ? 469  ARG A N     1 
ATOM   6261  C CA    . ARG C 2 69  ? 98.099  48.892 -48.468 1.00 37.03  ? 469  ARG A CA    1 
ATOM   6262  C C     . ARG C 2 69  ? 96.639  49.135 -48.786 1.00 35.62  ? 469  ARG A C     1 
ATOM   6263  O O     . ARG C 2 69  ? 95.994  50.011 -48.186 1.00 33.59  ? 469  ARG A O     1 
ATOM   6264  C CB    . ARG C 2 69  ? 98.923  49.262 -49.714 1.00 67.74  ? 469  ARG A CB    1 
ATOM   6265  C CG    . ARG C 2 69  ? 100.403 49.526 -49.476 1.00 72.40  ? 469  ARG A CG    1 
ATOM   6266  C CD    . ARG C 2 69  ? 100.961 50.507 -50.503 1.00 73.79  ? 469  ARG A CD    1 
ATOM   6267  N NE    . ARG C 2 69  ? 100.997 49.961 -51.856 1.00 73.31  ? 469  ARG A NE    1 
ATOM   6268  C CZ    . ARG C 2 69  ? 101.881 49.061 -52.277 1.00 73.56  ? 469  ARG A CZ    1 
ATOM   6269  N NH1   . ARG C 2 69  ? 102.811 48.597 -51.456 1.00 74.99  ? 469  ARG A NH1   1 
ATOM   6270  N NH2   . ARG C 2 69  ? 101.839 48.626 -53.526 1.00 71.11  ? 469  ARG A NH2   1 
ATOM   6271  N N     . LEU C 2 70  ? 96.127  48.366 -49.748 1.00 32.61  ? 470  LEU A N     1 
ATOM   6272  C CA    . LEU C 2 70  ? 94.749  48.511 -50.164 1.00 32.22  ? 470  LEU A CA    1 
ATOM   6273  C C     . LEU C 2 70  ? 93.852  48.400 -48.964 1.00 29.90  ? 470  LEU A C     1 
ATOM   6274  O O     . LEU C 2 70  ? 92.838  49.084 -48.873 1.00 31.16  ? 470  LEU A O     1 
ATOM   6275  C CB    . LEU C 2 70  ? 94.383  47.426 -51.147 1.00 33.42  ? 470  LEU A CB    1 
ATOM   6276  C CG    . LEU C 2 70  ? 92.915  47.279 -51.547 1.00 33.95  ? 470  LEU A CG    1 
ATOM   6277  C CD1   . LEU C 2 70  ? 92.405  48.471 -52.355 1.00 31.73  ? 470  LEU A CD1   1 
ATOM   6278  C CD2   . LEU C 2 70  ? 92.822  45.991 -52.340 1.00 30.86  ? 470  LEU A CD2   1 
ATOM   6279  N N     . VAL C 2 71  ? 94.221  47.533 -48.035 1.00 27.16  ? 471  VAL A N     1 
ATOM   6280  C CA    . VAL C 2 71  ? 93.414  47.361 -46.844 1.00 28.73  ? 471  VAL A CA    1 
ATOM   6281  C C     . VAL C 2 71  ? 93.331  48.641 -46.016 1.00 29.32  ? 471  VAL A C     1 
ATOM   6282  O O     . VAL C 2 71  ? 92.245  49.114 -45.642 1.00 29.51  ? 471  VAL A O     1 
ATOM   6283  C CB    . VAL C 2 71  ? 93.982  46.268 -45.949 1.00 28.21  ? 471  VAL A CB    1 
ATOM   6284  C CG1   . VAL C 2 71  ? 93.177  46.209 -44.644 1.00 28.53  ? 471  VAL A CG1   1 
ATOM   6285  C CG2   . VAL C 2 71  ? 93.954  44.941 -46.678 1.00 30.10  ? 471  VAL A CG2   1 
ATOM   6286  N N     . ARG C 2 72  ? 94.494  49.193 -45.713 1.00 37.46  ? 472  ARG A N     1 
ATOM   6287  C CA    . ARG C 2 72  ? 94.534  50.396 -44.915 1.00 37.05  ? 472  ARG A CA    1 
ATOM   6288  C C     . ARG C 2 72  ? 93.822  51.534 -45.636 1.00 35.89  ? 472  ARG A C     1 
ATOM   6289  O O     . ARG C 2 72  ? 93.047  52.259 -45.025 1.00 33.95  ? 472  ARG A O     1 
ATOM   6290  C CB    . ARG C 2 72  ? 95.981  50.759 -44.603 1.00 43.01  ? 472  ARG A CB    1 
ATOM   6291  C CG    . ARG C 2 72  ? 96.710  49.717 -43.770 1.00 44.60  ? 472  ARG A CG    1 
ATOM   6292  C CD    . ARG C 2 72  ? 98.189  50.061 -43.667 1.00 47.92  ? 472  ARG A CD    1 
ATOM   6293  N NE    . ARG C 2 72  ? 98.947  49.050 -42.936 1.00 50.19  ? 472  ARG A NE    1 
ATOM   6294  C CZ    . ARG C 2 72  ? 98.988  48.961 -41.614 1.00 50.47  ? 472  ARG A CZ    1 
ATOM   6295  N NH1   . ARG C 2 72  ? 98.319  49.828 -40.867 1.00 51.14  ? 472  ARG A NH1   1 
ATOM   6296  N NH2   . ARG C 2 72  ? 99.692  48.001 -41.040 1.00 52.95  ? 472  ARG A NH2   1 
ATOM   6297  N N     . GLU C 2 73  ? 94.063  51.662 -46.941 1.00 34.43  ? 473  GLU A N     1 
ATOM   6298  C CA    . GLU C 2 73  ? 93.451  52.722 -47.739 1.00 37.01  ? 473  GLU A CA    1 
ATOM   6299  C C     . GLU C 2 73  ? 91.959  52.689 -47.594 1.00 37.35  ? 473  GLU A C     1 
ATOM   6300  O O     . GLU C 2 73  ? 91.328  53.709 -47.375 1.00 37.97  ? 473  GLU A O     1 
ATOM   6301  C CB    . GLU C 2 73  ? 93.788  52.565 -49.222 1.00 66.18  ? 473  GLU A CB    1 
ATOM   6302  C CG    . GLU C 2 73  ? 92.923  53.443 -50.126 1.00 71.82  ? 473  GLU A CG    1 
ATOM   6303  C CD    . GLU C 2 73  ? 93.096  53.146 -51.605 1.00 75.44  ? 473  GLU A CD    1 
ATOM   6304  O OE1   . GLU C 2 73  ? 94.206  53.373 -52.134 1.00 78.71  ? 473  GLU A OE1   1 
ATOM   6305  O OE2   . GLU C 2 73  ? 92.117  52.687 -52.239 1.00 81.27  ? 473  GLU A OE2   1 
ATOM   6306  N N     . ILE C 2 74  ? 91.400  51.498 -47.739 1.00 37.37  ? 474  ILE A N     1 
ATOM   6307  C CA    . ILE C 2 74  ? 89.965  51.304 -47.635 1.00 34.43  ? 474  ILE A CA    1 
ATOM   6308  C C     . ILE C 2 74  ? 89.525  51.701 -46.235 1.00 34.54  ? 474  ILE A C     1 
ATOM   6309  O O     . ILE C 2 74  ? 88.563  52.462 -46.049 1.00 33.82  ? 474  ILE A O     1 
ATOM   6310  C CB    . ILE C 2 74  ? 89.601  49.822 -47.908 1.00 45.17  ? 474  ILE A CB    1 
ATOM   6311  C CG1   . ILE C 2 74  ? 89.826  49.495 -49.387 1.00 45.54  ? 474  ILE A CG1   1 
ATOM   6312  C CG2   . ILE C 2 74  ? 88.152  49.557 -47.533 1.00 43.34  ? 474  ILE A CG2   1 
ATOM   6313  C CD1   . ILE C 2 74  ? 89.654  48.044 -49.729 1.00 43.38  ? 474  ILE A CD1   1 
ATOM   6314  N N     . ALA C 2 75  ? 90.257  51.192 -45.251 1.00 33.64  ? 475  ALA A N     1 
ATOM   6315  C CA    . ALA C 2 75  ? 89.962  51.469 -43.852 1.00 36.40  ? 475  ALA A CA    1 
ATOM   6316  C C     . ALA C 2 75  ? 89.890  52.965 -43.531 1.00 40.19  ? 475  ALA A C     1 
ATOM   6317  O O     . ALA C 2 75  ? 88.912  53.447 -42.940 1.00 39.41  ? 475  ALA A O     1 
ATOM   6318  C CB    . ALA C 2 75  ? 90.999  50.812 -42.993 1.00 34.59  ? 475  ALA A CB    1 
ATOM   6319  N N     . GLN C 2 76  ? 90.941  53.677 -43.929 1.00 39.18  ? 476  GLN A N     1 
ATOM   6320  C CA    . GLN C 2 76  ? 91.074  55.103 -43.700 1.00 42.65  ? 476  GLN A CA    1 
ATOM   6321  C C     . GLN C 2 76  ? 89.834  55.877 -44.059 1.00 43.17  ? 476  GLN A C     1 
ATOM   6322  O O     . GLN C 2 76  ? 89.642  56.980 -43.571 1.00 44.29  ? 476  GLN A O     1 
ATOM   6323  C CB    . GLN C 2 76  ? 92.249  55.662 -44.492 1.00 68.10  ? 476  GLN A CB    1 
ATOM   6324  C CG    . GLN C 2 76  ? 92.670  57.062 -44.065 1.00 73.06  ? 476  GLN A CG    1 
ATOM   6325  C CD    . GLN C 2 76  ? 93.339  57.091 -42.699 1.00 76.15  ? 476  GLN A CD    1 
ATOM   6326  O OE1   . GLN C 2 76  ? 92.783  56.611 -41.707 1.00 77.00  ? 476  GLN A OE1   1 
ATOM   6327  N NE2   . GLN C 2 76  ? 94.539  57.656 -42.643 1.00 79.18  ? 476  GLN A NE2   1 
ATOM   6328  N N     . ASP C 2 77  ? 88.985  55.324 -44.910 1.00 46.54  ? 477  ASP A N     1 
ATOM   6329  C CA    . ASP C 2 77  ? 87.770  56.039 -45.275 1.00 45.49  ? 477  ASP A CA    1 
ATOM   6330  C C     . ASP C 2 77  ? 86.670  55.888 -44.227 1.00 45.12  ? 477  ASP A C     1 
ATOM   6331  O O     . ASP C 2 77  ? 85.619  56.508 -44.356 1.00 45.76  ? 477  ASP A O     1 
ATOM   6332  C CB    . ASP C 2 77  ? 87.259  55.553 -46.632 1.00 100.62 ? 477  ASP A CB    1 
ATOM   6333  C CG    . ASP C 2 77  ? 88.193  55.926 -47.767 1.00 104.98 ? 477  ASP A CG    1 
ATOM   6334  O OD1   . ASP C 2 77  ? 87.957  55.486 -48.914 1.00 107.55 ? 477  ASP A OD1   1 
ATOM   6335  O OD2   . ASP C 2 77  ? 89.166  56.665 -47.510 1.00 107.84 ? 477  ASP A OD2   1 
ATOM   6336  N N     . PHE C 2 78  ? 86.912  55.075 -43.196 1.00 49.84  ? 478  PHE A N     1 
ATOM   6337  C CA    . PHE C 2 78  ? 85.914  54.837 -42.154 1.00 49.31  ? 478  PHE A CA    1 
ATOM   6338  C C     . PHE C 2 78  ? 86.379  55.399 -40.828 1.00 49.69  ? 478  PHE A C     1 
ATOM   6339  O O     . PHE C 2 78  ? 85.577  55.736 -39.947 1.00 49.42  ? 478  PHE A O     1 
ATOM   6340  C CB    . PHE C 2 78  ? 85.627  53.327 -41.993 1.00 49.24  ? 478  PHE A CB    1 
ATOM   6341  C CG    . PHE C 2 78  ? 85.032  52.682 -43.217 1.00 48.88  ? 478  PHE A CG    1 
ATOM   6342  C CD1   . PHE C 2 78  ? 85.747  51.715 -43.930 1.00 46.16  ? 478  PHE A CD1   1 
ATOM   6343  C CD2   . PHE C 2 78  ? 83.780  53.079 -43.692 1.00 49.95  ? 478  PHE A CD2   1 
ATOM   6344  C CE1   . PHE C 2 78  ? 85.221  51.153 -45.102 1.00 46.05  ? 478  PHE A CE1   1 
ATOM   6345  C CE2   . PHE C 2 78  ? 83.248  52.526 -44.856 1.00 48.67  ? 478  PHE A CE2   1 
ATOM   6346  C CZ    . PHE C 2 78  ? 83.968  51.564 -45.569 1.00 46.76  ? 478  PHE A CZ    1 
ATOM   6347  N N     . LYS C 2 79  ? 87.690  55.453 -40.661 1.00 60.12  ? 479  LYS A N     1 
ATOM   6348  C CA    . LYS C 2 79  ? 88.262  56.012 -39.456 1.00 60.35  ? 479  LYS A CA    1 
ATOM   6349  C C     . LYS C 2 79  ? 89.729  56.219 -39.691 1.00 60.07  ? 479  LYS A C     1 
ATOM   6350  O O     . LYS C 2 79  ? 90.442  55.337 -40.168 1.00 56.78  ? 479  LYS A O     1 
ATOM   6351  C CB    . LYS C 2 79  ? 88.065  55.126 -38.241 1.00 54.79  ? 479  LYS A CB    1 
ATOM   6352  C CG    . LYS C 2 79  ? 88.678  55.771 -37.015 1.00 56.88  ? 479  LYS A CG    1 
ATOM   6353  C CD    . LYS C 2 79  ? 88.611  54.931 -35.747 1.00 65.29  ? 479  LYS A CD    1 
ATOM   6354  C CE    . LYS C 2 79  ? 89.257  55.689 -34.571 1.00 68.81  ? 479  LYS A CE    1 
ATOM   6355  N NZ    . LYS C 2 79  ? 89.384  54.877 -33.315 1.00 73.43  ? 479  LYS A NZ    1 
ATOM   6356  N N     . THR C 2 80  ? 90.159  57.417 -39.340 1.00 46.10  ? 480  THR A N     1 
ATOM   6357  C CA    . THR C 2 80  ? 91.526  57.862 -39.503 1.00 45.81  ? 480  THR A CA    1 
ATOM   6358  C C     . THR C 2 80  ? 92.529  57.337 -38.468 1.00 46.69  ? 480  THR A C     1 
ATOM   6359  O O     . THR C 2 80  ? 92.164  56.950 -37.356 1.00 46.77  ? 480  THR A O     1 
ATOM   6360  C CB    . THR C 2 80  ? 91.520  59.370 -39.492 1.00 51.90  ? 480  THR A CB    1 
ATOM   6361  O OG1   . THR C 2 80  ? 90.555  59.795 -38.530 1.00 52.33  ? 480  THR A OG1   1 
ATOM   6362  C CG2   . THR C 2 80  ? 91.126  59.919 -40.845 1.00 52.74  ? 480  THR A CG2   1 
ATOM   6363  N N     . ASP C 2 81  ? 93.799  57.351 -38.875 1.00 83.49  ? 481  ASP A N     1 
ATOM   6364  C CA    . ASP C 2 81  ? 94.931  56.894 -38.077 1.00 84.17  ? 481  ASP A CA    1 
ATOM   6365  C C     . ASP C 2 81  ? 94.600  55.624 -37.332 1.00 85.21  ? 481  ASP A C     1 
ATOM   6366  O O     . ASP C 2 81  ? 94.377  55.626 -36.125 1.00 85.27  ? 481  ASP A O     1 
ATOM   6367  C CB    . ASP C 2 81  ? 95.394  57.984 -37.099 1.00 83.23  ? 481  ASP A CB    1 
ATOM   6368  C CG    . ASP C 2 81  ? 96.619  57.563 -36.271 1.00 83.73  ? 481  ASP A CG    1 
ATOM   6369  O OD1   . ASP C 2 81  ? 97.472  56.802 -36.791 1.00 84.71  ? 481  ASP A OD1   1 
ATOM   6370  O OD2   . ASP C 2 81  ? 96.735  58.013 -35.104 1.00 87.31  ? 481  ASP A OD2   1 
ATOM   6371  N N     . LEU C 2 82  ? 94.555  54.529 -38.070 1.00 42.33  ? 482  LEU A N     1 
ATOM   6372  C CA    . LEU C 2 82  ? 94.267  53.253 -37.468 1.00 39.43  ? 482  LEU A CA    1 
ATOM   6373  C C     . LEU C 2 82  ? 95.492  52.347 -37.514 1.00 38.74  ? 482  LEU A C     1 
ATOM   6374  O O     . LEU C 2 82  ? 96.489  52.648 -38.171 1.00 39.65  ? 482  LEU A O     1 
ATOM   6375  C CB    . LEU C 2 82  ? 93.089  52.586 -38.182 1.00 38.61  ? 482  LEU A CB    1 
ATOM   6376  C CG    . LEU C 2 82  ? 91.668  52.944 -37.724 1.00 38.90  ? 482  LEU A CG    1 
ATOM   6377  C CD1   . LEU C 2 82  ? 90.654  52.344 -38.687 1.00 40.66  ? 482  LEU A CD1   1 
ATOM   6378  C CD2   . LEU C 2 82  ? 91.424  52.416 -36.309 1.00 36.09  ? 482  LEU A CD2   1 
ATOM   6379  N N     . ARG C 2 83  ? 95.427  51.243 -36.790 1.00 57.92  ? 483  ARG A N     1 
ATOM   6380  C CA    . ARG C 2 83  ? 96.527  50.312 -36.803 1.00 58.24  ? 483  ARG A CA    1 
ATOM   6381  C C     . ARG C 2 83  ? 95.917  48.936 -37.015 1.00 58.07  ? 483  ARG A C     1 
ATOM   6382  O O     . ARG C 2 83  ? 94.718  48.748 -36.811 1.00 53.51  ? 483  ARG A O     1 
ATOM   6383  C CB    . ARG C 2 83  ? 97.289  50.389 -35.488 1.00 59.43  ? 483  ARG A CB    1 
ATOM   6384  C CG    . ARG C 2 83  ? 97.541  51.810 -35.056 1.00 66.06  ? 483  ARG A CG    1 
ATOM   6385  C CD    . ARG C 2 83  ? 98.577  51.898 -33.964 1.00 69.70  ? 483  ARG A CD    1 
ATOM   6386  N NE    . ARG C 2 83  ? 99.927  51.787 -34.499 1.00 78.53  ? 483  ARG A NE    1 
ATOM   6387  C CZ    . ARG C 2 83  ? 101.029 51.902 -33.765 1.00 80.19  ? 483  ARG A CZ    1 
ATOM   6388  N NH1   . ARG C 2 83  ? 100.934 52.131 -32.462 1.00 82.17  ? 483  ARG A NH1   1 
ATOM   6389  N NH2   . ARG C 2 83  ? 102.224 51.789 -34.333 1.00 82.40  ? 483  ARG A NH2   1 
ATOM   6390  N N     . PHE C 2 84  ? 96.727  47.985 -37.456 1.00 53.92  ? 484  PHE A N     1 
ATOM   6391  C CA    . PHE C 2 84  ? 96.227  46.651 -37.679 1.00 54.09  ? 484  PHE A CA    1 
ATOM   6392  C C     . PHE C 2 84  ? 97.149  45.598 -37.100 1.00 55.08  ? 484  PHE A C     1 
ATOM   6393  O O     . PHE C 2 84  ? 98.359  45.639 -37.319 1.00 55.69  ? 484  PHE A O     1 
ATOM   6394  C CB    . PHE C 2 84  ? 96.069  46.387 -39.165 1.00 50.68  ? 484  PHE A CB    1 
ATOM   6395  C CG    . PHE C 2 84  ? 94.860  47.017 -39.770 1.00 49.72  ? 484  PHE A CG    1 
ATOM   6396  C CD1   . PHE C 2 84  ? 94.844  48.369 -40.079 1.00 51.09  ? 484  PHE A CD1   1 
ATOM   6397  C CD2   . PHE C 2 84  ? 93.746  46.243 -40.076 1.00 50.64  ? 484  PHE A CD2   1 
ATOM   6398  C CE1   . PHE C 2 84  ? 93.736  48.945 -40.687 1.00 48.46  ? 484  PHE A CE1   1 
ATOM   6399  C CE2   . PHE C 2 84  ? 92.634  46.805 -40.683 1.00 47.77  ? 484  PHE A CE2   1 
ATOM   6400  C CZ    . PHE C 2 84  ? 92.626  48.156 -40.992 1.00 48.10  ? 484  PHE A CZ    1 
ATOM   6401  N N     . GLN C 2 85  ? 96.586  44.659 -36.346 1.00 52.16  ? 485  GLN A N     1 
ATOM   6402  C CA    . GLN C 2 85  ? 97.405  43.597 -35.815 1.00 51.27  ? 485  GLN A CA    1 
ATOM   6403  C C     . GLN C 2 85  ? 97.892  42.866 -37.059 1.00 52.03  ? 485  GLN A C     1 
ATOM   6404  O O     . GLN C 2 85  ? 97.200  42.805 -38.075 1.00 50.63  ? 485  GLN A O     1 
ATOM   6405  C CB    . GLN C 2 85  ? 96.589  42.630 -34.961 1.00 41.73  ? 485  GLN A CB    1 
ATOM   6406  C CG    . GLN C 2 85  ? 95.890  43.262 -33.798 1.00 42.18  ? 485  GLN A CG    1 
ATOM   6407  C CD    . GLN C 2 85  ? 95.504  42.258 -32.723 1.00 46.58  ? 485  GLN A CD    1 
ATOM   6408  O OE1   . GLN C 2 85  ? 94.873  41.231 -32.994 1.00 45.06  ? 485  GLN A OE1   1 
ATOM   6409  N NE2   . GLN C 2 85  ? 95.879  42.558 -31.489 1.00 46.46  ? 485  GLN A NE2   1 
ATOM   6410  N N     . SER C 2 86  ? 99.093  42.325 -36.996 1.00 43.20  ? 486  SER A N     1 
ATOM   6411  C CA    . SER C 2 86  ? 99.621  41.590 -38.115 1.00 41.48  ? 486  SER A CA    1 
ATOM   6412  C C     . SER C 2 86  ? 98.548  40.581 -38.486 1.00 39.72  ? 486  SER A C     1 
ATOM   6413  O O     . SER C 2 86  ? 98.311  40.309 -39.659 1.00 39.24  ? 486  SER A O     1 
ATOM   6414  C CB    . SER C 2 86  ? 100.890 40.869 -37.685 1.00 61.72  ? 486  SER A CB    1 
ATOM   6415  O OG    . SER C 2 86  ? 101.442 40.161 -38.766 1.00 70.56  ? 486  SER A OG    1 
ATOM   6416  N N     . SER C 2 87  ? 97.880  40.062 -37.461 1.00 46.36  ? 487  SER A N     1 
ATOM   6417  C CA    . SER C 2 87  ? 96.847  39.052 -37.634 1.00 47.43  ? 487  SER A CA    1 
ATOM   6418  C C     . SER C 2 87  ? 95.520  39.485 -38.242 1.00 46.09  ? 487  SER A C     1 
ATOM   6419  O O     . SER C 2 87  ? 94.838  38.670 -38.890 1.00 44.57  ? 487  SER A O     1 
ATOM   6420  C CB    . SER C 2 87  ? 96.575  38.386 -36.303 1.00 36.42  ? 487  SER A CB    1 
ATOM   6421  O OG    . SER C 2 87  ? 96.446  39.371 -35.309 1.00 44.34  ? 487  SER A OG    1 
ATOM   6422  N N     . ALA C 2 88  ? 95.132  40.740 -38.033 1.00 41.92  ? 488  ALA A N     1 
ATOM   6423  C CA    . ALA C 2 88  ? 93.871  41.201 -38.595 1.00 40.27  ? 488  ALA A CA    1 
ATOM   6424  C C     . ALA C 2 88  ? 93.983  41.242 -40.103 1.00 40.77  ? 488  ALA A C     1 
ATOM   6425  O O     . ALA C 2 88  ? 93.038  40.886 -40.814 1.00 40.18  ? 488  ALA A O     1 
ATOM   6426  C CB    . ALA C 2 88  ? 93.514  42.556 -38.069 1.00 28.64  ? 488  ALA A CB    1 
ATOM   6427  N N     . VAL C 2 89  ? 95.142  41.669 -40.598 1.00 24.21  ? 489  VAL A N     1 
ATOM   6428  C CA    . VAL C 2 89  ? 95.357  41.737 -42.048 1.00 25.03  ? 489  VAL A CA    1 
ATOM   6429  C C     . VAL C 2 89  ? 95.412  40.322 -42.622 1.00 27.07  ? 489  VAL A C     1 
ATOM   6430  O O     . VAL C 2 89  ? 94.863  40.050 -43.685 1.00 28.96  ? 489  VAL A O     1 
ATOM   6431  C CB    . VAL C 2 89  ? 96.656  42.524 -42.388 1.00 17.70  ? 489  VAL A CB    1 
ATOM   6432  C CG1   . VAL C 2 89  ? 96.908  42.533 -43.868 1.00 14.85  ? 489  VAL A CG1   1 
ATOM   6433  C CG2   . VAL C 2 89  ? 96.516  43.953 -41.915 1.00 16.55  ? 489  VAL A CG2   1 
ATOM   6434  N N     . MET C 2 90  ? 96.055  39.420 -41.899 1.00 38.45  ? 490  MET A N     1 
ATOM   6435  C CA    . MET C 2 90  ? 96.129  38.049 -42.348 1.00 40.15  ? 490  MET A CA    1 
ATOM   6436  C C     . MET C 2 90  ? 94.718  37.454 -42.458 1.00 37.06  ? 490  MET A C     1 
ATOM   6437  O O     . MET C 2 90  ? 94.397  36.804 -43.451 1.00 36.05  ? 490  MET A O     1 
ATOM   6438  C CB    . MET C 2 90  ? 96.991  37.222 -41.394 1.00 54.87  ? 490  MET A CB    1 
ATOM   6439  C CG    . MET C 2 90  ? 98.459  37.519 -41.522 1.00 65.27  ? 490  MET A CG    1 
ATOM   6440  S SD    . MET C 2 90  ? 98.988  37.243 -43.222 1.00 75.01  ? 490  MET A SD    1 
ATOM   6441  C CE    . MET C 2 90  ? 99.795  35.653 -43.027 1.00 75.58  ? 490  MET A CE    1 
ATOM   6442  N N     . ALA C 2 91  ? 93.868  37.668 -41.455 1.00 45.30  ? 491  ALA A N     1 
ATOM   6443  C CA    . ALA C 2 91  ? 92.512  37.144 -41.536 1.00 43.12  ? 491  ALA A CA    1 
ATOM   6444  C C     . ALA C 2 91  ? 91.818  37.756 -42.755 1.00 42.51  ? 491  ALA A C     1 
ATOM   6445  O O     . ALA C 2 91  ? 91.266  37.046 -43.590 1.00 42.93  ? 491  ALA A O     1 
ATOM   6446  C CB    . ALA C 2 91  ? 91.760  37.478 -40.300 1.00 21.37  ? 491  ALA A CB    1 
ATOM   6447  N N     . LEU C 2 92  ? 91.853  39.078 -42.862 1.00 26.31  ? 492  LEU A N     1 
ATOM   6448  C CA    . LEU C 2 92  ? 91.239  39.746 -43.996 1.00 27.73  ? 492  LEU A CA    1 
ATOM   6449  C C     . LEU C 2 92  ? 91.649  39.140 -45.342 1.00 27.54  ? 492  LEU A C     1 
ATOM   6450  O O     . LEU C 2 92  ? 90.798  38.913 -46.220 1.00 27.42  ? 492  LEU A O     1 
ATOM   6451  C CB    . LEU C 2 92  ? 91.602  41.229 -43.987 1.00 32.58  ? 492  LEU A CB    1 
ATOM   6452  C CG    . LEU C 2 92  ? 90.765  42.230 -43.182 1.00 36.40  ? 492  LEU A CG    1 
ATOM   6453  C CD1   . LEU C 2 92  ? 91.381  43.600 -43.314 1.00 36.98  ? 492  LEU A CD1   1 
ATOM   6454  C CD2   . LEU C 2 92  ? 89.332  42.265 -43.693 1.00 34.20  ? 492  LEU A CD2   1 
ATOM   6455  N N     . GLN C 2 93  ? 92.945  38.887 -45.525 1.00 40.84  ? 493  GLN A N     1 
ATOM   6456  C CA    . GLN C 2 93  ? 93.407  38.312 -46.793 1.00 43.30  ? 493  GLN A CA    1 
ATOM   6457  C C     . GLN C 2 93  ? 92.898  36.896 -46.952 1.00 40.94  ? 493  GLN A C     1 
ATOM   6458  O O     . GLN C 2 93  ? 92.329  36.514 -47.973 1.00 41.84  ? 493  GLN A O     1 
ATOM   6459  C CB    . GLN C 2 93  ? 94.934  38.283 -46.888 1.00 35.73  ? 493  GLN A CB    1 
ATOM   6460  C CG    . GLN C 2 93  ? 95.379  38.287 -48.331 1.00 36.58  ? 493  GLN A CG    1 
ATOM   6461  C CD    . GLN C 2 93  ? 96.865  38.206 -48.511 1.00 40.90  ? 493  GLN A CD    1 
ATOM   6462  O OE1   . GLN C 2 93  ? 97.624  38.852 -47.794 1.00 39.29  ? 493  GLN A OE1   1 
ATOM   6463  N NE2   . GLN C 2 93  ? 97.297  37.424 -49.497 1.00 35.49  ? 493  GLN A NE2   1 
ATOM   6464  N N     . GLU C 2 94  ? 93.123  36.111 -45.917 1.00 35.96  ? 494  GLU A N     1 
ATOM   6465  C CA    . GLU C 2 94  ? 92.689  34.741 -45.928 1.00 38.20  ? 494  GLU A CA    1 
ATOM   6466  C C     . GLU C 2 94  ? 91.229  34.691 -46.303 1.00 37.05  ? 494  GLU A C     1 
ATOM   6467  O O     . GLU C 2 94  ? 90.800  33.799 -47.014 1.00 34.93  ? 494  GLU A O     1 
ATOM   6468  C CB    . GLU C 2 94  ? 92.907  34.139 -44.557 1.00 39.08  ? 494  GLU A CB    1 
ATOM   6469  C CG    . GLU C 2 94  ? 94.218  33.456 -44.441 1.00 45.44  ? 494  GLU A CG    1 
ATOM   6470  C CD    . GLU C 2 94  ? 94.175  32.127 -45.101 1.00 46.68  ? 494  GLU A CD    1 
ATOM   6471  O OE1   . GLU C 2 94  ? 95.204  31.441 -45.063 1.00 47.05  ? 494  GLU A OE1   1 
ATOM   6472  O OE2   . GLU C 2 94  ? 93.110  31.763 -45.654 1.00 45.53  ? 494  GLU A OE2   1 
ATOM   6473  N N     . ALA C 2 95  ? 90.473  35.670 -45.832 1.00 31.14  ? 495  ALA A N     1 
ATOM   6474  C CA    . ALA C 2 95  ? 89.048  35.719 -46.108 1.00 32.71  ? 495  ALA A CA    1 
ATOM   6475  C C     . ALA C 2 95  ? 88.791  36.187 -47.537 1.00 31.56  ? 495  ALA A C     1 
ATOM   6476  O O     . ALA C 2 95  ? 87.964  35.612 -48.252 1.00 29.24  ? 495  ALA A O     1 
ATOM   6477  C CB    . ALA C 2 95  ? 88.344  36.636 -45.076 1.00 12.43  ? 495  ALA A CB    1 
ATOM   6478  N N     . SER C 2 96  ? 89.515  37.224 -47.937 1.00 30.44  ? 496  SER A N     1 
ATOM   6479  C CA    . SER C 2 96  ? 89.419  37.777 -49.283 1.00 31.62  ? 496  SER A CA    1 
ATOM   6480  C C     . SER C 2 96  ? 89.683  36.764 -50.408 1.00 31.85  ? 496  SER A C     1 
ATOM   6481  O O     . SER C 2 96  ? 88.829  36.509 -51.255 1.00 30.22  ? 496  SER A O     1 
ATOM   6482  C CB    . SER C 2 96  ? 90.418  38.911 -49.423 1.00 31.37  ? 496  SER A CB    1 
ATOM   6483  O OG    . SER C 2 96  ? 90.008  39.992 -48.633 1.00 33.80  ? 496  SER A OG    1 
ATOM   6484  N N     . GLU C 2 97  ? 90.892  36.211 -50.417 1.00 49.19  ? 497  GLU A N     1 
ATOM   6485  C CA    . GLU C 2 97  ? 91.280  35.253 -51.430 1.00 50.34  ? 497  GLU A CA    1 
ATOM   6486  C C     . GLU C 2 97  ? 90.292  34.112 -51.456 1.00 50.42  ? 497  GLU A C     1 
ATOM   6487  O O     . GLU C 2 97  ? 89.860  33.671 -52.514 1.00 49.18  ? 497  GLU A O     1 
ATOM   6488  C CB    . GLU C 2 97  ? 92.706  34.757 -51.160 1.00 50.06  ? 497  GLU A CB    1 
ATOM   6489  C CG    . GLU C 2 97  ? 93.739  35.881 -51.300 1.00 52.55  ? 497  GLU A CG    1 
ATOM   6490  C CD    . GLU C 2 97  ? 95.179  35.406 -51.379 1.00 54.63  ? 497  GLU A CD    1 
ATOM   6491  O OE1   . GLU C 2 97  ? 95.774  35.101 -50.346 1.00 50.16  ? 497  GLU A OE1   1 
ATOM   6492  O OE2   . GLU C 2 97  ? 95.733  35.338 -52.484 1.00 55.23  ? 497  GLU A OE2   1 
ATOM   6493  N N     . ALA C 2 98  ? 89.900  33.657 -50.280 1.00 29.66  ? 498  ALA A N     1 
ATOM   6494  C CA    . ALA C 2 98  ? 88.950  32.556 -50.181 1.00 32.53  ? 498  ALA A CA    1 
ATOM   6495  C C     . ALA C 2 98  ? 87.653  32.873 -50.920 1.00 31.33  ? 498  ALA A C     1 
ATOM   6496  O O     . ALA C 2 98  ? 87.156  32.059 -51.692 1.00 28.13  ? 498  ALA A O     1 
ATOM   6497  C CB    . ALA C 2 98  ? 88.656  32.267 -48.730 1.00 5.52   ? 498  ALA A CB    1 
ATOM   6498  N N     . TYR C 2 99  ? 87.115  34.060 -50.656 1.00 27.50  ? 499  TYR A N     1 
ATOM   6499  C CA    . TYR C 2 99  ? 85.885  34.538 -51.260 1.00 25.87  ? 499  TYR A CA    1 
ATOM   6500  C C     . TYR C 2 99  ? 86.015  34.527 -52.750 1.00 28.83  ? 499  TYR A C     1 
ATOM   6501  O O     . TYR C 2 99  ? 85.135  34.053 -53.439 1.00 26.75  ? 499  TYR A O     1 
ATOM   6502  C CB    . TYR C 2 99  ? 85.598  35.964 -50.793 1.00 27.17  ? 499  TYR A CB    1 
ATOM   6503  C CG    . TYR C 2 99  ? 84.568  36.708 -51.609 1.00 26.25  ? 499  TYR A CG    1 
ATOM   6504  C CD1   . TYR C 2 99  ? 83.215  36.456 -51.467 1.00 26.11  ? 499  TYR A CD1   1 
ATOM   6505  C CD2   . TYR C 2 99  ? 84.947  37.654 -52.537 1.00 28.83  ? 499  TYR A CD2   1 
ATOM   6506  C CE1   . TYR C 2 99  ? 82.259  37.124 -52.227 1.00 27.90  ? 499  TYR A CE1   1 
ATOM   6507  C CE2   . TYR C 2 99  ? 83.995  38.330 -53.302 1.00 30.16  ? 499  TYR A CE2   1 
ATOM   6508  C CZ    . TYR C 2 99  ? 82.652  38.057 -53.140 1.00 27.47  ? 499  TYR A CZ    1 
ATOM   6509  O OH    . TYR C 2 99  ? 81.718  38.728 -53.907 1.00 26.49  ? 499  TYR A OH    1 
ATOM   6510  N N     . LEU C 2 100 ? 87.124  35.050 -53.245 1.00 19.53  ? 500  LEU A N     1 
ATOM   6511  C CA    . LEU C 2 100 ? 87.344  35.127 -54.674 1.00 18.93  ? 500  LEU A CA    1 
ATOM   6512  C C     . LEU C 2 100 ? 87.454  33.762 -55.339 1.00 18.82  ? 500  LEU A C     1 
ATOM   6513  O O     . LEU C 2 100 ? 86.746  33.453 -56.307 1.00 21.95  ? 500  LEU A O     1 
ATOM   6514  C CB    . LEU C 2 100 ? 88.605  35.931 -54.932 1.00 21.06  ? 500  LEU A CB    1 
ATOM   6515  C CG    . LEU C 2 100 ? 88.415  37.403 -54.604 1.00 24.30  ? 500  LEU A CG    1 
ATOM   6516  C CD1   . LEU C 2 100 ? 89.742  38.129 -54.494 1.00 24.92  ? 500  LEU A CD1   1 
ATOM   6517  C CD2   . LEU C 2 100 ? 87.561  37.998 -55.679 1.00 20.85  ? 500  LEU A CD2   1 
ATOM   6518  N N     . VAL C 2 101 ? 88.365  32.948 -54.830 1.00 20.33  ? 501  VAL A N     1 
ATOM   6519  C CA    . VAL C 2 101 ? 88.578  31.617 -55.382 1.00 22.33  ? 501  VAL A CA    1 
ATOM   6520  C C     . VAL C 2 101 ? 87.264  30.895 -55.607 1.00 21.38  ? 501  VAL A C     1 
ATOM   6521  O O     . VAL C 2 101 ? 87.116  30.121 -56.547 1.00 22.09  ? 501  VAL A O     1 
ATOM   6522  C CB    . VAL C 2 101 ? 89.409  30.754 -54.437 1.00 16.92  ? 501  VAL A CB    1 
ATOM   6523  C CG1   . VAL C 2 101 ? 89.407  29.326 -54.922 1.00 13.76  ? 501  VAL A CG1   1 
ATOM   6524  C CG2   . VAL C 2 101 ? 90.813  31.307 -54.332 1.00 16.95  ? 501  VAL A CG2   1 
ATOM   6525  N N     . ALA C 2 102 ? 86.318  31.162 -54.716 1.00 28.71  ? 502  ALA A N     1 
ATOM   6526  C CA    . ALA C 2 102 ? 85.018  30.535 -54.762 1.00 28.71  ? 502  ALA A CA    1 
ATOM   6527  C C     . ALA C 2 102 ? 84.117  31.228 -55.750 1.00 28.36  ? 502  ALA A C     1 
ATOM   6528  O O     . ALA C 2 102 ? 83.275  30.602 -56.365 1.00 28.07  ? 502  ALA A O     1 
ATOM   6529  C CB    . ALA C 2 102 ? 84.412  30.559 -53.405 1.00 26.57  ? 502  ALA A CB    1 
ATOM   6530  N N     . LEU C 2 103 ? 84.296  32.526 -55.912 1.00 24.97  ? 503  LEU A N     1 
ATOM   6531  C CA    . LEU C 2 103 ? 83.470  33.267 -56.845 1.00 25.63  ? 503  LEU A CA    1 
ATOM   6532  C C     . LEU C 2 103 ? 83.944  32.957 -58.265 1.00 27.44  ? 503  LEU A C     1 
ATOM   6533  O O     . LEU C 2 103 ? 83.178  33.074 -59.227 1.00 28.10  ? 503  LEU A O     1 
ATOM   6534  C CB    . LEU C 2 103 ? 83.539  34.784 -56.551 1.00 13.58  ? 503  LEU A CB    1 
ATOM   6535  C CG    . LEU C 2 103 ? 82.799  35.657 -57.565 1.00 18.23  ? 503  LEU A CG    1 
ATOM   6536  C CD1   . LEU C 2 103 ? 81.319  35.316 -57.501 1.00 14.77  ? 503  LEU A CD1   1 
ATOM   6537  C CD2   . LEU C 2 103 ? 83.059  37.132 -57.311 1.00 13.69  ? 503  LEU A CD2   1 
ATOM   6538  N N     . PHE C 2 104 ? 85.211  32.576 -58.404 1.00 42.46  ? 504  PHE A N     1 
ATOM   6539  C CA    . PHE C 2 104 ? 85.713  32.216 -59.724 1.00 43.06  ? 504  PHE A CA    1 
ATOM   6540  C C     . PHE C 2 104 ? 85.126  30.823 -60.030 1.00 42.75  ? 504  PHE A C     1 
ATOM   6541  O O     . PHE C 2 104 ? 84.918  30.469 -61.180 1.00 46.20  ? 504  PHE A O     1 
ATOM   6542  C CB    . PHE C 2 104 ? 87.262  32.210 -59.749 1.00 15.68  ? 504  PHE A CB    1 
ATOM   6543  C CG    . PHE C 2 104 ? 87.878  33.545 -60.096 1.00 15.63  ? 504  PHE A CG    1 
ATOM   6544  C CD1   . PHE C 2 104 ? 88.807  34.144 -59.244 1.00 16.48  ? 504  PHE A CD1   1 
ATOM   6545  C CD2   . PHE C 2 104 ? 87.497  34.228 -61.246 1.00 17.91  ? 504  PHE A CD2   1 
ATOM   6546  C CE1   . PHE C 2 104 ? 89.341  35.414 -59.533 1.00 19.31  ? 504  PHE A CE1   1 
ATOM   6547  C CE2   . PHE C 2 104 ? 88.027  35.494 -61.532 1.00 17.52  ? 504  PHE A CE2   1 
ATOM   6548  C CZ    . PHE C 2 104 ? 88.943  36.081 -60.672 1.00 18.92  ? 504  PHE A CZ    1 
ATOM   6549  N N     . GLU C 2 105 ? 84.847  30.044 -58.985 1.00 29.37  ? 505  GLU A N     1 
ATOM   6550  C CA    . GLU C 2 105 ? 84.244  28.728 -59.161 1.00 30.75  ? 505  GLU A CA    1 
ATOM   6551  C C     . GLU C 2 105 ? 82.859  28.879 -59.777 1.00 29.20  ? 505  GLU A C     1 
ATOM   6552  O O     . GLU C 2 105 ? 82.531  28.224 -60.758 1.00 31.17  ? 505  GLU A O     1 
ATOM   6553  C CB    . GLU C 2 105 ? 84.150  27.991 -57.828 1.00 39.67  ? 505  GLU A CB    1 
ATOM   6554  C CG    . GLU C 2 105 ? 85.347  27.093 -57.580 1.00 47.30  ? 505  GLU A CG    1 
ATOM   6555  C CD    . GLU C 2 105 ? 85.512  26.656 -56.119 1.00 51.18  ? 505  GLU A CD    1 
ATOM   6556  O OE1   . GLU C 2 105 ? 84.508  26.230 -55.508 1.00 51.01  ? 505  GLU A OE1   1 
ATOM   6557  O OE2   . GLU C 2 105 ? 86.651  26.726 -55.587 1.00 49.59  ? 505  GLU A OE2   1 
ATOM   6558  N N     . ASP C 2 106 ? 82.046  29.758 -59.217 1.00 36.03  ? 506  ASP A N     1 
ATOM   6559  C CA    . ASP C 2 106 ? 80.722  29.953 -59.769 1.00 36.06  ? 506  ASP A CA    1 
ATOM   6560  C C     . ASP C 2 106 ? 80.761  30.620 -61.155 1.00 35.35  ? 506  ASP A C     1 
ATOM   6561  O O     . ASP C 2 106 ? 79.884  30.397 -61.999 1.00 36.44  ? 506  ASP A O     1 
ATOM   6562  C CB    . ASP C 2 106 ? 79.871  30.806 -58.827 1.00 79.27  ? 506  ASP A CB    1 
ATOM   6563  C CG    . ASP C 2 106 ? 79.554  30.108 -57.522 1.00 79.85  ? 506  ASP A CG    1 
ATOM   6564  O OD1   . ASP C 2 106 ? 79.218  28.904 -57.564 1.00 83.25  ? 506  ASP A OD1   1 
ATOM   6565  O OD2   . ASP C 2 106 ? 79.621  30.768 -56.459 1.00 84.80  ? 506  ASP A OD2   1 
ATOM   6566  N N     . THR C 2 107 ? 81.769  31.446 -61.395 1.00 28.39  ? 507  THR A N     1 
ATOM   6567  C CA    . THR C 2 107 ? 81.840  32.123 -62.673 1.00 28.30  ? 507  THR A CA    1 
ATOM   6568  C C     . THR C 2 107 ? 82.147  31.138 -63.808 1.00 29.76  ? 507  THR A C     1 
ATOM   6569  O O     . THR C 2 107 ? 81.501  31.163 -64.873 1.00 30.34  ? 507  THR A O     1 
ATOM   6570  C CB    . THR C 2 107 ? 82.886  33.286 -62.621 1.00 33.67  ? 507  THR A CB    1 
ATOM   6571  O OG1   . THR C 2 107 ? 82.449  34.287 -61.683 1.00 28.55  ? 507  THR A OG1   1 
ATOM   6572  C CG2   . THR C 2 107 ? 83.039  33.943 -63.978 1.00 30.18  ? 507  THR A CG2   1 
ATOM   6573  N N     . ASN C 2 108 ? 83.107  30.249 -63.566 1.00 27.58  ? 508  ASN A N     1 
ATOM   6574  C CA    . ASN C 2 108 ? 83.499  29.272 -64.564 1.00 27.89  ? 508  ASN A CA    1 
ATOM   6575  C C     . ASN C 2 108 ? 82.272  28.465 -64.902 1.00 28.57  ? 508  ASN A C     1 
ATOM   6576  O O     . ASN C 2 108 ? 82.074  28.056 -66.055 1.00 25.28  ? 508  ASN A O     1 
ATOM   6577  C CB    . ASN C 2 108 ? 84.601  28.365 -64.035 1.00 36.37  ? 508  ASN A CB    1 
ATOM   6578  C CG    . ASN C 2 108 ? 85.366  27.693 -65.150 1.00 39.98  ? 508  ASN A CG    1 
ATOM   6579  O OD1   . ASN C 2 108 ? 85.810  28.351 -66.087 1.00 38.21  ? 508  ASN A OD1   1 
ATOM   6580  N ND2   . ASN C 2 108 ? 85.527  26.378 -65.062 1.00 40.49  ? 508  ASN A ND2   1 
ATOM   6581  N N     . LEU C 2 109 ? 81.439  28.255 -63.890 1.00 21.50  ? 509  LEU A N     1 
ATOM   6582  C CA    . LEU C 2 109 ? 80.209  27.517 -64.081 1.00 24.53  ? 509  LEU A CA    1 
ATOM   6583  C C     . LEU C 2 109 ? 79.278  28.309 -64.976 1.00 25.19  ? 509  LEU A C     1 
ATOM   6584  O O     . LEU C 2 109 ? 78.667  27.761 -65.891 1.00 25.54  ? 509  LEU A O     1 
ATOM   6585  C CB    . LEU C 2 109 ? 79.527  27.228 -62.743 1.00 16.69  ? 509  LEU A CB    1 
ATOM   6586  C CG    . LEU C 2 109 ? 80.123  26.041 -61.958 1.00 20.76  ? 509  LEU A CG    1 
ATOM   6587  C CD1   . LEU C 2 109 ? 79.166  25.622 -60.878 1.00 19.89  ? 509  LEU A CD1   1 
ATOM   6588  C CD2   . LEU C 2 109 ? 80.421  24.856 -62.889 1.00 17.84  ? 509  LEU A CD2   1 
ATOM   6589  N N     . CYS C 2 110 ? 79.180  29.609 -64.727 1.00 31.02  ? 510  CYS A N     1 
ATOM   6590  C CA    . CYS C 2 110 ? 78.323  30.467 -65.541 1.00 32.69  ? 510  CYS A CA    1 
ATOM   6591  C C     . CYS C 2 110 ? 78.834  30.575 -66.969 1.00 35.13  ? 510  CYS A C     1 
ATOM   6592  O O     . CYS C 2 110 ? 78.054  30.620 -67.920 1.00 33.76  ? 510  CYS A O     1 
ATOM   6593  C CB    . CYS C 2 110 ? 78.194  31.847 -64.897 1.00 31.62  ? 510  CYS A CB    1 
ATOM   6594  S SG    . CYS C 2 110 ? 77.050  31.848 -63.485 1.00 33.52  ? 510  CYS A SG    1 
ATOM   6595  N N     . ALA C 2 111 ? 80.152  30.606 -67.105 1.00 32.14  ? 511  ALA A N     1 
ATOM   6596  C CA    . ALA C 2 111 ? 80.800  30.652 -68.420 1.00 32.19  ? 511  ALA A CA    1 
ATOM   6597  C C     . ALA C 2 111 ? 80.485  29.353 -69.172 1.00 31.77  ? 511  ALA A C     1 
ATOM   6598  O O     . ALA C 2 111 ? 80.183  29.342 -70.362 1.00 32.77  ? 511  ALA A O     1 
ATOM   6599  C CB    . ALA C 2 111 ? 82.331  30.796 -68.245 1.00 29.68  ? 511  ALA A CB    1 
ATOM   6600  N N     . ILE C 2 112 ? 80.572  28.251 -68.450 1.00 30.73  ? 512  ILE A N     1 
ATOM   6601  C CA    . ILE C 2 112 ? 80.316  26.964 -69.033 1.00 32.01  ? 512  ILE A CA    1 
ATOM   6602  C C     . ILE C 2 112 ? 78.852  26.803 -69.392 1.00 32.92  ? 512  ILE A C     1 
ATOM   6603  O O     . ILE C 2 112 ? 78.525  26.253 -70.433 1.00 30.33  ? 512  ILE A O     1 
ATOM   6604  C CB    . ILE C 2 112 ? 80.775  25.880 -68.067 1.00 17.14  ? 512  ILE A CB    1 
ATOM   6605  C CG1   . ILE C 2 112 ? 82.290  26.026 -67.879 1.00 15.76  ? 512  ILE A CG1   1 
ATOM   6606  C CG2   . ILE C 2 112 ? 80.359  24.510 -68.547 1.00 19.07  ? 512  ILE A CG2   1 
ATOM   6607  C CD1   . ILE C 2 112 ? 82.967  24.847 -67.195 1.00 16.43  ? 512  ILE A CD1   1 
ATOM   6608  N N     . HIS C 2 113 ? 77.965  27.297 -68.544 1.00 38.29  ? 513  HIS A N     1 
ATOM   6609  C CA    . HIS C 2 113 ? 76.540  27.195 -68.823 1.00 38.00  ? 513  HIS A CA    1 
ATOM   6610  C C     . HIS C 2 113 ? 76.187  27.821 -70.180 1.00 39.42  ? 513  HIS A C     1 
ATOM   6611  O O     . HIS C 2 113 ? 75.250  27.378 -70.865 1.00 37.44  ? 513  HIS A O     1 
ATOM   6612  C CB    . HIS C 2 113 ? 75.761  27.900 -67.731 1.00 34.98  ? 513  HIS A CB    1 
ATOM   6613  C CG    . HIS C 2 113 ? 74.278  27.809 -67.889 1.00 33.93  ? 513  HIS A CG    1 
ATOM   6614  N ND1   . HIS C 2 113 ? 73.590  26.620 -67.779 1.00 35.08  ? 513  HIS A ND1   1 
ATOM   6615  C CD2   . HIS C 2 113 ? 73.340  28.767 -68.070 1.00 32.89  ? 513  HIS A CD2   1 
ATOM   6616  C CE1   . HIS C 2 113 ? 72.294  26.850 -67.877 1.00 33.38  ? 513  HIS A CE1   1 
ATOM   6617  N NE2   . HIS C 2 113 ? 72.115  28.147 -68.052 1.00 31.86  ? 513  HIS A NE2   1 
ATOM   6618  N N     . ALA C 2 114 ? 76.951  28.856 -70.543 1.00 21.23  ? 514  ALA A N     1 
ATOM   6619  C CA    . ALA C 2 114 ? 76.783  29.607 -71.785 1.00 22.53  ? 514  ALA A CA    1 
ATOM   6620  C C     . ALA C 2 114 ? 77.640  29.004 -72.865 1.00 23.00  ? 514  ALA A C     1 
ATOM   6621  O O     . ALA C 2 114 ? 77.893  29.623 -73.898 1.00 24.57  ? 514  ALA A O     1 
ATOM   6622  C CB    . ALA C 2 114 ? 77.164  31.054 -71.580 1.00 18.98  ? 514  ALA A CB    1 
ATOM   6623  N N     . LYS C 2 115 ? 78.094  27.788 -72.606 1.00 31.79  ? 515  LYS A N     1 
ATOM   6624  C CA    . LYS C 2 115 ? 78.894  27.048 -73.567 1.00 36.10  ? 515  LYS A CA    1 
ATOM   6625  C C     . LYS C 2 115 ? 80.139  27.789 -74.005 1.00 35.79  ? 515  LYS A C     1 
ATOM   6626  O O     . LYS C 2 115 ? 80.414  27.882 -75.197 1.00 35.95  ? 515  LYS A O     1 
ATOM   6627  C CB    . LYS C 2 115 ? 78.040  26.706 -74.799 1.00 51.94  ? 515  LYS A CB    1 
ATOM   6628  C CG    . LYS C 2 115 ? 76.759  25.956 -74.461 1.00 58.66  ? 515  LYS A CG    1 
ATOM   6629  C CD    . LYS C 2 115 ? 75.978  25.571 -75.688 1.00 63.62  ? 515  LYS A CD    1 
ATOM   6630  C CE    . LYS C 2 115 ? 74.847  24.633 -75.308 1.00 68.37  ? 515  LYS A CE    1 
ATOM   6631  N NZ    . LYS C 2 115 ? 74.109  24.094 -76.487 1.00 71.44  ? 515  LYS A NZ    1 
ATOM   6632  N N     . ARG C 2 116 ? 80.874  28.325 -73.033 1.00 33.76  ? 516  ARG A N     1 
ATOM   6633  C CA    . ARG C 2 116 ? 82.113  29.038 -73.296 1.00 32.80  ? 516  ARG A CA    1 
ATOM   6634  C C     . ARG C 2 116 ? 83.184  28.435 -72.397 1.00 33.15  ? 516  ARG A C     1 
ATOM   6635  O O     . ARG C 2 116 ? 82.925  27.493 -71.636 1.00 31.45  ? 516  ARG A O     1 
ATOM   6636  C CB    . ARG C 2 116 ? 81.945  30.536 -73.007 1.00 42.54  ? 516  ARG A CB    1 
ATOM   6637  C CG    . ARG C 2 116 ? 80.791  31.166 -73.777 1.00 42.37  ? 516  ARG A CG    1 
ATOM   6638  C CD    . ARG C 2 116 ? 80.747  32.716 -73.738 1.00 42.36  ? 516  ARG A CD    1 
ATOM   6639  N NE    . ARG C 2 116 ? 79.889  33.260 -72.681 1.00 40.99  ? 516  ARG A NE    1 
ATOM   6640  C CZ    . ARG C 2 116 ? 80.313  33.597 -71.459 1.00 42.38  ? 516  ARG A CZ    1 
ATOM   6641  N NH1   . ARG C 2 116 ? 81.592  33.457 -71.123 1.00 38.57  ? 516  ARG A NH1   1 
ATOM   6642  N NH2   . ARG C 2 116 ? 79.457  34.062 -70.558 1.00 41.19  ? 516  ARG A NH2   1 
ATOM   6643  N N     . VAL C 2 117 ? 84.394  28.962 -72.504 1.00 27.86  ? 517  VAL A N     1 
ATOM   6644  C CA    . VAL C 2 117 ? 85.493  28.505 -71.675 1.00 27.15  ? 517  VAL A CA    1 
ATOM   6645  C C     . VAL C 2 117 ? 86.248  29.708 -71.155 1.00 26.36  ? 517  VAL A C     1 
ATOM   6646  O O     . VAL C 2 117 ? 87.123  29.577 -70.308 1.00 28.34  ? 517  VAL A O     1 
ATOM   6647  C CB    . VAL C 2 117 ? 86.436  27.647 -72.459 1.00 42.14  ? 517  VAL A CB    1 
ATOM   6648  C CG1   . VAL C 2 117 ? 85.725  26.383 -72.883 1.00 37.73  ? 517  VAL A CG1   1 
ATOM   6649  C CG2   . VAL C 2 117 ? 86.924  28.410 -73.661 1.00 39.28  ? 517  VAL A CG2   1 
ATOM   6650  N N     . ILE C 2 118 ? 85.910  30.882 -71.676 1.00 47.76  ? 518  ILE A N     1 
ATOM   6651  C CA    . ILE C 2 118 ? 86.553  32.107 -71.238 1.00 48.12  ? 518  ILE A CA    1 
ATOM   6652  C C     . ILE C 2 118 ? 85.591  32.782 -70.301 1.00 47.86  ? 518  ILE A C     1 
ATOM   6653  O O     . ILE C 2 118 ? 84.470  33.094 -70.697 1.00 47.24  ? 518  ILE A O     1 
ATOM   6654  C CB    . ILE C 2 118 ? 86.843  33.084 -72.413 1.00 61.26  ? 518  ILE A CB    1 
ATOM   6655  C CG1   . ILE C 2 118 ? 87.832  32.441 -73.391 1.00 48.97  ? 518  ILE A CG1   1 
ATOM   6656  C CG2   . ILE C 2 118 ? 87.418  34.394 -71.887 1.00 61.47  ? 518  ILE A CG2   1 
ATOM   6657  C CD1   . ILE C 2 118 ? 88.104  33.266 -74.674 1.00 48.97  ? 518  ILE A CD1   1 
ATOM   6658  N N     . ILE C 2 119 ? 86.016  32.988 -69.057 1.00 28.82  ? 519  ILE A N     1 
ATOM   6659  C CA    . ILE C 2 119 ? 85.178  33.670 -68.080 1.00 28.29  ? 519  ILE A CA    1 
ATOM   6660  C C     . ILE C 2 119 ? 85.209  35.171 -68.407 1.00 29.17  ? 519  ILE A C     1 
ATOM   6661  O O     . ILE C 2 119 ? 86.260  35.732 -68.708 1.00 29.67  ? 519  ILE A O     1 
ATOM   6662  C CB    . ILE C 2 119 ? 85.696  33.444 -66.658 1.00 30.80  ? 519  ILE A CB    1 
ATOM   6663  C CG1   . ILE C 2 119 ? 87.111  34.003 -66.539 1.00 26.53  ? 519  ILE A CG1   1 
ATOM   6664  C CG2   . ILE C 2 119 ? 85.689  31.949 -66.329 1.00 27.18  ? 519  ILE A CG2   1 
ATOM   6665  C CD1   . ILE C 2 119 ? 87.589  34.148 -65.117 1.00 31.34  ? 519  ILE A CD1   1 
ATOM   6666  N N     . MET C 2 120 ? 84.041  35.806 -68.360 1.00 27.66  ? 520  MET A N     1 
ATOM   6667  C CA    . MET C 2 120 ? 83.896  37.227 -68.659 1.00 26.76  ? 520  MET A CA    1 
ATOM   6668  C C     . MET C 2 120 ? 83.245  37.958 -67.509 1.00 27.26  ? 520  MET A C     1 
ATOM   6669  O O     . MET C 2 120 ? 82.837  37.360 -66.536 1.00 24.76  ? 520  MET A O     1 
ATOM   6670  C CB    . MET C 2 120 ? 83.073  37.418 -69.920 1.00 47.92  ? 520  MET A CB    1 
ATOM   6671  C CG    . MET C 2 120 ? 83.688  36.739 -71.110 1.00 51.89  ? 520  MET A CG    1 
ATOM   6672  S SD    . MET C 2 120 ? 82.907  37.290 -72.604 1.00 56.23  ? 520  MET A SD    1 
ATOM   6673  C CE    . MET C 2 120 ? 81.850  35.868 -73.027 1.00 55.49  ? 520  MET A CE    1 
ATOM   6674  N N     . PRO C 2 121 ? 83.133  39.280 -67.617 1.00 43.84  ? 521  PRO A N     1 
ATOM   6675  C CA    . PRO C 2 121 ? 82.521  40.016 -66.514 1.00 45.83  ? 521  PRO A CA    1 
ATOM   6676  C C     . PRO C 2 121 ? 81.078  39.644 -66.272 1.00 46.96  ? 521  PRO A C     1 
ATOM   6677  O O     . PRO C 2 121 ? 80.646  39.538 -65.119 1.00 45.99  ? 521  PRO A O     1 
ATOM   6678  C CB    . PRO C 2 121 ? 82.666  41.462 -66.950 1.00 22.26  ? 521  PRO A CB    1 
ATOM   6679  C CG    . PRO C 2 121 ? 83.863  41.433 -67.887 1.00 23.34  ? 521  PRO A CG    1 
ATOM   6680  C CD    . PRO C 2 121 ? 83.593  40.199 -68.673 1.00 24.61  ? 521  PRO A CD    1 
ATOM   6681  N N     . LYS C 2 122 ? 80.335  39.438 -67.359 1.00 38.21  ? 522  LYS A N     1 
ATOM   6682  C CA    . LYS C 2 122 ? 78.931  39.106 -67.234 1.00 38.38  ? 522  LYS A CA    1 
ATOM   6683  C C     . LYS C 2 122 ? 78.733  37.803 -66.475 1.00 37.35  ? 522  LYS A C     1 
ATOM   6684  O O     . LYS C 2 122 ? 77.667  37.579 -65.900 1.00 37.23  ? 522  LYS A O     1 
ATOM   6685  C CB    . LYS C 2 122 ? 78.269  39.053 -68.606 1.00 33.30  ? 522  LYS A CB    1 
ATOM   6686  C CG    . LYS C 2 122 ? 78.826  38.016 -69.542 1.00 39.32  ? 522  LYS A CG    1 
ATOM   6687  C CD    . LYS C 2 122 ? 78.127  38.087 -70.879 1.00 44.49  ? 522  LYS A CD    1 
ATOM   6688  C CE    . LYS C 2 122 ? 78.799  37.191 -71.877 1.00 48.52  ? 522  LYS A CE    1 
ATOM   6689  N NZ    . LYS C 2 122 ? 78.245  37.413 -73.244 1.00 53.57  ? 522  LYS A NZ    1 
ATOM   6690  N N     . ASP C 2 123 ? 79.761  36.952 -66.474 1.00 22.02  ? 523  ASP A N     1 
ATOM   6691  C CA    . ASP C 2 123 ? 79.733  35.690 -65.738 1.00 22.74  ? 523  ASP A CA    1 
ATOM   6692  C C     . ASP C 2 123 ? 79.850  35.973 -64.234 1.00 20.31  ? 523  ASP A C     1 
ATOM   6693  O O     . ASP C 2 123 ? 79.181  35.330 -63.411 1.00 17.98  ? 523  ASP A O     1 
ATOM   6694  C CB    . ASP C 2 123 ? 80.888  34.800 -66.170 1.00 43.74  ? 523  ASP A CB    1 
ATOM   6695  C CG    . ASP C 2 123 ? 80.731  34.297 -67.578 1.00 46.56  ? 523  ASP A CG    1 
ATOM   6696  O OD1   . ASP C 2 123 ? 79.629  33.829 -67.926 1.00 45.69  ? 523  ASP A OD1   1 
ATOM   6697  O OD2   . ASP C 2 123 ? 81.713  34.353 -68.337 1.00 44.34  ? 523  ASP A OD2   1 
ATOM   6698  N N     . ILE C 2 124 ? 80.703  36.932 -63.872 1.00 20.41  ? 524  ILE A N     1 
ATOM   6699  C CA    . ILE C 2 124 ? 80.857  37.311 -62.473 1.00 21.94  ? 524  ILE A CA    1 
ATOM   6700  C C     . ILE C 2 124 ? 79.555  37.994 -62.104 1.00 20.73  ? 524  ILE A C     1 
ATOM   6701  O O     . ILE C 2 124 ? 78.949  37.723 -61.061 1.00 21.40  ? 524  ILE A O     1 
ATOM   6702  C CB    . ILE C 2 124 ? 82.043  38.295 -62.259 1.00 23.29  ? 524  ILE A CB    1 
ATOM   6703  C CG1   . ILE C 2 124 ? 83.366  37.554 -62.472 1.00 27.00  ? 524  ILE A CG1   1 
ATOM   6704  C CG2   . ILE C 2 124 ? 82.037  38.842 -60.846 1.00 24.19  ? 524  ILE A CG2   1 
ATOM   6705  C CD1   . ILE C 2 124 ? 84.592  38.451 -62.558 1.00 28.38  ? 524  ILE A CD1   1 
ATOM   6706  N N     . GLN C 2 125 ? 79.107  38.865 -62.996 1.00 23.72  ? 525  GLN A N     1 
ATOM   6707  C CA    . GLN C 2 125 ? 77.870  39.590 -62.782 1.00 27.76  ? 525  GLN A CA    1 
ATOM   6708  C C     . GLN C 2 125 ? 76.699  38.675 -62.445 1.00 25.35  ? 525  GLN A C     1 
ATOM   6709  O O     . GLN C 2 125 ? 75.983  38.907 -61.474 1.00 27.85  ? 525  GLN A O     1 
ATOM   6710  C CB    . GLN C 2 125 ? 77.567  40.422 -64.017 1.00 68.23  ? 525  GLN A CB    1 
ATOM   6711  C CG    . GLN C 2 125 ? 78.471  41.623 -64.128 1.00 75.56  ? 525  GLN A CG    1 
ATOM   6712  C CD    . GLN C 2 125 ? 78.356  42.306 -65.456 1.00 78.23  ? 525  GLN A CD    1 
ATOM   6713  O OE1   . GLN C 2 125 ? 77.260  42.470 -65.994 1.00 79.34  ? 525  GLN A OE1   1 
ATOM   6714  N NE2   . GLN C 2 125 ? 79.489  42.723 -65.998 1.00 84.14  ? 525  GLN A NE2   1 
ATOM   6715  N N     . LEU C 2 126 ? 76.520  37.628 -63.245 1.00 21.52  ? 526  LEU A N     1 
ATOM   6716  C CA    . LEU C 2 126 ? 75.442  36.663 -63.048 1.00 21.73  ? 526  LEU A CA    1 
ATOM   6717  C C     . LEU C 2 126 ? 75.560  35.884 -61.768 1.00 23.31  ? 526  LEU A C     1 
ATOM   6718  O O     . LEU C 2 126 ? 74.561  35.610 -61.124 1.00 22.22  ? 526  LEU A O     1 
ATOM   6719  C CB    . LEU C 2 126 ? 75.384  35.651 -64.194 1.00 14.12  ? 526  LEU A CB    1 
ATOM   6720  C CG    . LEU C 2 126 ? 74.208  34.668 -64.125 1.00 14.91  ? 526  LEU A CG    1 
ATOM   6721  C CD1   . LEU C 2 126 ? 72.879  35.402 -64.283 1.00 14.58  ? 526  LEU A CD1   1 
ATOM   6722  C CD2   . LEU C 2 126 ? 74.365  33.632 -65.205 1.00 11.62  ? 526  LEU A CD2   1 
ATOM   6723  N N     . ALA C 2 127 ? 76.778  35.508 -61.405 1.00 19.49  ? 527  ALA A N     1 
ATOM   6724  C CA    . ALA C 2 127 ? 76.974  34.726 -60.195 1.00 19.68  ? 527  ALA A CA    1 
ATOM   6725  C C     . ALA C 2 127 ? 76.653  35.564 -58.971 1.00 20.60  ? 527  ALA A C     1 
ATOM   6726  O O     . ALA C 2 127 ? 75.963  35.117 -58.055 1.00 19.38  ? 527  ALA A O     1 
ATOM   6727  C CB    . ALA C 2 127 ? 78.389  34.220 -60.139 1.00 43.99  ? 527  ALA A CB    1 
ATOM   6728  N N     . ARG C 2 128 ? 77.125  36.799 -58.967 1.00 25.54  ? 528  ARG A N     1 
ATOM   6729  C CA    . ARG C 2 128 ? 76.865  37.639 -57.825 1.00 24.55  ? 528  ARG A CA    1 
ATOM   6730  C C     . ARG C 2 128 ? 75.385  37.957 -57.707 1.00 26.84  ? 528  ARG A C     1 
ATOM   6731  O O     . ARG C 2 128 ? 74.883  38.142 -56.601 1.00 26.48  ? 528  ARG A O     1 
ATOM   6732  C CB    . ARG C 2 128 ? 77.702  38.911 -57.895 1.00 26.08  ? 528  ARG A CB    1 
ATOM   6733  C CG    . ARG C 2 128 ? 79.191  38.629 -57.771 1.00 27.30  ? 528  ARG A CG    1 
ATOM   6734  C CD    . ARG C 2 128 ? 79.986  39.894 -57.518 1.00 35.04  ? 528  ARG A CD    1 
ATOM   6735  N NE    . ARG C 2 128 ? 79.460  40.616 -56.364 1.00 35.56  ? 528  ARG A NE    1 
ATOM   6736  C CZ    . ARG C 2 128 ? 79.129  41.903 -56.375 1.00 38.08  ? 528  ARG A CZ    1 
ATOM   6737  N NH1   . ARG C 2 128 ? 79.269  42.610 -57.487 1.00 38.66  ? 528  ARG A NH1   1 
ATOM   6738  N NH2   . ARG C 2 128 ? 78.664  42.483 -55.275 1.00 40.53  ? 528  ARG A NH2   1 
ATOM   6739  N N     . ARG C 2 129 ? 74.673  37.991 -58.829 1.00 29.38  ? 529  ARG A N     1 
ATOM   6740  C CA    . ARG C 2 129 ? 73.259  38.276 -58.744 1.00 32.75  ? 529  ARG A CA    1 
ATOM   6741  C C     . ARG C 2 129 ? 72.486  37.112 -58.140 1.00 31.49  ? 529  ARG A C     1 
ATOM   6742  O O     . ARG C 2 129 ? 71.614  37.300 -57.290 1.00 29.86  ? 529  ARG A O     1 
ATOM   6743  C CB    . ARG C 2 129 ? 72.665  38.616 -60.095 1.00 56.54  ? 529  ARG A CB    1 
ATOM   6744  C CG    . ARG C 2 129 ? 71.409  39.395 -59.897 1.00 63.91  ? 529  ARG A CG    1 
ATOM   6745  C CD    . ARG C 2 129 ? 70.562  39.522 -61.122 1.00 68.78  ? 529  ARG A CD    1 
ATOM   6746  N NE    . ARG C 2 129 ? 69.200  39.919 -60.751 1.00 68.32  ? 529  ARG A NE    1 
ATOM   6747  C CZ    . ARG C 2 129 ? 68.463  39.320 -59.803 1.00 68.07  ? 529  ARG A CZ    1 
ATOM   6748  N NH1   . ARG C 2 129 ? 68.941  38.284 -59.101 1.00 60.42  ? 529  ARG A NH1   1 
ATOM   6749  N NH2   . ARG C 2 129 ? 67.228  39.752 -59.562 1.00 69.99  ? 529  ARG A NH2   1 
ATOM   6750  N N     . ILE C 2 130 ? 72.789  35.896 -58.561 1.00 26.59  ? 530  ILE A N     1 
ATOM   6751  C CA    . ILE C 2 130 ? 72.066  34.779 -58.001 1.00 28.38  ? 530  ILE A CA    1 
ATOM   6752  C C     . ILE C 2 130 ? 72.483  34.575 -56.542 1.00 29.41  ? 530  ILE A C     1 
ATOM   6753  O O     . ILE C 2 130 ? 71.748  33.974 -55.749 1.00 28.81  ? 530  ILE A O     1 
ATOM   6754  C CB    . ILE C 2 130 ? 72.314  33.532 -58.816 1.00 34.62  ? 530  ILE A CB    1 
ATOM   6755  C CG1   . ILE C 2 130 ? 71.795  33.754 -60.223 1.00 35.75  ? 530  ILE A CG1   1 
ATOM   6756  C CG2   . ILE C 2 130 ? 71.598  32.341 -58.211 1.00 32.32  ? 530  ILE A CG2   1 
ATOM   6757  C CD1   . ILE C 2 130 ? 72.019  32.556 -61.124 1.00 41.11  ? 530  ILE A CD1   1 
ATOM   6758  N N     . ARG C 2 131 ? 73.659  35.093 -56.190 1.00 31.39  ? 531  ARG A N     1 
ATOM   6759  C CA    . ARG C 2 131 ? 74.176  34.996 -54.827 1.00 32.90  ? 531  ARG A CA    1 
ATOM   6760  C C     . ARG C 2 131 ? 73.487  35.998 -53.897 1.00 35.46  ? 531  ARG A C     1 
ATOM   6761  O O     . ARG C 2 131 ? 73.637  35.935 -52.680 1.00 36.95  ? 531  ARG A O     1 
ATOM   6762  C CB    . ARG C 2 131 ? 75.679  35.261 -54.812 1.00 28.96  ? 531  ARG A CB    1 
ATOM   6763  C CG    . ARG C 2 131 ? 76.554  34.060 -55.092 1.00 27.45  ? 531  ARG A CG    1 
ATOM   6764  C CD    . ARG C 2 131 ? 78.012  34.497 -55.224 1.00 27.77  ? 531  ARG A CD    1 
ATOM   6765  N NE    . ARG C 2 131 ? 78.994  33.435 -54.959 1.00 30.59  ? 531  ARG A NE    1 
ATOM   6766  C CZ    . ARG C 2 131 ? 80.132  33.617 -54.275 1.00 29.21  ? 531  ARG A CZ    1 
ATOM   6767  N NH1   . ARG C 2 131 ? 80.449  34.818 -53.779 1.00 21.60  ? 531  ARG A NH1   1 
ATOM   6768  N NH2   . ARG C 2 131 ? 80.955  32.603 -54.076 1.00 27.41  ? 531  ARG A NH2   1 
ATOM   6769  N N     . GLY C 2 132 ? 72.731  36.924 -54.468 1.00 45.60  ? 532  GLY A N     1 
ATOM   6770  C CA    . GLY C 2 132 ? 72.058  37.912 -53.651 1.00 48.75  ? 532  GLY A CA    1 
ATOM   6771  C C     . GLY C 2 132 ? 72.990  39.044 -53.247 1.00 51.97  ? 532  GLY A C     1 
ATOM   6772  O O     . GLY C 2 132 ? 72.691  39.851 -52.365 1.00 51.74  ? 532  GLY A O     1 
ATOM   6773  N N     . GLU C 2 133 ? 74.133  39.117 -53.906 1.00 42.06  ? 533  GLU A N     1 
ATOM   6774  C CA    . GLU C 2 133 ? 75.091  40.152 -53.592 1.00 46.19  ? 533  GLU A CA    1 
ATOM   6775  C C     . GLU C 2 133 ? 74.835  41.399 -54.411 1.00 51.44  ? 533  GLU A C     1 
ATOM   6776  O O     . GLU C 2 133 ? 75.295  42.485 -54.049 1.00 52.32  ? 533  GLU A O     1 
ATOM   6777  C CB    . GLU C 2 133 ? 76.511  39.637 -53.850 1.00 50.44  ? 533  GLU A CB    1 
ATOM   6778  C CG    . GLU C 2 133 ? 77.025  38.676 -52.791 1.00 45.60  ? 533  GLU A CG    1 
ATOM   6779  C CD    . GLU C 2 133 ? 78.273  37.935 -53.228 1.00 45.42  ? 533  GLU A CD    1 
ATOM   6780  O OE1   . GLU C 2 133 ? 79.112  38.582 -53.904 1.00 42.12  ? 533  GLU A OE1   1 
ATOM   6781  O OE2   . GLU C 2 133 ? 78.418  36.722 -52.888 1.00 43.19  ? 533  GLU A OE2   1 
ATOM   6782  N N     . ARG C 2 134 ? 74.093  41.240 -55.506 1.00 73.01  ? 534  ARG A N     1 
ATOM   6783  C CA    . ARG C 2 134 ? 73.792  42.343 -56.416 1.00 80.25  ? 534  ARG A CA    1 
ATOM   6784  C C     . ARG C 2 134 ? 72.375  42.870 -56.222 1.00 83.38  ? 534  ARG A C     1 
ATOM   6785  O O     . ARG C 2 134 ? 72.144  43.806 -55.449 1.00 84.75  ? 534  ARG A O     1 
ATOM   6786  C CB    . ARG C 2 134 ? 73.966  41.873 -57.859 1.00 166.73 ? 534  ARG A CB    1 
ATOM   6787  C CG    . ARG C 2 134 ? 74.591  42.888 -58.789 1.00 168.70 ? 534  ARG A CG    1 
ATOM   6788  C CD    . ARG C 2 134 ? 74.723  42.302 -60.185 1.00 170.67 ? 534  ARG A CD    1 
ATOM   6789  N NE    . ARG C 2 134 ? 75.686  43.034 -61.000 1.00 174.93 ? 534  ARG A NE    1 
ATOM   6790  C CZ    . ARG C 2 134 ? 76.988  43.102 -60.738 1.00 175.46 ? 534  ARG A CZ    1 
ATOM   6791  N NH1   . ARG C 2 134 ? 77.490  42.479 -59.679 1.00 177.52 ? 534  ARG A NH1   1 
ATOM   6792  N NH2   . ARG C 2 134 ? 77.791  43.793 -61.537 1.00 176.67 ? 534  ARG A NH2   1 
ATOM   6793  N N     . ALA C 2 135 ? 71.426  42.266 -56.931 1.00 201.47 ? 535  ALA A N     1 
ATOM   6794  C CA    . ALA C 2 135 ? 70.028  42.671 -56.842 1.00 201.47 ? 535  ALA A CA    1 
ATOM   6795  C C     . ALA C 2 135 ? 69.180  41.580 -56.181 1.00 201.47 ? 535  ALA A C     1 
ATOM   6796  O O     . ALA C 2 135 ? 68.621  41.829 -55.089 1.00 179.25 ? 535  ALA A O     1 
ATOM   6797  C CB    . ALA C 2 135 ? 69.490  42.994 -58.247 1.00 88.21  ? 535  ALA A CB    1 
ATOM   6798  O OXT   . ALA C 2 135 ? 69.088  40.480 -56.758 1.00 51.87  ? 535  ALA A OXT   1 
ATOM   6799  N N     . ASN D 3 25  ? 96.785  51.673 -55.270 1.00 66.16  ? 25   ASN B N     1 
ATOM   6800  C CA    . ASN D 3 25  ? 96.781  50.483 -54.356 1.00 59.51  ? 25   ASN B CA    1 
ATOM   6801  C C     . ASN D 3 25  ? 95.897  49.367 -54.890 1.00 56.24  ? 25   ASN B C     1 
ATOM   6802  O O     . ASN D 3 25  ? 96.258  48.197 -54.809 1.00 54.90  ? 25   ASN B O     1 
ATOM   6803  C CB    . ASN D 3 25  ? 96.285  50.852 -52.950 1.00 56.78  ? 25   ASN B CB    1 
ATOM   6804  C CG    . ASN D 3 25  ? 97.239  51.764 -52.204 1.00 56.07  ? 25   ASN B CG    1 
ATOM   6805  O OD1   . ASN D 3 25  ? 98.353  51.376 -51.842 1.00 53.64  ? 25   ASN B OD1   1 
ATOM   6806  N ND2   . ASN D 3 25  ? 96.798  52.986 -51.967 1.00 54.49  ? 25   ASN B ND2   1 
ATOM   6807  N N     . ILE D 3 26  ? 94.733  49.724 -55.423 1.00 41.19  ? 26   ILE B N     1 
ATOM   6808  C CA    . ILE D 3 26  ? 93.831  48.718 -55.965 1.00 38.84  ? 26   ILE B CA    1 
ATOM   6809  C C     . ILE D 3 26  ? 94.488  47.962 -57.113 1.00 37.88  ? 26   ILE B C     1 
ATOM   6810  O O     . ILE D 3 26  ? 94.224  46.776 -57.319 1.00 36.73  ? 26   ILE B O     1 
ATOM   6811  C CB    . ILE D 3 26  ? 92.535  49.335 -56.491 1.00 38.17  ? 26   ILE B CB    1 
ATOM   6812  C CG1   . ILE D 3 26  ? 91.518  48.227 -56.748 1.00 37.42  ? 26   ILE B CG1   1 
ATOM   6813  C CG2   . ILE D 3 26  ? 92.786  50.034 -57.809 1.00 37.93  ? 26   ILE B CG2   1 
ATOM   6814  C CD1   . ILE D 3 26  ? 91.171  47.443 -55.523 1.00 33.27  ? 26   ILE B CD1   1 
ATOM   6815  N N     . GLN D 3 27  ? 95.331  48.667 -57.862 1.00 50.43  ? 27   GLN B N     1 
ATOM   6816  C CA    . GLN D 3 27  ? 96.040  48.084 -58.989 1.00 49.68  ? 27   GLN B CA    1 
ATOM   6817  C C     . GLN D 3 27  ? 97.246  47.366 -58.437 1.00 50.01  ? 27   GLN B C     1 
ATOM   6818  O O     . GLN D 3 27  ? 98.033  46.775 -59.182 1.00 50.87  ? 27   GLN B O     1 
ATOM   6819  C CB    . GLN D 3 27  ? 96.504  49.162 -59.945 1.00 54.05  ? 27   GLN B CB    1 
ATOM   6820  C CG    . GLN D 3 27  ? 95.420  50.104 -60.416 1.00 52.81  ? 27   GLN B CG    1 
ATOM   6821  C CD    . GLN D 3 27  ? 94.374  49.445 -61.282 1.00 52.47  ? 27   GLN B CD    1 
ATOM   6822  O OE1   . GLN D 3 27  ? 94.663  48.539 -62.070 1.00 53.64  ? 27   GLN B OE1   1 
ATOM   6823  N NE2   . GLN D 3 27  ? 93.145  49.918 -61.156 1.00 47.76  ? 27   GLN B NE2   1 
ATOM   6824  N N     . GLY D 3 28  ? 97.396  47.450 -57.121 1.00 79.31  ? 28   GLY B N     1 
ATOM   6825  C CA    . GLY D 3 28  ? 98.501  46.785 -56.469 1.00 78.26  ? 28   GLY B CA    1 
ATOM   6826  C C     . GLY D 3 28  ? 98.198  45.307 -56.537 1.00 77.58  ? 28   GLY B C     1 
ATOM   6827  O O     . GLY D 3 28  ? 99.095  44.458 -56.455 1.00 77.04  ? 28   GLY B O     1 
ATOM   6828  N N     . ILE D 3 29  ? 96.908  45.014 -56.682 1.00 43.15  ? 29   ILE B N     1 
ATOM   6829  C CA    . ILE D 3 29  ? 96.425  43.648 -56.788 1.00 40.92  ? 29   ILE B CA    1 
ATOM   6830  C C     . ILE D 3 29  ? 96.593  43.369 -58.259 1.00 40.46  ? 29   ILE B C     1 
ATOM   6831  O O     . ILE D 3 29  ? 95.755  43.762 -59.068 1.00 41.19  ? 29   ILE B O     1 
ATOM   6832  C CB    . ILE D 3 29  ? 94.951  43.562 -56.401 1.00 41.22  ? 29   ILE B CB    1 
ATOM   6833  C CG1   . ILE D 3 29  ? 94.722  44.321 -55.094 1.00 39.94  ? 29   ILE B CG1   1 
ATOM   6834  C CG2   . ILE D 3 29  ? 94.555  42.111 -56.192 1.00 39.31  ? 29   ILE B CG2   1 
ATOM   6835  C CD1   . ILE D 3 29  ? 95.463  43.731 -53.898 1.00 41.30  ? 29   ILE B CD1   1 
ATOM   6836  N N     . THR D 3 30  ? 97.686  42.684 -58.586 1.00 46.21  ? 30   THR B N     1 
ATOM   6837  C CA    . THR D 3 30  ? 98.087  42.388 -59.959 1.00 46.79  ? 30   THR B CA    1 
ATOM   6838  C C     . THR D 3 30  ? 97.487  41.243 -60.759 1.00 48.13  ? 30   THR B C     1 
ATOM   6839  O O     . THR D 3 30  ? 97.079  40.209 -60.223 1.00 48.48  ? 30   THR B O     1 
ATOM   6840  C CB    . THR D 3 30  ? 99.576  42.150 -60.019 1.00 44.94  ? 30   THR B CB    1 
ATOM   6841  O OG1   . THR D 3 30  ? 99.852  40.850 -59.495 1.00 45.04  ? 30   THR B OG1   1 
ATOM   6842  C CG2   . THR D 3 30  ? 100.311 43.181 -59.196 1.00 44.12  ? 30   THR B CG2   1 
ATOM   6843  N N     . LYS D 3 31  ? 97.505  41.442 -62.075 1.00 46.02  ? 31   LYS B N     1 
ATOM   6844  C CA    . LYS D 3 31  ? 97.027  40.464 -63.044 1.00 47.08  ? 31   LYS B CA    1 
ATOM   6845  C C     . LYS D 3 31  ? 97.514  39.059 -62.658 1.00 47.10  ? 31   LYS B C     1 
ATOM   6846  O O     . LYS D 3 31  ? 96.715  38.151 -62.448 1.00 47.77  ? 31   LYS B O     1 
ATOM   6847  C CB    . LYS D 3 31  ? 97.540  40.847 -64.438 1.00 46.86  ? 31   LYS B CB    1 
ATOM   6848  C CG    . LYS D 3 31  ? 97.277  39.828 -65.522 1.00 49.84  ? 31   LYS B CG    1 
ATOM   6849  C CD    . LYS D 3 31  ? 98.171  40.104 -66.725 1.00 54.42  ? 31   LYS B CD    1 
ATOM   6850  C CE    . LYS D 3 31  ? 97.955  39.129 -67.882 1.00 55.95  ? 31   LYS B CE    1 
ATOM   6851  N NZ    . LYS D 3 31  ? 96.832  39.543 -68.770 1.00 58.01  ? 31   LYS B NZ    1 
ATOM   6852  N N     . PRO D 3 32  ? 98.839  38.867 -62.551 1.00 40.58  ? 32   PRO B N     1 
ATOM   6853  C CA    . PRO D 3 32  ? 99.380  37.543 -62.183 1.00 40.63  ? 32   PRO B CA    1 
ATOM   6854  C C     . PRO D 3 32  ? 98.696  36.968 -60.945 1.00 38.52  ? 32   PRO B C     1 
ATOM   6855  O O     . PRO D 3 32  ? 98.330  35.792 -60.902 1.00 40.38  ? 32   PRO B O     1 
ATOM   6856  C CB    . PRO D 3 32  ? 100.869 37.825 -61.924 1.00 32.35  ? 32   PRO B CB    1 
ATOM   6857  C CG    . PRO D 3 32  ? 101.156 38.987 -62.819 1.00 32.45  ? 32   PRO B CG    1 
ATOM   6858  C CD    . PRO D 3 32  ? 99.918  39.864 -62.693 1.00 31.87  ? 32   PRO B CD    1 
ATOM   6859  N N     . ALA D 3 33  ? 98.546  37.819 -59.935 1.00 38.51  ? 33   ALA B N     1 
ATOM   6860  C CA    . ALA D 3 33  ? 97.921  37.436 -58.679 1.00 37.86  ? 33   ALA B CA    1 
ATOM   6861  C C     . ALA D 3 33  ? 96.485  37.028 -58.927 1.00 37.21  ? 33   ALA B C     1 
ATOM   6862  O O     . ALA D 3 33  ? 96.058  35.949 -58.508 1.00 37.11  ? 33   ALA B O     1 
ATOM   6863  C CB    . ALA D 3 33  ? 97.972  38.593 -57.693 1.00 66.10  ? 33   ALA B CB    1 
ATOM   6864  N N     . ILE D 3 34  ? 95.738  37.887 -59.616 1.00 37.54  ? 34   ILE B N     1 
ATOM   6865  C CA    . ILE D 3 34  ? 94.343  37.576 -59.905 1.00 38.85  ? 34   ILE B CA    1 
ATOM   6866  C C     . ILE D 3 34  ? 94.234  36.309 -60.736 1.00 40.89  ? 34   ILE B C     1 
ATOM   6867  O O     . ILE D 3 34  ? 93.372  35.470 -60.496 1.00 40.05  ? 34   ILE B O     1 
ATOM   6868  C CB    . ILE D 3 34  ? 93.663  38.696 -60.670 1.00 17.24  ? 34   ILE B CB    1 
ATOM   6869  C CG1   . ILE D 3 34  ? 93.640  39.968 -59.817 1.00 17.72  ? 34   ILE B CG1   1 
ATOM   6870  C CG2   . ILE D 3 34  ? 92.269  38.241 -61.102 1.00 16.98  ? 34   ILE B CG2   1 
ATOM   6871  C CD1   . ILE D 3 34  ? 93.031  41.142 -60.528 1.00 17.75  ? 34   ILE B CD1   1 
ATOM   6872  N N     . ARG D 3 35  ? 95.112  36.180 -61.721 1.00 29.33  ? 35   ARG B N     1 
ATOM   6873  C CA    . ARG D 3 35  ? 95.122  35.001 -62.561 1.00 30.37  ? 35   ARG B CA    1 
ATOM   6874  C C     . ARG D 3 35  ? 95.303  33.779 -61.664 1.00 30.15  ? 35   ARG B C     1 
ATOM   6875  O O     . ARG D 3 35  ? 94.625  32.764 -61.861 1.00 30.17  ? 35   ARG B O     1 
ATOM   6876  C CB    . ARG D 3 35  ? 96.250  35.098 -63.592 1.00 67.34  ? 35   ARG B CB    1 
ATOM   6877  C CG    . ARG D 3 35  ? 96.435  33.859 -64.447 1.00 73.53  ? 35   ARG B CG    1 
ATOM   6878  C CD    . ARG D 3 35  ? 97.435  34.118 -65.553 1.00 79.53  ? 35   ARG B CD    1 
ATOM   6879  N NE    . ARG D 3 35  ? 96.896  35.066 -66.522 1.00 85.59  ? 35   ARG B NE    1 
ATOM   6880  C CZ    . ARG D 3 35  ? 95.960  34.759 -67.416 1.00 88.39  ? 35   ARG B CZ    1 
ATOM   6881  N NH1   . ARG D 3 35  ? 95.466  33.527 -67.470 1.00 89.79  ? 35   ARG B NH1   1 
ATOM   6882  N NH2   . ARG D 3 35  ? 95.502  35.685 -68.247 1.00 91.94  ? 35   ARG B NH2   1 
ATOM   6883  N N     . ARG D 3 36  ? 96.199  33.875 -60.678 1.00 47.05  ? 36   ARG B N     1 
ATOM   6884  C CA    . ARG D 3 36  ? 96.444  32.760 -59.764 1.00 46.65  ? 36   ARG B CA    1 
ATOM   6885  C C     . ARG D 3 36  ? 95.175  32.342 -59.019 1.00 44.25  ? 36   ARG B C     1 
ATOM   6886  O O     . ARG D 3 36  ? 94.840  31.156 -58.949 1.00 44.15  ? 36   ARG B O     1 
ATOM   6887  C CB    . ARG D 3 36  ? 97.540  33.109 -58.754 1.00 41.19  ? 36   ARG B CB    1 
ATOM   6888  C CG    . ARG D 3 36  ? 98.945  32.794 -59.225 1.00 43.38  ? 36   ARG B CG    1 
ATOM   6889  C CD    . ARG D 3 36  ? 99.931  32.770 -58.074 1.00 42.43  ? 36   ARG B CD    1 
ATOM   6890  N NE    . ARG D 3 36  ? 100.074 34.078 -57.453 1.00 41.68  ? 36   ARG B NE    1 
ATOM   6891  C CZ    . ARG D 3 36  ? 100.607 35.150 -58.040 1.00 44.03  ? 36   ARG B CZ    1 
ATOM   6892  N NH1   . ARG D 3 36  ? 101.071 35.086 -59.278 1.00 42.71  ? 36   ARG B NH1   1 
ATOM   6893  N NH2   . ARG D 3 36  ? 100.645 36.307 -57.396 1.00 41.26  ? 36   ARG B NH2   1 
ATOM   6894  N N     . LEU D 3 37  ? 94.466  33.314 -58.462 1.00 29.71  ? 37   LEU B N     1 
ATOM   6895  C CA    . LEU D 3 37  ? 93.245  33.011 -57.756 1.00 30.27  ? 37   LEU B CA    1 
ATOM   6896  C C     . LEU D 3 37  ? 92.350  32.217 -58.666 1.00 28.63  ? 37   LEU B C     1 
ATOM   6897  O O     . LEU D 3 37  ? 91.964  31.089 -58.352 1.00 30.00  ? 37   LEU B O     1 
ATOM   6898  C CB    . LEU D 3 37  ? 92.543  34.287 -57.379 1.00 43.67  ? 37   LEU B CB    1 
ATOM   6899  C CG    . LEU D 3 37  ? 93.374  35.114 -56.426 1.00 47.16  ? 37   LEU B CG    1 
ATOM   6900  C CD1   . LEU D 3 37  ? 92.737  36.474 -56.298 1.00 49.32  ? 37   LEU B CD1   1 
ATOM   6901  C CD2   . LEU D 3 37  ? 93.483  34.400 -55.083 1.00 43.54  ? 37   LEU B CD2   1 
ATOM   6902  N N     . ALA D 3 38  ? 92.022  32.816 -59.805 1.00 35.10  ? 38   ALA B N     1 
ATOM   6903  C CA    . ALA D 3 38  ? 91.159  32.171 -60.787 1.00 35.67  ? 38   ALA B CA    1 
ATOM   6904  C C     . ALA D 3 38  ? 91.564  30.731 -61.105 1.00 35.50  ? 38   ALA B C     1 
ATOM   6905  O O     . ALA D 3 38  ? 90.715  29.880 -61.346 1.00 32.87  ? 38   ALA B O     1 
ATOM   6906  C CB    . ALA D 3 38  ? 91.120  32.998 -62.059 1.00 2.47   ? 38   ALA B CB    1 
ATOM   6907  N N     . ARG D 3 39  ? 92.854  30.445 -61.108 1.00 29.44  ? 39   ARG B N     1 
ATOM   6908  C CA    . ARG D 3 39  ? 93.257  29.090 -61.399 1.00 28.84  ? 39   ARG B CA    1 
ATOM   6909  C C     . ARG D 3 39  ? 92.945  28.183 -60.219 1.00 29.75  ? 39   ARG B C     1 
ATOM   6910  O O     . ARG D 3 39  ? 92.654  27.000 -60.404 1.00 30.45  ? 39   ARG B O     1 
ATOM   6911  C CB    . ARG D 3 39  ? 94.741  29.038 -61.752 1.00 48.23  ? 39   ARG B CB    1 
ATOM   6912  C CG    . ARG D 3 39  ? 95.087  29.912 -62.924 1.00 48.94  ? 39   ARG B CG    1 
ATOM   6913  C CD    . ARG D 3 39  ? 96.029  29.233 -63.903 1.00 51.13  ? 39   ARG B CD    1 
ATOM   6914  N NE    . ARG D 3 39  ? 96.130  29.988 -65.150 1.00 53.48  ? 39   ARG B NE    1 
ATOM   6915  C CZ    . ARG D 3 39  ? 95.143  30.082 -66.031 1.00 57.43  ? 39   ARG B CZ    1 
ATOM   6916  N NH1   . ARG D 3 39  ? 93.995  29.463 -65.799 1.00 54.93  ? 39   ARG B NH1   1 
ATOM   6917  N NH2   . ARG D 3 39  ? 95.294  30.804 -67.129 1.00 54.07  ? 39   ARG B NH2   1 
ATOM   6918  N N     . ARG D 3 40  ? 93.007  28.724 -59.007 1.00 31.78  ? 40   ARG B N     1 
ATOM   6919  C CA    . ARG D 3 40  ? 92.693  27.924 -57.830 1.00 30.30  ? 40   ARG B CA    1 
ATOM   6920  C C     . ARG D 3 40  ? 91.204  27.629 -57.896 1.00 30.63  ? 40   ARG B C     1 
ATOM   6921  O O     . ARG D 3 40  ? 90.703  26.640 -57.337 1.00 29.79  ? 40   ARG B O     1 
ATOM   6922  C CB    . ARG D 3 40  ? 93.026  28.685 -56.552 1.00 29.44  ? 40   ARG B CB    1 
ATOM   6923  C CG    . ARG D 3 40  ? 92.676  27.930 -55.298 1.00 33.09  ? 40   ARG B CG    1 
ATOM   6924  C CD    . ARG D 3 40  ? 93.432  28.456 -54.098 1.00 34.35  ? 40   ARG B CD    1 
ATOM   6925  N NE    . ARG D 3 40  ? 94.828  28.049 -54.148 1.00 36.33  ? 40   ARG B NE    1 
ATOM   6926  C CZ    . ARG D 3 40  ? 95.756  28.401 -53.268 1.00 37.52  ? 40   ARG B CZ    1 
ATOM   6927  N NH1   . ARG D 3 40  ? 95.475  29.185 -52.241 1.00 33.82  ? 40   ARG B NH1   1 
ATOM   6928  N NH2   . ARG D 3 40  ? 96.976  27.934 -53.414 1.00 37.60  ? 40   ARG B NH2   1 
ATOM   6929  N N     . GLY D 3 41  ? 90.501  28.500 -58.606 1.00 25.32  ? 41   GLY B N     1 
ATOM   6930  C CA    . GLY D 3 41  ? 89.075  28.318 -58.775 1.00 26.14  ? 41   GLY B CA    1 
ATOM   6931  C C     . GLY D 3 41  ? 88.753  27.436 -59.967 1.00 27.22  ? 41   GLY B C     1 
ATOM   6932  O O     . GLY D 3 41  ? 87.585  27.235 -60.295 1.00 28.60  ? 41   GLY B O     1 
ATOM   6933  N N     . GLY D 3 42  ? 89.798  26.933 -60.622 1.00 56.37  ? 42   GLY B N     1 
ATOM   6934  C CA    . GLY D 3 42  ? 89.625  26.070 -61.778 1.00 56.31  ? 42   GLY B CA    1 
ATOM   6935  C C     . GLY D 3 42  ? 89.341  26.767 -63.099 1.00 57.22  ? 42   GLY B C     1 
ATOM   6936  O O     . GLY D 3 42  ? 88.844  26.139 -64.031 1.00 58.45  ? 42   GLY B O     1 
ATOM   6937  N N     . VAL D 3 43  ? 89.647  28.057 -63.188 1.00 43.65  ? 43   VAL B N     1 
ATOM   6938  C CA    . VAL D 3 43  ? 89.412  28.806 -64.410 1.00 44.35  ? 43   VAL B CA    1 
ATOM   6939  C C     . VAL D 3 43  ? 90.494  28.484 -65.419 1.00 46.40  ? 43   VAL B C     1 
ATOM   6940  O O     . VAL D 3 43  ? 91.679  28.601 -65.112 1.00 43.76  ? 43   VAL B O     1 
ATOM   6941  C CB    . VAL D 3 43  ? 89.426  30.296 -64.136 1.00 49.31  ? 43   VAL B CB    1 
ATOM   6942  C CG1   . VAL D 3 43  ? 89.266  31.074 -65.435 1.00 47.98  ? 43   VAL B CG1   1 
ATOM   6943  C CG2   . VAL D 3 43  ? 88.323  30.630 -63.153 1.00 49.16  ? 43   VAL B CG2   1 
ATOM   6944  N N     . LYS D 3 44  ? 90.090  28.098 -66.629 1.00 45.94  ? 44   LYS B N     1 
ATOM   6945  C CA    . LYS D 3 44  ? 91.056  27.719 -67.652 1.00 47.35  ? 44   LYS B CA    1 
ATOM   6946  C C     . LYS D 3 44  ? 91.491  28.847 -68.569 1.00 48.14  ? 44   LYS B C     1 
ATOM   6947  O O     . LYS D 3 44  ? 92.683  29.016 -68.790 1.00 48.08  ? 44   LYS B O     1 
ATOM   6948  C CB    . LYS D 3 44  ? 90.511  26.551 -68.473 1.00 59.28  ? 44   LYS B CB    1 
ATOM   6949  C CG    . LYS D 3 44  ? 91.455  26.043 -69.552 1.00 63.37  ? 44   LYS B CG    1 
ATOM   6950  C CD    . LYS D 3 44  ? 90.850  24.831 -70.260 1.00 60.99  ? 44   LYS B CD    1 
ATOM   6951  C CE    . LYS D 3 44  ? 91.634  24.401 -71.497 1.00 61.97  ? 44   LYS B CE    1 
ATOM   6952  N NZ    . LYS D 3 44  ? 90.926  23.266 -72.160 1.00 59.25  ? 44   LYS B NZ    1 
ATOM   6953  N N     . ARG D 3 45  ? 90.542  29.616 -69.100 1.00 51.98  ? 45   ARG B N     1 
ATOM   6954  C CA    . ARG D 3 45  ? 90.869  30.729 -69.990 1.00 51.80  ? 45   ARG B CA    1 
ATOM   6955  C C     . ARG D 3 45  ? 90.210  31.993 -69.422 1.00 51.69  ? 45   ARG B C     1 
ATOM   6956  O O     . ARG D 3 45  ? 88.998  32.004 -69.170 1.00 47.85  ? 45   ARG B O     1 
ATOM   6957  C CB    . ARG D 3 45  ? 90.362  30.433 -71.398 1.00 81.33  ? 45   ARG B CB    1 
ATOM   6958  C CG    . ARG D 3 45  ? 91.315  30.866 -72.482 1.00 82.56  ? 45   ARG B CG    1 
ATOM   6959  C CD    . ARG D 3 45  ? 90.772  30.489 -73.838 1.00 81.27  ? 45   ARG B CD    1 
ATOM   6960  N NE    . ARG D 3 45  ? 91.676  30.812 -74.943 1.00 83.41  ? 45   ARG B NE    1 
ATOM   6961  C CZ    . ARG D 3 45  ? 92.038  32.047 -75.291 1.00 86.98  ? 45   ARG B CZ    1 
ATOM   6962  N NH1   . ARG D 3 45  ? 91.580  33.097 -74.612 1.00 83.71  ? 45   ARG B NH1   1 
ATOM   6963  N NH2   . ARG D 3 45  ? 92.836  32.238 -76.341 1.00 88.46  ? 45   ARG B NH2   1 
ATOM   6964  N N     . ILE D 3 46  ? 91.012  33.052 -69.238 1.00 37.56  ? 46   ILE B N     1 
ATOM   6965  C CA    . ILE D 3 46  ? 90.556  34.315 -68.643 1.00 37.80  ? 46   ILE B CA    1 
ATOM   6966  C C     . ILE D 3 46  ? 90.470  35.565 -69.538 1.00 38.59  ? 46   ILE B C     1 
ATOM   6967  O O     . ILE D 3 46  ? 91.443  35.974 -70.159 1.00 40.21  ? 46   ILE B O     1 
ATOM   6968  C CB    . ILE D 3 46  ? 91.458  34.637 -67.434 1.00 20.68  ? 46   ILE B CB    1 
ATOM   6969  C CG1   . ILE D 3 46  ? 91.445  33.451 -66.471 1.00 20.07  ? 46   ILE B CG1   1 
ATOM   6970  C CG2   . ILE D 3 46  ? 91.018  35.903 -66.734 1.00 18.85  ? 46   ILE B CG2   1 
ATOM   6971  C CD1   . ILE D 3 46  ? 92.451  33.606 -65.329 1.00 24.66  ? 46   ILE B CD1   1 
ATOM   6972  N N     . SER D 3 47  ? 89.300  36.189 -69.565 1.00 68.67  ? 47   SER B N     1 
ATOM   6973  C CA    . SER D 3 47  ? 89.102  37.388 -70.366 1.00 68.43  ? 47   SER B CA    1 
ATOM   6974  C C     . SER D 3 47  ? 89.883  38.588 -69.836 1.00 68.35  ? 47   SER B C     1 
ATOM   6975  O O     . SER D 3 47  ? 90.101  38.720 -68.632 1.00 68.36  ? 47   SER B O     1 
ATOM   6976  C CB    . SER D 3 47  ? 87.625  37.748 -70.431 1.00 30.28  ? 47   SER B CB    1 
ATOM   6977  O OG    . SER D 3 47  ? 87.462  39.050 -70.958 1.00 34.49  ? 47   SER B OG    1 
ATOM   6978  N N     . GLY D 3 48  ? 90.272  39.475 -70.751 1.00 42.52  ? 48   GLY B N     1 
ATOM   6979  C CA    . GLY D 3 48  ? 91.050  40.635 -70.383 1.00 41.29  ? 48   GLY B CA    1 
ATOM   6980  C C     . GLY D 3 48  ? 90.336  41.568 -69.454 1.00 43.22  ? 48   GLY B C     1 
ATOM   6981  O O     . GLY D 3 48  ? 90.919  42.071 -68.501 1.00 45.72  ? 48   GLY B O     1 
ATOM   6982  N N     . LEU D 3 49  ? 89.060  41.794 -69.715 1.00 59.47  ? 49   LEU B N     1 
ATOM   6983  C CA    . LEU D 3 49  ? 88.274  42.709 -68.904 1.00 59.69  ? 49   LEU B CA    1 
ATOM   6984  C C     . LEU D 3 49  ? 87.935  42.231 -67.488 1.00 59.54  ? 49   LEU B C     1 
ATOM   6985  O O     . LEU D 3 49  ? 87.275  42.944 -66.732 1.00 59.74  ? 49   LEU B O     1 
ATOM   6986  C CB    . LEU D 3 49  ? 86.999  43.027 -69.658 1.00 31.90  ? 49   LEU B CB    1 
ATOM   6987  C CG    . LEU D 3 49  ? 87.218  43.805 -70.950 1.00 34.32  ? 49   LEU B CG    1 
ATOM   6988  C CD1   . LEU D 3 49  ? 86.020  43.683 -71.862 1.00 34.00  ? 49   LEU B CD1   1 
ATOM   6989  C CD2   . LEU D 3 49  ? 87.489  45.250 -70.595 1.00 33.18  ? 49   LEU B CD2   1 
ATOM   6990  N N     . ILE D 3 50  ? 88.396  41.030 -67.138 1.00 36.43  ? 50   ILE B N     1 
ATOM   6991  C CA    . ILE D 3 50  ? 88.137  40.419 -65.829 1.00 34.96  ? 50   ILE B CA    1 
ATOM   6992  C C     . ILE D 3 50  ? 88.954  41.011 -64.696 1.00 35.55  ? 50   ILE B C     1 
ATOM   6993  O O     . ILE D 3 50  ? 88.467  41.149 -63.589 1.00 33.49  ? 50   ILE B O     1 
ATOM   6994  C CB    . ILE D 3 50  ? 88.404  38.875 -65.863 1.00 35.38  ? 50   ILE B CB    1 
ATOM   6995  C CG1   . ILE D 3 50  ? 87.236  38.128 -66.533 1.00 32.79  ? 50   ILE B CG1   1 
ATOM   6996  C CG2   . ILE D 3 50  ? 88.654  38.362 -64.460 1.00 29.75  ? 50   ILE B CG2   1 
ATOM   6997  C CD1   . ILE D 3 50  ? 85.959  38.083 -65.730 1.00 34.42  ? 50   ILE B CD1   1 
ATOM   6998  N N     . TYR D 3 51  ? 90.199  41.355 -64.976 1.00 38.17  ? 51   TYR B N     1 
ATOM   6999  C CA    . TYR D 3 51  ? 91.071  41.911 -63.958 1.00 37.36  ? 51   TYR B CA    1 
ATOM   7000  C C     . TYR D 3 51  ? 90.474  43.146 -63.318 1.00 36.31  ? 51   TYR B C     1 
ATOM   7001  O O     . TYR D 3 51  ? 90.529  43.295 -62.115 1.00 36.91  ? 51   TYR B O     1 
ATOM   7002  C CB    . TYR D 3 51  ? 92.449  42.194 -64.561 1.00 38.99  ? 51   TYR B CB    1 
ATOM   7003  C CG    . TYR D 3 51  ? 93.035  40.938 -65.184 1.00 37.42  ? 51   TYR B CG    1 
ATOM   7004  C CD1   . TYR D 3 51  ? 93.607  39.939 -64.396 1.00 36.32  ? 51   TYR B CD1   1 
ATOM   7005  C CD2   . TYR D 3 51  ? 92.886  40.689 -66.543 1.00 37.97  ? 51   TYR B CD2   1 
ATOM   7006  C CE1   . TYR D 3 51  ? 93.998  38.726 -64.957 1.00 38.20  ? 51   TYR B CE1   1 
ATOM   7007  C CE2   . TYR D 3 51  ? 93.267  39.494 -67.101 1.00 34.71  ? 51   TYR B CE2   1 
ATOM   7008  C CZ    . TYR D 3 51  ? 93.812  38.511 -66.317 1.00 38.22  ? 51   TYR B CZ    1 
ATOM   7009  O OH    . TYR D 3 51  ? 94.096  37.291 -66.902 1.00 40.20  ? 51   TYR B OH    1 
ATOM   7010  N N     . GLU D 3 52  ? 89.876  44.028 -64.101 1.00 46.69  ? 52   GLU B N     1 
ATOM   7011  C CA    . GLU D 3 52  ? 89.280  45.215 -63.498 1.00 46.71  ? 52   GLU B CA    1 
ATOM   7012  C C     . GLU D 3 52  ? 87.949  44.887 -62.832 1.00 45.60  ? 52   GLU B C     1 
ATOM   7013  O O     . GLU D 3 52  ? 87.569  45.500 -61.844 1.00 43.58  ? 52   GLU B O     1 
ATOM   7014  C CB    . GLU D 3 52  ? 89.098  46.323 -64.537 1.00 47.88  ? 52   GLU B CB    1 
ATOM   7015  C CG    . GLU D 3 52  ? 90.399  47.044 -64.897 1.00 52.50  ? 52   GLU B CG    1 
ATOM   7016  C CD    . GLU D 3 52  ? 90.925  47.927 -63.772 1.00 54.34  ? 52   GLU B CD    1 
ATOM   7017  O OE1   . GLU D 3 52  ? 90.288  48.967 -63.483 1.00 56.20  ? 52   GLU B OE1   1 
ATOM   7018  O OE2   . GLU D 3 52  ? 91.971  47.579 -63.174 1.00 56.19  ? 52   GLU B OE2   1 
ATOM   7019  N N     . GLU D 3 53  ? 87.245  43.904 -63.368 1.00 61.56  ? 53   GLU B N     1 
ATOM   7020  C CA    . GLU D 3 53  ? 85.966  43.508 -62.800 1.00 58.83  ? 53   GLU B CA    1 
ATOM   7021  C C     . GLU D 3 53  ? 86.249  42.859 -61.460 1.00 58.74  ? 53   GLU B C     1 
ATOM   7022  O O     . GLU D 3 53  ? 85.495  43.006 -60.510 1.00 56.74  ? 53   GLU B O     1 
ATOM   7023  C CB    . GLU D 3 53  ? 85.277  42.509 -63.722 1.00 44.59  ? 53   GLU B CB    1 
ATOM   7024  C CG    . GLU D 3 53  ? 83.839  42.214 -63.391 1.00 46.41  ? 53   GLU B CG    1 
ATOM   7025  C CD    . GLU D 3 53  ? 82.930  43.388 -63.657 1.00 51.88  ? 53   GLU B CD    1 
ATOM   7026  O OE1   . GLU D 3 53  ? 83.311  44.282 -64.444 1.00 53.55  ? 53   GLU B OE1   1 
ATOM   7027  O OE2   . GLU D 3 53  ? 81.821  43.408 -63.084 1.00 55.31  ? 53   GLU B OE2   1 
ATOM   7028  N N     . THR D 3 54  ? 87.360  42.146 -61.389 1.00 33.61  ? 54   THR B N     1 
ATOM   7029  C CA    . THR D 3 54  ? 87.741  41.463 -60.170 1.00 32.68  ? 54   THR B CA    1 
ATOM   7030  C C     . THR D 3 54  ? 88.020  42.465 -59.085 1.00 33.86  ? 54   THR B C     1 
ATOM   7031  O O     . THR D 3 54  ? 87.381  42.446 -58.036 1.00 32.23  ? 54   THR B O     1 
ATOM   7032  C CB    . THR D 3 54  ? 88.993  40.596 -60.392 1.00 43.17  ? 54   THR B CB    1 
ATOM   7033  O OG1   . THR D 3 54  ? 88.707  39.609 -61.382 1.00 45.47  ? 54   THR B OG1   1 
ATOM   7034  C CG2   . THR D 3 54  ? 89.390  39.884 -59.131 1.00 43.04  ? 54   THR B CG2   1 
ATOM   7035  N N     . ARG D 3 55  ? 88.975  43.349 -59.342 1.00 44.45  ? 55   ARG B N     1 
ATOM   7036  C CA    . ARG D 3 55  ? 89.358  44.353 -58.358 1.00 46.21  ? 55   ARG B CA    1 
ATOM   7037  C C     . ARG D 3 55  ? 88.173  45.038 -57.713 1.00 44.38  ? 55   ARG B C     1 
ATOM   7038  O O     . ARG D 3 55  ? 88.150  45.235 -56.500 1.00 47.02  ? 55   ARG B O     1 
ATOM   7039  C CB    . ARG D 3 55  ? 90.271  45.403 -58.989 1.00 40.20  ? 55   ARG B CB    1 
ATOM   7040  C CG    . ARG D 3 55  ? 91.605  44.837 -59.456 1.00 39.09  ? 55   ARG B CG    1 
ATOM   7041  C CD    . ARG D 3 55  ? 92.633  45.944 -59.689 1.00 44.44  ? 55   ARG B CD    1 
ATOM   7042  N NE    . ARG D 3 55  ? 93.875  45.396 -60.228 1.00 42.28  ? 55   ARG B NE    1 
ATOM   7043  C CZ    . ARG D 3 55  ? 94.104  45.189 -61.518 1.00 43.12  ? 55   ARG B CZ    1 
ATOM   7044  N NH1   . ARG D 3 55  ? 93.179  45.499 -62.417 1.00 43.08  ? 55   ARG B NH1   1 
ATOM   7045  N NH2   . ARG D 3 55  ? 95.242  44.631 -61.897 1.00 44.50  ? 55   ARG B NH2   1 
ATOM   7046  N N     . GLY D 3 56  ? 87.184  45.384 -58.530 1.00 27.67  ? 56   GLY B N     1 
ATOM   7047  C CA    . GLY D 3 56  ? 86.002  46.059 -58.029 1.00 29.43  ? 56   GLY B CA    1 
ATOM   7048  C C     . GLY D 3 56  ? 85.280  45.238 -56.995 1.00 29.14  ? 56   GLY B C     1 
ATOM   7049  O O     . GLY D 3 56  ? 84.831  45.746 -55.971 1.00 29.35  ? 56   GLY B O     1 
ATOM   7050  N N     . VAL D 3 57  ? 85.160  43.951 -57.273 1.00 33.08  ? 57   VAL B N     1 
ATOM   7051  C CA    . VAL D 3 57  ? 84.499  43.074 -56.341 1.00 32.00  ? 57   VAL B CA    1 
ATOM   7052  C C     . VAL D 3 57  ? 85.333  43.095 -55.057 1.00 30.05  ? 57   VAL B C     1 
ATOM   7053  O O     . VAL D 3 57  ? 84.839  43.497 -54.005 1.00 30.90  ? 57   VAL B O     1 
ATOM   7054  C CB    . VAL D 3 57  ? 84.388  41.634 -56.921 1.00 33.75  ? 57   VAL B CB    1 
ATOM   7055  C CG1   . VAL D 3 57  ? 83.774  40.678 -55.895 1.00 35.08  ? 57   VAL B CG1   1 
ATOM   7056  C CG2   . VAL D 3 57  ? 83.539  41.656 -58.159 1.00 32.19  ? 57   VAL B CG2   1 
ATOM   7057  N N     . LEU D 3 58  ? 86.599  42.697 -55.152 1.00 26.91  ? 58   LEU B N     1 
ATOM   7058  C CA    . LEU D 3 58  ? 87.465  42.681 -53.988 1.00 26.06  ? 58   LEU B CA    1 
ATOM   7059  C C     . LEU D 3 58  ? 87.317  43.966 -53.193 1.00 27.14  ? 58   LEU B C     1 
ATOM   7060  O O     . LEU D 3 58  ? 87.382  43.944 -51.958 1.00 26.48  ? 58   LEU B O     1 
ATOM   7061  C CB    . LEU D 3 58  ? 88.927  42.510 -54.406 1.00 38.98  ? 58   LEU B CB    1 
ATOM   7062  C CG    . LEU D 3 58  ? 89.951  42.630 -53.268 1.00 40.04  ? 58   LEU B CG    1 
ATOM   7063  C CD1   . LEU D 3 58  ? 89.676  41.576 -52.219 1.00 39.79  ? 58   LEU B CD1   1 
ATOM   7064  C CD2   . LEU D 3 58  ? 91.359  42.497 -53.812 1.00 41.87  ? 58   LEU B CD2   1 
ATOM   7065  N N     . LYS D 3 59  ? 87.119  45.088 -53.887 1.00 28.63  ? 59   LYS B N     1 
ATOM   7066  C CA    . LYS D 3 59  ? 86.971  46.345 -53.178 1.00 30.24  ? 59   LYS B CA    1 
ATOM   7067  C C     . LYS D 3 59  ? 85.691  46.396 -52.368 1.00 28.19  ? 59   LYS B C     1 
ATOM   7068  O O     . LYS D 3 59  ? 85.707  46.806 -51.211 1.00 25.45  ? 59   LYS B O     1 
ATOM   7069  C CB    . LYS D 3 59  ? 86.984  47.538 -54.121 1.00 32.65  ? 59   LYS B CB    1 
ATOM   7070  C CG    . LYS D 3 59  ? 86.896  48.865 -53.356 1.00 39.79  ? 59   LYS B CG    1 
ATOM   7071  C CD    . LYS D 3 59  ? 86.818  50.089 -54.261 1.00 47.63  ? 59   LYS B CD    1 
ATOM   7072  C CE    . LYS D 3 59  ? 86.650  51.352 -53.433 1.00 50.92  ? 59   LYS B CE    1 
ATOM   7073  N NZ    . LYS D 3 59  ? 86.293  52.536 -54.245 1.00 55.13  ? 59   LYS B NZ    1 
ATOM   7074  N N     . VAL D 3 60  ? 84.577  45.985 -52.970 1.00 30.25  ? 60   VAL B N     1 
ATOM   7075  C CA    . VAL D 3 60  ? 83.314  46.017 -52.252 1.00 28.48  ? 60   VAL B CA    1 
ATOM   7076  C C     . VAL D 3 60  ? 83.336  45.060 -51.077 1.00 28.60  ? 60   VAL B C     1 
ATOM   7077  O O     . VAL D 3 60  ? 82.661  45.284 -50.091 1.00 27.06  ? 60   VAL B O     1 
ATOM   7078  C CB    . VAL D 3 60  ? 82.134  45.604 -53.118 1.00 22.82  ? 60   VAL B CB    1 
ATOM   7079  C CG1   . VAL D 3 60  ? 80.862  45.816 -52.338 1.00 22.94  ? 60   VAL B CG1   1 
ATOM   7080  C CG2   . VAL D 3 60  ? 82.098  46.381 -54.389 1.00 23.01  ? 60   VAL B CG2   1 
ATOM   7081  N N     . PHE D 3 61  ? 84.114  43.994 -51.192 1.00 21.97  ? 61   PHE B N     1 
ATOM   7082  C CA    . PHE D 3 61  ? 84.181  43.000 -50.142 1.00 24.46  ? 61   PHE B CA    1 
ATOM   7083  C C     . PHE D 3 61  ? 84.870  43.626 -48.957 1.00 23.66  ? 61   PHE B C     1 
ATOM   7084  O O     . PHE D 3 61  ? 84.337  43.656 -47.844 1.00 22.92  ? 61   PHE B O     1 
ATOM   7085  C CB    . PHE D 3 61  ? 84.960  41.752 -50.619 1.00 30.17  ? 61   PHE B CB    1 
ATOM   7086  C CG    . PHE D 3 61  ? 85.025  40.618 -49.599 1.00 30.56  ? 61   PHE B CG    1 
ATOM   7087  C CD1   . PHE D 3 61  ? 83.917  39.813 -49.341 1.00 27.53  ? 61   PHE B CD1   1 
ATOM   7088  C CD2   . PHE D 3 61  ? 86.187  40.388 -48.870 1.00 29.64  ? 61   PHE B CD2   1 
ATOM   7089  C CE1   . PHE D 3 61  ? 83.964  38.800 -48.365 1.00 30.76  ? 61   PHE B CE1   1 
ATOM   7090  C CE2   . PHE D 3 61  ? 86.235  39.377 -47.898 1.00 31.41  ? 61   PHE B CE2   1 
ATOM   7091  C CZ    . PHE D 3 61  ? 85.124  38.589 -47.648 1.00 29.24  ? 61   PHE B CZ    1 
ATOM   7092  N N     . LEU D 3 62  ? 86.057  44.150 -49.195 1.00 45.84  ? 62   LEU B N     1 
ATOM   7093  C CA    . LEU D 3 62  ? 86.799  44.745 -48.107 1.00 44.08  ? 62   LEU B CA    1 
ATOM   7094  C C     . LEU D 3 62  ? 86.016  45.875 -47.477 1.00 44.95  ? 62   LEU B C     1 
ATOM   7095  O O     . LEU D 3 62  ? 85.920  45.941 -46.250 1.00 45.91  ? 62   LEU B O     1 
ATOM   7096  C CB    . LEU D 3 62  ? 88.165  45.225 -48.596 1.00 30.88  ? 62   LEU B CB    1 
ATOM   7097  C CG    . LEU D 3 62  ? 89.058  44.095 -49.141 1.00 32.54  ? 62   LEU B CG    1 
ATOM   7098  C CD1   . LEU D 3 62  ? 90.420  44.654 -49.463 1.00 31.54  ? 62   LEU B CD1   1 
ATOM   7099  C CD2   . LEU D 3 62  ? 89.177  42.960 -48.128 1.00 31.16  ? 62   LEU B CD2   1 
ATOM   7100  N N     . GLU D 3 63  ? 85.430  46.741 -48.305 1.00 30.74  ? 63   GLU B N     1 
ATOM   7101  C CA    . GLU D 3 63  ? 84.661  47.859 -47.778 1.00 32.81  ? 63   GLU B CA    1 
ATOM   7102  C C     . GLU D 3 63  ? 83.587  47.321 -46.861 1.00 32.86  ? 63   GLU B C     1 
ATOM   7103  O O     . GLU D 3 63  ? 83.516  47.697 -45.690 1.00 30.95  ? 63   GLU B O     1 
ATOM   7104  C CB    . GLU D 3 63  ? 84.009  48.672 -48.887 1.00 32.80  ? 63   GLU B CB    1 
ATOM   7105  C CG    . GLU D 3 63  ? 84.970  49.439 -49.766 1.00 37.73  ? 63   GLU B CG    1 
ATOM   7106  C CD    . GLU D 3 63  ? 84.259  50.219 -50.859 1.00 41.01  ? 63   GLU B CD    1 
ATOM   7107  O OE1   . GLU D 3 63  ? 83.261  49.687 -51.392 1.00 38.63  ? 63   GLU B OE1   1 
ATOM   7108  O OE2   . GLU D 3 63  ? 84.699  51.348 -51.192 1.00 42.07  ? 63   GLU B OE2   1 
ATOM   7109  N N     . ASN D 3 64  ? 82.768  46.412 -47.367 1.00 39.20  ? 64   ASN B N     1 
ATOM   7110  C CA    . ASN D 3 64  ? 81.705  45.876 -46.529 1.00 39.75  ? 64   ASN B CA    1 
ATOM   7111  C C     . ASN D 3 64  ? 82.165  45.239 -45.246 1.00 39.29  ? 64   ASN B C     1 
ATOM   7112  O O     . ASN D 3 64  ? 81.500  45.390 -44.226 1.00 38.62  ? 64   ASN B O     1 
ATOM   7113  C CB    . ASN D 3 64  ? 80.819  44.899 -47.297 1.00 35.94  ? 64   ASN B CB    1 
ATOM   7114  C CG    . ASN D 3 64  ? 79.696  45.601 -48.000 1.00 39.34  ? 64   ASN B CG    1 
ATOM   7115  O OD1   . ASN D 3 64  ? 78.966  46.390 -47.388 1.00 44.28  ? 64   ASN B OD1   1 
ATOM   7116  N ND2   . ASN D 3 64  ? 79.549  45.346 -49.287 1.00 42.43  ? 64   ASN B ND2   1 
ATOM   7117  N N     . VAL D 3 65  ? 83.313  44.569 -45.278 1.00 19.98  ? 65   VAL B N     1 
ATOM   7118  C CA    . VAL D 3 65  ? 83.828  43.886 -44.090 1.00 20.91  ? 65   VAL B CA    1 
ATOM   7119  C C     . VAL D 3 65  ? 84.618  44.782 -43.136 1.00 19.46  ? 65   VAL B C     1 
ATOM   7120  O O     . VAL D 3 65  ? 84.442  44.729 -41.903 1.00 17.72  ? 65   VAL B O     1 
ATOM   7121  C CB    . VAL D 3 65  ? 84.723  42.697 -44.505 1.00 30.36  ? 65   VAL B CB    1 
ATOM   7122  C CG1   . VAL D 3 65  ? 84.864  41.725 -43.367 1.00 27.31  ? 65   VAL B CG1   1 
ATOM   7123  C CG2   . VAL D 3 65  ? 84.130  41.997 -45.713 1.00 33.87  ? 65   VAL B CG2   1 
ATOM   7124  N N     . ILE D 3 66  ? 85.494  45.605 -43.701 1.00 20.44  ? 66   ILE B N     1 
ATOM   7125  C CA    . ILE D 3 66  ? 86.313  46.471 -42.869 1.00 21.56  ? 66   ILE B CA    1 
ATOM   7126  C C     . ILE D 3 66  ? 85.433  47.435 -42.102 1.00 22.53  ? 66   ILE B C     1 
ATOM   7127  O O     . ILE D 3 66  ? 85.641  47.670 -40.910 1.00 21.09  ? 66   ILE B O     1 
ATOM   7128  C CB    . ILE D 3 66  ? 87.352  47.262 -43.715 1.00 42.79  ? 66   ILE B CB    1 
ATOM   7129  C CG1   . ILE D 3 66  ? 88.399  46.294 -44.282 1.00 40.87  ? 66   ILE B CG1   1 
ATOM   7130  C CG2   . ILE D 3 66  ? 88.031  48.341 -42.847 1.00 41.67  ? 66   ILE B CG2   1 
ATOM   7131  C CD1   . ILE D 3 66  ? 89.414  46.944 -45.153 1.00 45.83  ? 66   ILE B CD1   1 
ATOM   7132  N N     . ARG D 3 67  ? 84.452  47.991 -42.807 1.00 44.42  ? 67   ARG B N     1 
ATOM   7133  C CA    . ARG D 3 67  ? 83.501  48.910 -42.211 1.00 47.14  ? 67   ARG B CA    1 
ATOM   7134  C C     . ARG D 3 67  ? 82.964  48.307 -40.924 1.00 46.53  ? 67   ARG B C     1 
ATOM   7135  O O     . ARG D 3 67  ? 82.928  48.967 -39.898 1.00 45.44  ? 67   ARG B O     1 
ATOM   7136  C CB    . ARG D 3 67  ? 82.337  49.151 -43.171 1.00 42.35  ? 67   ARG B CB    1 
ATOM   7137  C CG    . ARG D 3 67  ? 81.188  49.999 -42.622 1.00 48.99  ? 67   ARG B CG    1 
ATOM   7138  C CD    . ARG D 3 67  ? 79.929  49.846 -43.498 1.00 54.02  ? 67   ARG B CD    1 
ATOM   7139  N NE    . ARG D 3 67  ? 80.170  50.184 -44.902 1.00 60.73  ? 67   ARG B NE    1 
ATOM   7140  C CZ    . ARG D 3 67  ? 79.636  49.536 -45.938 1.00 62.29  ? 67   ARG B CZ    1 
ATOM   7141  N NH1   . ARG D 3 67  ? 78.823  48.501 -45.733 1.00 62.18  ? 67   ARG B NH1   1 
ATOM   7142  N NH2   . ARG D 3 67  ? 79.913  49.918 -47.182 1.00 62.28  ? 67   ARG B NH2   1 
ATOM   7143  N N     . ASP D 3 68  ? 82.546  47.048 -40.975 1.00 43.03  ? 68   ASP B N     1 
ATOM   7144  C CA    . ASP D 3 68  ? 81.996  46.423 -39.787 1.00 41.88  ? 68   ASP B CA    1 
ATOM   7145  C C     . ASP D 3 68  ? 83.048  46.092 -38.733 1.00 41.96  ? 68   ASP B C     1 
ATOM   7146  O O     . ASP D 3 68  ? 82.752  46.097 -37.536 1.00 43.08  ? 68   ASP B O     1 
ATOM   7147  C CB    . ASP D 3 68  ? 81.187  45.166 -40.155 1.00 40.77  ? 68   ASP B CB    1 
ATOM   7148  C CG    . ASP D 3 68  ? 79.713  45.466 -40.407 1.00 42.84  ? 68   ASP B CG    1 
ATOM   7149  O OD1   . ASP D 3 68  ? 79.183  46.444 -39.837 1.00 39.71  ? 68   ASP B OD1   1 
ATOM   7150  O OD2   . ASP D 3 68  ? 79.068  44.715 -41.158 1.00 43.47  ? 68   ASP B OD2   1 
ATOM   7151  N N     . ALA D 3 69  ? 84.270  45.804 -39.175 1.00 29.13  ? 69   ALA B N     1 
ATOM   7152  C CA    . ALA D 3 69  ? 85.354  45.485 -38.244 1.00 31.93  ? 69   ALA B CA    1 
ATOM   7153  C C     . ALA D 3 69  ? 85.691  46.776 -37.524 1.00 31.43  ? 69   ALA B C     1 
ATOM   7154  O O     . ALA D 3 69  ? 85.705  46.834 -36.321 1.00 29.17  ? 69   ALA B O     1 
ATOM   7155  C CB    . ALA D 3 69  ? 86.586  44.966 -39.005 1.00 10.59  ? 69   ALA B CB    1 
ATOM   7156  N N     . VAL D 3 70  ? 85.952  47.826 -38.275 1.00 21.77  ? 70   VAL B N     1 
ATOM   7157  C CA    . VAL D 3 70  ? 86.278  49.089 -37.663 1.00 22.07  ? 70   VAL B CA    1 
ATOM   7158  C C     . VAL D 3 70  ? 85.226  49.539 -36.669 1.00 25.24  ? 70   VAL B C     1 
ATOM   7159  O O     . VAL D 3 70  ? 85.540  50.170 -35.675 1.00 26.28  ? 70   VAL B O     1 
ATOM   7160  C CB    . VAL D 3 70  ? 86.466  50.176 -38.718 1.00 22.36  ? 70   VAL B CB    1 
ATOM   7161  C CG1   . VAL D 3 70  ? 86.557  51.538 -38.062 1.00 23.70  ? 70   VAL B CG1   1 
ATOM   7162  C CG2   . VAL D 3 70  ? 87.717  49.886 -39.497 1.00 20.92  ? 70   VAL B CG2   1 
ATOM   7163  N N     . THR D 3 71  ? 83.975  49.228 -36.932 1.00 21.47  ? 71   THR B N     1 
ATOM   7164  C CA    . THR D 3 71  ? 82.931  49.626 -36.011 1.00 21.47  ? 71   THR B CA    1 
ATOM   7165  C C     . THR D 3 71  ? 83.174  48.904 -34.688 1.00 21.74  ? 71   THR B C     1 
ATOM   7166  O O     . THR D 3 71  ? 82.938  49.442 -33.604 1.00 20.52  ? 71   THR B O     1 
ATOM   7167  C CB    . THR D 3 71  ? 81.552  49.245 -36.562 1.00 17.45  ? 71   THR B CB    1 
ATOM   7168  O OG1   . THR D 3 71  ? 81.263  50.067 -37.689 1.00 19.03  ? 71   THR B OG1   1 
ATOM   7169  C CG2   . THR D 3 71  ? 80.454  49.402 -35.490 1.00 15.35  ? 71   THR B CG2   1 
ATOM   7170  N N     . TYR D 3 72  ? 83.636  47.667 -34.773 1.00 27.58  ? 72   TYR B N     1 
ATOM   7171  C CA    . TYR D 3 72  ? 83.905  46.937 -33.568 1.00 27.77  ? 72   TYR B CA    1 
ATOM   7172  C C     . TYR D 3 72  ? 85.062  47.636 -32.871 1.00 31.19  ? 72   TYR B C     1 
ATOM   7173  O O     . TYR D 3 72  ? 85.061  47.786 -31.658 1.00 30.93  ? 72   TYR B O     1 
ATOM   7174  C CB    . TYR D 3 72  ? 84.243  45.480 -33.892 1.00 32.14  ? 72   TYR B CB    1 
ATOM   7175  C CG    . TYR D 3 72  ? 83.021  44.612 -34.065 1.00 32.92  ? 72   TYR B CG    1 
ATOM   7176  C CD1   . TYR D 3 72  ? 82.827  43.849 -35.220 1.00 32.90  ? 72   TYR B CD1   1 
ATOM   7177  C CD2   . TYR D 3 72  ? 82.032  44.588 -33.086 1.00 33.00  ? 72   TYR B CD2   1 
ATOM   7178  C CE1   . TYR D 3 72  ? 81.661  43.088 -35.396 1.00 31.87  ? 72   TYR B CE1   1 
ATOM   7179  C CE2   . TYR D 3 72  ? 80.882  43.839 -33.249 1.00 31.42  ? 72   TYR B CE2   1 
ATOM   7180  C CZ    . TYR D 3 72  ? 80.702  43.101 -34.402 1.00 31.12  ? 72   TYR B CZ    1 
ATOM   7181  O OH    . TYR D 3 72  ? 79.532  42.418 -34.536 1.00 34.55  ? 72   TYR B OH    1 
ATOM   7182  N N     . THR D 3 73  ? 86.031  48.099 -33.646 1.00 42.89  ? 73   THR B N     1 
ATOM   7183  C CA    . THR D 3 73  ? 87.175  48.773 -33.069 1.00 44.05  ? 73   THR B CA    1 
ATOM   7184  C C     . THR D 3 73  ? 86.748  49.968 -32.256 1.00 46.58  ? 73   THR B C     1 
ATOM   7185  O O     . THR D 3 73  ? 87.150  50.133 -31.100 1.00 45.77  ? 73   THR B O     1 
ATOM   7186  C CB    . THR D 3 73  ? 88.129  49.301 -34.120 1.00 14.64  ? 73   THR B CB    1 
ATOM   7187  O OG1   . THR D 3 73  ? 88.499  48.252 -35.029 1.00 13.43  ? 73   THR B OG1   1 
ATOM   7188  C CG2   . THR D 3 73  ? 89.381  49.868 -33.425 1.00 16.01  ? 73   THR B CG2   1 
ATOM   7189  N N     . GLU D 3 74  ? 85.942  50.817 -32.876 1.00 30.11  ? 74   GLU B N     1 
ATOM   7190  C CA    . GLU D 3 74  ? 85.465  52.015 -32.211 1.00 31.71  ? 74   GLU B CA    1 
ATOM   7191  C C     . GLU D 3 74  ? 84.535  51.714 -31.050 1.00 31.22  ? 74   GLU B C     1 
ATOM   7192  O O     . GLU D 3 74  ? 84.547  52.408 -30.039 1.00 29.58  ? 74   GLU B O     1 
ATOM   7193  C CB    . GLU D 3 74  ? 84.729  52.932 -33.188 1.00 53.08  ? 74   GLU B CB    1 
ATOM   7194  C CG    . GLU D 3 74  ? 85.610  53.724 -34.123 1.00 64.75  ? 74   GLU B CG    1 
ATOM   7195  C CD    . GLU D 3 74  ? 84.848  54.857 -34.772 1.00 71.00  ? 74   GLU B CD    1 
ATOM   7196  O OE1   . GLU D 3 74  ? 84.577  55.859 -34.067 1.00 76.35  ? 74   GLU B OE1   1 
ATOM   7197  O OE2   . GLU D 3 74  ? 84.507  54.737 -35.976 1.00 74.57  ? 74   GLU B OE2   1 
ATOM   7198  N N     . HIS D 3 75  ? 83.717  50.688 -31.156 1.00 46.67  ? 75   HIS B N     1 
ATOM   7199  C CA    . HIS D 3 75  ? 82.838  50.501 -30.039 1.00 48.27  ? 75   HIS B CA    1 
ATOM   7200  C C     . HIS D 3 75  ? 83.679  50.159 -28.828 1.00 49.39  ? 75   HIS B C     1 
ATOM   7201  O O     . HIS D 3 75  ? 83.304  50.456 -27.684 1.00 51.96  ? 75   HIS B O     1 
ATOM   7202  C CB    . HIS D 3 75  ? 81.828  49.401 -30.313 1.00 31.80  ? 75   HIS B CB    1 
ATOM   7203  C CG    . HIS D 3 75  ? 80.940  49.118 -29.147 1.00 29.51  ? 75   HIS B CG    1 
ATOM   7204  N ND1   . HIS D 3 75  ? 79.943  49.976 -28.744 1.00 30.42  ? 75   HIS B ND1   1 
ATOM   7205  C CD2   . HIS D 3 75  ? 80.956  48.106 -28.248 1.00 29.91  ? 75   HIS B CD2   1 
ATOM   7206  C CE1   . HIS D 3 75  ? 79.379  49.505 -27.641 1.00 28.40  ? 75   HIS B CE1   1 
ATOM   7207  N NE2   . HIS D 3 75  ? 79.975  48.374 -27.320 1.00 29.51  ? 75   HIS B NE2   1 
ATOM   7208  N N     . ALA D 3 76  ? 84.841  49.570 -29.101 1.00 44.00  ? 76   ALA B N     1 
ATOM   7209  C CA    . ALA D 3 76  ? 85.744  49.122 -28.056 1.00 45.27  ? 76   ALA B CA    1 
ATOM   7210  C C     . ALA D 3 76  ? 86.712  50.196 -27.617 1.00 46.72  ? 76   ALA B C     1 
ATOM   7211  O O     . ALA D 3 76  ? 87.583  49.953 -26.778 1.00 44.23  ? 76   ALA B O     1 
ATOM   7212  C CB    . ALA D 3 76  ? 86.489  47.897 -28.517 1.00 40.20  ? 76   ALA B CB    1 
ATOM   7213  N N     . LYS D 3 77  ? 86.566  51.387 -28.183 1.00 38.48  ? 77   LYS B N     1 
ATOM   7214  C CA    . LYS D 3 77  ? 87.425  52.493 -27.784 1.00 41.13  ? 77   LYS B CA    1 
ATOM   7215  C C     . LYS D 3 77  ? 88.874  52.167 -28.042 1.00 40.43  ? 77   LYS B C     1 
ATOM   7216  O O     . LYS D 3 77  ? 89.718  52.416 -27.200 1.00 39.89  ? 77   LYS B O     1 
ATOM   7217  C CB    . LYS D 3 77  ? 87.240  52.752 -26.290 1.00 54.07  ? 77   LYS B CB    1 
ATOM   7218  C CG    . LYS D 3 77  ? 85.786  52.881 -25.872 1.00 58.30  ? 77   LYS B CG    1 
ATOM   7219  C CD    . LYS D 3 77  ? 85.623  53.028 -24.371 1.00 62.97  ? 77   LYS B CD    1 
ATOM   7220  C CE    . LYS D 3 77  ? 84.214  53.493 -24.029 1.00 65.96  ? 77   LYS B CE    1 
ATOM   7221  N NZ    . LYS D 3 77  ? 84.077  53.898 -22.601 1.00 66.92  ? 77   LYS B NZ    1 
ATOM   7222  N N     . ARG D 3 78  ? 89.170  51.584 -29.189 1.00 30.90  ? 78   ARG B N     1 
ATOM   7223  C CA    . ARG D 3 78  ? 90.545  51.227 -29.511 1.00 28.24  ? 78   ARG B CA    1 
ATOM   7224  C C     . ARG D 3 78  ? 91.020  52.002 -30.722 1.00 28.27  ? 78   ARG B C     1 
ATOM   7225  O O     . ARG D 3 78  ? 90.244  52.738 -31.347 1.00 26.74  ? 78   ARG B O     1 
ATOM   7226  C CB    . ARG D 3 78  ? 90.672  49.728 -29.806 1.00 47.40  ? 78   ARG B CB    1 
ATOM   7227  C CG    . ARG D 3 78  ? 91.017  48.873 -28.615 1.00 47.80  ? 78   ARG B CG    1 
ATOM   7228  C CD    . ARG D 3 78  ? 91.360  47.437 -29.020 1.00 45.86  ? 78   ARG B CD    1 
ATOM   7229  N NE    . ARG D 3 78  ? 90.175  46.593 -29.219 1.00 47.38  ? 78   ARG B NE    1 
ATOM   7230  C CZ    . ARG D 3 78  ? 89.637  46.288 -30.399 1.00 47.41  ? 78   ARG B CZ    1 
ATOM   7231  N NH1   . ARG D 3 78  ? 90.163  46.740 -31.534 1.00 42.56  ? 78   ARG B NH1   1 
ATOM   7232  N NH2   . ARG D 3 78  ? 88.557  45.534 -30.437 1.00 43.65  ? 78   ARG B NH2   1 
ATOM   7233  N N     . LYS D 3 79  ? 92.291  51.819 -31.072 1.00 40.74  ? 79   LYS B N     1 
ATOM   7234  C CA    . LYS D 3 79  ? 92.884  52.525 -32.208 1.00 42.38  ? 79   LYS B CA    1 
ATOM   7235  C C     . LYS D 3 79  ? 93.545  51.498 -33.116 1.00 40.20  ? 79   LYS B C     1 
ATOM   7236  O O     . LYS D 3 79  ? 94.255  51.839 -34.069 1.00 42.67  ? 79   LYS B O     1 
ATOM   7237  C CB    . LYS D 3 79  ? 93.926  53.531 -31.694 1.00 63.93  ? 79   LYS B CB    1 
ATOM   7238  C CG    . LYS D 3 79  ? 93.892  54.875 -32.388 1.00 69.52  ? 79   LYS B CG    1 
ATOM   7239  C CD    . LYS D 3 79  ? 94.930  55.827 -31.811 1.00 74.88  ? 79   LYS B CD    1 
ATOM   7240  C CE    . LYS D 3 79  ? 94.978  57.118 -32.630 1.00 80.46  ? 79   LYS B CE    1 
ATOM   7241  N NZ    . LYS D 3 79  ? 96.057  58.062 -32.221 1.00 83.07  ? 79   LYS B NZ    1 
ATOM   7242  N N     . THR D 3 80  ? 93.293  50.229 -32.811 1.00 42.72  ? 80   THR B N     1 
ATOM   7243  C CA    . THR D 3 80  ? 93.877  49.147 -33.570 1.00 44.84  ? 80   THR B CA    1 
ATOM   7244  C C     . THR D 3 80  ? 92.874  48.065 -33.914 1.00 43.17  ? 80   THR B C     1 
ATOM   7245  O O     . THR D 3 80  ? 92.341  47.385 -33.032 1.00 42.42  ? 80   THR B O     1 
ATOM   7246  C CB    . THR D 3 80  ? 95.008  48.483 -32.784 1.00 60.52  ? 80   THR B CB    1 
ATOM   7247  O OG1   . THR D 3 80  ? 95.826  49.489 -32.172 1.00 65.11  ? 80   THR B OG1   1 
ATOM   7248  C CG2   . THR D 3 80  ? 95.857  47.638 -33.707 1.00 58.67  ? 80   THR B CG2   1 
ATOM   7249  N N     . VAL D 3 81  ? 92.600  47.898 -35.198 1.00 24.43  ? 81   VAL B N     1 
ATOM   7250  C CA    . VAL D 3 81  ? 91.699  46.839 -35.579 1.00 22.49  ? 81   VAL B CA    1 
ATOM   7251  C C     . VAL D 3 81  ? 92.422  45.535 -35.246 1.00 22.14  ? 81   VAL B C     1 
ATOM   7252  O O     . VAL D 3 81  ? 93.551  45.290 -35.716 1.00 24.81  ? 81   VAL B O     1 
ATOM   7253  C CB    . VAL D 3 81  ? 91.416  46.819 -37.069 1.00 26.82  ? 81   VAL B CB    1 
ATOM   7254  C CG1   . VAL D 3 81  ? 90.429  45.687 -37.368 1.00 26.32  ? 81   VAL B CG1   1 
ATOM   7255  C CG2   . VAL D 3 81  ? 90.870  48.147 -37.520 1.00 25.71  ? 81   VAL B CG2   1 
ATOM   7256  N N     . THR D 3 82  ? 91.768  44.693 -34.448 1.00 25.13  ? 82   THR B N     1 
ATOM   7257  C CA    . THR D 3 82  ? 92.339  43.412 -34.056 1.00 27.31  ? 82   THR B CA    1 
ATOM   7258  C C     . THR D 3 82  ? 91.836  42.234 -34.895 1.00 27.01  ? 82   THR B C     1 
ATOM   7259  O O     . THR D 3 82  ? 90.766  42.292 -35.490 1.00 24.72  ? 82   THR B O     1 
ATOM   7260  C CB    . THR D 3 82  ? 92.047  43.147 -32.583 1.00 33.63  ? 82   THR B CB    1 
ATOM   7261  O OG1   . THR D 3 82  ? 90.634  43.012 -32.390 1.00 33.22  ? 82   THR B OG1   1 
ATOM   7262  C CG2   . THR D 3 82  ? 92.574  44.301 -31.737 1.00 34.46  ? 82   THR B CG2   1 
ATOM   7263  N N     . ALA D 3 83  ? 92.618  41.164 -34.955 1.00 38.72  ? 83   ALA B N     1 
ATOM   7264  C CA    . ALA D 3 83  ? 92.208  40.002 -35.721 1.00 38.57  ? 83   ALA B CA    1 
ATOM   7265  C C     . ALA D 3 83  ? 90.798  39.586 -35.308 1.00 38.93  ? 83   ALA B C     1 
ATOM   7266  O O     . ALA D 3 83  ? 90.008  39.189 -36.151 1.00 40.71  ? 83   ALA B O     1 
ATOM   7267  C CB    . ALA D 3 83  ? 93.173  38.875 -35.502 1.00 54.83  ? 83   ALA B CB    1 
ATOM   7268  N N     . MET D 3 84  ? 90.483  39.677 -34.018 1.00 31.55  ? 84   MET B N     1 
ATOM   7269  C CA    . MET D 3 84  ? 89.147  39.338 -33.538 1.00 32.06  ? 84   MET B CA    1 
ATOM   7270  C C     . MET D 3 84  ? 88.103  40.311 -34.084 1.00 32.51  ? 84   MET B C     1 
ATOM   7271  O O     . MET D 3 84  ? 86.951  39.949 -34.309 1.00 30.86  ? 84   MET B O     1 
ATOM   7272  C CB    . MET D 3 84  ? 89.099  39.374 -32.020 1.00 41.64  ? 84   MET B CB    1 
ATOM   7273  C CG    . MET D 3 84  ? 89.513  38.084 -31.383 1.00 46.91  ? 84   MET B CG    1 
ATOM   7274  S SD    . MET D 3 84  ? 88.519  36.730 -31.978 1.00 52.04  ? 84   MET B SD    1 
ATOM   7275  C CE    . MET D 3 84  ? 87.182  36.719 -30.770 1.00 53.25  ? 84   MET B CE    1 
ATOM   7276  N N     . ASP D 3 85  ? 88.504  41.557 -34.290 1.00 34.01  ? 85   ASP B N     1 
ATOM   7277  C CA    . ASP D 3 85  ? 87.589  42.548 -34.823 1.00 36.13  ? 85   ASP B CA    1 
ATOM   7278  C C     . ASP D 3 85  ? 87.098  42.107 -36.193 1.00 35.39  ? 85   ASP B C     1 
ATOM   7279  O O     . ASP D 3 85  ? 85.918  42.234 -36.485 1.00 36.48  ? 85   ASP B O     1 
ATOM   7280  C CB    . ASP D 3 85  ? 88.277  43.921 -34.900 1.00 31.16  ? 85   ASP B CB    1 
ATOM   7281  C CG    . ASP D 3 85  ? 88.095  44.739 -33.622 1.00 33.06  ? 85   ASP B CG    1 
ATOM   7282  O OD1   . ASP D 3 85  ? 87.873  44.143 -32.548 1.00 33.43  ? 85   ASP B OD1   1 
ATOM   7283  O OD2   . ASP D 3 85  ? 88.182  45.978 -33.683 1.00 36.50  ? 85   ASP B OD2   1 
ATOM   7284  N N     . VAL D 3 86  ? 88.013  41.591 -37.021 1.00 25.31  ? 86   VAL B N     1 
ATOM   7285  C CA    . VAL D 3 86  ? 87.717  41.094 -38.372 1.00 28.00  ? 86   VAL B CA    1 
ATOM   7286  C C     . VAL D 3 86  ? 86.922  39.774 -38.299 1.00 28.54  ? 86   VAL B C     1 
ATOM   7287  O O     . VAL D 3 86  ? 85.967  39.568 -39.050 1.00 29.75  ? 86   VAL B O     1 
ATOM   7288  C CB    . VAL D 3 86  ? 89.027  40.846 -39.149 1.00 35.10  ? 86   VAL B CB    1 
ATOM   7289  C CG1   . VAL D 3 86  ? 88.735  40.362 -40.547 1.00 33.86  ? 86   VAL B CG1   1 
ATOM   7290  C CG2   . VAL D 3 86  ? 89.839  42.105 -39.184 1.00 35.78  ? 86   VAL B CG2   1 
ATOM   7291  N N     . VAL D 3 87  ? 87.346  38.882 -37.406 1.00 30.58  ? 87   VAL B N     1 
ATOM   7292  C CA    . VAL D 3 87  ? 86.666  37.606 -37.179 1.00 27.51  ? 87   VAL B CA    1 
ATOM   7293  C C     . VAL D 3 87  ? 85.193  37.879 -36.910 1.00 29.85  ? 87   VAL B C     1 
ATOM   7294  O O     . VAL D 3 87  ? 84.318  37.300 -37.541 1.00 28.05  ? 87   VAL B O     1 
ATOM   7295  C CB    . VAL D 3 87  ? 87.206  36.885 -35.928 1.00 27.26  ? 87   VAL B CB    1 
ATOM   7296  C CG1   . VAL D 3 87  ? 86.477  35.572 -35.727 1.00 25.89  ? 87   VAL B CG1   1 
ATOM   7297  C CG2   . VAL D 3 87  ? 88.694  36.665 -36.059 1.00 25.93  ? 87   VAL B CG2   1 
ATOM   7298  N N     . TYR D 3 88  ? 84.932  38.750 -35.944 1.00 26.31  ? 88   TYR B N     1 
ATOM   7299  C CA    . TYR D 3 88  ? 83.578  39.115 -35.605 1.00 25.90  ? 88   TYR B CA    1 
ATOM   7300  C C     . TYR D 3 88  ? 82.779  39.696 -36.779 1.00 24.78  ? 88   TYR B C     1 
ATOM   7301  O O     . TYR D 3 88  ? 81.607  39.363 -36.952 1.00 23.62  ? 88   TYR B O     1 
ATOM   7302  C CB    . TYR D 3 88  ? 83.592  40.110 -34.453 1.00 37.98  ? 88   TYR B CB    1 
ATOM   7303  C CG    . TYR D 3 88  ? 83.834  39.459 -33.131 1.00 41.82  ? 88   TYR B CG    1 
ATOM   7304  C CD1   . TYR D 3 88  ? 84.553  40.112 -32.132 1.00 42.19  ? 88   TYR B CD1   1 
ATOM   7305  C CD2   . TYR D 3 88  ? 83.316  38.207 -32.856 1.00 43.27  ? 88   TYR B CD2   1 
ATOM   7306  C CE1   . TYR D 3 88  ? 84.746  39.534 -30.893 1.00 44.56  ? 88   TYR B CE1   1 
ATOM   7307  C CE2   . TYR D 3 88  ? 83.496  37.623 -31.630 1.00 46.10  ? 88   TYR B CE2   1 
ATOM   7308  C CZ    . TYR D 3 88  ? 84.209  38.290 -30.646 1.00 46.94  ? 88   TYR B CZ    1 
ATOM   7309  O OH    . TYR D 3 88  ? 84.345  37.720 -29.396 1.00 49.79  ? 88   TYR B OH    1 
ATOM   7310  N N     . ALA D 3 89  ? 83.405  40.556 -37.579 1.00 29.89  ? 89   ALA B N     1 
ATOM   7311  C CA    . ALA D 3 89  ? 82.724  41.190 -38.723 1.00 31.55  ? 89   ALA B CA    1 
ATOM   7312  C C     . ALA D 3 89  ? 82.367  40.146 -39.791 1.00 31.60  ? 89   ALA B C     1 
ATOM   7313  O O     . ALA D 3 89  ? 81.243  40.088 -40.283 1.00 30.13  ? 89   ALA B O     1 
ATOM   7314  C CB    . ALA D 3 89  ? 83.620  42.317 -39.335 1.00 9.27   ? 89   ALA B CB    1 
ATOM   7315  N N     . LEU D 3 90  ? 83.346  39.323 -40.130 1.00 29.61  ? 90   LEU B N     1 
ATOM   7316  C CA    . LEU D 3 90  ? 83.153  38.276 -41.099 1.00 32.75  ? 90   LEU B CA    1 
ATOM   7317  C C     . LEU D 3 90  ? 81.974  37.387 -40.693 1.00 32.49  ? 90   LEU B C     1 
ATOM   7318  O O     . LEU D 3 90  ? 81.124  37.050 -41.523 1.00 34.26  ? 90   LEU B O     1 
ATOM   7319  C CB    . LEU D 3 90  ? 84.443  37.448 -41.221 1.00 15.12  ? 90   LEU B CB    1 
ATOM   7320  C CG    . LEU D 3 90  ? 85.602  38.102 -41.996 1.00 16.07  ? 90   LEU B CG    1 
ATOM   7321  C CD1   . LEU D 3 90  ? 86.922  37.473 -41.634 1.00 15.62  ? 90   LEU B CD1   1 
ATOM   7322  C CD2   . LEU D 3 90  ? 85.328  38.016 -43.514 1.00 16.75  ? 90   LEU B CD2   1 
ATOM   7323  N N     . LYS D 3 91  ? 81.902  37.006 -39.422 1.00 22.83  ? 91   LYS B N     1 
ATOM   7324  C CA    . LYS D 3 91  ? 80.800  36.156 -39.004 1.00 24.19  ? 91   LYS B CA    1 
ATOM   7325  C C     . LYS D 3 91  ? 79.475  36.841 -39.307 1.00 26.84  ? 91   LYS B C     1 
ATOM   7326  O O     . LYS D 3 91  ? 78.579  36.226 -39.852 1.00 24.52  ? 91   LYS B O     1 
ATOM   7327  C CB    . LYS D 3 91  ? 80.898  35.817 -37.522 1.00 27.89  ? 91   LYS B CB    1 
ATOM   7328  C CG    . LYS D 3 91  ? 79.705  35.001 -37.041 1.00 31.72  ? 91   LYS B CG    1 
ATOM   7329  C CD    . LYS D 3 91  ? 80.072  33.901 -36.061 1.00 40.47  ? 91   LYS B CD    1 
ATOM   7330  C CE    . LYS D 3 91  ? 80.786  34.440 -34.839 1.00 44.14  ? 91   LYS B CE    1 
ATOM   7331  N NZ    . LYS D 3 91  ? 80.926  33.346 -33.859 1.00 44.37  ? 91   LYS B NZ    1 
ATOM   7332  N N     . ARG D 3 92  ? 79.360  38.115 -38.953 1.00 25.61  ? 92   ARG B N     1 
ATOM   7333  C CA    . ARG D 3 92  ? 78.160  38.892 -39.220 1.00 29.49  ? 92   ARG B CA    1 
ATOM   7334  C C     . ARG D 3 92  ? 77.877  38.953 -40.720 1.00 29.80  ? 92   ARG B C     1 
ATOM   7335  O O     . ARG D 3 92  ? 76.719  39.082 -41.123 1.00 29.43  ? 92   ARG B O     1 
ATOM   7336  C CB    . ARG D 3 92  ? 78.348  40.312 -38.737 1.00 27.99  ? 92   ARG B CB    1 
ATOM   7337  C CG    . ARG D 3 92  ? 77.534  40.651 -37.569 1.00 29.84  ? 92   ARG B CG    1 
ATOM   7338  C CD    . ARG D 3 92  ? 77.540  42.141 -37.342 1.00 24.54  ? 92   ARG B CD    1 
ATOM   7339  N NE    . ARG D 3 92  ? 76.337  42.712 -37.908 1.00 23.03  ? 92   ARG B NE    1 
ATOM   7340  C CZ    . ARG D 3 92  ? 76.240  43.131 -39.157 1.00 25.09  ? 92   ARG B CZ    1 
ATOM   7341  N NH1   . ARG D 3 92  ? 77.292  43.065 -39.972 1.00 23.84  ? 92   ARG B NH1   1 
ATOM   7342  N NH2   . ARG D 3 92  ? 75.074  43.560 -39.607 1.00 26.30  ? 92   ARG B NH2   1 
ATOM   7343  N N     . GLN D 3 93  ? 78.946  38.922 -41.529 1.00 24.96  ? 93   GLN B N     1 
ATOM   7344  C CA    . GLN D 3 93  ? 78.851  38.957 -42.987 1.00 26.50  ? 93   GLN B CA    1 
ATOM   7345  C C     . GLN D 3 93  ? 78.467  37.575 -43.458 1.00 23.54  ? 93   GLN B C     1 
ATOM   7346  O O     . GLN D 3 93  ? 78.075  37.382 -44.592 1.00 24.63  ? 93   GLN B O     1 
ATOM   7347  C CB    . GLN D 3 93  ? 80.200  39.302 -43.632 1.00 62.33  ? 93   GLN B CB    1 
ATOM   7348  C CG    . GLN D 3 93  ? 80.717  40.668 -43.319 1.00 68.76  ? 93   GLN B CG    1 
ATOM   7349  C CD    . GLN D 3 93  ? 79.680  41.705 -43.595 1.00 72.18  ? 93   GLN B CD    1 
ATOM   7350  O OE1   . GLN D 3 93  ? 79.289  41.911 -44.741 1.00 72.89  ? 93   GLN B OE1   1 
ATOM   7351  N NE2   . GLN D 3 93  ? 79.204  42.360 -42.543 1.00 71.32  ? 93   GLN B NE2   1 
ATOM   7352  N N     . GLY D 3 94  ? 78.592  36.599 -42.584 1.00 31.62  ? 94   GLY B N     1 
ATOM   7353  C CA    . GLY D 3 94  ? 78.276  35.253 -42.992 1.00 29.72  ? 94   GLY B CA    1 
ATOM   7354  C C     . GLY D 3 94  ? 79.489  34.663 -43.669 1.00 31.61  ? 94   GLY B C     1 
ATOM   7355  O O     . GLY D 3 94  ? 79.364  33.812 -44.524 1.00 30.78  ? 94   GLY B O     1 
ATOM   7356  N N     . ARG D 3 95  ? 80.673  35.128 -43.296 1.00 31.31  ? 95   ARG B N     1 
ATOM   7357  C CA    . ARG D 3 95  ? 81.886  34.617 -43.901 1.00 30.80  ? 95   ARG B CA    1 
ATOM   7358  C C     . ARG D 3 95  ? 82.794  34.045 -42.832 1.00 31.90  ? 95   ARG B C     1 
ATOM   7359  O O     . ARG D 3 95  ? 84.015  34.205 -42.918 1.00 31.42  ? 95   ARG B O     1 
ATOM   7360  C CB    . ARG D 3 95  ? 82.651  35.709 -44.660 1.00 65.72  ? 95   ARG B CB    1 
ATOM   7361  C CG    . ARG D 3 95  ? 81.820  36.699 -45.461 1.00 70.61  ? 95   ARG B CG    1 
ATOM   7362  C CD    . ARG D 3 95  ? 81.032  36.075 -46.581 1.00 75.57  ? 95   ARG B CD    1 
ATOM   7363  N NE    . ARG D 3 95  ? 81.867  35.285 -47.472 1.00 80.33  ? 95   ARG B NE    1 
ATOM   7364  C CZ    . ARG D 3 95  ? 81.446  34.774 -48.627 1.00 81.72  ? 95   ARG B CZ    1 
ATOM   7365  N NH1   . ARG D 3 95  ? 80.200  34.987 -49.042 1.00 82.86  ? 95   ARG B NH1   1 
ATOM   7366  N NH2   . ARG D 3 95  ? 82.255  34.000 -49.342 1.00 81.89  ? 95   ARG B NH2   1 
ATOM   7367  N N     . THR D 3 96  ? 82.185  33.381 -41.841 1.00 20.53  ? 96   THR B N     1 
ATOM   7368  C CA    . THR D 3 96  ? 82.896  32.735 -40.726 1.00 20.46  ? 96   THR B CA    1 
ATOM   7369  C C     . THR D 3 96  ? 84.275  32.188 -41.104 1.00 22.96  ? 96   THR B C     1 
ATOM   7370  O O     . THR D 3 96  ? 84.405  31.355 -42.021 1.00 19.52  ? 96   THR B O     1 
ATOM   7371  C CB    . THR D 3 96  ? 82.108  31.559 -40.180 1.00 23.80  ? 96   THR B CB    1 
ATOM   7372  O OG1   . THR D 3 96  ? 80.954  32.036 -39.512 1.00 23.18  ? 96   THR B OG1   1 
ATOM   7373  C CG2   . THR D 3 96  ? 82.936  30.769 -39.195 1.00 26.28  ? 96   THR B CG2   1 
ATOM   7374  N N     . LEU D 3 97  ? 85.287  32.653 -40.371 1.00 29.33  ? 97   LEU B N     1 
ATOM   7375  C CA    . LEU D 3 97  ? 86.670  32.259 -40.586 1.00 28.45  ? 97   LEU B CA    1 
ATOM   7376  C C     . LEU D 3 97  ? 87.245  31.559 -39.357 1.00 30.23  ? 97   LEU B C     1 
ATOM   7377  O O     . LEU D 3 97  ? 87.134  32.058 -38.241 1.00 30.84  ? 97   LEU B O     1 
ATOM   7378  C CB    . LEU D 3 97  ? 87.501  33.496 -40.908 1.00 17.78  ? 97   LEU B CB    1 
ATOM   7379  C CG    . LEU D 3 97  ? 88.992  33.208 -41.071 1.00 19.88  ? 97   LEU B CG    1 
ATOM   7380  C CD1   . LEU D 3 97  ? 89.177  32.317 -42.299 1.00 15.72  ? 97   LEU B CD1   1 
ATOM   7381  C CD2   . LEU D 3 97  ? 89.797  34.519 -41.172 1.00 21.65  ? 97   LEU B CD2   1 
ATOM   7382  N N     . TYR D 3 98  ? 87.846  30.390 -39.557 1.00 36.69  ? 98   TYR B N     1 
ATOM   7383  C CA    . TYR D 3 98  ? 88.435  29.653 -38.440 1.00 35.56  ? 98   TYR B CA    1 
ATOM   7384  C C     . TYR D 3 98  ? 89.920  29.886 -38.456 1.00 35.58  ? 98   TYR B C     1 
ATOM   7385  O O     . TYR D 3 98  ? 90.518  29.927 -39.521 1.00 34.28  ? 98   TYR B O     1 
ATOM   7386  C CB    . TYR D 3 98  ? 88.212  28.141 -38.554 1.00 25.76  ? 98   TYR B CB    1 
ATOM   7387  C CG    . TYR D 3 98  ? 86.821  27.621 -38.226 1.00 26.17  ? 98   TYR B CG    1 
ATOM   7388  C CD1   . TYR D 3 98  ? 85.814  28.468 -37.771 1.00 29.42  ? 98   TYR B CD1   1 
ATOM   7389  C CD2   . TYR D 3 98  ? 86.515  26.277 -38.401 1.00 25.67  ? 98   TYR B CD2   1 
ATOM   7390  C CE1   . TYR D 3 98  ? 84.544  27.996 -37.498 1.00 27.12  ? 98   TYR B CE1   1 
ATOM   7391  C CE2   . TYR D 3 98  ? 85.241  25.789 -38.142 1.00 29.71  ? 98   TYR B CE2   1 
ATOM   7392  C CZ    . TYR D 3 98  ? 84.255  26.657 -37.681 1.00 29.01  ? 98   TYR B CZ    1 
ATOM   7393  O OH    . TYR D 3 98  ? 82.991  26.196 -37.367 1.00 32.72  ? 98   TYR B OH    1 
ATOM   7394  N N     . GLY D 3 99  ? 90.510  30.047 -37.277 1.00 39.70  ? 99   GLY B N     1 
ATOM   7395  C CA    . GLY D 3 99  ? 91.953  30.235 -37.189 1.00 43.12  ? 99   GLY B CA    1 
ATOM   7396  C C     . GLY D 3 99  ? 92.538  31.483 -36.582 1.00 45.94  ? 99   GLY B C     1 
ATOM   7397  O O     . GLY D 3 99  ? 93.756  31.605 -36.503 1.00 45.68  ? 99   GLY B O     1 
ATOM   7398  N N     . PHE D 3 100 ? 91.662  32.397 -36.185 1.00 40.16  ? 100  PHE B N     1 
ATOM   7399  C CA    . PHE D 3 100 ? 92.062  33.660 -35.582 1.00 40.24  ? 100  PHE B CA    1 
ATOM   7400  C C     . PHE D 3 100 ? 91.010  34.045 -34.420 1.00 41.92  ? 100  PHE B C     1 
ATOM   7401  O O     . PHE D 3 100 ? 90.935  35.216 -34.086 1.00 40.44  ? 100  PHE B O     1 
ATOM   7402  C CB    . PHE D 3 100 ? 92.147  34.806 -36.708 1.00 41.33  ? 100  PHE B CB    1 
ATOM   7403  C CG    . PHE D 3 100 ? 92.970  34.454 -38.041 1.00 40.34  ? 100  PHE B CG    1 
ATOM   7404  C CD1   . PHE D 3 100 ? 92.488  33.563 -39.020 1.00 40.34  ? 100  PHE B CD1   1 
ATOM   7405  C CD2   . PHE D 3 100 ? 94.194  35.079 -38.320 1.00 40.10  ? 100  PHE B CD2   1 
ATOM   7406  C CE1   . PHE D 3 100 ? 93.232  33.318 -40.237 1.00 41.37  ? 100  PHE B CE1   1 
ATOM   7407  C CE2   . PHE D 3 100 ? 94.924  34.836 -39.514 1.00 40.53  ? 100  PHE B CE2   1 
ATOM   7408  C CZ    . PHE D 3 100 ? 94.449  33.968 -40.457 1.00 42.13  ? 100  PHE B CZ    1 
ATOM   7409  N N     . GLY D 3 101 ? 90.285  33.008 -33.872 1.00 62.65  ? 101  GLY B N     1 
ATOM   7410  C CA    . GLY D 3 101 ? 89.156  32.911 -32.883 1.00 68.00  ? 101  GLY B CA    1 
ATOM   7411  C C     . GLY D 3 101 ? 88.043  32.115 -33.650 1.00 71.55  ? 101  GLY B C     1 
ATOM   7412  O O     . GLY D 3 101 ? 88.185  32.129 -34.905 1.00 71.48  ? 101  GLY B O     1 
ATOM   7413  N N     . GLY D 3 102 ? 86.995  31.437 -33.106 1.00 132.79 ? 102  GLY B N     1 
ATOM   7414  C CA    . GLY D 3 102 ? 86.023  30.838 -34.040 1.00 133.59 ? 102  GLY B CA    1 
ATOM   7415  C C     . GLY D 3 102 ? 84.860  29.884 -34.174 1.00 135.23 ? 102  GLY B C     1 
ATOM   7416  O O     . GLY D 3 102 ? 84.452  29.059 -33.332 1.00 116.45 ? 102  GLY B O     1 
ATOM   7417  O OXT   . GLY D 3 102 ? 84.374  30.056 -35.304 1.00 78.08  ? 102  GLY B OXT   1 
ATOM   7418  N N     . ALA E 4 14  ? 52.429  61.670 -12.985 1.00 86.97  ? 814  ALA C N     1 
ATOM   7419  C CA    . ALA E 4 14  ? 53.300  60.507 -13.337 1.00 86.81  ? 814  ALA C CA    1 
ATOM   7420  C C     . ALA E 4 14  ? 53.309  60.237 -14.840 1.00 85.67  ? 814  ALA C C     1 
ATOM   7421  O O     . ALA E 4 14  ? 52.559  59.392 -15.336 1.00 87.18  ? 814  ALA C O     1 
ATOM   7422  C CB    . ALA E 4 14  ? 52.837  59.251 -12.588 1.00 57.85  ? 814  ALA C CB    1 
ATOM   7423  N N     . LYS E 4 15  ? 54.161  60.956 -15.565 1.00 76.38  ? 815  LYS C N     1 
ATOM   7424  C CA    . LYS E 4 15  ? 54.264  60.771 -17.005 1.00 72.54  ? 815  LYS C CA    1 
ATOM   7425  C C     . LYS E 4 15  ? 54.822  59.382 -17.287 1.00 67.01  ? 815  LYS C C     1 
ATOM   7426  O O     . LYS E 4 15  ? 55.201  58.642 -16.374 1.00 65.99  ? 815  LYS C O     1 
ATOM   7427  C CB    . LYS E 4 15  ? 55.212  61.804 -17.615 1.00 75.10  ? 815  LYS C CB    1 
ATOM   7428  C CG    . LYS E 4 15  ? 54.901  63.232 -17.263 1.00 79.65  ? 815  LYS C CG    1 
ATOM   7429  C CD    . LYS E 4 15  ? 56.020  64.143 -17.737 1.00 82.66  ? 815  LYS C CD    1 
ATOM   7430  C CE    . LYS E 4 15  ? 55.898  65.555 -17.152 1.00 84.47  ? 815  LYS C CE    1 
ATOM   7431  N NZ    . LYS E 4 15  ? 57.098  66.404 -17.444 1.00 85.79  ? 815  LYS C NZ    1 
ATOM   7432  N N     . THR E 4 16  ? 54.866  59.030 -18.563 1.00 63.60  ? 816  THR C N     1 
ATOM   7433  C CA    . THR E 4 16  ? 55.417  57.752 -18.966 1.00 56.00  ? 816  THR C CA    1 
ATOM   7434  C C     . THR E 4 16  ? 56.803  58.072 -19.473 1.00 51.23  ? 816  THR C C     1 
ATOM   7435  O O     . THR E 4 16  ? 57.116  59.225 -19.747 1.00 47.33  ? 816  THR C O     1 
ATOM   7436  C CB    . THR E 4 16  ? 54.615  57.128 -20.092 1.00 48.27  ? 816  THR C CB    1 
ATOM   7437  O OG1   . THR E 4 16  ? 54.566  58.033 -21.204 1.00 46.42  ? 816  THR C OG1   1 
ATOM   7438  C CG2   . THR E 4 16  ? 53.220  56.804 -19.606 1.00 45.45  ? 816  THR C CG2   1 
ATOM   7439  N N     . ARG E 4 17  ? 57.640  57.058 -19.597 1.00 42.18  ? 817  ARG C N     1 
ATOM   7440  C CA    . ARG E 4 17  ? 58.993  57.290 -20.061 1.00 39.77  ? 817  ARG C CA    1 
ATOM   7441  C C     . ARG E 4 17  ? 58.924  57.642 -21.541 1.00 36.47  ? 817  ARG C C     1 
ATOM   7442  O O     . ARG E 4 17  ? 59.740  58.420 -22.058 1.00 34.34  ? 817  ARG C O     1 
ATOM   7443  C CB    . ARG E 4 17  ? 59.831  56.031 -19.812 1.00 30.48  ? 817  ARG C CB    1 
ATOM   7444  C CG    . ARG E 4 17  ? 59.560  55.416 -18.440 1.00 34.03  ? 817  ARG C CG    1 
ATOM   7445  C CD    . ARG E 4 17  ? 60.811  54.889 -17.841 1.00 33.22  ? 817  ARG C CD    1 
ATOM   7446  N NE    . ARG E 4 17  ? 60.946  53.465 -18.057 1.00 35.94  ? 817  ARG C NE    1 
ATOM   7447  C CZ    . ARG E 4 17  ? 62.083  52.874 -18.413 1.00 36.55  ? 817  ARG C CZ    1 
ATOM   7448  N NH1   . ARG E 4 17  ? 63.192  53.606 -18.598 1.00 34.36  ? 817  ARG C NH1   1 
ATOM   7449  N NH2   . ARG E 4 17  ? 62.105  51.553 -18.575 1.00 36.58  ? 817  ARG C NH2   1 
ATOM   7450  N N     . SER E 4 18  ? 57.923  57.074 -22.209 1.00 38.74  ? 818  SER C N     1 
ATOM   7451  C CA    . SER E 4 18  ? 57.717  57.322 -23.629 1.00 40.71  ? 818  SER C CA    1 
ATOM   7452  C C     . SER E 4 18  ? 57.587  58.833 -23.814 1.00 40.93  ? 818  SER C C     1 
ATOM   7453  O O     . SER E 4 18  ? 58.360  59.434 -24.556 1.00 39.85  ? 818  SER C O     1 
ATOM   7454  C CB    . SER E 4 18  ? 56.447  56.603 -24.131 1.00 31.62  ? 818  SER C CB    1 
ATOM   7455  O OG    . SER E 4 18  ? 56.487  55.198 -23.911 1.00 33.34  ? 818  SER C OG    1 
ATOM   7456  N N     . SER E 4 19  ? 56.624  59.442 -23.117 1.00 39.05  ? 819  SER C N     1 
ATOM   7457  C CA    . SER E 4 19  ? 56.399  60.892 -23.200 1.00 41.71  ? 819  SER C CA    1 
ATOM   7458  C C     . SER E 4 19  ? 57.632  61.672 -22.770 1.00 40.46  ? 819  SER C C     1 
ATOM   7459  O O     . SER E 4 19  ? 58.026  62.632 -23.419 1.00 41.35  ? 819  SER C O     1 
ATOM   7460  C CB    . SER E 4 19  ? 55.199  61.306 -22.341 1.00 61.47  ? 819  SER C CB    1 
ATOM   7461  O OG    . SER E 4 19  ? 55.340  60.868 -21.004 1.00 67.81  ? 819  SER C OG    1 
ATOM   7462  N N     . ARG E 4 20  ? 58.233  61.239 -21.670 1.00 30.96  ? 820  ARG C N     1 
ATOM   7463  C CA    . ARG E 4 20  ? 59.432  61.843 -21.135 1.00 30.58  ? 820  ARG C CA    1 
ATOM   7464  C C     . ARG E 4 20  ? 60.558  61.781 -22.185 1.00 29.16  ? 820  ARG C C     1 
ATOM   7465  O O     . ARG E 4 20  ? 61.455  62.627 -22.207 1.00 28.43  ? 820  ARG C O     1 
ATOM   7466  C CB    . ARG E 4 20  ? 59.828  61.105 -19.857 1.00 53.04  ? 820  ARG C CB    1 
ATOM   7467  C CG    . ARG E 4 20  ? 61.040  61.670 -19.146 1.00 59.52  ? 820  ARG C CG    1 
ATOM   7468  C CD    . ARG E 4 20  ? 61.414  60.814 -17.942 1.00 66.07  ? 820  ARG C CD    1 
ATOM   7469  N NE    . ARG E 4 20  ? 62.796  61.048 -17.515 1.00 71.20  ? 820  ARG C NE    1 
ATOM   7470  C CZ    . ARG E 4 20  ? 63.486  60.241 -16.705 1.00 74.24  ? 820  ARG C CZ    1 
ATOM   7471  N NH1   . ARG E 4 20  ? 62.917  59.138 -16.229 1.00 76.47  ? 820  ARG C NH1   1 
ATOM   7472  N NH2   . ARG E 4 20  ? 64.750  60.528 -16.379 1.00 75.01  ? 820  ARG C NH2   1 
ATOM   7473  N N     . ALA E 4 21  ? 60.508  60.790 -23.070 1.00 33.71  ? 821  ALA C N     1 
ATOM   7474  C CA    . ALA E 4 21  ? 61.529  60.670 -24.113 1.00 33.03  ? 821  ALA C CA    1 
ATOM   7475  C C     . ALA E 4 21  ? 61.060  61.318 -25.404 1.00 32.36  ? 821  ALA C C     1 
ATOM   7476  O O     . ALA E 4 21  ? 61.807  61.381 -26.380 1.00 34.59  ? 821  ALA C O     1 
ATOM   7477  C CB    . ALA E 4 21  ? 61.852  59.204 -24.372 1.00 60.59  ? 821  ALA C CB    1 
ATOM   7478  N N     . GLY E 4 22  ? 59.821  61.806 -25.392 1.00 39.36  ? 822  GLY C N     1 
ATOM   7479  C CA    . GLY E 4 22  ? 59.235  62.397 -26.580 1.00 36.49  ? 822  GLY C CA    1 
ATOM   7480  C C     . GLY E 4 22  ? 58.951  61.300 -27.604 1.00 35.06  ? 822  GLY C C     1 
ATOM   7481  O O     . GLY E 4 22  ? 59.239  61.460 -28.790 1.00 33.13  ? 822  GLY C O     1 
ATOM   7482  N N     . LEU E 4 23  ? 58.357  60.192 -27.160 1.00 40.94  ? 823  LEU C N     1 
ATOM   7483  C CA    . LEU E 4 23  ? 58.092  59.067 -28.054 1.00 40.00  ? 823  LEU C CA    1 
ATOM   7484  C C     . LEU E 4 23  ? 56.674  58.520 -28.154 1.00 41.10  ? 823  LEU C C     1 
ATOM   7485  O O     . LEU E 4 23  ? 55.849  58.691 -27.266 1.00 43.94  ? 823  LEU C O     1 
ATOM   7486  C CB    . LEU E 4 23  ? 59.032  57.917 -27.695 1.00 25.56  ? 823  LEU C CB    1 
ATOM   7487  C CG    . LEU E 4 23  ? 60.501  58.065 -28.085 1.00 23.93  ? 823  LEU C CG    1 
ATOM   7488  C CD1   . LEU E 4 23  ? 61.253  56.769 -27.756 1.00 21.28  ? 823  LEU C CD1   1 
ATOM   7489  C CD2   . LEU E 4 23  ? 60.588  58.355 -29.564 1.00 23.85  ? 823  LEU C CD2   1 
ATOM   7490  N N     . GLN E 4 24  ? 56.408  57.849 -29.261 1.00 35.51  ? 824  GLN C N     1 
ATOM   7491  C CA    . GLN E 4 24  ? 55.111  57.248 -29.486 1.00 35.91  ? 824  GLN C CA    1 
ATOM   7492  C C     . GLN E 4 24  ? 55.179  55.799 -29.101 1.00 35.58  ? 824  GLN C C     1 
ATOM   7493  O O     . GLN E 4 24  ? 54.229  55.276 -28.556 1.00 37.13  ? 824  GLN C O     1 
ATOM   7494  C CB    . GLN E 4 24  ? 54.684  57.385 -30.942 1.00 31.39  ? 824  GLN C CB    1 
ATOM   7495  C CG    . GLN E 4 24  ? 54.347  58.828 -31.330 1.00 34.46  ? 824  GLN C CG    1 
ATOM   7496  C CD    . GLN E 4 24  ? 53.207  59.385 -30.506 1.00 32.65  ? 824  GLN C CD    1 
ATOM   7497  O OE1   . GLN E 4 24  ? 52.067  58.928 -30.595 1.00 31.19  ? 824  GLN C OE1   1 
ATOM   7498  N NE2   . GLN E 4 24  ? 53.513  60.367 -29.689 1.00 37.32  ? 824  GLN C NE2   1 
ATOM   7499  N N     . PHE E 4 25  ? 56.302  55.143 -29.365 1.00 51.98  ? 825  PHE C N     1 
ATOM   7500  C CA    . PHE E 4 25  ? 56.443  53.746 -28.976 1.00 52.31  ? 825  PHE C CA    1 
ATOM   7501  C C     . PHE E 4 25  ? 56.583  53.649 -27.455 1.00 54.46  ? 825  PHE C C     1 
ATOM   7502  O O     . PHE E 4 25  ? 57.019  54.596 -26.794 1.00 52.78  ? 825  PHE C O     1 
ATOM   7503  C CB    . PHE E 4 25  ? 57.635  53.115 -29.681 1.00 20.16  ? 825  PHE C CB    1 
ATOM   7504  C CG    . PHE E 4 25  ? 57.285  52.510 -31.009 1.00 22.96  ? 825  PHE C CG    1 
ATOM   7505  C CD1   . PHE E 4 25  ? 56.488  53.198 -31.907 1.00 21.90  ? 825  PHE C CD1   1 
ATOM   7506  C CD2   . PHE E 4 25  ? 57.769  51.248 -31.365 1.00 25.13  ? 825  PHE C CD2   1 
ATOM   7507  C CE1   . PHE E 4 25  ? 56.170  52.653 -33.147 1.00 23.57  ? 825  PHE C CE1   1 
ATOM   7508  C CE2   . PHE E 4 25  ? 57.470  50.688 -32.589 1.00 25.48  ? 825  PHE C CE2   1 
ATOM   7509  C CZ    . PHE E 4 25  ? 56.660  51.398 -33.494 1.00 24.58  ? 825  PHE C CZ    1 
ATOM   7510  N N     . PRO E 4 26  ? 56.219  52.494 -26.884 1.00 39.84  ? 826  PRO C N     1 
ATOM   7511  C CA    . PRO E 4 26  ? 56.248  52.182 -25.449 1.00 39.01  ? 826  PRO C CA    1 
ATOM   7512  C C     . PRO E 4 26  ? 57.609  51.892 -24.808 1.00 41.03  ? 826  PRO C C     1 
ATOM   7513  O O     . PRO E 4 26  ? 58.003  50.738 -24.706 1.00 37.70  ? 826  PRO C O     1 
ATOM   7514  C CB    . PRO E 4 26  ? 55.311  50.990 -25.368 1.00 24.45  ? 826  PRO C CB    1 
ATOM   7515  C CG    . PRO E 4 26  ? 55.670  50.226 -26.613 1.00 25.24  ? 826  PRO C CG    1 
ATOM   7516  C CD    . PRO E 4 26  ? 55.814  51.313 -27.670 1.00 23.93  ? 826  PRO C CD    1 
ATOM   7517  N N     . VAL E 4 27  ? 58.303  52.930 -24.345 1.00 34.20  ? 827  VAL C N     1 
ATOM   7518  C CA    . VAL E 4 27  ? 59.622  52.757 -23.746 1.00 34.40  ? 827  VAL C CA    1 
ATOM   7519  C C     . VAL E 4 27  ? 59.689  51.697 -22.655 1.00 35.98  ? 827  VAL C C     1 
ATOM   7520  O O     . VAL E 4 27  ? 60.659  50.932 -22.589 1.00 32.99  ? 827  VAL C O     1 
ATOM   7521  C CB    . VAL E 4 27  ? 60.150  54.055 -23.137 1.00 25.46  ? 827  VAL C CB    1 
ATOM   7522  C CG1   . VAL E 4 27  ? 61.431  53.777 -22.350 1.00 27.20  ? 827  VAL C CG1   1 
ATOM   7523  C CG2   . VAL E 4 27  ? 60.430  55.055 -24.213 1.00 24.41  ? 827  VAL C CG2   1 
ATOM   7524  N N     . GLY E 4 28  ? 58.672  51.659 -21.796 1.00 36.71  ? 828  GLY C N     1 
ATOM   7525  C CA    . GLY E 4 28  ? 58.665  50.688 -20.718 1.00 36.68  ? 828  GLY C CA    1 
ATOM   7526  C C     . GLY E 4 28  ? 58.584  49.268 -21.239 1.00 38.38  ? 828  GLY C C     1 
ATOM   7527  O O     . GLY E 4 28  ? 59.340  48.394 -20.830 1.00 36.18  ? 828  GLY C O     1 
ATOM   7528  N N     . ARG E 4 29  ? 57.654  49.040 -22.156 1.00 46.20  ? 829  ARG C N     1 
ATOM   7529  C CA    . ARG E 4 29  ? 57.453  47.719 -22.746 1.00 46.69  ? 829  ARG C CA    1 
ATOM   7530  C C     . ARG E 4 29  ? 58.738  47.157 -23.316 1.00 46.28  ? 829  ARG C C     1 
ATOM   7531  O O     . ARG E 4 29  ? 59.076  45.990 -23.109 1.00 46.03  ? 829  ARG C O     1 
ATOM   7532  C CB    . ARG E 4 29  ? 56.444  47.825 -23.866 1.00 31.57  ? 829  ARG C CB    1 
ATOM   7533  C CG    . ARG E 4 29  ? 56.116  46.535 -24.515 1.00 32.07  ? 829  ARG C CG    1 
ATOM   7534  C CD    . ARG E 4 29  ? 54.656  46.387 -24.401 1.00 35.05  ? 829  ARG C CD    1 
ATOM   7535  N NE    . ARG E 4 29  ? 54.058  46.036 -25.663 1.00 38.29  ? 829  ARG C NE    1 
ATOM   7536  C CZ    . ARG E 4 29  ? 52.754  46.049 -25.874 1.00 37.45  ? 829  ARG C CZ    1 
ATOM   7537  N NH1   . ARG E 4 29  ? 51.929  46.415 -24.901 1.00 38.42  ? 829  ARG C NH1   1 
ATOM   7538  N NH2   . ARG E 4 29  ? 52.278  45.651 -27.046 1.00 42.32  ? 829  ARG C NH2   1 
ATOM   7539  N N     . VAL E 4 30  ? 59.428  48.008 -24.068 1.00 46.47  ? 830  VAL C N     1 
ATOM   7540  C CA    . VAL E 4 30  ? 60.685  47.669 -24.705 1.00 47.34  ? 830  VAL C CA    1 
ATOM   7541  C C     . VAL E 4 30  ? 61.740  47.328 -23.655 1.00 50.79  ? 830  VAL C C     1 
ATOM   7542  O O     . VAL E 4 30  ? 62.423  46.317 -23.751 1.00 50.75  ? 830  VAL C O     1 
ATOM   7543  C CB    . VAL E 4 30  ? 61.178  48.847 -25.572 1.00 31.80  ? 830  VAL C CB    1 
ATOM   7544  C CG1   . VAL E 4 30  ? 62.566  48.538 -26.142 1.00 29.46  ? 830  VAL C CG1   1 
ATOM   7545  C CG2   . VAL E 4 30  ? 60.176  49.119 -26.685 1.00 29.30  ? 830  VAL C CG2   1 
ATOM   7546  N N     . HIS E 4 31  ? 61.878  48.178 -22.650 1.00 39.97  ? 831  HIS C N     1 
ATOM   7547  C CA    . HIS E 4 31  ? 62.850  47.921 -21.608 1.00 42.91  ? 831  HIS C CA    1 
ATOM   7548  C C     . HIS E 4 31  ? 62.480  46.606 -20.932 1.00 44.09  ? 831  HIS C C     1 
ATOM   7549  O O     . HIS E 4 31  ? 63.319  45.907 -20.358 1.00 44.09  ? 831  HIS C O     1 
ATOM   7550  C CB    . HIS E 4 31  ? 62.821  49.054 -20.599 1.00 36.39  ? 831  HIS C CB    1 
ATOM   7551  C CG    . HIS E 4 31  ? 63.824  48.909 -19.504 1.00 37.47  ? 831  HIS C CG    1 
ATOM   7552  N ND1   . HIS E 4 31  ? 64.727  47.876 -19.463 1.00 41.16  ? 831  HIS C ND1   1 
ATOM   7553  C CD2   . HIS E 4 31  ? 64.081  49.676 -18.421 1.00 38.26  ? 831  HIS C CD2   1 
ATOM   7554  C CE1   . HIS E 4 31  ? 65.501  48.010 -18.401 1.00 39.76  ? 831  HIS C CE1   1 
ATOM   7555  N NE2   . HIS E 4 31  ? 65.128  49.095 -17.752 1.00 40.32  ? 831  HIS C NE2   1 
ATOM   7556  N N     . ARG E 4 32  ? 61.211  46.252 -21.023 1.00 32.58  ? 832  ARG C N     1 
ATOM   7557  C CA    . ARG E 4 32  ? 60.751  45.034 -20.386 1.00 34.08  ? 832  ARG C CA    1 
ATOM   7558  C C     . ARG E 4 32  ? 61.143  43.823 -21.200 1.00 33.84  ? 832  ARG C C     1 
ATOM   7559  O O     . ARG E 4 32  ? 61.706  42.866 -20.668 1.00 35.44  ? 832  ARG C O     1 
ATOM   7560  C CB    . ARG E 4 32  ? 59.243  45.083 -20.219 1.00 40.40  ? 832  ARG C CB    1 
ATOM   7561  C CG    . ARG E 4 32  ? 58.729  44.267 -19.086 1.00 42.48  ? 832  ARG C CG    1 
ATOM   7562  C CD    . ARG E 4 32  ? 57.240  44.228 -19.173 1.00 47.93  ? 832  ARG C CD    1 
ATOM   7563  N NE    . ARG E 4 32  ? 56.808  43.352 -20.258 1.00 49.50  ? 832  ARG C NE    1 
ATOM   7564  C CZ    . ARG E 4 32  ? 55.806  43.636 -21.086 1.00 51.09  ? 832  ARG C CZ    1 
ATOM   7565  N NH1   . ARG E 4 32  ? 55.132  44.776 -20.972 1.00 52.57  ? 832  ARG C NH1   1 
ATOM   7566  N NH2   . ARG E 4 32  ? 55.460  42.761 -22.016 1.00 54.15  ? 832  ARG C NH2   1 
ATOM   7567  N N     . LEU E 4 33  ? 60.831  43.859 -22.490 1.00 35.90  ? 833  LEU C N     1 
ATOM   7568  C CA    . LEU E 4 33  ? 61.187  42.763 -23.356 1.00 34.64  ? 833  LEU C CA    1 
ATOM   7569  C C     . LEU E 4 33  ? 62.685  42.545 -23.306 1.00 32.92  ? 833  LEU C C     1 
ATOM   7570  O O     . LEU E 4 33  ? 63.124  41.409 -23.288 1.00 33.88  ? 833  LEU C O     1 
ATOM   7571  C CB    . LEU E 4 33  ? 60.761  43.050 -24.770 1.00 26.61  ? 833  LEU C CB    1 
ATOM   7572  C CG    . LEU E 4 33  ? 59.244  43.144 -24.936 1.00 27.39  ? 833  LEU C CG    1 
ATOM   7573  C CD1   . LEU E 4 33  ? 58.909  43.624 -26.368 1.00 28.58  ? 833  LEU C CD1   1 
ATOM   7574  C CD2   . LEU E 4 33  ? 58.617  41.798 -24.666 1.00 28.21  ? 833  LEU C CD2   1 
ATOM   7575  N N     . LEU E 4 34  ? 63.473  43.615 -23.268 1.00 26.69  ? 834  LEU C N     1 
ATOM   7576  C CA    . LEU E 4 34  ? 64.924  43.488 -23.194 1.00 27.62  ? 834  LEU C CA    1 
ATOM   7577  C C     . LEU E 4 34  ? 65.380  42.568 -22.045 1.00 31.65  ? 834  LEU C C     1 
ATOM   7578  O O     . LEU E 4 34  ? 66.375  41.825 -22.147 1.00 31.86  ? 834  LEU C O     1 
ATOM   7579  C CB    . LEU E 4 34  ? 65.551  44.850 -23.006 1.00 19.63  ? 834  LEU C CB    1 
ATOM   7580  C CG    . LEU E 4 34  ? 65.599  45.698 -24.259 1.00 22.55  ? 834  LEU C CG    1 
ATOM   7581  C CD1   . LEU E 4 34  ? 66.493  46.935 -24.009 1.00 19.07  ? 834  LEU C CD1   1 
ATOM   7582  C CD2   . LEU E 4 34  ? 66.141  44.852 -25.418 1.00 17.88  ? 834  LEU C CD2   1 
ATOM   7583  N N     . ARG E 4 35  ? 64.653  42.629 -20.941 1.00 49.79  ? 835  ARG C N     1 
ATOM   7584  C CA    . ARG E 4 35  ? 64.965  41.798 -19.808 1.00 54.22  ? 835  ARG C CA    1 
ATOM   7585  C C     . ARG E 4 35  ? 64.530  40.368 -20.126 1.00 55.78  ? 835  ARG C C     1 
ATOM   7586  O O     . ARG E 4 35  ? 65.332  39.446 -20.058 1.00 58.55  ? 835  ARG C O     1 
ATOM   7587  C CB    . ARG E 4 35  ? 64.214  42.293 -18.575 1.00 57.85  ? 835  ARG C CB    1 
ATOM   7588  C CG    . ARG E 4 35  ? 64.411  43.761 -18.243 1.00 59.68  ? 835  ARG C CG    1 
ATOM   7589  C CD    . ARG E 4 35  ? 63.645  44.122 -16.979 1.00 65.63  ? 835  ARG C CD    1 
ATOM   7590  N NE    . ARG E 4 35  ? 63.924  45.485 -16.541 1.00 69.15  ? 835  ARG C NE    1 
ATOM   7591  C CZ    . ARG E 4 35  ? 65.121  45.931 -16.149 1.00 71.13  ? 835  ARG C CZ    1 
ATOM   7592  N NH1   . ARG E 4 35  ? 66.187  45.127 -16.132 1.00 73.03  ? 835  ARG C NH1   1 
ATOM   7593  N NH2   . ARG E 4 35  ? 65.249  47.195 -15.761 1.00 72.82  ? 835  ARG C NH2   1 
ATOM   7594  N N     . LYS E 4 36  ? 63.271  40.178 -20.500 1.00 30.02  ? 836  LYS C N     1 
ATOM   7595  C CA    . LYS E 4 36  ? 62.786  38.831 -20.767 1.00 32.55  ? 836  LYS C CA    1 
ATOM   7596  C C     . LYS E 4 36  ? 63.448  38.130 -21.962 1.00 31.43  ? 836  LYS C C     1 
ATOM   7597  O O     . LYS E 4 36  ? 63.308  36.907 -22.161 1.00 30.10  ? 836  LYS C O     1 
ATOM   7598  C CB    . LYS E 4 36  ? 61.270  38.844 -20.957 1.00 102.51 ? 836  LYS C CB    1 
ATOM   7599  C CG    . LYS E 4 36  ? 60.823  39.383 -22.299 1.00 108.74 ? 836  LYS C CG    1 
ATOM   7600  C CD    . LYS E 4 36  ? 59.314  39.289 -22.459 1.00 113.65 ? 836  LYS C CD    1 
ATOM   7601  C CE    . LYS E 4 36  ? 58.830  37.852 -22.459 1.00 115.25 ? 836  LYS C CE    1 
ATOM   7602  N NZ    . LYS E 4 36  ? 57.350  37.794 -22.591 1.00 119.27 ? 836  LYS C NZ    1 
ATOM   7603  N N     . GLY E 4 37  ? 64.177  38.890 -22.764 1.00 51.61  ? 837  GLY C N     1 
ATOM   7604  C CA    . GLY E 4 37  ? 64.823  38.290 -23.914 1.00 48.40  ? 837  GLY C CA    1 
ATOM   7605  C C     . GLY E 4 37  ? 66.196  37.795 -23.549 1.00 48.82  ? 837  GLY C C     1 
ATOM   7606  O O     . GLY E 4 37  ? 66.873  37.148 -24.354 1.00 47.95  ? 837  GLY C O     1 
ATOM   7607  N N     . ASN E 4 38  ? 66.590  38.121 -22.320 1.00 39.66  ? 838  ASN C N     1 
ATOM   7608  C CA    . ASN E 4 38  ? 67.881  37.751 -21.759 1.00 41.37  ? 838  ASN C CA    1 
ATOM   7609  C C     . ASN E 4 38  ? 69.007  37.985 -22.751 1.00 38.21  ? 838  ASN C C     1 
ATOM   7610  O O     . ASN E 4 38  ? 69.513  37.055 -23.366 1.00 40.15  ? 838  ASN C O     1 
ATOM   7611  C CB    . ASN E 4 38  ? 67.867  36.292 -21.316 1.00 94.06  ? 838  ASN C CB    1 
ATOM   7612  C CG    . ASN E 4 38  ? 68.623  36.087 -20.028 1.00 97.56  ? 838  ASN C CG    1 
ATOM   7613  O OD1   . ASN E 4 38  ? 68.287  36.684 -19.003 1.00 99.18  ? 838  ASN C OD1   1 
ATOM   7614  N ND2   . ASN E 4 38  ? 69.657  35.252 -20.067 1.00 100.22 ? 838  ASN C ND2   1 
ATOM   7615  N N     . TYR E 4 39  ? 69.388  39.246 -22.915 1.00 43.04  ? 839  TYR C N     1 
ATOM   7616  C CA    . TYR E 4 39  ? 70.449  39.577 -23.853 1.00 38.77  ? 839  TYR C CA    1 
ATOM   7617  C C     . TYR E 4 39  ? 71.701  39.978 -23.100 1.00 38.01  ? 839  TYR C C     1 
ATOM   7618  O O     . TYR E 4 39  ? 72.784  40.035 -23.674 1.00 37.79  ? 839  TYR C O     1 
ATOM   7619  C CB    . TYR E 4 39  ? 70.018  40.707 -24.790 1.00 28.01  ? 839  TYR C CB    1 
ATOM   7620  C CG    . TYR E 4 39  ? 68.764  40.438 -25.597 1.00 28.87  ? 839  TYR C CG    1 
ATOM   7621  C CD1   . TYR E 4 39  ? 67.509  40.699 -25.061 1.00 27.02  ? 839  TYR C CD1   1 
ATOM   7622  C CD2   . TYR E 4 39  ? 68.836  39.936 -26.892 1.00 27.79  ? 839  TYR C CD2   1 
ATOM   7623  C CE1   . TYR E 4 39  ? 66.354  40.471 -25.791 1.00 28.72  ? 839  TYR C CE1   1 
ATOM   7624  C CE2   . TYR E 4 39  ? 67.692  39.698 -27.632 1.00 29.71  ? 839  TYR C CE2   1 
ATOM   7625  C CZ    . TYR E 4 39  ? 66.448  39.965 -27.077 1.00 31.29  ? 839  TYR C CZ    1 
ATOM   7626  O OH    . TYR E 4 39  ? 65.284  39.697 -27.777 1.00 33.98  ? 839  TYR C OH    1 
ATOM   7627  N N     . ALA E 4 40  ? 71.539  40.269 -21.816 1.00 30.02  ? 840  ALA C N     1 
ATOM   7628  C CA    . ALA E 4 40  ? 72.657  40.624 -20.945 1.00 32.70  ? 840  ALA C CA    1 
ATOM   7629  C C     . ALA E 4 40  ? 72.176  40.631 -19.492 1.00 34.21  ? 840  ALA C C     1 
ATOM   7630  O O     . ALA E 4 40  ? 70.967  40.616 -19.222 1.00 34.05  ? 840  ALA C O     1 
ATOM   7631  C CB    . ALA E 4 40  ? 73.224  41.978 -21.322 1.00 33.98  ? 840  ALA C CB    1 
ATOM   7632  N N     . GLU E 4 41  ? 73.112  40.646 -18.554 1.00 38.46  ? 841  GLU C N     1 
ATOM   7633  C CA    . GLU E 4 41  ? 72.735  40.649 -17.151 1.00 41.35  ? 841  GLU C CA    1 
ATOM   7634  C C     . GLU E 4 41  ? 71.862  41.859 -16.818 1.00 40.11  ? 841  GLU C C     1 
ATOM   7635  O O     . GLU E 4 41  ? 70.834  41.752 -16.134 1.00 40.22  ? 841  GLU C O     1 
ATOM   7636  C CB    . GLU E 4 41  ? 73.991  40.647 -16.275 1.00 66.45  ? 841  GLU C CB    1 
ATOM   7637  C CG    . GLU E 4 41  ? 74.823  39.384 -16.400 1.00 74.64  ? 841  GLU C CG    1 
ATOM   7638  C CD    . GLU E 4 41  ? 74.106  38.163 -15.844 1.00 79.56  ? 841  GLU C CD    1 
ATOM   7639  O OE1   . GLU E 4 41  ? 73.949  38.084 -14.607 1.00 79.84  ? 841  GLU C OE1   1 
ATOM   7640  O OE2   . GLU E 4 41  ? 73.692  37.289 -16.643 1.00 81.79  ? 841  GLU C OE2   1 
ATOM   7641  N N     . ARG E 4 42  ? 72.269  43.020 -17.310 1.00 40.13  ? 842  ARG C N     1 
ATOM   7642  C CA    . ARG E 4 42  ? 71.517  44.224 -17.025 1.00 39.64  ? 842  ARG C CA    1 
ATOM   7643  C C     . ARG E 4 42  ? 71.231  45.043 -18.270 1.00 38.16  ? 842  ARG C C     1 
ATOM   7644  O O     . ARG E 4 42  ? 71.853  44.838 -19.322 1.00 36.55  ? 842  ARG C O     1 
ATOM   7645  C CB    . ARG E 4 42  ? 72.271  45.088 -16.002 1.00 60.65  ? 842  ARG C CB    1 
ATOM   7646  C CG    . ARG E 4 42  ? 73.601  44.517 -15.541 1.00 66.07  ? 842  ARG C CG    1 
ATOM   7647  C CD    . ARG E 4 42  ? 74.309  45.440 -14.564 1.00 68.74  ? 842  ARG C CD    1 
ATOM   7648  N NE    . ARG E 4 42  ? 73.441  45.779 -13.445 1.00 75.61  ? 842  ARG C NE    1 
ATOM   7649  C CZ    . ARG E 4 42  ? 73.823  46.473 -12.379 1.00 76.99  ? 842  ARG C CZ    1 
ATOM   7650  N NH1   . ARG E 4 42  ? 75.075  46.902 -12.284 1.00 77.20  ? 842  ARG C NH1   1 
ATOM   7651  N NH2   . ARG E 4 42  ? 72.947  46.749 -11.418 1.00 78.51  ? 842  ARG C NH2   1 
ATOM   7652  N N     . VAL E 4 43  ? 70.274  45.962 -18.124 1.00 31.13  ? 843  VAL C N     1 
ATOM   7653  C CA    . VAL E 4 43  ? 69.881  46.872 -19.186 1.00 29.92  ? 843  VAL C CA    1 
ATOM   7654  C C     . VAL E 4 43  ? 69.754  48.277 -18.662 1.00 29.87  ? 843  VAL C C     1 
ATOM   7655  O O     . VAL E 4 43  ? 68.866  48.572 -17.874 1.00 30.15  ? 843  VAL C O     1 
ATOM   7656  C CB    . VAL E 4 43  ? 68.539  46.523 -19.773 1.00 19.93  ? 843  VAL C CB    1 
ATOM   7657  C CG1   . VAL E 4 43  ? 68.255  47.456 -20.908 1.00 17.55  ? 843  VAL C CG1   1 
ATOM   7658  C CG2   . VAL E 4 43  ? 68.527  45.091 -20.244 1.00 22.03  ? 843  VAL C CG2   1 
ATOM   7659  N N     . GLY E 4 44  ? 70.638  49.150 -19.104 1.00 30.70  ? 844  GLY C N     1 
ATOM   7660  C CA    . GLY E 4 44  ? 70.558  50.530 -18.659 1.00 30.84  ? 844  GLY C CA    1 
ATOM   7661  C C     . GLY E 4 44  ? 69.346  51.249 -19.229 1.00 30.65  ? 844  GLY C C     1 
ATOM   7662  O O     . GLY E 4 44  ? 68.854  50.888 -20.300 1.00 29.25  ? 844  GLY C O     1 
ATOM   7663  N N     . ALA E 4 45  ? 68.867  52.269 -18.519 1.00 40.71  ? 845  ALA C N     1 
ATOM   7664  C CA    . ALA E 4 45  ? 67.693  53.041 -18.941 1.00 39.55  ? 845  ALA C CA    1 
ATOM   7665  C C     . ALA E 4 45  ? 67.818  53.691 -20.322 1.00 36.26  ? 845  ALA C C     1 
ATOM   7666  O O     . ALA E 4 45  ? 66.815  54.063 -20.924 1.00 38.40  ? 845  ALA C O     1 
ATOM   7667  C CB    . ALA E 4 45  ? 67.368  54.105 -17.897 1.00 26.77  ? 845  ALA C CB    1 
ATOM   7668  N N     . GLY E 4 46  ? 69.047  53.821 -20.813 1.00 41.67  ? 846  GLY C N     1 
ATOM   7669  C CA    . GLY E 4 46  ? 69.243  54.417 -22.112 1.00 43.59  ? 846  GLY C CA    1 
ATOM   7670  C C     . GLY E 4 46  ? 68.770  53.506 -23.233 1.00 42.56  ? 846  GLY C C     1 
ATOM   7671  O O     . GLY E 4 46  ? 67.965  53.901 -24.076 1.00 43.87  ? 846  GLY C O     1 
ATOM   7672  N N     . ALA E 4 47  ? 69.269  52.277 -23.236 1.00 38.67  ? 847  ALA C N     1 
ATOM   7673  C CA    . ALA E 4 47  ? 68.931  51.303 -24.261 1.00 38.17  ? 847  ALA C CA    1 
ATOM   7674  C C     . ALA E 4 47  ? 67.483  51.307 -24.718 1.00 36.04  ? 847  ALA C C     1 
ATOM   7675  O O     . ALA E 4 47  ? 67.215  51.540 -25.885 1.00 38.04  ? 847  ALA C O     1 
ATOM   7676  C CB    . ALA E 4 47  ? 69.324  49.897 -23.800 1.00 40.23  ? 847  ALA C CB    1 
ATOM   7677  N N     . PRO E 4 48  ? 66.528  51.056 -23.809 1.00 30.83  ? 848  PRO C N     1 
ATOM   7678  C CA    . PRO E 4 48  ? 65.103  51.027 -24.161 1.00 31.27  ? 848  PRO C CA    1 
ATOM   7679  C C     . PRO E 4 48  ? 64.580  52.316 -24.802 1.00 32.99  ? 848  PRO C C     1 
ATOM   7680  O O     . PRO E 4 48  ? 63.774  52.280 -25.740 1.00 31.70  ? 848  PRO C O     1 
ATOM   7681  C CB    . PRO E 4 48  ? 64.438  50.710 -22.831 1.00 20.20  ? 848  PRO C CB    1 
ATOM   7682  C CG    . PRO E 4 48  ? 65.335  51.411 -21.873 1.00 21.02  ? 848  PRO C CG    1 
ATOM   7683  C CD    . PRO E 4 48  ? 66.696  50.996 -22.349 1.00 20.09  ? 848  PRO C CD    1 
ATOM   7684  N N     . VAL E 4 49  ? 65.029  53.451 -24.284 1.00 25.01  ? 849  VAL C N     1 
ATOM   7685  C CA    . VAL E 4 49  ? 64.638  54.730 -24.836 1.00 24.60  ? 849  VAL C CA    1 
ATOM   7686  C C     . VAL E 4 49  ? 65.149  54.794 -26.261 1.00 24.19  ? 849  VAL C C     1 
ATOM   7687  O O     . VAL E 4 49  ? 64.403  55.094 -27.185 1.00 26.06  ? 849  VAL C O     1 
ATOM   7688  C CB    . VAL E 4 49  ? 65.258  55.882 -24.037 1.00 25.33  ? 849  VAL C CB    1 
ATOM   7689  C CG1   . VAL E 4 49  ? 65.207  57.191 -24.841 1.00 24.89  ? 849  VAL C CG1   1 
ATOM   7690  C CG2   . VAL E 4 49  ? 64.507  56.028 -22.715 1.00 25.72  ? 849  VAL C CG2   1 
ATOM   7691  N N     . TYR E 4 50  ? 66.433  54.501 -26.432 1.00 26.13  ? 850  TYR C N     1 
ATOM   7692  C CA    . TYR E 4 50  ? 67.088  54.522 -27.742 1.00 28.01  ? 850  TYR C CA    1 
ATOM   7693  C C     . TYR E 4 50  ? 66.489  53.529 -28.727 1.00 29.67  ? 850  TYR C C     1 
ATOM   7694  O O     . TYR E 4 50  ? 66.277  53.840 -29.898 1.00 30.46  ? 850  TYR C O     1 
ATOM   7695  C CB    . TYR E 4 50  ? 68.579  54.218 -27.565 1.00 26.85  ? 850  TYR C CB    1 
ATOM   7696  C CG    . TYR E 4 50  ? 69.455  54.656 -28.718 1.00 29.58  ? 850  TYR C CG    1 
ATOM   7697  C CD1   . TYR E 4 50  ? 70.521  55.530 -28.502 1.00 29.46  ? 850  TYR C CD1   1 
ATOM   7698  C CD2   . TYR E 4 50  ? 69.237  54.200 -30.008 1.00 30.55  ? 850  TYR C CD2   1 
ATOM   7699  C CE1   . TYR E 4 50  ? 71.353  55.941 -29.539 1.00 33.34  ? 850  TYR C CE1   1 
ATOM   7700  C CE2   . TYR E 4 50  ? 70.067  54.607 -31.047 1.00 28.72  ? 850  TYR C CE2   1 
ATOM   7701  C CZ    . TYR E 4 50  ? 71.123  55.477 -30.799 1.00 32.78  ? 850  TYR C CZ    1 
ATOM   7702  O OH    . TYR E 4 50  ? 71.957  55.882 -31.800 1.00 32.00  ? 850  TYR C OH    1 
ATOM   7703  N N     . LEU E 4 51  ? 66.232  52.327 -28.241 1.00 25.83  ? 851  LEU C N     1 
ATOM   7704  C CA    . LEU E 4 51  ? 65.686  51.281 -29.073 1.00 24.85  ? 851  LEU C CA    1 
ATOM   7705  C C     . LEU E 4 51  ? 64.225  51.516 -29.463 1.00 26.13  ? 851  LEU C C     1 
ATOM   7706  O O     . LEU E 4 51  ? 63.802  51.132 -30.548 1.00 25.62  ? 851  LEU C O     1 
ATOM   7707  C CB    . LEU E 4 51  ? 65.858  49.929 -28.376 1.00 22.29  ? 851  LEU C CB    1 
ATOM   7708  C CG    . LEU E 4 51  ? 65.284  48.674 -29.045 1.00 21.09  ? 851  LEU C CG    1 
ATOM   7709  C CD1   . LEU E 4 51  ? 65.875  48.435 -30.455 1.00 18.59  ? 851  LEU C CD1   1 
ATOM   7710  C CD2   . LEU E 4 51  ? 65.575  47.514 -28.101 1.00 18.98  ? 851  LEU C CD2   1 
ATOM   7711  N N     . ALA E 4 52  ? 63.441  52.131 -28.594 1.00 32.06  ? 852  ALA C N     1 
ATOM   7712  C CA    . ALA E 4 52  ? 62.064  52.387 -28.976 1.00 31.23  ? 852  ALA C CA    1 
ATOM   7713  C C     . ALA E 4 52  ? 62.084  53.474 -30.070 1.00 29.73  ? 852  ALA C C     1 
ATOM   7714  O O     . ALA E 4 52  ? 61.282  53.459 -31.021 1.00 29.05  ? 852  ALA C O     1 
ATOM   7715  C CB    . ALA E 4 52  ? 61.257  52.847 -27.773 1.00 8.84   ? 852  ALA C CB    1 
ATOM   7716  N N     . ALA E 4 53  ? 63.022  54.408 -29.934 1.00 29.52  ? 853  ALA C N     1 
ATOM   7717  C CA    . ALA E 4 53  ? 63.147  55.477 -30.896 1.00 29.08  ? 853  ALA C CA    1 
ATOM   7718  C C     . ALA E 4 53  ? 63.445  54.885 -32.266 1.00 29.29  ? 853  ALA C C     1 
ATOM   7719  O O     . ALA E 4 53  ? 62.734  55.166 -33.219 1.00 27.46  ? 853  ALA C O     1 
ATOM   7720  C CB    . ALA E 4 53  ? 64.249  56.426 -30.479 1.00 52.95  ? 853  ALA C CB    1 
ATOM   7721  N N     . VAL E 4 54  ? 64.492  54.064 -32.357 1.00 23.96  ? 854  VAL C N     1 
ATOM   7722  C CA    . VAL E 4 54  ? 64.884  53.434 -33.616 1.00 24.92  ? 854  VAL C CA    1 
ATOM   7723  C C     . VAL E 4 54  ? 63.707  52.647 -34.204 1.00 26.29  ? 854  VAL C C     1 
ATOM   7724  O O     . VAL E 4 54  ? 63.384  52.745 -35.401 1.00 26.07  ? 854  VAL C O     1 
ATOM   7725  C CB    . VAL E 4 54  ? 66.128  52.520 -33.370 1.00 25.05  ? 854  VAL C CB    1 
ATOM   7726  C CG1   . VAL E 4 54  ? 66.470  51.644 -34.574 1.00 25.79  ? 854  VAL C CG1   1 
ATOM   7727  C CG2   . VAL E 4 54  ? 67.308  53.409 -33.070 1.00 23.35  ? 854  VAL C CG2   1 
ATOM   7728  N N     . LEU E 4 55  ? 63.053  51.878 -33.350 1.00 33.65  ? 855  LEU C N     1 
ATOM   7729  C CA    . LEU E 4 55  ? 61.919  51.103 -33.789 1.00 34.50  ? 855  LEU C CA    1 
ATOM   7730  C C     . LEU E 4 55  ? 60.884  52.037 -34.384 1.00 36.85  ? 855  LEU C C     1 
ATOM   7731  O O     . LEU E 4 55  ? 60.445  51.842 -35.512 1.00 35.05  ? 855  LEU C O     1 
ATOM   7732  C CB    . LEU E 4 55  ? 61.340  50.324 -32.615 1.00 14.78  ? 855  LEU C CB    1 
ATOM   7733  C CG    . LEU E 4 55  ? 62.238  49.152 -32.169 1.00 12.57  ? 855  LEU C CG    1 
ATOM   7734  C CD1   . LEU E 4 55  ? 61.713  48.582 -30.845 1.00 14.28  ? 855  LEU C CD1   1 
ATOM   7735  C CD2   . LEU E 4 55  ? 62.302  48.056 -33.251 1.00 13.68  ? 855  LEU C CD2   1 
ATOM   7736  N N     . GLU E 4 56  ? 60.516  53.069 -33.637 1.00 37.76  ? 856  GLU C N     1 
ATOM   7737  C CA    . GLU E 4 56  ? 59.528  54.031 -34.108 1.00 38.34  ? 856  GLU C CA    1 
ATOM   7738  C C     . GLU E 4 56  ? 59.923  54.713 -35.420 1.00 35.58  ? 856  GLU C C     1 
ATOM   7739  O O     . GLU E 4 56  ? 59.122  54.831 -36.339 1.00 36.57  ? 856  GLU C O     1 
ATOM   7740  C CB    . GLU E 4 56  ? 59.301  55.093 -33.046 1.00 43.45  ? 856  GLU C CB    1 
ATOM   7741  C CG    . GLU E 4 56  ? 58.083  55.939 -33.298 1.00 44.03  ? 856  GLU C CG    1 
ATOM   7742  C CD    . GLU E 4 56  ? 57.933  57.043 -32.269 1.00 48.23  ? 856  GLU C CD    1 
ATOM   7743  O OE1   . GLU E 4 56  ? 58.254  56.805 -31.072 1.00 47.29  ? 856  GLU C OE1   1 
ATOM   7744  O OE2   . GLU E 4 56  ? 57.477  58.146 -32.654 1.00 42.78  ? 856  GLU C OE2   1 
ATOM   7745  N N     . TYR E 4 57  ? 61.161  55.177 -35.498 1.00 20.56  ? 857  TYR C N     1 
ATOM   7746  C CA    . TYR E 4 57  ? 61.646  55.852 -36.681 1.00 20.85  ? 857  TYR C CA    1 
ATOM   7747  C C     . TYR E 4 57  ? 61.430  54.981 -37.879 1.00 22.31  ? 857  TYR C C     1 
ATOM   7748  O O     . TYR E 4 57  ? 60.923  55.463 -38.895 1.00 21.33  ? 857  TYR C O     1 
ATOM   7749  C CB    . TYR E 4 57  ? 63.132  56.156 -36.545 1.00 39.00  ? 857  TYR C CB    1 
ATOM   7750  C CG    . TYR E 4 57  ? 63.847  56.392 -37.854 1.00 40.57  ? 857  TYR C CG    1 
ATOM   7751  C CD1   . TYR E 4 57  ? 63.484  57.433 -38.691 1.00 45.54  ? 857  TYR C CD1   1 
ATOM   7752  C CD2   . TYR E 4 57  ? 64.888  55.571 -38.249 1.00 44.06  ? 857  TYR C CD2   1 
ATOM   7753  C CE1   . TYR E 4 57  ? 64.135  57.653 -39.883 1.00 45.73  ? 857  TYR C CE1   1 
ATOM   7754  C CE2   . TYR E 4 57  ? 65.545  55.777 -39.431 1.00 44.19  ? 857  TYR C CE2   1 
ATOM   7755  C CZ    . TYR E 4 57  ? 65.166  56.819 -40.251 1.00 46.21  ? 857  TYR C CZ    1 
ATOM   7756  O OH    . TYR E 4 57  ? 65.809  57.012 -41.458 1.00 47.77  ? 857  TYR C OH    1 
ATOM   7757  N N     . LEU E 4 58  ? 61.806  53.699 -37.758 1.00 22.09  ? 858  LEU C N     1 
ATOM   7758  C CA    . LEU E 4 58  ? 61.685  52.738 -38.863 1.00 23.56  ? 858  LEU C CA    1 
ATOM   7759  C C     . LEU E 4 58  ? 60.278  52.441 -39.350 1.00 21.45  ? 858  LEU C C     1 
ATOM   7760  O O     . LEU E 4 58  ? 60.051  52.354 -40.560 1.00 25.07  ? 858  LEU C O     1 
ATOM   7761  C CB    . LEU E 4 58  ? 62.365  51.415 -38.515 1.00 16.09  ? 858  LEU C CB    1 
ATOM   7762  C CG    . LEU E 4 58  ? 63.894  51.446 -38.444 1.00 17.25  ? 858  LEU C CG    1 
ATOM   7763  C CD1   . LEU E 4 58  ? 64.441  50.093 -37.942 1.00 17.73  ? 858  LEU C CD1   1 
ATOM   7764  C CD2   . LEU E 4 58  ? 64.441  51.860 -39.842 1.00 17.38  ? 858  LEU C CD2   1 
ATOM   7765  N N     . THR E 4 59  ? 59.341  52.280 -38.422 1.00 14.49  ? 859  THR C N     1 
ATOM   7766  C CA    . THR E 4 59  ? 57.971  51.992 -38.791 1.00 17.80  ? 859  THR C CA    1 
ATOM   7767  C C     . THR E 4 59  ? 57.429  53.202 -39.551 1.00 17.94  ? 859  THR C C     1 
ATOM   7768  O O     . THR E 4 59  ? 56.628  53.069 -40.475 1.00 19.11  ? 859  THR C O     1 
ATOM   7769  C CB    . THR E 4 59  ? 57.092  51.777 -37.571 1.00 10.02  ? 859  THR C CB    1 
ATOM   7770  O OG1   . THR E 4 59  ? 56.632  53.045 -37.155 1.00 23.47  ? 859  THR C OG1   1 
ATOM   7771  C CG2   . THR E 4 59  ? 57.857  51.150 -36.408 1.00 2.61   ? 859  THR C CG2   1 
ATOM   7772  N N     . ALA E 4 60  ? 57.878  54.386 -39.168 1.00 21.45  ? 860  ALA C N     1 
ATOM   7773  C CA    . ALA E 4 60  ? 57.431  55.616 -39.831 1.00 20.67  ? 860  ALA C CA    1 
ATOM   7774  C C     . ALA E 4 60  ? 57.877  55.667 -41.291 1.00 19.18  ? 860  ALA C C     1 
ATOM   7775  O O     . ALA E 4 60  ? 57.101  55.987 -42.187 1.00 19.33  ? 860  ALA C O     1 
ATOM   7776  C CB    . ALA E 4 60  ? 57.976  56.837 -39.086 1.00 28.50  ? 860  ALA C CB    1 
ATOM   7777  N N     . GLU E 4 61  ? 59.146  55.352 -41.506 1.00 21.16  ? 861  GLU C N     1 
ATOM   7778  C CA    . GLU E 4 61  ? 59.749  55.352 -42.821 1.00 23.39  ? 861  GLU C CA    1 
ATOM   7779  C C     . GLU E 4 61  ? 59.004  54.393 -43.743 1.00 23.78  ? 861  GLU C C     1 
ATOM   7780  O O     . GLU E 4 61  ? 58.691  54.721 -44.897 1.00 19.57  ? 861  GLU C O     1 
ATOM   7781  C CB    . GLU E 4 61  ? 61.212  54.932 -42.681 1.00 51.72  ? 861  GLU C CB    1 
ATOM   7782  C CG    . GLU E 4 61  ? 62.045  55.135 -43.902 1.00 60.32  ? 861  GLU C CG    1 
ATOM   7783  C CD    . GLU E 4 61  ? 62.025  56.567 -44.353 1.00 67.45  ? 861  GLU C CD    1 
ATOM   7784  O OE1   . GLU E 4 61  ? 62.439  57.445 -43.557 1.00 72.69  ? 861  GLU C OE1   1 
ATOM   7785  O OE2   . GLU E 4 61  ? 61.591  56.814 -45.499 1.00 70.90  ? 861  GLU C OE2   1 
ATOM   7786  N N     . ILE E 4 62  ? 58.720  53.197 -43.244 1.00 32.06  ? 862  ILE C N     1 
ATOM   7787  C CA    . ILE E 4 62  ? 58.029  52.239 -44.077 1.00 30.80  ? 862  ILE C CA    1 
ATOM   7788  C C     . ILE E 4 62  ? 56.562  52.636 -44.272 1.00 29.05  ? 862  ILE C C     1 
ATOM   7789  O O     . ILE E 4 62  ? 56.036  52.492 -45.383 1.00 29.92  ? 862  ILE C O     1 
ATOM   7790  C CB    . ILE E 4 62  ? 58.148  50.824 -43.514 1.00 24.33  ? 862  ILE C CB    1 
ATOM   7791  C CG1   . ILE E 4 62  ? 57.737  49.811 -44.563 1.00 26.97  ? 862  ILE C CG1   1 
ATOM   7792  C CG2   . ILE E 4 62  ? 57.219  50.648 -42.341 1.00 25.33  ? 862  ILE C CG2   1 
ATOM   7793  C CD1   . ILE E 4 62  ? 57.874  48.394 -44.073 1.00 32.29  ? 862  ILE C CD1   1 
ATOM   7794  N N     . LEU E 4 63  ? 55.899  53.142 -43.224 1.00 17.03  ? 863  LEU C N     1 
ATOM   7795  C CA    . LEU E 4 63  ? 54.503  53.596 -43.363 1.00 19.57  ? 863  LEU C CA    1 
ATOM   7796  C C     . LEU E 4 63  ? 54.377  54.796 -44.344 1.00 20.41  ? 863  LEU C C     1 
ATOM   7797  O O     . LEU E 4 63  ? 53.402  54.913 -45.103 1.00 20.51  ? 863  LEU C O     1 
ATOM   7798  C CB    . LEU E 4 63  ? 53.919  53.973 -42.002 1.00 6.09   ? 863  LEU C CB    1 
ATOM   7799  C CG    . LEU E 4 63  ? 53.426  52.794 -41.153 1.00 7.20   ? 863  LEU C CG    1 
ATOM   7800  C CD1   . LEU E 4 63  ? 52.960  53.329 -39.855 1.00 6.81   ? 863  LEU C CD1   1 
ATOM   7801  C CD2   . LEU E 4 63  ? 52.323  52.029 -41.833 1.00 9.13   ? 863  LEU C CD2   1 
ATOM   7802  N N     . GLU E 4 64  ? 55.360  55.693 -44.312 1.00 24.76  ? 864  GLU C N     1 
ATOM   7803  C CA    . GLU E 4 64  ? 55.369  56.807 -45.239 1.00 25.33  ? 864  GLU C CA    1 
ATOM   7804  C C     . GLU E 4 64  ? 55.348  56.182 -46.637 1.00 25.97  ? 864  GLU C C     1 
ATOM   7805  O O     . GLU E 4 64  ? 54.404  56.351 -47.392 1.00 22.89  ? 864  GLU C O     1 
ATOM   7806  C CB    . GLU E 4 64  ? 56.636  57.640 -45.068 1.00 42.07  ? 864  GLU C CB    1 
ATOM   7807  C CG    . GLU E 4 64  ? 56.800  58.745 -46.112 1.00 49.38  ? 864  GLU C CG    1 
ATOM   7808  C CD    . GLU E 4 64  ? 55.844  59.900 -45.892 1.00 51.17  ? 864  GLU C CD    1 
ATOM   7809  O OE1   . GLU E 4 64  ? 55.783  60.820 -46.732 1.00 58.78  ? 864  GLU C OE1   1 
ATOM   7810  O OE2   . GLU E 4 64  ? 55.151  59.886 -44.864 1.00 54.85  ? 864  GLU C OE2   1 
ATOM   7811  N N     . LEU E 4 65  ? 56.379  55.417 -46.962 1.00 23.61  ? 865  LEU C N     1 
ATOM   7812  C CA    . LEU E 4 65  ? 56.468  54.781 -48.267 1.00 25.84  ? 865  LEU C CA    1 
ATOM   7813  C C     . LEU E 4 65  ? 55.261  53.925 -48.690 1.00 21.64  ? 865  LEU C C     1 
ATOM   7814  O O     . LEU E 4 65  ? 54.870  53.923 -49.875 1.00 23.14  ? 865  LEU C O     1 
ATOM   7815  C CB    . LEU E 4 65  ? 57.763  53.966 -48.337 1.00 34.23  ? 865  LEU C CB    1 
ATOM   7816  C CG    . LEU E 4 65  ? 59.007  54.863 -48.331 1.00 36.01  ? 865  LEU C CG    1 
ATOM   7817  C CD1   . LEU E 4 65  ? 60.292  54.045 -48.408 1.00 30.94  ? 865  LEU C CD1   1 
ATOM   7818  C CD2   . LEU E 4 65  ? 58.892  55.821 -49.506 1.00 38.42  ? 865  LEU C CD2   1 
ATOM   7819  N N     . ALA E 4 66  ? 54.675  53.203 -47.734 1.00 25.13  ? 866  ALA C N     1 
ATOM   7820  C CA    . ALA E 4 66  ? 53.509  52.364 -48.022 1.00 28.89  ? 866  ALA C CA    1 
ATOM   7821  C C     . ALA E 4 66  ? 52.320  53.265 -48.296 1.00 27.04  ? 866  ALA C C     1 
ATOM   7822  O O     . ALA E 4 66  ? 51.610  53.128 -49.310 1.00 27.84  ? 866  ALA C O     1 
ATOM   7823  C CB    . ALA E 4 66  ? 53.213  51.481 -46.857 1.00 33.47  ? 866  ALA C CB    1 
ATOM   7824  N N     . GLY E 4 67  ? 52.114  54.202 -47.385 1.00 22.50  ? 867  GLY C N     1 
ATOM   7825  C CA    . GLY E 4 67  ? 51.024  55.127 -47.555 1.00 18.60  ? 867  GLY C CA    1 
ATOM   7826  C C     . GLY E 4 67  ? 50.982  55.722 -48.953 1.00 19.42  ? 867  GLY C C     1 
ATOM   7827  O O     . GLY E 4 67  ? 49.900  55.932 -49.510 1.00 19.27  ? 867  GLY C O     1 
ATOM   7828  N N     . ASN E 4 68  ? 52.146  56.000 -49.538 1.00 13.59  ? 868  ASN C N     1 
ATOM   7829  C CA    . ASN E 4 68  ? 52.161  56.591 -50.888 1.00 14.53  ? 868  ASN C CA    1 
ATOM   7830  C C     . ASN E 4 68  ? 51.728  55.574 -51.916 1.00 18.63  ? 868  ASN C C     1 
ATOM   7831  O O     . ASN E 4 68  ? 50.982  55.885 -52.838 1.00 18.46  ? 868  ASN C O     1 
ATOM   7832  C CB    . ASN E 4 68  ? 53.543  57.130 -51.263 1.00 31.24  ? 868  ASN C CB    1 
ATOM   7833  C CG    . ASN E 4 68  ? 53.997  58.270 -50.363 1.00 33.01  ? 868  ASN C CG    1 
ATOM   7834  O OD1   . ASN E 4 68  ? 53.190  59.059 -49.870 1.00 33.86  ? 868  ASN C OD1   1 
ATOM   7835  N ND2   . ASN E 4 68  ? 55.299  58.374 -50.167 1.00 33.78  ? 868  ASN C ND2   1 
ATOM   7836  N N     . ALA E 4 69  ? 52.190  54.344 -51.733 1.00 22.03  ? 869  ALA C N     1 
ATOM   7837  C CA    . ALA E 4 69  ? 51.848  53.306 -52.656 1.00 24.99  ? 869  ALA C CA    1 
ATOM   7838  C C     . ALA E 4 69  ? 50.347  53.139 -52.621 1.00 25.42  ? 869  ALA C C     1 
ATOM   7839  O O     . ALA E 4 69  ? 49.715  52.967 -53.655 1.00 26.29  ? 869  ALA C O     1 
ATOM   7840  C CB    . ALA E 4 69  ? 52.527  52.051 -52.267 1.00 16.78  ? 869  ALA C CB    1 
ATOM   7841  N N     . ALA E 4 70  ? 49.756  53.196 -51.438 1.00 26.18  ? 870  ALA C N     1 
ATOM   7842  C CA    . ALA E 4 70  ? 48.318  53.039 -51.396 1.00 28.66  ? 870  ALA C CA    1 
ATOM   7843  C C     . ALA E 4 70  ? 47.742  54.131 -52.272 1.00 29.80  ? 870  ALA C C     1 
ATOM   7844  O O     . ALA E 4 70  ? 46.973  53.862 -53.189 1.00 29.02  ? 870  ALA C O     1 
ATOM   7845  C CB    . ALA E 4 70  ? 47.814  53.179 -50.001 1.00 11.56  ? 870  ALA C CB    1 
ATOM   7846  N N     . ARG E 4 71  ? 48.132  55.370 -51.988 1.00 31.43  ? 871  ARG C N     1 
ATOM   7847  C CA    . ARG E 4 71  ? 47.676  56.515 -52.754 1.00 33.41  ? 871  ARG C CA    1 
ATOM   7848  C C     . ARG E 4 71  ? 47.876  56.298 -54.250 1.00 31.26  ? 871  ARG C C     1 
ATOM   7849  O O     . ARG E 4 71  ? 46.974  56.527 -55.045 1.00 29.25  ? 871  ARG C O     1 
ATOM   7850  C CB    . ARG E 4 71  ? 48.441  57.756 -52.315 1.00 54.80  ? 871  ARG C CB    1 
ATOM   7851  C CG    . ARG E 4 71  ? 48.282  58.935 -53.238 1.00 65.76  ? 871  ARG C CG    1 
ATOM   7852  C CD    . ARG E 4 71  ? 48.899  60.185 -52.652 1.00 72.72  ? 871  ARG C CD    1 
ATOM   7853  N NE    . ARG E 4 71  ? 48.168  60.651 -51.474 1.00 81.32  ? 871  ARG C NE    1 
ATOM   7854  C CZ    . ARG E 4 71  ? 48.244  61.885 -50.977 1.00 85.23  ? 871  ARG C CZ    1 
ATOM   7855  N NH1   . ARG E 4 71  ? 49.019  62.801 -51.555 1.00 86.38  ? 871  ARG C NH1   1 
ATOM   7856  N NH2   . ARG E 4 71  ? 47.546  62.207 -49.894 1.00 88.32  ? 871  ARG C NH2   1 
ATOM   7857  N N     . ASP E 4 72  ? 49.064  55.859 -54.642 1.00 28.77  ? 872  ASP C N     1 
ATOM   7858  C CA    . ASP E 4 72  ? 49.327  55.644 -56.048 1.00 30.45  ? 872  ASP C CA    1 
ATOM   7859  C C     . ASP E 4 72  ? 48.350  54.685 -56.680 1.00 32.88  ? 872  ASP C C     1 
ATOM   7860  O O     . ASP E 4 72  ? 47.980  54.858 -57.818 1.00 33.15  ? 872  ASP C O     1 
ATOM   7861  C CB    . ASP E 4 72  ? 50.733  55.099 -56.268 1.00 56.72  ? 872  ASP C CB    1 
ATOM   7862  C CG    . ASP E 4 72  ? 51.798  56.132 -56.050 1.00 58.13  ? 872  ASP C CG    1 
ATOM   7863  O OD1   . ASP E 4 72  ? 51.583  57.308 -56.422 1.00 56.37  ? 872  ASP C OD1   1 
ATOM   7864  O OD2   . ASP E 4 72  ? 52.863  55.755 -55.519 1.00 61.30  ? 872  ASP C OD2   1 
ATOM   7865  N N     . ASN E 4 73  ? 47.947  53.660 -55.953 1.00 38.13  ? 873  ASN C N     1 
ATOM   7866  C CA    . ASN E 4 73  ? 47.031  52.676 -56.508 1.00 40.71  ? 873  ASN C CA    1 
ATOM   7867  C C     . ASN E 4 73  ? 45.611  53.057 -56.184 1.00 40.86  ? 873  ASN C C     1 
ATOM   7868  O O     . ASN E 4 73  ? 44.712  52.218 -56.139 1.00 39.19  ? 873  ASN C O     1 
ATOM   7869  C CB    . ASN E 4 73  ? 47.348  51.287 -55.957 1.00 55.87  ? 873  ASN C CB    1 
ATOM   7870  C CG    . ASN E 4 73  ? 48.750  50.841 -56.300 1.00 60.57  ? 873  ASN C CG    1 
ATOM   7871  O OD1   . ASN E 4 73  ? 48.942  49.962 -57.129 1.00 64.52  ? 873  ASN C OD1   1 
ATOM   7872  N ND2   . ASN E 4 73  ? 49.741  51.461 -55.676 1.00 59.88  ? 873  ASN C ND2   1 
ATOM   7873  N N     . LYS E 4 74  ? 45.433  54.340 -55.937 1.00 32.13  ? 874  LYS C N     1 
ATOM   7874  C CA    . LYS E 4 74  ? 44.133  54.911 -55.641 1.00 33.68  ? 874  LYS C CA    1 
ATOM   7875  C C     . LYS E 4 74  ? 43.336  54.310 -54.468 1.00 33.05  ? 874  LYS C C     1 
ATOM   7876  O O     . LYS E 4 74  ? 42.113  54.442 -54.403 1.00 33.93  ? 874  LYS C O     1 
ATOM   7877  C CB    . LYS E 4 74  ? 43.319  54.927 -56.938 1.00 61.86  ? 874  LYS C CB    1 
ATOM   7878  C CG    . LYS E 4 74  ? 44.051  55.687 -58.057 1.00 67.44  ? 874  LYS C CG    1 
ATOM   7879  C CD    . LYS E 4 74  ? 43.243  55.809 -59.340 1.00 71.88  ? 874  LYS C CD    1 
ATOM   7880  C CE    . LYS E 4 74  ? 44.037  56.524 -60.435 1.00 74.80  ? 874  LYS C CE    1 
ATOM   7881  N NZ    . LYS E 4 74  ? 43.242  56.750 -61.684 1.00 76.57  ? 874  LYS C NZ    1 
ATOM   7882  N N     . LYS E 4 75  ? 44.041  53.704 -53.513 1.00 53.75  ? 875  LYS C N     1 
ATOM   7883  C CA    . LYS E 4 75  ? 43.398  53.096 -52.352 1.00 50.82  ? 875  LYS C CA    1 
ATOM   7884  C C     . LYS E 4 75  ? 43.636  53.905 -51.076 1.00 49.40  ? 875  LYS C C     1 
ATOM   7885  O O     . LYS E 4 75  ? 44.593  54.678 -50.983 1.00 48.79  ? 875  LYS C O     1 
ATOM   7886  C CB    . LYS E 4 75  ? 43.927  51.682 -52.150 1.00 40.44  ? 875  LYS C CB    1 
ATOM   7887  C CG    . LYS E 4 75  ? 44.195  50.940 -53.420 1.00 42.59  ? 875  LYS C CG    1 
ATOM   7888  C CD    . LYS E 4 75  ? 42.939  50.464 -54.115 1.00 46.82  ? 875  LYS C CD    1 
ATOM   7889  C CE    . LYS E 4 75  ? 43.002  48.955 -54.345 1.00 51.33  ? 875  LYS C CE    1 
ATOM   7890  N NZ    . LYS E 4 75  ? 44.333  48.456 -54.858 1.00 54.47  ? 875  LYS C NZ    1 
ATOM   7891  N N     . THR E 4 76  ? 42.775  53.687 -50.085 1.00 32.64  ? 876  THR C N     1 
ATOM   7892  C CA    . THR E 4 76  ? 42.840  54.387 -48.810 1.00 35.23  ? 876  THR C CA    1 
ATOM   7893  C C     . THR E 4 76  ? 43.437  53.565 -47.700 1.00 33.08  ? 876  THR C C     1 
ATOM   7894  O O     . THR E 4 76  ? 44.084  54.103 -46.798 1.00 32.13  ? 876  THR C O     1 
ATOM   7895  C CB    . THR E 4 76  ? 41.435  54.798 -48.353 1.00 31.69  ? 876  THR C CB    1 
ATOM   7896  O OG1   . THR E 4 76  ? 41.152  56.083 -48.873 1.00 38.14  ? 876  THR C OG1   1 
ATOM   7897  C CG2   . THR E 4 76  ? 41.306  54.829 -46.819 1.00 35.55  ? 876  THR C CG2   1 
ATOM   7898  N N     . ARG E 4 77  ? 43.171  52.262 -47.738 1.00 42.82  ? 877  ARG C N     1 
ATOM   7899  C CA    . ARG E 4 77  ? 43.656  51.342 -46.721 1.00 42.86  ? 877  ARG C CA    1 
ATOM   7900  C C     . ARG E 4 77  ? 44.911  50.660 -47.235 1.00 40.63  ? 877  ARG C C     1 
ATOM   7901  O O     . ARG E 4 77  ? 44.916  50.100 -48.335 1.00 36.48  ? 877  ARG C O     1 
ATOM   7902  C CB    . ARG E 4 77  ? 42.579  50.303 -46.448 1.00 48.87  ? 877  ARG C CB    1 
ATOM   7903  C CG    . ARG E 4 77  ? 42.627  49.674 -45.088 1.00 53.28  ? 877  ARG C CG    1 
ATOM   7904  C CD    . ARG E 4 77  ? 41.496  48.679 -44.969 1.00 54.02  ? 877  ARG C CD    1 
ATOM   7905  N NE    . ARG E 4 77  ? 40.206  49.320 -45.172 1.00 54.77  ? 877  ARG C NE    1 
ATOM   7906  C CZ    . ARG E 4 77  ? 39.205  48.791 -45.870 1.00 57.33  ? 877  ARG C CZ    1 
ATOM   7907  N NH1   . ARG E 4 77  ? 39.344  47.605 -46.435 1.00 56.54  ? 877  ARG C NH1   1 
ATOM   7908  N NH2   . ARG E 4 77  ? 38.063  49.456 -46.015 1.00 58.14  ? 877  ARG C NH2   1 
ATOM   7909  N N     . ILE E 4 78  ? 45.978  50.729 -46.450 1.00 39.04  ? 878  ILE C N     1 
ATOM   7910  C CA    . ILE E 4 78  ? 47.249  50.104 -46.815 1.00 37.00  ? 878  ILE C CA    1 
ATOM   7911  C C     . ILE E 4 78  ? 47.087  48.594 -46.664 1.00 35.23  ? 878  ILE C C     1 
ATOM   7912  O O     . ILE E 4 78  ? 46.574  48.123 -45.641 1.00 33.64  ? 878  ILE C O     1 
ATOM   7913  C CB    . ILE E 4 78  ? 48.407  50.561 -45.864 1.00 30.24  ? 878  ILE C CB    1 
ATOM   7914  C CG1   . ILE E 4 78  ? 48.845  51.985 -46.207 1.00 29.84  ? 878  ILE C CG1   1 
ATOM   7915  C CG2   . ILE E 4 78  ? 49.584  49.582 -45.925 1.00 29.31  ? 878  ILE C CG2   1 
ATOM   7916  C CD1   . ILE E 4 78  ? 49.903  52.548 -45.262 1.00 25.50  ? 878  ILE C CD1   1 
ATOM   7917  N N     . ILE E 4 79  ? 47.503  47.841 -47.680 1.00 26.06  ? 879  ILE C N     1 
ATOM   7918  C CA    . ILE E 4 79  ? 47.432  46.389 -47.603 1.00 27.19  ? 879  ILE C CA    1 
ATOM   7919  C C     . ILE E 4 79  ? 48.840  45.818 -47.823 1.00 28.43  ? 879  ILE C C     1 
ATOM   7920  O O     . ILE E 4 79  ? 49.761  46.545 -48.175 1.00 25.36  ? 879  ILE C O     1 
ATOM   7921  C CB    . ILE E 4 79  ? 46.419  45.819 -48.643 1.00 15.75  ? 879  ILE C CB    1 
ATOM   7922  C CG1   . ILE E 4 79  ? 46.936  45.982 -50.081 1.00 15.79  ? 879  ILE C CG1   1 
ATOM   7923  C CG2   . ILE E 4 79  ? 45.059  46.521 -48.479 1.00 17.06  ? 879  ILE C CG2   1 
ATOM   7924  C CD1   . ILE E 4 79  ? 46.022  45.352 -51.094 1.00 14.03  ? 879  ILE C CD1   1 
ATOM   7925  N N     . PRO E 4 80  ? 49.032  44.512 -47.616 1.00 29.42  ? 880  PRO C N     1 
ATOM   7926  C CA    . PRO E 4 80  ? 50.361  43.935 -47.808 1.00 25.34  ? 880  PRO C CA    1 
ATOM   7927  C C     . PRO E 4 80  ? 51.085  44.304 -49.067 1.00 23.30  ? 880  PRO C C     1 
ATOM   7928  O O     . PRO E 4 80  ? 52.255  44.621 -49.003 1.00 25.32  ? 880  PRO C O     1 
ATOM   7929  C CB    . PRO E 4 80  ? 50.102  42.453 -47.686 1.00 19.32  ? 880  PRO C CB    1 
ATOM   7930  C CG    . PRO E 4 80  ? 49.142  42.441 -46.552 1.00 18.79  ? 880  PRO C CG    1 
ATOM   7931  C CD    . PRO E 4 80  ? 48.142  43.524 -47.000 1.00 18.49  ? 880  PRO C CD    1 
ATOM   7932  N N     . ARG E 4 81  ? 50.411  44.274 -50.210 1.00 19.33  ? 881  ARG C N     1 
ATOM   7933  C CA    . ARG E 4 81  ? 51.083  44.641 -51.454 1.00 22.71  ? 881  ARG C CA    1 
ATOM   7934  C C     . ARG E 4 81  ? 51.766  46.000 -51.336 1.00 22.19  ? 881  ARG C C     1 
ATOM   7935  O O     . ARG E 4 81  ? 52.899  46.179 -51.786 1.00 22.01  ? 881  ARG C O     1 
ATOM   7936  C CB    . ARG E 4 81  ? 50.100  44.676 -52.628 1.00 23.65  ? 881  ARG C CB    1 
ATOM   7937  C CG    . ARG E 4 81  ? 50.485  45.685 -53.659 1.00 27.81  ? 881  ARG C CG    1 
ATOM   7938  C CD    . ARG E 4 81  ? 50.697  45.134 -55.049 1.00 33.46  ? 881  ARG C CD    1 
ATOM   7939  N NE    . ARG E 4 81  ? 51.700  44.084 -55.124 1.00 35.34  ? 881  ARG C NE    1 
ATOM   7940  C CZ    . ARG E 4 81  ? 52.359  43.777 -56.239 1.00 33.04  ? 881  ARG C CZ    1 
ATOM   7941  N NH1   . ARG E 4 81  ? 52.121  44.453 -57.350 1.00 30.49  ? 881  ARG C NH1   1 
ATOM   7942  N NH2   . ARG E 4 81  ? 53.229  42.776 -56.260 1.00 29.25  ? 881  ARG C NH2   1 
ATOM   7943  N N     . HIS E 4 82  ? 51.070  46.961 -50.738 1.00 45.36  ? 882  HIS C N     1 
ATOM   7944  C CA    . HIS E 4 82  ? 51.622  48.300 -50.577 1.00 45.93  ? 882  HIS C CA    1 
ATOM   7945  C C     . HIS E 4 82  ? 52.913  48.259 -49.798 1.00 47.98  ? 882  HIS C C     1 
ATOM   7946  O O     . HIS E 4 82  ? 53.883  48.928 -50.168 1.00 45.76  ? 882  HIS C O     1 
ATOM   7947  C CB    . HIS E 4 82  ? 50.618  49.173 -49.877 1.00 20.98  ? 882  HIS C CB    1 
ATOM   7948  C CG    . HIS E 4 82  ? 49.350  49.324 -50.640 1.00 21.15  ? 882  HIS C CG    1 
ATOM   7949  N ND1   . HIS E 4 82  ? 48.115  49.377 -50.033 1.00 22.63  ? 882  HIS C ND1   1 
ATOM   7950  C CD2   . HIS E 4 82  ? 49.128  49.459 -51.968 1.00 21.23  ? 882  HIS C CD2   1 
ATOM   7951  C CE1   . HIS E 4 82  ? 47.185  49.546 -50.958 1.00 21.35  ? 882  HIS C CE1   1 
ATOM   7952  N NE2   . HIS E 4 82  ? 47.774  49.600 -52.139 1.00 24.13  ? 882  HIS C NE2   1 
ATOM   7953  N N     . LEU E 4 83  ? 52.909  47.475 -48.718 1.00 14.54  ? 883  LEU C N     1 
ATOM   7954  C CA    . LEU E 4 83  ? 54.088  47.275 -47.882 1.00 14.90  ? 883  LEU C CA    1 
ATOM   7955  C C     . LEU E 4 83  ? 55.210  46.729 -48.756 1.00 16.80  ? 883  LEU C C     1 
ATOM   7956  O O     . LEU E 4 83  ? 56.354  47.182 -48.689 1.00 15.55  ? 883  LEU C O     1 
ATOM   7957  C CB    . LEU E 4 83  ? 53.780  46.277 -46.777 1.00 22.87  ? 883  LEU C CB    1 
ATOM   7958  C CG    . LEU E 4 83  ? 53.082  46.889 -45.564 1.00 27.14  ? 883  LEU C CG    1 
ATOM   7959  C CD1   . LEU E 4 83  ? 52.671  45.807 -44.534 1.00 23.78  ? 883  LEU C CD1   1 
ATOM   7960  C CD2   . LEU E 4 83  ? 54.034  47.920 -44.946 1.00 23.14  ? 883  LEU C CD2   1 
ATOM   7961  N N     . GLN E 4 84  ? 54.862  45.759 -49.592 1.00 15.21  ? 884  GLN C N     1 
ATOM   7962  C CA    . GLN E 4 84  ? 55.828  45.133 -50.467 1.00 15.93  ? 884  GLN C CA    1 
ATOM   7963  C C     . GLN E 4 84  ? 56.387  46.129 -51.488 1.00 15.41  ? 884  GLN C C     1 
ATOM   7964  O O     . GLN E 4 84  ? 57.605  46.253 -51.657 1.00 16.00  ? 884  GLN C O     1 
ATOM   7965  C CB    . GLN E 4 84  ? 55.187  43.952 -51.184 1.00 26.16  ? 884  GLN C CB    1 
ATOM   7966  C CG    . GLN E 4 84  ? 56.083  43.386 -52.272 1.00 26.04  ? 884  GLN C CG    1 
ATOM   7967  C CD    . GLN E 4 84  ? 57.261  42.575 -51.738 1.00 26.85  ? 884  GLN C CD    1 
ATOM   7968  O OE1   . GLN E 4 84  ? 57.721  42.754 -50.597 1.00 20.55  ? 884  GLN C OE1   1 
ATOM   7969  N NE2   . GLN E 4 84  ? 57.763  41.686 -52.573 1.00 23.45  ? 884  GLN C NE2   1 
ATOM   7970  N N     . LEU E 4 85  ? 55.492  46.847 -52.155 1.00 21.11  ? 885  LEU C N     1 
ATOM   7971  C CA    . LEU E 4 85  ? 55.910  47.810 -53.156 1.00 22.28  ? 885  LEU C CA    1 
ATOM   7972  C C     . LEU E 4 85  ? 56.836  48.837 -52.550 1.00 20.92  ? 885  LEU C C     1 
ATOM   7973  O O     . LEU E 4 85  ? 57.804  49.235 -53.185 1.00 26.06  ? 885  LEU C O     1 
ATOM   7974  C CB    . LEU E 4 85  ? 54.694  48.498 -53.778 1.00 36.26  ? 885  LEU C CB    1 
ATOM   7975  C CG    . LEU E 4 85  ? 53.669  47.581 -54.441 1.00 38.11  ? 885  LEU C CG    1 
ATOM   7976  C CD1   . LEU E 4 85  ? 52.532  48.403 -54.970 1.00 41.76  ? 885  LEU C CD1   1 
ATOM   7977  C CD2   . LEU E 4 85  ? 54.323  46.803 -55.532 1.00 41.77  ? 885  LEU C CD2   1 
ATOM   7978  N N     . ALA E 4 86  ? 56.540  49.259 -51.322 1.00 20.25  ? 886  ALA C N     1 
ATOM   7979  C CA    . ALA E 4 86  ? 57.374  50.231 -50.611 1.00 25.49  ? 886  ALA C CA    1 
ATOM   7980  C C     . ALA E 4 86  ? 58.772  49.711 -50.290 1.00 24.98  ? 886  ALA C C     1 
ATOM   7981  O O     . ALA E 4 86  ? 59.785  50.385 -50.490 1.00 22.80  ? 886  ALA C O     1 
ATOM   7982  C CB    . ALA E 4 86  ? 56.714  50.623 -49.352 1.00 9.36   ? 886  ALA C CB    1 
ATOM   7983  N N     . VAL E 4 87  ? 58.823  48.498 -49.776 1.00 36.15  ? 887  VAL C N     1 
ATOM   7984  C CA    . VAL E 4 87  ? 60.084  47.897 -49.428 1.00 33.36  ? 887  VAL C CA    1 
ATOM   7985  C C     . VAL E 4 87  ? 60.946  47.594 -50.677 1.00 32.46  ? 887  VAL C C     1 
ATOM   7986  O O     . VAL E 4 87  ? 62.108  47.948 -50.739 1.00 35.33  ? 887  VAL C O     1 
ATOM   7987  C CB    . VAL E 4 87  ? 59.805  46.612 -48.585 1.00 19.11  ? 887  VAL C CB    1 
ATOM   7988  C CG1   . VAL E 4 87  ? 61.085  45.937 -48.156 1.00 17.20  ? 887  VAL C CG1   1 
ATOM   7989  C CG2   . VAL E 4 87  ? 59.021  46.979 -47.366 1.00 20.08  ? 887  VAL C CG2   1 
ATOM   7990  N N     . ARG E 4 88  ? 60.379  46.977 -51.698 1.00 27.38  ? 888  ARG C N     1 
ATOM   7991  C CA    . ARG E 4 88  ? 61.211  46.623 -52.838 1.00 31.75  ? 888  ARG C CA    1 
ATOM   7992  C C     . ARG E 4 88  ? 61.595  47.794 -53.707 1.00 32.59  ? 888  ARG C C     1 
ATOM   7993  O O     . ARG E 4 88  ? 62.447  47.696 -54.598 1.00 30.42  ? 888  ARG C O     1 
ATOM   7994  C CB    . ARG E 4 88  ? 60.544  45.497 -53.662 1.00 17.20  ? 888  ARG C CB    1 
ATOM   7995  C CG    . ARG E 4 88  ? 60.246  44.221 -52.830 1.00 14.46  ? 888  ARG C CG    1 
ATOM   7996  C CD    . ARG E 4 88  ? 61.392  43.890 -51.886 1.00 18.86  ? 888  ARG C CD    1 
ATOM   7997  N NE    . ARG E 4 88  ? 61.050  42.943 -50.831 1.00 17.15  ? 888  ARG C NE    1 
ATOM   7998  C CZ    . ARG E 4 88  ? 61.892  42.595 -49.846 1.00 17.44  ? 888  ARG C CZ    1 
ATOM   7999  N NH1   . ARG E 4 88  ? 63.108  43.119 -49.778 1.00 13.53  ? 888  ARG C NH1   1 
ATOM   8000  N NH2   . ARG E 4 88  ? 61.549  41.697 -48.934 1.00 16.19  ? 888  ARG C NH2   1 
ATOM   8001  N N     . ASN E 4 89  ? 60.989  48.929 -53.433 1.00 15.98  ? 889  ASN C N     1 
ATOM   8002  C CA    . ASN E 4 89  ? 61.309  50.087 -54.233 1.00 18.89  ? 889  ASN C CA    1 
ATOM   8003  C C     . ASN E 4 89  ? 62.352  50.978 -53.613 1.00 20.95  ? 889  ASN C C     1 
ATOM   8004  O O     . ASN E 4 89  ? 62.947  51.792 -54.307 1.00 21.18  ? 889  ASN C O     1 
ATOM   8005  C CB    . ASN E 4 89  ? 60.051  50.851 -54.567 1.00 30.63  ? 889  ASN C CB    1 
ATOM   8006  C CG    . ASN E 4 89  ? 59.386  50.309 -55.805 1.00 32.08  ? 889  ASN C CG    1 
ATOM   8007  O OD1   . ASN E 4 89  ? 60.043  50.086 -56.819 1.00 32.33  ? 889  ASN C OD1   1 
ATOM   8008  N ND2   . ASN E 4 89  ? 58.088  50.091 -55.739 1.00 33.24  ? 889  ASN C ND2   1 
ATOM   8009  N N     . ASP E 4 90  ? 62.591  50.808 -52.308 1.00 33.19  ? 890  ASP C N     1 
ATOM   8010  C CA    . ASP E 4 90  ? 63.610  51.580 -51.608 1.00 32.14  ? 890  ASP C CA    1 
ATOM   8011  C C     . ASP E 4 90  ? 64.831  50.709 -51.480 1.00 32.95  ? 890  ASP C C     1 
ATOM   8012  O O     . ASP E 4 90  ? 64.748  49.613 -50.952 1.00 32.63  ? 890  ASP C O     1 
ATOM   8013  C CB    . ASP E 4 90  ? 63.154  52.003 -50.200 1.00 42.08  ? 890  ASP C CB    1 
ATOM   8014  C CG    . ASP E 4 90  ? 64.332  52.497 -49.310 1.00 47.45  ? 890  ASP C CG    1 
ATOM   8015  O OD1   . ASP E 4 90  ? 65.173  53.302 -49.781 1.00 46.86  ? 890  ASP C OD1   1 
ATOM   8016  O OD2   . ASP E 4 90  ? 64.420  52.083 -48.128 1.00 43.79  ? 890  ASP C OD2   1 
ATOM   8017  N N     . GLU E 4 91  ? 65.972  51.187 -51.960 1.00 37.87  ? 891  GLU C N     1 
ATOM   8018  C CA    . GLU E 4 91  ? 67.213  50.417 -51.850 1.00 40.07  ? 891  GLU C CA    1 
ATOM   8019  C C     . GLU E 4 91  ? 67.356  49.836 -50.453 1.00 38.91  ? 891  GLU C C     1 
ATOM   8020  O O     . GLU E 4 91  ? 67.397  48.617 -50.280 1.00 36.75  ? 891  GLU C O     1 
ATOM   8021  C CB    . GLU E 4 91  ? 68.428  51.308 -52.121 1.00 42.37  ? 891  GLU C CB    1 
ATOM   8022  C CG    . GLU E 4 91  ? 69.428  50.720 -53.094 1.00 53.13  ? 891  GLU C CG    1 
ATOM   8023  C CD    . GLU E 4 91  ? 69.726  51.669 -54.246 1.00 60.08  ? 891  GLU C CD    1 
ATOM   8024  O OE1   . GLU E 4 91  ? 70.346  52.729 -53.986 1.00 60.60  ? 891  GLU C OE1   1 
ATOM   8025  O OE2   . GLU E 4 91  ? 69.332  51.366 -55.403 1.00 63.57  ? 891  GLU C OE2   1 
ATOM   8026  N N     . GLU E 4 92  ? 67.372  50.736 -49.467 1.00 23.42  ? 892  GLU C N     1 
ATOM   8027  C CA    . GLU E 4 92  ? 67.588  50.391 -48.054 1.00 24.78  ? 892  GLU C CA    1 
ATOM   8028  C C     . GLU E 4 92  ? 66.601  49.507 -47.336 1.00 21.22  ? 892  GLU C C     1 
ATOM   8029  O O     . GLU E 4 92  ? 67.010  48.536 -46.701 1.00 19.46  ? 892  GLU C O     1 
ATOM   8030  C CB    . GLU E 4 92  ? 67.869  51.669 -47.242 1.00 39.28  ? 892  GLU C CB    1 
ATOM   8031  C CG    . GLU E 4 92  ? 69.337  52.107 -47.361 1.00 48.71  ? 892  GLU C CG    1 
ATOM   8032  C CD    . GLU E 4 92  ? 69.587  53.570 -47.046 1.00 50.69  ? 892  GLU C CD    1 
ATOM   8033  O OE1   . GLU E 4 92  ? 69.090  54.058 -46.014 1.00 53.70  ? 892  GLU C OE1   1 
ATOM   8034  O OE2   . GLU E 4 92  ? 70.301  54.231 -47.826 1.00 53.65  ? 892  GLU C OE2   1 
ATOM   8035  N N     . LEU E 4 93  ? 65.316  49.816 -47.406 1.00 32.28  ? 893  LEU C N     1 
ATOM   8036  C CA    . LEU E 4 93  ? 64.377  48.931 -46.739 1.00 33.16  ? 893  LEU C CA    1 
ATOM   8037  C C     . LEU E 4 93  ? 64.483  47.605 -47.435 1.00 31.78  ? 893  LEU C C     1 
ATOM   8038  O O     . LEU E 4 93  ? 64.214  46.560 -46.850 1.00 30.30  ? 893  LEU C O     1 
ATOM   8039  C CB    . LEU E 4 93  ? 62.949  49.445 -46.829 1.00 17.27  ? 893  LEU C CB    1 
ATOM   8040  C CG    . LEU E 4 93  ? 62.730  50.661 -45.915 1.00 17.69  ? 893  LEU C CG    1 
ATOM   8041  C CD1   . LEU E 4 93  ? 61.275  51.178 -46.083 1.00 17.93  ? 893  LEU C CD1   1 
ATOM   8042  C CD2   . LEU E 4 93  ? 63.067  50.294 -44.435 1.00 15.54  ? 893  LEU C CD2   1 
ATOM   8043  N N     . ASN E 4 94  ? 64.910  47.647 -48.692 1.00 29.68  ? 894  ASN C N     1 
ATOM   8044  C CA    . ASN E 4 94  ? 65.043  46.428 -49.457 1.00 31.68  ? 894  ASN C CA    1 
ATOM   8045  C C     . ASN E 4 94  ? 66.181  45.579 -48.957 1.00 34.29  ? 894  ASN C C     1 
ATOM   8046  O O     . ASN E 4 94  ? 66.085  44.367 -48.948 1.00 32.31  ? 894  ASN C O     1 
ATOM   8047  C CB    . ASN E 4 94  ? 65.275  46.710 -50.916 1.00 31.32  ? 894  ASN C CB    1 
ATOM   8048  C CG    . ASN E 4 94  ? 65.313  45.449 -51.712 1.00 36.58  ? 894  ASN C CG    1 
ATOM   8049  O OD1   . ASN E 4 94  ? 64.298  44.789 -51.895 1.00 30.66  ? 894  ASN C OD1   1 
ATOM   8050  N ND2   . ASN E 4 94  ? 66.491  45.080 -52.160 1.00 33.71  ? 894  ASN C ND2   1 
ATOM   8051  N N     . LYS E 4 95  ? 67.271  46.221 -48.566 1.00 29.10  ? 895  LYS C N     1 
ATOM   8052  C CA    . LYS E 4 95  ? 68.395  45.483 -48.044 1.00 32.59  ? 895  LYS C CA    1 
ATOM   8053  C C     . LYS E 4 95  ? 68.043  45.041 -46.635 1.00 31.50  ? 895  LYS C C     1 
ATOM   8054  O O     . LYS E 4 95  ? 68.232  43.883 -46.281 1.00 32.07  ? 895  LYS C O     1 
ATOM   8055  C CB    . LYS E 4 95  ? 69.659  46.328 -48.023 1.00 31.31  ? 895  LYS C CB    1 
ATOM   8056  C CG    . LYS E 4 95  ? 70.865  45.485 -47.721 1.00 39.49  ? 895  LYS C CG    1 
ATOM   8057  C CD    . LYS E 4 95  ? 72.143  46.241 -47.980 1.00 49.42  ? 895  LYS C CD    1 
ATOM   8058  C CE    . LYS E 4 95  ? 73.383  45.352 -47.722 1.00 54.98  ? 895  LYS C CE    1 
ATOM   8059  N NZ    . LYS E 4 95  ? 74.695  46.091 -47.940 1.00 59.54  ? 895  LYS C NZ    1 
ATOM   8060  N N     . LEU E 4 96  ? 67.522  45.960 -45.824 1.00 19.24  ? 896  LEU C N     1 
ATOM   8061  C CA    . LEU E 4 96  ? 67.151  45.612 -44.453 1.00 17.30  ? 896  LEU C CA    1 
ATOM   8062  C C     . LEU E 4 96  ? 66.276  44.377 -44.423 1.00 16.96  ? 896  LEU C C     1 
ATOM   8063  O O     . LEU E 4 96  ? 66.282  43.658 -43.426 1.00 17.21  ? 896  LEU C O     1 
ATOM   8064  C CB    . LEU E 4 96  ? 66.393  46.764 -43.755 1.00 14.20  ? 896  LEU C CB    1 
ATOM   8065  C CG    . LEU E 4 96  ? 66.029  46.571 -42.258 1.00 17.25  ? 896  LEU C CG    1 
ATOM   8066  C CD1   . LEU E 4 96  ? 67.301  46.313 -41.426 1.00 14.56  ? 896  LEU C CD1   1 
ATOM   8067  C CD2   . LEU E 4 96  ? 65.304  47.809 -41.716 1.00 16.77  ? 896  LEU C CD2   1 
ATOM   8068  N N     . LEU E 4 97  ? 65.535  44.140 -45.512 1.00 20.42  ? 897  LEU C N     1 
ATOM   8069  C CA    . LEU E 4 97  ? 64.618  43.009 -45.581 1.00 22.25  ? 897  LEU C CA    1 
ATOM   8070  C C     . LEU E 4 97  ? 64.859  42.102 -46.778 1.00 21.84  ? 897  LEU C C     1 
ATOM   8071  O O     . LEU E 4 97  ? 63.921  41.533 -47.339 1.00 20.88  ? 897  LEU C O     1 
ATOM   8072  C CB    . LEU E 4 97  ? 63.186  43.524 -45.623 1.00 13.16  ? 897  LEU C CB    1 
ATOM   8073  C CG    . LEU E 4 97  ? 62.629  44.353 -44.457 1.00 19.83  ? 897  LEU C CG    1 
ATOM   8074  C CD1   . LEU E 4 97  ? 61.310  44.887 -44.893 1.00 19.33  ? 897  LEU C CD1   1 
ATOM   8075  C CD2   . LEU E 4 97  ? 62.440  43.549 -43.182 1.00 17.24  ? 897  LEU C CD2   1 
ATOM   8076  N N     . GLY E 4 98  ? 66.119  41.953 -47.165 1.00 30.28  ? 898  GLY C N     1 
ATOM   8077  C CA    . GLY E 4 98  ? 66.437  41.139 -48.320 1.00 33.37  ? 898  GLY C CA    1 
ATOM   8078  C C     . GLY E 4 98  ? 66.179  39.664 -48.143 1.00 35.95  ? 898  GLY C C     1 
ATOM   8079  O O     . GLY E 4 98  ? 66.372  38.879 -49.064 1.00 35.12  ? 898  GLY C O     1 
ATOM   8080  N N     . ARG E 4 99  ? 65.731  39.271 -46.962 1.00 18.92  ? 899  ARG C N     1 
ATOM   8081  C CA    . ARG E 4 99  ? 65.495  37.867 -46.703 1.00 22.62  ? 899  ARG C CA    1 
ATOM   8082  C C     . ARG E 4 99  ? 64.255  37.709 -45.867 1.00 22.05  ? 899  ARG C C     1 
ATOM   8083  O O     . ARG E 4 99  ? 64.100  36.757 -45.096 1.00 22.63  ? 899  ARG C O     1 
ATOM   8084  C CB    . ARG E 4 99  ? 66.714  37.248 -46.025 1.00 31.42  ? 899  ARG C CB    1 
ATOM   8085  C CG    . ARG E 4 99  ? 67.947  37.480 -46.819 1.00 38.80  ? 899  ARG C CG    1 
ATOM   8086  C CD    . ARG E 4 99  ? 68.962  36.410 -46.634 1.00 52.24  ? 899  ARG C CD    1 
ATOM   8087  N NE    . ARG E 4 99  ? 70.138  36.724 -47.446 1.00 60.49  ? 899  ARG C NE    1 
ATOM   8088  C CZ    . ARG E 4 99  ? 71.197  35.930 -47.596 1.00 65.02  ? 899  ARG C CZ    1 
ATOM   8089  N NH1   . ARG E 4 99  ? 71.244  34.742 -46.991 1.00 67.30  ? 899  ARG C NH1   1 
ATOM   8090  N NH2   . ARG E 4 99  ? 72.222  36.341 -48.336 1.00 67.17  ? 899  ARG C NH2   1 
ATOM   8091  N N     . VAL E 4 100 ? 63.369  38.678 -46.027 1.00 28.16  ? 900  VAL C N     1 
ATOM   8092  C CA    . VAL E 4 100 ? 62.086  38.654 -45.358 1.00 27.55  ? 900  VAL C CA    1 
ATOM   8093  C C     . VAL E 4 100 ? 61.036  38.418 -46.441 1.00 28.22  ? 900  VAL C C     1 
ATOM   8094  O O     . VAL E 4 100 ? 61.184  38.889 -47.576 1.00 26.67  ? 900  VAL C O     1 
ATOM   8095  C CB    . VAL E 4 100 ? 61.795  39.969 -44.666 1.00 38.66  ? 900  VAL C CB    1 
ATOM   8096  C CG1   . VAL E 4 100 ? 60.321  40.058 -44.318 1.00 35.15  ? 900  VAL C CG1   1 
ATOM   8097  C CG2   . VAL E 4 100 ? 62.644  40.067 -43.440 1.00 36.57  ? 900  VAL C CG2   1 
ATOM   8098  N N     . THR E 4 101 ? 59.999  37.661 -46.109 1.00 28.04  ? 901  THR C N     1 
ATOM   8099  C CA    . THR E 4 101 ? 58.971  37.434 -47.090 1.00 25.15  ? 901  THR C CA    1 
ATOM   8100  C C     . THR E 4 101 ? 57.689  38.033 -46.548 1.00 29.60  ? 901  THR C C     1 
ATOM   8101  O O     . THR E 4 101 ? 57.162  37.593 -45.529 1.00 30.72  ? 901  THR C O     1 
ATOM   8102  C CB    . THR E 4 101 ? 58.788  35.955 -47.370 1.00 33.52  ? 901  THR C CB    1 
ATOM   8103  O OG1   . THR E 4 101 ? 60.055  35.374 -47.704 1.00 32.66  ? 901  THR C OG1   1 
ATOM   8104  C CG2   . THR E 4 101 ? 57.831  35.755 -48.518 1.00 27.48  ? 901  THR C CG2   1 
ATOM   8105  N N     . ILE E 4 102 ? 57.229  39.081 -47.224 1.00 27.39  ? 902  ILE C N     1 
ATOM   8106  C CA    . ILE E 4 102 ? 56.016  39.775 -46.859 1.00 26.30  ? 902  ILE C CA    1 
ATOM   8107  C C     . ILE E 4 102 ? 54.922  38.980 -47.558 1.00 24.37  ? 902  ILE C C     1 
ATOM   8108  O O     . ILE E 4 102 ? 54.819  38.952 -48.803 1.00 24.43  ? 902  ILE C O     1 
ATOM   8109  C CB    . ILE E 4 102 ? 56.010  41.231 -47.389 1.00 13.01  ? 902  ILE C CB    1 
ATOM   8110  C CG1   . ILE E 4 102 ? 57.087  42.083 -46.715 1.00 11.97  ? 902  ILE C CG1   1 
ATOM   8111  C CG2   . ILE E 4 102 ? 54.685  41.859 -47.139 1.00 12.09  ? 902  ILE C CG2   1 
ATOM   8112  C CD1   . ILE E 4 102 ? 57.214  43.456 -47.347 1.00 14.09  ? 902  ILE C CD1   1 
ATOM   8113  N N     . ALA E 4 103 ? 54.119  38.310 -46.740 1.00 22.96  ? 903  ALA C N     1 
ATOM   8114  C CA    . ALA E 4 103 ? 53.033  37.493 -47.234 1.00 22.33  ? 903  ALA C CA    1 
ATOM   8115  C C     . ALA E 4 103 ? 52.034  38.346 -47.977 1.00 27.00  ? 903  ALA C C     1 
ATOM   8116  O O     . ALA E 4 103 ? 51.834  39.511 -47.642 1.00 25.34  ? 903  ALA C O     1 
ATOM   8117  C CB    . ALA E 4 103 ? 52.368  36.797 -46.092 1.00 10.88  ? 903  ALA C CB    1 
ATOM   8118  N N     . GLN E 4 104 ? 51.413  37.747 -48.989 1.00 22.01  ? 904  GLN C N     1 
ATOM   8119  C CA    . GLN E 4 104 ? 50.436  38.423 -49.824 1.00 24.90  ? 904  GLN C CA    1 
ATOM   8120  C C     . GLN E 4 104 ? 50.954  39.734 -50.449 1.00 23.91  ? 904  GLN C C     1 
ATOM   8121  O O     . GLN E 4 104 ? 50.173  40.607 -50.828 1.00 22.71  ? 904  GLN C O     1 
ATOM   8122  C CB    . GLN E 4 104 ? 49.145  38.657 -49.033 1.00 41.76  ? 904  GLN C CB    1 
ATOM   8123  C CG    . GLN E 4 104 ? 48.170  37.510 -49.139 1.00 46.59  ? 904  GLN C CG    1 
ATOM   8124  C CD    . GLN E 4 104 ? 47.994  37.025 -50.589 1.00 48.13  ? 904  GLN C CD    1 
ATOM   8125  O OE1   . GLN E 4 104 ? 47.441  37.745 -51.464 1.00 48.22  ? 904  GLN C OE1   1 
ATOM   8126  N NE2   . GLN E 4 104 ? 48.474  35.797 -50.855 1.00 40.96  ? 904  GLN C NE2   1 
ATOM   8127  N N     . GLY E 4 105 ? 52.272  39.851 -50.587 1.00 25.63  ? 905  GLY C N     1 
ATOM   8128  C CA    . GLY E 4 105 ? 52.834  41.048 -51.178 1.00 26.07  ? 905  GLY C CA    1 
ATOM   8129  C C     . GLY E 4 105 ? 53.085  41.022 -52.682 1.00 26.74  ? 905  GLY C C     1 
ATOM   8130  O O     . GLY E 4 105 ? 53.082  42.068 -53.323 1.00 24.80  ? 905  GLY C O     1 
ATOM   8131  N N     . GLY E 4 106 ? 53.285  39.833 -53.248 1.00 22.19  ? 906  GLY C N     1 
ATOM   8132  C CA    . GLY E 4 106 ? 53.582  39.702 -54.668 1.00 15.45  ? 906  GLY C CA    1 
ATOM   8133  C C     . GLY E 4 106 ? 54.980  40.220 -54.935 1.00 22.46  ? 906  GLY C C     1 
ATOM   8134  O O     . GLY E 4 106 ? 55.716  40.509 -54.002 1.00 22.97  ? 906  GLY C O     1 
ATOM   8135  N N     . VAL E 4 107 ? 55.341  40.350 -56.203 1.00 16.24  ? 907  VAL C N     1 
ATOM   8136  C CA    . VAL E 4 107 ? 56.659  40.849 -56.617 1.00 23.07  ? 907  VAL C CA    1 
ATOM   8137  C C     . VAL E 4 107 ? 56.478  42.169 -57.372 1.00 22.42  ? 907  VAL C C     1 
ATOM   8138  O O     . VAL E 4 107 ? 55.356  42.575 -57.648 1.00 21.06  ? 907  VAL C O     1 
ATOM   8139  C CB    . VAL E 4 107 ? 57.385  39.836 -57.567 1.00 20.31  ? 907  VAL C CB    1 
ATOM   8140  C CG1   . VAL E 4 107 ? 57.359  38.450 -56.972 1.00 21.47  ? 907  VAL C CG1   1 
ATOM   8141  C CG2   . VAL E 4 107 ? 56.740  39.835 -58.964 1.00 18.98  ? 907  VAL C CG2   1 
ATOM   8142  N N     . LEU E 4 108 ? 57.581  42.844 -57.684 1.00 26.02  ? 908  LEU C N     1 
ATOM   8143  C CA    . LEU E 4 108 ? 57.521  44.103 -58.431 1.00 28.20  ? 908  LEU C CA    1 
ATOM   8144  C C     . LEU E 4 108 ? 57.429  43.766 -59.908 1.00 28.34  ? 908  LEU C C     1 
ATOM   8145  O O     . LEU E 4 108 ? 58.099  42.847 -60.402 1.00 26.75  ? 908  LEU C O     1 
ATOM   8146  C CB    . LEU E 4 108 ? 58.786  44.932 -58.251 1.00 13.66  ? 908  LEU C CB    1 
ATOM   8147  C CG    . LEU E 4 108 ? 59.143  45.617 -56.939 1.00 15.26  ? 908  LEU C CG    1 
ATOM   8148  C CD1   . LEU E 4 108 ? 60.402  46.475 -57.140 1.00 18.78  ? 908  LEU C CD1   1 
ATOM   8149  C CD2   . LEU E 4 108 ? 57.998  46.476 -56.466 1.00 15.70  ? 908  LEU C CD2   1 
ATOM   8150  N N     . PRO E 4 109 ? 56.591  44.497 -60.644 1.00 30.19  ? 909  PRO C N     1 
ATOM   8151  C CA    . PRO E 4 109 ? 56.473  44.217 -62.072 1.00 31.50  ? 909  PRO C CA    1 
ATOM   8152  C C     . PRO E 4 109 ? 57.834  44.423 -62.713 1.00 34.85  ? 909  PRO C C     1 
ATOM   8153  O O     . PRO E 4 109 ? 58.407  45.500 -62.602 1.00 34.71  ? 909  PRO C O     1 
ATOM   8154  C CB    . PRO E 4 109 ? 55.461  45.258 -62.526 1.00 16.87  ? 909  PRO C CB    1 
ATOM   8155  C CG    . PRO E 4 109 ? 54.552  45.319 -61.425 1.00 15.79  ? 909  PRO C CG    1 
ATOM   8156  C CD    . PRO E 4 109 ? 55.494  45.372 -60.207 1.00 13.13  ? 909  PRO C CD    1 
ATOM   8157  N N     . ASN E 4 110 ? 58.369  43.393 -63.357 1.00 31.25  ? 910  ASN C N     1 
ATOM   8158  C CA    . ASN E 4 110 ? 59.666  43.544 -64.007 1.00 34.16  ? 910  ASN C CA    1 
ATOM   8159  C C     . ASN E 4 110 ? 59.923  42.453 -65.028 1.00 34.33  ? 910  ASN C C     1 
ATOM   8160  O O     . ASN E 4 110 ? 60.146  41.295 -64.672 1.00 34.66  ? 910  ASN C O     1 
ATOM   8161  C CB    . ASN E 4 110 ? 60.795  43.567 -62.970 1.00 53.32  ? 910  ASN C CB    1 
ATOM   8162  C CG    . ASN E 4 110 ? 62.154  43.808 -63.598 1.00 59.20  ? 910  ASN C CG    1 
ATOM   8163  O OD1   . ASN E 4 110 ? 62.303  44.680 -64.453 1.00 62.12  ? 910  ASN C OD1   1 
ATOM   8164  N ND2   . ASN E 4 110 ? 63.155  43.040 -63.175 1.00 58.66  ? 910  ASN C ND2   1 
ATOM   8165  N N     . ILE E 4 111 ? 59.890  42.844 -66.301 1.00 44.74  ? 911  ILE C N     1 
ATOM   8166  C CA    . ILE E 4 111 ? 60.113  41.931 -67.421 1.00 43.41  ? 911  ILE C CA    1 
ATOM   8167  C C     . ILE E 4 111 ? 61.472  42.215 -68.033 1.00 45.36  ? 911  ILE C C     1 
ATOM   8168  O O     . ILE E 4 111 ? 61.797  43.361 -68.317 1.00 45.53  ? 911  ILE C O     1 
ATOM   8169  C CB    . ILE E 4 111 ? 59.079  42.142 -68.559 1.00 21.29  ? 911  ILE C CB    1 
ATOM   8170  C CG1   . ILE E 4 111 ? 57.651  42.143 -68.010 1.00 20.17  ? 911  ILE C CG1   1 
ATOM   8171  C CG2   . ILE E 4 111 ? 59.232  41.061 -69.604 1.00 23.98  ? 911  ILE C CG2   1 
ATOM   8172  C CD1   . ILE E 4 111 ? 56.582  42.382 -69.081 1.00 20.52  ? 911  ILE C CD1   1 
ATOM   8173  N N     . GLN E 4 112 ? 62.265  41.180 -68.250 1.00 31.51  ? 912  GLN C N     1 
ATOM   8174  C CA    . GLN E 4 112 ? 63.567  41.368 -68.880 1.00 32.18  ? 912  GLN C CA    1 
ATOM   8175  C C     . GLN E 4 112 ? 63.391  41.846 -70.325 1.00 34.84  ? 912  GLN C C     1 
ATOM   8176  O O     . GLN E 4 112 ? 62.559  41.299 -71.059 1.00 33.88  ? 912  GLN C O     1 
ATOM   8177  C CB    . GLN E 4 112 ? 64.317  40.049 -68.873 1.00 43.56  ? 912  GLN C CB    1 
ATOM   8178  C CG    . GLN E 4 112 ? 64.487  39.519 -67.494 1.00 44.33  ? 912  GLN C CG    1 
ATOM   8179  C CD    . GLN E 4 112 ? 65.300  40.468 -66.665 1.00 47.58  ? 912  GLN C CD    1 
ATOM   8180  O OE1   . GLN E 4 112 ? 66.478  40.682 -66.945 1.00 43.07  ? 912  GLN C OE1   1 
ATOM   8181  N NE2   . GLN E 4 112 ? 64.681  41.059 -65.645 1.00 47.33  ? 912  GLN C NE2   1 
ATOM   8182  N N     . SER E 4 113 ? 64.181  42.860 -70.705 1.00 37.30  ? 913  SER C N     1 
ATOM   8183  C CA    . SER E 4 113 ? 64.202  43.468 -72.046 1.00 39.36  ? 913  SER C CA    1 
ATOM   8184  C C     . SER E 4 113 ? 64.092  42.473 -73.178 1.00 37.59  ? 913  SER C C     1 
ATOM   8185  O O     . SER E 4 113 ? 63.139  42.503 -73.950 1.00 39.02  ? 913  SER C O     1 
ATOM   8186  C CB    . SER E 4 113 ? 65.497  44.242 -72.268 1.00 43.60  ? 913  SER C CB    1 
ATOM   8187  O OG    . SER E 4 113 ? 65.469  45.491 -71.621 1.00 52.56  ? 913  SER C OG    1 
ATOM   8188  N N     . VAL E 4 114 ? 65.086  41.598 -73.279 1.00 46.57  ? 914  VAL C N     1 
ATOM   8189  C CA    . VAL E 4 114 ? 65.137  40.576 -74.327 1.00 47.12  ? 914  VAL C CA    1 
ATOM   8190  C C     . VAL E 4 114 ? 63.837  39.788 -74.522 1.00 46.29  ? 914  VAL C C     1 
ATOM   8191  O O     . VAL E 4 114 ? 63.694  39.064 -75.495 1.00 46.28  ? 914  VAL C O     1 
ATOM   8192  C CB    . VAL E 4 114 ? 66.264  39.558 -74.040 1.00 54.15  ? 914  VAL C CB    1 
ATOM   8193  C CG1   . VAL E 4 114 ? 67.545  40.286 -73.651 1.00 57.32  ? 914  VAL C CG1   1 
ATOM   8194  C CG2   . VAL E 4 114 ? 65.841  38.623 -72.932 1.00 52.68  ? 914  VAL C CG2   1 
ATOM   8195  N N     . LEU E 4 115 ? 62.900  39.922 -73.590 1.00 48.50  ? 915  LEU C N     1 
ATOM   8196  C CA    . LEU E 4 115 ? 61.630  39.211 -73.660 1.00 49.09  ? 915  LEU C CA    1 
ATOM   8197  C C     . LEU E 4 115 ? 60.534  40.020 -74.355 1.00 50.31  ? 915  LEU C C     1 
ATOM   8198  O O     . LEU E 4 115 ? 59.472  39.484 -74.690 1.00 49.59  ? 915  LEU C O     1 
ATOM   8199  C CB    . LEU E 4 115 ? 61.196  38.810 -72.255 1.00 37.43  ? 915  LEU C CB    1 
ATOM   8200  C CG    . LEU E 4 115 ? 62.180  37.866 -71.558 1.00 38.20  ? 915  LEU C CG    1 
ATOM   8201  C CD1   . LEU E 4 115 ? 61.553  37.355 -70.267 1.00 36.99  ? 915  LEU C CD1   1 
ATOM   8202  C CD2   . LEU E 4 115 ? 62.531  36.696 -72.481 1.00 36.36  ? 915  LEU C CD2   1 
ATOM   8203  N N     . LEU E 4 116 ? 60.801  41.310 -74.562 1.00 35.18  ? 916  LEU C N     1 
ATOM   8204  C CA    . LEU E 4 116 ? 59.871  42.189 -75.268 1.00 39.81  ? 916  LEU C CA    1 
ATOM   8205  C C     . LEU E 4 116 ? 60.020  41.968 -76.782 1.00 42.29  ? 916  LEU C C     1 
ATOM   8206  O O     . LEU E 4 116 ? 61.098  41.624 -77.289 1.00 42.02  ? 916  LEU C O     1 
ATOM   8207  C CB    . LEU E 4 116 ? 60.164  43.649 -74.959 1.00 36.28  ? 916  LEU C CB    1 
ATOM   8208  C CG    . LEU E 4 116 ? 60.291  44.018 -73.488 1.00 38.59  ? 916  LEU C CG    1 
ATOM   8209  C CD1   . LEU E 4 116 ? 60.871  45.419 -73.410 1.00 39.92  ? 916  LEU C CD1   1 
ATOM   8210  C CD2   . LEU E 4 116 ? 58.932  43.898 -72.770 1.00 36.26  ? 916  LEU C CD2   1 
ATOM   8211  N N     . PRO E 4 117 ? 58.932  42.185 -77.524 1.00 88.31  ? 917  PRO C N     1 
ATOM   8212  C CA    . PRO E 4 117 ? 58.935  42.003 -78.980 1.00 94.35  ? 917  PRO C CA    1 
ATOM   8213  C C     . PRO E 4 117 ? 59.610  43.115 -79.786 1.00 100.77 ? 917  PRO C C     1 
ATOM   8214  O O     . PRO E 4 117 ? 60.394  43.897 -79.245 1.00 100.02 ? 917  PRO C O     1 
ATOM   8215  C CB    . PRO E 4 117 ? 57.445  41.844 -79.309 1.00 38.28  ? 917  PRO C CB    1 
ATOM   8216  C CG    . PRO E 4 117 ? 56.792  42.736 -78.290 1.00 36.32  ? 917  PRO C CG    1 
ATOM   8217  C CD    . PRO E 4 117 ? 57.590  42.524 -77.015 1.00 35.53  ? 917  PRO C CD    1 
ATOM   8218  N N     . LYS E 4 118 ? 59.299  43.142 -81.085 1.00 125.92 ? 918  LYS C N     1 
ATOM   8219  C CA    . LYS E 4 118 ? 59.804  44.118 -82.054 1.00 133.05 ? 918  LYS C CA    1 
ATOM   8220  C C     . LYS E 4 118 ? 61.318  44.327 -82.018 1.00 136.59 ? 918  LYS C C     1 
ATOM   8221  O O     . LYS E 4 118 ? 62.056  43.482 -81.507 1.00 137.66 ? 918  LYS C O     1 
ATOM   8222  C CB    . LYS E 4 118 ? 59.079  45.460 -81.875 1.00 104.24 ? 918  LYS C CB    1 
ATOM   8223  C CG    . LYS E 4 118 ? 59.063  46.317 -83.129 1.00 108.51 ? 918  LYS C CG    1 
ATOM   8224  C CD    . LYS E 4 118 ? 58.189  47.545 -82.971 1.00 111.93 ? 918  LYS C CD    1 
ATOM   8225  C CE    . LYS E 4 118 ? 58.111  48.323 -84.278 1.00 114.20 ? 918  LYS C CE    1 
ATOM   8226  N NZ    . LYS E 4 118 ? 57.269  49.544 -84.158 1.00 114.65 ? 918  LYS C NZ    1 
ATOM   8227  N N     . LYS E 4 119 ? 61.770  45.451 -82.576 1.00 199.17 ? 919  LYS C N     1 
ATOM   8228  C CA    . LYS E 4 119 ? 63.195  45.785 -82.630 1.00 201.47 ? 919  LYS C CA    1 
ATOM   8229  C C     . LYS E 4 119 ? 63.483  47.284 -82.775 1.00 201.47 ? 919  LYS C C     1 
ATOM   8230  O O     . LYS E 4 119 ? 63.404  47.839 -83.875 1.00 201.47 ? 919  LYS C O     1 
ATOM   8231  C CB    . LYS E 4 119 ? 63.870  45.035 -83.782 1.00 140.13 ? 919  LYS C CB    1 
ATOM   8232  C CG    . LYS E 4 119 ? 63.182  45.184 -85.136 1.00 140.23 ? 919  LYS C CG    1 
ATOM   8233  C CD    . LYS E 4 119 ? 61.882  44.390 -85.186 1.00 140.33 ? 919  LYS C CD    1 
ATOM   8234  C CE    . LYS E 4 119 ? 61.224  44.465 -86.553 1.00 140.22 ? 919  LYS C CE    1 
ATOM   8235  N NZ    . LYS E 4 119 ? 59.937  43.715 -86.577 1.00 139.68 ? 919  LYS C NZ    1 
ATOM   8236  N N     . THR E 4 120 ? 63.832  47.914 -81.651 1.00 200.24 ? 920  THR C N     1 
ATOM   8237  C CA    . THR E 4 120 ? 64.154  49.345 -81.561 1.00 200.24 ? 920  THR C CA    1 
ATOM   8238  C C     . THR E 4 120 ? 64.046  49.815 -80.102 1.00 200.24 ? 920  THR C C     1 
ATOM   8239  O O     . THR E 4 120 ? 64.874  50.649 -79.669 1.00 145.45 ? 920  THR C O     1 
ATOM   8240  C CB    . THR E 4 120 ? 63.218  50.218 -82.463 1.00 125.39 ? 920  THR C CB    1 
ATOM   8241  O OG1   . THR E 4 120 ? 63.976  50.745 -83.565 1.00 125.64 ? 920  THR C OG1   1 
ATOM   8242  C CG2   . THR E 4 120 ? 62.597  51.380 -81.667 1.00 125.39 ? 920  THR C CG2   1 
ATOM   8243  N N     . LYS F 5 34  ? 47.946  38.509 -25.400 1.00 64.39  ? 1231 LYS D N     1 
ATOM   8244  C CA    . LYS F 5 34  ? 49.022  38.705 -26.427 1.00 57.73  ? 1231 LYS D CA    1 
ATOM   8245  C C     . LYS F 5 34  ? 49.197  40.153 -26.853 1.00 52.26  ? 1231 LYS D C     1 
ATOM   8246  O O     . LYS F 5 34  ? 48.380  40.693 -27.602 1.00 51.17  ? 1231 LYS D O     1 
ATOM   8247  C CB    . LYS F 5 34  ? 48.756  37.848 -27.677 1.00 89.68  ? 1231 LYS D CB    1 
ATOM   8248  C CG    . LYS F 5 34  ? 47.324  37.870 -28.163 1.00 92.65  ? 1231 LYS D CG    1 
ATOM   8249  C CD    . LYS F 5 34  ? 47.013  36.665 -29.046 1.00 94.89  ? 1231 LYS D CD    1 
ATOM   8250  C CE    . LYS F 5 34  ? 45.509  36.578 -29.323 1.00 96.82  ? 1231 LYS D CE    1 
ATOM   8251  N NZ    . LYS F 5 34  ? 45.105  35.418 -30.176 1.00 97.44  ? 1231 LYS D NZ    1 
ATOM   8252  N N     . GLU F 5 35  ? 50.274  40.774 -26.376 1.00 62.61  ? 1232 GLU D N     1 
ATOM   8253  C CA    . GLU F 5 35  ? 50.587  42.162 -26.707 1.00 58.08  ? 1232 GLU D CA    1 
ATOM   8254  C C     . GLU F 5 35  ? 50.960  42.281 -28.172 1.00 54.90  ? 1232 GLU D C     1 
ATOM   8255  O O     . GLU F 5 35  ? 51.294  41.291 -28.813 1.00 53.90  ? 1232 GLU D O     1 
ATOM   8256  C CB    . GLU F 5 35  ? 51.782  42.663 -25.912 1.00 75.58  ? 1232 GLU D CB    1 
ATOM   8257  C CG    . GLU F 5 35  ? 51.740  42.405 -24.452 1.00 76.87  ? 1232 GLU D CG    1 
ATOM   8258  C CD    . GLU F 5 35  ? 53.016  42.860 -23.796 1.00 78.57  ? 1232 GLU D CD    1 
ATOM   8259  O OE1   . GLU F 5 35  ? 54.087  42.703 -24.429 1.00 79.62  ? 1232 GLU D OE1   1 
ATOM   8260  O OE2   . GLU F 5 35  ? 52.946  43.364 -22.653 1.00 77.84  ? 1232 GLU D OE2   1 
ATOM   8261  N N     . SER F 5 36  ? 50.961  43.505 -28.685 1.00 36.37  ? 1233 SER D N     1 
ATOM   8262  C CA    . SER F 5 36  ? 51.296  43.733 -30.078 1.00 34.12  ? 1233 SER D CA    1 
ATOM   8263  C C     . SER F 5 36  ? 51.609  45.213 -30.251 1.00 30.28  ? 1233 SER D C     1 
ATOM   8264  O O     . SER F 5 36  ? 51.066  46.011 -29.541 1.00 27.65  ? 1233 SER D O     1 
ATOM   8265  C CB    . SER F 5 36  ? 50.093  43.280 -30.937 1.00 9.34   ? 1233 SER D CB    1 
ATOM   8266  O OG    . SER F 5 36  ? 49.790  44.171 -32.003 1.00 12.84  ? 1233 SER D OG    1 
ATOM   8267  N N     . TYR F 5 37  ? 52.487  45.590 -31.168 1.00 39.68  ? 1234 TYR D N     1 
ATOM   8268  C CA    . TYR F 5 37  ? 52.777  47.007 -31.372 1.00 37.76  ? 1234 TYR D CA    1 
ATOM   8269  C C     . TYR F 5 37  ? 51.703  47.778 -32.153 1.00 35.13  ? 1234 TYR D C     1 
ATOM   8270  O O     . TYR F 5 37  ? 51.927  48.937 -32.543 1.00 33.15  ? 1234 TYR D O     1 
ATOM   8271  C CB    . TYR F 5 37  ? 54.084  47.175 -32.116 1.00 34.64  ? 1234 TYR D CB    1 
ATOM   8272  C CG    . TYR F 5 37  ? 55.256  46.740 -31.339 1.00 36.68  ? 1234 TYR D CG    1 
ATOM   8273  C CD1   . TYR F 5 37  ? 55.829  45.502 -31.561 1.00 36.54  ? 1234 TYR D CD1   1 
ATOM   8274  C CD2   . TYR F 5 37  ? 55.793  47.554 -30.360 1.00 38.36  ? 1234 TYR D CD2   1 
ATOM   8275  C CE1   . TYR F 5 37  ? 56.926  45.071 -30.819 1.00 35.12  ? 1234 TYR D CE1   1 
ATOM   8276  C CE2   . TYR F 5 37  ? 56.881  47.148 -29.607 1.00 36.93  ? 1234 TYR D CE2   1 
ATOM   8277  C CZ    . TYR F 5 37  ? 57.448  45.904 -29.839 1.00 35.91  ? 1234 TYR D CZ    1 
ATOM   8278  O OH    . TYR F 5 37  ? 58.538  45.488 -29.099 1.00 35.75  ? 1234 TYR D OH    1 
ATOM   8279  N N     . ALA F 5 38  ? 50.538  47.163 -32.352 1.00 29.53  ? 1235 ALA D N     1 
ATOM   8280  C CA    . ALA F 5 38  ? 49.463  47.767 -33.144 1.00 33.40  ? 1235 ALA D CA    1 
ATOM   8281  C C     . ALA F 5 38  ? 49.020  49.203 -32.883 1.00 34.23  ? 1235 ALA D C     1 
ATOM   8282  O O     . ALA F 5 38  ? 49.075  50.032 -33.793 1.00 34.38  ? 1235 ALA D O     1 
ATOM   8283  C CB    . ALA F 5 38  ? 48.249  46.859 -33.137 1.00 22.27  ? 1235 ALA D CB    1 
ATOM   8284  N N     . ILE F 5 39  ? 48.581  49.509 -31.663 1.00 41.00  ? 1236 ILE D N     1 
ATOM   8285  C CA    . ILE F 5 39  ? 48.110  50.859 -31.376 1.00 42.15  ? 1236 ILE D CA    1 
ATOM   8286  C C     . ILE F 5 39  ? 49.186  51.892 -31.619 1.00 40.81  ? 1236 ILE D C     1 
ATOM   8287  O O     . ILE F 5 39  ? 48.896  53.025 -32.006 1.00 39.94  ? 1236 ILE D O     1 
ATOM   8288  C CB    . ILE F 5 39  ? 47.594  51.003 -29.937 1.00 13.52  ? 1236 ILE D CB    1 
ATOM   8289  C CG1   . ILE F 5 39  ? 48.753  51.122 -28.946 1.00 16.74  ? 1236 ILE D CG1   1 
ATOM   8290  C CG2   . ILE F 5 39  ? 46.718  49.816 -29.588 1.00 12.91  ? 1236 ILE D CG2   1 
ATOM   8291  C CD1   . ILE F 5 39  ? 48.289  51.320 -27.529 1.00 19.93  ? 1236 ILE D CD1   1 
ATOM   8292  N N     . TYR F 5 40  ? 50.433  51.503 -31.406 1.00 25.00  ? 1237 TYR D N     1 
ATOM   8293  C CA    . TYR F 5 40  ? 51.511  52.443 -31.635 1.00 26.84  ? 1237 TYR D CA    1 
ATOM   8294  C C     . TYR F 5 40  ? 51.756  52.598 -33.127 1.00 27.73  ? 1237 TYR D C     1 
ATOM   8295  O O     . TYR F 5 40  ? 52.065  53.689 -33.589 1.00 27.28  ? 1237 TYR D O     1 
ATOM   8296  C CB    . TYR F 5 40  ? 52.772  51.990 -30.905 1.00 29.36  ? 1237 TYR D CB    1 
ATOM   8297  C CG    . TYR F 5 40  ? 52.485  51.636 -29.461 1.00 32.48  ? 1237 TYR D CG    1 
ATOM   8298  C CD1   . TYR F 5 40  ? 52.079  50.341 -29.102 1.00 35.33  ? 1237 TYR D CD1   1 
ATOM   8299  C CD2   . TYR F 5 40  ? 52.584  52.594 -28.460 1.00 32.17  ? 1237 TYR D CD2   1 
ATOM   8300  C CE1   . TYR F 5 40  ? 51.793  50.018 -27.786 1.00 36.81  ? 1237 TYR D CE1   1 
ATOM   8301  C CE2   . TYR F 5 40  ? 52.294  52.284 -27.150 1.00 37.21  ? 1237 TYR D CE2   1 
ATOM   8302  C CZ    . TYR F 5 40  ? 51.902  50.994 -26.813 1.00 38.56  ? 1237 TYR D CZ    1 
ATOM   8303  O OH    . TYR F 5 40  ? 51.634  50.662 -25.494 1.00 40.15  ? 1237 TYR D OH    1 
ATOM   8304  N N     . VAL F 5 41  ? 51.618  51.514 -33.886 1.00 32.06  ? 1238 VAL D N     1 
ATOM   8305  C CA    . VAL F 5 41  ? 51.797  51.595 -35.335 1.00 31.66  ? 1238 VAL D CA    1 
ATOM   8306  C C     . VAL F 5 41  ? 50.716  52.517 -35.838 1.00 31.79  ? 1238 VAL D C     1 
ATOM   8307  O O     . VAL F 5 41  ? 50.997  53.469 -36.568 1.00 29.64  ? 1238 VAL D O     1 
ATOM   8308  C CB    . VAL F 5 41  ? 51.599  50.244 -36.033 1.00 20.92  ? 1238 VAL D CB    1 
ATOM   8309  C CG1   . VAL F 5 41  ? 51.345  50.458 -37.503 1.00 20.50  ? 1238 VAL D CG1   1 
ATOM   8310  C CG2   . VAL F 5 41  ? 52.811  49.391 -35.856 1.00 18.83  ? 1238 VAL D CG2   1 
ATOM   8311  N N     . TYR F 5 42  ? 49.478  52.239 -35.430 1.00 22.08  ? 1239 TYR D N     1 
ATOM   8312  C CA    . TYR F 5 42  ? 48.346  53.051 -35.846 1.00 23.24  ? 1239 TYR D CA    1 
ATOM   8313  C C     . TYR F 5 42  ? 48.555  54.560 -35.523 1.00 23.00  ? 1239 TYR D C     1 
ATOM   8314  O O     . TYR F 5 42  ? 48.158  55.442 -36.313 1.00 24.74  ? 1239 TYR D O     1 
ATOM   8315  C CB    . TYR F 5 42  ? 47.058  52.511 -35.228 1.00 51.07  ? 1239 TYR D CB    1 
ATOM   8316  C CG    . TYR F 5 42  ? 45.829  53.142 -35.821 1.00 57.49  ? 1239 TYR D CG    1 
ATOM   8317  C CD1   . TYR F 5 42  ? 45.575  53.067 -37.193 1.00 59.35  ? 1239 TYR D CD1   1 
ATOM   8318  C CD2   . TYR F 5 42  ? 44.953  53.891 -35.025 1.00 61.06  ? 1239 TYR D CD2   1 
ATOM   8319  C CE1   . TYR F 5 42  ? 44.476  53.735 -37.765 1.00 67.22  ? 1239 TYR D CE1   1 
ATOM   8320  C CE2   . TYR F 5 42  ? 43.850  54.564 -35.579 1.00 65.32  ? 1239 TYR D CE2   1 
ATOM   8321  C CZ    . TYR F 5 42  ? 43.617  54.484 -36.951 1.00 67.80  ? 1239 TYR D CZ    1 
ATOM   8322  O OH    . TYR F 5 42  ? 42.528  55.140 -37.498 1.00 72.51  ? 1239 TYR D OH    1 
ATOM   8323  N N     . LYS F 5 43  ? 49.193  54.860 -34.392 1.00 24.77  ? 1240 LYS D N     1 
ATOM   8324  C CA    . LYS F 5 43  ? 49.454  56.243 -34.055 1.00 26.28  ? 1240 LYS D CA    1 
ATOM   8325  C C     . LYS F 5 43  ? 50.452  56.828 -35.035 1.00 28.28  ? 1240 LYS D C     1 
ATOM   8326  O O     . LYS F 5 43  ? 50.194  57.855 -35.674 1.00 26.11  ? 1240 LYS D O     1 
ATOM   8327  C CB    . LYS F 5 43  ? 50.025  56.362 -32.671 1.00 32.81  ? 1240 LYS D CB    1 
ATOM   8328  C CG    . LYS F 5 43  ? 49.061  56.059 -31.558 1.00 32.22  ? 1240 LYS D CG    1 
ATOM   8329  C CD    . LYS F 5 43  ? 49.770  56.306 -30.211 1.00 38.73  ? 1240 LYS D CD    1 
ATOM   8330  C CE    . LYS F 5 43  ? 49.056  55.709 -29.023 1.00 40.75  ? 1240 LYS D CE    1 
ATOM   8331  N NZ    . LYS F 5 43  ? 49.950  55.885 -27.844 1.00 46.60  ? 1240 LYS D NZ    1 
ATOM   8332  N N     . VAL F 5 44  ? 51.607  56.188 -35.154 1.00 46.77  ? 1241 VAL D N     1 
ATOM   8333  C CA    . VAL F 5 44  ? 52.614  56.680 -36.083 1.00 43.11  ? 1241 VAL D CA    1 
ATOM   8334  C C     . VAL F 5 44  ? 51.996  56.778 -37.470 1.00 43.46  ? 1241 VAL D C     1 
ATOM   8335  O O     . VAL F 5 44  ? 52.275  57.717 -38.224 1.00 44.64  ? 1241 VAL D O     1 
ATOM   8336  C CB    . VAL F 5 44  ? 53.831  55.746 -36.155 1.00 36.36  ? 1241 VAL D CB    1 
ATOM   8337  C CG1   . VAL F 5 44  ? 54.799  56.241 -37.207 1.00 32.82  ? 1241 VAL D CG1   1 
ATOM   8338  C CG2   . VAL F 5 44  ? 54.532  55.695 -34.817 1.00 31.22  ? 1241 VAL D CG2   1 
ATOM   8339  N N     . LEU F 5 45  ? 51.157  55.808 -37.813 1.00 33.50  ? 1242 LEU D N     1 
ATOM   8340  C CA    . LEU F 5 45  ? 50.530  55.848 -39.117 1.00 36.02  ? 1242 LEU D CA    1 
ATOM   8341  C C     . LEU F 5 45  ? 49.792  57.180 -39.304 1.00 37.34  ? 1242 LEU D C     1 
ATOM   8342  O O     . LEU F 5 45  ? 50.033  57.918 -40.274 1.00 35.19  ? 1242 LEU D O     1 
ATOM   8343  C CB    . LEU F 5 45  ? 49.561  54.681 -39.284 1.00 27.77  ? 1242 LEU D CB    1 
ATOM   8344  C CG    . LEU F 5 45  ? 48.724  54.764 -40.569 1.00 31.65  ? 1242 LEU D CG    1 
ATOM   8345  C CD1   . LEU F 5 45  ? 49.624  55.075 -41.779 1.00 30.21  ? 1242 LEU D CD1   1 
ATOM   8346  C CD2   . LEU F 5 45  ? 47.959  53.478 -40.781 1.00 29.61  ? 1242 LEU D CD2   1 
ATOM   8347  N N     . LYS F 5 46  ? 48.907  57.494 -38.362 1.00 20.19  ? 1243 LYS D N     1 
ATOM   8348  C CA    . LYS F 5 46  ? 48.148  58.729 -38.433 1.00 24.83  ? 1243 LYS D CA    1 
ATOM   8349  C C     . LYS F 5 46  ? 48.978  59.984 -38.560 1.00 23.59  ? 1243 LYS D C     1 
ATOM   8350  O O     . LYS F 5 46  ? 48.544  60.929 -39.201 1.00 25.49  ? 1243 LYS D O     1 
ATOM   8351  C CB    . LYS F 5 46  ? 47.192  58.845 -37.241 1.00 35.35  ? 1243 LYS D CB    1 
ATOM   8352  C CG    . LYS F 5 46  ? 46.003  57.891 -37.385 1.00 37.67  ? 1243 LYS D CG    1 
ATOM   8353  C CD    . LYS F 5 46  ? 45.402  58.036 -38.791 1.00 42.76  ? 1243 LYS D CD    1 
ATOM   8354  C CE    . LYS F 5 46  ? 44.317  57.029 -39.111 1.00 43.67  ? 1243 LYS D CE    1 
ATOM   8355  N NZ    . LYS F 5 46  ? 43.756  57.293 -40.460 1.00 43.99  ? 1243 LYS D NZ    1 
ATOM   8356  N N     . GLN F 5 47  ? 50.172  60.006 -37.978 1.00 41.49  ? 1244 GLN D N     1 
ATOM   8357  C CA    . GLN F 5 47  ? 51.017  61.194 -38.085 1.00 39.81  ? 1244 GLN D CA    1 
ATOM   8358  C C     . GLN F 5 47  ? 51.498  61.454 -39.508 1.00 39.61  ? 1244 GLN D C     1 
ATOM   8359  O O     . GLN F 5 47  ? 51.386  62.572 -40.014 1.00 36.28  ? 1244 GLN D O     1 
ATOM   8360  C CB    . GLN F 5 47  ? 52.240  61.076 -37.181 1.00 33.34  ? 1244 GLN D CB    1 
ATOM   8361  C CG    . GLN F 5 47  ? 51.928  60.852 -35.708 1.00 34.41  ? 1244 GLN D CG    1 
ATOM   8362  C CD    . GLN F 5 47  ? 53.175  60.894 -34.860 1.00 36.82  ? 1244 GLN D CD    1 
ATOM   8363  O OE1   . GLN F 5 47  ? 54.174  60.213 -35.157 1.00 40.64  ? 1244 GLN D OE1   1 
ATOM   8364  N NE2   . GLN F 5 47  ? 53.133  61.694 -33.796 1.00 32.86  ? 1244 GLN D NE2   1 
ATOM   8365  N N     . VAL F 5 48  ? 52.016  60.415 -40.157 1.00 30.30  ? 1245 VAL D N     1 
ATOM   8366  C CA    . VAL F 5 48  ? 52.554  60.531 -41.517 1.00 29.08  ? 1245 VAL D CA    1 
ATOM   8367  C C     . VAL F 5 48  ? 51.561  60.690 -42.662 1.00 28.62  ? 1245 VAL D C     1 
ATOM   8368  O O     . VAL F 5 48  ? 51.800  61.460 -43.621 1.00 34.07  ? 1245 VAL D O     1 
ATOM   8369  C CB    . VAL F 5 48  ? 53.450  59.346 -41.825 1.00 26.70  ? 1245 VAL D CB    1 
ATOM   8370  C CG1   . VAL F 5 48  ? 54.413  59.162 -40.685 1.00 25.95  ? 1245 VAL D CG1   1 
ATOM   8371  C CG2   . VAL F 5 48  ? 52.632  58.118 -42.047 1.00 22.59  ? 1245 VAL D CG2   1 
ATOM   8372  N N     . HIS F 5 49  ? 50.469  59.938 -42.545 1.00 31.39  ? 1246 HIS D N     1 
ATOM   8373  C CA    . HIS F 5 49  ? 49.370  59.945 -43.506 1.00 32.85  ? 1246 HIS D CA    1 
ATOM   8374  C C     . HIS F 5 49  ? 48.076  59.900 -42.701 1.00 33.86  ? 1246 HIS D C     1 
ATOM   8375  O O     . HIS F 5 49  ? 47.463  58.845 -42.545 1.00 34.52  ? 1246 HIS D O     1 
ATOM   8376  C CB    . HIS F 5 49  ? 49.452  58.728 -44.404 1.00 33.66  ? 1246 HIS D CB    1 
ATOM   8377  C CG    . HIS F 5 49  ? 50.688  58.685 -45.234 1.00 34.51  ? 1246 HIS D CG    1 
ATOM   8378  N ND1   . HIS F 5 49  ? 50.985  59.654 -46.163 1.00 33.00  ? 1246 HIS D ND1   1 
ATOM   8379  C CD2   . HIS F 5 49  ? 51.640  57.737 -45.366 1.00 34.61  ? 1246 HIS D CD2   1 
ATOM   8380  C CE1   . HIS F 5 49  ? 52.056  59.298 -46.845 1.00 35.54  ? 1246 HIS D CE1   1 
ATOM   8381  N NE2   . HIS F 5 49  ? 52.472  58.139 -46.383 1.00 34.76  ? 1246 HIS D NE2   1 
ATOM   8382  N N     . PRO F 5 50  ? 47.638  61.064 -42.195 1.00 45.98  ? 1247 PRO D N     1 
ATOM   8383  C CA    . PRO F 5 50  ? 46.439  61.269 -41.385 1.00 46.64  ? 1247 PRO D CA    1 
ATOM   8384  C C     . PRO F 5 50  ? 45.161  60.639 -41.900 1.00 43.83  ? 1247 PRO D C     1 
ATOM   8385  O O     . PRO F 5 50  ? 44.310  60.249 -41.128 1.00 45.88  ? 1247 PRO D O     1 
ATOM   8386  C CB    . PRO F 5 50  ? 46.343  62.785 -41.313 1.00 36.45  ? 1247 PRO D CB    1 
ATOM   8387  C CG    . PRO F 5 50  ? 47.770  63.220 -41.424 1.00 38.66  ? 1247 PRO D CG    1 
ATOM   8388  C CD    . PRO F 5 50  ? 48.241  62.367 -42.537 1.00 32.88  ? 1247 PRO D CD    1 
ATOM   8389  N N     . ASP F 5 51  ? 45.011  60.516 -43.201 1.00 35.90  ? 1248 ASP D N     1 
ATOM   8390  C CA    . ASP F 5 51  ? 43.787  59.927 -43.688 1.00 39.04  ? 1248 ASP D CA    1 
ATOM   8391  C C     . ASP F 5 51  ? 43.910  58.525 -44.268 1.00 38.87  ? 1248 ASP D C     1 
ATOM   8392  O O     . ASP F 5 51  ? 43.006  58.068 -44.956 1.00 37.05  ? 1248 ASP D O     1 
ATOM   8393  C CB    . ASP F 5 51  ? 43.168  60.855 -44.719 1.00 71.56  ? 1248 ASP D CB    1 
ATOM   8394  C CG    . ASP F 5 51  ? 42.918  62.225 -44.165 1.00 77.13  ? 1248 ASP D CG    1 
ATOM   8395  O OD1   . ASP F 5 51  ? 42.246  62.314 -43.124 1.00 77.20  ? 1248 ASP D OD1   1 
ATOM   8396  O OD2   . ASP F 5 51  ? 43.393  63.208 -44.761 1.00 79.72  ? 1248 ASP D OD2   1 
ATOM   8397  N N     . THR F 5 52  ? 44.999  57.826 -43.980 1.00 26.16  ? 1249 THR D N     1 
ATOM   8398  C CA    . THR F 5 52  ? 45.179  56.487 -44.525 1.00 24.00  ? 1249 THR D CA    1 
ATOM   8399  C C     . THR F 5 52  ? 44.960  55.349 -43.509 1.00 22.64  ? 1249 THR D C     1 
ATOM   8400  O O     . THR F 5 52  ? 45.393  55.420 -42.369 1.00 22.98  ? 1249 THR D O     1 
ATOM   8401  C CB    . THR F 5 52  ? 46.574  56.363 -45.124 1.00 37.77  ? 1249 THR D CB    1 
ATOM   8402  O OG1   . THR F 5 52  ? 46.780  57.401 -46.098 1.00 34.75  ? 1249 THR D OG1   1 
ATOM   8403  C CG2   . THR F 5 52  ? 46.747  55.003 -45.752 1.00 33.74  ? 1249 THR D CG2   1 
ATOM   8404  N N     . GLY F 5 53  ? 44.281  54.292 -43.928 1.00 52.99  ? 1250 GLY D N     1 
ATOM   8405  C CA    . GLY F 5 53  ? 44.058  53.193 -43.012 1.00 53.07  ? 1250 GLY D CA    1 
ATOM   8406  C C     . GLY F 5 53  ? 45.040  52.057 -43.235 1.00 53.52  ? 1250 GLY D C     1 
ATOM   8407  O O     . GLY F 5 53  ? 45.985  52.184 -44.009 1.00 50.65  ? 1250 GLY D O     1 
ATOM   8408  N N     . ILE F 5 54  ? 44.812  50.943 -42.547 1.00 29.07  ? 1251 ILE D N     1 
ATOM   8409  C CA    . ILE F 5 54  ? 45.663  49.761 -42.659 1.00 29.39  ? 1251 ILE D CA    1 
ATOM   8410  C C     . ILE F 5 54  ? 44.807  48.530 -42.354 1.00 30.39  ? 1251 ILE D C     1 
ATOM   8411  O O     . ILE F 5 54  ? 44.052  48.512 -41.379 1.00 28.44  ? 1251 ILE D O     1 
ATOM   8412  C CB    . ILE F 5 54  ? 46.928  49.832 -41.675 1.00 20.76  ? 1251 ILE D CB    1 
ATOM   8413  C CG1   . ILE F 5 54  ? 47.995  48.823 -42.143 1.00 20.36  ? 1251 ILE D CG1   1 
ATOM   8414  C CG2   . ILE F 5 54  ? 46.514  49.602 -40.185 1.00 19.19  ? 1251 ILE D CG2   1 
ATOM   8415  C CD1   . ILE F 5 54  ? 49.257  48.763 -41.269 1.00 16.87  ? 1251 ILE D CD1   1 
ATOM   8416  N N     . SER F 5 55  ? 44.907  47.526 -43.224 1.00 36.16  ? 1252 SER D N     1 
ATOM   8417  C CA    . SER F 5 55  ? 44.163  46.274 -43.085 1.00 36.10  ? 1252 SER D CA    1 
ATOM   8418  C C     . SER F 5 55  ? 44.829  45.492 -41.970 1.00 37.79  ? 1252 SER D C     1 
ATOM   8419  O O     . SER F 5 55  ? 45.966  45.800 -41.589 1.00 36.40  ? 1252 SER D O     1 
ATOM   8420  C CB    . SER F 5 55  ? 44.219  45.460 -44.385 1.00 43.99  ? 1252 SER D CB    1 
ATOM   8421  O OG    . SER F 5 55  ? 45.483  44.820 -44.580 1.00 48.40  ? 1252 SER D OG    1 
ATOM   8422  N N     . SER F 5 56  ? 44.141  44.482 -41.448 1.00 46.46  ? 1253 SER D N     1 
ATOM   8423  C CA    . SER F 5 56  ? 44.716  43.706 -40.363 1.00 47.85  ? 1253 SER D CA    1 
ATOM   8424  C C     . SER F 5 56  ? 45.890  42.878 -40.862 1.00 46.69  ? 1253 SER D C     1 
ATOM   8425  O O     . SER F 5 56  ? 46.928  42.766 -40.181 1.00 45.06  ? 1253 SER D O     1 
ATOM   8426  C CB    . SER F 5 56  ? 43.663  42.801 -39.728 1.00 61.92  ? 1253 SER D CB    1 
ATOM   8427  O OG    . SER F 5 56  ? 43.203  41.850 -40.666 1.00 65.68  ? 1253 SER D OG    1 
ATOM   8428  N N     . LYS F 5 57  ? 45.740  42.310 -42.053 1.00 29.31  ? 1254 LYS D N     1 
ATOM   8429  C CA    . LYS F 5 57  ? 46.817  41.502 -42.565 1.00 30.14  ? 1254 LYS D CA    1 
ATOM   8430  C C     . LYS F 5 57  ? 48.076  42.334 -42.605 1.00 28.64  ? 1254 LYS D C     1 
ATOM   8431  O O     . LYS F 5 57  ? 49.144  41.857 -42.216 1.00 28.47  ? 1254 LYS D O     1 
ATOM   8432  C CB    . LYS F 5 57  ? 46.496  40.957 -43.945 1.00 45.46  ? 1254 LYS D CB    1 
ATOM   8433  C CG    . LYS F 5 57  ? 45.541  39.779 -43.928 1.00 54.19  ? 1254 LYS D CG    1 
ATOM   8434  C CD    . LYS F 5 57  ? 45.383  39.187 -45.328 1.00 60.76  ? 1254 LYS D CD    1 
ATOM   8435  C CE    . LYS F 5 57  ? 44.324  38.098 -45.401 1.00 63.63  ? 1254 LYS D CE    1 
ATOM   8436  N NZ    . LYS F 5 57  ? 44.086  37.700 -46.820 1.00 69.79  ? 1254 LYS D NZ    1 
ATOM   8437  N N     . ALA F 5 58  ? 47.959  43.584 -43.052 1.00 32.27  ? 1255 ALA D N     1 
ATOM   8438  C CA    . ALA F 5 58  ? 49.123  44.468 -43.128 1.00 32.21  ? 1255 ALA D CA    1 
ATOM   8439  C C     . ALA F 5 58  ? 49.654  44.861 -41.749 1.00 28.71  ? 1255 ALA D C     1 
ATOM   8440  O O     . ALA F 5 58  ? 50.861  44.929 -41.550 1.00 32.54  ? 1255 ALA D O     1 
ATOM   8441  C CB    . ALA F 5 58  ? 48.790  45.680 -43.919 1.00 6.89   ? 1255 ALA D CB    1 
ATOM   8442  N N     . MET F 5 59  ? 48.761  45.113 -40.798 1.00 30.65  ? 1256 MET D N     1 
ATOM   8443  C CA    . MET F 5 59  ? 49.190  45.450 -39.440 1.00 30.46  ? 1256 MET D CA    1 
ATOM   8444  C C     . MET F 5 59  ? 49.928  44.262 -38.844 1.00 32.99  ? 1256 MET D C     1 
ATOM   8445  O O     . MET F 5 59  ? 50.802  44.438 -37.999 1.00 34.32  ? 1256 MET D O     1 
ATOM   8446  C CB    . MET F 5 59  ? 48.005  45.795 -38.548 1.00 21.78  ? 1256 MET D CB    1 
ATOM   8447  C CG    . MET F 5 59  ? 48.403  46.183 -37.135 1.00 24.96  ? 1256 MET D CG    1 
ATOM   8448  S SD    . MET F 5 59  ? 49.575  47.562 -37.056 1.00 27.32  ? 1256 MET D SD    1 
ATOM   8449  C CE    . MET F 5 59  ? 48.543  48.959 -37.297 1.00 29.54  ? 1256 MET D CE    1 
ATOM   8450  N N     . SER F 5 60  ? 49.555  43.049 -39.257 1.00 24.28  ? 1257 SER D N     1 
ATOM   8451  C CA    . SER F 5 60  ? 50.268  41.865 -38.791 1.00 29.63  ? 1257 SER D CA    1 
ATOM   8452  C C     . SER F 5 60  ? 51.685  41.924 -39.381 1.00 27.27  ? 1257 SER D C     1 
ATOM   8453  O O     . SER F 5 60  ? 52.669  41.855 -38.638 1.00 29.73  ? 1257 SER D O     1 
ATOM   8454  C CB    . SER F 5 60  ? 49.577  40.596 -39.256 1.00 22.12  ? 1257 SER D CB    1 
ATOM   8455  O OG    . SER F 5 60  ? 50.351  39.464 -38.901 1.00 28.74  ? 1257 SER D OG    1 
ATOM   8456  N N     . ILE F 5 61  ? 51.785  42.061 -40.708 1.00 20.88  ? 1258 ILE D N     1 
ATOM   8457  C CA    . ILE F 5 61  ? 53.085  42.190 -41.362 1.00 24.06  ? 1258 ILE D CA    1 
ATOM   8458  C C     . ILE F 5 61  ? 53.907  43.276 -40.657 1.00 24.88  ? 1258 ILE D C     1 
ATOM   8459  O O     . ILE F 5 61  ? 55.131  43.144 -40.515 1.00 22.71  ? 1258 ILE D O     1 
ATOM   8460  C CB    . ILE F 5 61  ? 52.932  42.575 -42.823 1.00 20.88  ? 1258 ILE D CB    1 
ATOM   8461  C CG1   . ILE F 5 61  ? 52.439  41.369 -43.604 1.00 25.61  ? 1258 ILE D CG1   1 
ATOM   8462  C CG2   . ILE F 5 61  ? 54.243  43.039 -43.408 1.00 16.13  ? 1258 ILE D CG2   1 
ATOM   8463  C CD1   . ILE F 5 61  ? 52.276  41.633 -45.080 1.00 29.49  ? 1258 ILE D CD1   1 
ATOM   8464  N N     . MET F 5 62  ? 53.238  44.343 -40.208 1.00 18.57  ? 1259 MET D N     1 
ATOM   8465  C CA    . MET F 5 62  ? 53.918  45.414 -39.486 1.00 19.25  ? 1259 MET D CA    1 
ATOM   8466  C C     . MET F 5 62  ? 54.379  44.983 -38.086 1.00 18.79  ? 1259 MET D C     1 
ATOM   8467  O O     . MET F 5 62  ? 55.452  45.383 -37.613 1.00 15.37  ? 1259 MET D O     1 
ATOM   8468  C CB    . MET F 5 62  ? 53.010  46.640 -39.356 1.00 28.17  ? 1259 MET D CB    1 
ATOM   8469  C CG    . MET F 5 62  ? 52.986  47.550 -40.589 1.00 26.93  ? 1259 MET D CG    1 
ATOM   8470  S SD    . MET F 5 62  ? 54.626  47.988 -41.246 1.00 32.78  ? 1259 MET D SD    1 
ATOM   8471  C CE    . MET F 5 62  ? 55.043  49.330 -40.234 1.00 30.82  ? 1259 MET D CE    1 
ATOM   8472  N N     . ASN F 5 63  ? 53.572  44.165 -37.420 1.00 25.52  ? 1260 ASN D N     1 
ATOM   8473  C CA    . ASN F 5 63  ? 53.933  43.747 -36.083 1.00 27.33  ? 1260 ASN D CA    1 
ATOM   8474  C C     . ASN F 5 63  ? 55.105  42.788 -36.211 1.00 25.75  ? 1260 ASN D C     1 
ATOM   8475  O O     . ASN F 5 63  ? 56.015  42.750 -35.361 1.00 28.36  ? 1260 ASN D O     1 
ATOM   8476  C CB    . ASN F 5 63  ? 52.735  43.107 -35.364 1.00 12.61  ? 1260 ASN D CB    1 
ATOM   8477  C CG    . ASN F 5 63  ? 52.894  43.150 -33.847 1.00 21.15  ? 1260 ASN D CG    1 
ATOM   8478  O OD1   . ASN F 5 63  ? 53.113  44.200 -33.275 1.00 22.40  ? 1260 ASN D OD1   1 
ATOM   8479  N ND2   . ASN F 5 63  ? 52.808  42.011 -33.205 1.00 18.60  ? 1260 ASN D ND2   1 
ATOM   8480  N N     . SER F 5 64  ? 55.091  42.028 -37.302 1.00 30.52  ? 1261 SER D N     1 
ATOM   8481  C CA    . SER F 5 64  ? 56.176  41.101 -37.568 1.00 31.65  ? 1261 SER D CA    1 
ATOM   8482  C C     . SER F 5 64  ? 57.451  41.910 -37.846 1.00 31.74  ? 1261 SER D C     1 
ATOM   8483  O O     . SER F 5 64  ? 58.533  41.578 -37.371 1.00 32.64  ? 1261 SER D O     1 
ATOM   8484  C CB    . SER F 5 64  ? 55.834  40.205 -38.760 1.00 37.94  ? 1261 SER D CB    1 
ATOM   8485  O OG    . SER F 5 64  ? 54.672  39.425 -38.510 1.00 40.05  ? 1261 SER D OG    1 
ATOM   8486  N N     . PHE F 5 65  ? 57.315  42.992 -38.597 1.00 30.34  ? 1262 PHE D N     1 
ATOM   8487  C CA    . PHE F 5 65  ? 58.464  43.833 -38.898 1.00 30.19  ? 1262 PHE D CA    1 
ATOM   8488  C C     . PHE F 5 65  ? 59.131  44.399 -37.652 1.00 28.59  ? 1262 PHE D C     1 
ATOM   8489  O O     . PHE F 5 65  ? 60.346  44.328 -37.513 1.00 29.88  ? 1262 PHE D O     1 
ATOM   8490  C CB    . PHE F 5 65  ? 58.044  44.987 -39.778 1.00 19.70  ? 1262 PHE D CB    1 
ATOM   8491  C CG    . PHE F 5 65  ? 59.136  45.989 -40.017 1.00 19.74  ? 1262 PHE D CG    1 
ATOM   8492  C CD1   . PHE F 5 65  ? 60.272  45.643 -40.744 1.00 20.99  ? 1262 PHE D CD1   1 
ATOM   8493  C CD2   . PHE F 5 65  ? 59.010  47.308 -39.541 1.00 21.78  ? 1262 PHE D CD2   1 
ATOM   8494  C CE1   . PHE F 5 65  ? 61.268  46.607 -40.978 1.00 23.10  ? 1262 PHE D CE1   1 
ATOM   8495  C CE2   . PHE F 5 65  ? 60.008  48.269 -39.777 1.00 23.20  ? 1262 PHE D CE2   1 
ATOM   8496  C CZ    . PHE F 5 65  ? 61.124  47.926 -40.491 1.00 20.29  ? 1262 PHE D CZ    1 
ATOM   8497  N N     . VAL F 5 66  ? 58.340  44.965 -36.746 1.00 22.52  ? 1263 VAL D N     1 
ATOM   8498  C CA    . VAL F 5 66  ? 58.897  45.547 -35.523 1.00 21.46  ? 1263 VAL D CA    1 
ATOM   8499  C C     . VAL F 5 66  ? 59.661  44.526 -34.667 1.00 23.20  ? 1263 VAL D C     1 
ATOM   8500  O O     . VAL F 5 66  ? 60.814  44.772 -34.270 1.00 21.43  ? 1263 VAL D O     1 
ATOM   8501  C CB    . VAL F 5 66  ? 57.790  46.229 -34.640 1.00 22.62  ? 1263 VAL D CB    1 
ATOM   8502  C CG1   . VAL F 5 66  ? 58.417  46.824 -33.413 1.00 20.70  ? 1263 VAL D CG1   1 
ATOM   8503  C CG2   . VAL F 5 66  ? 57.085  47.358 -35.403 1.00 20.80  ? 1263 VAL D CG2   1 
ATOM   8504  N N     . ASN F 5 67  ? 59.019  43.384 -34.403 1.00 11.05  ? 1264 ASN D N     1 
ATOM   8505  C CA    . ASN F 5 67  ? 59.609  42.334 -33.594 1.00 11.37  ? 1264 ASN D CA    1 
ATOM   8506  C C     . ASN F 5 67  ? 60.836  41.791 -34.274 1.00 8.74   ? 1264 ASN D C     1 
ATOM   8507  O O     . ASN F 5 67  ? 61.841  41.521 -33.626 1.00 9.73   ? 1264 ASN D O     1 
ATOM   8508  C CB    . ASN F 5 67  ? 58.588  41.228 -33.315 1.00 51.33  ? 1264 ASN D CB    1 
ATOM   8509  C CG    . ASN F 5 67  ? 57.548  41.648 -32.272 1.00 55.94  ? 1264 ASN D CG    1 
ATOM   8510  O OD1   . ASN F 5 67  ? 57.888  42.232 -31.231 1.00 57.41  ? 1264 ASN D OD1   1 
ATOM   8511  N ND2   . ASN F 5 67  ? 56.281  41.354 -32.544 1.00 60.33  ? 1264 ASN D ND2   1 
ATOM   8512  N N     . ASP F 5 68  ? 60.781  41.649 -35.588 1.00 20.40  ? 1265 ASP D N     1 
ATOM   8513  C CA    . ASP F 5 68  ? 61.948  41.179 -36.302 1.00 22.63  ? 1265 ASP D CA    1 
ATOM   8514  C C     . ASP F 5 68  ? 63.148  42.108 -36.006 1.00 23.33  ? 1265 ASP D C     1 
ATOM   8515  O O     . ASP F 5 68  ? 64.140  41.701 -35.436 1.00 22.51  ? 1265 ASP D O     1 
ATOM   8516  C CB    . ASP F 5 68  ? 61.665  41.180 -37.791 1.00 31.10  ? 1265 ASP D CB    1 
ATOM   8517  C CG    . ASP F 5 68  ? 62.793  40.579 -38.592 1.00 33.47  ? 1265 ASP D CG    1 
ATOM   8518  O OD1   . ASP F 5 68  ? 63.002  39.355 -38.465 1.00 38.96  ? 1265 ASP D OD1   1 
ATOM   8519  O OD2   . ASP F 5 68  ? 63.470  41.308 -39.347 1.00 30.97  ? 1265 ASP D OD2   1 
ATOM   8520  N N     . VAL F 5 69  ? 63.041  43.370 -36.392 1.00 19.61  ? 1266 VAL D N     1 
ATOM   8521  C CA    . VAL F 5 69  ? 64.113  44.323 -36.187 1.00 16.66  ? 1266 VAL D CA    1 
ATOM   8522  C C     . VAL F 5 69  ? 64.495  44.444 -34.705 1.00 18.18  ? 1266 VAL D C     1 
ATOM   8523  O O     . VAL F 5 69  ? 65.665  44.669 -34.367 1.00 17.38  ? 1266 VAL D O     1 
ATOM   8524  C CB    . VAL F 5 69  ? 63.693  45.722 -36.742 1.00 8.96   ? 1266 VAL D CB    1 
ATOM   8525  C CG1   . VAL F 5 69  ? 64.659  46.811 -36.227 1.00 9.19   ? 1266 VAL D CG1   1 
ATOM   8526  C CG2   . VAL F 5 69  ? 63.670  45.707 -38.255 1.00 8.10   ? 1266 VAL D CG2   1 
ATOM   8527  N N     . PHE F 5 70  ? 63.502  44.319 -33.826 1.00 22.80  ? 1267 PHE D N     1 
ATOM   8528  C CA    . PHE F 5 70  ? 63.740  44.416 -32.394 1.00 24.76  ? 1267 PHE D CA    1 
ATOM   8529  C C     . PHE F 5 70  ? 64.748  43.389 -31.945 1.00 26.06  ? 1267 PHE D C     1 
ATOM   8530  O O     . PHE F 5 70  ? 65.730  43.743 -31.295 1.00 25.04  ? 1267 PHE D O     1 
ATOM   8531  C CB    . PHE F 5 70  ? 62.468  44.181 -31.610 1.00 17.97  ? 1267 PHE D CB    1 
ATOM   8532  C CG    . PHE F 5 70  ? 62.673  44.174 -30.126 1.00 21.83  ? 1267 PHE D CG    1 
ATOM   8533  C CD1   . PHE F 5 70  ? 62.514  45.326 -29.382 1.00 25.48  ? 1267 PHE D CD1   1 
ATOM   8534  C CD2   . PHE F 5 70  ? 63.013  43.004 -29.462 1.00 25.38  ? 1267 PHE D CD2   1 
ATOM   8535  C CE1   . PHE F 5 70  ? 62.688  45.313 -27.990 1.00 25.01  ? 1267 PHE D CE1   1 
ATOM   8536  C CE2   . PHE F 5 70  ? 63.193  42.986 -28.069 1.00 26.88  ? 1267 PHE D CE2   1 
ATOM   8537  C CZ    . PHE F 5 70  ? 63.025  44.146 -27.338 1.00 25.67  ? 1267 PHE D CZ    1 
ATOM   8538  N N     . GLU F 5 71  ? 64.485  42.115 -32.276 1.00 28.53  ? 1268 GLU D N     1 
ATOM   8539  C CA    . GLU F 5 71  ? 65.357  41.003 -31.912 1.00 30.68  ? 1268 GLU D CA    1 
ATOM   8540  C C     . GLU F 5 71  ? 66.681  41.190 -32.595 1.00 30.31  ? 1268 GLU D C     1 
ATOM   8541  O O     . GLU F 5 71  ? 67.726  41.082 -31.980 1.00 29.96  ? 1268 GLU D O     1 
ATOM   8542  C CB    . GLU F 5 71  ? 64.773  39.663 -32.350 1.00 55.31  ? 1268 GLU D CB    1 
ATOM   8543  C CG    . GLU F 5 71  ? 63.321  39.446 -31.977 1.00 66.74  ? 1268 GLU D CG    1 
ATOM   8544  C CD    . GLU F 5 71  ? 62.688  38.292 -32.750 1.00 73.60  ? 1268 GLU D CD    1 
ATOM   8545  O OE1   . GLU F 5 71  ? 62.983  38.143 -33.961 1.00 77.36  ? 1268 GLU D OE1   1 
ATOM   8546  O OE2   . GLU F 5 71  ? 61.881  37.545 -32.154 1.00 78.27  ? 1268 GLU D OE2   1 
ATOM   8547  N N     . ARG F 5 72  ? 66.659  41.486 -33.872 1.00 26.16  ? 1269 ARG D N     1 
ATOM   8548  C CA    . ARG F 5 72  ? 67.914  41.682 -34.557 1.00 25.14  ? 1269 ARG D CA    1 
ATOM   8549  C C     . ARG F 5 72  ? 68.877  42.658 -33.850 1.00 26.30  ? 1269 ARG D C     1 
ATOM   8550  O O     . ARG F 5 72  ? 70.064  42.336 -33.641 1.00 22.91  ? 1269 ARG D O     1 
ATOM   8551  C CB    . ARG F 5 72  ? 67.641  42.155 -35.972 1.00 25.09  ? 1269 ARG D CB    1 
ATOM   8552  C CG    . ARG F 5 72  ? 66.899  41.124 -36.800 1.00 26.36  ? 1269 ARG D CG    1 
ATOM   8553  C CD    . ARG F 5 72  ? 67.462  41.109 -38.158 1.00 28.72  ? 1269 ARG D CD    1 
ATOM   8554  N NE    . ARG F 5 72  ? 66.459  41.535 -39.101 1.00 27.35  ? 1269 ARG D NE    1 
ATOM   8555  C CZ    . ARG F 5 72  ? 66.739  41.955 -40.323 1.00 28.38  ? 1269 ARG D CZ    1 
ATOM   8556  N NH1   . ARG F 5 72  ? 68.004  42.012 -40.720 1.00 23.85  ? 1269 ARG D NH1   1 
ATOM   8557  N NH2   . ARG F 5 72  ? 65.755  42.279 -41.161 1.00 30.37  ? 1269 ARG D NH2   1 
ATOM   8558  N N     . ILE F 5 73  ? 68.378  43.841 -33.480 1.00 22.47  ? 1270 ILE D N     1 
ATOM   8559  C CA    . ILE F 5 73  ? 69.208  44.827 -32.811 1.00 21.19  ? 1270 ILE D CA    1 
ATOM   8560  C C     . ILE F 5 73  ? 69.648  44.324 -31.454 1.00 22.65  ? 1270 ILE D C     1 
ATOM   8561  O O     . ILE F 5 73  ? 70.827  44.366 -31.140 1.00 23.76  ? 1270 ILE D O     1 
ATOM   8562  C CB    . ILE F 5 73  ? 68.479  46.189 -32.653 1.00 17.59  ? 1270 ILE D CB    1 
ATOM   8563  C CG1   . ILE F 5 73  ? 68.358  46.876 -34.014 1.00 15.36  ? 1270 ILE D CG1   1 
ATOM   8564  C CG2   . ILE F 5 73  ? 69.249  47.082 -31.710 1.00 17.86  ? 1270 ILE D CG2   1 
ATOM   8565  C CD1   . ILE F 5 73  ? 67.830  48.238 -33.965 1.00 18.14  ? 1270 ILE D CD1   1 
ATOM   8566  N N     . ALA F 5 74  ? 68.716  43.826 -30.652 1.00 29.64  ? 1271 ALA D N     1 
ATOM   8567  C CA    . ALA F 5 74  ? 69.073  43.320 -29.314 1.00 29.63  ? 1271 ALA D CA    1 
ATOM   8568  C C     . ALA F 5 74  ? 70.085  42.180 -29.432 1.00 28.84  ? 1271 ALA D C     1 
ATOM   8569  O O     . ALA F 5 74  ? 70.861  41.913 -28.530 1.00 28.30  ? 1271 ALA D O     1 
ATOM   8570  C CB    . ALA F 5 74  ? 67.809  42.841 -28.556 1.00 28.13  ? 1271 ALA D CB    1 
ATOM   8571  N N     . GLY F 5 75  ? 70.061  41.503 -30.566 1.00 21.99  ? 1272 GLY D N     1 
ATOM   8572  C CA    . GLY F 5 75  ? 70.994  40.423 -30.751 1.00 23.61  ? 1272 GLY D CA    1 
ATOM   8573  C C     . GLY F 5 75  ? 72.387  40.980 -30.929 1.00 26.82  ? 1272 GLY D C     1 
ATOM   8574  O O     . GLY F 5 75  ? 73.302  40.619 -30.169 1.00 26.46  ? 1272 GLY D O     1 
ATOM   8575  N N     . GLU F 5 76  ? 72.550  41.858 -31.924 1.00 30.29  ? 1273 GLU D N     1 
ATOM   8576  C CA    . GLU F 5 76  ? 73.850  42.440 -32.178 1.00 31.85  ? 1273 GLU D CA    1 
ATOM   8577  C C     . GLU F 5 76  ? 74.342  43.128 -30.917 1.00 29.21  ? 1273 GLU D C     1 
ATOM   8578  O O     . GLU F 5 76  ? 75.533  43.072 -30.597 1.00 30.10  ? 1273 GLU D O     1 
ATOM   8579  C CB    . GLU F 5 76  ? 73.809  43.423 -33.363 1.00 47.75  ? 1273 GLU D CB    1 
ATOM   8580  C CG    . GLU F 5 76  ? 74.647  42.973 -34.596 1.00 53.16  ? 1273 GLU D CG    1 
ATOM   8581  C CD    . GLU F 5 76  ? 75.937  42.200 -34.217 1.00 54.84  ? 1273 GLU D CD    1 
ATOM   8582  O OE1   . GLU F 5 76  ? 76.795  42.735 -33.472 1.00 54.97  ? 1273 GLU D OE1   1 
ATOM   8583  O OE2   . GLU F 5 76  ? 76.096  41.033 -34.660 1.00 55.43  ? 1273 GLU D OE2   1 
ATOM   8584  N N     . ALA F 5 77  ? 73.417  43.746 -30.187 1.00 25.25  ? 1274 ALA D N     1 
ATOM   8585  C CA    . ALA F 5 77  ? 73.753  44.430 -28.947 1.00 26.11  ? 1274 ALA D CA    1 
ATOM   8586  C C     . ALA F 5 77  ? 74.297  43.425 -27.935 1.00 25.68  ? 1274 ALA D C     1 
ATOM   8587  O O     . ALA F 5 77  ? 75.345  43.622 -27.308 1.00 26.38  ? 1274 ALA D O     1 
ATOM   8588  C CB    . ALA F 5 77  ? 72.524  45.107 -28.392 1.00 67.23  ? 1274 ALA D CB    1 
ATOM   8589  N N     . SER F 5 78  ? 73.566  42.332 -27.798 1.00 31.04  ? 1275 SER D N     1 
ATOM   8590  C CA    . SER F 5 78  ? 73.911  41.268 -26.891 1.00 33.74  ? 1275 SER D CA    1 
ATOM   8591  C C     . SER F 5 78  ? 75.343  40.789 -27.038 1.00 34.24  ? 1275 SER D C     1 
ATOM   8592  O O     . SER F 5 78  ? 76.115  40.834 -26.079 1.00 32.78  ? 1275 SER D O     1 
ATOM   8593  C CB    . SER F 5 78  ? 72.982  40.114 -27.135 1.00 18.61  ? 1275 SER D CB    1 
ATOM   8594  O OG    . SER F 5 78  ? 73.059  39.241 -26.043 1.00 21.75  ? 1275 SER D OG    1 
ATOM   8595  N N     . ARG F 5 79  ? 75.686  40.318 -28.237 1.00 37.89  ? 1276 ARG D N     1 
ATOM   8596  C CA    . ARG F 5 79  ? 77.027  39.807 -28.537 1.00 40.54  ? 1276 ARG D CA    1 
ATOM   8597  C C     . ARG F 5 79  ? 78.089  40.873 -28.371 1.00 40.55  ? 1276 ARG D C     1 
ATOM   8598  O O     . ARG F 5 79  ? 79.104  40.633 -27.738 1.00 40.98  ? 1276 ARG D O     1 
ATOM   8599  C CB    . ARG F 5 79  ? 77.120  39.298 -29.974 1.00 36.38  ? 1276 ARG D CB    1 
ATOM   8600  C CG    . ARG F 5 79  ? 75.999  38.415 -30.424 1.00 38.93  ? 1276 ARG D CG    1 
ATOM   8601  C CD    . ARG F 5 79  ? 76.186  37.991 -31.863 1.00 42.21  ? 1276 ARG D CD    1 
ATOM   8602  N NE    . ARG F 5 79  ? 74.902  37.534 -32.359 1.00 48.24  ? 1276 ARG D NE    1 
ATOM   8603  C CZ    . ARG F 5 79  ? 73.992  38.340 -32.888 1.00 48.38  ? 1276 ARG D CZ    1 
ATOM   8604  N NH1   . ARG F 5 79  ? 74.253  39.629 -33.001 1.00 55.74  ? 1276 ARG D NH1   1 
ATOM   8605  N NH2   . ARG F 5 79  ? 72.810  37.864 -33.248 1.00 52.41  ? 1276 ARG D NH2   1 
ATOM   8606  N N     . LEU F 5 80  ? 77.874  42.029 -28.987 1.00 30.78  ? 1277 LEU D N     1 
ATOM   8607  C CA    . LEU F 5 80  ? 78.799  43.148 -28.870 1.00 31.80  ? 1277 LEU D CA    1 
ATOM   8608  C C     . LEU F 5 80  ? 79.278  43.287 -27.401 1.00 31.59  ? 1277 LEU D C     1 
ATOM   8609  O O     . LEU F 5 80  ? 80.477  43.419 -27.113 1.00 32.27  ? 1277 LEU D O     1 
ATOM   8610  C CB    . LEU F 5 80  ? 78.075  44.423 -29.311 1.00 32.50  ? 1277 LEU D CB    1 
ATOM   8611  C CG    . LEU F 5 80  ? 78.835  45.741 -29.413 1.00 36.87  ? 1277 LEU D CG    1 
ATOM   8612  C CD1   . LEU F 5 80  ? 80.101  45.561 -30.214 1.00 33.76  ? 1277 LEU D CD1   1 
ATOM   8613  C CD2   . LEU F 5 80  ? 77.942  46.756 -30.078 1.00 39.08  ? 1277 LEU D CD2   1 
ATOM   8614  N N     . ALA F 5 81  ? 78.314  43.272 -26.484 1.00 25.18  ? 1278 ALA D N     1 
ATOM   8615  C CA    . ALA F 5 81  ? 78.577  43.350 -25.068 1.00 26.91  ? 1278 ALA D CA    1 
ATOM   8616  C C     . ALA F 5 81  ? 79.471  42.177 -24.655 1.00 27.98  ? 1278 ALA D C     1 
ATOM   8617  O O     . ALA F 5 81  ? 80.469  42.352 -23.949 1.00 28.67  ? 1278 ALA D O     1 
ATOM   8618  C CB    . ALA F 5 81  ? 77.263  43.295 -24.313 1.00 33.73  ? 1278 ALA D CB    1 
ATOM   8619  N N     . HIS F 5 82  ? 79.123  40.968 -25.082 1.00 34.51  ? 1279 HIS D N     1 
ATOM   8620  C CA    . HIS F 5 82  ? 79.943  39.838 -24.698 1.00 36.45  ? 1279 HIS D CA    1 
ATOM   8621  C C     . HIS F 5 82  ? 81.346  40.021 -25.214 1.00 35.70  ? 1279 HIS D C     1 
ATOM   8622  O O     . HIS F 5 82  ? 82.283  40.018 -24.439 1.00 37.46  ? 1279 HIS D O     1 
ATOM   8623  C CB    . HIS F 5 82  ? 79.321  38.537 -25.167 1.00 91.47  ? 1279 HIS D CB    1 
ATOM   8624  C CG    . HIS F 5 82  ? 78.250  38.042 -24.247 1.00 96.71  ? 1279 HIS D CG    1 
ATOM   8625  N ND1   . HIS F 5 82  ? 78.526  37.527 -22.998 1.00 101.87 ? 1279 HIS D ND1   1 
ATOM   8626  C CD2   . HIS F 5 82  ? 76.902  38.037 -24.367 1.00 99.14  ? 1279 HIS D CD2   1 
ATOM   8627  C CE1   . HIS F 5 82  ? 77.393  37.225 -22.389 1.00 101.10 ? 1279 HIS D CE1   1 
ATOM   8628  N NE2   . HIS F 5 82  ? 76.392  37.525 -23.198 1.00 100.97 ? 1279 HIS D NE2   1 
ATOM   8629  N N     . TYR F 5 83  ? 81.495  40.232 -26.512 1.00 40.76  ? 1280 TYR D N     1 
ATOM   8630  C CA    . TYR F 5 83  ? 82.818  40.456 -27.096 1.00 42.17  ? 1280 TYR D CA    1 
ATOM   8631  C C     . TYR F 5 83  ? 83.683  41.401 -26.265 1.00 42.99  ? 1280 TYR D C     1 
ATOM   8632  O O     . TYR F 5 83  ? 84.897  41.348 -26.358 1.00 43.40  ? 1280 TYR D O     1 
ATOM   8633  C CB    . TYR F 5 83  ? 82.700  41.069 -28.490 1.00 52.40  ? 1280 TYR D CB    1 
ATOM   8634  C CG    . TYR F 5 83  ? 81.831  40.304 -29.450 1.00 55.15  ? 1280 TYR D CG    1 
ATOM   8635  C CD1   . TYR F 5 83  ? 81.404  40.898 -30.641 1.00 54.99  ? 1280 TYR D CD1   1 
ATOM   8636  C CD2   . TYR F 5 83  ? 81.411  38.998 -29.172 1.00 55.57  ? 1280 TYR D CD2   1 
ATOM   8637  C CE1   . TYR F 5 83  ? 80.581  40.224 -31.528 1.00 57.14  ? 1280 TYR D CE1   1 
ATOM   8638  C CE2   . TYR F 5 83  ? 80.581  38.316 -30.059 1.00 57.62  ? 1280 TYR D CE2   1 
ATOM   8639  C CZ    . TYR F 5 83  ? 80.169  38.943 -31.234 1.00 60.08  ? 1280 TYR D CZ    1 
ATOM   8640  O OH    . TYR F 5 83  ? 79.305  38.327 -32.109 1.00 61.40  ? 1280 TYR D OH    1 
ATOM   8641  N N     . ASN F 5 84  ? 83.067  42.269 -25.468 1.00 42.14  ? 1281 ASN D N     1 
ATOM   8642  C CA    . ASN F 5 84  ? 83.826  43.234 -24.679 1.00 42.57  ? 1281 ASN D CA    1 
ATOM   8643  C C     . ASN F 5 84  ? 83.853  42.964 -23.199 1.00 42.28  ? 1281 ASN D C     1 
ATOM   8644  O O     . ASN F 5 84  ? 84.413  43.751 -22.437 1.00 42.61  ? 1281 ASN D O     1 
ATOM   8645  C CB    . ASN F 5 84  ? 83.286  44.636 -24.913 1.00 43.11  ? 1281 ASN D CB    1 
ATOM   8646  C CG    . ASN F 5 84  ? 83.713  45.191 -26.239 1.00 44.63  ? 1281 ASN D CG    1 
ATOM   8647  O OD1   . ASN F 5 84  ? 84.887  45.515 -26.434 1.00 42.26  ? 1281 ASN D OD1   1 
ATOM   8648  N ND2   . ASN F 5 84  ? 82.769  45.288 -27.180 1.00 44.20  ? 1281 ASN D ND2   1 
ATOM   8649  N N     . LYS F 5 85  ? 83.244  41.856 -22.789 1.00 39.00  ? 1282 LYS D N     1 
ATOM   8650  C CA    . LYS F 5 85  ? 83.202  41.490 -21.383 1.00 41.72  ? 1282 LYS D CA    1 
ATOM   8651  C C     . LYS F 5 85  ? 82.520  42.605 -20.592 1.00 40.71  ? 1282 LYS D C     1 
ATOM   8652  O O     . LYS F 5 85  ? 83.051  43.105 -19.603 1.00 41.20  ? 1282 LYS D O     1 
ATOM   8653  C CB    . LYS F 5 85  ? 84.617  41.264 -20.862 1.00 47.76  ? 1282 LYS D CB    1 
ATOM   8654  C CG    . LYS F 5 85  ? 85.440  40.263 -21.633 1.00 52.71  ? 1282 LYS D CG    1 
ATOM   8655  C CD    . LYS F 5 85  ? 86.732  39.997 -20.893 1.00 58.93  ? 1282 LYS D CD    1 
ATOM   8656  C CE    . LYS F 5 85  ? 87.581  38.946 -21.584 1.00 60.81  ? 1282 LYS D CE    1 
ATOM   8657  N NZ    . LYS F 5 85  ? 88.786  38.610 -20.774 1.00 66.30  ? 1282 LYS D NZ    1 
ATOM   8658  N N     . ARG F 5 86  ? 81.349  42.999 -21.077 1.00 54.16  ? 1283 ARG D N     1 
ATOM   8659  C CA    . ARG F 5 86  ? 80.509  44.030 -20.481 1.00 54.85  ? 1283 ARG D CA    1 
ATOM   8660  C C     . ARG F 5 86  ? 79.222  43.282 -20.142 1.00 53.51  ? 1283 ARG D C     1 
ATOM   8661  O O     . ARG F 5 86  ? 78.739  42.503 -20.955 1.00 52.38  ? 1283 ARG D O     1 
ATOM   8662  C CB    . ARG F 5 86  ? 80.212  45.116 -21.515 1.00 68.60  ? 1283 ARG D CB    1 
ATOM   8663  C CG    . ARG F 5 86  ? 81.381  46.002 -21.844 1.00 76.08  ? 1283 ARG D CG    1 
ATOM   8664  C CD    . ARG F 5 86  ? 81.407  47.185 -20.889 1.00 81.95  ? 1283 ARG D CD    1 
ATOM   8665  N NE    . ARG F 5 86  ? 82.587  48.040 -21.042 1.00 89.01  ? 1283 ARG D NE    1 
ATOM   8666  C CZ    . ARG F 5 86  ? 83.810  47.712 -20.632 1.00 92.53  ? 1283 ARG D CZ    1 
ATOM   8667  N NH1   . ARG F 5 86  ? 84.026  46.542 -20.038 1.00 96.02  ? 1283 ARG D NH1   1 
ATOM   8668  N NH2   . ARG F 5 86  ? 84.816  48.558 -20.809 1.00 95.37  ? 1283 ARG D NH2   1 
ATOM   8669  N N     . SER F 5 87  ? 78.651  43.504 -18.966 1.00 38.92  ? 1284 SER D N     1 
ATOM   8670  C CA    . SER F 5 87  ? 77.432  42.777 -18.615 1.00 38.78  ? 1284 SER D CA    1 
ATOM   8671  C C     . SER F 5 87  ? 76.140  43.574 -18.789 1.00 36.21  ? 1284 SER D C     1 
ATOM   8672  O O     . SER F 5 87  ? 75.043  43.071 -18.568 1.00 34.96  ? 1284 SER D O     1 
ATOM   8673  C CB    . SER F 5 87  ? 77.537  42.258 -17.177 1.00 32.64  ? 1284 SER D CB    1 
ATOM   8674  O OG    . SER F 5 87  ? 77.716  43.329 -16.289 1.00 33.30  ? 1284 SER D OG    1 
ATOM   8675  N N     . THR F 5 88  ? 76.267  44.819 -19.205 1.00 60.73  ? 1285 THR D N     1 
ATOM   8676  C CA    . THR F 5 88  ? 75.091  45.638 -19.373 1.00 59.95  ? 1285 THR D CA    1 
ATOM   8677  C C     . THR F 5 88  ? 74.955  46.135 -20.791 1.00 58.30  ? 1285 THR D C     1 
ATOM   8678  O O     . THR F 5 88  ? 75.940  46.509 -21.426 1.00 58.00  ? 1285 THR D O     1 
ATOM   8679  C CB    . THR F 5 88  ? 75.152  46.867 -18.476 1.00 49.88  ? 1285 THR D CB    1 
ATOM   8680  O OG1   . THR F 5 88  ? 75.479  46.469 -17.144 1.00 51.34  ? 1285 THR D OG1   1 
ATOM   8681  C CG2   . THR F 5 88  ? 73.824  47.581 -18.476 1.00 49.59  ? 1285 THR D CG2   1 
ATOM   8682  N N     . ILE F 5 89  ? 73.734  46.121 -21.298 1.00 25.35  ? 1286 ILE D N     1 
ATOM   8683  C CA    . ILE F 5 89  ? 73.506  46.657 -22.618 1.00 23.96  ? 1286 ILE D CA    1 
ATOM   8684  C C     . ILE F 5 89  ? 73.056  48.080 -22.333 1.00 23.67  ? 1286 ILE D C     1 
ATOM   8685  O O     . ILE F 5 89  ? 72.092  48.286 -21.575 1.00 24.66  ? 1286 ILE D O     1 
ATOM   8686  C CB    . ILE F 5 89  ? 72.373  45.928 -23.368 1.00 19.40  ? 1286 ILE D CB    1 
ATOM   8687  C CG1   . ILE F 5 89  ? 72.790  44.483 -23.672 1.00 20.68  ? 1286 ILE D CG1   1 
ATOM   8688  C CG2   . ILE F 5 89  ? 72.042  46.672 -24.669 1.00 19.46  ? 1286 ILE D CG2   1 
ATOM   8689  C CD1   . ILE F 5 89  ? 71.686  43.615 -24.289 1.00 20.04  ? 1286 ILE D CD1   1 
ATOM   8690  N N     . THR F 5 90  ? 73.770  49.044 -22.915 1.00 26.57  ? 1287 THR D N     1 
ATOM   8691  C CA    . THR F 5 90  ? 73.457  50.458 -22.770 1.00 28.24  ? 1287 THR D CA    1 
ATOM   8692  C C     . THR F 5 90  ? 73.076  51.089 -24.119 1.00 28.96  ? 1287 THR D C     1 
ATOM   8693  O O     . THR F 5 90  ? 73.043  50.412 -25.158 1.00 29.37  ? 1287 THR D O     1 
ATOM   8694  C CB    . THR F 5 90  ? 74.648  51.217 -22.221 1.00 44.27  ? 1287 THR D CB    1 
ATOM   8695  O OG1   . THR F 5 90  ? 75.769  51.039 -23.094 1.00 39.37  ? 1287 THR D OG1   1 
ATOM   8696  C CG2   . THR F 5 90  ? 75.002  50.698 -20.870 1.00 46.09  ? 1287 THR D CG2   1 
ATOM   8697  N N     . SER F 5 91  ? 72.801  52.391 -24.104 1.00 32.56  ? 1288 SER D N     1 
ATOM   8698  C CA    . SER F 5 91  ? 72.428  53.077 -25.324 1.00 32.61  ? 1288 SER D CA    1 
ATOM   8699  C C     . SER F 5 91  ? 73.612  53.030 -26.288 1.00 33.44  ? 1288 SER D C     1 
ATOM   8700  O O     . SER F 5 91  ? 73.451  53.125 -27.517 1.00 35.53  ? 1288 SER D O     1 
ATOM   8701  C CB    . SER F 5 91  ? 72.007  54.530 -25.025 1.00 40.41  ? 1288 SER D CB    1 
ATOM   8702  O OG    . SER F 5 91  ? 73.103  55.373 -24.694 1.00 42.10  ? 1288 SER D OG    1 
ATOM   8703  N N     . ARG F 5 92  ? 74.804  52.864 -25.729 1.00 33.00  ? 1289 ARG D N     1 
ATOM   8704  C CA    . ARG F 5 92  ? 75.994  52.792 -26.554 1.00 33.33  ? 1289 ARG D CA    1 
ATOM   8705  C C     . ARG F 5 92  ? 76.075  51.447 -27.329 1.00 33.62  ? 1289 ARG D C     1 
ATOM   8706  O O     . ARG F 5 92  ? 76.527  51.398 -28.469 1.00 29.36  ? 1289 ARG D O     1 
ATOM   8707  C CB    . ARG F 5 92  ? 77.227  53.021 -25.683 1.00 47.62  ? 1289 ARG D CB    1 
ATOM   8708  C CG    . ARG F 5 92  ? 78.474  53.325 -26.477 1.00 53.00  ? 1289 ARG D CG    1 
ATOM   8709  C CD    . ARG F 5 92  ? 79.618  53.777 -25.596 1.00 59.30  ? 1289 ARG D CD    1 
ATOM   8710  N NE    . ARG F 5 92  ? 80.802  54.079 -26.394 1.00 58.99  ? 1289 ARG D NE    1 
ATOM   8711  C CZ    . ARG F 5 92  ? 81.707  53.180 -26.778 1.00 58.78  ? 1289 ARG D CZ    1 
ATOM   8712  N NH1   . ARG F 5 92  ? 81.581  51.903 -26.429 1.00 55.71  ? 1289 ARG D NH1   1 
ATOM   8713  N NH2   . ARG F 5 92  ? 82.732  53.560 -27.535 1.00 59.78  ? 1289 ARG D NH2   1 
ATOM   8714  N N     . GLU F 5 93  ? 75.624  50.350 -26.736 1.00 48.69  ? 1290 GLU D N     1 
ATOM   8715  C CA    . GLU F 5 93  ? 75.676  49.097 -27.468 1.00 49.74  ? 1290 GLU D CA    1 
ATOM   8716  C C     . GLU F 5 93  ? 74.552  49.205 -28.496 1.00 47.92  ? 1290 GLU D C     1 
ATOM   8717  O O     . GLU F 5 93  ? 74.752  48.982 -29.696 1.00 47.67  ? 1290 GLU D O     1 
ATOM   8718  C CB    . GLU F 5 93  ? 75.437  47.900 -26.546 1.00 36.65  ? 1290 GLU D CB    1 
ATOM   8719  C CG    . GLU F 5 93  ? 75.750  48.152 -25.070 1.00 45.66  ? 1290 GLU D CG    1 
ATOM   8720  C CD    . GLU F 5 93  ? 77.154  48.664 -24.830 1.00 43.89  ? 1290 GLU D CD    1 
ATOM   8721  O OE1   . GLU F 5 93  ? 78.085  47.853 -24.674 1.00 46.93  ? 1290 GLU D OE1   1 
ATOM   8722  O OE2   . GLU F 5 93  ? 77.330  49.892 -24.802 1.00 47.28  ? 1290 GLU D OE2   1 
ATOM   8723  N N     . ILE F 5 94  ? 73.369  49.575 -28.019 1.00 29.03  ? 1291 ILE D N     1 
ATOM   8724  C CA    . ILE F 5 94  ? 72.213  49.721 -28.894 1.00 26.28  ? 1291 ILE D CA    1 
ATOM   8725  C C     . ILE F 5 94  ? 72.579  50.487 -30.169 1.00 27.52  ? 1291 ILE D C     1 
ATOM   8726  O O     . ILE F 5 94  ? 72.247  50.091 -31.294 1.00 27.58  ? 1291 ILE D O     1 
ATOM   8727  C CB    . ILE F 5 94  ? 71.084  50.482 -28.180 1.00 31.10  ? 1291 ILE D CB    1 
ATOM   8728  C CG1   . ILE F 5 94  ? 70.604  49.681 -26.978 1.00 33.01  ? 1291 ILE D CG1   1 
ATOM   8729  C CG2   . ILE F 5 94  ? 69.923  50.693 -29.124 1.00 26.02  ? 1291 ILE D CG2   1 
ATOM   8730  C CD1   . ILE F 5 94  ? 70.024  48.315 -27.352 1.00 33.12  ? 1291 ILE D CD1   1 
ATOM   8731  N N     . GLN F 5 95  ? 73.277  51.595 -29.979 1.00 26.30  ? 1292 GLN D N     1 
ATOM   8732  C CA    . GLN F 5 95  ? 73.668  52.422 -31.091 1.00 26.09  ? 1292 GLN D CA    1 
ATOM   8733  C C     . GLN F 5 95  ? 74.618  51.728 -32.064 1.00 22.99  ? 1292 GLN D C     1 
ATOM   8734  O O     . GLN F 5 95  ? 74.459  51.837 -33.276 1.00 24.28  ? 1292 GLN D O     1 
ATOM   8735  C CB    . GLN F 5 95  ? 74.301  53.686 -30.557 1.00 42.67  ? 1292 GLN D CB    1 
ATOM   8736  C CG    . GLN F 5 95  ? 74.325  54.769 -31.563 1.00 43.35  ? 1292 GLN D CG    1 
ATOM   8737  C CD    . GLN F 5 95  ? 75.253  55.853 -31.172 1.00 43.93  ? 1292 GLN D CD    1 
ATOM   8738  O OE1   . GLN F 5 95  ? 76.454  55.625 -31.078 1.00 46.78  ? 1292 GLN D OE1   1 
ATOM   8739  N NE2   . GLN F 5 95  ? 74.716  57.049 -30.926 1.00 36.99  ? 1292 GLN D NE2   1 
ATOM   8740  N N     . THR F 5 96  ? 75.615  51.024 -31.533 1.00 27.45  ? 1293 THR D N     1 
ATOM   8741  C CA    . THR F 5 96  ? 76.574  50.337 -32.388 1.00 29.38  ? 1293 THR D CA    1 
ATOM   8742  C C     . THR F 5 96  ? 75.842  49.325 -33.219 1.00 27.00  ? 1293 THR D C     1 
ATOM   8743  O O     . THR F 5 96  ? 76.109  49.180 -34.391 1.00 27.60  ? 1293 THR D O     1 
ATOM   8744  C CB    . THR F 5 96  ? 77.627  49.576 -31.594 1.00 31.86  ? 1293 THR D CB    1 
ATOM   8745  O OG1   . THR F 5 96  ? 78.209  50.437 -30.616 1.00 33.66  ? 1293 THR D OG1   1 
ATOM   8746  C CG2   . THR F 5 96  ? 78.713  49.089 -32.516 1.00 30.44  ? 1293 THR D CG2   1 
ATOM   8747  N N     . ALA F 5 97  ? 74.915  48.618 -32.592 1.00 32.82  ? 1294 ALA D N     1 
ATOM   8748  C CA    . ALA F 5 97  ? 74.134  47.598 -33.275 1.00 33.45  ? 1294 ALA D CA    1 
ATOM   8749  C C     . ALA F 5 97  ? 73.366  48.200 -34.438 1.00 34.67  ? 1294 ALA D C     1 
ATOM   8750  O O     . ALA F 5 97  ? 73.332  47.660 -35.544 1.00 35.62  ? 1294 ALA D O     1 
ATOM   8751  C CB    . ALA F 5 97  ? 73.174  46.975 -32.308 1.00 20.32  ? 1294 ALA D CB    1 
ATOM   8752  N N     . VAL F 5 98  ? 72.721  49.318 -34.168 1.00 17.23  ? 1295 VAL D N     1 
ATOM   8753  C CA    . VAL F 5 98  ? 71.952  50.015 -35.184 1.00 16.75  ? 1295 VAL D CA    1 
ATOM   8754  C C     . VAL F 5 98  ? 72.832  50.363 -36.378 1.00 15.50  ? 1295 VAL D C     1 
ATOM   8755  O O     . VAL F 5 98  ? 72.351  50.465 -37.492 1.00 14.97  ? 1295 VAL D O     1 
ATOM   8756  C CB    . VAL F 5 98  ? 71.373  51.304 -34.601 1.00 14.11  ? 1295 VAL D CB    1 
ATOM   8757  C CG1   . VAL F 5 98  ? 71.002  52.244 -35.715 1.00 13.35  ? 1295 VAL D CG1   1 
ATOM   8758  C CG2   . VAL F 5 98  ? 70.186  50.977 -33.687 1.00 11.63  ? 1295 VAL D CG2   1 
ATOM   8759  N N     . ARG F 5 99  ? 74.123  50.558 -36.113 1.00 25.00  ? 1296 ARG D N     1 
ATOM   8760  C CA    . ARG F 5 99  ? 75.111  50.890 -37.131 1.00 26.62  ? 1296 ARG D CA    1 
ATOM   8761  C C     . ARG F 5 99  ? 75.518  49.629 -37.862 1.00 27.33  ? 1296 ARG D C     1 
ATOM   8762  O O     . ARG F 5 99  ? 75.629  49.631 -39.076 1.00 26.78  ? 1296 ARG D O     1 
ATOM   8763  C CB    . ARG F 5 99  ? 76.338  51.535 -36.499 1.00 61.42  ? 1296 ARG D CB    1 
ATOM   8764  C CG    . ARG F 5 99  ? 76.132  52.960 -36.061 1.00 68.64  ? 1296 ARG D CG    1 
ATOM   8765  C CD    . ARG F 5 99  ? 76.196  53.890 -37.255 1.00 75.09  ? 1296 ARG D CD    1 
ATOM   8766  N NE    . ARG F 5 99  ? 76.192  55.298 -36.859 1.00 79.04  ? 1296 ARG D NE    1 
ATOM   8767  C CZ    . ARG F 5 99  ? 77.087  55.846 -36.040 1.00 80.96  ? 1296 ARG D CZ    1 
ATOM   8768  N NH1   . ARG F 5 99  ? 78.063  55.109 -35.529 1.00 78.72  ? 1296 ARG D NH1   1 
ATOM   8769  N NH2   . ARG F 5 99  ? 77.004  57.131 -35.727 1.00 83.15  ? 1296 ARG D NH2   1 
ATOM   8770  N N     . LEU F 5 100 ? 75.739  48.545 -37.134 1.00 29.75  ? 1297 LEU D N     1 
ATOM   8771  C CA    . LEU F 5 100 ? 76.092  47.283 -37.788 1.00 31.75  ? 1297 LEU D CA    1 
ATOM   8772  C C     . LEU F 5 100 ? 74.938  46.770 -38.656 1.00 32.71  ? 1297 LEU D C     1 
ATOM   8773  O O     . LEU F 5 100 ? 75.146  46.354 -39.796 1.00 32.23  ? 1297 LEU D O     1 
ATOM   8774  C CB    . LEU F 5 100 ? 76.433  46.217 -36.759 1.00 23.96  ? 1297 LEU D CB    1 
ATOM   8775  C CG    . LEU F 5 100 ? 77.632  46.579 -35.914 1.00 25.79  ? 1297 LEU D CG    1 
ATOM   8776  C CD1   . LEU F 5 100 ? 77.668  45.714 -34.711 1.00 23.97  ? 1297 LEU D CD1   1 
ATOM   8777  C CD2   . LEU F 5 100 ? 78.889  46.446 -36.736 1.00 25.53  ? 1297 LEU D CD2   1 
ATOM   8778  N N     . LEU F 5 101 ? 73.733  46.839 -38.104 1.00 35.29  ? 1298 LEU D N     1 
ATOM   8779  C CA    . LEU F 5 101 ? 72.507  46.376 -38.741 1.00 35.11  ? 1298 LEU D CA    1 
ATOM   8780  C C     . LEU F 5 101 ? 71.944  47.122 -39.967 1.00 36.87  ? 1298 LEU D C     1 
ATOM   8781  O O     . LEU F 5 101 ? 71.716  46.528 -41.026 1.00 38.68  ? 1298 LEU D O     1 
ATOM   8782  C CB    . LEU F 5 101 ? 71.423  46.317 -37.672 1.00 43.59  ? 1298 LEU D CB    1 
ATOM   8783  C CG    . LEU F 5 101 ? 70.420  45.172 -37.718 1.00 48.61  ? 1298 LEU D CG    1 
ATOM   8784  C CD1   . LEU F 5 101 ? 69.698  45.200 -39.037 1.00 50.47  ? 1298 LEU D CD1   1 
ATOM   8785  C CD2   . LEU F 5 101 ? 71.143  43.851 -37.499 1.00 46.34  ? 1298 LEU D CD2   1 
ATOM   8786  N N     . LEU F 5 102 ? 71.701  48.416 -39.819 1.00 25.88  ? 1299 LEU D N     1 
ATOM   8787  C CA    . LEU F 5 102 ? 71.115  49.212 -40.892 1.00 27.28  ? 1299 LEU D CA    1 
ATOM   8788  C C     . LEU F 5 102 ? 72.047  49.901 -41.879 1.00 27.34  ? 1299 LEU D C     1 
ATOM   8789  O O     . LEU F 5 102 ? 73.121  50.390 -41.528 1.00 29.84  ? 1299 LEU D O     1 
ATOM   8790  C CB    . LEU F 5 102 ? 70.189  50.275 -40.295 1.00 39.15  ? 1299 LEU D CB    1 
ATOM   8791  C CG    . LEU F 5 102 ? 69.362  49.839 -39.085 1.00 42.46  ? 1299 LEU D CG    1 
ATOM   8792  C CD1   . LEU F 5 102 ? 68.651  51.023 -38.453 1.00 38.56  ? 1299 LEU D CD1   1 
ATOM   8793  C CD2   . LEU F 5 102 ? 68.376  48.806 -39.540 1.00 37.84  ? 1299 LEU D CD2   1 
ATOM   8794  N N     . PRO F 5 103 ? 71.645  49.910 -43.152 1.00 32.27  ? 1300 PRO D N     1 
ATOM   8795  C CA    . PRO F 5 103 ? 72.309  50.502 -44.302 1.00 34.94  ? 1300 PRO D CA    1 
ATOM   8796  C C     . PRO F 5 103 ? 72.484  52.002 -44.178 1.00 33.44  ? 1300 PRO D C     1 
ATOM   8797  O O     . PRO F 5 103 ? 71.773  52.677 -43.427 1.00 37.12  ? 1300 PRO D O     1 
ATOM   8798  C CB    . PRO F 5 103 ? 71.376  50.138 -45.430 1.00 59.35  ? 1300 PRO D CB    1 
ATOM   8799  C CG    . PRO F 5 103 ? 71.032  48.762 -45.103 1.00 59.94  ? 1300 PRO D CG    1 
ATOM   8800  C CD    . PRO F 5 103 ? 70.881  48.727 -43.592 1.00 57.44  ? 1300 PRO D CD    1 
ATOM   8801  N N     . GLY F 5 104 ? 73.430  52.505 -44.957 1.00 24.41  ? 1301 GLY D N     1 
ATOM   8802  C CA    . GLY F 5 104 ? 73.732  53.915 -44.986 1.00 23.52  ? 1301 GLY D CA    1 
ATOM   8803  C C     . GLY F 5 104 ? 72.785  54.948 -44.401 1.00 24.56  ? 1301 GLY D C     1 
ATOM   8804  O O     . GLY F 5 104 ? 72.854  55.318 -43.218 1.00 26.15  ? 1301 GLY D O     1 
ATOM   8805  N N     . GLU F 5 105 ? 71.892  55.429 -45.244 1.00 35.92  ? 1302 GLU D N     1 
ATOM   8806  C CA    . GLU F 5 105 ? 70.987  56.469 -44.829 1.00 35.87  ? 1302 GLU D CA    1 
ATOM   8807  C C     . GLU F 5 105 ? 70.116  56.129 -43.630 1.00 38.01  ? 1302 GLU D C     1 
ATOM   8808  O O     . GLU F 5 105 ? 69.908  56.970 -42.754 1.00 36.70  ? 1302 GLU D O     1 
ATOM   8809  C CB    . GLU F 5 105 ? 70.122  56.883 -46.006 1.00 46.89  ? 1302 GLU D CB    1 
ATOM   8810  C CG    . GLU F 5 105 ? 69.524  58.240 -45.827 1.00 56.46  ? 1302 GLU D CG    1 
ATOM   8811  C CD    . GLU F 5 105 ? 70.556  59.259 -45.387 1.00 58.34  ? 1302 GLU D CD    1 
ATOM   8812  O OE1   . GLU F 5 105 ? 71.677  59.247 -45.937 1.00 59.09  ? 1302 GLU D OE1   1 
ATOM   8813  O OE2   . GLU F 5 105 ? 70.248  60.079 -44.496 1.00 63.90  ? 1302 GLU D OE2   1 
ATOM   8814  N N     . LEU F 5 106 ? 69.612  54.900 -43.580 1.00 35.62  ? 1303 LEU D N     1 
ATOM   8815  C CA    . LEU F 5 106 ? 68.748  54.503 -42.485 1.00 32.24  ? 1303 LEU D CA    1 
ATOM   8816  C C     . LEU F 5 106 ? 69.476  54.601 -41.164 1.00 30.73  ? 1303 LEU D C     1 
ATOM   8817  O O     . LEU F 5 106 ? 68.981  55.222 -40.229 1.00 30.93  ? 1303 LEU D O     1 
ATOM   8818  C CB    . LEU F 5 106 ? 68.222  53.083 -42.701 1.00 10.99  ? 1303 LEU D CB    1 
ATOM   8819  C CG    . LEU F 5 106 ? 66.971  52.924 -43.577 1.00 11.33  ? 1303 LEU D CG    1 
ATOM   8820  C CD1   . LEU F 5 106 ? 66.550  51.446 -43.758 1.00 7.29   ? 1303 LEU D CD1   1 
ATOM   8821  C CD2   . LEU F 5 106 ? 65.868  53.701 -42.906 1.00 8.56   ? 1303 LEU D CD2   1 
ATOM   8822  N N     . ALA F 5 107 ? 70.660  54.003 -41.093 1.00 37.38  ? 1304 ALA D N     1 
ATOM   8823  C CA    . ALA F 5 107 ? 71.451  54.031 -39.871 1.00 38.61  ? 1304 ALA D CA    1 
ATOM   8824  C C     . ALA F 5 107 ? 71.698  55.475 -39.415 1.00 42.43  ? 1304 ALA D C     1 
ATOM   8825  O O     . ALA F 5 107 ? 71.402  55.851 -38.267 1.00 41.61  ? 1304 ALA D O     1 
ATOM   8826  C CB    . ALA F 5 107 ? 72.779  53.311 -40.103 1.00 22.43  ? 1304 ALA D CB    1 
ATOM   8827  N N     . LYS F 5 108 ? 72.242  56.283 -40.324 1.00 33.15  ? 1305 LYS D N     1 
ATOM   8828  C CA    . LYS F 5 108 ? 72.517  57.672 -40.006 1.00 35.27  ? 1305 LYS D CA    1 
ATOM   8829  C C     . LYS F 5 108 ? 71.345  58.281 -39.301 1.00 36.44  ? 1305 LYS D C     1 
ATOM   8830  O O     . LYS F 5 108 ? 71.483  58.759 -38.194 1.00 34.63  ? 1305 LYS D O     1 
ATOM   8831  C CB    . LYS F 5 108 ? 72.839  58.476 -41.262 1.00 46.98  ? 1305 LYS D CB    1 
ATOM   8832  C CG    . LYS F 5 108 ? 74.295  58.415 -41.661 1.00 56.97  ? 1305 LYS D CG    1 
ATOM   8833  C CD    . LYS F 5 108 ? 74.589  59.400 -42.790 1.00 61.23  ? 1305 LYS D CD    1 
ATOM   8834  C CE    . LYS F 5 108 ? 73.922  58.996 -44.129 1.00 64.75  ? 1305 LYS D CE    1 
ATOM   8835  N NZ    . LYS F 5 108 ? 74.048  60.034 -45.217 1.00 69.21  ? 1305 LYS D NZ    1 
ATOM   8836  N N     . HIS F 5 109 ? 70.182  58.242 -39.925 1.00 29.88  ? 1306 HIS D N     1 
ATOM   8837  C CA    . HIS F 5 109 ? 69.017  58.829 -39.298 1.00 31.60  ? 1306 HIS D CA    1 
ATOM   8838  C C     . HIS F 5 109 ? 68.573  58.164 -38.011 1.00 30.04  ? 1306 HIS D C     1 
ATOM   8839  O O     . HIS F 5 109 ? 68.114  58.842 -37.082 1.00 28.33  ? 1306 HIS D O     1 
ATOM   8840  C CB    . HIS F 5 109 ? 67.866  58.883 -40.284 1.00 62.95  ? 1306 HIS D CB    1 
ATOM   8841  C CG    . HIS F 5 109 ? 68.053  59.916 -41.346 1.00 69.62  ? 1306 HIS D CG    1 
ATOM   8842  N ND1   . HIS F 5 109 ? 67.031  60.335 -42.169 1.00 73.85  ? 1306 HIS D ND1   1 
ATOM   8843  C CD2   . HIS F 5 109 ? 69.150  60.612 -41.723 1.00 71.81  ? 1306 HIS D CD2   1 
ATOM   8844  C CE1   . HIS F 5 109 ? 67.491  61.243 -43.010 1.00 73.90  ? 1306 HIS D CE1   1 
ATOM   8845  N NE2   . HIS F 5 109 ? 68.775  61.429 -42.759 1.00 73.73  ? 1306 HIS D NE2   1 
ATOM   8846  N N     . ALA F 5 110 ? 68.729  56.842 -37.950 1.00 28.71  ? 1307 ALA D N     1 
ATOM   8847  C CA    . ALA F 5 110 ? 68.350  56.052 -36.777 1.00 26.49  ? 1307 ALA D CA    1 
ATOM   8848  C C     . ALA F 5 110 ? 69.098  56.532 -35.550 1.00 27.37  ? 1307 ALA D C     1 
ATOM   8849  O O     . ALA F 5 110 ? 68.523  56.712 -34.487 1.00 26.85  ? 1307 ALA D O     1 
ATOM   8850  C CB    . ALA F 5 110 ? 68.654  54.575 -37.029 1.00 29.44  ? 1307 ALA D CB    1 
ATOM   8851  N N     . VAL F 5 111 ? 70.395  56.732 -35.697 1.00 35.07  ? 1308 VAL D N     1 
ATOM   8852  C CA    . VAL F 5 111 ? 71.200  57.192 -34.575 1.00 38.60  ? 1308 VAL D CA    1 
ATOM   8853  C C     . VAL F 5 111 ? 70.620  58.482 -34.020 1.00 40.06  ? 1308 VAL D C     1 
ATOM   8854  O O     . VAL F 5 111 ? 70.446  58.649 -32.806 1.00 36.32  ? 1308 VAL D O     1 
ATOM   8855  C CB    . VAL F 5 111 ? 72.628  57.467 -35.011 1.00 29.46  ? 1308 VAL D CB    1 
ATOM   8856  C CG1   . VAL F 5 111 ? 73.493  57.669 -33.804 1.00 30.22  ? 1308 VAL D CG1   1 
ATOM   8857  C CG2   . VAL F 5 111 ? 73.129  56.316 -35.867 1.00 29.11  ? 1308 VAL D CG2   1 
ATOM   8858  N N     . SER F 5 112 ? 70.318  59.402 -34.923 1.00 38.82  ? 1309 SER D N     1 
ATOM   8859  C CA    . SER F 5 112 ? 69.761  60.664 -34.501 1.00 40.71  ? 1309 SER D CA    1 
ATOM   8860  C C     . SER F 5 112 ? 68.555  60.494 -33.630 1.00 40.64  ? 1309 SER D C     1 
ATOM   8861  O O     . SER F 5 112 ? 68.534  60.920 -32.487 1.00 40.18  ? 1309 SER D O     1 
ATOM   8862  C CB    . SER F 5 112 ? 69.391  61.506 -35.693 1.00 42.40  ? 1309 SER D CB    1 
ATOM   8863  O OG    . SER F 5 112 ? 70.576  62.036 -36.234 1.00 50.86  ? 1309 SER D OG    1 
ATOM   8864  N N     . GLU F 5 113 ? 67.534  59.874 -34.174 1.00 40.38  ? 1310 GLU D N     1 
ATOM   8865  C CA    . GLU F 5 113 ? 66.333  59.688 -33.402 1.00 41.94  ? 1310 GLU D CA    1 
ATOM   8866  C C     . GLU F 5 113 ? 66.618  59.139 -32.008 1.00 40.93  ? 1310 GLU D C     1 
ATOM   8867  O O     . GLU F 5 113 ? 66.083  59.620 -31.015 1.00 39.48  ? 1310 GLU D O     1 
ATOM   8868  C CB    . GLU F 5 113 ? 65.403  58.748 -34.155 1.00 42.76  ? 1310 GLU D CB    1 
ATOM   8869  C CG    . GLU F 5 113 ? 64.951  59.297 -35.481 1.00 47.20  ? 1310 GLU D CG    1 
ATOM   8870  C CD    . GLU F 5 113 ? 63.880  60.368 -35.345 1.00 53.69  ? 1310 GLU D CD    1 
ATOM   8871  O OE1   . GLU F 5 113 ? 64.174  61.457 -34.800 1.00 53.08  ? 1310 GLU D OE1   1 
ATOM   8872  O OE2   . GLU F 5 113 ? 62.734  60.110 -35.788 1.00 56.02  ? 1310 GLU D OE2   1 
ATOM   8873  N N     . GLY F 5 114 ? 67.476  58.138 -31.939 1.00 28.95  ? 1311 GLY D N     1 
ATOM   8874  C CA    . GLY F 5 114 ? 67.769  57.525 -30.661 1.00 28.45  ? 1311 GLY D CA    1 
ATOM   8875  C C     . GLY F 5 114 ? 68.563  58.418 -29.758 1.00 27.20  ? 1311 GLY D C     1 
ATOM   8876  O O     . GLY F 5 114 ? 68.343  58.461 -28.560 1.00 26.99  ? 1311 GLY D O     1 
ATOM   8877  N N     . THR F 5 115 ? 69.524  59.117 -30.326 1.00 16.27  ? 1312 THR D N     1 
ATOM   8878  C CA    . THR F 5 115 ? 70.289  60.017 -29.501 1.00 20.52  ? 1312 THR D CA    1 
ATOM   8879  C C     . THR F 5 115 ? 69.325  61.073 -28.985 1.00 21.44  ? 1312 THR D C     1 
ATOM   8880  O O     . THR F 5 115 ? 69.342  61.450 -27.826 1.00 22.38  ? 1312 THR D O     1 
ATOM   8881  C CB    . THR F 5 115 ? 71.325  60.777 -30.282 1.00 30.22  ? 1312 THR D CB    1 
ATOM   8882  O OG1   . THR F 5 115 ? 72.158  59.866 -30.997 1.00 31.30  ? 1312 THR D OG1   1 
ATOM   8883  C CG2   . THR F 5 115 ? 72.143  61.640 -29.308 1.00 29.66  ? 1312 THR D CG2   1 
ATOM   8884  N N     . LYS F 5 116 ? 68.533  61.579 -29.916 1.00 30.46  ? 1313 LYS D N     1 
ATOM   8885  C CA    . LYS F 5 116 ? 67.541  62.585 -29.649 1.00 33.92  ? 1313 LYS D CA    1 
ATOM   8886  C C     . LYS F 5 116 ? 66.743  62.153 -28.424 1.00 31.89  ? 1313 LYS D C     1 
ATOM   8887  O O     . LYS F 5 116 ? 66.718  62.838 -27.407 1.00 30.17  ? 1313 LYS D O     1 
ATOM   8888  C CB    . LYS F 5 116 ? 66.603  62.696 -30.855 1.00 45.91  ? 1313 LYS D CB    1 
ATOM   8889  C CG    . LYS F 5 116 ? 65.744  63.944 -30.880 1.00 53.28  ? 1313 LYS D CG    1 
ATOM   8890  C CD    . LYS F 5 116 ? 66.304  64.991 -31.829 1.00 60.99  ? 1313 LYS D CD    1 
ATOM   8891  C CE    . LYS F 5 116 ? 65.317  66.129 -31.978 1.00 66.13  ? 1313 LYS D CE    1 
ATOM   8892  N NZ    . LYS F 5 116 ? 63.991  65.598 -32.434 1.00 70.52  ? 1313 LYS D NZ    1 
ATOM   8893  N N     . ALA F 5 117 ? 66.084  61.010 -28.535 1.00 25.98  ? 1314 ALA D N     1 
ATOM   8894  C CA    . ALA F 5 117 ? 65.268  60.497 -27.457 1.00 25.23  ? 1314 ALA D CA    1 
ATOM   8895  C C     . ALA F 5 117 ? 66.049  60.393 -26.144 1.00 27.60  ? 1314 ALA D C     1 
ATOM   8896  O O     . ALA F 5 117 ? 65.585  60.841 -25.084 1.00 27.00  ? 1314 ALA D O     1 
ATOM   8897  C CB    . ALA F 5 117 ? 64.681  59.115 -27.858 1.00 17.51  ? 1314 ALA D CB    1 
ATOM   8898  N N     . VAL F 5 118 ? 67.234  59.808 -26.208 1.00 37.11  ? 1315 VAL D N     1 
ATOM   8899  C CA    . VAL F 5 118 ? 68.015  59.637 -24.999 1.00 37.05  ? 1315 VAL D CA    1 
ATOM   8900  C C     . VAL F 5 118 ? 68.260  60.971 -24.324 1.00 37.21  ? 1315 VAL D C     1 
ATOM   8901  O O     . VAL F 5 118 ? 67.998  61.116 -23.125 1.00 36.64  ? 1315 VAL D O     1 
ATOM   8902  C CB    . VAL F 5 118 ? 69.344  58.918 -25.287 1.00 34.24  ? 1315 VAL D CB    1 
ATOM   8903  C CG1   . VAL F 5 118 ? 70.225  58.927 -24.052 1.00 30.12  ? 1315 VAL D CG1   1 
ATOM   8904  C CG2   . VAL F 5 118 ? 69.043  57.469 -25.708 1.00 31.66  ? 1315 VAL D CG2   1 
ATOM   8905  N N     . THR F 5 119 ? 68.746  61.931 -25.110 1.00 17.70  ? 1316 THR D N     1 
ATOM   8906  C CA    . THR F 5 119 ? 69.013  63.295 -24.662 1.00 20.82  ? 1316 THR D CA    1 
ATOM   8907  C C     . THR F 5 119 ? 67.762  63.881 -24.031 1.00 21.90  ? 1316 THR D C     1 
ATOM   8908  O O     . THR F 5 119 ? 67.807  64.342 -22.907 1.00 24.28  ? 1316 THR D O     1 
ATOM   8909  C CB    . THR F 5 119 ? 69.416  64.190 -25.822 1.00 42.32  ? 1316 THR D CB    1 
ATOM   8910  O OG1   . THR F 5 119 ? 70.658  63.740 -26.376 1.00 43.67  ? 1316 THR D OG1   1 
ATOM   8911  C CG2   . THR F 5 119 ? 69.575  65.601 -25.347 1.00 44.51  ? 1316 THR D CG2   1 
ATOM   8912  N N     . LYS F 5 120 ? 66.641  63.852 -24.748 1.00 51.08  ? 1317 LYS D N     1 
ATOM   8913  C CA    . LYS F 5 120 ? 65.390  64.368 -24.202 1.00 51.65  ? 1317 LYS D CA    1 
ATOM   8914  C C     . LYS F 5 120 ? 64.957  63.622 -22.931 1.00 52.53  ? 1317 LYS D C     1 
ATOM   8915  O O     . LYS F 5 120 ? 64.427  64.235 -21.993 1.00 53.88  ? 1317 LYS D O     1 
ATOM   8916  C CB    . LYS F 5 120 ? 64.265  64.319 -25.257 1.00 33.16  ? 1317 LYS D CB    1 
ATOM   8917  C CG    . LYS F 5 120 ? 62.873  64.458 -24.642 1.00 36.47  ? 1317 LYS D CG    1 
ATOM   8918  C CD    . LYS F 5 120 ? 61.845  65.266 -25.451 1.00 39.61  ? 1317 LYS D CD    1 
ATOM   8919  C CE    . LYS F 5 120 ? 60.488  65.283 -24.677 1.00 42.94  ? 1317 LYS D CE    1 
ATOM   8920  N NZ    . LYS F 5 120 ? 59.295  65.901 -25.364 1.00 50.17  ? 1317 LYS D NZ    1 
ATOM   8921  N N     . TYR F 5 121 ? 65.185  62.311 -22.890 1.00 34.26  ? 1318 TYR D N     1 
ATOM   8922  C CA    . TYR F 5 121 ? 64.798  61.515 -21.717 1.00 34.78  ? 1318 TYR D CA    1 
ATOM   8923  C C     . TYR F 5 121 ? 65.699  61.817 -20.518 1.00 37.75  ? 1318 TYR D C     1 
ATOM   8924  O O     . TYR F 5 121 ? 65.270  61.775 -19.360 1.00 35.17  ? 1318 TYR D O     1 
ATOM   8925  C CB    . TYR F 5 121 ? 64.886  60.029 -22.030 1.00 43.17  ? 1318 TYR D CB    1 
ATOM   8926  C CG    . TYR F 5 121 ? 64.550  59.145 -20.847 1.00 41.63  ? 1318 TYR D CG    1 
ATOM   8927  C CD1   . TYR F 5 121 ? 63.229  58.827 -20.540 1.00 39.84  ? 1318 TYR D CD1   1 
ATOM   8928  C CD2   . TYR F 5 121 ? 65.560  58.610 -20.047 1.00 40.30  ? 1318 TYR D CD2   1 
ATOM   8929  C CE1   . TYR F 5 121 ? 62.919  57.982 -19.459 1.00 42.67  ? 1318 TYR D CE1   1 
ATOM   8930  C CE2   . TYR F 5 121 ? 65.271  57.779 -18.973 1.00 41.02  ? 1318 TYR D CE2   1 
ATOM   8931  C CZ    . TYR F 5 121 ? 63.949  57.467 -18.682 1.00 42.30  ? 1318 TYR D CZ    1 
ATOM   8932  O OH    . TYR F 5 121 ? 63.671  56.651 -17.609 1.00 48.58  ? 1318 TYR D OH    1 
ATOM   8933  N N     . THR F 5 122 ? 66.959  62.102 -20.821 1.00 52.30  ? 1319 THR D N     1 
ATOM   8934  C CA    . THR F 5 122 ? 67.944  62.421 -19.812 1.00 57.86  ? 1319 THR D CA    1 
ATOM   8935  C C     . THR F 5 122 ? 67.664  63.786 -19.233 1.00 60.84  ? 1319 THR D C     1 
ATOM   8936  O O     . THR F 5 122 ? 67.476  63.920 -18.028 1.00 61.99  ? 1319 THR D O     1 
ATOM   8937  C CB    . THR F 5 122 ? 69.353  62.418 -20.406 1.00 81.64  ? 1319 THR D CB    1 
ATOM   8938  O OG1   . THR F 5 122 ? 69.760  61.069 -20.642 1.00 82.72  ? 1319 THR D OG1   1 
ATOM   8939  C CG2   . THR F 5 122 ? 70.330  63.083 -19.467 1.00 83.49  ? 1319 THR D CG2   1 
ATOM   8940  N N     . SER F 5 123 ? 67.623  64.794 -20.101 1.00 54.99  ? 1320 SER D N     1 
ATOM   8941  C CA    . SER F 5 123 ? 67.383  66.181 -19.686 1.00 58.40  ? 1320 SER D CA    1 
ATOM   8942  C C     . SER F 5 123 ? 65.992  66.441 -19.143 1.00 61.21  ? 1320 SER D C     1 
ATOM   8943  O O     . SER F 5 123 ? 65.582  67.597 -19.040 1.00 61.77  ? 1320 SER D O     1 
ATOM   8944  C CB    . SER F 5 123 ? 67.612  67.147 -20.853 1.00 75.14  ? 1320 SER D CB    1 
ATOM   8945  O OG    . SER F 5 123 ? 66.497  67.158 -21.731 1.00 73.62  ? 1320 SER D OG    1 
ATOM   8946  N N     . ALA F 5 124 ? 65.273  65.383 -18.783 1.00 90.56  ? 1321 ALA D N     1 
ATOM   8947  C CA    . ALA F 5 124 ? 63.916  65.541 -18.283 1.00 94.53  ? 1321 ALA D CA    1 
ATOM   8948  C C     . ALA F 5 124 ? 63.648  64.928 -16.915 1.00 98.96  ? 1321 ALA D C     1 
ATOM   8949  O O     . ALA F 5 124 ? 62.769  64.082 -16.781 1.00 101.14 ? 1321 ALA D O     1 
ATOM   8950  C CB    . ALA F 5 124 ? 62.920  64.976 -19.311 1.00 59.40  ? 1321 ALA D CB    1 
ATOM   8951  N N     . LYS F 5 125 ? 64.388  65.362 -15.899 1.00 163.86 ? 1322 LYS D N     1 
ATOM   8952  C CA    . LYS F 5 125 ? 64.192  64.852 -14.543 1.00 166.82 ? 1322 LYS D CA    1 
ATOM   8953  C C     . LYS F 5 125 ? 65.298  65.356 -13.627 1.00 168.61 ? 1322 LYS D C     1 
ATOM   8954  O O     . LYS F 5 125 ? 66.063  64.507 -13.111 1.00 123.77 ? 1322 LYS D O     1 
ATOM   8955  C CB    . LYS F 5 125 ? 64.171  63.317 -14.539 1.00 87.58  ? 1322 LYS D CB    1 
ATOM   8956  C CG    . LYS F 5 125 ? 63.521  62.684 -13.303 1.00 86.90  ? 1322 LYS D CG    1 
ATOM   8957  C CD    . LYS F 5 125 ? 63.297  61.186 -13.501 1.00 87.62  ? 1322 LYS D CD    1 
ATOM   8958  C CE    . LYS F 5 125 ? 62.463  60.577 -12.393 1.00 87.27  ? 1322 LYS D CE    1 
ATOM   8959  N NZ    . LYS F 5 125 ? 62.173  59.145 -12.669 1.00 87.36  ? 1322 LYS D NZ    1 
ATOM   8960  O OXT   . LYS F 5 125 ? 65.382  66.595 -13.445 1.00 44.87  ? 1322 LYS D OXT   1 
ATOM   8961  N N     . LYS G 2 37  ? 41.927  32.376 -91.029 1.00 108.83 ? 637  LYS E N     1 
ATOM   8962  C CA    . LYS G 2 37  ? 41.151  33.647 -91.088 1.00 110.38 ? 637  LYS E CA    1 
ATOM   8963  C C     . LYS G 2 37  ? 40.843  34.141 -89.683 1.00 108.93 ? 637  LYS E C     1 
ATOM   8964  O O     . LYS G 2 37  ? 40.975  35.330 -89.397 1.00 106.18 ? 637  LYS E O     1 
ATOM   8965  C CB    . LYS G 2 37  ? 39.845  33.437 -91.853 1.00 80.76  ? 637  LYS E CB    1 
ATOM   8966  C CG    . LYS G 2 37  ? 39.310  34.690 -92.525 1.00 88.62  ? 637  LYS E CG    1 
ATOM   8967  C CD    . LYS G 2 37  ? 38.228  34.315 -93.515 1.00 93.62  ? 637  LYS E CD    1 
ATOM   8968  C CE    . LYS G 2 37  ? 37.870  35.467 -94.417 1.00 100.16 ? 637  LYS E CE    1 
ATOM   8969  N NZ    . LYS G 2 37  ? 36.891  35.036 -95.450 1.00 104.81 ? 637  LYS E NZ    1 
ATOM   8970  N N     . PRO G 2 38  ? 40.412  33.234 -88.787 1.00 166.79 ? 638  PRO E N     1 
ATOM   8971  C CA    . PRO G 2 38  ? 40.100  33.636 -87.410 1.00 165.04 ? 638  PRO E CA    1 
ATOM   8972  C C     . PRO G 2 38  ? 41.327  34.105 -86.619 1.00 161.34 ? 638  PRO E C     1 
ATOM   8973  O O     . PRO G 2 38  ? 42.400  33.498 -86.677 1.00 160.77 ? 638  PRO E O     1 
ATOM   8974  C CB    . PRO G 2 38  ? 39.450  32.384 -86.820 1.00 95.19  ? 638  PRO E CB    1 
ATOM   8975  C CG    . PRO G 2 38  ? 40.075  31.262 -87.615 1.00 96.96  ? 638  PRO E CG    1 
ATOM   8976  C CD    . PRO G 2 38  ? 40.055  31.820 -89.013 1.00 97.14  ? 638  PRO E CD    1 
ATOM   8977  N N     . HIS G 2 39  ? 41.143  35.196 -85.884 1.00 137.18 ? 639  HIS E N     1 
ATOM   8978  C CA    . HIS G 2 39  ? 42.192  35.814 -85.079 1.00 131.47 ? 639  HIS E CA    1 
ATOM   8979  C C     . HIS G 2 39  ? 43.026  34.811 -84.286 1.00 125.57 ? 639  HIS E C     1 
ATOM   8980  O O     . HIS G 2 39  ? 42.493  33.875 -83.686 1.00 121.85 ? 639  HIS E O     1 
ATOM   8981  C CB    . HIS G 2 39  ? 41.556  36.838 -84.125 1.00 114.07 ? 639  HIS E CB    1 
ATOM   8982  C CG    . HIS G 2 39  ? 42.536  37.771 -83.478 1.00 117.02 ? 639  HIS E CG    1 
ATOM   8983  N ND1   . HIS G 2 39  ? 43.518  37.340 -82.612 1.00 117.92 ? 639  HIS E ND1   1 
ATOM   8984  C CD2   . HIS G 2 39  ? 42.670  39.117 -83.556 1.00 117.76 ? 639  HIS E CD2   1 
ATOM   8985  C CE1   . HIS G 2 39  ? 44.213  38.379 -82.185 1.00 118.55 ? 639  HIS E CE1   1 
ATOM   8986  N NE2   . HIS G 2 39  ? 43.719  39.470 -82.742 1.00 118.14 ? 639  HIS E NE2   1 
ATOM   8987  N N     . ARG G 2 40  ? 44.342  35.004 -84.305 1.00 64.61  ? 640  ARG E N     1 
ATOM   8988  C CA    . ARG G 2 40  ? 45.247  34.141 -83.559 1.00 60.47  ? 640  ARG E CA    1 
ATOM   8989  C C     . ARG G 2 40  ? 46.502  34.853 -83.059 1.00 56.93  ? 640  ARG E C     1 
ATOM   8990  O O     . ARG G 2 40  ? 47.333  35.291 -83.853 1.00 53.81  ? 640  ARG E O     1 
ATOM   8991  C CB    . ARG G 2 40  ? 45.662  32.922 -84.390 1.00 38.00  ? 640  ARG E CB    1 
ATOM   8992  C CG    . ARG G 2 40  ? 46.925  32.224 -83.859 1.00 42.03  ? 640  ARG E CG    1 
ATOM   8993  C CD    . ARG G 2 40  ? 47.144  30.864 -84.477 1.00 42.57  ? 640  ARG E CD    1 
ATOM   8994  N NE    . ARG G 2 40  ? 46.355  29.847 -83.789 1.00 47.01  ? 640  ARG E NE    1 
ATOM   8995  C CZ    . ARG G 2 40  ? 46.837  29.006 -82.882 1.00 45.63  ? 640  ARG E CZ    1 
ATOM   8996  N NH1   . ARG G 2 40  ? 48.124  29.044 -82.554 1.00 49.39  ? 640  ARG E NH1   1 
ATOM   8997  N NH2   . ARG G 2 40  ? 46.019  28.153 -82.279 1.00 47.26  ? 640  ARG E NH2   1 
ATOM   8998  N N     . TYR G 2 41  ? 46.637  34.944 -81.736 1.00 52.94  ? 641  TYR E N     1 
ATOM   8999  C CA    . TYR G 2 41  ? 47.790  35.576 -81.111 1.00 48.96  ? 641  TYR E CA    1 
ATOM   9000  C C     . TYR G 2 41  ? 49.050  34.757 -81.284 1.00 46.99  ? 641  TYR E C     1 
ATOM   9001  O O     . TYR G 2 41  ? 49.029  33.525 -81.143 1.00 46.45  ? 641  TYR E O     1 
ATOM   9002  C CB    . TYR G 2 41  ? 47.531  35.779 -79.623 1.00 29.26  ? 641  TYR E CB    1 
ATOM   9003  C CG    . TYR G 2 41  ? 46.684  36.977 -79.357 1.00 28.85  ? 641  TYR E CG    1 
ATOM   9004  C CD1   . TYR G 2 41  ? 45.516  36.872 -78.620 1.00 28.88  ? 641  TYR E CD1   1 
ATOM   9005  C CD2   . TYR G 2 41  ? 47.036  38.233 -79.878 1.00 29.09  ? 641  TYR E CD2   1 
ATOM   9006  C CE1   . TYR G 2 41  ? 44.704  37.978 -78.400 1.00 29.59  ? 641  TYR E CE1   1 
ATOM   9007  C CE2   . TYR G 2 41  ? 46.227  39.352 -79.663 1.00 27.70  ? 641  TYR E CE2   1 
ATOM   9008  C CZ    . TYR G 2 41  ? 45.062  39.200 -78.918 1.00 27.96  ? 641  TYR E CZ    1 
ATOM   9009  O OH    . TYR G 2 41  ? 44.258  40.267 -78.682 1.00 33.05  ? 641  TYR E OH    1 
ATOM   9010  N N     . ARG G 2 42  ? 50.145  35.448 -81.595 1.00 40.44  ? 642  ARG E N     1 
ATOM   9011  C CA    . ARG G 2 42  ? 51.445  34.811 -81.783 1.00 40.21  ? 642  ARG E CA    1 
ATOM   9012  C C     . ARG G 2 42  ? 51.990  34.366 -80.423 1.00 42.90  ? 642  ARG E C     1 
ATOM   9013  O O     . ARG G 2 42  ? 51.605  34.900 -79.375 1.00 39.99  ? 642  ARG E O     1 
ATOM   9014  C CB    . ARG G 2 42  ? 52.410  35.791 -82.441 1.00 59.62  ? 642  ARG E CB    1 
ATOM   9015  C CG    . ARG G 2 42  ? 51.934  36.302 -83.780 1.00 66.26  ? 642  ARG E CG    1 
ATOM   9016  C CD    . ARG G 2 42  ? 52.890  37.344 -84.293 1.00 74.55  ? 642  ARG E CD    1 
ATOM   9017  N NE    . ARG G 2 42  ? 54.271  36.870 -84.217 1.00 81.84  ? 642  ARG E NE    1 
ATOM   9018  C CZ    . ARG G 2 42  ? 55.340  37.666 -84.188 1.00 86.40  ? 642  ARG E CZ    1 
ATOM   9019  N NH1   . ARG G 2 42  ? 55.192  38.985 -84.230 1.00 88.58  ? 642  ARG E NH1   1 
ATOM   9020  N NH2   . ARG G 2 42  ? 56.563  37.148 -84.104 1.00 89.42  ? 642  ARG E NH2   1 
ATOM   9021  N N     . PRO G 2 43  ? 52.882  33.366 -80.421 1.00 66.87  ? 643  PRO E N     1 
ATOM   9022  C CA    . PRO G 2 43  ? 53.479  32.849 -79.186 1.00 65.83  ? 643  PRO E CA    1 
ATOM   9023  C C     . PRO G 2 43  ? 54.287  33.874 -78.428 1.00 64.68  ? 643  PRO E C     1 
ATOM   9024  O O     . PRO G 2 43  ? 55.178  34.513 -78.997 1.00 65.27  ? 643  PRO E O     1 
ATOM   9025  C CB    . PRO G 2 43  ? 54.361  31.702 -79.672 1.00 33.67  ? 643  PRO E CB    1 
ATOM   9026  C CG    . PRO G 2 43  ? 54.665  32.072 -81.085 1.00 36.78  ? 643  PRO E CG    1 
ATOM   9027  C CD    . PRO G 2 43  ? 53.347  32.592 -81.581 1.00 34.40  ? 643  PRO E CD    1 
ATOM   9028  N N     . GLY G 2 44  ? 53.971  34.016 -77.143 1.00 59.56  ? 644  GLY E N     1 
ATOM   9029  C CA    . GLY G 2 44  ? 54.692  34.949 -76.305 1.00 57.69  ? 644  GLY E CA    1 
ATOM   9030  C C     . GLY G 2 44  ? 53.968  36.256 -76.137 1.00 57.78  ? 644  GLY E C     1 
ATOM   9031  O O     . GLY G 2 44  ? 54.395  37.109 -75.362 1.00 59.46  ? 644  GLY E O     1 
ATOM   9032  N N     . THR G 2 45  ? 52.880  36.421 -76.875 1.00 48.20  ? 645  THR E N     1 
ATOM   9033  C CA    . THR G 2 45  ? 52.092  37.640 -76.787 1.00 47.69  ? 645  THR E CA    1 
ATOM   9034  C C     . THR G 2 45  ? 51.186  37.442 -75.583 1.00 46.81  ? 645  THR E C     1 
ATOM   9035  O O     . THR G 2 45  ? 50.906  38.373 -74.827 1.00 45.58  ? 645  THR E O     1 
ATOM   9036  C CB    . THR G 2 45  ? 51.254  37.874 -78.087 1.00 43.81  ? 645  THR E CB    1 
ATOM   9037  O OG1   . THR G 2 45  ? 52.119  38.331 -79.135 1.00 43.97  ? 645  THR E OG1   1 
ATOM   9038  C CG2   . THR G 2 45  ? 50.176  38.909 -77.866 1.00 42.83  ? 645  THR E CG2   1 
ATOM   9039  N N     . VAL G 2 46  ? 50.754  36.204 -75.403 1.00 42.70  ? 646  VAL E N     1 
ATOM   9040  C CA    . VAL G 2 46  ? 49.905  35.874 -74.286 1.00 43.40  ? 646  VAL E CA    1 
ATOM   9041  C C     . VAL G 2 46  ? 50.773  35.761 -73.048 1.00 43.43  ? 646  VAL E C     1 
ATOM   9042  O O     . VAL G 2 46  ? 50.384  36.202 -71.974 1.00 43.03  ? 646  VAL E O     1 
ATOM   9043  C CB    . VAL G 2 46  ? 49.174  34.552 -74.516 1.00 39.29  ? 646  VAL E CB    1 
ATOM   9044  C CG1   . VAL G 2 46  ? 48.464  34.119 -73.245 1.00 40.10  ? 646  VAL E CG1   1 
ATOM   9045  C CG2   . VAL G 2 46  ? 48.183  34.720 -75.635 1.00 41.11  ? 646  VAL E CG2   1 
ATOM   9046  N N     . ALA G 2 47  ? 51.955  35.184 -73.206 1.00 49.36  ? 647  ALA E N     1 
ATOM   9047  C CA    . ALA G 2 47  ? 52.885  35.023 -72.097 1.00 49.98  ? 647  ALA E CA    1 
ATOM   9048  C C     . ALA G 2 47  ? 53.173  36.374 -71.418 1.00 51.70  ? 647  ALA E C     1 
ATOM   9049  O O     . ALA G 2 47  ? 53.122  36.507 -70.176 1.00 47.86  ? 647  ALA E O     1 
ATOM   9050  C CB    . ALA G 2 47  ? 54.173  34.412 -72.603 1.00 32.30  ? 647  ALA E CB    1 
ATOM   9051  N N     . LEU G 2 48  ? 53.484  37.379 -72.231 1.00 37.44  ? 648  LEU E N     1 
ATOM   9052  C CA    . LEU G 2 48  ? 53.754  38.696 -71.697 1.00 36.24  ? 648  LEU E CA    1 
ATOM   9053  C C     . LEU G 2 48  ? 52.527  39.201 -70.960 1.00 35.87  ? 648  LEU E C     1 
ATOM   9054  O O     . LEU G 2 48  ? 52.645  39.742 -69.876 1.00 37.16  ? 648  LEU E O     1 
ATOM   9055  C CB    . LEU G 2 48  ? 54.141  39.628 -72.829 1.00 29.07  ? 648  LEU E CB    1 
ATOM   9056  C CG    . LEU G 2 48  ? 55.485  39.167 -73.406 1.00 31.49  ? 648  LEU E CG    1 
ATOM   9057  C CD1   . LEU G 2 48  ? 55.793  39.850 -74.711 1.00 31.96  ? 648  LEU E CD1   1 
ATOM   9058  C CD2   . LEU G 2 48  ? 56.573  39.475 -72.387 1.00 31.34  ? 648  LEU E CD2   1 
ATOM   9059  N N     . ARG G 2 49  ? 51.345  38.999 -71.526 1.00 31.51  ? 649  ARG E N     1 
ATOM   9060  C CA    . ARG G 2 49  ? 50.139  39.445 -70.866 1.00 33.87  ? 649  ARG E CA    1 
ATOM   9061  C C     . ARG G 2 49  ? 50.011  38.766 -69.511 1.00 32.90  ? 649  ARG E C     1 
ATOM   9062  O O     . ARG G 2 49  ? 49.584  39.394 -68.517 1.00 28.04  ? 649  ARG E O     1 
ATOM   9063  C CB    . ARG G 2 49  ? 48.924  39.148 -71.729 1.00 57.86  ? 649  ARG E CB    1 
ATOM   9064  C CG    . ARG G 2 49  ? 48.996  39.855 -73.065 1.00 63.65  ? 649  ARG E CG    1 
ATOM   9065  C CD    . ARG G 2 49  ? 47.651  39.919 -73.795 1.00 70.97  ? 649  ARG E CD    1 
ATOM   9066  N NE    . ARG G 2 49  ? 47.019  38.612 -73.964 1.00 75.33  ? 649  ARG E NE    1 
ATOM   9067  C CZ    . ARG G 2 49  ? 46.196  38.310 -74.961 1.00 76.48  ? 649  ARG E CZ    1 
ATOM   9068  N NH1   . ARG G 2 49  ? 45.913  39.226 -75.879 1.00 78.86  ? 649  ARG E NH1   1 
ATOM   9069  N NH2   . ARG G 2 49  ? 45.655  37.100 -75.041 1.00 75.89  ? 649  ARG E NH2   1 
ATOM   9070  N N     . GLU G 2 50  ? 50.399  37.489 -69.459 1.00 40.64  ? 650  GLU E N     1 
ATOM   9071  C CA    . GLU G 2 50  ? 50.336  36.720 -68.211 1.00 42.67  ? 650  GLU E CA    1 
ATOM   9072  C C     . GLU G 2 50  ? 51.391  37.185 -67.213 1.00 43.09  ? 650  GLU E C     1 
ATOM   9073  O O     . GLU G 2 50  ? 51.130  37.270 -66.014 1.00 44.31  ? 650  GLU E O     1 
ATOM   9074  C CB    . GLU G 2 50  ? 50.459  35.228 -68.509 1.00 52.10  ? 650  GLU E CB    1 
ATOM   9075  C CG    . GLU G 2 50  ? 49.255  34.720 -69.261 1.00 56.65  ? 650  GLU E CG    1 
ATOM   9076  C CD    . GLU G 2 50  ? 49.298  33.241 -69.519 1.00 59.95  ? 650  GLU E CD    1 
ATOM   9077  O OE1   . GLU G 2 50  ? 48.463  32.761 -70.316 1.00 62.22  ? 650  GLU E OE1   1 
ATOM   9078  O OE2   . GLU G 2 50  ? 50.159  32.553 -68.930 1.00 59.96  ? 650  GLU E OE2   1 
ATOM   9079  N N     . ILE G 2 51  ? 52.584  37.481 -67.706 1.00 17.61  ? 651  ILE E N     1 
ATOM   9080  C CA    . ILE G 2 51  ? 53.613  38.015 -66.834 1.00 19.30  ? 651  ILE E CA    1 
ATOM   9081  C C     . ILE G 2 51  ? 53.075  39.327 -66.248 1.00 21.10  ? 651  ILE E C     1 
ATOM   9082  O O     . ILE G 2 51  ? 53.105  39.566 -65.037 1.00 20.57  ? 651  ILE E O     1 
ATOM   9083  C CB    . ILE G 2 51  ? 54.879  38.326 -67.603 1.00 18.20  ? 651  ILE E CB    1 
ATOM   9084  C CG1   . ILE G 2 51  ? 55.516  37.018 -68.064 1.00 19.28  ? 651  ILE E CG1   1 
ATOM   9085  C CG2   . ILE G 2 51  ? 55.812  39.151 -66.726 1.00 18.25  ? 651  ILE E CG2   1 
ATOM   9086  C CD1   . ILE G 2 51  ? 56.626  37.182 -69.070 1.00 17.25  ? 651  ILE E CD1   1 
ATOM   9087  N N     . ARG G 2 52  ? 52.566  40.182 -67.114 1.00 21.16  ? 652  ARG E N     1 
ATOM   9088  C CA    . ARG G 2 52  ? 52.032  41.444 -66.641 1.00 23.95  ? 652  ARG E CA    1 
ATOM   9089  C C     . ARG G 2 52  ? 50.849  41.191 -65.708 1.00 22.23  ? 652  ARG E C     1 
ATOM   9090  O O     . ARG G 2 52  ? 50.669  41.861 -64.700 1.00 21.42  ? 652  ARG E O     1 
ATOM   9091  C CB    . ARG G 2 52  ? 51.630  42.322 -67.833 1.00 25.93  ? 652  ARG E CB    1 
ATOM   9092  C CG    . ARG G 2 52  ? 52.815  42.960 -68.556 1.00 33.17  ? 652  ARG E CG    1 
ATOM   9093  C CD    . ARG G 2 52  ? 52.337  43.841 -69.685 1.00 37.59  ? 652  ARG E CD    1 
ATOM   9094  N NE    . ARG G 2 52  ? 52.563  43.261 -71.013 1.00 41.65  ? 652  ARG E NE    1 
ATOM   9095  C CZ    . ARG G 2 52  ? 53.725  43.300 -71.666 1.00 43.01  ? 652  ARG E CZ    1 
ATOM   9096  N NH1   . ARG G 2 52  ? 54.788  43.897 -71.110 1.00 47.01  ? 652  ARG E NH1   1 
ATOM   9097  N NH2   . ARG G 2 52  ? 53.820  42.762 -72.880 1.00 40.36  ? 652  ARG E NH2   1 
ATOM   9098  N N     . ARG G 2 53  ? 50.058  40.190 -66.032 1.00 30.37  ? 653  ARG E N     1 
ATOM   9099  C CA    . ARG G 2 53  ? 48.907  39.901 -65.208 1.00 28.75  ? 653  ARG E CA    1 
ATOM   9100  C C     . ARG G 2 53  ? 49.296  39.440 -63.827 1.00 29.41  ? 653  ARG E C     1 
ATOM   9101  O O     . ARG G 2 53  ? 48.966  40.062 -62.819 1.00 27.68  ? 653  ARG E O     1 
ATOM   9102  C CB    . ARG G 2 53  ? 48.031  38.821 -65.843 1.00 34.07  ? 653  ARG E CB    1 
ATOM   9103  C CG    . ARG G 2 53  ? 46.851  38.493 -64.966 1.00 36.46  ? 653  ARG E CG    1 
ATOM   9104  C CD    . ARG G 2 53  ? 46.000  37.388 -65.510 1.00 43.26  ? 653  ARG E CD    1 
ATOM   9105  N NE    . ARG G 2 53  ? 45.081  36.908 -64.477 1.00 50.77  ? 653  ARG E NE    1 
ATOM   9106  C CZ    . ARG G 2 53  ? 44.296  35.843 -64.610 1.00 51.62  ? 653  ARG E CZ    1 
ATOM   9107  N NH1   . ARG G 2 53  ? 44.312  35.141 -65.741 1.00 50.90  ? 653  ARG E NH1   1 
ATOM   9108  N NH2   . ARG G 2 53  ? 43.511  35.471 -63.606 1.00 52.63  ? 653  ARG E NH2   1 
ATOM   9109  N N     . TYR G 2 54  ? 49.995  38.322 -63.794 1.00 44.58  ? 654  TYR E N     1 
ATOM   9110  C CA    . TYR G 2 54  ? 50.399  37.735 -62.546 1.00 45.68  ? 654  TYR E CA    1 
ATOM   9111  C C     . TYR G 2 54  ? 51.356  38.587 -61.741 1.00 44.49  ? 654  TYR E C     1 
ATOM   9112  O O     . TYR G 2 54  ? 51.289  38.598 -60.512 1.00 43.26  ? 654  TYR E O     1 
ATOM   9113  C CB    . TYR G 2 54  ? 50.938  36.328 -62.820 1.00 26.77  ? 654  TYR E CB    1 
ATOM   9114  C CG    . TYR G 2 54  ? 49.804  35.392 -63.173 1.00 28.47  ? 654  TYR E CG    1 
ATOM   9115  C CD1   . TYR G 2 54  ? 49.706  34.804 -64.440 1.00 26.01  ? 654  TYR E CD1   1 
ATOM   9116  C CD2   . TYR G 2 54  ? 48.755  35.194 -62.269 1.00 27.06  ? 654  TYR E CD2   1 
ATOM   9117  C CE1   . TYR G 2 54  ? 48.580  34.047 -64.795 1.00 25.27  ? 654  TYR E CE1   1 
ATOM   9118  C CE2   . TYR G 2 54  ? 47.633  34.452 -62.611 1.00 29.30  ? 654  TYR E CE2   1 
ATOM   9119  C CZ    . TYR G 2 54  ? 47.547  33.884 -63.864 1.00 26.71  ? 654  TYR E CZ    1 
ATOM   9120  O OH    . TYR G 2 54  ? 46.425  33.156 -64.145 1.00 29.47  ? 654  TYR E OH    1 
ATOM   9121  N N     . GLN G 2 55  ? 52.221  39.328 -62.422 1.00 43.09  ? 655  GLN E N     1 
ATOM   9122  C CA    . GLN G 2 55  ? 53.153  40.179 -61.710 1.00 44.20  ? 655  GLN E CA    1 
ATOM   9123  C C     . GLN G 2 55  ? 52.429  41.341 -61.042 1.00 46.84  ? 655  GLN E C     1 
ATOM   9124  O O     . GLN G 2 55  ? 52.990  42.037 -60.199 1.00 48.58  ? 655  GLN E O     1 
ATOM   9125  C CB    . GLN G 2 55  ? 54.230  40.694 -62.662 1.00 19.48  ? 655  GLN E CB    1 
ATOM   9126  C CG    . GLN G 2 55  ? 55.533  39.927 -62.523 1.00 18.95  ? 655  GLN E CG    1 
ATOM   9127  C CD    . GLN G 2 55  ? 56.639  40.447 -63.421 1.00 20.03  ? 655  GLN E CD    1 
ATOM   9128  O OE1   . GLN G 2 55  ? 56.642  41.623 -63.827 1.00 20.44  ? 655  GLN E OE1   1 
ATOM   9129  N NE2   . GLN G 2 55  ? 57.605  39.581 -63.716 1.00 21.64  ? 655  GLN E NE2   1 
ATOM   9130  N N     . LYS G 2 56  ? 51.167  41.521 -61.406 1.00 32.12  ? 656  LYS E N     1 
ATOM   9131  C CA    . LYS G 2 56  ? 50.351  42.600 -60.883 1.00 33.67  ? 656  LYS E CA    1 
ATOM   9132  C C     . LYS G 2 56  ? 49.498  42.188 -59.680 1.00 32.22  ? 656  LYS E C     1 
ATOM   9133  O O     . LYS G 2 56  ? 48.986  43.032 -58.940 1.00 29.47  ? 656  LYS E O     1 
ATOM   9134  C CB    . LYS G 2 56  ? 49.474  43.132 -62.016 1.00 47.00  ? 656  LYS E CB    1 
ATOM   9135  C CG    . LYS G 2 56  ? 48.443  44.163 -61.611 1.00 54.86  ? 656  LYS E CG    1 
ATOM   9136  C CD    . LYS G 2 56  ? 47.980  45.024 -62.809 1.00 59.86  ? 656  LYS E CD    1 
ATOM   9137  C CE    . LYS G 2 56  ? 46.827  45.980 -62.407 1.00 66.40  ? 656  LYS E CE    1 
ATOM   9138  N NZ    . LYS G 2 56  ? 46.288  46.788 -63.545 1.00 71.05  ? 656  LYS E NZ    1 
ATOM   9139  N N     . SER G 2 57  ? 49.347  40.894 -59.453 1.00 44.26  ? 657  SER E N     1 
ATOM   9140  C CA    . SER G 2 57  ? 48.544  40.487 -58.322 1.00 44.07  ? 657  SER E CA    1 
ATOM   9141  C C     . SER G 2 57  ? 49.383  39.875 -57.212 1.00 42.69  ? 657  SER E C     1 
ATOM   9142  O O     . SER G 2 57  ? 50.616  39.900 -57.264 1.00 41.77  ? 657  SER E O     1 
ATOM   9143  C CB    . SER G 2 57  ? 47.495  39.506 -58.779 1.00 29.69  ? 657  SER E CB    1 
ATOM   9144  O OG    . SER G 2 57  ? 48.118  38.478 -59.507 1.00 32.54  ? 657  SER E OG    1 
ATOM   9145  N N     . THR G 2 58  ? 48.707  39.325 -56.207 1.00 31.23  ? 658  THR E N     1 
ATOM   9146  C CA    . THR G 2 58  ? 49.387  38.726 -55.073 1.00 34.74  ? 658  THR E CA    1 
ATOM   9147  C C     . THR G 2 58  ? 48.684  37.480 -54.582 1.00 33.04  ? 658  THR E C     1 
ATOM   9148  O O     . THR G 2 58  ? 49.031  36.967 -53.529 1.00 33.69  ? 658  THR E O     1 
ATOM   9149  C CB    . THR G 2 58  ? 49.483  39.713 -53.871 1.00 25.05  ? 658  THR E CB    1 
ATOM   9150  O OG1   . THR G 2 58  ? 48.180  40.185 -53.517 1.00 27.26  ? 658  THR E OG1   1 
ATOM   9151  C CG2   . THR G 2 58  ? 50.333  40.892 -54.218 1.00 30.40  ? 658  THR E CG2   1 
ATOM   9152  N N     . GLU G 2 59  ? 47.698  36.990 -55.325 1.00 26.83  ? 659  GLU E N     1 
ATOM   9153  C CA    . GLU G 2 59  ? 46.987  35.806 -54.870 1.00 27.59  ? 659  GLU E CA    1 
ATOM   9154  C C     . GLU G 2 59  ? 47.857  34.596 -55.048 1.00 25.10  ? 659  GLU E C     1 
ATOM   9155  O O     . GLU G 2 59  ? 48.688  34.561 -55.969 1.00 21.83  ? 659  GLU E O     1 
ATOM   9156  C CB    . GLU G 2 59  ? 45.681  35.598 -55.635 1.00 38.81  ? 659  GLU E CB    1 
ATOM   9157  C CG    . GLU G 2 59  ? 45.531  36.462 -56.856 1.00 51.70  ? 659  GLU E CG    1 
ATOM   9158  C CD    . GLU G 2 59  ? 45.845  35.755 -58.160 1.00 52.82  ? 659  GLU E CD    1 
ATOM   9159  O OE1   . GLU G 2 59  ? 45.242  34.692 -58.412 1.00 61.76  ? 659  GLU E OE1   1 
ATOM   9160  O OE2   . GLU G 2 59  ? 46.675  36.272 -58.941 1.00 52.24  ? 659  GLU E OE2   1 
ATOM   9161  N N     . LEU G 2 60  ? 47.686  33.614 -54.156 1.00 27.60  ? 660  LEU E N     1 
ATOM   9162  C CA    . LEU G 2 60  ? 48.447  32.389 -54.266 1.00 30.47  ? 660  LEU E CA    1 
ATOM   9163  C C     . LEU G 2 60  ? 48.074  31.720 -55.602 1.00 30.41  ? 660  LEU E C     1 
ATOM   9164  O O     . LEU G 2 60  ? 46.905  31.664 -55.990 1.00 28.95  ? 660  LEU E O     1 
ATOM   9165  C CB    . LEU G 2 60  ? 48.167  31.483 -53.064 1.00 21.06  ? 660  LEU E CB    1 
ATOM   9166  C CG    . LEU G 2 60  ? 48.801  31.936 -51.724 1.00 22.96  ? 660  LEU E CG    1 
ATOM   9167  C CD1   . LEU G 2 60  ? 48.474  30.924 -50.592 1.00 24.48  ? 660  LEU E CD1   1 
ATOM   9168  C CD2   . LEU G 2 60  ? 50.332  32.088 -51.869 1.00 22.69  ? 660  LEU E CD2   1 
ATOM   9169  N N     . LEU G 2 61  ? 49.079  31.226 -56.309 1.00 26.16  ? 661  LEU E N     1 
ATOM   9170  C CA    . LEU G 2 61  ? 48.867  30.617 -57.608 1.00 24.06  ? 661  LEU E CA    1 
ATOM   9171  C C     . LEU G 2 61  ? 48.794  29.082 -57.610 1.00 23.99  ? 661  LEU E C     1 
ATOM   9172  O O     . LEU G 2 61  ? 48.929  28.454 -58.658 1.00 23.66  ? 661  LEU E O     1 
ATOM   9173  C CB    . LEU G 2 61  ? 49.983  31.094 -58.554 1.00 23.04  ? 661  LEU E CB    1 
ATOM   9174  C CG    . LEU G 2 61  ? 50.195  32.614 -58.525 1.00 24.52  ? 661  LEU E CG    1 
ATOM   9175  C CD1   . LEU G 2 61  ? 51.389  33.036 -59.313 1.00 23.31  ? 661  LEU E CD1   1 
ATOM   9176  C CD2   . LEU G 2 61  ? 48.972  33.262 -59.085 1.00 24.97  ? 661  LEU E CD2   1 
ATOM   9177  N N     . ILE G 2 62  ? 48.591  28.463 -56.453 1.00 19.30  ? 662  ILE E N     1 
ATOM   9178  C CA    . ILE G 2 62  ? 48.522  27.011 -56.419 1.00 21.08  ? 662  ILE E CA    1 
ATOM   9179  C C     . ILE G 2 62  ? 47.200  26.650 -55.777 1.00 21.58  ? 662  ILE E C     1 
ATOM   9180  O O     . ILE G 2 62  ? 46.766  27.324 -54.847 1.00 17.61  ? 662  ILE E O     1 
ATOM   9181  C CB    . ILE G 2 62  ? 49.741  26.387 -55.634 1.00 21.68  ? 662  ILE E CB    1 
ATOM   9182  C CG1   . ILE G 2 62  ? 51.028  26.580 -56.451 1.00 20.18  ? 662  ILE E CG1   1 
ATOM   9183  C CG2   . ILE G 2 62  ? 49.541  24.900 -55.393 1.00 22.26  ? 662  ILE E CG2   1 
ATOM   9184  C CD1   . ILE G 2 62  ? 52.293  26.075 -55.784 1.00 18.27  ? 662  ILE E CD1   1 
ATOM   9185  N N     . ARG G 2 63  ? 46.543  25.612 -56.311 1.00 12.23  ? 663  ARG E N     1 
ATOM   9186  C CA    . ARG G 2 63  ? 45.262  25.171 -55.799 1.00 13.63  ? 663  ARG E CA    1 
ATOM   9187  C C     . ARG G 2 63  ? 45.443  24.994 -54.295 1.00 13.82  ? 663  ARG E C     1 
ATOM   9188  O O     . ARG G 2 63  ? 46.337  24.289 -53.864 1.00 12.71  ? 663  ARG E O     1 
ATOM   9189  C CB    . ARG G 2 63  ? 44.884  23.847 -56.457 1.00 74.76  ? 663  ARG E CB    1 
ATOM   9190  C CG    . ARG G 2 63  ? 44.730  23.903 -57.974 1.00 82.05  ? 663  ARG E CG    1 
ATOM   9191  C CD    . ARG G 2 63  ? 43.347  24.376 -58.338 1.00 89.78  ? 663  ARG E CD    1 
ATOM   9192  N NE    . ARG G 2 63  ? 43.027  25.622 -57.653 1.00 100.22 ? 663  ARG E NE    1 
ATOM   9193  C CZ    . ARG G 2 63  ? 41.831  26.195 -57.667 1.00 105.32 ? 663  ARG E CZ    1 
ATOM   9194  N NH1   . ARG G 2 63  ? 40.831  25.630 -58.329 1.00 111.06 ? 663  ARG E NH1   1 
ATOM   9195  N NH2   . ARG G 2 63  ? 41.640  27.340 -57.031 1.00 105.81 ? 663  ARG E NH2   1 
ATOM   9196  N N     . LYS G 2 64  ? 44.611  25.637 -53.485 1.00 23.75  ? 664  LYS E N     1 
ATOM   9197  C CA    . LYS G 2 64  ? 44.751  25.491 -52.045 1.00 26.60  ? 664  LYS E CA    1 
ATOM   9198  C C     . LYS G 2 64  ? 44.609  24.082 -51.489 1.00 26.52  ? 664  LYS E C     1 
ATOM   9199  O O     . LYS G 2 64  ? 45.436  23.659 -50.667 1.00 22.94  ? 664  LYS E O     1 
ATOM   9200  C CB    . LYS G 2 64  ? 43.794  26.418 -51.317 1.00 31.88  ? 664  LYS E CB    1 
ATOM   9201  C CG    . LYS G 2 64  ? 44.272  27.853 -51.324 1.00 44.19  ? 664  LYS E CG    1 
ATOM   9202  C CD    . LYS G 2 64  ? 43.602  28.666 -50.228 1.00 50.70  ? 664  LYS E CD    1 
ATOM   9203  C CE    . LYS G 2 64  ? 43.954  30.130 -50.373 1.00 55.42  ? 664  LYS E CE    1 
ATOM   9204  N NZ    . LYS G 2 64  ? 45.429  30.252 -50.422 1.00 60.81  ? 664  LYS E NZ    1 
ATOM   9205  N N     . LEU G 2 65  ? 43.584  23.354 -51.921 1.00 20.96  ? 665  LEU E N     1 
ATOM   9206  C CA    . LEU G 2 65  ? 43.373  22.014 -51.405 1.00 20.37  ? 665  LEU E CA    1 
ATOM   9207  C C     . LEU G 2 65  ? 44.505  21.055 -51.771 1.00 19.63  ? 665  LEU E C     1 
ATOM   9208  O O     . LEU G 2 65  ? 45.046  20.328 -50.917 1.00 20.75  ? 665  LEU E O     1 
ATOM   9209  C CB    . LEU G 2 65  ? 42.045  21.447 -51.909 1.00 33.61  ? 665  LEU E CB    1 
ATOM   9210  C CG    . LEU G 2 65  ? 41.724  19.980 -51.565 1.00 35.34  ? 665  LEU E CG    1 
ATOM   9211  C CD1   . LEU G 2 65  ? 41.437  19.811 -50.081 1.00 36.46  ? 665  LEU E CD1   1 
ATOM   9212  C CD2   . LEU G 2 65  ? 40.532  19.554 -52.369 1.00 35.64  ? 665  LEU E CD2   1 
ATOM   9213  N N     . PRO G 2 66  ? 44.853  21.004 -53.054 1.00 38.53  ? 666  PRO E N     1 
ATOM   9214  C CA    . PRO G 2 66  ? 45.936  20.101 -53.439 1.00 39.03  ? 666  PRO E CA    1 
ATOM   9215  C C     . PRO G 2 66  ? 47.203  20.366 -52.627 1.00 41.03  ? 666  PRO E C     1 
ATOM   9216  O O     . PRO G 2 66  ? 47.950  19.451 -52.296 1.00 36.73  ? 666  PRO E O     1 
ATOM   9217  C CB    . PRO G 2 66  ? 46.097  20.394 -54.927 1.00 31.33  ? 666  PRO E CB    1 
ATOM   9218  C CG    . PRO G 2 66  ? 44.681  20.625 -55.334 1.00 33.42  ? 666  PRO E CG    1 
ATOM   9219  C CD    . PRO G 2 66  ? 44.145  21.520 -54.234 1.00 33.93  ? 666  PRO E CD    1 
ATOM   9220  N N     . PHE G 2 67  ? 47.441  21.623 -52.292 1.00 27.49  ? 667  PHE E N     1 
ATOM   9221  C CA    . PHE G 2 67  ? 48.612  21.958 -51.524 1.00 25.86  ? 667  PHE E CA    1 
ATOM   9222  C C     . PHE G 2 67  ? 48.499  21.424 -50.097 1.00 24.00  ? 667  PHE E C     1 
ATOM   9223  O O     . PHE G 2 67  ? 49.461  20.889 -49.552 1.00 20.11  ? 667  PHE E O     1 
ATOM   9224  C CB    . PHE G 2 67  ? 48.801  23.451 -51.484 1.00 25.82  ? 667  PHE E CB    1 
ATOM   9225  C CG    . PHE G 2 67  ? 50.099  23.856 -50.902 1.00 22.39  ? 667  PHE E CG    1 
ATOM   9226  C CD1   . PHE G 2 67  ? 51.263  23.771 -51.653 1.00 25.23  ? 667  PHE E CD1   1 
ATOM   9227  C CD2   . PHE G 2 67  ? 50.175  24.314 -49.592 1.00 23.24  ? 667  PHE E CD2   1 
ATOM   9228  C CE1   . PHE G 2 67  ? 52.500  24.153 -51.100 1.00 21.58  ? 667  PHE E CE1   1 
ATOM   9229  C CE2   . PHE G 2 67  ? 51.394  24.689 -49.040 1.00 18.33  ? 667  PHE E CE2   1 
ATOM   9230  C CZ    . PHE G 2 67  ? 52.557  24.609 -49.797 1.00 19.66  ? 667  PHE E CZ    1 
ATOM   9231  N N     . GLN G 2 68  ? 47.333  21.584 -49.477 1.00 19.21  ? 668  GLN E N     1 
ATOM   9232  C CA    . GLN G 2 68  ? 47.144  21.090 -48.119 1.00 24.40  ? 668  GLN E CA    1 
ATOM   9233  C C     . GLN G 2 68  ? 47.471  19.583 -48.073 1.00 22.97  ? 668  GLN E C     1 
ATOM   9234  O O     . GLN G 2 68  ? 48.110  19.096 -47.134 1.00 20.46  ? 668  GLN E O     1 
ATOM   9235  C CB    . GLN G 2 68  ? 45.704  21.342 -47.670 1.00 33.36  ? 668  GLN E CB    1 
ATOM   9236  C CG    . GLN G 2 68  ? 45.461  21.051 -46.204 1.00 42.60  ? 668  GLN E CG    1 
ATOM   9237  C CD    . GLN G 2 68  ? 44.117  21.569 -45.693 1.00 48.43  ? 668  GLN E CD    1 
ATOM   9238  O OE1   . GLN G 2 68  ? 43.072  21.056 -46.062 1.00 52.12  ? 668  GLN E OE1   1 
ATOM   9239  N NE2   . GLN G 2 68  ? 44.147  22.588 -44.835 1.00 52.09  ? 668  GLN E NE2   1 
ATOM   9240  N N     . ARG G 2 69  ? 47.058  18.845 -49.100 1.00 23.47  ? 669  ARG E N     1 
ATOM   9241  C CA    . ARG G 2 69  ? 47.322  17.435 -49.097 1.00 25.63  ? 669  ARG E CA    1 
ATOM   9242  C C     . ARG G 2 69  ? 48.801  17.164 -49.129 1.00 25.77  ? 669  ARG E C     1 
ATOM   9243  O O     . ARG G 2 69  ? 49.324  16.472 -48.242 1.00 26.61  ? 669  ARG E O     1 
ATOM   9244  C CB    . ARG G 2 69  ? 46.675  16.759 -50.272 1.00 20.36  ? 669  ARG E CB    1 
ATOM   9245  C CG    . ARG G 2 69  ? 45.205  16.778 -50.223 1.00 24.10  ? 669  ARG E CG    1 
ATOM   9246  C CD    . ARG G 2 69  ? 44.626  15.734 -51.166 1.00 28.24  ? 669  ARG E CD    1 
ATOM   9247  N NE    . ARG G 2 69  ? 43.339  16.167 -51.683 1.00 36.22  ? 669  ARG E NE    1 
ATOM   9248  C CZ    . ARG G 2 69  ? 43.175  16.658 -52.899 1.00 33.84  ? 669  ARG E CZ    1 
ATOM   9249  N NH1   . ARG G 2 69  ? 44.225  16.759 -53.715 1.00 28.37  ? 669  ARG E NH1   1 
ATOM   9250  N NH2   . ARG G 2 69  ? 41.972  17.063 -53.287 1.00 38.34  ? 669  ARG E NH2   1 
ATOM   9251  N N     . LEU G 2 70  ? 49.471  17.689 -50.154 1.00 32.86  ? 670  LEU E N     1 
ATOM   9252  C CA    . LEU G 2 70  ? 50.909  17.510 -50.302 1.00 33.21  ? 670  LEU E CA    1 
ATOM   9253  C C     . LEU G 2 70  ? 51.612  17.785 -48.962 1.00 32.70  ? 670  LEU E C     1 
ATOM   9254  O O     . LEU G 2 70  ? 52.528  17.058 -48.553 1.00 31.93  ? 670  LEU E O     1 
ATOM   9255  C CB    . LEU G 2 70  ? 51.442  18.465 -51.374 1.00 10.37  ? 670  LEU E CB    1 
ATOM   9256  C CG    . LEU G 2 70  ? 52.956  18.459 -51.629 1.00 9.89   ? 670  LEU E CG    1 
ATOM   9257  C CD1   . LEU G 2 70  ? 53.386  17.069 -52.125 1.00 5.70   ? 670  LEU E CD1   1 
ATOM   9258  C CD2   . LEU G 2 70  ? 53.323  19.526 -52.626 1.00 9.31   ? 670  LEU E CD2   1 
ATOM   9259  N N     . VAL G 2 71  ? 51.171  18.837 -48.279 1.00 21.13  ? 671  VAL E N     1 
ATOM   9260  C CA    . VAL G 2 71  ? 51.747  19.204 -46.998 1.00 21.05  ? 671  VAL E CA    1 
ATOM   9261  C C     . VAL G 2 71  ? 51.493  18.104 -46.004 1.00 23.09  ? 671  VAL E C     1 
ATOM   9262  O O     . VAL G 2 71  ? 52.389  17.674 -45.275 1.00 19.27  ? 671  VAL E O     1 
ATOM   9263  C CB    . VAL G 2 71  ? 51.133  20.509 -46.467 1.00 10.64  ? 671  VAL E CB    1 
ATOM   9264  C CG1   . VAL G 2 71  ? 51.435  20.679 -44.993 1.00 9.30   ? 671  VAL E CG1   1 
ATOM   9265  C CG2   . VAL G 2 71  ? 51.682  21.672 -47.275 1.00 12.57  ? 671  VAL E CG2   1 
ATOM   9266  N N     . ARG G 2 72  ? 50.257  17.644 -45.983 1.00 16.94  ? 672  ARG E N     1 
ATOM   9267  C CA    . ARG G 2 72  ? 49.893  16.582 -45.070 1.00 18.71  ? 672  ARG E CA    1 
ATOM   9268  C C     . ARG G 2 72  ? 50.588  15.237 -45.401 1.00 16.27  ? 672  ARG E C     1 
ATOM   9269  O O     . ARG G 2 72  ? 50.910  14.457 -44.496 1.00 20.56  ? 672  ARG E O     1 
ATOM   9270  C CB    . ARG G 2 72  ? 48.366  16.458 -45.050 1.00 29.83  ? 672  ARG E CB    1 
ATOM   9271  C CG    . ARG G 2 72  ? 47.675  17.573 -44.268 1.00 33.73  ? 672  ARG E CG    1 
ATOM   9272  C CD    . ARG G 2 72  ? 46.191  17.354 -44.316 1.00 36.00  ? 672  ARG E CD    1 
ATOM   9273  N NE    . ARG G 2 72  ? 45.400  18.455 -43.772 1.00 39.17  ? 672  ARG E NE    1 
ATOM   9274  C CZ    . ARG G 2 72  ? 45.294  18.761 -42.481 1.00 41.13  ? 672  ARG E CZ    1 
ATOM   9275  N NH1   . ARG G 2 72  ? 45.940  18.064 -41.551 1.00 35.28  ? 672  ARG E NH1   1 
ATOM   9276  N NH2   . ARG G 2 72  ? 44.489  19.744 -42.111 1.00 41.22  ? 672  ARG E NH2   1 
ATOM   9277  N N     . GLU G 2 73  ? 50.827  14.988 -46.690 1.00 26.82  ? 673  GLU E N     1 
ATOM   9278  C CA    . GLU G 2 73  ? 51.496  13.772 -47.107 1.00 25.48  ? 673  GLU E CA    1 
ATOM   9279  C C     . GLU G 2 73  ? 52.912  13.780 -46.596 1.00 27.26  ? 673  GLU E C     1 
ATOM   9280  O O     . GLU G 2 73  ? 53.350  12.831 -45.935 1.00 28.93  ? 673  GLU E O     1 
ATOM   9281  C CB    . GLU G 2 73  ? 51.550  13.642 -48.621 1.00 30.62  ? 673  GLU E CB    1 
ATOM   9282  C CG    . GLU G 2 73  ? 52.426  12.464 -49.060 1.00 28.57  ? 673  GLU E CG    1 
ATOM   9283  C CD    . GLU G 2 73  ? 52.635  12.383 -50.563 1.00 29.67  ? 673  GLU E CD    1 
ATOM   9284  O OE1   . GLU G 2 73  ? 51.618  12.354 -51.291 1.00 29.86  ? 673  GLU E OE1   1 
ATOM   9285  O OE2   . GLU G 2 73  ? 53.811  12.346 -51.014 1.00 30.47  ? 673  GLU E OE2   1 
ATOM   9286  N N     . ILE G 2 74  ? 53.630  14.849 -46.929 1.00 18.33  ? 674  ILE E N     1 
ATOM   9287  C CA    . ILE G 2 74  ? 55.021  15.003 -46.503 1.00 16.96  ? 674  ILE E CA    1 
ATOM   9288  C C     . ILE G 2 74  ? 55.120  14.982 -44.974 1.00 15.48  ? 674  ILE E C     1 
ATOM   9289  O O     . ILE G 2 74  ? 55.891  14.215 -44.399 1.00 18.08  ? 674  ILE E O     1 
ATOM   9290  C CB    . ILE G 2 74  ? 55.652  16.325 -47.029 1.00 30.38  ? 674  ILE E CB    1 
ATOM   9291  C CG1   . ILE G 2 74  ? 55.747  16.299 -48.545 1.00 29.05  ? 674  ILE E CG1   1 
ATOM   9292  C CG2   . ILE G 2 74  ? 57.070  16.476 -46.538 1.00 24.44  ? 674  ILE E CG2   1 
ATOM   9293  C CD1   . ILE G 2 74  ? 56.278  17.623 -49.136 1.00 31.01  ? 674  ILE E CD1   1 
ATOM   9294  N N     . ALA G 2 75  ? 54.348  15.831 -44.314 1.00 22.48  ? 675  ALA E N     1 
ATOM   9295  C CA    . ALA G 2 75  ? 54.390  15.875 -42.857 1.00 22.99  ? 675  ALA E CA    1 
ATOM   9296  C C     . ALA G 2 75  ? 54.238  14.481 -42.281 1.00 25.04  ? 675  ALA E C     1 
ATOM   9297  O O     . ALA G 2 75  ? 55.014  14.063 -41.423 1.00 24.00  ? 675  ALA E O     1 
ATOM   9298  C CB    . ALA G 2 75  ? 53.272  16.784 -42.303 1.00 8.03   ? 675  ALA E CB    1 
ATOM   9299  N N     . GLN G 2 76  ? 53.228  13.775 -42.772 1.00 26.16  ? 676  GLN E N     1 
ATOM   9300  C CA    . GLN G 2 76  ? 52.891  12.448 -42.299 1.00 28.80  ? 676  GLN E CA    1 
ATOM   9301  C C     . GLN G 2 76  ? 53.953  11.422 -42.538 1.00 29.23  ? 676  GLN E C     1 
ATOM   9302  O O     . GLN G 2 76  ? 54.205  10.593 -41.681 1.00 28.52  ? 676  GLN E O     1 
ATOM   9303  C CB    . GLN G 2 76  ? 51.613  11.994 -42.963 1.00 42.11  ? 676  GLN E CB    1 
ATOM   9304  C CG    . GLN G 2 76  ? 51.133  10.630 -42.572 1.00 44.53  ? 676  GLN E CG    1 
ATOM   9305  C CD    . GLN G 2 76  ? 50.081  10.165 -43.527 1.00 42.69  ? 676  GLN E CD    1 
ATOM   9306  O OE1   . GLN G 2 76  ? 50.334  9.982  -44.727 1.00 40.99  ? 676  GLN E OE1   1 
ATOM   9307  N NE2   . GLN G 2 76  ? 48.879  9.990  -43.015 1.00 43.39  ? 676  GLN E NE2   1 
ATOM   9308  N N     . ASP G 2 77  ? 54.575  11.440 -43.706 1.00 35.47  ? 677  ASP E N     1 
ATOM   9309  C CA    . ASP G 2 77  ? 55.601  10.450 -43.945 1.00 37.88  ? 677  ASP E CA    1 
ATOM   9310  C C     . ASP G 2 77  ? 56.933  10.908 -43.171 1.00 40.44  ? 677  ASP E C     1 
ATOM   9311  O O     . ASP G 2 77  ? 58.060  10.568 -43.538 1.00 38.66  ? 677  ASP E O     1 
ATOM   9312  C CB    . ASP G 2 77  ? 55.726  10.186 -45.510 1.00 27.49  ? 677  ASP E CB    1 
ATOM   9313  C CG    . ASP G 2 77  ? 54.563  9.166  -46.137 1.00 30.48  ? 677  ASP E CG    1 
ATOM   9314  O OD1   . ASP G 2 77  ? 53.925  8.305  -45.461 1.00 32.13  ? 677  ASP E OD1   1 
ATOM   9315  O OD2   . ASP G 2 77  ? 54.311  9.188  -47.368 1.00 25.53  ? 677  ASP E OD2   1 
ATOM   9316  N N     . PHE G 2 78  ? 56.757  11.653 -42.063 1.00 34.92  ? 678  PHE E N     1 
ATOM   9317  C CA    . PHE G 2 78  ? 57.835  12.164 -41.166 1.00 38.40  ? 678  PHE E CA    1 
ATOM   9318  C C     . PHE G 2 78  ? 57.410  11.961 -39.714 1.00 36.64  ? 678  PHE E C     1 
ATOM   9319  O O     . PHE G 2 78  ? 58.225  11.816 -38.795 1.00 33.89  ? 678  PHE E O     1 
ATOM   9320  C CB    . PHE G 2 78  ? 58.085  13.662 -41.344 1.00 70.81  ? 678  PHE E CB    1 
ATOM   9321  C CG    . PHE G 2 78  ? 59.252  13.980 -42.225 1.00 75.01  ? 678  PHE E CG    1 
ATOM   9322  C CD1   . PHE G 2 78  ? 59.544  15.299 -42.560 1.00 74.31  ? 678  PHE E CD1   1 
ATOM   9323  C CD2   . PHE G 2 78  ? 60.040  12.956 -42.763 1.00 76.65  ? 678  PHE E CD2   1 
ATOM   9324  C CE1   . PHE G 2 78  ? 60.599  15.603 -43.414 1.00 73.28  ? 678  PHE E CE1   1 
ATOM   9325  C CE2   . PHE G 2 78  ? 61.103  13.245 -43.623 1.00 78.06  ? 678  PHE E CE2   1 
ATOM   9326  C CZ    . PHE G 2 78  ? 61.381  14.578 -43.951 1.00 74.76  ? 678  PHE E CZ    1 
ATOM   9327  N N     . LYS G 2 79  ? 56.108  11.971 -39.514 1.00 40.44  ? 679  LYS E N     1 
ATOM   9328  C CA    . LYS G 2 79  ? 55.560  11.765 -38.204 1.00 42.66  ? 679  LYS E CA    1 
ATOM   9329  C C     . LYS G 2 79  ? 54.072  11.599 -38.392 1.00 42.33  ? 679  LYS E C     1 
ATOM   9330  O O     . LYS G 2 79  ? 53.398  12.438 -38.994 1.00 40.60  ? 679  LYS E O     1 
ATOM   9331  C CB    . LYS G 2 79  ? 55.867  12.957 -37.320 1.00 35.29  ? 679  LYS E CB    1 
ATOM   9332  C CG    . LYS G 2 79  ? 55.860  12.647 -35.841 1.00 43.22  ? 679  LYS E CG    1 
ATOM   9333  C CD    . LYS G 2 79  ? 54.502  12.211 -35.360 1.00 48.41  ? 679  LYS E CD    1 
ATOM   9334  C CE    . LYS G 2 79  ? 54.531  11.937 -33.862 1.00 49.33  ? 679  LYS E CE    1 
ATOM   9335  N NZ    . LYS G 2 79  ? 53.215  11.422 -33.368 1.00 53.11  ? 679  LYS E NZ    1 
ATOM   9336  N N     . THR G 2 80  ? 53.557  10.490 -37.898 1.00 45.96  ? 680  THR E N     1 
ATOM   9337  C CA    . THR G 2 80  ? 52.140  10.218 -38.026 1.00 45.93  ? 680  THR E CA    1 
ATOM   9338  C C     . THR G 2 80  ? 51.344  11.010 -37.009 1.00 46.17  ? 680  THR E C     1 
ATOM   9339  O O     . THR G 2 80  ? 51.915  11.682 -36.154 1.00 49.81  ? 680  THR E O     1 
ATOM   9340  C CB    . THR G 2 80  ? 51.878  8.745  -37.817 1.00 55.43  ? 680  THR E CB    1 
ATOM   9341  O OG1   . THR G 2 80  ? 52.929  8.209  -37.002 1.00 54.11  ? 680  THR E OG1   1 
ATOM   9342  C CG2   . THR G 2 80  ? 51.824  8.022  -39.152 1.00 56.98  ? 680  THR E CG2   1 
ATOM   9343  N N     . ASP G 2 81  ? 50.023  10.927 -37.118 1.00 60.01  ? 681  ASP E N     1 
ATOM   9344  C CA    . ASP G 2 81  ? 49.128  11.617 -36.196 1.00 63.77  ? 681  ASP E CA    1 
ATOM   9345  C C     . ASP G 2 81  ? 49.555  13.040 -35.892 1.00 64.29  ? 681  ASP E C     1 
ATOM   9346  O O     . ASP G 2 81  ? 49.961  13.334 -34.767 1.00 63.74  ? 681  ASP E O     1 
ATOM   9347  C CB    . ASP G 2 81  ? 49.034  10.861 -34.864 1.00 110.02 ? 681  ASP E CB    1 
ATOM   9348  C CG    . ASP G 2 81  ? 48.297  9.548  -34.978 1.00 116.12 ? 681  ASP E CG    1 
ATOM   9349  O OD1   . ASP G 2 81  ? 48.796  8.634  -35.669 1.00 120.13 ? 681  ASP E OD1   1 
ATOM   9350  O OD2   . ASP G 2 81  ? 47.215  9.435  -34.366 1.00 120.98 ? 681  ASP E OD2   1 
ATOM   9351  N N     . LEU G 2 82  ? 49.473  13.914 -36.888 1.00 47.90  ? 682  LEU E N     1 
ATOM   9352  C CA    . LEU G 2 82  ? 49.824  15.324 -36.712 1.00 46.45  ? 682  LEU E CA    1 
ATOM   9353  C C     . LEU G 2 82  ? 48.651  16.159 -37.168 1.00 43.85  ? 682  LEU E C     1 
ATOM   9354  O O     . LEU G 2 82  ? 47.910  15.754 -38.051 1.00 44.67  ? 682  LEU E O     1 
ATOM   9355  C CB    . LEU G 2 82  ? 51.045  15.714 -37.552 1.00 31.33  ? 682  LEU E CB    1 
ATOM   9356  C CG    . LEU G 2 82  ? 52.447  15.327 -37.085 1.00 29.49  ? 682  LEU E CG    1 
ATOM   9357  C CD1   . LEU G 2 82  ? 53.466  15.772 -38.109 1.00 29.38  ? 682  LEU E CD1   1 
ATOM   9358  C CD2   . LEU G 2 82  ? 52.732  15.961 -35.763 1.00 29.37  ? 682  LEU E CD2   1 
ATOM   9359  N N     . ARG G 2 83  ? 48.474  17.325 -36.568 1.00 51.51  ? 683  ARG E N     1 
ATOM   9360  C CA    . ARG G 2 83  ? 47.387  18.198 -36.974 1.00 51.05  ? 683  ARG E CA    1 
ATOM   9361  C C     . ARG G 2 83  ? 47.921  19.545 -37.469 1.00 50.33  ? 683  ARG E C     1 
ATOM   9362  O O     . ARG G 2 83  ? 49.055  19.925 -37.189 1.00 47.17  ? 683  ARG E O     1 
ATOM   9363  C CB    . ARG G 2 83  ? 46.432  18.402 -35.815 1.00 51.76  ? 683  ARG E CB    1 
ATOM   9364  C CG    . ARG G 2 83  ? 45.573  17.201 -35.495 1.00 56.65  ? 683  ARG E CG    1 
ATOM   9365  C CD    . ARG G 2 83  ? 44.657  17.543 -34.327 1.00 61.96  ? 683  ARG E CD    1 
ATOM   9366  N NE    . ARG G 2 83  ? 43.367  16.865 -34.401 1.00 71.36  ? 683  ARG E NE    1 
ATOM   9367  C CZ    . ARG G 2 83  ? 42.255  17.331 -33.844 1.00 72.53  ? 683  ARG E CZ    1 
ATOM   9368  N NH1   . ARG G 2 83  ? 42.273  18.479 -33.168 1.00 74.24  ? 683  ARG E NH1   1 
ATOM   9369  N NH2   . ARG G 2 83  ? 41.123  16.659 -33.981 1.00 77.65  ? 683  ARG E NH2   1 
ATOM   9370  N N     . PHE G 2 84  ? 47.097  20.271 -38.207 1.00 41.55  ? 684  PHE E N     1 
ATOM   9371  C CA    . PHE G 2 84  ? 47.533  21.544 -38.731 1.00 43.41  ? 684  PHE E CA    1 
ATOM   9372  C C     . PHE G 2 84  ? 46.570  22.696 -38.553 1.00 40.49  ? 684  PHE E C     1 
ATOM   9373  O O     . PHE G 2 84  ? 45.400  22.581 -38.899 1.00 43.77  ? 684  PHE E O     1 
ATOM   9374  C CB    . PHE G 2 84  ? 47.825  21.419 -40.227 1.00 39.33  ? 684  PHE E CB    1 
ATOM   9375  C CG    . PHE G 2 84  ? 49.151  20.807 -40.532 1.00 38.06  ? 684  PHE E CG    1 
ATOM   9376  C CD1   . PHE G 2 84  ? 49.302  19.437 -40.601 1.00 39.60  ? 684  PHE E CD1   1 
ATOM   9377  C CD2   . PHE G 2 84  ? 50.251  21.607 -40.778 1.00 38.25  ? 684  PHE E CD2   1 
ATOM   9378  C CE1   . PHE G 2 84  ? 50.544  18.874 -40.879 1.00 38.92  ? 684  PHE E CE1   1 
ATOM   9379  C CE2   . PHE G 2 84  ? 51.486  21.055 -41.051 1.00 38.70  ? 684  PHE E CE2   1 
ATOM   9380  C CZ    . PHE G 2 84  ? 51.633  19.692 -41.119 1.00 40.51  ? 684  PHE E CZ    1 
ATOM   9381  N N     . GLN G 2 85  ? 47.068  23.806 -38.013 1.00 35.30  ? 685  GLN E N     1 
ATOM   9382  C CA    . GLN G 2 85  ? 46.269  25.017 -37.889 1.00 34.85  ? 685  GLN E CA    1 
ATOM   9383  C C     . GLN G 2 85  ? 46.181  25.449 -39.360 1.00 34.76  ? 685  GLN E C     1 
ATOM   9384  O O     . GLN G 2 85  ? 47.136  25.263 -40.121 1.00 31.94  ? 685  GLN E O     1 
ATOM   9385  C CB    . GLN G 2 85  ? 47.020  26.092 -37.107 1.00 49.93  ? 685  GLN E CB    1 
ATOM   9386  C CG    . GLN G 2 85  ? 47.210  25.831 -35.629 1.00 50.99  ? 685  GLN E CG    1 
ATOM   9387  C CD    . GLN G 2 85  ? 47.798  27.041 -34.919 1.00 54.20  ? 685  GLN E CD    1 
ATOM   9388  O OE1   . GLN G 2 85  ? 48.858  27.534 -35.298 1.00 52.61  ? 685  GLN E OE1   1 
ATOM   9389  N NE2   . GLN G 2 85  ? 47.109  27.530 -33.891 1.00 54.65  ? 685  GLN E NE2   1 
ATOM   9390  N N     . SER G 2 86  ? 45.051  26.002 -39.777 1.00 36.67  ? 686  SER E N     1 
ATOM   9391  C CA    . SER G 2 86  ? 44.918  26.423 -41.165 1.00 36.85  ? 686  SER E CA    1 
ATOM   9392  C C     . SER G 2 86  ? 46.002  27.448 -41.488 1.00 35.11  ? 686  SER E C     1 
ATOM   9393  O O     . SER G 2 86  ? 46.566  27.441 -42.570 1.00 34.78  ? 686  SER E O     1 
ATOM   9394  C CB    . SER G 2 86  ? 43.536  27.008 -41.388 1.00 36.00  ? 686  SER E CB    1 
ATOM   9395  O OG    . SER G 2 86  ? 43.128  27.665 -40.205 1.00 46.60  ? 686  SER E OG    1 
ATOM   9396  N N     . SER G 2 87  ? 46.314  28.310 -40.531 1.00 30.43  ? 687  SER E N     1 
ATOM   9397  C CA    . SER G 2 87  ? 47.340  29.321 -40.737 1.00 31.91  ? 687  SER E CA    1 
ATOM   9398  C C     . SER G 2 87  ? 48.734  28.738 -41.015 1.00 30.90  ? 687  SER E C     1 
ATOM   9399  O O     . SER G 2 87  ? 49.549  29.354 -41.705 1.00 29.90  ? 687  SER E O     1 
ATOM   9400  C CB    . SER G 2 87  ? 47.385  30.248 -39.527 1.00 40.07  ? 687  SER E CB    1 
ATOM   9401  O OG    . SER G 2 87  ? 47.259  29.498 -38.339 1.00 51.47  ? 687  SER E OG    1 
ATOM   9402  N N     . ALA G 2 88  ? 49.009  27.557 -40.478 1.00 27.03  ? 688  ALA E N     1 
ATOM   9403  C CA    . ALA G 2 88  ? 50.292  26.905 -40.696 1.00 27.51  ? 688  ALA E CA    1 
ATOM   9404  C C     . ALA G 2 88  ? 50.384  26.451 -42.145 1.00 28.03  ? 688  ALA E C     1 
ATOM   9405  O O     . ALA G 2 88  ? 51.403  26.616 -42.821 1.00 24.53  ? 688  ALA E O     1 
ATOM   9406  C CB    . ALA G 2 88  ? 50.414  25.726 -39.799 1.00 13.95  ? 688  ALA E CB    1 
ATOM   9407  N N     . VAL G 2 89  ? 49.310  25.856 -42.627 1.00 14.94  ? 689  VAL E N     1 
ATOM   9408  C CA    . VAL G 2 89  ? 49.301  25.404 -44.009 1.00 17.97  ? 689  VAL E CA    1 
ATOM   9409  C C     . VAL G 2 89  ? 49.417  26.582 -44.958 1.00 16.90  ? 689  VAL E C     1 
ATOM   9410  O O     . VAL G 2 89  ? 49.925  26.447 -46.055 1.00 17.94  ? 689  VAL E O     1 
ATOM   9411  C CB    . VAL G 2 89  ? 47.997  24.641 -44.358 1.00 26.35  ? 689  VAL E CB    1 
ATOM   9412  C CG1   . VAL G 2 89  ? 48.164  23.939 -45.705 1.00 25.25  ? 689  VAL E CG1   1 
ATOM   9413  C CG2   . VAL G 2 89  ? 47.663  23.650 -43.257 1.00 28.56  ? 689  VAL E CG2   1 
ATOM   9414  N N     . MET G 2 90  ? 48.912  27.731 -44.534 1.00 24.80  ? 690  MET E N     1 
ATOM   9415  C CA    . MET G 2 90  ? 48.962  28.928 -45.357 1.00 26.48  ? 690  MET E CA    1 
ATOM   9416  C C     . MET G 2 90  ? 50.352  29.562 -45.348 1.00 23.44  ? 690  MET E C     1 
ATOM   9417  O O     . MET G 2 90  ? 50.823  30.045 -46.389 1.00 24.65  ? 690  MET E O     1 
ATOM   9418  C CB    . MET G 2 90  ? 47.921  29.941 -44.885 1.00 26.17  ? 690  MET E CB    1 
ATOM   9419  C CG    . MET G 2 90  ? 46.504  29.602 -45.300 1.00 34.51  ? 690  MET E CG    1 
ATOM   9420  S SD    . MET G 2 90  ? 46.314  29.401 -47.073 1.00 43.27  ? 690  MET E SD    1 
ATOM   9421  C CE    . MET G 2 90  ? 46.345  31.167 -47.476 1.00 38.77  ? 690  MET E CE    1 
ATOM   9422  N N     . ALA G 2 91  ? 50.998  29.562 -44.176 1.00 18.09  ? 691  ALA E N     1 
ATOM   9423  C CA    . ALA G 2 91  ? 52.336  30.102 -44.044 1.00 19.34  ? 691  ALA E CA    1 
ATOM   9424  C C     . ALA G 2 91  ? 53.282  29.287 -44.923 1.00 19.03  ? 691  ALA E C     1 
ATOM   9425  O O     . ALA G 2 91  ? 54.200  29.843 -45.516 1.00 18.52  ? 691  ALA E O     1 
ATOM   9426  C CB    . ALA G 2 91  ? 52.775  30.045 -42.611 1.00 8.33   ? 691  ALA E CB    1 
ATOM   9427  N N     . LEU G 2 92  ? 53.067  27.973 -45.003 1.00 16.35  ? 692  LEU E N     1 
ATOM   9428  C CA    . LEU G 2 92  ? 53.894  27.141 -45.850 1.00 17.07  ? 692  LEU E CA    1 
ATOM   9429  C C     . LEU G 2 92  ? 53.649  27.510 -47.307 1.00 16.20  ? 692  LEU E C     1 
ATOM   9430  O O     . LEU G 2 92  ? 54.605  27.671 -48.092 1.00 13.37  ? 692  LEU E O     1 
ATOM   9431  C CB    . LEU G 2 92  ? 53.579  25.663 -45.660 1.00 18.27  ? 692  LEU E CB    1 
ATOM   9432  C CG    . LEU G 2 92  ? 53.987  25.030 -44.334 1.00 20.38  ? 692  LEU E CG    1 
ATOM   9433  C CD1   . LEU G 2 92  ? 53.159  23.766 -44.102 1.00 20.65  ? 692  LEU E CD1   1 
ATOM   9434  C CD2   . LEU G 2 92  ? 55.494  24.761 -44.327 1.00 18.16  ? 692  LEU E CD2   1 
ATOM   9435  N N     . GLN G 2 93  ? 52.384  27.657 -47.694 1.00 26.43  ? 693  GLN E N     1 
ATOM   9436  C CA    . GLN G 2 93  ? 52.125  27.990 -49.075 1.00 30.74  ? 693  GLN E CA    1 
ATOM   9437  C C     . GLN G 2 93  ? 52.753  29.330 -49.428 1.00 30.93  ? 693  GLN E C     1 
ATOM   9438  O O     . GLN G 2 93  ? 53.404  29.453 -50.464 1.00 31.90  ? 693  GLN E O     1 
ATOM   9439  C CB    . GLN G 2 93  ? 50.639  28.012 -49.371 1.00 23.26  ? 693  GLN E CB    1 
ATOM   9440  C CG    . GLN G 2 93  ? 50.384  27.693 -50.829 1.00 24.00  ? 693  GLN E CG    1 
ATOM   9441  C CD    . GLN G 2 93  ? 48.928  27.623 -51.183 1.00 27.97  ? 693  GLN E CD    1 
ATOM   9442  O OE1   . GLN G 2 93  ? 48.099  27.215 -50.369 1.00 26.32  ? 693  GLN E OE1   1 
ATOM   9443  N NE2   . GLN G 2 93  ? 48.604  28.000 -52.409 1.00 26.28  ? 693  GLN E NE2   1 
ATOM   9444  N N     . GLU G 2 94  ? 52.573  30.325 -48.562 1.00 20.69  ? 694  GLU E N     1 
ATOM   9445  C CA    . GLU G 2 94  ? 53.137  31.631 -48.796 1.00 20.13  ? 694  GLU E CA    1 
ATOM   9446  C C     . GLU G 2 94  ? 54.642  31.509 -48.986 1.00 19.33  ? 694  GLU E C     1 
ATOM   9447  O O     . GLU G 2 94  ? 55.215  32.089 -49.919 1.00 18.04  ? 694  GLU E O     1 
ATOM   9448  C CB    . GLU G 2 94  ? 52.855  32.551 -47.615 1.00 33.85  ? 694  GLU E CB    1 
ATOM   9449  C CG    . GLU G 2 94  ? 51.381  32.921 -47.382 1.00 33.36  ? 694  GLU E CG    1 
ATOM   9450  C CD    . GLU G 2 94  ? 50.813  33.893 -48.406 1.00 38.56  ? 694  GLU E CD    1 
ATOM   9451  O OE1   . GLU G 2 94  ? 51.557  34.780 -48.870 1.00 37.85  ? 694  GLU E OE1   1 
ATOM   9452  O OE2   . GLU G 2 94  ? 49.610  33.783 -48.730 1.00 41.44  ? 694  GLU E OE2   1 
ATOM   9453  N N     . ALA G 2 95  ? 55.284  30.742 -48.114 1.00 14.46  ? 695  ALA E N     1 
ATOM   9454  C CA    . ALA G 2 95  ? 56.733  30.577 -48.180 1.00 13.65  ? 695  ALA E CA    1 
ATOM   9455  C C     . ALA G 2 95  ? 57.203  29.890 -49.441 1.00 14.25  ? 695  ALA E C     1 
ATOM   9456  O O     . ALA G 2 95  ? 58.188  30.282 -50.074 1.00 13.08  ? 695  ALA E O     1 
ATOM   9457  C CB    . ALA G 2 95  ? 57.205  29.787 -47.001 1.00 7.47   ? 695  ALA E CB    1 
ATOM   9458  N N     . SER G 2 96  ? 56.475  28.837 -49.772 1.00 16.87  ? 696  SER E N     1 
ATOM   9459  C CA    . SER G 2 96  ? 56.765  28.013 -50.919 1.00 16.27  ? 696  SER E CA    1 
ATOM   9460  C C     . SER G 2 96  ? 56.622  28.713 -52.256 1.00 13.81  ? 696  SER E C     1 
ATOM   9461  O O     . SER G 2 96  ? 57.460  28.539 -53.124 1.00 14.64  ? 696  SER E O     1 
ATOM   9462  C CB    . SER G 2 96  ? 55.873  26.763 -50.879 1.00 28.88  ? 696  SER E CB    1 
ATOM   9463  O OG    . SER G 2 96  ? 56.000  26.057 -49.653 1.00 34.68  ? 696  SER E OG    1 
ATOM   9464  N N     . GLU G 2 97  ? 55.578  29.505 -52.455 1.00 23.76  ? 697  GLU E N     1 
ATOM   9465  C CA    . GLU G 2 97  ? 55.455  30.142 -53.763 1.00 24.58  ? 697  GLU E CA    1 
ATOM   9466  C C     . GLU G 2 97  ? 56.452  31.291 -53.845 1.00 22.00  ? 697  GLU E C     1 
ATOM   9467  O O     . GLU G 2 97  ? 57.022  31.583 -54.909 1.00 23.65  ? 697  GLU E O     1 
ATOM   9468  C CB    . GLU G 2 97  ? 54.027  30.641 -54.007 1.00 38.45  ? 697  GLU E CB    1 
ATOM   9469  C CG    . GLU G 2 97  ? 52.953  29.578 -53.786 1.00 39.89  ? 697  GLU E CG    1 
ATOM   9470  C CD    . GLU G 2 97  ? 51.628  29.898 -54.484 1.00 44.39  ? 697  GLU E CD    1 
ATOM   9471  O OE1   . GLU G 2 97  ? 51.317  31.088 -54.625 1.00 40.65  ? 697  GLU E OE1   1 
ATOM   9472  O OE2   . GLU G 2 97  ? 50.887  28.975 -54.881 1.00 45.23  ? 697  GLU E OE2   1 
ATOM   9473  N N     . ALA G 2 98  ? 56.679  31.917 -52.697 1.00 17.22  ? 698  ALA E N     1 
ATOM   9474  C CA    . ALA G 2 98  ? 57.589  33.039 -52.644 1.00 19.27  ? 698  ALA E CA    1 
ATOM   9475  C C     . ALA G 2 98  ? 58.958  32.566 -53.058 1.00 20.60  ? 698  ALA E C     1 
ATOM   9476  O O     . ALA G 2 98  ? 59.707  33.295 -53.712 1.00 20.95  ? 698  ALA E O     1 
ATOM   9477  C CB    . ALA G 2 98  ? 57.625  33.602 -51.258 1.00 5.62   ? 698  ALA E CB    1 
ATOM   9478  N N     . TYR G 2 99  ? 59.260  31.333 -52.677 1.00 16.82  ? 699  TYR E N     1 
ATOM   9479  C CA    . TYR G 2 99  ? 60.520  30.684 -52.984 1.00 14.27  ? 699  TYR E CA    1 
ATOM   9480  C C     . TYR G 2 99  ? 60.600  30.320 -54.472 1.00 14.74  ? 699  TYR E C     1 
ATOM   9481  O O     . TYR G 2 99  ? 61.580  30.632 -55.165 1.00 15.64  ? 699  TYR E O     1 
ATOM   9482  C CB    . TYR G 2 99  ? 60.644  29.422 -52.130 1.00 22.82  ? 699  TYR E CB    1 
ATOM   9483  C CG    . TYR G 2 99  ? 61.765  28.516 -52.534 1.00 24.32  ? 699  TYR E CG    1 
ATOM   9484  C CD1   . TYR G 2 99  ? 63.075  28.776 -52.153 1.00 23.19  ? 699  TYR E CD1   1 
ATOM   9485  C CD2   . TYR G 2 99  ? 61.519  27.409 -53.334 1.00 26.99  ? 699  TYR E CD2   1 
ATOM   9486  C CE1   . TYR G 2 99  ? 64.125  27.946 -52.563 1.00 25.28  ? 699  TYR E CE1   1 
ATOM   9487  C CE2   . TYR G 2 99  ? 62.552  26.572 -53.760 1.00 25.73  ? 699  TYR E CE2   1 
ATOM   9488  C CZ    . TYR G 2 99  ? 63.865  26.837 -53.377 1.00 28.75  ? 699  TYR E CZ    1 
ATOM   9489  O OH    . TYR G 2 99  ? 64.894  26.009 -53.846 1.00 27.02  ? 699  TYR E OH    1 
ATOM   9490  N N     . LEU G 2 100 ? 59.560  29.653 -54.960 1.00 18.01  ? 700  LEU E N     1 
ATOM   9491  C CA    . LEU G 2 100 ? 59.531  29.252 -56.350 1.00 18.40  ? 700  LEU E CA    1 
ATOM   9492  C C     . LEU G 2 100 ? 59.554  30.466 -57.323 1.00 17.18  ? 700  LEU E C     1 
ATOM   9493  O O     . LEU G 2 100 ? 60.239  30.466 -58.365 1.00 18.80  ? 700  LEU E O     1 
ATOM   9494  C CB    . LEU G 2 100 ? 58.296  28.370 -56.590 1.00 13.88  ? 700  LEU E CB    1 
ATOM   9495  C CG    . LEU G 2 100 ? 58.284  26.961 -55.988 1.00 19.05  ? 700  LEU E CG    1 
ATOM   9496  C CD1   . LEU G 2 100 ? 56.977  26.252 -56.321 1.00 15.53  ? 700  LEU E CD1   1 
ATOM   9497  C CD2   . LEU G 2 100 ? 59.444  26.160 -56.529 1.00 14.99  ? 700  LEU E CD2   1 
ATOM   9498  N N     . VAL G 2 101 ? 58.804  31.505 -56.985 1.00 29.62  ? 701  VAL E N     1 
ATOM   9499  C CA    . VAL G 2 101 ? 58.762  32.660 -57.851 1.00 29.15  ? 701  VAL E CA    1 
ATOM   9500  C C     . VAL G 2 101 ? 60.156  33.230 -57.985 1.00 25.43  ? 701  VAL E C     1 
ATOM   9501  O O     . VAL G 2 101 ? 60.638  33.506 -59.084 1.00 28.46  ? 701  VAL E O     1 
ATOM   9502  C CB    . VAL G 2 101 ? 57.794  33.725 -57.310 1.00 19.33  ? 701  VAL E CB    1 
ATOM   9503  C CG1   . VAL G 2 101 ? 57.907  34.986 -58.139 1.00 18.62  ? 701  VAL E CG1   1 
ATOM   9504  C CG2   . VAL G 2 101 ? 56.340  33.204 -57.395 1.00 19.70  ? 701  VAL E CG2   1 
ATOM   9505  N N     . ALA G 2 102 ? 60.820  33.363 -56.852 1.00 30.52  ? 702  ALA E N     1 
ATOM   9506  C CA    . ALA G 2 102 ? 62.160  33.902 -56.832 1.00 31.06  ? 702  ALA E CA    1 
ATOM   9507  C C     . ALA G 2 102 ? 63.125  32.987 -57.523 1.00 32.08  ? 702  ALA E C     1 
ATOM   9508  O O     . ALA G 2 102 ? 64.058  33.449 -58.141 1.00 33.59  ? 702  ALA E O     1 
ATOM   9509  C CB    . ALA G 2 102 ? 62.586  34.099 -55.448 1.00 21.25  ? 702  ALA E CB    1 
ATOM   9510  N N     . LEU G 2 103 ? 62.922  31.683 -57.412 1.00 25.89  ? 703  LEU E N     1 
ATOM   9511  C CA    . LEU G 2 103 ? 63.831  30.760 -58.046 1.00 21.67  ? 703  LEU E CA    1 
ATOM   9512  C C     . LEU G 2 103 ? 63.671  30.834 -59.560 1.00 22.11  ? 703  LEU E C     1 
ATOM   9513  O O     . LEU G 2 103 ? 64.656  30.702 -60.300 1.00 21.04  ? 703  LEU E O     1 
ATOM   9514  C CB    . LEU G 2 103 ? 63.576  29.337 -57.544 1.00 4.43   ? 703  LEU E CB    1 
ATOM   9515  C CG    . LEU G 2 103 ? 64.491  28.315 -58.224 1.00 7.04   ? 703  LEU E CG    1 
ATOM   9516  C CD1   . LEU G 2 103 ? 65.947  28.594 -57.884 1.00 7.22   ? 703  LEU E CD1   1 
ATOM   9517  C CD2   . LEU G 2 103 ? 64.121  26.955 -57.783 1.00 5.77   ? 703  LEU E CD2   1 
ATOM   9518  N N     . PHE G 2 104 ? 62.431  31.047 -60.021 1.00 29.19  ? 704  PHE E N     1 
ATOM   9519  C CA    . PHE G 2 104 ? 62.152  31.154 -61.458 1.00 30.23  ? 704  PHE E CA    1 
ATOM   9520  C C     . PHE G 2 104 ? 62.815  32.397 -62.047 1.00 31.07  ? 704  PHE E C     1 
ATOM   9521  O O     . PHE G 2 104 ? 63.263  32.377 -63.195 1.00 34.00  ? 704  PHE E O     1 
ATOM   9522  C CB    . PHE G 2 104 ? 60.638  31.177 -61.731 1.00 13.31  ? 704  PHE E CB    1 
ATOM   9523  C CG    . PHE G 2 104 ? 60.048  29.815 -62.014 1.00 12.90  ? 704  PHE E CG    1 
ATOM   9524  C CD1   . PHE G 2 104 ? 59.026  29.317 -61.232 1.00 13.58  ? 704  PHE E CD1   1 
ATOM   9525  C CD2   . PHE G 2 104 ? 60.593  28.995 -63.007 1.00 13.79  ? 704  PHE E CD2   1 
ATOM   9526  C CE1   . PHE G 2 104 ? 58.553  28.022 -61.406 1.00 13.22  ? 704  PHE E CE1   1 
ATOM   9527  C CE2   . PHE G 2 104 ? 60.133  27.698 -63.194 1.00 13.27  ? 704  PHE E CE2   1 
ATOM   9528  C CZ    . PHE G 2 104 ? 59.098  27.208 -62.373 1.00 14.12  ? 704  PHE E CZ    1 
ATOM   9529  N N     . GLU G 2 105 ? 62.884  33.477 -61.269 1.00 26.74  ? 705  GLU E N     1 
ATOM   9530  C CA    . GLU G 2 105 ? 63.557  34.678 -61.756 1.00 28.89  ? 705  GLU E CA    1 
ATOM   9531  C C     . GLU G 2 105 ? 65.035  34.326 -62.027 1.00 27.12  ? 705  GLU E C     1 
ATOM   9532  O O     . GLU G 2 105 ? 65.553  34.551 -63.147 1.00 27.36  ? 705  GLU E O     1 
ATOM   9533  C CB    . GLU G 2 105 ? 63.474  35.819 -60.738 1.00 50.11  ? 705  GLU E CB    1 
ATOM   9534  C CG    . GLU G 2 105 ? 62.064  36.120 -60.261 1.00 57.30  ? 705  GLU E CG    1 
ATOM   9535  C CD    . GLU G 2 105 ? 61.986  37.256 -59.237 1.00 60.83  ? 705  GLU E CD    1 
ATOM   9536  O OE1   . GLU G 2 105 ? 62.948  37.458 -58.457 1.00 60.12  ? 705  GLU E OE1   1 
ATOM   9537  O OE2   . GLU G 2 105 ? 60.936  37.936 -59.207 1.00 60.50  ? 705  GLU E OE2   1 
ATOM   9538  N N     . ASP G 2 106 ? 65.706  33.758 -61.016 1.00 23.97  ? 706  ASP E N     1 
ATOM   9539  C CA    . ASP G 2 106 ? 67.112  33.367 -61.168 1.00 24.40  ? 706  ASP E CA    1 
ATOM   9540  C C     . ASP G 2 106 ? 67.270  32.496 -62.408 1.00 22.70  ? 706  ASP E C     1 
ATOM   9541  O O     . ASP G 2 106 ? 68.140  32.735 -63.239 1.00 22.98  ? 706  ASP E O     1 
ATOM   9542  C CB    . ASP G 2 106 ? 67.605  32.606 -59.937 1.00 37.31  ? 706  ASP E CB    1 
ATOM   9543  C CG    . ASP G 2 106 ? 67.754  33.497 -58.726 1.00 41.18  ? 706  ASP E CG    1 
ATOM   9544  O OD1   . ASP G 2 106 ? 68.080  34.683 -58.917 1.00 42.09  ? 706  ASP E OD1   1 
ATOM   9545  O OD2   . ASP G 2 106 ? 67.568  33.022 -57.583 1.00 41.75  ? 706  ASP E OD2   1 
ATOM   9546  N N     . THR G 2 107 ? 66.415  31.484 -62.517 1.00 17.82  ? 707  THR E N     1 
ATOM   9547  C CA    . THR G 2 107 ? 66.416  30.580 -63.663 1.00 14.13  ? 707  THR E CA    1 
ATOM   9548  C C     . THR G 2 107 ? 66.331  31.364 -64.953 1.00 14.94  ? 707  THR E C     1 
ATOM   9549  O O     . THR G 2 107 ? 67.118  31.148 -65.879 1.00 16.67  ? 707  THR E O     1 
ATOM   9550  C CB    . THR G 2 107 ? 65.189  29.652 -63.673 1.00 20.46  ? 707  THR E CB    1 
ATOM   9551  O OG1   . THR G 2 107 ? 65.235  28.770 -62.555 1.00 17.66  ? 707  THR E OG1   1 
ATOM   9552  C CG2   . THR G 2 107 ? 65.160  28.842 -64.924 1.00 22.64  ? 707  THR E CG2   1 
ATOM   9553  N N     . ASN G 2 108 ? 65.361  32.281 -65.002 1.00 16.79  ? 708  ASN E N     1 
ATOM   9554  C CA    . ASN G 2 108 ? 65.123  33.063 -66.196 1.00 15.22  ? 708  ASN E CA    1 
ATOM   9555  C C     . ASN G 2 108 ? 66.383  33.770 -66.638 1.00 20.16  ? 708  ASN E C     1 
ATOM   9556  O O     . ASN G 2 108 ? 66.704  33.793 -67.822 1.00 19.28  ? 708  ASN E O     1 
ATOM   9557  C CB    . ASN G 2 108 ? 63.996  34.044 -65.938 1.00 13.46  ? 708  ASN E CB    1 
ATOM   9558  C CG    . ASN G 2 108 ? 63.417  34.623 -67.228 1.00 14.92  ? 708  ASN E CG    1 
ATOM   9559  O OD1   . ASN G 2 108 ? 63.371  33.955 -68.251 1.00 17.64  ? 708  ASN E OD1   1 
ATOM   9560  N ND2   . ASN G 2 108 ? 62.952  35.879 -67.165 1.00 16.75  ? 708  ASN E ND2   1 
ATOM   9561  N N     . LEU G 2 109 ? 67.102  34.332 -65.670 1.00 25.50  ? 709  LEU E N     1 
ATOM   9562  C CA    . LEU G 2 109 ? 68.355  35.021 -65.933 1.00 25.35  ? 709  LEU E CA    1 
ATOM   9563  C C     . LEU G 2 109 ? 69.410  34.069 -66.442 1.00 26.30  ? 709  LEU E C     1 
ATOM   9564  O O     . LEU G 2 109 ? 70.087  34.366 -67.420 1.00 24.46  ? 709  LEU E O     1 
ATOM   9565  C CB    . LEU G 2 109 ? 68.860  35.644 -64.672 1.00 2.50   ? 709  LEU E CB    1 
ATOM   9566  C CG    . LEU G 2 109 ? 68.261  36.977 -64.254 1.00 2.88   ? 709  LEU E CG    1 
ATOM   9567  C CD1   . LEU G 2 109 ? 68.876  37.439 -62.948 1.00 4.74   ? 709  LEU E CD1   1 
ATOM   9568  C CD2   . LEU G 2 109 ? 68.526  37.960 -65.340 1.00 2.92   ? 709  LEU E CD2   1 
ATOM   9569  N N     . CYS G 2 110 ? 69.559  32.931 -65.766 1.00 34.49  ? 710  CYS E N     1 
ATOM   9570  C CA    . CYS G 2 110 ? 70.522  31.913 -66.190 1.00 38.50  ? 710  CYS E CA    1 
ATOM   9571  C C     . CYS G 2 110 ? 70.295  31.498 -67.657 1.00 37.81  ? 710  CYS E C     1 
ATOM   9572  O O     . CYS G 2 110 ? 71.247  31.336 -68.420 1.00 36.22  ? 710  CYS E O     1 
ATOM   9573  C CB    . CYS G 2 110 ? 70.437  30.677 -65.284 1.00 23.70  ? 710  CYS E CB    1 
ATOM   9574  S SG    . CYS G 2 110 ? 71.428  30.759 -63.805 1.00 30.92  ? 710  CYS E SG    1 
ATOM   9575  N N     . ALA G 2 111 ? 69.037  31.314 -68.043 1.00 24.25  ? 711  ALA E N     1 
ATOM   9576  C CA    . ALA G 2 111 ? 68.731  30.967 -69.419 1.00 23.28  ? 711  ALA E CA    1 
ATOM   9577  C C     . ALA G 2 111 ? 69.158  32.127 -70.302 1.00 22.89  ? 711  ALA E C     1 
ATOM   9578  O O     . ALA G 2 111 ? 69.907  31.958 -71.258 1.00 23.43  ? 711  ALA E O     1 
ATOM   9579  C CB    . ALA G 2 111 ? 67.244  30.737 -69.589 1.00 33.51  ? 711  ALA E CB    1 
ATOM   9580  N N     . ILE G 2 112 ? 68.669  33.313 -69.977 1.00 21.12  ? 712  ILE E N     1 
ATOM   9581  C CA    . ILE G 2 112 ? 69.002  34.475 -70.764 1.00 22.19  ? 712  ILE E CA    1 
ATOM   9582  C C     . ILE G 2 112 ? 70.527  34.576 -70.933 1.00 24.58  ? 712  ILE E C     1 
ATOM   9583  O O     . ILE G 2 112 ? 71.036  34.936 -71.997 1.00 25.92  ? 712  ILE E O     1 
ATOM   9584  C CB    . ILE G 2 112 ? 68.388  35.757 -70.107 1.00 18.12  ? 712  ILE E CB    1 
ATOM   9585  C CG1   . ILE G 2 112 ? 66.879  35.795 -70.376 1.00 14.17  ? 712  ILE E CG1   1 
ATOM   9586  C CG2   . ILE G 2 112 ? 68.992  37.009 -70.679 1.00 16.91  ? 712  ILE E CG2   1 
ATOM   9587  C CD1   . ILE G 2 112 ? 66.054  36.588 -69.310 1.00 16.78  ? 712  ILE E CD1   1 
ATOM   9588  N N     . HIS G 2 113 ? 71.247  34.222 -69.880 1.00 24.57  ? 713  HIS E N     1 
ATOM   9589  C CA    . HIS G 2 113 ? 72.698  34.270 -69.891 1.00 26.55  ? 713  HIS E CA    1 
ATOM   9590  C C     . HIS G 2 113 ? 73.239  33.407 -71.016 1.00 28.87  ? 713  HIS E C     1 
ATOM   9591  O O     . HIS G 2 113 ? 74.253  33.719 -71.646 1.00 30.91  ? 713  HIS E O     1 
ATOM   9592  C CB    . HIS G 2 113 ? 73.217  33.750 -68.557 1.00 31.45  ? 713  HIS E CB    1 
ATOM   9593  C CG    . HIS G 2 113 ? 74.705  33.784 -68.429 1.00 30.00  ? 713  HIS E CG    1 
ATOM   9594  N ND1   . HIS G 2 113 ? 75.416  34.960 -68.331 1.00 28.78  ? 713  HIS E ND1   1 
ATOM   9595  C CD2   . HIS G 2 113 ? 75.617  32.784 -68.393 1.00 30.83  ? 713  HIS E CD2   1 
ATOM   9596  C CE1   . HIS G 2 113 ? 76.704  34.682 -68.242 1.00 29.73  ? 713  HIS E CE1   1 
ATOM   9597  N NE2   . HIS G 2 113 ? 76.853  33.369 -68.276 1.00 29.69  ? 713  HIS E NE2   1 
ATOM   9598  N N     . ALA G 2 114 ? 72.542  32.299 -71.235 1.00 43.14  ? 714  ALA E N     1 
ATOM   9599  C CA    . ALA G 2 114 ? 72.888  31.326 -72.249 1.00 45.94  ? 714  ALA E CA    1 
ATOM   9600  C C     . ALA G 2 114 ? 72.291  31.721 -73.584 1.00 45.76  ? 714  ALA E C     1 
ATOM   9601  O O     . ALA G 2 114 ? 72.207  30.910 -74.507 1.00 45.23  ? 714  ALA E O     1 
ATOM   9602  C CB    . ALA G 2 114 ? 72.369  29.978 -71.840 1.00 56.14  ? 714  ALA E CB    1 
ATOM   9603  N N     . LYS G 2 115 ? 71.837  32.961 -73.677 1.00 39.59  ? 715  LYS E N     1 
ATOM   9604  C CA    . LYS G 2 115 ? 71.282  33.431 -74.924 1.00 42.00  ? 715  LYS E CA    1 
ATOM   9605  C C     . LYS G 2 115 ? 70.037  32.656 -75.387 1.00 41.11  ? 715  LYS E C     1 
ATOM   9606  O O     . LYS G 2 115 ? 69.829  32.461 -76.577 1.00 40.86  ? 715  LYS E O     1 
ATOM   9607  C CB    . LYS G 2 115 ? 72.365  33.361 -75.991 1.00 30.72  ? 715  LYS E CB    1 
ATOM   9608  C CG    . LYS G 2 115 ? 73.496  34.354 -75.825 1.00 38.22  ? 715  LYS E CG    1 
ATOM   9609  C CD    . LYS G 2 115 ? 74.542  34.126 -76.924 1.00 43.80  ? 715  LYS E CD    1 
ATOM   9610  C CE    . LYS G 2 115 ? 75.620  35.200 -76.934 1.00 48.09  ? 715  LYS E CE    1 
ATOM   9611  N NZ    . LYS G 2 115 ? 75.080  36.588 -77.117 1.00 52.51  ? 715  LYS E NZ    1 
ATOM   9612  N N     . ARG G 2 116 ? 69.216  32.222 -74.439 1.00 49.49  ? 716  ARG E N     1 
ATOM   9613  C CA    . ARG G 2 116 ? 67.984  31.504 -74.734 1.00 48.13  ? 716  ARG E CA    1 
ATOM   9614  C C     . ARG G 2 116 ? 66.842  32.262 -74.059 1.00 48.55  ? 716  ARG E C     1 
ATOM   9615  O O     . ARG G 2 116 ? 67.073  33.214 -73.313 1.00 48.55  ? 716  ARG E O     1 
ATOM   9616  C CB    . ARG G 2 116 ? 68.039  30.090 -74.163 1.00 35.98  ? 716  ARG E CB    1 
ATOM   9617  C CG    . ARG G 2 116 ? 68.906  29.129 -74.921 1.00 37.83  ? 716  ARG E CG    1 
ATOM   9618  C CD    . ARG G 2 116 ? 68.893  27.710 -74.305 1.00 37.31  ? 716  ARG E CD    1 
ATOM   9619  N NE    . ARG G 2 116 ? 69.779  27.593 -73.143 1.00 35.94  ? 716  ARG E NE    1 
ATOM   9620  C CZ    . ARG G 2 116 ? 69.382  27.550 -71.871 1.00 36.97  ? 716  ARG E CZ    1 
ATOM   9621  N NH1   . ARG G 2 116 ? 68.089  27.608 -71.567 1.00 32.90  ? 716  ARG E NH1   1 
ATOM   9622  N NH2   . ARG G 2 116 ? 70.280  27.442 -70.899 1.00 34.40  ? 716  ARG E NH2   1 
ATOM   9623  N N     . VAL G 2 117 ? 65.611  31.846 -74.333 1.00 36.44  ? 717  VAL E N     1 
ATOM   9624  C CA    . VAL G 2 117 ? 64.437  32.440 -73.708 1.00 35.17  ? 717  VAL E CA    1 
ATOM   9625  C C     . VAL G 2 117 ? 63.578  31.322 -73.118 1.00 33.16  ? 717  VAL E C     1 
ATOM   9626  O O     . VAL G 2 117 ? 62.664  31.578 -72.356 1.00 35.70  ? 717  VAL E O     1 
ATOM   9627  C CB    . VAL G 2 117 ? 63.625  33.265 -74.707 1.00 17.84  ? 717  VAL E CB    1 
ATOM   9628  C CG1   . VAL G 2 117 ? 64.451  34.389 -75.202 1.00 18.54  ? 717  VAL E CG1   1 
ATOM   9629  C CG2   . VAL G 2 117 ? 63.207  32.424 -75.883 1.00 15.74  ? 717  VAL E CG2   1 
ATOM   9630  N N     . ILE G 2 118 ? 63.887  30.080 -73.472 1.00 35.32  ? 718  ILE E N     1 
ATOM   9631  C CA    . ILE G 2 118 ? 63.163  28.929 -72.944 1.00 36.95  ? 718  ILE E CA    1 
ATOM   9632  C C     . ILE G 2 118 ? 63.932  28.365 -71.760 1.00 34.90  ? 718  ILE E C     1 
ATOM   9633  O O     . ILE G 2 118 ? 65.006  27.789 -71.945 1.00 37.38  ? 718  ILE E O     1 
ATOM   9634  C CB    . ILE G 2 118 ? 63.036  27.822 -73.992 1.00 56.30  ? 718  ILE E CB    1 
ATOM   9635  C CG1   . ILE G 2 118 ? 62.431  28.418 -75.278 1.00 48.64  ? 718  ILE E CG1   1 
ATOM   9636  C CG2   . ILE G 2 118 ? 62.223  26.673 -73.430 1.00 55.01  ? 718  ILE E CG2   1 
ATOM   9637  C CD1   . ILE G 2 118 ? 62.067  27.405 -76.423 1.00 48.64  ? 718  ILE E CD1   1 
ATOM   9638  N N     . ILE G 2 119 ? 63.400  28.523 -70.549 1.00 15.30  ? 719  ILE E N     1 
ATOM   9639  C CA    . ILE G 2 119 ? 64.096  28.002 -69.383 1.00 14.94  ? 719  ILE E CA    1 
ATOM   9640  C C     . ILE G 2 119 ? 64.119  26.457 -69.385 1.00 16.77  ? 719  ILE E C     1 
ATOM   9641  O O     . ILE G 2 119 ? 63.188  25.810 -69.854 1.00 15.07  ? 719  ILE E O     1 
ATOM   9642  C CB    . ILE G 2 119 ? 63.463  28.509 -68.068 1.00 9.94   ? 719  ILE E CB    1 
ATOM   9643  C CG1   . ILE G 2 119 ? 62.086  27.858 -67.852 1.00 10.46  ? 719  ILE E CG1   1 
ATOM   9644  C CG2   . ILE G 2 119 ? 63.441  30.046 -68.060 1.00 8.47   ? 719  ILE E CG2   1 
ATOM   9645  C CD1   . ILE G 2 119 ? 61.408  28.230 -66.517 1.00 10.62  ? 719  ILE E CD1   1 
ATOM   9646  N N     . MET G 2 120 ? 65.193  25.867 -68.867 1.00 32.78  ? 720  MET E N     1 
ATOM   9647  C CA    . MET G 2 120 ? 65.327  24.411 -68.840 1.00 36.22  ? 720  MET E CA    1 
ATOM   9648  C C     . MET G 2 120 ? 65.813  23.917 -67.499 1.00 36.66  ? 720  MET E C     1 
ATOM   9649  O O     . MET G 2 120 ? 66.306  24.684 -66.706 1.00 34.97  ? 720  MET E O     1 
ATOM   9650  C CB    . MET G 2 120 ? 66.281  23.971 -69.932 1.00 45.05  ? 720  MET E CB    1 
ATOM   9651  C CG    . MET G 2 120 ? 65.848  24.444 -71.298 1.00 44.80  ? 720  MET E CG    1 
ATOM   9652  S SD    . MET G 2 120 ? 66.857  23.713 -72.577 1.00 51.47  ? 720  MET E SD    1 
ATOM   9653  C CE    . MET G 2 120 ? 68.318  24.705 -72.503 1.00 56.16  ? 720  MET E CE    1 
ATOM   9654  N N     . PRO G 2 121 ? 65.676  22.622 -67.222 1.00 32.00  ? 721  PRO E N     1 
ATOM   9655  C CA    . PRO G 2 121 ? 66.128  22.103 -65.933 1.00 32.19  ? 721  PRO E CA    1 
ATOM   9656  C C     . PRO G 2 121 ? 67.546  22.557 -65.565 1.00 30.57  ? 721  PRO E C     1 
ATOM   9657  O O     . PRO G 2 121 ? 67.817  22.922 -64.402 1.00 33.07  ? 721  PRO E O     1 
ATOM   9658  C CB    . PRO G 2 121 ? 66.028  20.594 -66.133 1.00 19.52  ? 721  PRO E CB    1 
ATOM   9659  C CG    . PRO G 2 121 ? 64.869  20.462 -67.020 1.00 20.01  ? 721  PRO E CG    1 
ATOM   9660  C CD    . PRO G 2 121 ? 65.160  21.523 -68.053 1.00 19.83  ? 721  PRO E CD    1 
ATOM   9661  N N     . LYS G 2 122 ? 68.432  22.522 -66.562 1.00 31.36  ? 722  LYS E N     1 
ATOM   9662  C CA    . LYS G 2 122 ? 69.818  22.912 -66.390 1.00 34.51  ? 722  LYS E CA    1 
ATOM   9663  C C     . LYS G 2 122 ? 69.917  24.327 -65.853 1.00 31.20  ? 722  LYS E C     1 
ATOM   9664  O O     . LYS G 2 122 ? 70.815  24.631 -65.078 1.00 31.31  ? 722  LYS E O     1 
ATOM   9665  C CB    . LYS G 2 122 ? 70.569  22.798 -67.717 1.00 52.92  ? 722  LYS E CB    1 
ATOM   9666  C CG    . LYS G 2 122 ? 70.002  23.665 -68.826 1.00 57.67  ? 722  LYS E CG    1 
ATOM   9667  C CD    . LYS G 2 122 ? 70.475  23.231 -70.214 1.00 63.02  ? 722  LYS E CD    1 
ATOM   9668  C CE    . LYS G 2 122 ? 71.961  23.469 -70.425 1.00 69.44  ? 722  LYS E CE    1 
ATOM   9669  N NZ    . LYS G 2 122 ? 72.380  23.154 -71.820 1.00 70.57  ? 722  LYS E NZ    1 
ATOM   9670  N N     . ASP G 2 123 ? 69.000  25.195 -66.262 1.00 27.60  ? 723  ASP E N     1 
ATOM   9671  C CA    . ASP G 2 123 ? 68.983  26.569 -65.781 1.00 26.71  ? 723  ASP E CA    1 
ATOM   9672  C C     . ASP G 2 123 ? 68.640  26.560 -64.297 1.00 27.62  ? 723  ASP E C     1 
ATOM   9673  O O     . ASP G 2 123 ? 69.329  27.183 -63.501 1.00 25.80  ? 723  ASP E O     1 
ATOM   9674  C CB    . ASP G 2 123 ? 67.943  27.390 -66.536 1.00 32.76  ? 723  ASP E CB    1 
ATOM   9675  C CG    . ASP G 2 123 ? 68.339  27.649 -67.974 1.00 31.18  ? 723  ASP E CG    1 
ATOM   9676  O OD1   . ASP G 2 123 ? 69.441  28.204 -68.181 1.00 31.19  ? 723  ASP E OD1   1 
ATOM   9677  O OD2   . ASP G 2 123 ? 67.559  27.311 -68.894 1.00 32.77  ? 723  ASP E OD2   1 
ATOM   9678  N N     . ILE G 2 124 ? 67.572  25.853 -63.928 1.00 29.58  ? 724  ILE E N     1 
ATOM   9679  C CA    . ILE G 2 124 ? 67.140  25.756 -62.534 1.00 30.54  ? 724  ILE E CA    1 
ATOM   9680  C C     . ILE G 2 124 ? 68.299  25.197 -61.717 1.00 31.55  ? 724  ILE E C     1 
ATOM   9681  O O     . ILE G 2 124 ? 68.580  25.660 -60.602 1.00 32.31  ? 724  ILE E O     1 
ATOM   9682  C CB    . ILE G 2 124 ? 65.917  24.800 -62.385 1.00 22.26  ? 724  ILE E CB    1 
ATOM   9683  C CG1   . ILE G 2 124 ? 64.680  25.414 -63.069 1.00 23.56  ? 724  ILE E CG1   1 
ATOM   9684  C CG2   . ILE G 2 124 ? 65.646  24.504 -60.908 1.00 21.30  ? 724  ILE E CG2   1 
ATOM   9685  C CD1   . ILE G 2 124 ? 63.339  24.681 -62.777 1.00 19.76  ? 724  ILE E CD1   1 
ATOM   9686  N N     . GLN G 2 125 ? 68.971  24.198 -62.284 1.00 36.32  ? 725  GLN E N     1 
ATOM   9687  C CA    . GLN G 2 125 ? 70.095  23.564 -61.613 1.00 36.83  ? 725  GLN E CA    1 
ATOM   9688  C C     . GLN G 2 125 ? 71.275  24.492 -61.396 1.00 33.64  ? 725  GLN E C     1 
ATOM   9689  O O     . GLN G 2 125 ? 71.927  24.433 -60.350 1.00 34.71  ? 725  GLN E O     1 
ATOM   9690  C CB    . GLN G 2 125 ? 70.565  22.358 -62.405 1.00 34.12  ? 725  GLN E CB    1 
ATOM   9691  C CG    . GLN G 2 125 ? 69.701  21.147 -62.256 1.00 36.25  ? 725  GLN E CG    1 
ATOM   9692  C CD    . GLN G 2 125 ? 69.697  20.267 -63.504 1.00 41.71  ? 725  GLN E CD    1 
ATOM   9693  O OE1   . GLN G 2 125 ? 70.701  20.155 -64.231 1.00 43.56  ? 725  GLN E OE1   1 
ATOM   9694  N NE2   . GLN G 2 125 ? 68.556  19.629 -63.755 1.00 40.88  ? 725  GLN E NE2   1 
ATOM   9695  N N     . LEU G 2 126 ? 71.566  25.340 -62.383 1.00 31.74  ? 726  LEU E N     1 
ATOM   9696  C CA    . LEU G 2 126 ? 72.703  26.244 -62.258 1.00 32.26  ? 726  LEU E CA    1 
ATOM   9697  C C     . LEU G 2 126 ? 72.374  27.245 -61.184 1.00 33.06  ? 726  LEU E C     1 
ATOM   9698  O O     . LEU G 2 126 ? 73.215  27.588 -60.358 1.00 32.52  ? 726  LEU E O     1 
ATOM   9699  C CB    . LEU G 2 126 ? 73.023  26.975 -63.580 1.00 6.80   ? 726  LEU E CB    1 
ATOM   9700  C CG    . LEU G 2 126 ? 74.185  27.987 -63.439 1.00 10.24  ? 726  LEU E CG    1 
ATOM   9701  C CD1   . LEU G 2 126 ? 75.422  27.268 -62.952 1.00 9.98   ? 726  LEU E CD1   1 
ATOM   9702  C CD2   . LEU G 2 126 ? 74.505  28.654 -64.740 1.00 9.42   ? 726  LEU E CD2   1 
ATOM   9703  N N     . ALA G 2 127 ? 71.129  27.686 -61.175 1.00 15.20  ? 727  ALA E N     1 
ATOM   9704  C CA    . ALA G 2 127 ? 70.723  28.668 -60.185 1.00 17.67  ? 727  ALA E CA    1 
ATOM   9705  C C     . ALA G 2 127 ? 70.851  28.117 -58.780 1.00 18.67  ? 727  ALA E C     1 
ATOM   9706  O O     . ALA G 2 127 ? 71.424  28.771 -57.901 1.00 19.99  ? 727  ALA E O     1 
ATOM   9707  C CB    . ALA G 2 127 ? 69.281  29.162 -60.445 1.00 2.80   ? 727  ALA E CB    1 
ATOM   9708  N N     . ARG G 2 128 ? 70.343  26.906 -58.577 1.00 28.55  ? 728  ARG E N     1 
ATOM   9709  C CA    . ARG G 2 128 ? 70.387  26.308 -57.259 1.00 31.10  ? 728  ARG E CA    1 
ATOM   9710  C C     . ARG G 2 128 ? 71.805  26.024 -56.836 1.00 32.21  ? 728  ARG E C     1 
ATOM   9711  O O     . ARG G 2 128 ? 72.097  26.028 -55.657 1.00 28.31  ? 728  ARG E O     1 
ATOM   9712  C CB    . ARG G 2 128 ? 69.557  25.042 -57.229 1.00 25.46  ? 728  ARG E CB    1 
ATOM   9713  C CG    . ARG G 2 128 ? 68.102  25.264 -57.604 1.00 27.05  ? 728  ARG E CG    1 
ATOM   9714  C CD    . ARG G 2 128 ? 67.186  24.627 -56.572 1.00 34.17  ? 728  ARG E CD    1 
ATOM   9715  N NE    . ARG G 2 128 ? 67.543  23.227 -56.371 1.00 44.66  ? 728  ARG E NE    1 
ATOM   9716  C CZ    . ARG G 2 128 ? 67.217  22.496 -55.312 1.00 43.61  ? 728  ARG E CZ    1 
ATOM   9717  N NH1   . ARG G 2 128 ? 66.504  23.012 -54.307 1.00 42.11  ? 728  ARG E NH1   1 
ATOM   9718  N NH2   . ARG G 2 128 ? 67.615  21.239 -55.260 1.00 45.06  ? 728  ARG E NH2   1 
ATOM   9719  N N     . ARG G 2 129 ? 72.696  25.805 -57.796 1.00 28.87  ? 729  ARG E N     1 
ATOM   9720  C CA    . ARG G 2 129 ? 74.089  25.537 -57.458 1.00 34.11  ? 729  ARG E CA    1 
ATOM   9721  C C     . ARG G 2 129 ? 74.783  26.796 -56.956 1.00 33.77  ? 729  ARG E C     1 
ATOM   9722  O O     . ARG G 2 129 ? 75.504  26.788 -55.960 1.00 32.90  ? 729  ARG E O     1 
ATOM   9723  C CB    . ARG G 2 129 ? 74.841  25.013 -58.666 1.00 50.07  ? 729  ARG E CB    1 
ATOM   9724  C CG    . ARG G 2 129 ? 76.341  24.873 -58.450 1.00 57.73  ? 729  ARG E CG    1 
ATOM   9725  C CD    . ARG G 2 129 ? 76.731  23.419 -58.547 1.00 65.89  ? 729  ARG E CD    1 
ATOM   9726  N NE    . ARG G 2 129 ? 78.129  23.225 -58.917 1.00 71.37  ? 729  ARG E NE    1 
ATOM   9727  C CZ    . ARG G 2 129 ? 78.648  22.050 -59.280 1.00 72.75  ? 729  ARG E CZ    1 
ATOM   9728  N NH1   . ARG G 2 129 ? 77.875  20.962 -59.316 1.00 72.73  ? 729  ARG E NH1   1 
ATOM   9729  N NH2   . ARG G 2 129 ? 79.935  21.963 -59.618 1.00 71.66  ? 729  ARG E NH2   1 
ATOM   9730  N N     . ILE G 2 130 ? 74.573  27.890 -57.662 1.00 38.97  ? 730  ILE E N     1 
ATOM   9731  C CA    . ILE G 2 130 ? 75.197  29.119 -57.243 1.00 40.66  ? 730  ILE E CA    1 
ATOM   9732  C C     . ILE G 2 130 ? 74.581  29.593 -55.955 1.00 41.96  ? 730  ILE E C     1 
ATOM   9733  O O     . ILE G 2 130 ? 75.276  30.148 -55.131 1.00 40.77  ? 730  ILE E O     1 
ATOM   9734  C CB    . ILE G 2 130 ? 75.064  30.172 -58.309 1.00 31.70  ? 730  ILE E CB    1 
ATOM   9735  C CG1   . ILE G 2 130 ? 75.780  29.673 -59.563 1.00 34.66  ? 730  ILE E CG1   1 
ATOM   9736  C CG2   . ILE G 2 130 ? 75.653  31.469 -57.829 1.00 29.26  ? 730  ILE E CG2   1 
ATOM   9737  C CD1   . ILE G 2 130 ? 75.333  30.366 -60.826 1.00 37.53  ? 730  ILE E CD1   1 
ATOM   9738  N N     . ARG G 2 131 ? 73.282  29.354 -55.785 1.00 45.02  ? 731  ARG E N     1 
ATOM   9739  C CA    . ARG G 2 131 ? 72.555  29.752 -54.573 1.00 47.47  ? 731  ARG E CA    1 
ATOM   9740  C C     . ARG G 2 131 ? 73.088  29.024 -53.358 1.00 48.80  ? 731  ARG E C     1 
ATOM   9741  O O     . ARG G 2 131 ? 72.987  29.514 -52.238 1.00 51.93  ? 731  ARG E O     1 
ATOM   9742  C CB    . ARG G 2 131 ? 71.070  29.430 -54.686 1.00 32.62  ? 731  ARG E CB    1 
ATOM   9743  C CG    . ARG G 2 131 ? 70.245  30.432 -55.440 1.00 29.43  ? 731  ARG E CG    1 
ATOM   9744  C CD    . ARG G 2 131 ? 68.870  29.867 -55.554 1.00 30.24  ? 731  ARG E CD    1 
ATOM   9745  N NE    . ARG G 2 131 ? 67.855  30.862 -55.868 1.00 28.10  ? 731  ARG E NE    1 
ATOM   9746  C CZ    . ARG G 2 131 ? 66.630  30.832 -55.345 1.00 27.98  ? 731  ARG E CZ    1 
ATOM   9747  N NH1   . ARG G 2 131 ? 66.294  29.862 -54.494 1.00 27.27  ? 731  ARG E NH1   1 
ATOM   9748  N NH2   . ARG G 2 131 ? 65.749  31.767 -55.657 1.00 23.81  ? 731  ARG E NH2   1 
ATOM   9749  N N     . GLY G 2 132 ? 73.632  27.837 -53.584 1.00 33.05  ? 732  GLY E N     1 
ATOM   9750  C CA    . GLY G 2 132 ? 74.176  27.069 -52.492 1.00 35.25  ? 732  GLY E CA    1 
ATOM   9751  C C     . GLY G 2 132 ? 73.177  26.066 -51.972 1.00 37.83  ? 732  GLY E C     1 
ATOM   9752  O O     . GLY G 2 132 ? 73.108  25.809 -50.779 1.00 35.38  ? 732  GLY E O     1 
ATOM   9753  N N     . GLU G 2 133 ? 72.404  25.483 -52.866 1.00 47.52  ? 733  GLU E N     1 
ATOM   9754  C CA    . GLU G 2 133 ? 71.415  24.509 -52.469 1.00 51.64  ? 733  GLU E CA    1 
ATOM   9755  C C     . GLU G 2 133 ? 71.812  23.084 -52.918 1.00 57.39  ? 733  GLU E C     1 
ATOM   9756  O O     . GLU G 2 133 ? 71.298  22.087 -52.399 1.00 59.04  ? 733  GLU E O     1 
ATOM   9757  C CB    . GLU G 2 133 ? 70.057  24.943 -53.043 1.00 39.54  ? 733  GLU E CB    1 
ATOM   9758  C CG    . GLU G 2 133 ? 69.460  26.203 -52.372 1.00 38.88  ? 733  GLU E CG    1 
ATOM   9759  C CD    . GLU G 2 133 ? 68.194  26.726 -53.071 1.00 33.82  ? 733  GLU E CD    1 
ATOM   9760  O OE1   . GLU G 2 133 ? 67.453  25.906 -53.677 1.00 34.20  ? 733  GLU E OE1   1 
ATOM   9761  O OE2   . GLU G 2 133 ? 67.934  27.960 -53.003 1.00 34.41  ? 733  GLU E OE2   1 
ATOM   9762  N N     . ARG G 2 134 ? 72.739  22.996 -53.871 1.00 140.45 ? 734  ARG E N     1 
ATOM   9763  C CA    . ARG G 2 134 ? 73.220  21.710 -54.394 1.00 148.10 ? 734  ARG E CA    1 
ATOM   9764  C C     . ARG G 2 134 ? 74.590  21.914 -55.064 1.00 150.60 ? 734  ARG E C     1 
ATOM   9765  O O     . ARG G 2 134 ? 74.911  21.266 -56.070 1.00 152.85 ? 734  ARG E O     1 
ATOM   9766  C CB    . ARG G 2 134 ? 72.220  21.143 -55.418 1.00 99.86  ? 734  ARG E CB    1 
ATOM   9767  C CG    . ARG G 2 134 ? 72.196  21.897 -56.756 1.00 103.30 ? 734  ARG E CG    1 
ATOM   9768  C CD    . ARG G 2 134 ? 71.353  21.206 -57.834 1.00 107.26 ? 734  ARG E CD    1 
ATOM   9769  N NE    . ARG G 2 134 ? 69.908  21.297 -57.597 1.00 113.38 ? 734  ARG E NE    1 
ATOM   9770  C CZ    . ARG G 2 134 ? 68.980  20.854 -58.445 1.00 113.74 ? 734  ARG E CZ    1 
ATOM   9771  N NH1   . ARG G 2 134 ? 69.345  20.289 -59.586 1.00 114.10 ? 734  ARG E NH1   1 
ATOM   9772  N NH2   . ARG G 2 134 ? 67.688  20.973 -58.156 1.00 114.50 ? 734  ARG E NH2   1 
ATOM   9773  N N     . ALA G 2 135 ? 75.392  22.806 -54.478 1.00 105.59 ? 735  ALA E N     1 
ATOM   9774  C CA    . ALA G 2 135 ? 76.719  23.176 -54.989 1.00 108.52 ? 735  ALA E CA    1 
ATOM   9775  C C     . ALA G 2 135 ? 77.771  22.064 -55.161 1.00 111.21 ? 735  ALA E C     1 
ATOM   9776  O O     . ALA G 2 135 ? 77.554  20.929 -54.677 1.00 69.81  ? 735  ALA E O     1 
ATOM   9777  C CB    . ALA G 2 135 ? 77.295  24.317 -54.124 1.00 113.94 ? 735  ALA E CB    1 
ATOM   9778  O OXT   . ALA G 2 135 ? 78.814  22.351 -55.799 1.00 75.42  ? 735  ALA E OXT   1 
ATOM   9779  N N     . VAL H 3 21  ? 44.357  7.129  -47.313 1.00 43.80  ? 221  VAL F N     1 
ATOM   9780  C CA    . VAL H 3 21  ? 45.812  7.018  -47.685 1.00 43.66  ? 221  VAL F CA    1 
ATOM   9781  C C     . VAL H 3 21  ? 46.119  8.151  -48.626 1.00 41.68  ? 221  VAL F C     1 
ATOM   9782  O O     . VAL H 3 21  ? 45.361  8.426  -49.543 1.00 43.65  ? 221  VAL F O     1 
ATOM   9783  C CB    . VAL H 3 21  ? 46.208  5.650  -48.442 1.00 33.10  ? 221  VAL F CB    1 
ATOM   9784  C CG1   . VAL H 3 21  ? 47.536  5.803  -49.224 1.00 28.25  ? 221  VAL F CG1   1 
ATOM   9785  C CG2   . VAL H 3 21  ? 46.394  4.523  -47.463 1.00 27.62  ? 221  VAL F CG2   1 
ATOM   9786  N N     . LEU H 3 22  ? 47.252  8.795  -48.402 1.00 35.77  ? 222  LEU F N     1 
ATOM   9787  C CA    . LEU H 3 22  ? 47.688  9.910  -49.226 1.00 34.79  ? 222  LEU F CA    1 
ATOM   9788  C C     . LEU H 3 22  ? 48.835  9.499  -50.141 1.00 36.23  ? 222  LEU F C     1 
ATOM   9789  O O     . LEU H 3 22  ? 49.849  9.003  -49.662 1.00 33.19  ? 222  LEU F O     1 
ATOM   9790  C CB    . LEU H 3 22  ? 48.158  11.054 -48.321 1.00 42.32  ? 222  LEU F CB    1 
ATOM   9791  C CG    . LEU H 3 22  ? 47.129  11.649 -47.360 1.00 42.06  ? 222  LEU F CG    1 
ATOM   9792  C CD1   . LEU H 3 22  ? 47.824  12.529 -46.301 1.00 42.42  ? 222  LEU F CD1   1 
ATOM   9793  C CD2   . LEU H 3 22  ? 46.105  12.436 -48.172 1.00 43.85  ? 222  LEU F CD2   1 
ATOM   9794  N N     . ARG H 3 23  ? 48.689  9.708  -51.442 1.00 30.59  ? 223  ARG F N     1 
ATOM   9795  C CA    . ARG H 3 23  ? 49.769  9.368  -52.361 1.00 30.55  ? 223  ARG F CA    1 
ATOM   9796  C C     . ARG H 3 23  ? 49.766  10.230 -53.612 1.00 29.82  ? 223  ARG F C     1 
ATOM   9797  O O     . ARG H 3 23  ? 48.728  10.744 -54.004 1.00 30.40  ? 223  ARG F O     1 
ATOM   9798  C CB    . ARG H 3 23  ? 49.724  7.881  -52.770 1.00 3.93   ? 223  ARG F CB    1 
ATOM   9799  C CG    . ARG H 3 23  ? 48.397  7.182  -52.502 1.00 10.16  ? 223  ARG F CG    1 
ATOM   9800  C CD    . ARG H 3 23  ? 48.571  5.686  -52.611 1.00 17.14  ? 223  ARG F CD    1 
ATOM   9801  N NE    . ARG H 3 23  ? 48.953  5.259  -53.956 1.00 28.41  ? 223  ARG F NE    1 
ATOM   9802  C CZ    . ARG H 3 23  ? 48.096  4.893  -54.900 1.00 34.59  ? 223  ARG F CZ    1 
ATOM   9803  N NH1   . ARG H 3 23  ? 46.789  4.899  -54.678 1.00 39.69  ? 223  ARG F NH1   1 
ATOM   9804  N NH2   . ARG H 3 23  ? 48.563  4.491  -56.064 1.00 40.65  ? 223  ARG F NH2   1 
ATOM   9805  N N     . ASP H 3 24  ? 50.941  10.371 -54.224 1.00 29.12  ? 224  ASP F N     1 
ATOM   9806  C CA    . ASP H 3 24  ? 51.134  11.146 -55.436 1.00 29.97  ? 224  ASP F CA    1 
ATOM   9807  C C     . ASP H 3 24  ? 50.606  12.593 -55.380 1.00 26.59  ? 224  ASP F C     1 
ATOM   9808  O O     . ASP H 3 24  ? 50.422  13.251 -56.396 1.00 28.08  ? 224  ASP F O     1 
ATOM   9809  C CB    . ASP H 3 24  ? 50.521  10.396 -56.603 1.00 57.10  ? 224  ASP F CB    1 
ATOM   9810  C CG    . ASP H 3 24  ? 51.316  10.565 -57.861 1.00 59.66  ? 224  ASP F CG    1 
ATOM   9811  O OD1   . ASP H 3 24  ? 52.561  10.474 -57.760 1.00 61.06  ? 224  ASP F OD1   1 
ATOM   9812  O OD2   . ASP H 3 24  ? 50.707  10.780 -58.938 1.00 59.85  ? 224  ASP F OD2   1 
ATOM   9813  N N     . ASN H 3 25  ? 50.399  13.112 -54.184 1.00 36.62  ? 225  ASN F N     1 
ATOM   9814  C CA    . ASN H 3 25  ? 49.897  14.458 -54.069 1.00 41.65  ? 225  ASN F CA    1 
ATOM   9815  C C     . ASN H 3 25  ? 50.781  15.481 -54.728 1.00 39.81  ? 225  ASN F C     1 
ATOM   9816  O O     . ASN H 3 25  ? 50.306  16.559 -55.068 1.00 42.19  ? 225  ASN F O     1 
ATOM   9817  C CB    . ASN H 3 25  ? 49.667  14.794 -52.610 1.00 32.55  ? 225  ASN F CB    1 
ATOM   9818  C CG    . ASN H 3 25  ? 48.425  14.136 -52.079 1.00 36.51  ? 225  ASN F CG    1 
ATOM   9819  O OD1   . ASN H 3 25  ? 47.317  14.528 -52.433 1.00 34.47  ? 225  ASN F OD1   1 
ATOM   9820  N ND2   . ASN H 3 25  ? 48.595  13.109 -51.255 1.00 35.08  ? 225  ASN F ND2   1 
ATOM   9821  N N     . ILE H 3 26  ? 52.054  15.158 -54.925 1.00 30.97  ? 226  ILE F N     1 
ATOM   9822  C CA    . ILE H 3 26  ? 52.970  16.095 -55.582 1.00 34.29  ? 226  ILE F CA    1 
ATOM   9823  C C     . ILE H 3 26  ? 52.464  16.407 -57.002 1.00 37.20  ? 226  ILE F C     1 
ATOM   9824  O O     . ILE H 3 26  ? 52.856  17.398 -57.601 1.00 35.88  ? 226  ILE F O     1 
ATOM   9825  C CB    . ILE H 3 26  ? 54.394  15.506 -55.714 1.00 30.83  ? 226  ILE F CB    1 
ATOM   9826  C CG1   . ILE H 3 26  ? 55.373  16.539 -56.272 1.00 33.29  ? 226  ILE F CG1   1 
ATOM   9827  C CG2   . ILE H 3 26  ? 54.367  14.331 -56.693 1.00 27.70  ? 226  ILE F CG2   1 
ATOM   9828  C CD1   . ILE H 3 26  ? 55.748  17.607 -55.325 1.00 30.18  ? 226  ILE F CD1   1 
ATOM   9829  N N     . GLN H 3 27  ? 51.610  15.546 -57.549 1.00 39.63  ? 227  GLN F N     1 
ATOM   9830  C CA    . GLN H 3 27  ? 51.077  15.772 -58.883 1.00 45.14  ? 227  GLN F CA    1 
ATOM   9831  C C     . GLN H 3 27  ? 49.919  16.735 -58.741 1.00 46.17  ? 227  GLN F C     1 
ATOM   9832  O O     . GLN H 3 27  ? 49.232  17.060 -59.706 1.00 49.24  ? 227  GLN F O     1 
ATOM   9833  C CB    . GLN H 3 27  ? 50.598  14.459 -59.518 1.00 31.89  ? 227  GLN F CB    1 
ATOM   9834  C CG    . GLN H 3 27  ? 51.713  13.516 -59.983 1.00 33.05  ? 227  GLN F CG    1 
ATOM   9835  C CD    . GLN H 3 27  ? 52.806  14.197 -60.840 1.00 35.67  ? 227  GLN F CD    1 
ATOM   9836  O OE1   . GLN H 3 27  ? 52.517  14.990 -61.740 1.00 40.39  ? 227  GLN F OE1   1 
ATOM   9837  N NE2   . GLN H 3 27  ? 54.067  13.868 -60.565 1.00 35.14  ? 227  GLN F NE2   1 
ATOM   9838  N N     . GLY H 3 28  ? 49.702  17.186 -57.514 1.00 31.41  ? 228  GLY F N     1 
ATOM   9839  C CA    . GLY H 3 28  ? 48.622  18.117 -57.246 1.00 33.51  ? 228  GLY F CA    1 
ATOM   9840  C C     . GLY H 3 28  ? 49.056  19.516 -57.627 1.00 33.52  ? 228  GLY F C     1 
ATOM   9841  O O     . GLY H 3 28  ? 48.304  20.481 -57.568 1.00 36.61  ? 228  GLY F O     1 
ATOM   9842  N N     . ILE H 3 29  ? 50.316  19.627 -57.991 1.00 27.69  ? 229  ILE F N     1 
ATOM   9843  C CA    . ILE H 3 29  ? 50.842  20.895 -58.395 1.00 26.77  ? 229  ILE F CA    1 
ATOM   9844  C C     . ILE H 3 29  ? 50.818  20.718 -59.876 1.00 22.60  ? 229  ILE F C     1 
ATOM   9845  O O     . ILE H 3 29  ? 51.706  20.091 -60.452 1.00 23.67  ? 229  ILE F O     1 
ATOM   9846  C CB    . ILE H 3 29  ? 52.262  21.079 -57.913 1.00 29.26  ? 229  ILE F CB    1 
ATOM   9847  C CG1   . ILE H 3 29  ? 52.359  20.737 -56.421 1.00 30.88  ? 229  ILE F CG1   1 
ATOM   9848  C CG2   . ILE H 3 29  ? 52.680  22.511 -58.153 1.00 29.26  ? 229  ILE F CG2   1 
ATOM   9849  C CD1   . ILE H 3 29  ? 51.307  21.363 -55.594 1.00 29.10  ? 229  ILE F CD1   1 
ATOM   9850  N N     . THR H 3 30  ? 49.764  21.261 -60.471 1.00 25.10  ? 230  THR F N     1 
ATOM   9851  C CA    . THR H 3 30  ? 49.500  21.149 -61.898 1.00 24.87  ? 230  THR F CA    1 
ATOM   9852  C C     . THR H 3 30  ? 50.419  21.929 -62.796 1.00 26.66  ? 230  THR F C     1 
ATOM   9853  O O     . THR H 3 30  ? 51.128  22.820 -62.348 1.00 24.77  ? 230  THR F O     1 
ATOM   9854  C CB    . THR H 3 30  ? 48.046  21.582 -62.225 1.00 32.46  ? 230  THR F CB    1 
ATOM   9855  O OG1   . THR H 3 30  ? 47.958  23.015 -62.248 1.00 33.95  ? 230  THR F OG1   1 
ATOM   9856  C CG2   . THR H 3 30  ? 47.073  21.047 -61.174 1.00 30.64  ? 230  THR F CG2   1 
ATOM   9857  N N     . LYS H 3 31  ? 50.400  21.568 -64.073 1.00 36.87  ? 231  LYS F N     1 
ATOM   9858  C CA    . LYS H 3 31  ? 51.183  22.257 -65.079 1.00 40.65  ? 231  LYS F CA    1 
ATOM   9859  C C     . LYS H 3 31  ? 50.710  23.724 -65.096 1.00 39.30  ? 231  LYS F C     1 
ATOM   9860  O O     . LYS H 3 31  ? 51.537  24.633 -65.128 1.00 38.31  ? 231  LYS F O     1 
ATOM   9861  C CB    . LYS H 3 31  ? 50.956  21.610 -66.436 1.00 23.29  ? 231  LYS F CB    1 
ATOM   9862  C CG    . LYS H 3 31  ? 51.919  22.028 -67.503 1.00 28.96  ? 231  LYS F CG    1 
ATOM   9863  C CD    . LYS H 3 31  ? 51.366  21.658 -68.863 1.00 31.25  ? 231  LYS F CD    1 
ATOM   9864  C CE    . LYS H 3 31  ? 52.192  22.258 -70.020 1.00 35.41  ? 231  LYS F CE    1 
ATOM   9865  N NZ    . LYS H 3 31  ? 51.597  21.914 -71.361 1.00 38.13  ? 231  LYS F NZ    1 
ATOM   9866  N N     . PRO H 3 32  ? 49.373  23.972 -65.073 1.00 28.31  ? 232  PRO F N     1 
ATOM   9867  C CA    . PRO H 3 32  ? 48.801  25.326 -65.073 1.00 29.85  ? 232  PRO F CA    1 
ATOM   9868  C C     . PRO H 3 32  ? 49.390  26.128 -63.928 1.00 29.85  ? 232  PRO F C     1 
ATOM   9869  O O     . PRO H 3 32  ? 49.869  27.248 -64.109 1.00 29.02  ? 232  PRO F O     1 
ATOM   9870  C CB    . PRO H 3 32  ? 47.314  25.074 -64.845 1.00 31.59  ? 232  PRO F CB    1 
ATOM   9871  C CG    . PRO H 3 32  ? 47.083  23.818 -65.545 1.00 33.36  ? 232  PRO F CG    1 
ATOM   9872  C CD    . PRO H 3 32  ? 48.287  22.976 -65.139 1.00 30.49  ? 232  PRO F CD    1 
ATOM   9873  N N     . ALA H 3 33  ? 49.318  25.553 -62.733 1.00 23.35  ? 233  ALA F N     1 
ATOM   9874  C CA    . ALA H 3 33  ? 49.856  26.193 -61.553 1.00 21.57  ? 233  ALA F CA    1 
ATOM   9875  C C     . ALA H 3 33  ? 51.333  26.563 -61.723 1.00 24.31  ? 233  ALA F C     1 
ATOM   9876  O O     . ALA H 3 33  ? 51.679  27.734 -61.608 1.00 22.23  ? 233  ALA F O     1 
ATOM   9877  C CB    . ALA H 3 33  ? 49.684  25.289 -60.353 1.00 43.35  ? 233  ALA F CB    1 
ATOM   9878  N N     . ILE H 3 34  ? 52.197  25.584 -62.011 1.00 15.93  ? 234  ILE F N     1 
ATOM   9879  C CA    . ILE H 3 34  ? 53.625  25.879 -62.142 1.00 17.44  ? 234  ILE F CA    1 
ATOM   9880  C C     . ILE H 3 34  ? 53.915  26.986 -63.162 1.00 19.14  ? 234  ILE F C     1 
ATOM   9881  O O     . ILE H 3 34  ? 54.883  27.744 -63.026 1.00 16.40  ? 234  ILE F O     1 
ATOM   9882  C CB    . ILE H 3 34  ? 54.441  24.610 -62.523 1.00 12.79  ? 234  ILE F CB    1 
ATOM   9883  C CG1   . ILE H 3 34  ? 54.402  23.610 -61.361 1.00 13.80  ? 234  ILE F CG1   1 
ATOM   9884  C CG2   . ILE H 3 34  ? 55.905  24.979 -62.846 1.00 12.65  ? 234  ILE F CG2   1 
ATOM   9885  C CD1   . ILE H 3 34  ? 55.122  22.274 -61.641 1.00 12.94  ? 234  ILE F CD1   1 
ATOM   9886  N N     . ARG H 3 35  ? 53.063  27.060 -64.186 1.00 23.55  ? 235  ARG F N     1 
ATOM   9887  C CA    . ARG H 3 35  ? 53.156  28.031 -65.270 1.00 23.51  ? 235  ARG F CA    1 
ATOM   9888  C C     . ARG H 3 35  ? 52.856  29.409 -64.701 1.00 22.78  ? 235  ARG F C     1 
ATOM   9889  O O     . ARG H 3 35  ? 53.592  30.353 -64.929 1.00 23.36  ? 235  ARG F O     1 
ATOM   9890  C CB    . ARG H 3 35  ? 52.162  27.632 -66.355 1.00 58.03  ? 235  ARG F CB    1 
ATOM   9891  C CG    . ARG H 3 35  ? 51.965  28.627 -67.454 1.00 67.38  ? 235  ARG F CG    1 
ATOM   9892  C CD    . ARG H 3 35  ? 51.127  28.012 -68.547 1.00 74.36  ? 235  ARG F CD    1 
ATOM   9893  N NE    . ARG H 3 35  ? 51.895  27.034 -69.307 1.00 85.63  ? 235  ARG F NE    1 
ATOM   9894  C CZ    . ARG H 3 35  ? 52.878  27.353 -70.143 1.00 91.81  ? 235  ARG F CZ    1 
ATOM   9895  N NH1   . ARG H 3 35  ? 53.210  28.623 -70.330 1.00 96.91  ? 235  ARG F NH1   1 
ATOM   9896  N NH2   . ARG H 3 35  ? 53.530  26.404 -70.796 1.00 97.87  ? 235  ARG F NH2   1 
ATOM   9897  N N     . ARG H 3 36  ? 51.787  29.531 -63.934 1.00 26.45  ? 236  ARG F N     1 
ATOM   9898  C CA    . ARG H 3 36  ? 51.481  30.816 -63.335 1.00 29.40  ? 236  ARG F CA    1 
ATOM   9899  C C     . ARG H 3 36  ? 52.627  31.268 -62.444 1.00 29.51  ? 236  ARG F C     1 
ATOM   9900  O O     . ARG H 3 36  ? 52.893  32.453 -62.337 1.00 30.00  ? 236  ARG F O     1 
ATOM   9901  C CB    . ARG H 3 36  ? 50.226  30.742 -62.471 1.00 27.02  ? 236  ARG F CB    1 
ATOM   9902  C CG    . ARG H 3 36  ? 48.990  30.346 -63.189 1.00 26.68  ? 236  ARG F CG    1 
ATOM   9903  C CD    . ARG H 3 36  ? 47.832  30.604 -62.302 1.00 29.27  ? 236  ARG F CD    1 
ATOM   9904  N NE    . ARG H 3 36  ? 47.568  29.537 -61.349 1.00 28.20  ? 236  ARG F NE    1 
ATOM   9905  C CZ    . ARG H 3 36  ? 47.026  28.358 -61.657 1.00 32.28  ? 236  ARG F CZ    1 
ATOM   9906  N NH1   . ARG H 3 36  ? 46.691  28.065 -62.906 1.00 26.23  ? 236  ARG F NH1   1 
ATOM   9907  N NH2   . ARG H 3 36  ? 46.765  27.485 -60.699 1.00 29.25  ? 236  ARG F NH2   1 
ATOM   9908  N N     . LEU H 3 37  ? 53.302  30.342 -61.783 1.00 24.89  ? 237  LEU F N     1 
ATOM   9909  C CA    . LEU H 3 37  ? 54.381  30.765 -60.914 1.00 23.91  ? 237  LEU F CA    1 
ATOM   9910  C C     . LEU H 3 37  ? 55.521  31.371 -61.717 1.00 25.35  ? 237  LEU F C     1 
ATOM   9911  O O     . LEU H 3 37  ? 56.051  32.439 -61.362 1.00 22.31  ? 237  LEU F O     1 
ATOM   9912  C CB    . LEU H 3 37  ? 54.892  29.600 -60.067 1.00 24.62  ? 237  LEU F CB    1 
ATOM   9913  C CG    . LEU H 3 37  ? 53.936  29.146 -58.975 1.00 24.36  ? 237  LEU F CG    1 
ATOM   9914  C CD1   . LEU H 3 37  ? 54.367  27.800 -58.468 1.00 24.72  ? 237  LEU F CD1   1 
ATOM   9915  C CD2   . LEU H 3 37  ? 53.895  30.144 -57.869 1.00 26.15  ? 237  LEU F CD2   1 
ATOM   9916  N N     . ALA H 3 38  ? 55.889  30.679 -62.792 1.00 23.26  ? 238  ALA F N     1 
ATOM   9917  C CA    . ALA H 3 38  ? 56.963  31.112 -63.667 1.00 25.96  ? 238  ALA F CA    1 
ATOM   9918  C C     . ALA H 3 38  ? 56.628  32.456 -64.333 1.00 28.74  ? 238  ALA F C     1 
ATOM   9919  O O     . ALA H 3 38  ? 57.519  33.242 -64.687 1.00 26.86  ? 238  ALA F O     1 
ATOM   9920  C CB    . ALA H 3 38  ? 57.193  30.073 -64.695 1.00 2.47   ? 238  ALA F CB    1 
ATOM   9921  N N     . ARG H 3 39  ? 55.336  32.714 -64.492 1.00 22.65  ? 239  ARG F N     1 
ATOM   9922  C CA    . ARG H 3 39  ? 54.886  33.961 -65.086 1.00 26.25  ? 239  ARG F CA    1 
ATOM   9923  C C     . ARG H 3 39  ? 55.135  35.105 -64.137 1.00 26.64  ? 239  ARG F C     1 
ATOM   9924  O O     . ARG H 3 39  ? 55.554  36.165 -64.554 1.00 28.06  ? 239  ARG F O     1 
ATOM   9925  C CB    . ARG H 3 39  ? 53.395  33.915 -65.380 1.00 22.66  ? 239  ARG F CB    1 
ATOM   9926  C CG    . ARG H 3 39  ? 53.018  33.055 -66.537 1.00 21.51  ? 239  ARG F CG    1 
ATOM   9927  C CD    . ARG H 3 39  ? 53.536  33.609 -67.813 1.00 24.95  ? 239  ARG F CD    1 
ATOM   9928  N NE    . ARG H 3 39  ? 52.844  32.951 -68.901 1.00 24.21  ? 239  ARG F NE    1 
ATOM   9929  C CZ    . ARG H 3 39  ? 53.424  32.161 -69.789 1.00 27.52  ? 239  ARG F CZ    1 
ATOM   9930  N NH1   . ARG H 3 39  ? 54.728  31.929 -69.723 1.00 26.65  ? 239  ARG F NH1   1 
ATOM   9931  N NH2   . ARG H 3 39  ? 52.687  31.602 -70.742 1.00 28.52  ? 239  ARG F NH2   1 
ATOM   9932  N N     . ARG H 3 40  ? 54.850  34.890 -62.860 1.00 16.07  ? 240  ARG F N     1 
ATOM   9933  C CA    . ARG H 3 40  ? 55.050  35.925 -61.863 1.00 17.00  ? 240  ARG F CA    1 
ATOM   9934  C C     . ARG H 3 40  ? 56.516  36.069 -61.696 1.00 17.24  ? 240  ARG F C     1 
ATOM   9935  O O     . ARG H 3 40  ? 56.982  37.090 -61.276 1.00 16.44  ? 240  ARG F O     1 
ATOM   9936  C CB    . ARG H 3 40  ? 54.396  35.556 -60.528 1.00 20.35  ? 240  ARG F CB    1 
ATOM   9937  C CG    . ARG H 3 40  ? 54.451  36.654 -59.472 1.00 15.30  ? 240  ARG F CG    1 
ATOM   9938  C CD    . ARG H 3 40  ? 53.556  36.281 -58.307 1.00 20.34  ? 240  ARG F CD    1 
ATOM   9939  N NE    . ARG H 3 40  ? 52.145  36.591 -58.550 1.00 19.09  ? 240  ARG F NE    1 
ATOM   9940  C CZ    . ARG H 3 40  ? 51.139  36.246 -57.741 1.00 20.24  ? 240  ARG F CZ    1 
ATOM   9941  N NH1   . ARG H 3 40  ? 51.389  35.556 -56.638 1.00 16.33  ? 240  ARG F NH1   1 
ATOM   9942  N NH2   . ARG H 3 40  ? 49.886  36.626 -58.011 1.00 17.70  ? 240  ARG F NH2   1 
ATOM   9943  N N     . GLY H 3 41  ? 57.246  35.036 -62.052 1.00 23.76  ? 241  GLY F N     1 
ATOM   9944  C CA    . GLY H 3 41  ? 58.687  35.097 -61.949 1.00 24.36  ? 241  GLY F CA    1 
ATOM   9945  C C     . GLY H 3 41  ? 59.262  35.762 -63.189 1.00 25.35  ? 241  GLY F C     1 
ATOM   9946  O O     . GLY H 3 41  ? 60.488  35.927 -63.338 1.00 25.43  ? 241  GLY F O     1 
ATOM   9947  N N     . GLY H 3 42  ? 58.370  36.131 -64.102 1.00 23.41  ? 242  GLY F N     1 
ATOM   9948  C CA    . GLY H 3 42  ? 58.799  36.810 -65.314 1.00 20.97  ? 242  GLY F CA    1 
ATOM   9949  C C     . GLY H 3 42  ? 59.294  35.918 -66.430 1.00 24.94  ? 242  GLY F C     1 
ATOM   9950  O O     . GLY H 3 42  ? 59.911  36.378 -67.382 1.00 23.90  ? 242  GLY F O     1 
ATOM   9951  N N     . VAL H 3 43  ? 59.023  34.631 -66.315 1.00 22.41  ? 243  VAL F N     1 
ATOM   9952  C CA    . VAL H 3 43  ? 59.443  33.710 -67.341 1.00 22.27  ? 243  VAL F CA    1 
ATOM   9953  C C     . VAL H 3 43  ? 58.445  33.727 -68.504 1.00 20.29  ? 243  VAL F C     1 
ATOM   9954  O O     . VAL H 3 43  ? 57.237  33.631 -68.307 1.00 22.26  ? 243  VAL F O     1 
ATOM   9955  C CB    . VAL H 3 43  ? 59.569  32.294 -66.772 1.00 18.30  ? 243  VAL F CB    1 
ATOM   9956  C CG1   . VAL H 3 43  ? 59.798  31.309 -67.882 1.00 13.45  ? 243  VAL F CG1   1 
ATOM   9957  C CG2   . VAL H 3 43  ? 60.679  32.242 -65.799 1.00 12.82  ? 243  VAL F CG2   1 
ATOM   9958  N N     . LYS H 3 44  ? 58.986  33.847 -69.712 1.00 33.47  ? 244  LYS F N     1 
ATOM   9959  C CA    . LYS H 3 44  ? 58.219  33.893 -70.944 1.00 36.37  ? 244  LYS F CA    1 
ATOM   9960  C C     . LYS H 3 44  ? 58.041  32.509 -71.572 1.00 37.28  ? 244  LYS F C     1 
ATOM   9961  O O     . LYS H 3 44  ? 56.921  32.070 -71.806 1.00 38.16  ? 244  LYS F O     1 
ATOM   9962  C CB    . LYS H 3 44  ? 58.927  34.829 -71.928 1.00 51.27  ? 244  LYS F CB    1 
ATOM   9963  C CG    . LYS H 3 44  ? 58.118  35.271 -73.151 1.00 53.32  ? 244  LYS F CG    1 
ATOM   9964  C CD    . LYS H 3 44  ? 58.948  36.280 -73.931 1.00 55.98  ? 244  LYS F CD    1 
ATOM   9965  C CE    . LYS H 3 44  ? 58.390  36.636 -75.288 1.00 57.50  ? 244  LYS F CE    1 
ATOM   9966  N NZ    . LYS H 3 44  ? 59.429  37.401 -76.063 1.00 57.30  ? 244  LYS F NZ    1 
ATOM   9967  N N     . ARG H 3 45  ? 59.146  31.822 -71.841 1.00 39.05  ? 245  ARG F N     1 
ATOM   9968  C CA    . ARG H 3 45  ? 59.090  30.499 -72.463 1.00 40.86  ? 245  ARG F CA    1 
ATOM   9969  C C     . ARG H 3 45  ? 59.530  29.367 -71.525 1.00 41.69  ? 245  ARG F C     1 
ATOM   9970  O O     . ARG H 3 45  ? 60.561  29.468 -70.847 1.00 38.63  ? 245  ARG F O     1 
ATOM   9971  C CB    . ARG H 3 45  ? 59.952  30.491 -73.727 1.00 70.31  ? 245  ARG F CB    1 
ATOM   9972  C CG    . ARG H 3 45  ? 59.341  29.725 -74.879 1.00 72.01  ? 245  ARG F CG    1 
ATOM   9973  C CD    . ARG H 3 45  ? 58.376  30.595 -75.655 1.00 73.24  ? 245  ARG F CD    1 
ATOM   9974  N NE    . ARG H 3 45  ? 57.688  29.835 -76.694 1.00 74.20  ? 245  ARG F NE    1 
ATOM   9975  C CZ    . ARG H 3 45  ? 58.292  29.054 -77.586 1.00 76.23  ? 245  ARG F CZ    1 
ATOM   9976  N NH1   . ARG H 3 45  ? 59.613  28.921 -77.575 1.00 69.86  ? 245  ARG F NH1   1 
ATOM   9977  N NH2   . ARG H 3 45  ? 57.570  28.397 -78.487 1.00 75.39  ? 245  ARG F NH2   1 
ATOM   9978  N N     . ILE H 3 46  ? 58.755  28.280 -71.518 1.00 24.08  ? 246  ILE F N     1 
ATOM   9979  C CA    . ILE H 3 46  ? 59.024  27.139 -70.639 1.00 26.61  ? 246  ILE F CA    1 
ATOM   9980  C C     . ILE H 3 46  ? 59.272  25.752 -71.265 1.00 27.81  ? 246  ILE F C     1 
ATOM   9981  O O     . ILE H 3 46  ? 58.467  25.254 -72.068 1.00 27.66  ? 246  ILE F O     1 
ATOM   9982  C CB    . ILE H 3 46  ? 57.871  26.922 -69.690 1.00 12.08  ? 246  ILE F CB    1 
ATOM   9983  C CG1   . ILE H 3 46  ? 57.360  28.242 -69.145 1.00 12.10  ? 246  ILE F CG1   1 
ATOM   9984  C CG2   . ILE H 3 46  ? 58.312  25.989 -68.591 1.00 10.53  ? 246  ILE F CG2   1 
ATOM   9985  C CD1   . ILE H 3 46  ? 56.227  28.082 -68.160 1.00 11.13  ? 246  ILE F CD1   1 
ATOM   9986  N N     . SER H 3 47  ? 60.354  25.093 -70.855 1.00 38.63  ? 247  SER F N     1 
ATOM   9987  C CA    . SER H 3 47  ? 60.663  23.751 -71.365 1.00 38.29  ? 247  SER F CA    1 
ATOM   9988  C C     . SER H 3 47  ? 59.669  22.741 -70.808 1.00 39.00  ? 247  SER F C     1 
ATOM   9989  O O     . SER H 3 47  ? 59.215  22.853 -69.664 1.00 36.10  ? 247  SER F O     1 
ATOM   9990  C CB    . SER H 3 47  ? 62.075  23.330 -70.956 1.00 46.45  ? 247  SER F CB    1 
ATOM   9991  O OG    . SER H 3 47  ? 62.336  21.989 -71.336 1.00 54.90  ? 247  SER F OG    1 
ATOM   9992  N N     . GLY H 3 48  ? 59.328  21.746 -71.606 1.00 34.36  ? 248  GLY F N     1 
ATOM   9993  C CA    . GLY H 3 48  ? 58.393  20.749 -71.121 1.00 31.21  ? 248  GLY F CA    1 
ATOM   9994  C C     . GLY H 3 48  ? 58.881  20.011 -69.879 1.00 31.19  ? 248  GLY F C     1 
ATOM   9995  O O     . GLY H 3 48  ? 58.089  19.529 -69.072 1.00 32.27  ? 248  GLY F O     1 
ATOM   9996  N N     . LEU H 3 49  ? 60.193  19.929 -69.714 1.00 31.41  ? 249  LEU F N     1 
ATOM   9997  C CA    . LEU H 3 49  ? 60.765  19.241 -68.581 1.00 33.56  ? 249  LEU F CA    1 
ATOM   9998  C C     . LEU H 3 49  ? 60.747  20.044 -67.276 1.00 32.79  ? 249  LEU F C     1 
ATOM   9999  O O     . LEU H 3 49  ? 60.938  19.491 -66.190 1.00 30.28  ? 249  LEU F O     1 
ATOM   10000 C CB    . LEU H 3 49  ? 62.193  18.870 -68.919 1.00 14.53  ? 249  LEU F CB    1 
ATOM   10001 C CG    . LEU H 3 49  ? 62.395  17.963 -70.132 1.00 20.40  ? 249  LEU F CG    1 
ATOM   10002 C CD1   . LEU H 3 49  ? 63.872  17.946 -70.497 1.00 21.99  ? 249  LEU F CD1   1 
ATOM   10003 C CD2   . LEU H 3 49  ? 61.866  16.564 -69.830 1.00 19.95  ? 249  LEU F CD2   1 
ATOM   10004 N N     . ILE H 3 50  ? 60.527  21.346 -67.375 1.00 36.23  ? 250  ILE F N     1 
ATOM   10005 C CA    . ILE H 3 50  ? 60.517  22.200 -66.189 1.00 32.94  ? 250  ILE F CA    1 
ATOM   10006 C C     . ILE H 3 50  ? 59.512  21.762 -65.106 1.00 33.66  ? 250  ILE F C     1 
ATOM   10007 O O     . ILE H 3 50  ? 59.778  21.830 -63.906 1.00 33.89  ? 250  ILE F O     1 
ATOM   10008 C CB    . ILE H 3 50  ? 60.216  23.699 -66.587 1.00 29.53  ? 250  ILE F CB    1 
ATOM   10009 C CG1   . ILE H 3 50  ? 61.390  24.289 -67.364 1.00 27.99  ? 250  ILE F CG1   1 
ATOM   10010 C CG2   . ILE H 3 50  ? 59.948  24.549 -65.358 1.00 26.00  ? 250  ILE F CG2   1 
ATOM   10011 C CD1   . ILE H 3 50  ? 62.701  24.261 -66.626 1.00 26.99  ? 250  ILE F CD1   1 
ATOM   10012 N N     . TYR H 3 51  ? 58.356  21.297 -65.531 1.00 32.19  ? 251  TYR F N     1 
ATOM   10013 C CA    . TYR H 3 51  ? 57.350  20.959 -64.572 1.00 32.41  ? 251  TYR F CA    1 
ATOM   10014 C C     . TYR H 3 51  ? 57.744  19.909 -63.572 1.00 33.72  ? 251  TYR F C     1 
ATOM   10015 O O     . TYR H 3 51  ? 57.537  20.117 -62.380 1.00 33.06  ? 251  TYR F O     1 
ATOM   10016 C CB    . TYR H 3 51  ? 56.070  20.594 -65.297 1.00 37.69  ? 251  TYR F CB    1 
ATOM   10017 C CG    . TYR H 3 51  ? 55.660  21.644 -66.303 1.00 40.87  ? 251  TYR F CG    1 
ATOM   10018 C CD1   . TYR H 3 51  ? 55.905  21.457 -67.653 1.00 40.42  ? 251  TYR F CD1   1 
ATOM   10019 C CD2   . TYR H 3 51  ? 55.027  22.830 -65.907 1.00 41.07  ? 251  TYR F CD2   1 
ATOM   10020 C CE1   . TYR H 3 51  ? 55.529  22.403 -68.600 1.00 42.73  ? 251  TYR F CE1   1 
ATOM   10021 C CE2   . TYR H 3 51  ? 54.650  23.801 -66.852 1.00 43.51  ? 251  TYR F CE2   1 
ATOM   10022 C CZ    . TYR H 3 51  ? 54.903  23.568 -68.199 1.00 43.17  ? 251  TYR F CZ    1 
ATOM   10023 O OH    . TYR H 3 51  ? 54.511  24.455 -69.172 1.00 42.90  ? 251  TYR F OH    1 
ATOM   10024 N N     . GLU H 3 52  ? 58.322  18.797 -64.023 1.00 26.90  ? 252  GLU F N     1 
ATOM   10025 C CA    . GLU H 3 52  ? 58.713  17.755 -63.084 1.00 28.25  ? 252  GLU F CA    1 
ATOM   10026 C C     . GLU H 3 52  ? 59.921  18.169 -62.263 1.00 24.04  ? 252  GLU F C     1 
ATOM   10027 O O     . GLU H 3 52  ? 59.990  17.870 -61.078 1.00 27.29  ? 252  GLU F O     1 
ATOM   10028 C CB    . GLU H 3 52  ? 58.999  16.430 -63.795 1.00 42.77  ? 252  GLU F CB    1 
ATOM   10029 C CG    . GLU H 3 52  ? 57.782  15.474 -63.909 1.00 54.42  ? 252  GLU F CG    1 
ATOM   10030 C CD    . GLU H 3 52  ? 57.185  15.022 -62.554 1.00 54.94  ? 252  GLU F CD    1 
ATOM   10031 O OE1   . GLU H 3 52  ? 57.900  14.399 -61.739 1.00 61.65  ? 252  GLU F OE1   1 
ATOM   10032 O OE2   . GLU H 3 52  ? 55.987  15.277 -62.300 1.00 57.47  ? 252  GLU F OE2   1 
ATOM   10033 N N     . GLU H 3 53  ? 60.869  18.862 -62.883 1.00 33.34  ? 253  GLU F N     1 
ATOM   10034 C CA    . GLU H 3 53  ? 62.059  19.322 -62.174 1.00 36.88  ? 253  GLU F CA    1 
ATOM   10035 C C     . GLU H 3 53  ? 61.588  20.156 -60.989 1.00 33.73  ? 253  GLU F C     1 
ATOM   10036 O O     . GLU H 3 53  ? 62.072  20.026 -59.859 1.00 32.20  ? 253  GLU F O     1 
ATOM   10037 C CB    . GLU H 3 53  ? 62.906  20.187 -63.105 1.00 39.20  ? 253  GLU F CB    1 
ATOM   10038 C CG    . GLU H 3 53  ? 64.274  20.605 -62.592 1.00 43.34  ? 253  GLU F CG    1 
ATOM   10039 C CD    . GLU H 3 53  ? 65.291  19.459 -62.524 1.00 49.63  ? 253  GLU F CD    1 
ATOM   10040 O OE1   . GLU H 3 53  ? 65.285  18.553 -63.394 1.00 49.58  ? 253  GLU F OE1   1 
ATOM   10041 O OE2   . GLU H 3 53  ? 66.122  19.477 -61.589 1.00 49.64  ? 253  GLU F OE2   1 
ATOM   10042 N N     . THR H 3 54  ? 60.605  20.998 -61.261 1.00 17.39  ? 254  THR F N     1 
ATOM   10043 C CA    . THR H 3 54  ? 60.058  21.889 -60.275 1.00 17.05  ? 254  THR F CA    1 
ATOM   10044 C C     . THR H 3 54  ? 59.389  21.147 -59.148 1.00 20.16  ? 254  THR F C     1 
ATOM   10045 O O     . THR H 3 54  ? 59.560  21.485 -57.970 1.00 19.66  ? 254  THR F O     1 
ATOM   10046 C CB    . THR H 3 54  ? 59.063  22.824 -60.945 1.00 28.85  ? 254  THR F CB    1 
ATOM   10047 O OG1   . THR H 3 54  ? 59.751  23.560 -61.946 1.00 30.83  ? 254  THR F OG1   1 
ATOM   10048 C CG2   . THR H 3 54  ? 58.475  23.803 -59.966 1.00 27.08  ? 254  THR F CG2   1 
ATOM   10049 N N     . ARG H 3 55  ? 58.605  20.142 -59.491 1.00 21.68  ? 255  ARG F N     1 
ATOM   10050 C CA    . ARG H 3 55  ? 57.918  19.418 -58.445 1.00 17.65  ? 255  ARG F CA    1 
ATOM   10051 C C     . ARG H 3 55  ? 58.961  18.893 -57.454 1.00 18.70  ? 255  ARG F C     1 
ATOM   10052 O O     . ARG H 3 55  ? 58.764  18.915 -56.226 1.00 19.17  ? 255  ARG F O     1 
ATOM   10053 C CB    . ARG H 3 55  ? 57.102  18.285 -59.056 1.00 20.79  ? 255  ARG F CB    1 
ATOM   10054 C CG    . ARG H 3 55  ? 55.908  18.757 -59.844 1.00 21.34  ? 255  ARG F CG    1 
ATOM   10055 C CD    . ARG H 3 55  ? 55.023  17.581 -60.213 1.00 26.24  ? 255  ARG F CD    1 
ATOM   10056 N NE    . ARG H 3 55  ? 53.890  17.975 -61.049 1.00 24.84  ? 255  ARG F NE    1 
ATOM   10057 C CZ    . ARG H 3 55  ? 53.920  18.061 -62.375 1.00 25.08  ? 255  ARG F CZ    1 
ATOM   10058 N NH1   . ARG H 3 55  ? 55.024  17.770 -63.047 1.00 21.33  ? 255  ARG F NH1   1 
ATOM   10059 N NH2   . ARG H 3 55  ? 52.852  18.486 -63.026 1.00 25.88  ? 255  ARG F NH2   1 
ATOM   10060 N N     . GLY H 3 56  ? 60.085  18.461 -58.015 1.00 20.90  ? 256  GLY F N     1 
ATOM   10061 C CA    . GLY H 3 56  ? 61.167  17.924 -57.233 1.00 22.89  ? 256  GLY F CA    1 
ATOM   10062 C C     . GLY H 3 56  ? 61.721  18.964 -56.310 1.00 23.57  ? 256  GLY F C     1 
ATOM   10063 O O     . GLY H 3 56  ? 61.906  18.707 -55.130 1.00 22.11  ? 256  GLY F O     1 
ATOM   10064 N N     . VAL H 3 57  ? 61.991  20.141 -56.847 1.00 20.96  ? 257  VAL F N     1 
ATOM   10065 C CA    . VAL H 3 57  ? 62.515  21.239 -56.049 1.00 20.14  ? 257  VAL F CA    1 
ATOM   10066 C C     . VAL H 3 57  ? 61.535  21.651 -54.954 1.00 18.79  ? 257  VAL F C     1 
ATOM   10067 O O     . VAL H 3 57  ? 61.919  21.910 -53.806 1.00 17.91  ? 257  VAL F O     1 
ATOM   10068 C CB    . VAL H 3 57  ? 62.820  22.417 -56.955 1.00 30.07  ? 257  VAL F CB    1 
ATOM   10069 C CG1   . VAL H 3 57  ? 63.023  23.679 -56.157 1.00 29.56  ? 257  VAL F CG1   1 
ATOM   10070 C CG2   . VAL H 3 57  ? 64.046  22.086 -57.758 1.00 27.23  ? 257  VAL F CG2   1 
ATOM   10071 N N     . LEU H 3 58  ? 60.263  21.716 -55.299 1.00 16.29  ? 258  LEU F N     1 
ATOM   10072 C CA    . LEU H 3 58  ? 59.286  22.086 -54.293 1.00 17.29  ? 258  LEU F CA    1 
ATOM   10073 C C     . LEU H 3 58  ? 59.308  21.093 -53.140 1.00 18.60  ? 258  LEU F C     1 
ATOM   10074 O O     . LEU H 3 58  ? 59.304  21.488 -51.980 1.00 17.43  ? 258  LEU F O     1 
ATOM   10075 C CB    . LEU H 3 58  ? 57.875  22.126 -54.901 1.00 23.56  ? 258  LEU F CB    1 
ATOM   10076 C CG    . LEU H 3 58  ? 56.713  22.327 -53.923 1.00 24.23  ? 258  LEU F CG    1 
ATOM   10077 C CD1   . LEU H 3 58  ? 56.960  23.583 -53.162 1.00 26.08  ? 258  LEU F CD1   1 
ATOM   10078 C CD2   . LEU H 3 58  ? 55.384  22.388 -54.658 1.00 28.80  ? 258  LEU F CD2   1 
ATOM   10079 N N     . LYS H 3 59  ? 59.327  19.803 -53.492 1.00 21.58  ? 259  LYS F N     1 
ATOM   10080 C CA    . LYS H 3 59  ? 59.322  18.699 -52.538 1.00 21.43  ? 259  LYS F CA    1 
ATOM   10081 C C     . LYS H 3 59  ? 60.430  18.799 -51.535 1.00 16.33  ? 259  LYS F C     1 
ATOM   10082 O O     . LYS H 3 59  ? 60.199  18.598 -50.361 1.00 18.69  ? 259  LYS F O     1 
ATOM   10083 C CB    . LYS H 3 59  ? 59.401  17.361 -53.271 1.00 44.58  ? 259  LYS F CB    1 
ATOM   10084 C CG    . LYS H 3 59  ? 59.343  16.142 -52.371 1.00 48.97  ? 259  LYS F CG    1 
ATOM   10085 C CD    . LYS H 3 59  ? 58.805  14.951 -53.133 1.00 52.37  ? 259  LYS F CD    1 
ATOM   10086 C CE    . LYS H 3 59  ? 59.257  13.619 -52.538 1.00 56.81  ? 259  LYS F CE    1 
ATOM   10087 N NZ    . LYS H 3 59  ? 60.736  13.411 -52.686 1.00 55.65  ? 259  LYS F NZ    1 
ATOM   10088 N N     . VAL H 3 60  ? 61.635  19.118 -51.991 1.00 13.86  ? 260  VAL F N     1 
ATOM   10089 C CA    . VAL H 3 60  ? 62.779  19.274 -51.093 1.00 14.78  ? 260  VAL F CA    1 
ATOM   10090 C C     . VAL H 3 60  ? 62.603  20.485 -50.169 1.00 13.65  ? 260  VAL F C     1 
ATOM   10091 O O     . VAL H 3 60  ? 63.058  20.485 -49.037 1.00 15.19  ? 260  VAL F O     1 
ATOM   10092 C CB    . VAL H 3 60  ? 64.088  19.469 -51.884 1.00 36.63  ? 260  VAL F CB    1 
ATOM   10093 C CG1   . VAL H 3 60  ? 65.255  19.676 -50.923 1.00 37.72  ? 260  VAL F CG1   1 
ATOM   10094 C CG2   . VAL H 3 60  ? 64.345  18.263 -52.753 1.00 39.19  ? 260  VAL F CG2   1 
ATOM   10095 N N     . PHE H 3 61  ? 61.949  21.526 -50.668 1.00 20.77  ? 261  PHE F N     1 
ATOM   10096 C CA    . PHE H 3 61  ? 61.720  22.704 -49.866 1.00 18.24  ? 261  PHE F CA    1 
ATOM   10097 C C     . PHE H 3 61  ? 60.718  22.338 -48.801 1.00 18.65  ? 261  PHE F C     1 
ATOM   10098 O O     . PHE H 3 61  ? 60.946  22.524 -47.611 1.00 17.68  ? 261  PHE F O     1 
ATOM   10099 C CB    . PHE H 3 61  ? 61.161  23.836 -50.734 1.00 23.94  ? 261  PHE F CB    1 
ATOM   10100 C CG    . PHE H 3 61  ? 60.814  25.120 -49.968 1.00 25.29  ? 261  PHE F CG    1 
ATOM   10101 C CD1   . PHE H 3 61  ? 61.772  26.094 -49.728 1.00 24.22  ? 261  PHE F CD1   1 
ATOM   10102 C CD2   . PHE H 3 61  ? 59.514  25.356 -49.522 1.00 23.91  ? 261  PHE F CD2   1 
ATOM   10103 C CE1   . PHE H 3 61  ? 61.431  27.277 -49.068 1.00 23.44  ? 261  PHE F CE1   1 
ATOM   10104 C CE2   . PHE H 3 61  ? 59.184  26.537 -48.865 1.00 24.05  ? 261  PHE F CE2   1 
ATOM   10105 C CZ    . PHE H 3 61  ? 60.142  27.491 -48.639 1.00 26.41  ? 261  PHE F CZ    1 
ATOM   10106 N N     . LEU H 3 62  ? 59.594  21.795 -49.218 1.00 20.78  ? 262  LEU F N     1 
ATOM   10107 C CA    . LEU H 3 62  ? 58.608  21.467 -48.232 1.00 21.58  ? 262  LEU F CA    1 
ATOM   10108 C C     . LEU H 3 62  ? 59.142  20.496 -47.198 1.00 19.15  ? 262  LEU F C     1 
ATOM   10109 O O     . LEU H 3 62  ? 58.836  20.634 -46.013 1.00 23.24  ? 262  LEU F O     1 
ATOM   10110 C CB    . LEU H 3 62  ? 57.353  20.947 -48.917 1.00 31.53  ? 262  LEU F CB    1 
ATOM   10111 C CG    . LEU H 3 62  ? 56.470  22.098 -49.402 1.00 33.36  ? 262  LEU F CG    1 
ATOM   10112 C CD1   . LEU H 3 62  ? 55.262  21.539 -50.109 1.00 31.97  ? 262  LEU F CD1   1 
ATOM   10113 C CD2   . LEU H 3 62  ? 56.043  22.954 -48.224 1.00 27.24  ? 262  LEU F CD2   1 
ATOM   10114 N N     . GLU H 3 63  ? 59.952  19.537 -47.640 1.00 24.25  ? 263  GLU F N     1 
ATOM   10115 C CA    . GLU H 3 63  ? 60.540  18.535 -46.755 1.00 24.52  ? 263  GLU F CA    1 
ATOM   10116 C C     . GLU H 3 63  ? 61.384  19.193 -45.674 1.00 23.88  ? 263  GLU F C     1 
ATOM   10117 O O     . GLU H 3 63  ? 61.260  18.902 -44.472 1.00 22.25  ? 263  GLU F O     1 
ATOM   10118 C CB    . GLU H 3 63  ? 61.458  17.620 -47.538 1.00 65.87  ? 263  GLU F CB    1 
ATOM   10119 C CG    . GLU H 3 63  ? 60.861  16.326 -47.972 1.00 71.91  ? 263  GLU F CG    1 
ATOM   10120 C CD    . GLU H 3 63  ? 61.762  15.620 -48.959 1.00 71.50  ? 263  GLU F CD    1 
ATOM   10121 O OE1   . GLU H 3 63  ? 62.998  15.656 -48.747 1.00 72.20  ? 263  GLU F OE1   1 
ATOM   10122 O OE2   . GLU H 3 63  ? 61.240  15.036 -49.936 1.00 77.76  ? 263  GLU F OE2   1 
ATOM   10123 N N     . ASN H 3 64  ? 62.256  20.090 -46.111 1.00 18.01  ? 264  ASN F N     1 
ATOM   10124 C CA    . ASN H 3 64  ? 63.145  20.743 -45.185 1.00 17.56  ? 264  ASN F CA    1 
ATOM   10125 C C     . ASN H 3 64  ? 62.477  21.575 -44.122 1.00 17.72  ? 264  ASN F C     1 
ATOM   10126 O O     . ASN H 3 64  ? 62.883  21.536 -42.954 1.00 16.13  ? 264  ASN F O     1 
ATOM   10127 C CB    . ASN H 3 64  ? 64.168  21.566 -45.944 1.00 22.12  ? 264  ASN F CB    1 
ATOM   10128 C CG    . ASN H 3 64  ? 65.130  20.706 -46.684 1.00 29.08  ? 264  ASN F CG    1 
ATOM   10129 O OD1   . ASN H 3 64  ? 65.678  19.772 -46.125 1.00 33.75  ? 264  ASN F OD1   1 
ATOM   10130 N ND2   . ASN H 3 64  ? 65.347  21.004 -47.945 1.00 30.11  ? 264  ASN F ND2   1 
ATOM   10131 N N     . VAL H 3 65  ? 61.438  22.296 -44.517 1.00 25.26  ? 265  VAL F N     1 
ATOM   10132 C CA    . VAL H 3 65  ? 60.739  23.158 -43.589 1.00 24.64  ? 265  VAL F CA    1 
ATOM   10133 C C     . VAL H 3 65  ? 59.827  22.359 -42.681 1.00 21.89  ? 265  VAL F C     1 
ATOM   10134 O O     . VAL H 3 65  ? 59.852  22.534 -41.457 1.00 20.31  ? 265  VAL F O     1 
ATOM   10135 C CB    . VAL H 3 65  ? 59.930  24.240 -44.350 1.00 31.86  ? 265  VAL F CB    1 
ATOM   10136 C CG1   . VAL H 3 65  ? 59.323  25.241 -43.364 1.00 35.47  ? 265  VAL F CG1   1 
ATOM   10137 C CG2   . VAL H 3 65  ? 60.846  24.961 -45.337 1.00 36.88  ? 265  VAL F CG2   1 
ATOM   10138 N N     . ILE H 3 66  ? 59.037  21.453 -43.251 1.00 31.18  ? 266  ILE F N     1 
ATOM   10139 C CA    . ILE H 3 66  ? 58.135  20.683 -42.411 1.00 29.22  ? 266  ILE F CA    1 
ATOM   10140 C C     . ILE H 3 66  ? 58.909  19.983 -41.295 1.00 31.91  ? 266  ILE F C     1 
ATOM   10141 O O     . ILE H 3 66  ? 58.537  20.073 -40.125 1.00 29.49  ? 266  ILE F O     1 
ATOM   10142 C CB    . ILE H 3 66  ? 57.298  19.701 -43.262 1.00 32.62  ? 266  ILE F CB    1 
ATOM   10143 C CG1   . ILE H 3 66  ? 56.395  20.524 -44.199 1.00 31.67  ? 266  ILE F CG1   1 
ATOM   10144 C CG2   . ILE H 3 66  ? 56.459  18.788 -42.364 1.00 30.52  ? 266  ILE F CG2   1 
ATOM   10145 C CD1   . ILE H 3 66  ? 55.243  19.794 -44.839 1.00 30.11  ? 266  ILE F CD1   1 
ATOM   10146 N N     . ARG H 3 67  ? 60.003  19.319 -41.657 1.00 24.38  ? 267  ARG F N     1 
ATOM   10147 C CA    . ARG H 3 67  ? 60.841  18.638 -40.683 1.00 25.78  ? 267  ARG F CA    1 
ATOM   10148 C C     . ARG H 3 67  ? 61.157  19.519 -39.462 1.00 26.21  ? 267  ARG F C     1 
ATOM   10149 O O     . ARG H 3 67  ? 60.925  19.149 -38.305 1.00 24.34  ? 267  ARG F O     1 
ATOM   10150 C CB    . ARG H 3 67  ? 62.141  18.241 -41.353 1.00 27.87  ? 267  ARG F CB    1 
ATOM   10151 C CG    . ARG H 3 67  ? 63.175  17.703 -40.397 1.00 35.07  ? 267  ARG F CG    1 
ATOM   10152 C CD    . ARG H 3 67  ? 64.469  17.355 -41.125 1.00 40.90  ? 267  ARG F CD    1 
ATOM   10153 N NE    . ARG H 3 67  ? 64.252  16.379 -42.192 1.00 50.76  ? 267  ARG F NE    1 
ATOM   10154 C CZ    . ARG H 3 67  ? 64.550  16.591 -43.472 1.00 52.50  ? 267  ARG F CZ    1 
ATOM   10155 N NH1   . ARG H 3 67  ? 65.085  17.760 -43.840 1.00 52.90  ? 267  ARG F NH1   1 
ATOM   10156 N NH2   . ARG H 3 67  ? 64.300  15.639 -44.380 1.00 52.46  ? 267  ARG F NH2   1 
ATOM   10157 N N     . ASP H 3 68  ? 61.710  20.691 -39.724 1.00 35.19  ? 268  ASP F N     1 
ATOM   10158 C CA    . ASP H 3 68  ? 62.047  21.595 -38.645 1.00 32.97  ? 268  ASP F CA    1 
ATOM   10159 C C     . ASP H 3 68  ? 60.776  22.044 -37.971 1.00 30.11  ? 268  ASP F C     1 
ATOM   10160 O O     . ASP H 3 68  ? 60.695  22.074 -36.743 1.00 31.85  ? 268  ASP F O     1 
ATOM   10161 C CB    . ASP H 3 68  ? 62.814  22.779 -39.189 1.00 51.51  ? 268  ASP F CB    1 
ATOM   10162 C CG    . ASP H 3 68  ? 64.160  22.378 -39.710 1.00 59.20  ? 268  ASP F CG    1 
ATOM   10163 O OD1   . ASP H 3 68  ? 64.300  21.221 -40.175 1.00 53.89  ? 268  ASP F OD1   1 
ATOM   10164 O OD2   . ASP H 3 68  ? 65.075  23.219 -39.665 1.00 55.09  ? 268  ASP F OD2   1 
ATOM   10165 N N     . ALA H 3 69  ? 59.767  22.363 -38.773 1.00 22.22  ? 269  ALA F N     1 
ATOM   10166 C CA    . ALA H 3 69  ? 58.498  22.788 -38.206 1.00 24.82  ? 269  ALA F CA    1 
ATOM   10167 C C     . ALA H 3 69  ? 58.010  21.726 -37.222 1.00 24.72  ? 269  ALA F C     1 
ATOM   10168 O O     . ALA H 3 69  ? 57.675  22.029 -36.081 1.00 24.51  ? 269  ALA F O     1 
ATOM   10169 C CB    . ALA H 3 69  ? 57.488  22.989 -39.299 1.00 23.87  ? 269  ALA F CB    1 
ATOM   10170 N N     . VAL H 3 70  ? 58.002  20.474 -37.669 1.00 20.75  ? 270  VAL F N     1 
ATOM   10171 C CA    . VAL H 3 70  ? 57.556  19.375 -36.839 1.00 22.05  ? 270  VAL F CA    1 
ATOM   10172 C C     . VAL H 3 70  ? 58.525  19.080 -35.697 1.00 22.26  ? 270  VAL F C     1 
ATOM   10173 O O     . VAL H 3 70  ? 58.109  18.628 -34.643 1.00 25.46  ? 270  VAL F O     1 
ATOM   10174 C CB    . VAL H 3 70  ? 57.308  18.118 -37.694 1.00 6.07   ? 270  VAL F CB    1 
ATOM   10175 C CG1   . VAL H 3 70  ? 56.938  16.910 -36.790 1.00 3.53   ? 270  VAL F CG1   1 
ATOM   10176 C CG2   . VAL H 3 70  ? 56.195  18.410 -38.702 1.00 2.95   ? 270  VAL F CG2   1 
ATOM   10177 N N     . THR H 3 71  ? 59.811  19.329 -35.882 1.00 17.00  ? 271  THR F N     1 
ATOM   10178 C CA    . THR H 3 71  ? 60.718  19.117 -34.759 1.00 16.31  ? 271  THR F CA    1 
ATOM   10179 C C     . THR H 3 71  ? 60.293  20.073 -33.634 1.00 19.11  ? 271  THR F C     1 
ATOM   10180 O O     . THR H 3 71  ? 60.258  19.682 -32.454 1.00 17.16  ? 271  THR F O     1 
ATOM   10181 C CB    . THR H 3 71  ? 62.159  19.425 -35.134 1.00 13.58  ? 271  THR F CB    1 
ATOM   10182 O OG1   . THR H 3 71  ? 62.592  18.467 -36.104 1.00 10.52  ? 271  THR F OG1   1 
ATOM   10183 C CG2   . THR H 3 71  ? 63.070  19.399 -33.912 1.00 11.96  ? 271  THR F CG2   1 
ATOM   10184 N N     . TYR H 3 72  ? 59.971  21.320 -33.999 1.00 36.76  ? 272  TYR F N     1 
ATOM   10185 C CA    . TYR H 3 72  ? 59.527  22.317 -33.018 1.00 34.90  ? 272  TYR F CA    1 
ATOM   10186 C C     . TYR H 3 72  ? 58.229  21.864 -32.308 1.00 37.96  ? 272  TYR F C     1 
ATOM   10187 O O     . TYR H 3 72  ? 58.059  22.070 -31.106 1.00 36.56  ? 272  TYR F O     1 
ATOM   10188 C CB    . TYR H 3 72  ? 59.274  23.686 -33.690 1.00 27.42  ? 272  TYR F CB    1 
ATOM   10189 C CG    . TYR H 3 72  ? 60.478  24.587 -33.782 1.00 27.17  ? 272  TYR F CG    1 
ATOM   10190 C CD1   . TYR H 3 72  ? 61.076  24.879 -35.025 1.00 27.67  ? 272  TYR F CD1   1 
ATOM   10191 C CD2   . TYR H 3 72  ? 61.089  25.059 -32.644 1.00 28.87  ? 272  TYR F CD2   1 
ATOM   10192 C CE1   . TYR H 3 72  ? 62.274  25.609 -35.124 1.00 29.10  ? 272  TYR F CE1   1 
ATOM   10193 C CE2   . TYR H 3 72  ? 62.281  25.796 -32.727 1.00 29.26  ? 272  TYR F CE2   1 
ATOM   10194 C CZ    . TYR H 3 72  ? 62.870  26.047 -33.973 1.00 29.58  ? 272  TYR F CZ    1 
ATOM   10195 O OH    . TYR H 3 72  ? 64.084  26.663 -34.021 1.00 32.32  ? 272  TYR F OH    1 
ATOM   10196 N N     . THR H 3 73  ? 57.326  21.256 -33.076 1.00 25.97  ? 273  THR F N     1 
ATOM   10197 C CA    . THR H 3 73  ? 56.034  20.794 -32.585 1.00 30.72  ? 273  THR F CA    1 
ATOM   10198 C C     . THR H 3 73  ? 56.166  19.719 -31.543 1.00 32.37  ? 273  THR F C     1 
ATOM   10199 O O     . THR H 3 73  ? 55.568  19.816 -30.494 1.00 30.40  ? 273  THR F O     1 
ATOM   10200 C CB    . THR H 3 73  ? 55.173  20.191 -33.704 1.00 29.33  ? 273  THR F CB    1 
ATOM   10201 O OG1   . THR H 3 73  ? 55.323  20.946 -34.907 1.00 31.05  ? 273  THR F OG1   1 
ATOM   10202 C CG2   . THR H 3 73  ? 53.736  20.183 -33.284 1.00 26.08  ? 273  THR F CG2   1 
ATOM   10203 N N     . GLU H 3 74  ? 56.921  18.673 -31.857 1.00 39.33  ? 274  GLU F N     1 
ATOM   10204 C CA    . GLU H 3 74  ? 57.112  17.578 -30.920 1.00 42.25  ? 274  GLU F CA    1 
ATOM   10205 C C     . GLU H 3 74  ? 57.758  18.112 -29.672 1.00 43.02  ? 274  GLU F C     1 
ATOM   10206 O O     . GLU H 3 74  ? 57.353  17.775 -28.566 1.00 41.62  ? 274  GLU F O     1 
ATOM   10207 C CB    . GLU H 3 74  ? 57.999  16.470 -31.506 1.00 59.91  ? 274  GLU F CB    1 
ATOM   10208 C CG    . GLU H 3 74  ? 57.387  15.769 -32.710 1.00 72.00  ? 274  GLU F CG    1 
ATOM   10209 C CD    . GLU H 3 74  ? 58.163  14.544 -33.166 1.00 76.54  ? 274  GLU F CD    1 
ATOM   10210 O OE1   . GLU H 3 74  ? 59.389  14.654 -33.411 1.00 81.54  ? 274  GLU F OE1   1 
ATOM   10211 O OE2   . GLU H 3 74  ? 57.531  13.468 -33.291 1.00 80.45  ? 274  GLU F OE2   1 
ATOM   10212 N N     . HIS H 3 75  ? 58.760  18.960 -29.839 1.00 34.23  ? 275  HIS F N     1 
ATOM   10213 C CA    . HIS H 3 75  ? 59.420  19.484 -28.674 1.00 33.04  ? 275  HIS F CA    1 
ATOM   10214 C C     . HIS H 3 75  ? 58.440  20.120 -27.687 1.00 36.73  ? 275  HIS F C     1 
ATOM   10215 O O     . HIS H 3 75  ? 58.573  19.999 -26.466 1.00 34.76  ? 275  HIS F O     1 
ATOM   10216 C CB    . HIS H 3 75  ? 60.463  20.507 -29.057 1.00 26.66  ? 275  HIS F CB    1 
ATOM   10217 C CG    . HIS H 3 75  ? 61.202  21.031 -27.874 1.00 26.91  ? 275  HIS F CG    1 
ATOM   10218 N ND1   . HIS H 3 75  ? 62.195  20.306 -27.248 1.00 25.83  ? 275  HIS F ND1   1 
ATOM   10219 C CD2   . HIS H 3 75  ? 60.987  22.124 -27.108 1.00 28.21  ? 275  HIS F CD2   1 
ATOM   10220 C CE1   . HIS H 3 75  ? 62.555  20.932 -26.140 1.00 29.87  ? 275  HIS F CE1   1 
ATOM   10221 N NE2   . HIS H 3 75  ? 61.839  22.035 -26.029 1.00 28.86  ? 275  HIS F NE2   1 
ATOM   10222 N N     . ALA H 3 76  ? 57.451  20.807 -28.228 1.00 32.24  ? 276  ALA F N     1 
ATOM   10223 C CA    . ALA H 3 76  ? 56.452  21.476 -27.417 1.00 34.40  ? 276  ALA F CA    1 
ATOM   10224 C C     . ALA H 3 76  ? 55.407  20.452 -26.970 1.00 35.08  ? 276  ALA F C     1 
ATOM   10225 O O     . ALA H 3 76  ? 54.367  20.793 -26.409 1.00 35.64  ? 276  ALA F O     1 
ATOM   10226 C CB    . ALA H 3 76  ? 55.812  22.603 -28.223 1.00 38.17  ? 276  ALA F CB    1 
ATOM   10227 N N     . LYS H 3 77  ? 55.703  19.187 -27.230 1.00 46.40  ? 277  LYS F N     1 
ATOM   10228 C CA    . LYS H 3 77  ? 54.820  18.104 -26.843 1.00 47.60  ? 277  LYS F CA    1 
ATOM   10229 C C     . LYS H 3 77  ? 53.385  18.242 -27.355 1.00 47.71  ? 277  LYS F C     1 
ATOM   10230 O O     . LYS H 3 77  ? 52.456  17.689 -26.762 1.00 48.20  ? 277  LYS F O     1 
ATOM   10231 C CB    . LYS H 3 77  ? 54.832  17.964 -25.314 1.00 42.85  ? 277  LYS F CB    1 
ATOM   10232 C CG    . LYS H 3 77  ? 56.152  17.432 -24.755 1.00 46.86  ? 277  LYS F CG    1 
ATOM   10233 C CD    . LYS H 3 77  ? 56.199  17.526 -23.243 1.00 51.72  ? 277  LYS F CD    1 
ATOM   10234 C CE    . LYS H 3 77  ? 57.516  17.003 -22.676 1.00 56.36  ? 277  LYS F CE    1 
ATOM   10235 N NZ    . LYS H 3 77  ? 57.631  17.294 -21.207 1.00 58.37  ? 277  LYS F NZ    1 
ATOM   10236 N N     . ARG H 3 78  ? 53.213  18.968 -28.459 1.00 28.39  ? 278  ARG F N     1 
ATOM   10237 C CA    . ARG H 3 78  ? 51.895  19.173 -29.072 1.00 24.63  ? 278  ARG F CA    1 
ATOM   10238 C C     . ARG H 3 78  ? 51.624  18.177 -30.194 1.00 24.56  ? 278  ARG F C     1 
ATOM   10239 O O     . ARG H 3 78  ? 52.523  17.472 -30.645 1.00 22.66  ? 278  ARG F O     1 
ATOM   10240 C CB    . ARG H 3 78  ? 51.768  20.594 -29.646 1.00 34.07  ? 278  ARG F CB    1 
ATOM   10241 C CG    . ARG H 3 78  ? 51.619  21.654 -28.598 1.00 34.23  ? 278  ARG F CG    1 
ATOM   10242 C CD    . ARG H 3 78  ? 51.429  23.036 -29.180 1.00 35.71  ? 278  ARG F CD    1 
ATOM   10243 N NE    . ARG H 3 78  ? 52.695  23.607 -29.639 1.00 34.59  ? 278  ARG F NE    1 
ATOM   10244 C CZ    . ARG H 3 78  ? 53.158  23.558 -30.890 1.00 33.30  ? 278  ARG F CZ    1 
ATOM   10245 N NH1   . ARG H 3 78  ? 52.480  22.966 -31.877 1.00 29.19  ? 278  ARG F NH1   1 
ATOM   10246 N NH2   . ARG H 3 78  ? 54.329  24.105 -31.143 1.00 32.67  ? 278  ARG F NH2   1 
ATOM   10247 N N     . LYS H 3 79  ? 50.376  18.123 -30.640 1.00 44.52  ? 279  LYS F N     1 
ATOM   10248 C CA    . LYS H 3 79  ? 50.007  17.237 -31.726 1.00 47.79  ? 279  LYS F CA    1 
ATOM   10249 C C     . LYS H 3 79  ? 49.637  18.082 -32.935 1.00 45.05  ? 279  LYS F C     1 
ATOM   10250 O O     . LYS H 3 79  ? 49.527  17.577 -34.056 1.00 46.12  ? 279  LYS F O     1 
ATOM   10251 C CB    . LYS H 3 79  ? 48.821  16.362 -31.332 1.00 79.56  ? 279  LYS F CB    1 
ATOM   10252 C CG    . LYS H 3 79  ? 49.185  15.083 -30.598 1.00 86.48  ? 279  LYS F CG    1 
ATOM   10253 C CD    . LYS H 3 79  ? 47.996  14.134 -30.607 1.00 94.80  ? 279  LYS F CD    1 
ATOM   10254 C CE    . LYS H 3 79  ? 48.349  12.765 -30.063 1.00 98.23  ? 279  LYS F CE    1 
ATOM   10255 N NZ    . LYS H 3 79  ? 47.200  11.825 -30.194 1.00 98.74  ? 279  LYS F NZ    1 
ATOM   10256 N N     . THR H 3 80  ? 49.467  19.381 -32.709 1.00 33.75  ? 280  THR F N     1 
ATOM   10257 C CA    . THR H 3 80  ? 49.092  20.275 -33.785 1.00 33.74  ? 280  THR F CA    1 
ATOM   10258 C C     . THR H 3 80  ? 50.221  21.184 -34.266 1.00 31.67  ? 280  THR F C     1 
ATOM   10259 O O     . THR H 3 80  ? 50.705  22.035 -33.513 1.00 30.52  ? 280  THR F O     1 
ATOM   10260 C CB    . THR H 3 80  ? 47.916  21.166 -33.343 1.00 48.40  ? 280  THR F CB    1 
ATOM   10261 O OG1   . THR H 3 80  ? 46.858  20.349 -32.832 1.00 51.40  ? 280  THR F OG1   1 
ATOM   10262 C CG2   . THR H 3 80  ? 47.384  21.956 -34.506 1.00 50.92  ? 280  THR F CG2   1 
ATOM   10263 N N     . VAL H 3 81  ? 50.648  21.014 -35.512 1.00 23.46  ? 281  VAL F N     1 
ATOM   10264 C CA    . VAL H 3 81  ? 51.680  21.894 -36.054 1.00 22.41  ? 281  VAL F CA    1 
ATOM   10265 C C     . VAL H 3 81  ? 51.055  23.301 -36.111 1.00 21.84  ? 281  VAL F C     1 
ATOM   10266 O O     . VAL H 3 81  ? 50.048  23.531 -36.815 1.00 21.13  ? 281  VAL F O     1 
ATOM   10267 C CB    . VAL H 3 81  ? 52.099  21.510 -37.510 1.00 27.09  ? 281  VAL F CB    1 
ATOM   10268 C CG1   . VAL H 3 81  ? 53.141  22.489 -37.996 1.00 27.28  ? 281  VAL F CG1   1 
ATOM   10269 C CG2   . VAL H 3 81  ? 52.654  20.085 -37.583 1.00 27.57  ? 281  VAL F CG2   1 
ATOM   10270 N N     . THR H 3 82  ? 51.642  24.246 -35.377 1.00 28.18  ? 282  THR F N     1 
ATOM   10271 C CA    . THR H 3 82  ? 51.121  25.615 -35.348 1.00 28.92  ? 282  THR F CA    1 
ATOM   10272 C C     . THR H 3 82  ? 51.809  26.497 -36.371 1.00 28.61  ? 282  THR F C     1 
ATOM   10273 O O     . THR H 3 82  ? 52.855  26.162 -36.883 1.00 24.47  ? 282  THR F O     1 
ATOM   10274 C CB    . THR H 3 82  ? 51.307  26.282 -33.956 1.00 25.40  ? 282  THR F CB    1 
ATOM   10275 O OG1   . THR H 3 82  ? 52.701  26.483 -33.700 1.00 26.30  ? 282  THR F OG1   1 
ATOM   10276 C CG2   . THR H 3 82  ? 50.718  25.428 -32.863 1.00 25.16  ? 282  THR F CG2   1 
ATOM   10277 N N     . ALA H 3 83  ? 51.213  27.647 -36.646 1.00 37.07  ? 283  ALA F N     1 
ATOM   10278 C CA    . ALA H 3 83  ? 51.771  28.583 -37.596 1.00 36.55  ? 283  ALA F CA    1 
ATOM   10279 C C     . ALA H 3 83  ? 53.123  29.129 -37.092 1.00 35.64  ? 283  ALA F C     1 
ATOM   10280 O O     . ALA H 3 83  ? 54.006  29.515 -37.880 1.00 36.70  ? 283  ALA F O     1 
ATOM   10281 C CB    . ALA H 3 83  ? 50.787  29.689 -37.813 1.00 16.61  ? 283  ALA F CB    1 
ATOM   10282 N N     . MET H 3 84  ? 53.299  29.156 -35.775 1.00 23.47  ? 284  MET F N     1 
ATOM   10283 C CA    . MET H 3 84  ? 54.570  29.624 -35.255 1.00 25.76  ? 284  MET F CA    1 
ATOM   10284 C C     . MET H 3 84  ? 55.652  28.607 -35.538 1.00 25.61  ? 284  MET F C     1 
ATOM   10285 O O     . MET H 3 84  ? 56.790  28.979 -35.824 1.00 23.31  ? 284  MET F O     1 
ATOM   10286 C CB    . MET H 3 84  ? 54.478  29.910 -33.762 1.00 21.56  ? 284  MET F CB    1 
ATOM   10287 C CG    . MET H 3 84  ? 53.874  31.275 -33.477 1.00 33.31  ? 284  MET F CG    1 
ATOM   10288 S SD    . MET H 3 84  ? 54.642  32.608 -34.485 1.00 39.21  ? 284  MET F SD    1 
ATOM   10289 C CE    . MET H 3 84  ? 55.923  33.181 -33.393 1.00 37.76  ? 284  MET F CE    1 
ATOM   10290 N N     . ASP H 3 85  ? 55.277  27.328 -35.461 1.00 25.49  ? 285  ASP F N     1 
ATOM   10291 C CA    . ASP H 3 85  ? 56.191  26.225 -35.736 1.00 25.50  ? 285  ASP F CA    1 
ATOM   10292 C C     . ASP H 3 85  ? 56.794  26.448 -37.111 1.00 21.67  ? 285  ASP F C     1 
ATOM   10293 O O     . ASP H 3 85  ? 58.003  26.352 -37.309 1.00 22.98  ? 285  ASP F O     1 
ATOM   10294 C CB    . ASP H 3 85  ? 55.442  24.886 -35.750 1.00 49.00  ? 285  ASP F CB    1 
ATOM   10295 C CG    . ASP H 3 85  ? 55.088  24.390 -34.365 1.00 50.32  ? 285  ASP F CG    1 
ATOM   10296 O OD1   . ASP H 3 85  ? 55.868  24.669 -33.435 1.00 47.09  ? 285  ASP F OD1   1 
ATOM   10297 O OD2   . ASP H 3 85  ? 54.049  23.706 -34.216 1.00 51.28  ? 285  ASP F OD2   1 
ATOM   10298 N N     . VAL H 3 86  ? 55.921  26.738 -38.061 1.00 16.69  ? 286  VAL F N     1 
ATOM   10299 C CA    . VAL H 3 86  ? 56.321  26.982 -39.419 1.00 16.32  ? 286  VAL F CA    1 
ATOM   10300 C C     . VAL H 3 86  ? 57.128  28.271 -39.549 1.00 17.38  ? 286  VAL F C     1 
ATOM   10301 O O     . VAL H 3 86  ? 58.072  28.343 -40.347 1.00 20.13  ? 286  VAL F O     1 
ATOM   10302 C CB    . VAL H 3 86  ? 55.077  27.040 -40.327 1.00 6.25   ? 286  VAL F CB    1 
ATOM   10303 C CG1   . VAL H 3 86  ? 55.458  27.554 -41.745 1.00 5.76   ? 286  VAL F CG1   1 
ATOM   10304 C CG2   . VAL H 3 86  ? 54.444  25.661 -40.380 1.00 7.54   ? 286  VAL F CG2   1 
ATOM   10305 N N     . VAL H 3 87  ? 56.763  29.294 -38.783 1.00 18.08  ? 287  VAL F N     1 
ATOM   10306 C CA    . VAL H 3 87  ? 57.503  30.551 -38.858 1.00 16.52  ? 287  VAL F CA    1 
ATOM   10307 C C     .