data_1P4K
# 
_entry.id   1P4K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1P4K         pdb_00001p4k 10.2210/pdb1p4k/pdb 
RCSB  RCSB018998   ?            ?                   
WWPDB D_1000018998 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1P4V 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF THE GLYCOSYLASPARAGINASE PRECURSOR D151N MUTANT WITH GLYCINE' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P4K 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qian, X.'  1 
'Guan, C.'  2 
'Guo, H.C.' 3 
# 
_citation.id                        primary 
_citation.title                     'A dual role for an aspartic acid in glycosylasparaginase autoproteolysis.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                997 
_citation.page_last                 1003 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12906830 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00150-3' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Qian, X.'  1 ? 
primary 'Guan, C.'  2 ? 
primary 'Guo, H.C.' 3 ? 
# 
_cell.entry_id           1P4K 
_cell.length_a           46.176 
_cell.length_b           52.717 
_cell.length_c           61.924 
_cell.angle_alpha        80.85 
_cell.angle_beta         90.21 
_cell.angle_gamma        105.08 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P4K 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase' 32178.645 2 3.5.1.26 D151N 
'Glycosylasparaginase, alpha and beta chains' ? 
2 non-polymer syn GLYCEROL                                          92.094    4 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Glycosylasparaginase, Aspartylglucosaminidase, N4-N- acetyl-beta-glucosaminyl, -L-asparagine amidase, AGA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_entity_poly.pdbx_strand_id                 A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   THR n 
1 3   ASN n 
1 4   LYS n 
1 5   PRO n 
1 6   ILE n 
1 7   VAL n 
1 8   LEU n 
1 9   SER n 
1 10  THR n 
1 11  TRP n 
1 12  ASN n 
1 13  PHE n 
1 14  GLY n 
1 15  LEU n 
1 16  HIS n 
1 17  ALA n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  ALA n 
1 22  TRP n 
1 23  LYS n 
1 24  VAL n 
1 25  LEU n 
1 26  SER n 
1 27  LYS n 
1 28  GLY n 
1 29  GLY n 
1 30  LYS n 
1 31  ALA n 
1 32  LEU n 
1 33  ASP n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  GLY n 
1 39  VAL n 
1 40  ARG n 
1 41  LEU n 
1 42  VAL n 
1 43  GLU n 
1 44  ASP n 
1 45  ASP n 
1 46  PRO n 
1 47  THR n 
1 48  GLU n 
1 49  ARG n 
1 50  SER n 
1 51  VAL n 
1 52  GLY n 
1 53  TYR n 
1 54  GLY n 
1 55  GLY n 
1 56  ARG n 
1 57  PRO n 
1 58  ASP n 
1 59  ARG n 
1 60  ASP n 
1 61  GLY n 
1 62  ARG n 
1 63  VAL n 
1 64  THR n 
1 65  LEU n 
1 66  ASP n 
1 67  ALA n 
1 68  CYS n 
1 69  ILE n 
1 70  MET n 
1 71  ASP n 
1 72  GLU n 
1 73  ASN n 
1 74  TYR n 
1 75  ASN n 
1 76  ILE n 
1 77  GLY n 
1 78  SER n 
1 79  VAL n 
1 80  ALA n 
1 81  CYS n 
1 82  MET n 
1 83  GLU n 
1 84  HIS n 
1 85  ILE n 
1 86  LYS n 
1 87  ASN n 
1 88  PRO n 
1 89  ILE n 
1 90  SER n 
1 91  VAL n 
1 92  ALA n 
1 93  ARG n 
1 94  ALA n 
1 95  VAL n 
1 96  MET n 
1 97  GLU n 
1 98  LYS n 
1 99  THR n 
1 100 PRO n 
1 101 HIS n 
1 102 VAL n 
1 103 MET n 
1 104 LEU n 
1 105 VAL n 
1 106 GLY n 
1 107 ASP n 
1 108 GLY n 
1 109 ALA n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 ALA n 
1 114 LEU n 
1 115 SER n 
1 116 GLN n 
1 117 GLY n 
1 118 PHE n 
1 119 LYS n 
1 120 LYS n 
1 121 GLU n 
1 122 ASN n 
1 123 LEU n 
1 124 LEU n 
1 125 THR n 
1 126 ALA n 
1 127 GLU n 
1 128 SER n 
1 129 GLU n 
1 130 LYS n 
1 131 GLU n 
1 132 TRP n 
1 133 LYS n 
1 134 GLU n 
1 135 TRP n 
1 136 LEU n 
1 137 LYS n 
1 138 THR n 
1 139 SER n 
1 140 GLN n 
1 141 TYR n 
1 142 LYS n 
1 143 PRO n 
1 144 ILE n 
1 145 VAL n 
1 146 ASN n 
1 147 ILE n 
1 148 GLU n 
1 149 ASN n 
1 150 HIS n 
1 151 ASN n 
1 152 THR n 
1 153 ILE n 
1 154 GLY n 
1 155 MET n 
1 156 ILE n 
1 157 ALA n 
1 158 LEU n 
1 159 ASP n 
1 160 ALA n 
1 161 GLN n 
1 162 GLY n 
1 163 ASN n 
1 164 LEU n 
1 165 SER n 
1 166 GLY n 
1 167 ALA n 
1 168 CYS n 
1 169 THR n 
1 170 THR n 
1 171 SER n 
1 172 GLY n 
1 173 MET n 
1 174 ALA n 
1 175 TYR n 
1 176 LYS n 
1 177 MET n 
1 178 HIS n 
1 179 GLY n 
1 180 ARG n 
1 181 VAL n 
1 182 GLY n 
1 183 ASP n 
1 184 SER n 
1 185 PRO n 
1 186 ILE n 
1 187 ILE n 
1 188 GLY n 
1 189 ALA n 
1 190 GLY n 
1 191 LEU n 
1 192 PHE n 
1 193 VAL n 
1 194 ASP n 
1 195 ASN n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 ALA n 
1 200 ALA n 
1 201 THR n 
1 202 ALA n 
1 203 THR n 
1 204 GLY n 
1 205 HIS n 
1 206 GLY n 
1 207 GLU n 
1 208 GLU n 
1 209 VAL n 
1 210 ILE n 
1 211 ARG n 
1 212 THR n 
1 213 VAL n 
1 214 GLY n 
1 215 THR n 
1 216 HIS n 
1 217 LEU n 
1 218 VAL n 
1 219 VAL n 
1 220 GLU n 
1 221 LEU n 
1 222 MET n 
1 223 ASN n 
1 224 GLN n 
1 225 GLY n 
1 226 ARG n 
1 227 THR n 
1 228 PRO n 
1 229 GLN n 
1 230 GLN n 
1 231 ALA n 
1 232 CYS n 
1 233 LYS n 
1 234 GLU n 
1 235 ALA n 
1 236 VAL n 
1 237 GLU n 
1 238 ARG n 
1 239 ILE n 
1 240 VAL n 
1 241 LYS n 
1 242 ILE n 
1 243 VAL n 
1 244 ASN n 
1 245 ARG n 
1 246 ARG n 
1 247 GLY n 
1 248 LYS n 
1 249 ASN n 
1 250 LEU n 
1 251 LYS n 
1 252 ASP n 
1 253 ILE n 
1 254 GLN n 
1 255 VAL n 
1 256 GLY n 
1 257 PHE n 
1 258 ILE n 
1 259 ALA n 
1 260 LEU n 
1 261 ASN n 
1 262 LYS n 
1 263 LYS n 
1 264 GLY n 
1 265 GLU n 
1 266 TYR n 
1 267 GLY n 
1 268 ALA n 
1 269 TYR n 
1 270 CYS n 
1 271 ILE n 
1 272 GLN n 
1 273 ASP n 
1 274 GLY n 
1 275 PHE n 
1 276 ASN n 
1 277 PHE n 
1 278 ALA n 
1 279 VAL n 
1 280 HIS n 
1 281 ASP n 
1 282 GLN n 
1 283 LYS n 
1 284 GLY n 
1 285 ASN n 
1 286 ARG n 
1 287 LEU n 
1 288 GLU n 
1 289 THR n 
1 290 PRO n 
1 291 GLY n 
1 292 PHE n 
1 293 ALA n 
1 294 LEU n 
1 295 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Elizabethkingia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Elizabethkingia meningoseptica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     238 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMAL-c2X 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ASPG_FLAME 
_struct_ref.pdbx_db_accession          Q47898 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHDTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1P4K A 1 ? 295 ? Q47898 46 ? 340 ? 1   295 
2 1 1P4K C 1 ? 295 ? Q47898 46 ? 340 ? 301 595 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P4K ASN A 151 ? UNP Q47898 ASP 196 'engineered mutation' 151 1 
2 1P4K ASN C 151 ? UNP Q47898 ASP 196 'engineered mutation' 451 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1P4K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.density_percent_sol   45.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '15% PEG 3300, 0.1M Tris, pH 7.5, 0.2M lithium sulfate, 0.1% sodium azide, EVAPORATION' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1P4K 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             20.00 
_reflns.number_all                   43851 
_reflns.number_obs                   43851 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.02 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.04 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1P4K 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             20.00 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     43851 
_refine.ls_number_reflns_obs                     41680 
_refine.ls_number_reflns_R_free                  4266 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.22 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               13.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4510 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4534 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d 1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d  0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P4K 
_struct.title                     'CRYSTAL STRUCTURE OF THE GLYCOSYLASPARAGINASE PRECURSOR D151N MUTANT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P4K 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ALPHA BETA, BETA ALPHA, SANDWICH, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 13  ? SER A 26  ? PHE A 13  SER A 26  1 ? 14 
HELX_P HELX_P2  2  LYS A 30  ? ASP A 45  ? LYS A 30  ASP A 45  1 ? 16 
HELX_P HELX_P3  3  ASN A 87  ? THR A 99  ? ASN A 87  THR A 99  1 ? 13 
HELX_P HELX_P4  4  GLY A 106 ? GLN A 116 ? GLY A 106 GLN A 116 1 ? 11 
HELX_P HELX_P5  5  THR A 125 ? LYS A 137 ? THR A 125 LYS A 137 1 ? 13 
HELX_P HELX_P6  6  HIS A 205 ? VAL A 213 ? HIS A 205 VAL A 213 1 ? 9  
HELX_P HELX_P7  7  VAL A 213 ? GLN A 224 ? VAL A 213 GLN A 224 1 ? 12 
HELX_P HELX_P8  8  THR A 227 ? ARG A 246 ? THR A 227 ARG A 246 1 ? 20 
HELX_P HELX_P9  9  ASN A 249 ? ILE A 253 ? ASN A 249 ILE A 253 5 ? 5  
HELX_P HELX_P10 10 PHE B 13  ? SER B 26  ? PHE C 313 SER C 326 1 ? 14 
HELX_P HELX_P11 11 LYS B 30  ? ASP B 45  ? LYS C 330 ASP C 345 1 ? 16 
HELX_P HELX_P12 12 ASN B 87  ? THR B 99  ? ASN C 387 THR C 399 1 ? 13 
HELX_P HELX_P13 13 GLY B 106 ? GLN B 116 ? GLY C 406 GLN C 416 1 ? 11 
HELX_P HELX_P14 14 THR B 125 ? LYS B 137 ? THR C 425 LYS C 437 1 ? 13 
HELX_P HELX_P15 15 HIS B 205 ? VAL B 213 ? HIS C 505 VAL C 513 1 ? 9  
HELX_P HELX_P16 16 VAL B 213 ? GLN B 224 ? VAL C 513 GLN C 524 1 ? 12 
HELX_P HELX_P17 17 THR B 227 ? ARG B 246 ? THR C 527 ARG C 546 1 ? 20 
HELX_P HELX_P18 18 ASN B 249 ? ILE B 253 ? ASN C 549 ILE C 553 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale none ? C GOL . C1 ? ? ? 1_555 D GOL . O3 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
covale2  covale none ? C GOL . C1 ? ? ? 1_555 D GOL . C2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.720 ? ? 
covale3  covale none ? C GOL . O1 ? ? ? 1_555 D GOL . O1 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.380 ? ? 
covale4  covale none ? C GOL . O1 ? ? ? 1_555 D GOL . C2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
covale5  covale none ? C GOL . C2 ? ? ? 1_555 D GOL . C1 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.793 ? ? 
covale6  covale none ? C GOL . C2 ? ? ? 1_555 D GOL . O2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.927 ? ? 
covale7  covale none ? C GOL . C2 ? ? ? 1_555 D GOL . O3 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.635 ? ? 
covale8  covale none ? C GOL . O2 ? ? ? 1_555 D GOL . C3 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.682 ? ? 
covale9  covale none ? C GOL . O2 ? ? ? 1_555 D GOL . C2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale10 covale none ? C GOL . C3 ? ? ? 1_555 D GOL . C3 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.789 ? ? 
covale11 covale none ? C GOL . C3 ? ? ? 1_555 D GOL . C2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale12 covale none ? C GOL . O3 ? ? ? 1_555 D GOL . C2 ? ? A GOL 296 A GOL 297 1_555 ? ? ? ? ? ? ? 1.705 ? ? 
covale13 covale none ? E GOL . C1 ? ? ? 1_555 F GOL . C3 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.950 ? ? 
covale14 covale none ? E GOL . C1 ? ? ? 1_555 F GOL . O3 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 2.038 ? ? 
covale15 covale none ? E GOL . C1 ? ? ? 1_555 F GOL . O1 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.231 ? ? 
covale16 covale none ? E GOL . O1 ? ? ? 1_555 F GOL . O1 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale17 covale none ? E GOL . C2 ? ? ? 1_555 F GOL . O2 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.755 ? ? 
covale18 covale none ? E GOL . C2 ? ? ? 1_555 F GOL . O3 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.714 ? ? 
covale19 covale none ? E GOL . C2 ? ? ? 1_555 F GOL . C1 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.775 ? ? 
covale20 covale none ? E GOL . O2 ? ? ? 1_555 F GOL . C3 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.842 ? ? 
covale21 covale none ? E GOL . C3 ? ? ? 1_555 F GOL . C2 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.532 ? ? 
covale22 covale none ? E GOL . C3 ? ? ? 1_555 F GOL . C3 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 2.016 ? ? 
covale23 covale none ? E GOL . O3 ? ? ? 1_555 F GOL . C2 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 2.001 ? ? 
covale24 covale none ? E GOL . C1 ? ? ? 1_555 F GOL . C2 ? ? C GOL 2   C GOL 4   1_555 ? ? ? ? ? ? ? 1.712 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 4 A . ? LYS 4   A PRO 5 A ? PRO 5   A 1 -0.29 
2 LYS 4 B . ? LYS 304 C PRO 5 B ? PRO 305 C 1 0.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 5 ? 
C ? 8 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 103 ? VAL A 105 ? MET A 103 VAL A 105 
A 2 ILE A 76  ? MET A 82  ? ILE A 76  MET A 82  
A 3 LEU A 65  ? MET A 70  ? LEU A 65  MET A 70  
A 4 LEU A 164 ? THR A 170 ? LEU A 164 THR A 170 
A 5 ILE A 153 ? LEU A 158 ? ILE A 153 LEU A 158 
A 6 ILE A 6   ? THR A 10  ? ILE A 6   THR A 10  
A 7 PHE A 277 ? ASP A 281 ? PHE A 277 ASP A 281 
A 8 GLY A 284 ? GLU A 288 ? GLY A 284 GLU A 288 
B 1 LEU A 191 ? ASP A 194 ? LEU A 191 ASP A 194 
B 2 GLY A 198 ? GLY A 204 ? GLY A 198 GLY A 204 
B 3 VAL A 255 ? ASN A 261 ? VAL A 255 ASN A 261 
B 4 TYR A 266 ? CYS A 270 ? TYR A 266 CYS A 270 
B 5 GLY A 291 ? PHE A 292 ? GLY A 291 PHE A 292 
C 1 MET B 103 ? VAL B 105 ? MET C 403 VAL C 405 
C 2 ILE B 76  ? MET B 82  ? ILE C 376 MET C 382 
C 3 LEU B 65  ? MET B 70  ? LEU C 365 MET C 370 
C 4 LEU B 164 ? THR B 170 ? LEU C 464 THR C 470 
C 5 ILE B 153 ? LEU B 158 ? ILE C 453 LEU C 458 
C 6 ILE B 6   ? THR B 10  ? ILE C 306 THR C 310 
C 7 PHE B 277 ? ASP B 281 ? PHE C 577 ASP C 581 
C 8 GLY B 284 ? GLU B 288 ? GLY C 584 GLU C 588 
D 1 LEU B 191 ? ASP B 194 ? LEU C 491 ASP C 494 
D 2 GLY B 198 ? GLY B 204 ? GLY C 498 GLY C 504 
D 3 VAL B 255 ? ASN B 261 ? VAL C 555 ASN C 561 
D 4 TYR B 266 ? CYS B 270 ? TYR C 566 CYS C 570 
D 5 GLY B 291 ? PHE B 292 ? GLY C 591 PHE C 592 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 104 ? O LEU A 104 N SER A 78  ? N SER A 78  
A 2 3 O MET A 82  ? O MET A 82  N LEU A 65  ? N LEU A 65  
A 3 4 N ASP A 66  ? N ASP A 66  O THR A 170 ? O THR A 170 
A 4 5 O ALA A 167 ? O ALA A 167 N MET A 155 ? N MET A 155 
A 5 6 O ILE A 156 ? O ILE A 156 N LEU A 8   ? N LEU A 8   
A 6 7 N SER A 9   ? N SER A 9   O ALA A 278 ? O ALA A 278 
A 7 8 N PHE A 277 ? N PHE A 277 O GLU A 288 ? O GLU A 288 
B 1 2 N ASP A 194 ? N ASP A 194 O GLY A 198 ? O GLY A 198 
B 2 3 N ALA A 199 ? N ALA A 199 O LEU A 260 ? O LEU A 260 
B 3 4 N ALA A 259 ? N ALA A 259 O GLY A 267 ? O GLY A 267 
B 4 5 N CYS A 270 ? N CYS A 270 O GLY A 291 ? O GLY A 291 
C 1 2 O LEU B 104 ? O LEU C 404 N SER B 78  ? N SER C 378 
C 2 3 O MET B 82  ? O MET C 382 N LEU B 65  ? N LEU C 365 
C 3 4 N ASP B 66  ? N ASP C 366 O THR B 170 ? O THR C 470 
C 4 5 O ALA B 167 ? O ALA C 467 N MET B 155 ? N MET C 455 
C 5 6 O ILE B 156 ? O ILE C 456 N LEU B 8   ? N LEU C 308 
C 6 7 N VAL B 7   ? N VAL C 307 O HIS B 280 ? O HIS C 580 
C 7 8 N PHE B 277 ? N PHE C 577 O GLU B 288 ? O GLU C 588 
D 1 2 N ASP B 194 ? N ASP C 494 O GLY B 198 ? O GLY C 498 
D 2 3 N THR B 203 ? N THR C 503 O GLY B 256 ? O GLY C 556 
D 3 4 N ALA B 259 ? N ALA C 559 O GLY B 267 ? O GLY C 567 
D 4 5 N CYS B 270 ? N CYS C 570 O GLY B 291 ? O GLY C 591 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 296 ? 11 'BINDING SITE FOR RESIDUE GOL A 296' 
AC2 Software A GOL 297 ? 12 'BINDING SITE FOR RESIDUE GOL A 297' 
AC3 Software C GOL 2   ? 11 'BINDING SITE FOR RESIDUE GOL C 2'   
AC4 Software C GOL 4   ? 11 'BINDING SITE FOR RESIDUE GOL C 4'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 HIS A 150 ? HIS A 150 . ? 1_555 ? 
2  AC1 11 THR A 152 ? THR A 152 . ? 1_555 ? 
3  AC1 11 THR A 170 ? THR A 170 . ? 1_555 ? 
4  AC1 11 GLY A 172 ? GLY A 172 . ? 1_555 ? 
5  AC1 11 MET A 173 ? MET A 173 . ? 1_555 ? 
6  AC1 11 ARG A 180 ? ARG A 180 . ? 1_555 ? 
7  AC1 11 GLY A 182 ? GLY A 182 . ? 1_555 ? 
8  AC1 11 ASP A 183 ? ASP A 183 . ? 1_555 ? 
9  AC1 11 SER A 184 ? SER A 184 . ? 1_555 ? 
10 AC1 11 GLY A 204 ? GLY A 204 . ? 1_555 ? 
11 AC1 11 GOL D .   ? GOL A 297 . ? 1_555 ? 
12 AC2 12 HIS A 150 ? HIS A 150 . ? 1_555 ? 
13 AC2 12 THR A 152 ? THR A 152 . ? 1_555 ? 
14 AC2 12 THR A 170 ? THR A 170 . ? 1_555 ? 
15 AC2 12 GLY A 172 ? GLY A 172 . ? 1_555 ? 
16 AC2 12 MET A 173 ? MET A 173 . ? 1_555 ? 
17 AC2 12 ARG A 180 ? ARG A 180 . ? 1_555 ? 
18 AC2 12 GLY A 182 ? GLY A 182 . ? 1_555 ? 
19 AC2 12 ASP A 183 ? ASP A 183 . ? 1_555 ? 
20 AC2 12 SER A 184 ? SER A 184 . ? 1_555 ? 
21 AC2 12 GLY A 204 ? GLY A 204 . ? 1_555 ? 
22 AC2 12 GLY A 206 ? GLY A 206 . ? 1_555 ? 
23 AC2 12 GOL C .   ? GOL A 296 . ? 1_555 ? 
24 AC3 11 GOL F .   ? GOL C 4   . ? 1_555 ? 
25 AC3 11 HIS B 150 ? HIS C 450 . ? 1_555 ? 
26 AC3 11 THR B 152 ? THR C 452 . ? 1_555 ? 
27 AC3 11 THR B 170 ? THR C 470 . ? 1_555 ? 
28 AC3 11 GLY B 172 ? GLY C 472 . ? 1_555 ? 
29 AC3 11 MET B 173 ? MET C 473 . ? 1_555 ? 
30 AC3 11 ARG B 180 ? ARG C 480 . ? 1_555 ? 
31 AC3 11 GLY B 182 ? GLY C 482 . ? 1_555 ? 
32 AC3 11 ASP B 183 ? ASP C 483 . ? 1_555 ? 
33 AC3 11 SER B 184 ? SER C 484 . ? 1_555 ? 
34 AC3 11 GLY B 204 ? GLY C 504 . ? 1_555 ? 
35 AC4 11 GOL E .   ? GOL C 2   . ? 1_555 ? 
36 AC4 11 HIS B 150 ? HIS C 450 . ? 1_555 ? 
37 AC4 11 THR B 170 ? THR C 470 . ? 1_555 ? 
38 AC4 11 GLY B 172 ? GLY C 472 . ? 1_555 ? 
39 AC4 11 MET B 173 ? MET C 473 . ? 1_555 ? 
40 AC4 11 ARG B 180 ? ARG C 480 . ? 1_555 ? 
41 AC4 11 GLY B 182 ? GLY C 482 . ? 1_555 ? 
42 AC4 11 ASP B 183 ? ASP C 483 . ? 1_555 ? 
43 AC4 11 SER B 184 ? SER C 484 . ? 1_555 ? 
44 AC4 11 GLY B 204 ? GLY C 504 . ? 1_555 ? 
45 AC4 11 GLY B 206 ? GLY C 506 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1P4K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P4K 
_atom_sites.fract_transf_matrix[1][1]   0.021656 
_atom_sites.fract_transf_matrix[1][2]   0.005835 
_atom_sites.fract_transf_matrix[1][3]   -0.000888 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019646 
_atom_sites.fract_transf_matrix[2][3]   -0.003260 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016370 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? 4.878  12.888 63.010 1.00 37.96 ? 1   THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? 6.160  13.353 63.612 1.00 37.36 ? 1   THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? 6.592  14.694 63.010 1.00 35.17 ? 1   THR A C   1 
ATOM   4    O O   . THR A 1 1   ? 7.545  15.319 63.486 1.00 35.93 ? 1   THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? 7.281  12.317 63.381 0.00 37.54 ? 1   THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? 6.846  11.033 63.845 0.00 39.17 ? 1   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? 8.542  12.713 64.135 0.00 39.17 ? 1   THR A CG2 1 
ATOM   8    N N   . THR A 1 2   ? 5.883  15.135 61.973 1.00 30.71 ? 2   THR A N   1 
ATOM   9    C CA  . THR A 1 2   ? 6.197  16.399 61.309 1.00 27.02 ? 2   THR A CA  1 
ATOM   10   C C   . THR A 1 2   ? 6.280  17.565 62.293 1.00 27.04 ? 2   THR A C   1 
ATOM   11   O O   . THR A 1 2   ? 5.405  17.739 63.147 1.00 27.76 ? 2   THR A O   1 
ATOM   12   C CB  . THR A 1 2   ? 5.143  16.736 60.215 1.00 27.47 ? 2   THR A CB  1 
ATOM   13   O OG1 . THR A 1 2   ? 5.237  15.784 59.147 1.00 21.79 ? 2   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 2   ? 5.376  18.139 59.653 1.00 26.09 ? 2   THR A CG2 1 
ATOM   15   N N   . ASN A 1 3   ? 7.351  18.349 62.173 1.00 22.19 ? 3   ASN A N   1 
ATOM   16   C CA  . ASN A 1 3   ? 7.579  19.519 63.013 1.00 18.56 ? 3   ASN A CA  1 
ATOM   17   C C   . ASN A 1 3   ? 7.232  20.742 62.165 1.00 15.04 ? 3   ASN A C   1 
ATOM   18   O O   . ASN A 1 3   ? 7.991  21.108 61.269 1.00 15.23 ? 3   ASN A O   1 
ATOM   19   C CB  . ASN A 1 3   ? 9.055  19.565 63.453 1.00 17.53 ? 3   ASN A CB  1 
ATOM   20   C CG  . ASN A 1 3   ? 9.393  20.808 64.267 1.00 17.80 ? 3   ASN A CG  1 
ATOM   21   O OD1 . ASN A 1 3   ? 8.557  21.331 65.000 1.00 20.50 ? 3   ASN A OD1 1 
ATOM   22   N ND2 . ASN A 1 3   ? 10.626 21.280 64.143 1.00 18.42 ? 3   ASN A ND2 1 
ATOM   23   N N   . LYS A 1 4   ? 6.078  21.353 62.427 1.00 11.44 ? 4   LYS A N   1 
ATOM   24   C CA  . LYS A 1 4   ? 5.646  22.531 61.667 1.00 10.86 ? 4   LYS A CA  1 
ATOM   25   C C   . LYS A 1 4   ? 4.745  23.416 62.526 1.00 10.17 ? 4   LYS A C   1 
ATOM   26   O O   . LYS A 1 4   ? 4.062  22.925 63.421 1.00 11.30 ? 4   LYS A O   1 
ATOM   27   C CB  . LYS A 1 4   ? 4.883  22.105 60.400 1.00 14.02 ? 4   LYS A CB  1 
ATOM   28   C CG  . LYS A 1 4   ? 3.574  21.335 60.682 1.00 17.52 ? 4   LYS A CG  1 
ATOM   29   C CD  . LYS A 1 4   ? 2.781  21.028 59.409 1.00 18.87 ? 4   LYS A CD  1 
ATOM   30   C CE  . LYS A 1 4   ? 1.505  20.239 59.735 1.00 19.32 ? 4   LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 4   ? 0.546  20.131 58.585 1.00 22.43 ? 4   LYS A NZ  1 
ATOM   32   N N   . PRO A 1 5   ? 4.743  24.737 62.275 1.00 9.13  ? 5   PRO A N   1 
ATOM   33   C CA  . PRO A 1 5   ? 5.542  25.410 61.243 1.00 7.63  ? 5   PRO A CA  1 
ATOM   34   C C   . PRO A 1 5   ? 6.978  25.595 61.725 1.00 9.39  ? 5   PRO A C   1 
ATOM   35   O O   . PRO A 1 5   ? 7.268  25.474 62.921 1.00 5.70  ? 5   PRO A O   1 
ATOM   36   C CB  . PRO A 1 5   ? 4.858  26.768 61.071 1.00 9.00  ? 5   PRO A CB  1 
ATOM   37   C CG  . PRO A 1 5   ? 3.677  26.762 62.051 1.00 14.11 ? 5   PRO A CG  1 
ATOM   38   C CD  . PRO A 1 5   ? 3.977  25.711 63.066 1.00 11.17 ? 5   PRO A CD  1 
ATOM   39   N N   . ILE A 1 6   ? 7.866  25.912 60.789 1.00 7.07  ? 6   ILE A N   1 
ATOM   40   C CA  . ILE A 1 6   ? 9.269  26.141 61.097 1.00 6.42  ? 6   ILE A CA  1 
ATOM   41   C C   . ILE A 1 6   ? 9.880  26.974 59.980 1.00 5.67  ? 6   ILE A C   1 
ATOM   42   O O   . ILE A 1 6   ? 9.515  26.816 58.807 1.00 6.81  ? 6   ILE A O   1 
ATOM   43   C CB  . ILE A 1 6   ? 10.057 24.802 61.234 1.00 6.54  ? 6   ILE A CB  1 
ATOM   44   C CG1 . ILE A 1 6   ? 11.550 25.091 61.376 1.00 9.43  ? 6   ILE A CG1 1 
ATOM   45   C CG2 . ILE A 1 6   ? 9.810  23.899 60.022 1.00 5.81  ? 6   ILE A CG2 1 
ATOM   46   C CD1 . ILE A 1 6   ? 12.354 23.883 61.822 1.00 9.65  ? 6   ILE A CD1 1 
ATOM   47   N N   . VAL A 1 7   ? 10.775 27.884 60.352 1.00 5.50  ? 7   VAL A N   1 
ATOM   48   C CA  . VAL A 1 7   ? 11.457 28.726 59.381 1.00 6.54  ? 7   VAL A CA  1 
ATOM   49   C C   . VAL A 1 7   ? 12.944 28.846 59.703 1.00 8.62  ? 7   VAL A C   1 
ATOM   50   O O   . VAL A 1 7   ? 13.337 28.924 60.882 1.00 7.68  ? 7   VAL A O   1 
ATOM   51   C CB  . VAL A 1 7   ? 10.829 30.147 59.315 1.00 8.52  ? 7   VAL A CB  1 
ATOM   52   C CG1 . VAL A 1 7   ? 10.849 30.815 60.701 1.00 8.70  ? 7   VAL A CG1 1 
ATOM   53   C CG2 . VAL A 1 7   ? 11.588 31.004 58.315 1.00 5.52  ? 7   VAL A CG2 1 
ATOM   54   N N   . LEU A 1 8   ? 13.759 28.810 58.647 1.00 6.47  ? 8   LEU A N   1 
ATOM   55   C CA  . LEU A 1 8   ? 15.205 28.959 58.761 1.00 7.01  ? 8   LEU A CA  1 
ATOM   56   C C   . LEU A 1 8   ? 15.663 30.105 57.845 1.00 5.93  ? 8   LEU A C   1 
ATOM   57   O O   . LEU A 1 8   ? 15.101 30.312 56.761 1.00 5.87  ? 8   LEU A O   1 
ATOM   58   C CB  . LEU A 1 8   ? 15.937 27.680 58.322 1.00 9.32  ? 8   LEU A CB  1 
ATOM   59   C CG  . LEU A 1 8   ? 16.209 26.540 59.314 1.00 13.81 ? 8   LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 8   ? 14.921 25.762 59.603 1.00 12.75 ? 8   LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 8   ? 17.267 25.617 58.719 1.00 14.01 ? 8   LEU A CD2 1 
ATOM   62   N N   . SER A 1 9   ? 16.655 30.867 58.299 1.00 6.89  ? 9   SER A N   1 
ATOM   63   C CA  . SER A 1 9   ? 17.221 31.930 57.480 1.00 7.71  ? 9   SER A CA  1 
ATOM   64   C C   . SER A 1 9   ? 18.695 32.078 57.831 1.00 8.43  ? 9   SER A C   1 
ATOM   65   O O   . SER A 1 9   ? 19.154 31.692 58.918 1.00 6.30  ? 9   SER A O   1 
ATOM   66   C CB  . SER A 1 9   ? 16.445 33.262 57.609 1.00 6.09  ? 9   SER A CB  1 
ATOM   67   O OG  . SER A 1 9   ? 16.373 33.744 58.928 1.00 8.48  ? 9   SER A OG  1 
ATOM   68   N N   . THR A 1 10  ? 19.442 32.618 56.883 1.00 8.98  ? 10  THR A N   1 
ATOM   69   C CA  . THR A 1 10  ? 20.887 32.749 57.020 1.00 9.83  ? 10  THR A CA  1 
ATOM   70   C C   . THR A 1 10  ? 21.409 33.931 57.839 1.00 8.96  ? 10  THR A C   1 
ATOM   71   O O   . THR A 1 10  ? 20.802 34.996 57.857 1.00 7.22  ? 10  THR A O   1 
ATOM   72   C CB  . THR A 1 10  ? 21.498 32.830 55.620 1.00 9.54  ? 10  THR A CB  1 
ATOM   73   O OG1 . THR A 1 10  ? 20.978 33.987 54.958 1.00 7.98  ? 10  THR A OG1 1 
ATOM   74   C CG2 . THR A 1 10  ? 21.122 31.583 54.803 1.00 9.83  ? 10  THR A CG2 1 
ATOM   75   N N   . TRP A 1 11  ? 22.553 33.711 58.492 1.00 11.50 ? 11  TRP A N   1 
ATOM   76   C CA  . TRP A 1 11  ? 23.271 34.708 59.293 1.00 10.70 ? 11  TRP A CA  1 
ATOM   77   C C   . TRP A 1 11  ? 22.552 35.286 60.520 1.00 12.97 ? 11  TRP A C   1 
ATOM   78   O O   . TRP A 1 11  ? 21.381 35.019 60.747 1.00 9.86  ? 11  TRP A O   1 
ATOM   79   C CB  . TRP A 1 11  ? 23.743 35.854 58.381 1.00 9.88  ? 11  TRP A CB  1 
ATOM   80   C CG  . TRP A 1 11  ? 24.533 35.405 57.165 1.00 9.51  ? 11  TRP A CG  1 
ATOM   81   C CD1 . TRP A 1 11  ? 24.086 35.335 55.869 1.00 11.65 ? 11  TRP A CD1 1 
ATOM   82   C CD2 . TRP A 1 11  ? 25.906 34.997 57.131 1.00 13.33 ? 11  TRP A CD2 1 
ATOM   83   N NE1 . TRP A 1 11  ? 25.099 34.917 55.036 1.00 11.78 ? 11  TRP A NE1 1 
ATOM   84   C CE2 . TRP A 1 11  ? 26.225 34.703 55.782 1.00 12.12 ? 11  TRP A CE2 1 
ATOM   85   C CE3 . TRP A 1 11  ? 26.900 34.855 58.106 1.00 14.30 ? 11  TRP A CE3 1 
ATOM   86   C CZ2 . TRP A 1 11  ? 27.499 34.275 55.385 1.00 14.31 ? 11  TRP A CZ2 1 
ATOM   87   C CZ3 . TRP A 1 11  ? 28.175 34.428 57.705 1.00 16.11 ? 11  TRP A CZ3 1 
ATOM   88   C CH2 . TRP A 1 11  ? 28.457 34.146 56.358 1.00 14.19 ? 11  TRP A CH2 1 
ATOM   89   N N   . ASN A 1 12  ? 23.274 36.091 61.308 1.00 12.25 ? 12  ASN A N   1 
ATOM   90   C CA  . ASN A 1 12  ? 22.732 36.706 62.526 1.00 13.81 ? 12  ASN A CA  1 
ATOM   91   C C   . ASN A 1 12  ? 21.434 37.465 62.318 1.00 13.78 ? 12  ASN A C   1 
ATOM   92   O O   . ASN A 1 12  ? 20.521 37.398 63.141 1.00 9.69  ? 12  ASN A O   1 
ATOM   93   C CB  . ASN A 1 12  ? 23.739 37.694 63.138 1.00 17.56 ? 12  ASN A CB  1 
ATOM   94   C CG  . ASN A 1 12  ? 24.842 37.011 63.916 1.00 23.34 ? 12  ASN A CG  1 
ATOM   95   O OD1 . ASN A 1 12  ? 25.757 37.665 64.420 1.00 27.73 ? 12  ASN A OD1 1 
ATOM   96   N ND2 . ASN A 1 12  ? 24.760 35.697 64.030 1.00 25.90 ? 12  ASN A ND2 1 
ATOM   97   N N   . PHE A 1 13  ? 21.356 38.220 61.231 1.00 11.08 ? 13  PHE A N   1 
ATOM   98   C CA  . PHE A 1 13  ? 20.152 38.987 61.005 1.00 12.25 ? 13  PHE A CA  1 
ATOM   99   C C   . PHE A 1 13  ? 18.955 38.116 60.677 1.00 10.50 ? 13  PHE A C   1 
ATOM   100  O O   . PHE A 1 13  ? 17.826 38.595 60.679 1.00 13.16 ? 13  PHE A O   1 
ATOM   101  C CB  . PHE A 1 13  ? 20.376 40.045 59.925 1.00 14.49 ? 13  PHE A CB  1 
ATOM   102  C CG  . PHE A 1 13  ? 20.968 39.512 58.656 1.00 19.29 ? 13  PHE A CG  1 
ATOM   103  C CD1 . PHE A 1 13  ? 22.115 40.092 58.120 1.00 20.63 ? 13  PHE A CD1 1 
ATOM   104  C CD2 . PHE A 1 13  ? 20.372 38.453 57.979 1.00 17.47 ? 13  PHE A CD2 1 
ATOM   105  C CE1 . PHE A 1 13  ? 22.658 39.625 56.925 1.00 24.24 ? 13  PHE A CE1 1 
ATOM   106  C CE2 . PHE A 1 13  ? 20.904 37.981 56.789 1.00 18.63 ? 13  PHE A CE2 1 
ATOM   107  C CZ  . PHE A 1 13  ? 22.047 38.564 56.257 1.00 22.35 ? 13  PHE A CZ  1 
ATOM   108  N N   . GLY A 1 14  ? 19.199 36.836 60.399 1.00 9.25  ? 14  GLY A N   1 
ATOM   109  C CA  . GLY A 1 14  ? 18.095 35.939 60.116 1.00 10.34 ? 14  GLY A CA  1 
ATOM   110  C C   . GLY A 1 14  ? 17.242 35.759 61.366 1.00 8.67  ? 14  GLY A C   1 
ATOM   111  O O   . GLY A 1 14  ? 16.063 35.416 61.285 1.00 6.55  ? 14  GLY A O   1 
ATOM   112  N N   . LEU A 1 15  ? 17.822 36.007 62.534 1.00 9.43  ? 15  LEU A N   1 
ATOM   113  C CA  . LEU A 1 15  ? 17.055 35.856 63.766 1.00 9.29  ? 15  LEU A CA  1 
ATOM   114  C C   . LEU A 1 15  ? 15.906 36.865 63.730 1.00 8.99  ? 15  LEU A C   1 
ATOM   115  O O   . LEU A 1 15  ? 14.754 36.510 63.998 1.00 7.58  ? 15  LEU A O   1 
ATOM   116  C CB  . LEU A 1 15  ? 17.944 36.100 65.008 1.00 11.21 ? 15  LEU A CB  1 
ATOM   117  C CG  . LEU A 1 15  ? 17.413 35.572 66.349 1.00 12.08 ? 15  LEU A CG  1 
ATOM   118  C CD1 . LEU A 1 15  ? 17.393 34.038 66.337 1.00 12.71 ? 15  LEU A CD1 1 
ATOM   119  C CD2 . LEU A 1 15  ? 18.316 36.076 67.493 1.00 15.37 ? 15  LEU A CD2 1 
ATOM   120  N N   . HIS A 1 16  ? 16.211 38.115 63.376 1.00 9.00  ? 16  HIS A N   1 
ATOM   121  C CA  . HIS A 1 16  ? 15.186 39.155 63.329 1.00 9.34  ? 16  HIS A CA  1 
ATOM   122  C C   . HIS A 1 16  ? 14.223 38.910 62.173 1.00 9.09  ? 16  HIS A C   1 
ATOM   123  O O   . HIS A 1 16  ? 13.037 39.192 62.270 1.00 8.06  ? 16  HIS A O   1 
ATOM   124  C CB  . HIS A 1 16  ? 15.808 40.548 63.175 1.00 14.15 ? 16  HIS A CB  1 
ATOM   125  C CG  . HIS A 1 16  ? 17.208 40.660 63.700 1.00 22.13 ? 16  HIS A CG  1 
ATOM   126  N ND1 . HIS A 1 16  ? 17.557 40.344 64.997 1.00 25.04 ? 16  HIS A ND1 1 
ATOM   127  C CD2 . HIS A 1 16  ? 18.347 41.067 63.094 1.00 23.93 ? 16  HIS A CD2 1 
ATOM   128  C CE1 . HIS A 1 16  ? 18.851 40.551 65.164 1.00 24.69 ? 16  HIS A CE1 1 
ATOM   129  N NE2 . HIS A 1 16  ? 19.354 40.990 64.024 1.00 27.95 ? 16  HIS A NE2 1 
ATOM   130  N N   . ALA A 1 17  ? 14.742 38.397 61.064 1.00 7.22  ? 17  ALA A N   1 
ATOM   131  C CA  . ALA A 1 17  ? 13.895 38.101 59.916 1.00 8.31  ? 17  ALA A CA  1 
ATOM   132  C C   . ALA A 1 17  ? 12.905 37.003 60.293 1.00 8.30  ? 17  ALA A C   1 
ATOM   133  O O   . ALA A 1 17  ? 11.737 37.061 59.902 1.00 7.58  ? 17  ALA A O   1 
ATOM   134  C CB  . ALA A 1 17  ? 14.747 37.664 58.726 1.00 7.54  ? 17  ALA A CB  1 
ATOM   135  N N   . ASN A 1 18  ? 13.363 36.018 61.064 1.00 7.20  ? 18  ASN A N   1 
ATOM   136  C CA  . ASN A 1 18  ? 12.498 34.921 61.508 1.00 8.53  ? 18  ASN A CA  1 
ATOM   137  C C   . ASN A 1 18  ? 11.315 35.417 62.341 1.00 9.26  ? 18  ASN A C   1 
ATOM   138  O O   . ASN A 1 18  ? 10.218 34.840 62.280 1.00 6.57  ? 18  ASN A O   1 
ATOM   139  C CB  . ASN A 1 18  ? 13.274 33.909 62.360 1.00 7.26  ? 18  ASN A CB  1 
ATOM   140  C CG  . ASN A 1 18  ? 14.062 32.909 61.537 1.00 10.67 ? 18  ASN A CG  1 
ATOM   141  O OD1 . ASN A 1 18  ? 14.103 32.960 60.293 1.00 7.76  ? 18  ASN A OD1 1 
ATOM   142  N ND2 . ASN A 1 18  ? 14.701 31.983 62.234 1.00 5.22  ? 18  ASN A ND2 1 
ATOM   143  N N   . VAL A 1 19  ? 11.534 36.458 63.144 1.00 7.67  ? 19  VAL A N   1 
ATOM   144  C CA  . VAL A 1 19  ? 10.452 36.978 63.974 1.00 9.38  ? 19  VAL A CA  1 
ATOM   145  C C   . VAL A 1 19  ? 9.305  37.483 63.089 1.00 9.99  ? 19  VAL A C   1 
ATOM   146  O O   . VAL A 1 19  ? 8.126  37.248 63.382 1.00 9.57  ? 19  VAL A O   1 
ATOM   147  C CB  . VAL A 1 19  ? 10.939 38.132 64.906 1.00 10.71 ? 19  VAL A CB  1 
ATOM   148  C CG1 . VAL A 1 19  ? 9.746  38.735 65.650 1.00 12.23 ? 19  VAL A CG1 1 
ATOM   149  C CG2 . VAL A 1 19  ? 11.959 37.592 65.928 1.00 8.58  ? 19  VAL A CG2 1 
ATOM   150  N N   . GLU A 1 20  ? 9.643  38.158 61.994 1.00 9.53  ? 20  GLU A N   1 
ATOM   151  C CA  . GLU A 1 20  ? 8.614  38.670 61.088 1.00 10.48 ? 20  GLU A CA  1 
ATOM   152  C C   . GLU A 1 20  ? 7.895  37.533 60.361 1.00 10.79 ? 20  GLU A C   1 
ATOM   153  O O   . GLU A 1 20  ? 6.675  37.573 60.167 1.00 9.65  ? 20  GLU A O   1 
ATOM   154  C CB  . GLU A 1 20  ? 9.233  39.638 60.076 1.00 12.65 ? 20  GLU A CB  1 
ATOM   155  C CG  . GLU A 1 20  ? 9.822  40.880 60.719 1.00 12.65 ? 20  GLU A CG  1 
ATOM   156  C CD  . GLU A 1 20  ? 8.842  41.540 61.678 1.00 18.90 ? 20  GLU A CD  1 
ATOM   157  O OE1 . GLU A 1 20  ? 7.677  41.746 61.274 1.00 15.55 ? 20  GLU A OE1 1 
ATOM   158  O OE2 . GLU A 1 20  ? 9.235  41.850 62.825 1.00 20.41 ? 20  GLU A OE2 1 
ATOM   159  N N   . ALA A 1 21  ? 8.655  36.522 59.949 1.00 6.90  ? 21  ALA A N   1 
ATOM   160  C CA  . ALA A 1 21  ? 8.075  35.372 59.275 1.00 7.87  ? 21  ALA A CA  1 
ATOM   161  C C   . ALA A 1 21  ? 7.167  34.621 60.249 1.00 9.37  ? 21  ALA A C   1 
ATOM   162  O O   . ALA A 1 21  ? 6.111  34.113 59.862 1.00 5.40  ? 21  ALA A O   1 
ATOM   163  C CB  . ALA A 1 21  ? 9.184  34.447 58.776 1.00 10.34 ? 21  ALA A CB  1 
ATOM   164  N N   . TRP A 1 22  ? 7.561  34.571 61.523 1.00 8.56  ? 22  TRP A N   1 
ATOM   165  C CA  . TRP A 1 22  ? 6.777  33.838 62.516 1.00 9.15  ? 22  TRP A CA  1 
ATOM   166  C C   . TRP A 1 22  ? 5.419  34.482 62.748 1.00 9.07  ? 22  TRP A C   1 
ATOM   167  O O   . TRP A 1 22  ? 4.456  33.792 63.079 1.00 7.41  ? 22  TRP A O   1 
ATOM   168  C CB  . TRP A 1 22  ? 7.546  33.713 63.844 1.00 8.04  ? 22  TRP A CB  1 
ATOM   169  C CG  . TRP A 1 22  ? 6.990  32.626 64.767 1.00 5.68  ? 22  TRP A CG  1 
ATOM   170  C CD1 . TRP A 1 22  ? 6.338  32.806 65.967 1.00 8.46  ? 22  TRP A CD1 1 
ATOM   171  C CD2 . TRP A 1 22  ? 7.013  31.210 64.538 1.00 8.34  ? 22  TRP A CD2 1 
ATOM   172  N NE1 . TRP A 1 22  ? 5.955  31.590 66.488 1.00 4.63  ? 22  TRP A NE1 1 
ATOM   173  C CE2 . TRP A 1 22  ? 6.353  30.594 65.632 1.00 7.04  ? 22  TRP A CE2 1 
ATOM   174  C CE3 . TRP A 1 22  ? 7.521  30.400 63.514 1.00 7.11  ? 22  TRP A CE3 1 
ATOM   175  C CZ2 . TRP A 1 22  ? 6.196  29.210 65.727 1.00 9.82  ? 22  TRP A CZ2 1 
ATOM   176  C CZ3 . TRP A 1 22  ? 7.361  29.013 63.606 1.00 8.65  ? 22  TRP A CZ3 1 
ATOM   177  C CH2 . TRP A 1 22  ? 6.700  28.435 64.706 1.00 11.70 ? 22  TRP A CH2 1 
ATOM   178  N N   . LYS A 1 23  ? 5.336  35.798 62.565 1.00 10.42 ? 23  LYS A N   1 
ATOM   179  C CA  . LYS A 1 23  ? 4.066  36.502 62.738 1.00 11.44 ? 23  LYS A CA  1 
ATOM   180  C C   . LYS A 1 23  ? 3.025  35.908 61.778 1.00 11.01 ? 23  LYS A C   1 
ATOM   181  O O   . LYS A 1 23  ? 1.833  35.845 62.089 1.00 10.55 ? 23  LYS A O   1 
ATOM   182  C CB  . LYS A 1 23  ? 4.245  38.000 62.466 1.00 11.52 ? 23  LYS A CB  1 
ATOM   183  C CG  . LYS A 1 23  ? 4.956  38.759 63.585 1.00 14.76 ? 23  LYS A CG  1 
ATOM   184  C CD  . LYS A 1 23  ? 5.237  40.196 63.182 1.00 14.38 ? 23  LYS A CD  1 
ATOM   185  C CE  . LYS A 1 23  ? 5.942  40.965 64.297 1.00 18.60 ? 23  LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 23  ? 6.328  42.345 63.851 1.00 18.33 ? 23  LYS A NZ  1 
ATOM   187  N N   . VAL A 1 24  ? 3.480  35.488 60.604 1.00 9.96  ? 24  VAL A N   1 
ATOM   188  C CA  . VAL A 1 24  ? 2.592  34.878 59.609 1.00 6.93  ? 24  VAL A CA  1 
ATOM   189  C C   . VAL A 1 24  ? 2.425  33.385 59.932 1.00 7.73  ? 24  VAL A C   1 
ATOM   190  O O   . VAL A 1 24  ? 1.313  32.904 60.120 1.00 8.62  ? 24  VAL A O   1 
ATOM   191  C CB  . VAL A 1 24  ? 3.174  35.031 58.174 1.00 9.03  ? 24  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 24  ? 2.312  34.277 57.158 1.00 8.74  ? 24  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 24  ? 3.224  36.487 57.794 1.00 9.26  ? 24  VAL A CG2 1 
ATOM   194  N N   . LEU A 1 25  ? 3.535  32.656 60.033 1.00 9.23  ? 25  LEU A N   1 
ATOM   195  C CA  . LEU A 1 25  ? 3.473  31.225 60.310 1.00 8.38  ? 25  LEU A CA  1 
ATOM   196  C C   . LEU A 1 25  ? 2.694  30.823 61.568 1.00 9.98  ? 25  LEU A C   1 
ATOM   197  O O   . LEU A 1 25  ? 1.899  29.887 61.524 1.00 8.47  ? 25  LEU A O   1 
ATOM   198  C CB  . LEU A 1 25  ? 4.881  30.647 60.405 1.00 8.43  ? 25  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 25  ? 5.721  30.777 59.132 1.00 7.83  ? 25  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 25  ? 7.115  30.274 59.411 1.00 5.47  ? 25  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 25  ? 5.061  29.998 57.972 1.00 8.75  ? 25  LEU A CD2 1 
ATOM   202  N N   . SER A 1 26  ? 2.920  31.519 62.681 1.00 11.13 ? 26  SER A N   1 
ATOM   203  C CA  . SER A 1 26  ? 2.238  31.172 63.935 1.00 13.07 ? 26  SER A CA  1 
ATOM   204  C C   . SER A 1 26  ? 0.729  31.377 63.867 1.00 14.74 ? 26  SER A C   1 
ATOM   205  O O   . SER A 1 26  ? -0.005 30.858 64.705 1.00 15.11 ? 26  SER A O   1 
ATOM   206  C CB  . SER A 1 26  ? 2.815  31.983 65.100 1.00 9.27  ? 26  SER A CB  1 
ATOM   207  O OG  . SER A 1 26  ? 2.468  33.356 65.000 1.00 6.22  ? 26  SER A OG  1 
ATOM   208  N N   . LYS A 1 27  ? 0.261  32.125 62.875 1.00 14.21 ? 27  LYS A N   1 
ATOM   209  C CA  . LYS A 1 27  ? -1.174 32.360 62.731 1.00 17.04 ? 27  LYS A CA  1 
ATOM   210  C C   . LYS A 1 27  ? -1.781 31.469 61.656 1.00 17.59 ? 27  LYS A C   1 
ATOM   211  O O   . LYS A 1 27  ? -2.931 31.657 61.268 1.00 16.24 ? 27  LYS A O   1 
ATOM   212  C CB  . LYS A 1 27  ? -1.455 33.832 62.396 1.00 19.53 ? 27  LYS A CB  1 
ATOM   213  C CG  . LYS A 1 27  ? -0.898 34.815 63.415 1.00 19.81 ? 27  LYS A CG  1 
ATOM   214  C CD  . LYS A 1 27  ? -1.292 34.433 64.831 1.00 28.09 ? 27  LYS A CD  1 
ATOM   215  C CE  . LYS A 1 27  ? -0.645 35.363 65.856 1.00 30.35 ? 27  LYS A CE  1 
ATOM   216  N NZ  . LYS A 1 27  ? -1.023 36.782 65.620 1.00 31.86 ? 27  LYS A NZ  1 
ATOM   217  N N   . GLY A 1 28  ? -1.000 30.500 61.183 1.00 13.58 ? 28  GLY A N   1 
ATOM   218  C CA  . GLY A 1 28  ? -1.474 29.596 60.148 1.00 14.18 ? 28  GLY A CA  1 
ATOM   219  C C   . GLY A 1 28  ? -1.350 30.141 58.737 1.00 13.65 ? 28  GLY A C   1 
ATOM   220  O O   . GLY A 1 28  ? -1.896 29.558 57.780 1.00 11.91 ? 28  GLY A O   1 
ATOM   221  N N   . GLY A 1 29  ? -0.632 31.251 58.602 1.00 10.28 ? 29  GLY A N   1 
ATOM   222  C CA  . GLY A 1 29  ? -0.436 31.875 57.302 1.00 11.68 ? 29  GLY A CA  1 
ATOM   223  C C   . GLY A 1 29  ? 0.395  31.043 56.345 1.00 10.99 ? 29  GLY A C   1 
ATOM   224  O O   . GLY A 1 29  ? 1.054  30.079 56.754 1.00 10.80 ? 29  GLY A O   1 
ATOM   225  N N   . LYS A 1 30  ? 0.380  31.419 55.063 1.00 10.24 ? 30  LYS A N   1 
ATOM   226  C CA  . LYS A 1 30  ? 1.121  30.679 54.040 1.00 10.19 ? 30  LYS A CA  1 
ATOM   227  C C   . LYS A 1 30  ? 2.616  30.913 54.124 1.00 7.71  ? 30  LYS A C   1 
ATOM   228  O O   . LYS A 1 30  ? 3.057  32.030 54.401 1.00 6.73  ? 30  LYS A O   1 
ATOM   229  C CB  . LYS A 1 30  ? 0.650  31.087 52.646 1.00 13.20 ? 30  LYS A CB  1 
ATOM   230  C CG  . LYS A 1 30  ? -0.843 30.903 52.424 1.00 14.20 ? 30  LYS A CG  1 
ATOM   231  C CD  . LYS A 1 30  ? -1.207 31.144 50.966 1.00 18.75 ? 30  LYS A CD  1 
ATOM   232  C CE  . LYS A 1 30  ? -1.072 32.595 50.572 1.00 21.15 ? 30  LYS A CE  1 
ATOM   233  N NZ  . LYS A 1 30  ? -1.365 32.764 49.113 1.00 18.71 ? 30  LYS A NZ  1 
ATOM   234  N N   . ALA A 1 31  ? 3.391  29.863 53.868 1.00 7.25  ? 31  ALA A N   1 
ATOM   235  C CA  . ALA A 1 31  ? 4.841  29.978 53.901 1.00 5.72  ? 31  ALA A CA  1 
ATOM   236  C C   . ALA A 1 31  ? 5.326  31.024 52.890 1.00 4.55  ? 31  ALA A C   1 
ATOM   237  O O   . ALA A 1 31  ? 6.303  31.725 53.145 1.00 4.89  ? 31  ALA A O   1 
ATOM   238  C CB  . ALA A 1 31  ? 5.482  28.625 53.610 1.00 6.40  ? 31  ALA A CB  1 
ATOM   239  N N   . LEU A 1 32  ? 4.643  31.138 51.751 1.00 2.00  ? 32  LEU A N   1 
ATOM   240  C CA  . LEU A 1 32  ? 5.051  32.127 50.741 1.00 4.09  ? 32  LEU A CA  1 
ATOM   241  C C   . LEU A 1 32  ? 5.013  33.537 51.330 1.00 3.77  ? 32  LEU A C   1 
ATOM   242  O O   . LEU A 1 32  ? 5.945  34.328 51.167 1.00 4.66  ? 32  LEU A O   1 
ATOM   243  C CB  . LEU A 1 32  ? 4.122  32.058 49.514 1.00 4.05  ? 32  LEU A CB  1 
ATOM   244  C CG  . LEU A 1 32  ? 4.373  33.075 48.389 1.00 6.07  ? 32  LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 32  ? 5.750  32.861 47.808 1.00 8.08  ? 32  LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 32  ? 3.314  32.913 47.294 1.00 6.73  ? 32  LEU A CD2 1 
ATOM   247  N N   . ASP A 1 33  ? 3.929  33.861 52.022 1.00 6.36  ? 33  ASP A N   1 
ATOM   248  C CA  . ASP A 1 33  ? 3.798  35.177 52.627 1.00 7.28  ? 33  ASP A CA  1 
ATOM   249  C C   . ASP A 1 33  ? 4.830  35.387 53.736 1.00 7.23  ? 33  ASP A C   1 
ATOM   250  O O   . ASP A 1 33  ? 5.394  36.476 53.863 1.00 6.93  ? 33  ASP A O   1 
ATOM   251  C CB  . ASP A 1 33  ? 2.395  35.365 53.204 1.00 10.05 ? 33  ASP A CB  1 
ATOM   252  C CG  . ASP A 1 33  ? 1.335  35.510 52.131 1.00 12.94 ? 33  ASP A CG  1 
ATOM   253  O OD1 . ASP A 1 33  ? 1.548  36.288 51.190 1.00 14.47 ? 33  ASP A OD1 1 
ATOM   254  O OD2 . ASP A 1 33  ? 0.281  34.856 52.240 1.00 13.85 ? 33  ASP A OD2 1 
ATOM   255  N N   . ALA A 1 34  ? 5.070  34.342 54.529 1.00 7.17  ? 34  ALA A N   1 
ATOM   256  C CA  . ALA A 1 34  ? 6.028  34.412 55.628 1.00 8.00  ? 34  ALA A CA  1 
ATOM   257  C C   . ALA A 1 34  ? 7.452  34.707 55.163 1.00 6.62  ? 34  ALA A C   1 
ATOM   258  O O   . ALA A 1 34  ? 8.122  35.559 55.741 1.00 7.52  ? 34  ALA A O   1 
ATOM   259  C CB  . ALA A 1 34  ? 5.999  33.109 56.437 1.00 7.02  ? 34  ALA A CB  1 
ATOM   260  N N   . VAL A 1 35  ? 7.919  34.022 54.119 1.00 5.44  ? 35  VAL A N   1 
ATOM   261  C CA  . VAL A 1 35  ? 9.278  34.261 53.660 1.00 6.24  ? 35  VAL A CA  1 
ATOM   262  C C   . VAL A 1 35  ? 9.426  35.619 52.991 1.00 8.29  ? 35  VAL A C   1 
ATOM   263  O O   . VAL A 1 35  ? 10.472 36.233 53.100 1.00 7.48  ? 35  VAL A O   1 
ATOM   264  C CB  . VAL A 1 35  ? 9.802  33.126 52.731 1.00 9.54  ? 35  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 35  ? 9.835  31.822 53.507 1.00 3.82  ? 35  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 35  ? 8.943  32.991 51.467 1.00 6.20  ? 35  VAL A CG2 1 
ATOM   267  N N   . GLU A 1 36  ? 8.382  36.102 52.318 1.00 6.40  ? 36  GLU A N   1 
ATOM   268  C CA  . GLU A 1 36  ? 8.469  37.416 51.687 1.00 8.70  ? 36  GLU A CA  1 
ATOM   269  C C   . GLU A 1 36  ? 8.576  38.468 52.793 1.00 8.20  ? 36  GLU A C   1 
ATOM   270  O O   . GLU A 1 36  ? 9.448  39.330 52.769 1.00 6.94  ? 36  GLU A O   1 
ATOM   271  C CB  . GLU A 1 36  ? 7.226  37.709 50.829 1.00 7.29  ? 36  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 36  ? 7.209  39.141 50.297 1.00 8.80  ? 36  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 36  ? 5.966  39.487 49.482 1.00 10.25 ? 36  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 36  ? 4.897  38.884 49.720 1.00 8.94  ? 36  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 36  ? 6.056  40.379 48.608 1.00 12.69 ? 36  GLU A OE2 1 
ATOM   276  N N   . LYS A 1 37  ? 7.675  38.380 53.767 1.00 8.18  ? 37  LYS A N   1 
ATOM   277  C CA  . LYS A 1 37  ? 7.652  39.320 54.884 1.00 9.60  ? 37  LYS A CA  1 
ATOM   278  C C   . LYS A 1 37  ? 8.971  39.278 55.654 1.00 8.40  ? 37  LYS A C   1 
ATOM   279  O O   . LYS A 1 37  ? 9.492  40.313 56.074 1.00 8.52  ? 37  LYS A O   1 
ATOM   280  C CB  . LYS A 1 37  ? 6.481  38.968 55.812 1.00 12.66 ? 37  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 37  ? 6.368  39.800 57.084 1.00 16.74 ? 37  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 37  ? 5.217  39.273 57.951 1.00 21.37 ? 37  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 37  ? 5.060  40.025 59.255 1.00 20.46 ? 37  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 37  ? 4.637  41.450 59.027 1.00 26.77 ? 37  LYS A NZ  1 
ATOM   285  N N   . GLY A 1 38  ? 9.515  38.077 55.829 1.00 7.05  ? 38  GLY A N   1 
ATOM   286  C CA  . GLY A 1 38  ? 10.759 37.930 56.568 1.00 7.15  ? 38  GLY A CA  1 
ATOM   287  C C   . GLY A 1 38  ? 11.966 38.616 55.949 1.00 8.60  ? 38  GLY A C   1 
ATOM   288  O O   . GLY A 1 38  ? 12.693 39.349 56.635 1.00 6.55  ? 38  GLY A O   1 
ATOM   289  N N   . VAL A 1 39  ? 12.202 38.383 54.661 1.00 6.79  ? 39  VAL A N   1 
ATOM   290  C CA  . VAL A 1 39  ? 13.354 38.983 54.027 1.00 6.02  ? 39  VAL A CA  1 
ATOM   291  C C   . VAL A 1 39  ? 13.141 40.463 53.726 1.00 7.68  ? 39  VAL A C   1 
ATOM   292  O O   . VAL A 1 39  ? 14.111 41.214 53.630 1.00 8.04  ? 39  VAL A O   1 
ATOM   293  C CB  . VAL A 1 39  ? 13.769 38.221 52.750 1.00 6.61  ? 39  VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 39  ? 14.051 36.753 53.100 1.00 7.57  ? 39  VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 39  ? 12.693 38.342 51.667 1.00 5.22  ? 39  VAL A CG2 1 
ATOM   296  N N   . ARG A 1 40  ? 11.886 40.894 53.599 1.00 8.62  ? 40  ARG A N   1 
ATOM   297  C CA  . ARG A 1 40  ? 11.630 42.307 53.342 1.00 10.04 ? 40  ARG A CA  1 
ATOM   298  C C   . ARG A 1 40  ? 12.180 43.130 54.512 1.00 11.77 ? 40  ARG A C   1 
ATOM   299  O O   . ARG A 1 40  ? 12.616 44.260 54.328 1.00 11.01 ? 40  ARG A O   1 
ATOM   300  C CB  . ARG A 1 40  ? 10.128 42.585 53.177 1.00 11.74 ? 40  ARG A CB  1 
ATOM   301  C CG  . ARG A 1 40  ? 9.575  42.307 51.779 1.00 9.20  ? 40  ARG A CG  1 
ATOM   302  C CD  . ARG A 1 40  ? 8.082  42.672 51.672 1.00 11.49 ? 40  ARG A CD  1 
ATOM   303  N NE  . ARG A 1 40  ? 7.821  44.074 52.015 1.00 13.12 ? 40  ARG A NE  1 
ATOM   304  C CZ  . ARG A 1 40  ? 7.524  45.034 51.138 1.00 14.44 ? 40  ARG A CZ  1 
ATOM   305  N NH1 . ARG A 1 40  ? 7.445  44.764 49.839 1.00 12.90 ? 40  ARG A NH1 1 
ATOM   306  N NH2 . ARG A 1 40  ? 7.289  46.271 51.564 1.00 11.58 ? 40  ARG A NH2 1 
ATOM   307  N N   . LEU A 1 41  ? 12.162 42.561 55.714 1.00 9.39  ? 41  LEU A N   1 
ATOM   308  C CA  . LEU A 1 41  ? 12.673 43.274 56.883 1.00 10.49 ? 41  LEU A CA  1 
ATOM   309  C C   . LEU A 1 41  ? 14.120 43.710 56.672 1.00 11.67 ? 41  LEU A C   1 
ATOM   310  O O   . LEU A 1 41  ? 14.488 44.841 56.989 1.00 12.81 ? 41  LEU A O   1 
ATOM   311  C CB  . LEU A 1 41  ? 12.599 42.396 58.140 1.00 11.56 ? 41  LEU A CB  1 
ATOM   312  C CG  . LEU A 1 41  ? 13.134 43.076 59.410 1.00 13.87 ? 41  LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 41  ? 12.083 44.033 59.953 1.00 13.84 ? 41  LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 41  ? 13.485 42.033 60.462 1.00 12.96 ? 41  LEU A CD2 1 
ATOM   315  N N   . VAL A 1 42  ? 14.929 42.803 56.128 1.00 11.01 ? 42  VAL A N   1 
ATOM   316  C CA  . VAL A 1 42  ? 16.344 43.050 55.875 1.00 9.46  ? 42  VAL A CA  1 
ATOM   317  C C   . VAL A 1 42  ? 16.556 43.982 54.678 1.00 10.31 ? 42  VAL A C   1 
ATOM   318  O O   . VAL A 1 42  ? 17.484 44.810 54.676 1.00 10.98 ? 42  VAL A O   1 
ATOM   319  C CB  . VAL A 1 42  ? 17.068 41.696 55.668 1.00 12.87 ? 42  VAL A CB  1 
ATOM   320  C CG1 . VAL A 1 42  ? 18.561 41.898 55.483 1.00 12.13 ? 42  VAL A CG1 1 
ATOM   321  C CG2 . VAL A 1 42  ? 16.800 40.795 56.895 1.00 9.29  ? 42  VAL A CG2 1 
ATOM   322  N N   . GLU A 1 43  ? 15.702 43.856 53.663 1.00 7.83  ? 43  GLU A N   1 
ATOM   323  C CA  . GLU A 1 43  ? 15.787 44.735 52.497 1.00 7.58  ? 43  GLU A CA  1 
ATOM   324  C C   . GLU A 1 43  ? 15.541 46.181 52.931 1.00 9.66  ? 43  GLU A C   1 
ATOM   325  O O   . GLU A 1 43  ? 16.174 47.105 52.424 1.00 10.82 ? 43  GLU A O   1 
ATOM   326  C CB  . GLU A 1 43  ? 14.729 44.359 51.449 1.00 6.43  ? 43  GLU A CB  1 
ATOM   327  C CG  . GLU A 1 43  ? 14.930 42.977 50.818 1.00 4.77  ? 43  GLU A CG  1 
ATOM   328  C CD  . GLU A 1 43  ? 13.840 42.656 49.803 1.00 10.05 ? 43  GLU A CD  1 
ATOM   329  O OE1 . GLU A 1 43  ? 12.691 43.121 50.000 1.00 8.88  ? 43  GLU A OE1 1 
ATOM   330  O OE2 . GLU A 1 43  ? 14.136 41.940 48.823 1.00 7.40  ? 43  GLU A OE2 1 
ATOM   331  N N   . ASP A 1 44  ? 14.608 46.361 53.865 1.00 10.04 ? 44  ASP A N   1 
ATOM   332  C CA  . ASP A 1 44  ? 14.237 47.687 54.368 1.00 12.55 ? 44  ASP A CA  1 
ATOM   333  C C   . ASP A 1 44  ? 15.288 48.340 55.247 1.00 14.09 ? 44  ASP A C   1 
ATOM   334  O O   . ASP A 1 44  ? 15.361 49.568 55.334 1.00 10.42 ? 44  ASP A O   1 
ATOM   335  C CB  . ASP A 1 44  ? 12.943 47.615 55.197 1.00 9.68  ? 44  ASP A CB  1 
ATOM   336  C CG  . ASP A 1 44  ? 11.707 47.464 54.349 1.00 12.82 ? 44  ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 44  ? 11.805 47.586 53.113 1.00 11.94 ? 44  ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 44  ? 10.625 47.230 54.924 1.00 12.05 ? 44  ASP A OD2 1 
ATOM   339  N N   . ASP A 1 45  ? 16.092 47.508 55.898 1.00 13.35 ? 45  ASP A N   1 
ATOM   340  C CA  . ASP A 1 45  ? 17.112 47.974 56.833 1.00 15.52 ? 45  ASP A CA  1 
ATOM   341  C C   . ASP A 1 45  ? 18.392 48.507 56.191 1.00 14.16 ? 45  ASP A C   1 
ATOM   342  O O   . ASP A 1 45  ? 19.196 47.743 55.658 1.00 11.81 ? 45  ASP A O   1 
ATOM   343  C CB  . ASP A 1 45  ? 17.475 46.835 57.798 1.00 13.92 ? 45  ASP A CB  1 
ATOM   344  C CG  . ASP A 1 45  ? 18.184 47.327 59.048 1.00 18.03 ? 45  ASP A CG  1 
ATOM   345  O OD1 . ASP A 1 45  ? 18.809 48.405 59.006 1.00 14.00 ? 45  ASP A OD1 1 
ATOM   346  O OD2 . ASP A 1 45  ? 18.125 46.617 60.069 1.00 16.75 ? 45  ASP A OD2 1 
ATOM   347  N N   . PRO A 1 46  ? 18.603 49.829 56.262 1.00 15.11 ? 46  PRO A N   1 
ATOM   348  C CA  . PRO A 1 46  ? 19.782 50.511 55.704 1.00 15.81 ? 46  PRO A CA  1 
ATOM   349  C C   . PRO A 1 46  ? 21.098 50.018 56.318 1.00 14.35 ? 46  PRO A C   1 
ATOM   350  O O   . PRO A 1 46  ? 22.156 50.117 55.688 1.00 12.59 ? 46  PRO A O   1 
ATOM   351  C CB  . PRO A 1 46  ? 19.544 51.983 56.056 1.00 17.07 ? 46  PRO A CB  1 
ATOM   352  C CG  . PRO A 1 46  ? 18.070 52.077 56.255 1.00 21.84 ? 46  PRO A CG  1 
ATOM   353  C CD  . PRO A 1 46  ? 17.684 50.787 56.900 1.00 16.98 ? 46  PRO A CD  1 
ATOM   354  N N   . THR A 1 47  ? 21.035 49.505 57.547 1.00 13.38 ? 47  THR A N   1 
ATOM   355  C CA  . THR A 1 47  ? 22.237 49.027 58.223 1.00 12.95 ? 47  THR A CA  1 
ATOM   356  C C   . THR A 1 47  ? 22.694 47.647 57.761 1.00 15.83 ? 47  THR A C   1 
ATOM   357  O O   . THR A 1 47  ? 23.809 47.232 58.073 1.00 16.73 ? 47  THR A O   1 
ATOM   358  C CB  . THR A 1 47  ? 22.065 49.005 59.761 1.00 16.48 ? 47  THR A CB  1 
ATOM   359  O OG1 . THR A 1 47  ? 21.093 48.021 60.130 1.00 17.10 ? 47  THR A OG1 1 
ATOM   360  C CG2 . THR A 1 47  ? 21.620 50.374 60.259 1.00 14.96 ? 47  THR A CG2 1 
ATOM   361  N N   . GLU A 1 48  ? 21.830 46.924 57.049 1.00 15.60 ? 48  GLU A N   1 
ATOM   362  C CA  . GLU A 1 48  ? 22.219 45.623 56.514 1.00 15.36 ? 48  GLU A CA  1 
ATOM   363  C C   . GLU A 1 48  ? 22.705 45.984 55.121 1.00 12.41 ? 48  GLU A C   1 
ATOM   364  O O   . GLU A 1 48  ? 21.917 46.182 54.201 1.00 13.73 ? 48  GLU A O   1 
ATOM   365  C CB  . GLU A 1 48  ? 21.034 44.656 56.465 1.00 13.42 ? 48  GLU A CB  1 
ATOM   366  C CG  . GLU A 1 48  ? 20.707 44.055 57.830 1.00 18.95 ? 48  GLU A CG  1 
ATOM   367  C CD  . GLU A 1 48  ? 21.926 43.455 58.521 1.00 20.81 ? 48  GLU A CD  1 
ATOM   368  O OE1 . GLU A 1 48  ? 21.885 43.299 59.756 1.00 23.01 ? 48  GLU A OE1 1 
ATOM   369  O OE2 . GLU A 1 48  ? 22.924 43.135 57.837 1.00 24.82 ? 48  GLU A OE2 1 
ATOM   370  N N   . ARG A 1 49  ? 24.022 46.064 55.007 1.00 12.42 ? 49  ARG A N   1 
ATOM   371  C CA  . ARG A 1 49  ? 24.730 46.492 53.811 1.00 13.21 ? 49  ARG A CA  1 
ATOM   372  C C   . ARG A 1 49  ? 24.842 45.555 52.612 1.00 11.79 ? 49  ARG A C   1 
ATOM   373  O O   . ARG A 1 49  ? 25.478 45.920 51.628 1.00 13.25 ? 49  ARG A O   1 
ATOM   374  C CB  . ARG A 1 49  ? 26.133 46.933 54.238 1.00 14.83 ? 49  ARG A CB  1 
ATOM   375  C CG  . ARG A 1 49  ? 26.125 47.790 55.503 1.00 18.19 ? 49  ARG A CG  1 
ATOM   376  C CD  . ARG A 1 49  ? 25.437 49.130 55.259 1.00 17.71 ? 49  ARG A CD  1 
ATOM   377  N NE  . ARG A 1 49  ? 26.080 49.841 54.156 1.00 18.29 ? 49  ARG A NE  1 
ATOM   378  C CZ  . ARG A 1 49  ? 27.360 50.209 54.139 1.00 16.60 ? 49  ARG A CZ  1 
ATOM   379  N NH1 . ARG A 1 49  ? 28.152 49.943 55.170 1.00 19.61 ? 49  ARG A NH1 1 
ATOM   380  N NH2 . ARG A 1 49  ? 27.856 50.830 53.079 1.00 14.82 ? 49  ARG A NH2 1 
ATOM   381  N N   . SER A 1 50  ? 24.243 44.367 52.672 1.00 13.06 ? 50  SER A N   1 
ATOM   382  C CA  . SER A 1 50  ? 24.333 43.438 51.537 1.00 12.30 ? 50  SER A CA  1 
ATOM   383  C C   . SER A 1 50  ? 22.974 42.981 51.024 1.00 12.85 ? 50  SER A C   1 
ATOM   384  O O   . SER A 1 50  ? 22.887 42.053 50.211 1.00 9.43  ? 50  SER A O   1 
ATOM   385  C CB  . SER A 1 50  ? 25.181 42.212 51.909 1.00 15.22 ? 50  SER A CB  1 
ATOM   386  O OG  . SER A 1 50  ? 26.557 42.554 52.050 1.00 13.96 ? 50  SER A OG  1 
ATOM   387  N N   . VAL A 1 51  ? 21.922 43.650 51.491 1.00 11.75 ? 51  VAL A N   1 
ATOM   388  C CA  . VAL A 1 51  ? 20.557 43.341 51.090 1.00 9.35  ? 51  VAL A CA  1 
ATOM   389  C C   . VAL A 1 51  ? 19.766 44.640 50.932 1.00 11.07 ? 51  VAL A C   1 
ATOM   390  O O   . VAL A 1 51  ? 19.753 45.477 51.834 1.00 9.46  ? 51  VAL A O   1 
ATOM   391  C CB  . VAL A 1 51  ? 19.848 42.459 52.151 1.00 9.85  ? 51  VAL A CB  1 
ATOM   392  C CG1 . VAL A 1 51  ? 18.450 42.070 51.665 1.00 10.13 ? 51  VAL A CG1 1 
ATOM   393  C CG2 . VAL A 1 51  ? 20.680 41.190 52.432 1.00 9.79  ? 51  VAL A CG2 1 
ATOM   394  N N   . GLY A 1 52  ? 19.129 44.802 49.776 1.00 10.79 ? 52  GLY A N   1 
ATOM   395  C CA  . GLY A 1 52  ? 18.314 45.979 49.502 1.00 11.83 ? 52  GLY A CA  1 
ATOM   396  C C   . GLY A 1 52  ? 18.856 47.369 49.822 1.00 10.30 ? 52  GLY A C   1 
ATOM   397  O O   . GLY A 1 52  ? 19.967 47.722 49.455 1.00 10.25 ? 52  GLY A O   1 
ATOM   398  N N   . TYR A 1 53  ? 18.034 48.166 50.496 1.00 10.82 ? 53  TYR A N   1 
ATOM   399  C CA  . TYR A 1 53  ? 18.388 49.538 50.863 1.00 11.52 ? 53  TYR A CA  1 
ATOM   400  C C   . TYR A 1 53  ? 19.652 49.560 51.722 1.00 12.67 ? 53  TYR A C   1 
ATOM   401  O O   . TYR A 1 53  ? 19.793 48.777 52.664 1.00 10.02 ? 53  TYR A O   1 
ATOM   402  C CB  . TYR A 1 53  ? 17.197 50.170 51.593 1.00 14.31 ? 53  TYR A CB  1 
ATOM   403  C CG  . TYR A 1 53  ? 17.365 51.615 52.003 1.00 14.78 ? 53  TYR A CG  1 
ATOM   404  C CD1 . TYR A 1 53  ? 17.988 52.542 51.163 1.00 16.15 ? 53  TYR A CD1 1 
ATOM   405  C CD2 . TYR A 1 53  ? 16.866 52.064 53.226 1.00 15.66 ? 53  TYR A CD2 1 
ATOM   406  C CE1 . TYR A 1 53  ? 18.112 53.892 51.539 1.00 16.39 ? 53  TYR A CE1 1 
ATOM   407  C CE2 . TYR A 1 53  ? 16.983 53.406 53.610 1.00 18.23 ? 53  TYR A CE2 1 
ATOM   408  C CZ  . TYR A 1 53  ? 17.607 54.310 52.763 1.00 18.23 ? 53  TYR A CZ  1 
ATOM   409  O OH  . TYR A 1 53  ? 17.725 55.627 53.150 1.00 20.72 ? 53  TYR A OH  1 
ATOM   410  N N   . GLY A 1 54  ? 20.578 50.449 51.377 1.00 12.99 ? 54  GLY A N   1 
ATOM   411  C CA  . GLY A 1 54  ? 21.832 50.538 52.107 1.00 10.48 ? 54  GLY A CA  1 
ATOM   412  C C   . GLY A 1 54  ? 22.861 49.544 51.575 1.00 10.36 ? 54  GLY A C   1 
ATOM   413  O O   . GLY A 1 54  ? 23.977 49.456 52.085 1.00 11.12 ? 54  GLY A O   1 
ATOM   414  N N   . GLY A 1 55  ? 22.498 48.789 50.544 1.00 11.37 ? 55  GLY A N   1 
ATOM   415  C CA  . GLY A 1 55  ? 23.429 47.808 49.997 1.00 12.38 ? 55  GLY A CA  1 
ATOM   416  C C   . GLY A 1 55  ? 24.620 48.445 49.293 1.00 11.55 ? 55  GLY A C   1 
ATOM   417  O O   . GLY A 1 55  ? 24.481 49.468 48.629 1.00 11.61 ? 55  GLY A O   1 
ATOM   418  N N   . ARG A 1 56  ? 25.799 47.855 49.437 1.00 11.23 ? 56  ARG A N   1 
ATOM   419  C CA  . ARG A 1 56  ? 26.983 48.408 48.775 1.00 9.18  ? 56  ARG A CA  1 
ATOM   420  C C   . ARG A 1 56  ? 26.803 48.323 47.256 1.00 9.27  ? 56  ARG A C   1 
ATOM   421  O O   . ARG A 1 56  ? 26.359 47.291 46.718 1.00 10.44 ? 56  ARG A O   1 
ATOM   422  C CB  . ARG A 1 56  ? 28.235 47.664 49.251 1.00 12.90 ? 56  ARG A CB  1 
ATOM   423  C CG  . ARG A 1 56  ? 28.424 47.757 50.778 1.00 15.54 ? 56  ARG A CG  1 
ATOM   424  C CD  . ARG A 1 56  ? 29.862 47.434 51.205 1.00 17.53 ? 56  ARG A CD  1 
ATOM   425  N NE  . ARG A 1 56  ? 30.025 47.365 52.660 1.00 15.65 ? 56  ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 56  ? 29.607 46.352 53.412 1.00 17.61 ? 56  ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 56  ? 28.994 45.318 52.856 1.00 15.26 ? 56  ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 56  ? 29.828 46.356 54.718 1.00 17.62 ? 56  ARG A NH2 1 
ATOM   429  N N   . PRO A 1 57  ? 27.118 49.415 46.534 1.00 8.28  ? 57  PRO A N   1 
ATOM   430  C CA  . PRO A 1 57  ? 26.968 49.433 45.074 1.00 8.15  ? 57  PRO A CA  1 
ATOM   431  C C   . PRO A 1 57  ? 28.031 48.675 44.294 1.00 9.42  ? 57  PRO A C   1 
ATOM   432  O O   . PRO A 1 57  ? 29.018 48.224 44.871 1.00 10.61 ? 57  PRO A O   1 
ATOM   433  C CB  . PRO A 1 57  ? 26.995 50.925 44.753 1.00 9.31  ? 57  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 57  ? 28.028 51.439 45.751 1.00 10.39 ? 57  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 57  ? 27.574 50.727 47.038 1.00 11.59 ? 57  PRO A CD  1 
ATOM   436  N N   . ASP A 1 58  ? 27.806 48.526 42.984 1.00 9.30  ? 58  ASP A N   1 
ATOM   437  C CA  . ASP A 1 58  ? 28.781 47.888 42.105 1.00 8.64  ? 58  ASP A CA  1 
ATOM   438  C C   . ASP A 1 58  ? 29.905 48.926 41.942 1.00 9.87  ? 58  ASP A C   1 
ATOM   439  O O   . ASP A 1 58  ? 29.806 50.029 42.482 1.00 9.85  ? 58  ASP A O   1 
ATOM   440  C CB  . ASP A 1 58  ? 28.167 47.533 40.733 1.00 9.75  ? 58  ASP A CB  1 
ATOM   441  C CG  . ASP A 1 58  ? 27.635 48.745 39.976 1.00 12.36 ? 58  ASP A CG  1 
ATOM   442  O OD1 . ASP A 1 58  ? 28.113 49.885 40.203 1.00 13.07 ? 58  ASP A OD1 1 
ATOM   443  O OD2 . ASP A 1 58  ? 26.740 48.544 39.128 1.00 10.98 ? 58  ASP A OD2 1 
ATOM   444  N N   . ARG A 1 59  ? 30.960 48.604 41.206 1.00 11.80 ? 59  ARG A N   1 
ATOM   445  C CA  . ARG A 1 59  ? 32.074 49.546 41.089 1.00 12.63 ? 59  ARG A CA  1 
ATOM   446  C C   . ARG A 1 59  ? 31.767 50.856 40.375 1.00 13.42 ? 59  ARG A C   1 
ATOM   447  O O   . ARG A 1 59  ? 32.579 51.785 40.405 1.00 13.57 ? 59  ARG A O   1 
ATOM   448  C CB  . ARG A 1 59  ? 33.286 48.865 40.450 1.00 13.87 ? 59  ARG A CB  1 
ATOM   449  C CG  . ARG A 1 59  ? 33.086 48.367 39.036 1.00 19.37 ? 59  ARG A CG  1 
ATOM   450  C CD  . ARG A 1 59  ? 34.355 47.678 38.566 1.00 22.35 ? 59  ARG A CD  1 
ATOM   451  N NE  . ARG A 1 59  ? 34.337 47.402 37.133 1.00 30.61 ? 59  ARG A NE  1 
ATOM   452  C CZ  . ARG A 1 59  ? 35.322 46.795 36.475 1.00 32.88 ? 59  ARG A CZ  1 
ATOM   453  N NH1 . ARG A 1 59  ? 36.412 46.395 37.120 1.00 33.55 ? 59  ARG A NH1 1 
ATOM   454  N NH2 . ARG A 1 59  ? 35.216 46.584 35.168 1.00 33.61 ? 59  ARG A NH2 1 
ATOM   455  N N   . ASP A 1 60  ? 30.598 50.936 39.746 1.00 12.94 ? 60  ASP A N   1 
ATOM   456  C CA  . ASP A 1 60  ? 30.187 52.152 39.054 1.00 13.72 ? 60  ASP A CA  1 
ATOM   457  C C   . ASP A 1 60  ? 29.335 53.015 39.978 1.00 13.10 ? 60  ASP A C   1 
ATOM   458  O O   . ASP A 1 60  ? 28.833 54.062 39.575 1.00 11.79 ? 60  ASP A O   1 
ATOM   459  C CB  . ASP A 1 60  ? 29.393 51.813 37.786 1.00 15.94 ? 60  ASP A CB  1 
ATOM   460  C CG  . ASP A 1 60  ? 30.247 51.157 36.719 1.00 18.60 ? 60  ASP A CG  1 
ATOM   461  O OD1 . ASP A 1 60  ? 31.485 51.302 36.782 1.00 24.34 ? 60  ASP A OD1 1 
ATOM   462  O OD2 . ASP A 1 60  ? 29.684 50.518 35.805 1.00 19.09 ? 60  ASP A OD2 1 
ATOM   463  N N   . GLY A 1 61  ? 29.180 52.569 41.222 1.00 11.99 ? 61  GLY A N   1 
ATOM   464  C CA  . GLY A 1 61  ? 28.397 53.310 42.199 1.00 11.05 ? 61  GLY A CA  1 
ATOM   465  C C   . GLY A 1 61  ? 26.898 53.095 42.119 1.00 13.26 ? 61  GLY A C   1 
ATOM   466  O O   . GLY A 1 61  ? 26.124 53.863 42.698 1.00 11.72 ? 61  GLY A O   1 
ATOM   467  N N   . ARG A 1 62  ? 26.480 52.045 41.419 1.00 11.47 ? 62  ARG A N   1 
ATOM   468  C CA  . ARG A 1 62  ? 25.057 51.762 41.268 1.00 12.77 ? 62  ARG A CA  1 
ATOM   469  C C   . ARG A 1 62  ? 24.614 50.587 42.134 1.00 10.35 ? 62  ARG A C   1 
ATOM   470  O O   . ARG A 1 62  ? 25.228 49.518 42.113 1.00 9.85  ? 62  ARG A O   1 
ATOM   471  C CB  . ARG A 1 62  ? 24.742 51.453 39.803 1.00 19.12 ? 62  ARG A CB  1 
ATOM   472  C CG  . ARG A 1 62  ? 25.083 52.579 38.845 1.00 26.63 ? 62  ARG A CG  1 
ATOM   473  C CD  . ARG A 1 62  ? 24.925 52.141 37.398 1.00 34.99 ? 62  ARG A CD  1 
ATOM   474  N NE  . ARG A 1 62  ? 23.552 52.259 36.913 1.00 42.31 ? 62  ARG A NE  1 
ATOM   475  C CZ  . ARG A 1 62  ? 23.190 52.044 35.650 1.00 43.76 ? 62  ARG A CZ  1 
ATOM   476  N NH1 . ARG A 1 62  ? 24.098 51.695 34.748 1.00 46.23 ? 62  ARG A NH1 1 
ATOM   477  N NH2 . ARG A 1 62  ? 21.926 52.203 35.282 1.00 45.96 ? 62  ARG A NH2 1 
ATOM   478  N N   . VAL A 1 63  ? 23.554 50.787 42.906 1.00 8.82  ? 63  VAL A N   1 
ATOM   479  C CA  . VAL A 1 63  ? 23.055 49.698 43.734 1.00 9.01  ? 63  VAL A CA  1 
ATOM   480  C C   . VAL A 1 63  ? 22.113 48.867 42.872 1.00 7.95  ? 63  VAL A C   1 
ATOM   481  O O   . VAL A 1 63  ? 21.063 49.352 42.445 1.00 8.82  ? 63  VAL A O   1 
ATOM   482  C CB  . VAL A 1 63  ? 22.291 50.227 44.963 1.00 10.09 ? 63  VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 63  ? 21.766 49.069 45.775 1.00 9.92  ? 63  VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 63  ? 23.226 51.111 45.825 1.00 10.00 ? 63  VAL A CG2 1 
ATOM   485  N N   . THR A 1 64  ? 22.497 47.622 42.592 1.00 8.54  ? 64  THR A N   1 
ATOM   486  C CA  . THR A 1 64  ? 21.653 46.750 41.780 1.00 7.50  ? 64  THR A CA  1 
ATOM   487  C C   . THR A 1 64  ? 21.369 45.509 42.599 1.00 5.24  ? 64  THR A C   1 
ATOM   488  O O   . THR A 1 64  ? 22.294 44.865 43.106 1.00 4.66  ? 64  THR A O   1 
ATOM   489  C CB  . THR A 1 64  ? 22.316 46.401 40.414 1.00 7.57  ? 64  THR A CB  1 
ATOM   490  O OG1 . THR A 1 64  ? 23.418 45.505 40.594 1.00 9.84  ? 64  THR A OG1 1 
ATOM   491  C CG2 . THR A 1 64  ? 22.826 47.687 39.747 1.00 11.59 ? 64  THR A CG2 1 
ATOM   492  N N   . LEU A 1 65  ? 20.081 45.190 42.724 1.00 7.34  ? 65  LEU A N   1 
ATOM   493  C CA  . LEU A 1 65  ? 19.619 44.076 43.550 1.00 7.01  ? 65  LEU A CA  1 
ATOM   494  C C   . LEU A 1 65  ? 19.169 42.832 42.797 1.00 5.92  ? 65  LEU A C   1 
ATOM   495  O O   . LEU A 1 65  ? 18.712 42.905 41.657 1.00 6.17  ? 65  LEU A O   1 
ATOM   496  C CB  . LEU A 1 65  ? 18.463 44.554 44.435 1.00 5.58  ? 65  LEU A CB  1 
ATOM   497  C CG  . LEU A 1 65  ? 18.660 45.903 45.139 1.00 7.32  ? 65  LEU A CG  1 
ATOM   498  C CD1 . LEU A 1 65  ? 17.454 46.204 46.024 1.00 4.42  ? 65  LEU A CD1 1 
ATOM   499  C CD2 . LEU A 1 65  ? 19.942 45.876 45.976 1.00 6.69  ? 65  LEU A CD2 1 
ATOM   500  N N   . ASP A 1 66  ? 19.266 41.690 43.474 1.00 5.42  ? 66  ASP A N   1 
ATOM   501  C CA  . ASP A 1 66  ? 18.885 40.407 42.885 1.00 5.71  ? 66  ASP A CA  1 
ATOM   502  C C   . ASP A 1 66  ? 18.038 39.652 43.902 1.00 4.63  ? 66  ASP A C   1 
ATOM   503  O O   . ASP A 1 66  ? 18.331 39.694 45.098 1.00 3.87  ? 66  ASP A O   1 
ATOM   504  C CB  . ASP A 1 66  ? 20.113 39.536 42.592 1.00 4.29  ? 66  ASP A CB  1 
ATOM   505  C CG  . ASP A 1 66  ? 21.255 40.296 41.926 1.00 11.73 ? 66  ASP A CG  1 
ATOM   506  O OD1 . ASP A 1 66  ? 21.031 40.971 40.904 1.00 9.38  ? 66  ASP A OD1 1 
ATOM   507  O OD2 . ASP A 1 66  ? 22.393 40.192 42.431 1.00 12.76 ? 66  ASP A OD2 1 
ATOM   508  N N   . ALA A 1 67  ? 16.999 38.966 43.430 1.00 5.40  ? 67  ALA A N   1 
ATOM   509  C CA  . ALA A 1 67  ? 16.160 38.174 44.329 1.00 5.64  ? 67  ALA A CA  1 
ATOM   510  C C   . ALA A 1 67  ? 15.306 37.176 43.574 1.00 6.29  ? 67  ALA A C   1 
ATOM   511  O O   . ALA A 1 67  ? 14.997 37.374 42.406 1.00 3.75  ? 67  ALA A O   1 
ATOM   512  C CB  . ALA A 1 67  ? 15.244 39.088 45.149 1.00 2.85  ? 67  ALA A CB  1 
ATOM   513  N N   . CYS A 1 68  ? 14.943 36.088 44.244 1.00 4.31  ? 68  CYS A N   1 
ATOM   514  C CA  . CYS A 1 68  ? 14.031 35.128 43.638 1.00 3.51  ? 68  CYS A CA  1 
ATOM   515  C C   . CYS A 1 68  ? 13.189 34.539 44.773 1.00 8.03  ? 68  CYS A C   1 
ATOM   516  O O   . CYS A 1 68  ? 13.536 34.639 45.966 1.00 6.45  ? 68  CYS A O   1 
ATOM   517  C CB  . CYS A 1 68  ? 14.766 34.051 42.835 1.00 5.87  ? 68  CYS A CB  1 
ATOM   518  S SG  . CYS A 1 68  ? 15.627 32.801 43.774 1.00 10.66 ? 68  CYS A SG  1 
ATOM   519  N N   . ILE A 1 69  ? 12.055 33.965 44.401 1.00 7.01  ? 69  ILE A N   1 
ATOM   520  C CA  . ILE A 1 69  ? 11.125 33.428 45.373 1.00 4.26  ? 69  ILE A CA  1 
ATOM   521  C C   . ILE A 1 69  ? 10.535 32.185 44.722 1.00 6.52  ? 69  ILE A C   1 
ATOM   522  O O   . ILE A 1 69  ? 10.446 32.107 43.494 1.00 3.82  ? 69  ILE A O   1 
ATOM   523  C CB  . ILE A 1 69  ? 10.040 34.501 45.668 1.00 2.54  ? 69  ILE A CB  1 
ATOM   524  C CG1 . ILE A 1 69  ? 9.152  34.080 46.832 1.00 2.67  ? 69  ILE A CG1 1 
ATOM   525  C CG2 . ILE A 1 69  ? 9.185  34.759 44.387 1.00 5.42  ? 69  ILE A CG2 1 
ATOM   526  C CD1 . ILE A 1 69  ? 8.334  35.254 47.406 1.00 6.64  ? 69  ILE A CD1 1 
ATOM   527  N N   . MET A 1 70  ? 10.162 31.205 45.538 1.00 4.71  ? 70  MET A N   1 
ATOM   528  C CA  . MET A 1 70  ? 9.600  29.970 45.015 1.00 6.27  ? 70  MET A CA  1 
ATOM   529  C C   . MET A 1 70  ? 8.549  29.483 46.008 1.00 6.46  ? 70  MET A C   1 
ATOM   530  O O   . MET A 1 70  ? 8.782  29.463 47.229 1.00 4.85  ? 70  MET A O   1 
ATOM   531  C CB  . MET A 1 70  ? 10.716 28.919 44.842 1.00 6.41  ? 70  MET A CB  1 
ATOM   532  C CG  . MET A 1 70  ? 10.282 27.609 44.165 1.00 7.05  ? 70  MET A CG  1 
ATOM   533  S SD  . MET A 1 70  ? 11.690 26.718 43.411 1.00 10.54 ? 70  MET A SD  1 
ATOM   534  C CE  . MET A 1 70  ? 13.053 27.749 43.924 1.00 14.13 ? 70  MET A CE  1 
ATOM   535  N N   . ASP A 1 71  ? 7.383  29.106 45.501 1.00 4.62  ? 71  ASP A N   1 
ATOM   536  C CA  . ASP A 1 71  ? 6.346  28.651 46.406 1.00 6.95  ? 71  ASP A CA  1 
ATOM   537  C C   . ASP A 1 71  ? 6.216  27.138 46.496 1.00 8.16  ? 71  ASP A C   1 
ATOM   538  O O   . ASP A 1 71  ? 7.110  26.380 46.061 1.00 5.90  ? 71  ASP A O   1 
ATOM   539  C CB  . ASP A 1 71  ? 5.002  29.312 46.059 1.00 6.25  ? 71  ASP A CB  1 
ATOM   540  C CG  . ASP A 1 71  ? 4.346  28.732 44.811 1.00 8.82  ? 71  ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 71  ? 4.926  27.846 44.158 1.00 5.40  ? 71  ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 71  ? 3.228  29.181 44.501 1.00 6.87  ? 71  ASP A OD2 1 
ATOM   543  N N   . GLU A 1 72  ? 5.107  26.696 47.079 1.00 5.23  ? 72  GLU A N   1 
ATOM   544  C CA  . GLU A 1 72  ? 4.878  25.275 47.293 1.00 8.23  ? 72  GLU A CA  1 
ATOM   545  C C   . GLU A 1 72  ? 4.384  24.491 46.072 1.00 9.68  ? 72  GLU A C   1 
ATOM   546  O O   . GLU A 1 72  ? 4.168  23.280 46.165 1.00 9.02  ? 72  GLU A O   1 
ATOM   547  C CB  . GLU A 1 72  ? 3.869  25.093 48.440 1.00 9.79  ? 72  GLU A CB  1 
ATOM   548  C CG  . GLU A 1 72  ? 2.411  25.271 48.026 1.00 11.01 ? 72  GLU A CG  1 
ATOM   549  C CD  . GLU A 1 72  ? 1.996  26.711 47.769 1.00 14.95 ? 72  GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 72  ? 0.851  26.913 47.319 1.00 16.92 ? 72  GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 72  ? 2.790  27.642 48.020 1.00 18.56 ? 72  GLU A OE2 1 
ATOM   552  N N   . ASN A 1 73  ? 4.194  25.160 44.939 1.00 9.27  ? 73  ASN A N   1 
ATOM   553  C CA  . ASN A 1 73  ? 3.704  24.455 43.753 1.00 9.07  ? 73  ASN A CA  1 
ATOM   554  C C   . ASN A 1 73  ? 4.475  24.799 42.489 1.00 9.55  ? 73  ASN A C   1 
ATOM   555  O O   . ASN A 1 73  ? 3.889  25.047 41.437 1.00 10.79 ? 73  ASN A O   1 
ATOM   556  C CB  . ASN A 1 73  ? 2.210  24.731 43.552 1.00 10.41 ? 73  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 73  ? 1.523  23.648 42.725 1.00 13.22 ? 73  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 73  ? 1.754  22.462 42.939 1.00 13.30 ? 73  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 73  ? 0.669  24.054 41.787 1.00 9.90  ? 73  ASN A ND2 1 
ATOM   560  N N   . TYR A 1 74  ? 5.799  24.780 42.608 1.00 10.78 ? 74  TYR A N   1 
ATOM   561  C CA  . TYR A 1 74  ? 6.710  25.048 41.510 1.00 9.57  ? 74  TYR A CA  1 
ATOM   562  C C   . TYR A 1 74  ? 6.548  26.403 40.807 1.00 8.70  ? 74  TYR A C   1 
ATOM   563  O O   . TYR A 1 74  ? 6.972  26.560 39.668 1.00 8.76  ? 74  TYR A O   1 
ATOM   564  C CB  . TYR A 1 74  ? 6.631  23.914 40.480 1.00 9.25  ? 74  TYR A CB  1 
ATOM   565  C CG  . TYR A 1 74  ? 6.497  22.538 41.101 1.00 18.84 ? 74  TYR A CG  1 
ATOM   566  C CD1 . TYR A 1 74  ? 5.235  21.999 41.369 1.00 20.67 ? 74  TYR A CD1 1 
ATOM   567  C CD2 . TYR A 1 74  ? 7.620  21.795 41.465 1.00 18.18 ? 74  TYR A CD2 1 
ATOM   568  C CE1 . TYR A 1 74  ? 5.089  20.764 41.987 1.00 25.10 ? 74  TYR A CE1 1 
ATOM   569  C CE2 . TYR A 1 74  ? 7.487  20.544 42.087 1.00 21.35 ? 74  TYR A CE2 1 
ATOM   570  C CZ  . TYR A 1 74  ? 6.213  20.039 42.347 1.00 26.68 ? 74  TYR A CZ  1 
ATOM   571  O OH  . TYR A 1 74  ? 6.042  18.825 42.981 1.00 29.16 ? 74  TYR A OH  1 
ATOM   572  N N   . ASN A 1 75  ? 5.937  27.378 41.474 1.00 7.70  ? 75  ASN A N   1 
ATOM   573  C CA  . ASN A 1 75  ? 5.811  28.696 40.869 1.00 9.15  ? 75  ASN A CA  1 
ATOM   574  C C   . ASN A 1 75  ? 7.083  29.448 41.288 1.00 7.27  ? 75  ASN A C   1 
ATOM   575  O O   . ASN A 1 75  ? 7.557  29.298 42.420 1.00 3.73  ? 75  ASN A O   1 
ATOM   576  C CB  . ASN A 1 75  ? 4.547  29.407 41.372 1.00 7.22  ? 75  ASN A CB  1 
ATOM   577  C CG  . ASN A 1 75  ? 3.272  28.645 41.016 1.00 10.81 ? 75  ASN A CG  1 
ATOM   578  O OD1 . ASN A 1 75  ? 2.438  28.351 41.885 1.00 10.92 ? 75  ASN A OD1 1 
ATOM   579  N ND2 . ASN A 1 75  ? 3.120  28.317 39.739 1.00 2.76  ? 75  ASN A ND2 1 
ATOM   580  N N   . ILE A 1 76  ? 7.649  30.229 40.371 1.00 5.97  ? 76  ILE A N   1 
ATOM   581  C CA  . ILE A 1 76  ? 8.883  30.956 40.659 1.00 5.87  ? 76  ILE A CA  1 
ATOM   582  C C   . ILE A 1 76  ? 8.910  32.346 40.063 1.00 6.04  ? 76  ILE A C   1 
ATOM   583  O O   . ILE A 1 76  ? 8.265  32.624 39.046 1.00 4.61  ? 76  ILE A O   1 
ATOM   584  C CB  . ILE A 1 76  ? 10.129 30.222 40.105 1.00 5.53  ? 76  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 76  ? 9.917  29.899 38.618 1.00 6.82  ? 76  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 76  ? 10.401 28.956 40.905 1.00 7.07  ? 76  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 76  ? 11.183 29.424 37.917 1.00 4.23  ? 76  ILE A CD1 1 
ATOM   588  N N   . GLY A 1 77  ? 9.696  33.217 40.688 1.00 3.39  ? 77  GLY A N   1 
ATOM   589  C CA  . GLY A 1 77  ? 9.827  34.574 40.200 1.00 3.89  ? 77  GLY A CA  1 
ATOM   590  C C   . GLY A 1 77  ? 11.203 35.077 40.573 1.00 7.90  ? 77  GLY A C   1 
ATOM   591  O O   . GLY A 1 77  ? 11.702 34.793 41.666 1.00 7.96  ? 77  GLY A O   1 
ATOM   592  N N   . SER A 1 78  ? 11.813 35.845 39.681 1.00 7.56  ? 78  SER A N   1 
ATOM   593  C CA  . SER A 1 78  ? 13.151 36.337 39.937 1.00 7.64  ? 78  SER A CA  1 
ATOM   594  C C   . SER A 1 78  ? 13.449 37.659 39.247 1.00 6.59  ? 78  SER A C   1 
ATOM   595  O O   . SER A 1 78  ? 12.955 37.922 38.144 1.00 6.87  ? 78  SER A O   1 
ATOM   596  C CB  . SER A 1 78  ? 14.155 35.280 39.451 1.00 7.33  ? 78  SER A CB  1 
ATOM   597  O OG  . SER A 1 78  ? 15.449 35.834 39.240 1.00 8.17  ? 78  SER A OG  1 
ATOM   598  N N   . VAL A 1 79  ? 14.239 38.501 39.912 1.00 6.01  ? 79  VAL A N   1 
ATOM   599  C CA  . VAL A 1 79  ? 14.689 39.745 39.297 1.00 6.06  ? 79  VAL A CA  1 
ATOM   600  C C   . VAL A 1 79  ? 16.192 39.812 39.546 1.00 6.19  ? 79  VAL A C   1 
ATOM   601  O O   . VAL A 1 79  ? 16.663 39.353 40.572 1.00 6.42  ? 79  VAL A O   1 
ATOM   602  C CB  . VAL A 1 79  ? 13.993 41.012 39.875 1.00 5.47  ? 79  VAL A CB  1 
ATOM   603  C CG1 . VAL A 1 79  ? 12.543 41.032 39.432 1.00 8.69  ? 79  VAL A CG1 1 
ATOM   604  C CG2 . VAL A 1 79  ? 14.088 41.041 41.414 1.00 5.86  ? 79  VAL A CG2 1 
ATOM   605  N N   . ALA A 1 80  ? 16.954 40.324 38.584 1.00 4.67  ? 80  ALA A N   1 
ATOM   606  C CA  . ALA A 1 80  ? 18.388 40.438 38.787 1.00 6.44  ? 80  ALA A CA  1 
ATOM   607  C C   . ALA A 1 80  ? 18.857 41.774 38.233 1.00 5.64  ? 80  ALA A C   1 
ATOM   608  O O   . ALA A 1 80  ? 18.317 42.264 37.243 1.00 8.98  ? 80  ALA A O   1 
ATOM   609  C CB  . ALA A 1 80  ? 19.132 39.282 38.107 1.00 3.93  ? 80  ALA A CB  1 
ATOM   610  N N   . CYS A 1 81  ? 19.849 42.353 38.905 1.00 8.06  ? 81  CYS A N   1 
ATOM   611  C CA  . CYS A 1 81  ? 20.424 43.636 38.531 1.00 7.38  ? 81  CYS A CA  1 
ATOM   612  C C   . CYS A 1 81  ? 19.350 44.706 38.352 1.00 11.07 ? 81  CYS A C   1 
ATOM   613  O O   . CYS A 1 81  ? 19.316 45.406 37.324 1.00 9.16  ? 81  CYS A O   1 
ATOM   614  C CB  . CYS A 1 81  ? 21.237 43.490 37.244 1.00 10.18 ? 81  CYS A CB  1 
ATOM   615  S SG  . CYS A 1 81  ? 22.344 44.895 36.924 1.00 13.77 ? 81  CYS A SG  1 
ATOM   616  N N   . MET A 1 82  ? 18.486 44.848 39.361 1.00 5.75  ? 82  MET A N   1 
ATOM   617  C CA  . MET A 1 82  ? 17.420 45.849 39.302 1.00 8.19  ? 82  MET A CA  1 
ATOM   618  C C   . MET A 1 82  ? 17.756 47.018 40.220 1.00 7.24  ? 82  MET A C   1 
ATOM   619  O O   . MET A 1 82  ? 18.178 46.840 41.371 1.00 7.54  ? 82  MET A O   1 
ATOM   620  C CB  . MET A 1 82  ? 16.068 45.239 39.707 1.00 8.56  ? 82  MET A CB  1 
ATOM   621  C CG  . MET A 1 82  ? 14.912 46.242 39.734 1.00 5.86  ? 82  MET A CG  1 
ATOM   622  S SD  . MET A 1 82  ? 13.301 45.478 40.105 1.00 10.71 ? 82  MET A SD  1 
ATOM   623  C CE  . MET A 1 82  ? 13.545 44.961 41.822 1.00 9.76  ? 82  MET A CE  1 
ATOM   624  N N   . GLU A 1 83  ? 17.563 48.222 39.710 1.00 7.51  ? 83  GLU A N   1 
ATOM   625  C CA  . GLU A 1 83  ? 17.873 49.415 40.481 1.00 7.35  ? 83  GLU A CA  1 
ATOM   626  C C   . GLU A 1 83  ? 16.630 50.139 40.941 1.00 9.63  ? 83  GLU A C   1 
ATOM   627  O O   . GLU A 1 83  ? 15.547 49.946 40.395 1.00 9.98  ? 83  GLU A O   1 
ATOM   628  C CB  . GLU A 1 83  ? 18.675 50.414 39.644 1.00 10.60 ? 83  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 83  ? 19.955 49.899 39.060 1.00 15.92 ? 83  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 83  ? 20.589 50.932 38.155 1.00 19.19 ? 83  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 83  ? 21.242 51.857 38.666 1.00 20.16 ? 83  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 83  ? 20.400 50.830 36.928 1.00 27.11 ? 83  GLU A OE2 1 
ATOM   633  N N   . HIS A 1 84  ? 16.820 50.967 41.965 1.00 9.89  ? 84  HIS A N   1 
ATOM   634  C CA  . HIS A 1 84  ? 15.784 51.832 42.497 1.00 10.52 ? 84  HIS A CA  1 
ATOM   635  C C   . HIS A 1 84  ? 14.564 51.273 43.228 1.00 9.77  ? 84  HIS A C   1 
ATOM   636  O O   . HIS A 1 84  ? 13.723 52.057 43.654 1.00 12.43 ? 84  HIS A O   1 
ATOM   637  C CB  . HIS A 1 84  ? 15.312 52.758 41.368 1.00 11.07 ? 84  HIS A CB  1 
ATOM   638  C CG  . HIS A 1 84  ? 16.425 53.489 40.677 1.00 13.47 ? 84  HIS A CG  1 
ATOM   639  N ND1 . HIS A 1 84  ? 17.341 54.267 41.355 1.00 17.20 ? 84  HIS A ND1 1 
ATOM   640  C CD2 . HIS A 1 84  ? 16.749 53.587 39.364 1.00 14.74 ? 84  HIS A CD2 1 
ATOM   641  C CE1 . HIS A 1 84  ? 18.178 54.815 40.489 1.00 17.94 ? 84  HIS A CE1 1 
ATOM   642  N NE2 . HIS A 1 84  ? 17.841 54.419 39.274 1.00 13.89 ? 84  HIS A NE2 1 
ATOM   643  N N   . ILE A 1 85  ? 14.449 49.953 43.376 1.00 8.59  ? 85  ILE A N   1 
ATOM   644  C CA  . ILE A 1 85  ? 13.303 49.369 44.079 1.00 9.07  ? 85  ILE A CA  1 
ATOM   645  C C   . ILE A 1 85  ? 13.813 48.693 45.353 1.00 8.70  ? 85  ILE A C   1 
ATOM   646  O O   . ILE A 1 85  ? 14.605 47.750 45.289 1.00 7.47  ? 85  ILE A O   1 
ATOM   647  C CB  . ILE A 1 85  ? 12.570 48.322 43.195 1.00 9.57  ? 85  ILE A CB  1 
ATOM   648  C CG1 . ILE A 1 85  ? 12.234 48.933 41.828 1.00 12.17 ? 85  ILE A CG1 1 
ATOM   649  C CG2 . ILE A 1 85  ? 11.284 47.866 43.878 1.00 6.63  ? 85  ILE A CG2 1 
ATOM   650  C CD1 . ILE A 1 85  ? 11.290 50.122 41.889 1.00 11.93 ? 85  ILE A CD1 1 
ATOM   651  N N   . LYS A 1 86  ? 13.340 49.173 46.501 1.00 7.07  ? 86  LYS A N   1 
ATOM   652  C CA  . LYS A 1 86  ? 13.787 48.669 47.796 1.00 9.27  ? 86  LYS A CA  1 
ATOM   653  C C   . LYS A 1 86  ? 13.471 47.217 48.123 1.00 8.92  ? 86  LYS A C   1 
ATOM   654  O O   . LYS A 1 86  ? 14.243 46.561 48.838 1.00 7.70  ? 86  LYS A O   1 
ATOM   655  C CB  . LYS A 1 86  ? 13.247 49.565 48.921 1.00 11.58 ? 86  LYS A CB  1 
ATOM   656  C CG  . LYS A 1 86  ? 13.717 49.158 50.310 1.00 10.74 ? 86  LYS A CG  1 
ATOM   657  C CD  . LYS A 1 86  ? 13.446 50.265 51.336 1.00 20.94 ? 86  LYS A CD  1 
ATOM   658  C CE  . LYS A 1 86  ? 11.957 50.539 51.502 1.00 23.03 ? 86  LYS A CE  1 
ATOM   659  N NZ  . LYS A 1 86  ? 11.742 51.714 52.399 1.00 30.37 ? 86  LYS A NZ  1 
ATOM   660  N N   . ASN A 1 87  ? 12.353 46.710 47.611 1.00 8.21  ? 87  ASN A N   1 
ATOM   661  C CA  . ASN A 1 87  ? 11.963 45.331 47.896 1.00 8.49  ? 87  ASN A CA  1 
ATOM   662  C C   . ASN A 1 87  ? 11.925 44.441 46.655 1.00 8.48  ? 87  ASN A C   1 
ATOM   663  O O   . ASN A 1 87  ? 10.855 44.115 46.137 1.00 8.23  ? 87  ASN A O   1 
ATOM   664  C CB  . ASN A 1 87  ? 10.601 45.329 48.598 1.00 7.85  ? 87  ASN A CB  1 
ATOM   665  C CG  . ASN A 1 87  ? 10.614 46.158 49.878 1.00 10.10 ? 87  ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 87  ? 11.222 45.766 50.878 1.00 11.31 ? 87  ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 87  ? 9.957  47.321 49.844 1.00 6.54  ? 87  ASN A ND2 1 
ATOM   668  N N   . PRO A 1 88  ? 13.104 44.021 46.168 1.00 8.53  ? 88  PRO A N   1 
ATOM   669  C CA  . PRO A 1 88  ? 13.117 43.167 44.980 1.00 8.93  ? 88  PRO A CA  1 
ATOM   670  C C   . PRO A 1 88  ? 12.428 41.813 45.185 1.00 8.38  ? 88  PRO A C   1 
ATOM   671  O O   . PRO A 1 88  ? 11.912 41.241 44.223 1.00 7.71  ? 88  PRO A O   1 
ATOM   672  C CB  . PRO A 1 88  ? 14.610 43.044 44.654 1.00 5.82  ? 88  PRO A CB  1 
ATOM   673  C CG  . PRO A 1 88  ? 15.272 43.158 46.019 1.00 6.28  ? 88  PRO A CG  1 
ATOM   674  C CD  . PRO A 1 88  ? 14.472 44.288 46.655 1.00 7.77  ? 88  PRO A CD  1 
ATOM   675  N N   . ILE A 1 89  ? 12.388 41.304 46.417 1.00 7.58  ? 89  ILE A N   1 
ATOM   676  C CA  . ILE A 1 89  ? 11.722 40.011 46.626 1.00 8.20  ? 89  ILE A CA  1 
ATOM   677  C C   . ILE A 1 89  ? 10.243 40.130 46.233 1.00 7.08  ? 89  ILE A C   1 
ATOM   678  O O   . ILE A 1 89  ? 9.645  39.196 45.702 1.00 5.38  ? 89  ILE A O   1 
ATOM   679  C CB  . ILE A 1 89  ? 11.839 39.499 48.111 1.00 6.58  ? 89  ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 89  ? 11.375 38.032 48.192 1.00 6.34  ? 89  ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 89  ? 11.001 40.362 49.060 1.00 7.51  ? 89  ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 89  ? 12.228 37.066 47.349 1.00 3.62  ? 89  ILE A CD1 1 
ATOM   683  N N   . SER A 1 90  ? 9.657  41.299 46.463 1.00 7.64  ? 90  SER A N   1 
ATOM   684  C CA  . SER A 1 90  ? 8.255  41.492 46.128 1.00 4.26  ? 90  SER A CA  1 
ATOM   685  C C   . SER A 1 90  ? 8.054  41.691 44.632 1.00 5.70  ? 90  SER A C   1 
ATOM   686  O O   . SER A 1 90  ? 7.002  41.350 44.085 1.00 6.84  ? 90  SER A O   1 
ATOM   687  C CB  . SER A 1 90  ? 7.700  42.670 46.906 1.00 7.23  ? 90  SER A CB  1 
ATOM   688  O OG  . SER A 1 90  ? 7.751  42.397 48.296 1.00 9.23  ? 90  SER A OG  1 
ATOM   689  N N   . VAL A 1 91  ? 9.055  42.247 43.964 1.00 7.11  ? 91  VAL A N   1 
ATOM   690  C CA  . VAL A 1 91  ? 8.935  42.412 42.524 1.00 5.68  ? 91  VAL A CA  1 
ATOM   691  C C   . VAL A 1 91  ? 9.048  41.012 41.947 1.00 4.56  ? 91  VAL A C   1 
ATOM   692  O O   . VAL A 1 91  ? 8.353  40.659 41.001 1.00 4.14  ? 91  VAL A O   1 
ATOM   693  C CB  . VAL A 1 91  ? 10.053 43.279 41.942 1.00 3.54  ? 91  VAL A CB  1 
ATOM   694  C CG1 . VAL A 1 91  ? 9.805  43.465 40.432 1.00 4.28  ? 91  VAL A CG1 1 
ATOM   695  C CG2 . VAL A 1 91  ? 10.071 44.649 42.648 1.00 5.33  ? 91  VAL A CG2 1 
ATOM   696  N N   . ALA A 1 92  ? 9.939  40.207 42.518 1.00 5.47  ? 92  ALA A N   1 
ATOM   697  C CA  . ALA A 1 92  ? 10.097 38.826 42.049 1.00 4.78  ? 92  ALA A CA  1 
ATOM   698  C C   . ALA A 1 92  ? 8.759  38.085 42.192 1.00 7.03  ? 92  ALA A C   1 
ATOM   699  O O   . ALA A 1 92  ? 8.372  37.298 41.311 1.00 6.21  ? 92  ALA A O   1 
ATOM   700  C CB  . ALA A 1 92  ? 11.189 38.109 42.868 1.00 4.83  ? 92  ALA A CB  1 
ATOM   701  N N   . ARG A 1 93  ? 8.059  38.325 43.299 1.00 5.42  ? 93  ARG A N   1 
ATOM   702  C CA  . ARG A 1 93  ? 6.764  37.674 43.520 1.00 6.74  ? 93  ARG A CA  1 
ATOM   703  C C   . ARG A 1 93  ? 5.775  38.131 42.454 1.00 7.83  ? 93  ARG A C   1 
ATOM   704  O O   . ARG A 1 93  ? 4.940  37.349 41.976 1.00 6.89  ? 93  ARG A O   1 
ATOM   705  C CB  . ARG A 1 93  ? 6.214  37.987 44.924 1.00 6.14  ? 93  ARG A CB  1 
ATOM   706  C CG  . ARG A 1 93  ? 4.810  37.423 45.132 1.00 9.86  ? 93  ARG A CG  1 
ATOM   707  C CD  . ARG A 1 93  ? 4.393  37.404 46.595 1.00 11.01 ? 93  ARG A CD  1 
ATOM   708  N NE  . ARG A 1 93  ? 3.098  36.747 46.757 1.00 9.17  ? 93  ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 93  ? 2.545  36.476 47.930 1.00 12.61 ? 93  ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 93  ? 3.176  36.804 49.056 1.00 10.09 ? 93  ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 93  ? 1.357  35.883 47.975 1.00 9.35  ? 93  ARG A NH2 1 
ATOM   712  N N   . ALA A 1 94  ? 5.893  39.395 42.063 1.00 8.93  ? 94  ALA A N   1 
ATOM   713  C CA  . ALA A 1 94  ? 5.041  39.955 41.023 1.00 8.46  ? 94  ALA A CA  1 
ATOM   714  C C   . ALA A 1 94  ? 5.395  39.319 39.669 1.00 8.14  ? 94  ALA A C   1 
ATOM   715  O O   . ALA A 1 94  ? 4.509  39.058 38.851 1.00 8.21  ? 94  ALA A O   1 
ATOM   716  C CB  . ALA A 1 94  ? 5.208  41.475 40.966 1.00 3.86  ? 94  ALA A CB  1 
ATOM   717  N N   . VAL A 1 95  ? 6.680  39.070 39.424 1.00 4.51  ? 95  VAL A N   1 
ATOM   718  C CA  . VAL A 1 95  ? 7.070  38.426 38.163 1.00 6.95  ? 95  VAL A CA  1 
ATOM   719  C C   . VAL A 1 95  ? 6.399  37.046 38.109 1.00 6.29  ? 95  VAL A C   1 
ATOM   720  O O   . VAL A 1 95  ? 5.825  36.646 37.090 1.00 6.25  ? 95  VAL A O   1 
ATOM   721  C CB  . VAL A 1 95  ? 8.609  38.244 38.056 1.00 4.44  ? 95  VAL A CB  1 
ATOM   722  C CG1 . VAL A 1 95  ? 8.939  37.322 36.867 1.00 5.89  ? 95  VAL A CG1 1 
ATOM   723  C CG2 . VAL A 1 95  ? 9.289  39.613 37.867 1.00 7.26  ? 95  VAL A CG2 1 
ATOM   724  N N   . MET A 1 96  ? 6.472  36.329 39.225 1.00 6.28  ? 96  MET A N   1 
ATOM   725  C CA  . MET A 1 96  ? 5.871  35.002 39.349 1.00 6.09  ? 96  MET A CA  1 
ATOM   726  C C   . MET A 1 96  ? 4.360  35.014 39.110 1.00 7.92  ? 96  MET A C   1 
ATOM   727  O O   . MET A 1 96  ? 3.842  34.279 38.261 1.00 8.33  ? 96  MET A O   1 
ATOM   728  C CB  . MET A 1 96  ? 6.134  34.448 40.765 1.00 3.92  ? 96  MET A CB  1 
ATOM   729  C CG  . MET A 1 96  ? 5.572  33.046 41.038 1.00 4.85  ? 96  MET A CG  1 
ATOM   730  S SD  . MET A 1 96  ? 6.095  32.378 42.652 1.00 8.37  ? 96  MET A SD  1 
ATOM   731  C CE  . MET A 1 96  ? 5.186  33.475 43.745 1.00 6.92  ? 96  MET A CE  1 
ATOM   732  N N   . GLU A 1 97  ? 3.661  35.854 39.867 1.00 6.08  ? 97  GLU A N   1 
ATOM   733  C CA  . GLU A 1 97  ? 2.203  35.912 39.812 1.00 10.12 ? 97  GLU A CA  1 
ATOM   734  C C   . GLU A 1 97  ? 1.530  36.664 38.678 1.00 11.19 ? 97  GLU A C   1 
ATOM   735  O O   . GLU A 1 97  ? 0.418  36.300 38.275 1.00 7.42  ? 97  GLU A O   1 
ATOM   736  C CB  . GLU A 1 97  ? 1.668  36.485 41.128 1.00 9.56  ? 97  GLU A CB  1 
ATOM   737  C CG  . GLU A 1 97  ? 2.210  35.784 42.369 1.00 9.41  ? 97  GLU A CG  1 
ATOM   738  C CD  . GLU A 1 97  ? 1.666  36.362 43.671 1.00 10.67 ? 97  GLU A CD  1 
ATOM   739  O OE1 . GLU A 1 97  ? 1.332  37.558 43.710 1.00 11.57 ? 97  GLU A OE1 1 
ATOM   740  O OE2 . GLU A 1 97  ? 1.588  35.615 44.657 1.00 14.55 ? 97  GLU A OE2 1 
ATOM   741  N N   . LYS A 1 98  ? 2.208  37.679 38.153 1.00 8.62  ? 98  LYS A N   1 
ATOM   742  C CA  . LYS A 1 98  ? 1.615  38.545 37.137 1.00 12.24 ? 98  LYS A CA  1 
ATOM   743  C C   . LYS A 1 98  ? 2.120  38.498 35.702 1.00 11.26 ? 98  LYS A C   1 
ATOM   744  O O   . LYS A 1 98  ? 1.647  39.267 34.868 1.00 10.25 ? 98  LYS A O   1 
ATOM   745  C CB  . LYS A 1 98  ? 1.706  39.994 37.610 1.00 11.05 ? 98  LYS A CB  1 
ATOM   746  C CG  . LYS A 1 98  ? 1.130  40.272 38.991 1.00 17.72 ? 98  LYS A CG  1 
ATOM   747  C CD  . LYS A 1 98  ? -0.353 39.979 39.054 1.00 23.36 ? 98  LYS A CD  1 
ATOM   748  C CE  . LYS A 1 98  ? -1.007 40.714 40.228 1.00 26.98 ? 98  LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 98  ? -0.333 40.432 41.528 1.00 32.26 ? 98  LYS A NZ  1 
ATOM   750  N N   . THR A 1 99  ? 3.072  37.625 35.403 1.00 10.03 ? 99  THR A N   1 
ATOM   751  C CA  . THR A 1 99  ? 3.600  37.558 34.044 1.00 7.37  ? 99  THR A CA  1 
ATOM   752  C C   . THR A 1 99  ? 3.756  36.116 33.603 1.00 9.87  ? 99  THR A C   1 
ATOM   753  O O   . THR A 1 99  ? 3.706  35.194 34.415 1.00 10.42 ? 99  THR A O   1 
ATOM   754  C CB  . THR A 1 99  ? 5.020  38.191 33.936 1.00 8.38  ? 99  THR A CB  1 
ATOM   755  O OG1 . THR A 1 99  ? 5.997  37.254 34.423 1.00 7.50  ? 99  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 99  ? 5.116  39.478 34.773 1.00 6.34  ? 99  THR A CG2 1 
ATOM   757  N N   . PRO A 1 100 ? 3.957  35.906 32.299 1.00 12.10 ? 100 PRO A N   1 
ATOM   758  C CA  . PRO A 1 100 ? 4.142  34.557 31.766 1.00 13.22 ? 100 PRO A CA  1 
ATOM   759  C C   . PRO A 1 100 ? 5.637  34.207 31.834 1.00 13.07 ? 100 PRO A C   1 
ATOM   760  O O   . PRO A 1 100 ? 6.055  33.186 31.279 1.00 13.15 ? 100 PRO A O   1 
ATOM   761  C CB  . PRO A 1 100 ? 3.683  34.663 30.304 1.00 14.18 ? 100 PRO A CB  1 
ATOM   762  C CG  . PRO A 1 100 ? 3.155  36.065 30.144 1.00 20.85 ? 100 PRO A CG  1 
ATOM   763  C CD  . PRO A 1 100 ? 3.807  36.889 31.216 1.00 15.03 ? 100 PRO A CD  1 
ATOM   764  N N   . HIS A 1 101 ? 6.438  35.062 32.476 1.00 7.77  ? 101 HIS A N   1 
ATOM   765  C CA  . HIS A 1 101 ? 7.883  34.802 32.598 1.00 7.30  ? 101 HIS A CA  1 
ATOM   766  C C   . HIS A 1 101 ? 8.295  34.491 34.041 1.00 8.74  ? 101 HIS A C   1 
ATOM   767  O O   . HIS A 1 101 ? 7.492  34.644 34.965 1.00 8.27  ? 101 HIS A O   1 
ATOM   768  C CB  . HIS A 1 101 ? 8.697  36.006 32.112 1.00 9.24  ? 101 HIS A CB  1 
ATOM   769  C CG  . HIS A 1 101 ? 8.348  36.444 30.726 1.00 9.19  ? 101 HIS A CG  1 
ATOM   770  N ND1 . HIS A 1 101 ? 8.226  35.558 29.678 1.00 8.53  ? 101 HIS A ND1 1 
ATOM   771  C CD2 . HIS A 1 101 ? 8.083  37.671 30.218 1.00 10.58 ? 101 HIS A CD2 1 
ATOM   772  C CE1 . HIS A 1 101 ? 7.896  36.221 28.582 1.00 7.50  ? 101 HIS A CE1 1 
ATOM   773  N NE2 . HIS A 1 101 ? 7.803  37.504 28.884 1.00 7.69  ? 101 HIS A NE2 1 
ATOM   774  N N   . VAL A 1 102 ? 9.543  34.053 34.243 1.00 4.19  ? 102 VAL A N   1 
ATOM   775  C CA  . VAL A 1 102 ? 9.985  33.772 35.611 1.00 3.90  ? 102 VAL A CA  1 
ATOM   776  C C   . VAL A 1 102 ? 11.209 34.576 36.005 1.00 4.42  ? 102 VAL A C   1 
ATOM   777  O O   . VAL A 1 102 ? 11.654 34.510 37.152 1.00 4.83  ? 102 VAL A O   1 
ATOM   778  C CB  . VAL A 1 102 ? 10.293 32.270 35.848 1.00 6.04  ? 102 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 102 ? 9.047  31.443 35.551 1.00 5.13  ? 102 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 102 ? 11.470 31.822 34.992 1.00 6.18  ? 102 VAL A CG2 1 
ATOM   781  N N   . MET A 1 103 ? 11.760 35.337 35.063 1.00 4.14  ? 103 MET A N   1 
ATOM   782  C CA  . MET A 1 103 ? 12.933 36.133 35.386 1.00 5.70  ? 103 MET A CA  1 
ATOM   783  C C   . MET A 1 103 ? 13.039 37.365 34.500 1.00 6.90  ? 103 MET A C   1 
ATOM   784  O O   . MET A 1 103 ? 12.954 37.267 33.275 1.00 7.19  ? 103 MET A O   1 
ATOM   785  C CB  . MET A 1 103 ? 14.208 35.287 35.252 1.00 6.24  ? 103 MET A CB  1 
ATOM   786  C CG  . MET A 1 103 ? 15.498 36.027 35.606 1.00 6.61  ? 103 MET A CG  1 
ATOM   787  S SD  . MET A 1 103 ? 16.956 34.909 35.579 1.00 10.43 ? 103 MET A SD  1 
ATOM   788  C CE  . MET A 1 103 ? 18.134 35.882 36.481 1.00 8.68  ? 103 MET A CE  1 
ATOM   789  N N   . LEU A 1 104 ? 13.208 38.520 35.143 1.00 6.09  ? 104 LEU A N   1 
ATOM   790  C CA  . LEU A 1 104 ? 13.365 39.806 34.458 1.00 6.12  ? 104 LEU A CA  1 
ATOM   791  C C   . LEU A 1 104 ? 14.641 40.426 34.992 1.00 8.04  ? 104 LEU A C   1 
ATOM   792  O O   . LEU A 1 104 ? 14.912 40.348 36.191 1.00 6.57  ? 104 LEU A O   1 
ATOM   793  C CB  . LEU A 1 104 ? 12.191 40.752 34.769 1.00 7.02  ? 104 LEU A CB  1 
ATOM   794  C CG  . LEU A 1 104 ? 10.797 40.322 34.297 1.00 7.00  ? 104 LEU A CG  1 
ATOM   795  C CD1 . LEU A 1 104 ? 9.819  41.488 34.467 1.00 6.97  ? 104 LEU A CD1 1 
ATOM   796  C CD2 . LEU A 1 104 ? 10.846 39.930 32.825 1.00 10.45 ? 104 LEU A CD2 1 
ATOM   797  N N   . VAL A 1 105 ? 15.434 41.043 34.120 1.00 5.67  ? 105 VAL A N   1 
ATOM   798  C CA  . VAL A 1 105 ? 16.662 41.663 34.603 1.00 8.02  ? 105 VAL A CA  1 
ATOM   799  C C   . VAL A 1 105 ? 16.825 43.075 34.063 1.00 10.24 ? 105 VAL A C   1 
ATOM   800  O O   . VAL A 1 105 ? 16.167 43.460 33.090 1.00 7.07  ? 105 VAL A O   1 
ATOM   801  C CB  . VAL A 1 105 ? 17.919 40.837 34.203 1.00 7.85  ? 105 VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 105 ? 17.724 39.374 34.622 1.00 8.33  ? 105 VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 105 ? 18.166 40.934 32.687 1.00 11.17 ? 105 VAL A CG2 1 
ATOM   804  N N   . GLY A 1 106 ? 17.705 43.830 34.715 1.00 8.93  ? 106 GLY A N   1 
ATOM   805  C CA  . GLY A 1 106 ? 18.014 45.190 34.305 1.00 9.02  ? 106 GLY A CA  1 
ATOM   806  C C   . GLY A 1 106 ? 16.853 46.155 34.216 1.00 11.12 ? 106 GLY A C   1 
ATOM   807  O O   . GLY A 1 106 ? 15.904 46.077 34.997 1.00 10.40 ? 106 GLY A O   1 
ATOM   808  N N   . ASP A 1 107 ? 16.947 47.071 33.249 1.00 11.05 ? 107 ASP A N   1 
ATOM   809  C CA  . ASP A 1 107 ? 15.925 48.086 33.010 1.00 13.04 ? 107 ASP A CA  1 
ATOM   810  C C   . ASP A 1 107 ? 14.520 47.487 32.967 1.00 11.72 ? 107 ASP A C   1 
ATOM   811  O O   . ASP A 1 107 ? 13.592 48.030 33.562 1.00 10.81 ? 107 ASP A O   1 
ATOM   812  C CB  . ASP A 1 107 ? 16.189 48.810 31.676 1.00 16.68 ? 107 ASP A CB  1 
ATOM   813  C CG  . ASP A 1 107 ? 17.441 49.674 31.700 1.00 21.02 ? 107 ASP A CG  1 
ATOM   814  O OD1 . ASP A 1 107 ? 17.832 50.156 30.618 1.00 21.11 ? 107 ASP A OD1 1 
ATOM   815  O OD2 . ASP A 1 107 ? 18.027 49.884 32.781 1.00 18.33 ? 107 ASP A OD2 1 
ATOM   816  N N   . GLY A 1 108 ? 14.368 46.375 32.246 1.00 9.14  ? 108 GLY A N   1 
ATOM   817  C CA  . GLY A 1 108 ? 13.069 45.738 32.134 1.00 8.29  ? 108 GLY A CA  1 
ATOM   818  C C   . GLY A 1 108 ? 12.460 45.323 33.464 1.00 8.09  ? 108 GLY A C   1 
ATOM   819  O O   . GLY A 1 108 ? 11.239 45.313 33.621 1.00 6.73  ? 108 GLY A O   1 
ATOM   820  N N   . ALA A 1 109 ? 13.307 44.965 34.424 1.00 10.51 ? 109 ALA A N   1 
ATOM   821  C CA  . ALA A 1 109 ? 12.833 44.563 35.740 1.00 8.76  ? 109 ALA A CA  1 
ATOM   822  C C   . ALA A 1 109 ? 12.255 45.794 36.453 1.00 8.41  ? 109 ALA A C   1 
ATOM   823  O O   . ALA A 1 109 ? 11.207 45.723 37.097 1.00 7.04  ? 109 ALA A O   1 
ATOM   824  C CB  . ALA A 1 109 ? 13.980 43.977 36.543 1.00 8.68  ? 109 ALA A CB  1 
ATOM   825  N N   . LEU A 1 110 ? 12.945 46.921 36.331 1.00 9.16  ? 110 LEU A N   1 
ATOM   826  C CA  . LEU A 1 110 ? 12.490 48.166 36.949 1.00 8.81  ? 110 LEU A CA  1 
ATOM   827  C C   . LEU A 1 110 ? 11.193 48.628 36.292 1.00 9.46  ? 110 LEU A C   1 
ATOM   828  O O   . LEU A 1 110 ? 10.248 49.035 36.961 1.00 8.88  ? 110 LEU A O   1 
ATOM   829  C CB  . LEU A 1 110 ? 13.566 49.253 36.797 1.00 9.45  ? 110 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 110 ? 13.180 50.670 37.245 1.00 10.96 ? 110 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 110 ? 12.783 50.665 38.709 1.00 8.15  ? 110 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 110 ? 14.351 51.609 37.014 1.00 12.02 ? 110 LEU A CD2 1 
ATOM   833  N N   . GLU A 1 111 ? 11.152 48.569 34.969 1.00 8.75  ? 111 GLU A N   1 
ATOM   834  C CA  . GLU A 1 111 ? 9.963  48.997 34.239 1.00 11.59 ? 111 GLU A CA  1 
ATOM   835  C C   . GLU A 1 111 ? 8.745  48.201 34.699 1.00 10.91 ? 111 GLU A C   1 
ATOM   836  O O   . GLU A 1 111 ? 7.664  48.762 34.908 1.00 7.55  ? 111 GLU A O   1 
ATOM   837  C CB  . GLU A 1 111 ? 10.190 48.826 32.735 1.00 13.30 ? 111 GLU A CB  1 
ATOM   838  C CG  . GLU A 1 111 ? 11.245 49.784 32.173 1.00 17.86 ? 111 GLU A CG  1 
ATOM   839  C CD  . GLU A 1 111 ? 11.748 49.369 30.797 1.00 20.72 ? 111 GLU A CD  1 
ATOM   840  O OE1 . GLU A 1 111 ? 11.154 48.447 30.191 1.00 18.15 ? 111 GLU A OE1 1 
ATOM   841  O OE2 . GLU A 1 111 ? 12.735 49.973 30.323 1.00 22.20 ? 111 GLU A OE2 1 
ATOM   842  N N   . PHE A 1 112 ? 8.922  46.894 34.881 1.00 7.85  ? 112 PHE A N   1 
ATOM   843  C CA  . PHE A 1 112 ? 7.822  46.064 35.333 1.00 9.52  ? 112 PHE A CA  1 
ATOM   844  C C   . PHE A 1 112 ? 7.431  46.467 36.751 1.00 8.06  ? 112 PHE A C   1 
ATOM   845  O O   . PHE A 1 112 ? 6.252  46.701 37.032 1.00 9.37  ? 112 PHE A O   1 
ATOM   846  C CB  . PHE A 1 112 ? 8.211  44.577 35.285 1.00 7.73  ? 112 PHE A CB  1 
ATOM   847  C CG  . PHE A 1 112 ? 7.216  43.676 35.951 1.00 8.13  ? 112 PHE A CG  1 
ATOM   848  C CD1 . PHE A 1 112 ? 5.936  43.525 35.433 1.00 7.29  ? 112 PHE A CD1 1 
ATOM   849  C CD2 . PHE A 1 112 ? 7.557  42.991 37.114 1.00 11.11 ? 112 PHE A CD2 1 
ATOM   850  C CE1 . PHE A 1 112 ? 5.003  42.700 36.062 1.00 9.57  ? 112 PHE A CE1 1 
ATOM   851  C CE2 . PHE A 1 112 ? 6.640  42.164 37.749 1.00 9.32  ? 112 PHE A CE2 1 
ATOM   852  C CZ  . PHE A 1 112 ? 5.356  42.014 37.226 1.00 7.76  ? 112 PHE A CZ  1 
ATOM   853  N N   . ALA A 1 113 ? 8.417  46.567 37.638 1.00 7.40  ? 113 ALA A N   1 
ATOM   854  C CA  . ALA A 1 113 ? 8.155  46.955 39.013 1.00 6.86  ? 113 ALA A CA  1 
ATOM   855  C C   . ALA A 1 113 ? 7.317  48.223 39.058 1.00 9.54  ? 113 ALA A C   1 
ATOM   856  O O   . ALA A 1 113 ? 6.331  48.292 39.786 1.00 5.99  ? 113 ALA A O   1 
ATOM   857  C CB  . ALA A 1 113 ? 9.461  47.173 39.763 1.00 8.93  ? 113 ALA A CB  1 
ATOM   858  N N   . LEU A 1 114 ? 7.706  49.223 38.267 1.00 8.94  ? 114 LEU A N   1 
ATOM   859  C CA  . LEU A 1 114 ? 6.976  50.491 38.251 1.00 9.94  ? 114 LEU A CA  1 
ATOM   860  C C   . LEU A 1 114 ? 5.536  50.295 37.780 1.00 11.38 ? 114 LEU A C   1 
ATOM   861  O O   . LEU A 1 114 ? 4.616  50.887 38.341 1.00 12.73 ? 114 LEU A O   1 
ATOM   862  C CB  . LEU A 1 114 ? 7.703  51.504 37.361 1.00 10.86 ? 114 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 114 ? 9.112  51.872 37.854 1.00 11.16 ? 114 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 114 ? 9.827  52.748 36.834 1.00 9.94  ? 114 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 114 ? 9.012  52.594 39.203 1.00 12.47 ? 114 LEU A CD2 1 
ATOM   866  N N   . SER A 1 115 ? 5.347  49.462 36.756 1.00 10.74 ? 115 SER A N   1 
ATOM   867  C CA  . SER A 1 115 ? 4.015  49.184 36.222 1.00 11.41 ? 115 SER A CA  1 
ATOM   868  C C   . SER A 1 115 ? 3.145  48.520 37.279 1.00 12.07 ? 115 SER A C   1 
ATOM   869  O O   . SER A 1 115 ? 1.912  48.558 37.196 1.00 10.85 ? 115 SER A O   1 
ATOM   870  C CB  . SER A 1 115 ? 4.106  48.269 35.004 1.00 11.15 ? 115 SER A CB  1 
ATOM   871  O OG  . SER A 1 115 ? 4.295  46.918 35.394 1.00 12.30 ? 115 SER A OG  1 
ATOM   872  N N   . GLN A 1 116 ? 3.790  47.914 38.276 1.00 9.34  ? 116 GLN A N   1 
ATOM   873  C CA  . GLN A 1 116 ? 3.071  47.243 39.350 1.00 10.59 ? 116 GLN A CA  1 
ATOM   874  C C   . GLN A 1 116 ? 2.849  48.133 40.569 1.00 11.38 ? 116 GLN A C   1 
ATOM   875  O O   . GLN A 1 116 ? 2.331  47.682 41.589 1.00 11.56 ? 116 GLN A O   1 
ATOM   876  C CB  . GLN A 1 116 ? 3.816  45.969 39.757 1.00 13.05 ? 116 GLN A CB  1 
ATOM   877  C CG  . GLN A 1 116 ? 3.817  44.896 38.660 1.00 13.33 ? 116 GLN A CG  1 
ATOM   878  C CD  . GLN A 1 116 ? 2.415  44.435 38.289 1.00 18.46 ? 116 GLN A CD  1 
ATOM   879  O OE1 . GLN A 1 116 ? 1.681  43.917 39.122 1.00 19.21 ? 116 GLN A OE1 1 
ATOM   880  N NE2 . GLN A 1 116 ? 2.037  44.632 37.033 1.00 19.69 ? 116 GLN A NE2 1 
ATOM   881  N N   . GLY A 1 117 ? 3.246  49.395 40.469 1.00 13.46 ? 117 GLY A N   1 
ATOM   882  C CA  . GLY A 1 117 ? 3.047  50.311 41.578 1.00 12.05 ? 117 GLY A CA  1 
ATOM   883  C C   . GLY A 1 117 ? 4.192  50.461 42.561 1.00 13.60 ? 117 GLY A C   1 
ATOM   884  O O   . GLY A 1 117 ? 4.081  51.215 43.535 1.00 9.22  ? 117 GLY A O   1 
ATOM   885  N N   . PHE A 1 118 ? 5.294  49.754 42.340 1.00 13.62 ? 118 PHE A N   1 
ATOM   886  C CA  . PHE A 1 118 ? 6.421  49.884 43.255 1.00 12.40 ? 118 PHE A CA  1 
ATOM   887  C C   . PHE A 1 118 ? 6.980  51.288 43.064 1.00 12.78 ? 118 PHE A C   1 
ATOM   888  O O   . PHE A 1 118 ? 6.897  51.850 41.971 1.00 13.38 ? 118 PHE A O   1 
ATOM   889  C CB  . PHE A 1 118 ? 7.486  48.826 42.965 1.00 8.36  ? 118 PHE A CB  1 
ATOM   890  C CG  . PHE A 1 118 ? 7.081  47.438 43.378 1.00 9.38  ? 118 PHE A CG  1 
ATOM   891  C CD1 . PHE A 1 118 ? 6.333  46.630 42.523 1.00 9.28  ? 118 PHE A CD1 1 
ATOM   892  C CD2 . PHE A 1 118 ? 7.440  46.942 44.628 1.00 9.71  ? 118 PHE A CD2 1 
ATOM   893  C CE1 . PHE A 1 118 ? 5.943  45.332 42.904 1.00 7.68  ? 118 PHE A CE1 1 
ATOM   894  C CE2 . PHE A 1 118 ? 7.059  45.644 45.026 1.00 10.62 ? 118 PHE A CE2 1 
ATOM   895  C CZ  . PHE A 1 118 ? 6.311  44.840 44.161 1.00 8.12  ? 118 PHE A CZ  1 
ATOM   896  N N   . LYS A 1 119 ? 7.550  51.850 44.122 1.00 13.19 ? 119 LYS A N   1 
ATOM   897  C CA  . LYS A 1 119 ? 8.065  53.211 44.069 1.00 12.78 ? 119 LYS A CA  1 
ATOM   898  C C   . LYS A 1 119 ? 9.572  53.301 43.872 1.00 14.01 ? 119 LYS A C   1 
ATOM   899  O O   . LYS A 1 119 ? 10.352 52.599 44.517 1.00 11.92 ? 119 LYS A O   1 
ATOM   900  C CB  . LYS A 1 119 ? 7.684  53.955 45.351 1.00 17.55 ? 119 LYS A CB  1 
ATOM   901  C CG  . LYS A 1 119 ? 6.181  54.002 45.629 1.00 25.02 ? 119 LYS A CG  1 
ATOM   902  C CD  . LYS A 1 119 ? 5.416  54.801 44.576 1.00 29.22 ? 119 LYS A CD  1 
ATOM   903  C CE  . LYS A 1 119 ? 3.931  54.852 44.899 0.00 28.78 ? 119 LYS A CE  1 
ATOM   904  N NZ  . LYS A 1 119 ? 3.167  55.645 43.897 0.00 30.56 ? 119 LYS A NZ  1 
ATOM   905  N N   . LYS A 1 120 ? 9.968  54.190 42.973 1.00 13.71 ? 120 LYS A N   1 
ATOM   906  C CA  . LYS A 1 120 ? 11.368 54.410 42.683 1.00 14.42 ? 120 LYS A CA  1 
ATOM   907  C C   . LYS A 1 120 ? 11.958 55.135 43.889 1.00 16.10 ? 120 LYS A C   1 
ATOM   908  O O   . LYS A 1 120 ? 11.360 56.086 44.404 1.00 16.85 ? 120 LYS A O   1 
ATOM   909  C CB  . LYS A 1 120 ? 11.480 55.258 41.422 1.00 14.57 ? 120 LYS A CB  1 
ATOM   910  C CG  . LYS A 1 120 ? 12.872 55.493 40.918 1.00 17.21 ? 120 LYS A CG  1 
ATOM   911  C CD  . LYS A 1 120 ? 12.781 56.174 39.568 1.00 20.79 ? 120 LYS A CD  1 
ATOM   912  C CE  . LYS A 1 120 ? 14.139 56.417 38.953 1.00 23.01 ? 120 LYS A CE  1 
ATOM   913  N NZ  . LYS A 1 120 ? 13.959 57.116 37.640 1.00 27.19 ? 120 LYS A NZ  1 
ATOM   914  N N   . GLU A 1 121 ? 13.119 54.681 44.348 1.00 14.45 ? 121 GLU A N   1 
ATOM   915  C CA  . GLU A 1 121 ? 13.769 55.283 45.508 1.00 16.94 ? 121 GLU A CA  1 
ATOM   916  C C   . GLU A 1 121 ? 15.286 55.243 45.362 1.00 17.10 ? 121 GLU A C   1 
ATOM   917  O O   . GLU A 1 121 ? 15.815 54.424 44.614 1.00 15.46 ? 121 GLU A O   1 
ATOM   918  C CB  . GLU A 1 121 ? 13.365 54.543 46.784 1.00 19.94 ? 121 GLU A CB  1 
ATOM   919  C CG  . GLU A 1 121 ? 11.876 54.572 47.068 1.00 21.93 ? 121 GLU A CG  1 
ATOM   920  C CD  . GLU A 1 121 ? 11.538 54.030 48.442 1.00 26.92 ? 121 GLU A CD  1 
ATOM   921  O OE1 . GLU A 1 121 ? 11.661 52.805 48.656 1.00 27.30 ? 121 GLU A OE1 1 
ATOM   922  O OE2 . GLU A 1 121 ? 11.151 54.836 49.313 1.00 27.72 ? 121 GLU A OE2 1 
ATOM   923  N N   . ASN A 1 122 ? 15.979 56.139 46.063 1.00 15.42 ? 122 ASN A N   1 
ATOM   924  C CA  . ASN A 1 122 ? 17.438 56.181 46.007 1.00 14.85 ? 122 ASN A CA  1 
ATOM   925  C C   . ASN A 1 122 ? 17.947 55.186 47.047 1.00 14.33 ? 122 ASN A C   1 
ATOM   926  O O   . ASN A 1 122 ? 17.858 55.435 48.246 1.00 13.98 ? 122 ASN A O   1 
ATOM   927  C CB  . ASN A 1 122 ? 17.948 57.584 46.343 1.00 17.41 ? 122 ASN A CB  1 
ATOM   928  C CG  . ASN A 1 122 ? 19.440 57.737 46.100 1.00 19.88 ? 122 ASN A CG  1 
ATOM   929  O OD1 . ASN A 1 122 ? 20.173 56.752 46.036 1.00 16.57 ? 122 ASN A OD1 1 
ATOM   930  N ND2 . ASN A 1 122 ? 19.899 58.988 45.973 1.00 22.40 ? 122 ASN A ND2 1 
ATOM   931  N N   . LEU A 1 123 ? 18.478 54.058 46.586 1.00 12.59 ? 123 LEU A N   1 
ATOM   932  C CA  . LEU A 1 123 ? 18.964 53.028 47.498 1.00 11.03 ? 123 LEU A CA  1 
ATOM   933  C C   . LEU A 1 123 ? 20.385 53.248 48.001 1.00 12.59 ? 123 LEU A C   1 
ATOM   934  O O   . LEU A 1 123 ? 20.844 52.551 48.914 1.00 10.90 ? 123 LEU A O   1 
ATOM   935  C CB  . LEU A 1 123 ? 18.880 51.649 46.832 1.00 13.37 ? 123 LEU A CB  1 
ATOM   936  C CG  . LEU A 1 123 ? 17.533 51.264 46.212 1.00 10.95 ? 123 LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 123 ? 17.616 49.820 45.704 1.00 13.05 ? 123 LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 123 ? 16.432 51.403 47.237 1.00 11.51 ? 123 LEU A CD2 1 
ATOM   939  N N   . LEU A 1 124 ? 21.086 54.209 47.406 1.00 12.03 ? 124 LEU A N   1 
ATOM   940  C CA  . LEU A 1 124 ? 22.453 54.495 47.812 1.00 12.89 ? 124 LEU A CA  1 
ATOM   941  C C   . LEU A 1 124 ? 22.448 55.460 48.995 1.00 14.44 ? 124 LEU A C   1 
ATOM   942  O O   . LEU A 1 124 ? 22.150 56.643 48.838 1.00 12.88 ? 124 LEU A O   1 
ATOM   943  C CB  . LEU A 1 124 ? 23.244 55.113 46.652 1.00 14.19 ? 124 LEU A CB  1 
ATOM   944  C CG  . LEU A 1 124 ? 24.724 55.364 46.955 1.00 15.03 ? 124 LEU A CG  1 
ATOM   945  C CD1 . LEU A 1 124 ? 25.438 54.035 47.156 1.00 14.82 ? 124 LEU A CD1 1 
ATOM   946  C CD2 . LEU A 1 124 ? 25.368 56.132 45.795 1.00 18.67 ? 124 LEU A CD2 1 
ATOM   947  N N   . THR A 1 125 ? 22.777 54.944 50.176 1.00 13.21 ? 125 THR A N   1 
ATOM   948  C CA  . THR A 1 125 ? 22.819 55.763 51.386 1.00 15.27 ? 125 THR A CA  1 
ATOM   949  C C   . THR A 1 125 ? 24.122 56.554 51.434 1.00 13.42 ? 125 THR A C   1 
ATOM   950  O O   . THR A 1 125 ? 25.072 56.226 50.747 1.00 11.80 ? 125 THR A O   1 
ATOM   951  C CB  . THR A 1 125 ? 22.762 54.895 52.648 1.00 17.67 ? 125 THR A CB  1 
ATOM   952  O OG1 . THR A 1 125 ? 23.811 53.920 52.598 1.00 13.69 ? 125 THR A OG1 1 
ATOM   953  C CG2 . THR A 1 125 ? 21.413 54.203 52.763 1.00 17.87 ? 125 THR A CG2 1 
ATOM   954  N N   . ALA A 1 126 ? 24.163 57.597 52.251 1.00 14.75 ? 126 ALA A N   1 
ATOM   955  C CA  . ALA A 1 126 ? 25.368 58.408 52.363 1.00 15.31 ? 126 ALA A CA  1 
ATOM   956  C C   . ALA A 1 126 ? 26.549 57.527 52.753 1.00 16.04 ? 126 ALA A C   1 
ATOM   957  O O   . ALA A 1 126 ? 27.657 57.700 52.251 1.00 16.77 ? 126 ALA A O   1 
ATOM   958  C CB  . ALA A 1 126 ? 25.164 59.511 53.411 1.00 16.98 ? 126 ALA A CB  1 
ATOM   959  N N   . GLU A 1 127 ? 26.303 56.575 53.649 1.00 16.41 ? 127 GLU A N   1 
ATOM   960  C CA  . GLU A 1 127 ? 27.345 55.671 54.108 1.00 15.69 ? 127 GLU A CA  1 
ATOM   961  C C   . GLU A 1 127 ? 27.906 54.818 52.972 1.00 14.50 ? 127 GLU A C   1 
ATOM   962  O O   . GLU A 1 127 ? 29.116 54.640 52.863 1.00 16.44 ? 127 GLU A O   1 
ATOM   963  C CB  . GLU A 1 127 ? 26.802 54.764 55.223 1.00 18.62 ? 127 GLU A CB  1 
ATOM   964  C CG  . GLU A 1 127 ? 27.769 53.670 55.644 1.00 21.43 ? 127 GLU A CG  1 
ATOM   965  C CD  . GLU A 1 127 ? 27.210 52.788 56.742 1.00 25.58 ? 127 GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 127 ? 26.048 52.332 56.614 1.00 23.61 ? 127 GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 127 ? 27.937 52.543 57.727 1.00 24.31 ? 127 GLU A OE2 1 
ATOM   968  N N   . SER A 1 128 ? 27.033 54.282 52.123 1.00 13.16 ? 128 SER A N   1 
ATOM   969  C CA  . SER A 1 128 ? 27.503 53.458 51.019 1.00 13.86 ? 128 SER A CA  1 
ATOM   970  C C   . SER A 1 128 ? 28.244 54.283 49.977 1.00 13.81 ? 128 SER A C   1 
ATOM   971  O O   . SER A 1 128 ? 29.231 53.823 49.399 1.00 13.16 ? 128 SER A O   1 
ATOM   972  C CB  . SER A 1 128 ? 26.331 52.712 50.367 1.00 12.23 ? 128 SER A CB  1 
ATOM   973  O OG  . SER A 1 128 ? 25.886 51.688 51.232 1.00 14.48 ? 128 SER A OG  1 
ATOM   974  N N   . GLU A 1 129 ? 27.756 55.489 49.719 1.00 13.84 ? 129 GLU A N   1 
ATOM   975  C CA  . GLU A 1 129 ? 28.403 56.354 48.741 1.00 14.99 ? 129 GLU A CA  1 
ATOM   976  C C   . GLU A 1 129 ? 29.810 56.672 49.232 1.00 15.78 ? 129 GLU A C   1 
ATOM   977  O O   . GLU A 1 129 ? 30.764 56.627 48.474 1.00 14.83 ? 129 GLU A O   1 
ATOM   978  C CB  . GLU A 1 129 ? 27.613 57.649 48.561 1.00 18.33 ? 129 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 129 ? 28.211 58.588 47.522 1.00 23.98 ? 129 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 129 ? 27.409 59.861 47.367 1.00 26.28 ? 129 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 129 ? 27.149 60.516 48.396 1.00 28.23 ? 129 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 129 ? 27.045 60.205 46.221 1.00 27.12 ? 129 GLU A OE2 1 
ATOM   983  N N   . LYS A 1 130 ? 29.925 56.980 50.519 1.00 18.73 ? 130 LYS A N   1 
ATOM   984  C CA  . LYS A 1 130 ? 31.213 57.300 51.122 1.00 19.00 ? 130 LYS A CA  1 
ATOM   985  C C   . LYS A 1 130 ? 32.198 56.141 50.984 1.00 19.96 ? 130 LYS A C   1 
ATOM   986  O O   . LYS A 1 130 ? 33.321 56.324 50.508 1.00 20.71 ? 130 LYS A O   1 
ATOM   987  C CB  . LYS A 1 130 ? 31.019 57.648 52.602 1.00 19.38 ? 130 LYS A CB  1 
ATOM   988  C CG  . LYS A 1 130 ? 32.291 58.096 53.314 1.00 25.19 ? 130 LYS A CG  1 
ATOM   989  C CD  . LYS A 1 130 ? 32.036 58.377 54.794 1.00 25.82 ? 130 LYS A CD  1 
ATOM   990  C CE  . LYS A 1 130 ? 33.303 58.840 55.495 0.00 25.01 ? 130 LYS A CE  1 
ATOM   991  N NZ  . LYS A 1 130 ? 33.074 59.107 56.943 0.00 25.18 ? 130 LYS A NZ  1 
ATOM   992  N N   . GLU A 1 131 ? 31.777 54.950 51.400 1.00 19.89 ? 131 GLU A N   1 
ATOM   993  C CA  . GLU A 1 131 ? 32.624 53.765 51.317 1.00 19.85 ? 131 GLU A CA  1 
ATOM   994  C C   . GLU A 1 131 ? 33.022 53.455 49.877 1.00 18.53 ? 131 GLU A C   1 
ATOM   995  O O   . GLU A 1 131 ? 34.141 53.018 49.614 1.00 16.80 ? 131 GLU A O   1 
ATOM   996  C CB  . GLU A 1 131 ? 31.905 52.551 51.910 1.00 21.59 ? 131 GLU A CB  1 
ATOM   997  C CG  . GLU A 1 131 ? 31.927 52.472 53.424 1.00 25.84 ? 131 GLU A CG  1 
ATOM   998  C CD  . GLU A 1 131 ? 31.208 51.236 53.948 1.00 29.79 ? 131 GLU A CD  1 
ATOM   999  O OE1 . GLU A 1 131 ? 31.381 50.145 53.355 1.00 31.40 ? 131 GLU A OE1 1 
ATOM   1000 O OE2 . GLU A 1 131 ? 30.478 51.353 54.954 1.00 32.10 ? 131 GLU A OE2 1 
ATOM   1001 N N   . TRP A 1 132 ? 32.099 53.668 48.945 1.00 16.99 ? 132 TRP A N   1 
ATOM   1002 C CA  . TRP A 1 132 ? 32.388 53.407 47.544 1.00 16.85 ? 132 TRP A CA  1 
ATOM   1003 C C   . TRP A 1 132 ? 33.474 54.352 47.022 1.00 20.18 ? 132 TRP A C   1 
ATOM   1004 O O   . TRP A 1 132 ? 34.435 53.919 46.381 1.00 20.38 ? 132 TRP A O   1 
ATOM   1005 C CB  . TRP A 1 132 ? 31.121 53.564 46.707 1.00 17.28 ? 132 TRP A CB  1 
ATOM   1006 C CG  . TRP A 1 132 ? 31.379 53.572 45.241 1.00 16.98 ? 132 TRP A CG  1 
ATOM   1007 C CD1 . TRP A 1 132 ? 32.004 52.603 44.504 1.00 16.49 ? 132 TRP A CD1 1 
ATOM   1008 C CD2 . TRP A 1 132 ? 31.051 54.623 44.331 1.00 16.44 ? 132 TRP A CD2 1 
ATOM   1009 N NE1 . TRP A 1 132 ? 32.086 52.993 43.189 1.00 14.78 ? 132 TRP A NE1 1 
ATOM   1010 C CE2 . TRP A 1 132 ? 31.508 54.230 43.057 1.00 15.31 ? 132 TRP A CE2 1 
ATOM   1011 C CE3 . TRP A 1 132 ? 30.414 55.864 44.471 1.00 15.68 ? 132 TRP A CE3 1 
ATOM   1012 C CZ2 . TRP A 1 132 ? 31.348 55.036 41.922 1.00 17.24 ? 132 TRP A CZ2 1 
ATOM   1013 C CZ3 . TRP A 1 132 ? 30.254 56.666 43.341 1.00 17.34 ? 132 TRP A CZ3 1 
ATOM   1014 C CH2 . TRP A 1 132 ? 30.721 56.245 42.085 1.00 16.16 ? 132 TRP A CH2 1 
ATOM   1015 N N   . LYS A 1 133 ? 33.316 55.645 47.286 1.00 20.60 ? 133 LYS A N   1 
ATOM   1016 C CA  . LYS A 1 133 ? 34.301 56.619 46.831 1.00 22.97 ? 133 LYS A CA  1 
ATOM   1017 C C   . LYS A 1 133 ? 35.663 56.315 47.441 1.00 22.58 ? 133 LYS A C   1 
ATOM   1018 O O   . LYS A 1 133 ? 36.694 56.484 46.794 1.00 23.68 ? 133 LYS A O   1 
ATOM   1019 C CB  . LYS A 1 133 ? 33.845 58.033 47.191 1.00 24.88 ? 133 LYS A CB  1 
ATOM   1020 C CG  . LYS A 1 133 ? 32.591 58.453 46.426 1.00 25.28 ? 133 LYS A CG  1 
ATOM   1021 C CD  . LYS A 1 133 ? 32.218 59.899 46.689 1.00 28.40 ? 133 LYS A CD  1 
ATOM   1022 C CE  . LYS A 1 133 ? 31.013 60.298 45.845 1.00 30.13 ? 133 LYS A CE  1 
ATOM   1023 N NZ  . LYS A 1 133 ? 30.637 61.716 46.051 1.00 31.68 ? 133 LYS A NZ  1 
ATOM   1024 N N   . GLU A 1 134 ? 35.662 55.847 48.681 1.00 23.17 ? 134 GLU A N   1 
ATOM   1025 C CA  . GLU A 1 134 ? 36.905 55.498 49.357 1.00 25.52 ? 134 GLU A CA  1 
ATOM   1026 C C   . GLU A 1 134 ? 37.519 54.282 48.663 1.00 25.09 ? 134 GLU A C   1 
ATOM   1027 O O   . GLU A 1 134 ? 38.721 54.241 48.409 1.00 22.47 ? 134 GLU A O   1 
ATOM   1028 C CB  . GLU A 1 134 ? 36.628 55.182 50.829 1.00 27.88 ? 134 GLU A CB  1 
ATOM   1029 C CG  . GLU A 1 134 ? 37.838 54.688 51.621 1.00 31.53 ? 134 GLU A CG  1 
ATOM   1030 C CD  . GLU A 1 134 ? 39.049 55.601 51.493 1.00 33.92 ? 134 GLU A CD  1 
ATOM   1031 O OE1 . GLU A 1 134 ? 38.878 56.838 51.544 1.00 34.31 ? 134 GLU A OE1 1 
ATOM   1032 O OE2 . GLU A 1 134 ? 40.174 55.072 51.352 1.00 33.89 ? 134 GLU A OE2 1 
ATOM   1033 N N   . TRP A 1 135 ? 36.681 53.298 48.347 1.00 23.14 ? 135 TRP A N   1 
ATOM   1034 C CA  . TRP A 1 135 ? 37.147 52.087 47.676 1.00 23.50 ? 135 TRP A CA  1 
ATOM   1035 C C   . TRP A 1 135 ? 37.763 52.388 46.309 1.00 22.22 ? 135 TRP A C   1 
ATOM   1036 O O   . TRP A 1 135 ? 38.730 51.743 45.901 1.00 22.58 ? 135 TRP A O   1 
ATOM   1037 C CB  . TRP A 1 135 ? 35.983 51.102 47.490 1.00 21.42 ? 135 TRP A CB  1 
ATOM   1038 C CG  . TRP A 1 135 ? 36.352 49.879 46.708 1.00 20.17 ? 135 TRP A CG  1 
ATOM   1039 C CD1 . TRP A 1 135 ? 36.938 48.745 47.186 1.00 18.53 ? 135 TRP A CD1 1 
ATOM   1040 C CD2 . TRP A 1 135 ? 36.194 49.686 45.298 1.00 17.83 ? 135 TRP A CD2 1 
ATOM   1041 N NE1 . TRP A 1 135 ? 37.155 47.854 46.160 1.00 19.32 ? 135 TRP A NE1 1 
ATOM   1042 C CE2 . TRP A 1 135 ? 36.710 48.408 44.990 1.00 19.27 ? 135 TRP A CE2 1 
ATOM   1043 C CE3 . TRP A 1 135 ? 35.666 50.469 44.264 1.00 20.41 ? 135 TRP A CE3 1 
ATOM   1044 C CZ2 . TRP A 1 135 ? 36.715 47.891 43.686 1.00 19.95 ? 135 TRP A CZ2 1 
ATOM   1045 C CZ3 . TRP A 1 135 ? 35.669 49.956 42.967 1.00 20.41 ? 135 TRP A CZ3 1 
ATOM   1046 C CH2 . TRP A 1 135 ? 36.192 48.677 42.692 1.00 19.37 ? 135 TRP A CH2 1 
ATOM   1047 N N   . LEU A 1 136 ? 37.197 53.366 45.609 1.00 23.46 ? 136 LEU A N   1 
ATOM   1048 C CA  . LEU A 1 136 ? 37.666 53.732 44.275 1.00 26.40 ? 136 LEU A CA  1 
ATOM   1049 C C   . LEU A 1 136 ? 39.141 54.105 44.208 1.00 28.35 ? 136 LEU A C   1 
ATOM   1050 O O   . LEU A 1 136 ? 39.772 53.951 43.169 1.00 28.22 ? 136 LEU A O   1 
ATOM   1051 C CB  . LEU A 1 136 ? 36.824 54.882 43.712 1.00 26.80 ? 136 LEU A CB  1 
ATOM   1052 C CG  . LEU A 1 136 ? 35.456 54.512 43.127 1.00 29.19 ? 136 LEU A CG  1 
ATOM   1053 C CD1 . LEU A 1 136 ? 34.703 55.778 42.745 1.00 31.20 ? 136 LEU A CD1 1 
ATOM   1054 C CD2 . LEU A 1 136 ? 35.647 53.614 41.904 1.00 26.98 ? 136 LEU A CD2 1 
ATOM   1055 N N   . LYS A 1 137 ? 39.693 54.583 45.315 1.00 29.87 ? 137 LYS A N   1 
ATOM   1056 C CA  . LYS A 1 137 ? 41.092 54.983 45.340 1.00 32.66 ? 137 LYS A CA  1 
ATOM   1057 C C   . LYS A 1 137 ? 42.048 53.890 44.841 1.00 33.43 ? 137 LYS A C   1 
ATOM   1058 O O   . LYS A 1 137 ? 42.984 54.177 44.088 1.00 32.89 ? 137 LYS A O   1 
ATOM   1059 C CB  . LYS A 1 137 ? 41.455 55.441 46.754 1.00 35.03 ? 137 LYS A CB  1 
ATOM   1060 C CG  . LYS A 1 137 ? 40.554 56.582 47.230 1.00 37.09 ? 137 LYS A CG  1 
ATOM   1061 C CD  . LYS A 1 137 ? 40.795 56.962 48.680 1.00 39.75 ? 137 LYS A CD  1 
ATOM   1062 C CE  . LYS A 1 137 ? 42.182 57.544 48.887 1.00 41.89 ? 137 LYS A CE  1 
ATOM   1063 N NZ  . LYS A 1 137 ? 42.358 58.063 50.269 1.00 44.83 ? 137 LYS A NZ  1 
ATOM   1064 N N   . THR A 1 138 ? 41.815 52.640 45.235 1.00 31.69 ? 138 THR A N   1 
ATOM   1065 C CA  . THR A 1 138 ? 42.686 51.555 44.789 1.00 31.03 ? 138 THR A CA  1 
ATOM   1066 C C   . THR A 1 138 ? 41.956 50.500 43.960 1.00 29.70 ? 138 THR A C   1 
ATOM   1067 O O   . THR A 1 138 ? 42.586 49.705 43.266 1.00 29.31 ? 138 THR A O   1 
ATOM   1068 C CB  . THR A 1 138 ? 43.389 50.868 45.977 1.00 31.83 ? 138 THR A CB  1 
ATOM   1069 O OG1 . THR A 1 138 ? 42.425 50.172 46.774 1.00 33.35 ? 138 THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 138 ? 44.104 51.903 46.841 1.00 30.65 ? 138 THR A CG2 1 
ATOM   1071 N N   . SER A 1 139 ? 40.629 50.495 44.032 1.00 30.34 ? 139 SER A N   1 
ATOM   1072 C CA  . SER A 1 139 ? 39.816 49.551 43.269 1.00 28.67 ? 139 SER A CA  1 
ATOM   1073 C C   . SER A 1 139 ? 40.294 48.100 43.348 1.00 28.15 ? 139 SER A C   1 
ATOM   1074 O O   . SER A 1 139 ? 40.481 47.439 42.327 1.00 27.59 ? 139 SER A O   1 
ATOM   1075 C CB  . SER A 1 139 ? 39.763 49.981 41.802 1.00 30.45 ? 139 SER A CB  1 
ATOM   1076 O OG  . SER A 1 139 ? 39.179 51.264 41.667 1.00 30.57 ? 139 SER A OG  1 
ATOM   1077 N N   . GLN A 1 140 ? 40.503 47.611 44.561 1.00 28.44 ? 140 GLN A N   1 
ATOM   1078 C CA  . GLN A 1 140 ? 40.937 46.234 44.758 1.00 29.58 ? 140 GLN A CA  1 
ATOM   1079 C C   . GLN A 1 140 ? 39.704 45.388 45.055 1.00 29.08 ? 140 GLN A C   1 
ATOM   1080 O O   . GLN A 1 140 ? 39.082 45.534 46.107 1.00 29.17 ? 140 GLN A O   1 
ATOM   1081 C CB  . GLN A 1 140 ? 41.918 46.146 45.931 1.00 32.82 ? 140 GLN A CB  1 
ATOM   1082 C CG  . GLN A 1 140 ? 43.217 46.898 45.702 1.00 38.31 ? 140 GLN A CG  1 
ATOM   1083 C CD  . GLN A 1 140 ? 44.038 46.290 44.589 1.00 40.80 ? 140 GLN A CD  1 
ATOM   1084 O OE1 . GLN A 1 140 ? 44.495 45.152 44.695 1.00 44.81 ? 140 GLN A OE1 1 
ATOM   1085 N NE2 . GLN A 1 140 ? 44.226 47.041 43.507 1.00 41.43 ? 140 GLN A NE2 1 
ATOM   1086 N N   . TYR A 1 141 ? 39.341 44.515 44.123 1.00 28.16 ? 141 TYR A N   1 
ATOM   1087 C CA  . TYR A 1 141 ? 38.176 43.658 44.312 1.00 26.78 ? 141 TYR A CA  1 
ATOM   1088 C C   . TYR A 1 141 ? 38.610 42.392 45.055 1.00 26.53 ? 141 TYR A C   1 
ATOM   1089 O O   . TYR A 1 141 ? 39.376 41.587 44.525 1.00 23.40 ? 141 TYR A O   1 
ATOM   1090 C CB  . TYR A 1 141 ? 37.566 43.302 42.949 1.00 27.27 ? 141 TYR A CB  1 
ATOM   1091 C CG  . TYR A 1 141 ? 36.298 42.486 43.036 1.00 25.71 ? 141 TYR A CG  1 
ATOM   1092 C CD1 . TYR A 1 141 ? 35.136 43.022 43.597 1.00 24.70 ? 141 TYR A CD1 1 
ATOM   1093 C CD2 . TYR A 1 141 ? 36.266 41.168 42.585 1.00 25.30 ? 141 TYR A CD2 1 
ATOM   1094 C CE1 . TYR A 1 141 ? 33.977 42.261 43.709 1.00 20.12 ? 141 TYR A CE1 1 
ATOM   1095 C CE2 . TYR A 1 141 ? 35.107 40.396 42.692 1.00 22.00 ? 141 TYR A CE2 1 
ATOM   1096 C CZ  . TYR A 1 141 ? 33.972 40.947 43.257 1.00 21.76 ? 141 TYR A CZ  1 
ATOM   1097 O OH  . TYR A 1 141 ? 32.843 40.173 43.402 1.00 18.96 ? 141 TYR A OH  1 
ATOM   1098 N N   . LYS A 1 142 ? 38.126 42.228 46.283 1.00 25.90 ? 142 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 142 ? 38.471 41.065 47.101 1.00 29.85 ? 142 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 142 ? 37.277 40.577 47.923 1.00 31.12 ? 142 LYS A C   1 
ATOM   1101 O O   . LYS A 1 142 ? 37.193 40.832 49.128 1.00 30.29 ? 142 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 142 ? 39.635 41.405 48.040 1.00 30.60 ? 142 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 142 ? 40.928 41.764 47.327 0.00 31.42 ? 142 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 142 ? 42.043 42.052 48.319 0.00 31.54 ? 142 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 142 ? 43.341 42.394 47.606 0.00 31.52 ? 142 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 142 ? 44.445 42.671 48.566 0.00 31.85 ? 142 LYS A NZ  1 
ATOM   1107 N N   . PRO A 1 143 ? 36.345 39.853 47.277 1.00 32.76 ? 143 PRO A N   1 
ATOM   1108 C CA  . PRO A 1 143 ? 35.128 39.296 47.881 1.00 33.17 ? 143 PRO A CA  1 
ATOM   1109 C C   . PRO A 1 143 ? 35.363 38.532 49.180 1.00 32.96 ? 143 PRO A C   1 
ATOM   1110 O O   . PRO A 1 143 ? 35.963 37.456 49.177 1.00 32.70 ? 143 PRO A O   1 
ATOM   1111 C CB  . PRO A 1 143 ? 34.593 38.369 46.794 1.00 34.49 ? 143 PRO A CB  1 
ATOM   1112 C CG  . PRO A 1 143 ? 35.064 38.998 45.548 1.00 36.19 ? 143 PRO A CG  1 
ATOM   1113 C CD  . PRO A 1 143 ? 36.477 39.399 45.882 1.00 34.85 ? 143 PRO A CD  1 
ATOM   1114 N N   . ILE A 1 144 ? 34.875 39.081 50.285 1.00 30.67 ? 144 ILE A N   1 
ATOM   1115 C CA  . ILE A 1 144 ? 35.017 38.434 51.582 1.00 30.54 ? 144 ILE A CA  1 
ATOM   1116 C C   . ILE A 1 144 ? 33.622 38.142 52.132 1.00 28.51 ? 144 ILE A C   1 
ATOM   1117 O O   . ILE A 1 144 ? 32.748 39.010 52.117 1.00 26.05 ? 144 ILE A O   1 
ATOM   1118 C CB  . ILE A 1 144 ? 35.798 39.337 52.561 1.00 33.69 ? 144 ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 144 ? 35.698 38.784 53.983 1.00 37.37 ? 144 ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 144 ? 35.289 40.762 52.456 1.00 36.13 ? 144 ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 144 ? 36.447 39.603 55.024 1.00 39.76 ? 144 ILE A CD1 1 
ATOM   1122 N N   . VAL A 1 145 ? 33.421 36.918 52.612 1.00 27.79 ? 145 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 145 ? 32.125 36.497 53.144 1.00 29.80 ? 145 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 145 ? 32.101 36.271 54.667 1.00 31.19 ? 145 VAL A C   1 
ATOM   1125 O O   . VAL A 1 145 ? 32.871 35.474 55.203 1.00 33.06 ? 145 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 145 ? 31.644 35.187 52.436 1.00 27.91 ? 145 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 145 ? 30.403 34.624 53.134 1.00 25.23 ? 145 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 145 ? 31.337 35.465 50.966 1.00 23.30 ? 145 VAL A CG2 1 
ATOM   1129 N N   . ASN A 1 146 ? 31.213 36.996 55.344 1.00 30.84 ? 146 ASN A N   1 
ATOM   1130 C CA  . ASN A 1 146 ? 30.998 36.895 56.790 1.00 30.19 ? 146 ASN A CA  1 
ATOM   1131 C C   . ASN A 1 146 ? 30.007 37.971 57.223 1.00 30.05 ? 146 ASN A C   1 
ATOM   1132 O O   . ASN A 1 146 ? 29.586 38.776 56.397 1.00 28.35 ? 146 ASN A O   1 
ATOM   1133 C CB  . ASN A 1 146 ? 32.320 36.969 57.583 1.00 28.74 ? 146 ASN A CB  1 
ATOM   1134 C CG  . ASN A 1 146 ? 33.170 38.184 57.244 1.00 29.06 ? 146 ASN A CG  1 
ATOM   1135 O OD1 . ASN A 1 146 ? 34.368 38.056 56.981 1.00 28.96 ? 146 ASN A OD1 1 
ATOM   1136 N ND2 . ASN A 1 146 ? 32.572 39.363 57.283 1.00 23.02 ? 146 ASN A ND2 1 
ATOM   1137 N N   . ILE A 1 147 ? 29.610 37.977 58.496 1.00 32.83 ? 147 ILE A N   1 
ATOM   1138 C CA  . ILE A 1 147 ? 28.627 38.952 58.971 1.00 33.16 ? 147 ILE A CA  1 
ATOM   1139 C C   . ILE A 1 147 ? 29.001 40.375 58.561 1.00 34.43 ? 147 ILE A C   1 
ATOM   1140 O O   . ILE A 1 147 ? 28.132 41.216 58.318 1.00 32.96 ? 147 ILE A O   1 
ATOM   1141 C CB  . ILE A 1 147 ? 28.427 38.868 60.505 1.00 35.14 ? 147 ILE A CB  1 
ATOM   1142 C CG1 . ILE A 1 147 ? 27.112 39.556 60.882 1.00 35.32 ? 147 ILE A CG1 1 
ATOM   1143 C CG2 . ILE A 1 147 ? 29.601 39.503 61.233 1.00 34.87 ? 147 ILE A CG2 1 
ATOM   1144 C CD1 . ILE A 1 147 ? 25.890 38.967 60.173 1.00 34.48 ? 147 ILE A CD1 1 
ATOM   1145 N N   . GLU A 1 148 ? 30.298 40.647 58.501 1.00 35.53 ? 148 GLU A N   1 
ATOM   1146 C CA  . GLU A 1 148 ? 30.759 41.943 58.035 1.00 36.94 ? 148 GLU A CA  1 
ATOM   1147 C C   . GLU A 1 148 ? 31.022 41.618 56.569 1.00 36.61 ? 148 GLU A C   1 
ATOM   1148 O O   . GLU A 1 148 ? 30.989 40.454 56.183 1.00 40.56 ? 148 GLU A O   1 
ATOM   1149 C CB  . GLU A 1 148 ? 32.058 42.356 58.738 1.00 38.02 ? 148 GLU A CB  1 
ATOM   1150 C CG  . GLU A 1 148 ? 31.901 42.640 60.223 1.00 40.30 ? 148 GLU A CG  1 
ATOM   1151 C CD  . GLU A 1 148 ? 33.191 43.114 60.863 0.00 41.30 ? 148 GLU A CD  1 
ATOM   1152 O OE1 . GLU A 1 148 ? 33.721 44.159 60.431 0.00 42.16 ? 148 GLU A OE1 1 
ATOM   1153 O OE2 . GLU A 1 148 ? 33.675 42.442 61.798 0.00 42.16 ? 148 GLU A OE2 1 
ATOM   1154 N N   . ASN A 1 149 ? 31.259 42.612 55.734 1.00 36.31 ? 149 ASN A N   1 
ATOM   1155 C CA  . ASN A 1 149 ? 31.517 42.306 54.333 1.00 33.07 ? 149 ASN A CA  1 
ATOM   1156 C C   . ASN A 1 149 ? 30.312 41.650 53.649 1.00 31.20 ? 149 ASN A C   1 
ATOM   1157 O O   . ASN A 1 149 ? 29.166 42.025 53.913 1.00 31.13 ? 149 ASN A O   1 
ATOM   1158 C CB  . ASN A 1 149 ? 32.740 41.395 54.222 1.00 31.72 ? 149 ASN A CB  1 
ATOM   1159 C CG  . ASN A 1 149 ? 33.928 41.929 54.999 1.00 30.99 ? 149 ASN A CG  1 
ATOM   1160 O OD1 . ASN A 1 149 ? 34.198 41.500 56.121 1.00 28.25 ? 149 ASN A OD1 1 
ATOM   1161 N ND2 . ASN A 1 149 ? 34.632 42.887 54.410 1.00 30.01 ? 149 ASN A ND2 1 
ATOM   1162 N N   . HIS A 1 150 ? 30.563 40.656 52.796 1.00 26.64 ? 150 HIS A N   1 
ATOM   1163 C CA  . HIS A 1 150 ? 29.468 40.025 52.057 1.00 23.79 ? 150 HIS A CA  1 
ATOM   1164 C C   . HIS A 1 150 ? 28.634 38.930 52.686 1.00 22.01 ? 150 HIS A C   1 
ATOM   1165 O O   . HIS A 1 150 ? 29.126 38.036 53.371 1.00 19.39 ? 150 HIS A O   1 
ATOM   1166 C CB  . HIS A 1 150 ? 29.951 39.500 50.702 1.00 21.92 ? 150 HIS A CB  1 
ATOM   1167 C CG  . HIS A 1 150 ? 28.831 39.087 49.794 1.00 18.88 ? 150 HIS A CG  1 
ATOM   1168 N ND1 . HIS A 1 150 ? 28.488 37.768 49.577 1.00 19.68 ? 150 HIS A ND1 1 
ATOM   1169 C CD2 . HIS A 1 150 ? 27.947 39.827 49.084 1.00 18.53 ? 150 HIS A CD2 1 
ATOM   1170 C CE1 . HIS A 1 150 ? 27.443 37.715 48.770 1.00 19.40 ? 150 HIS A CE1 1 
ATOM   1171 N NE2 . HIS A 1 150 ? 27.094 38.950 48.456 1.00 21.92 ? 150 HIS A NE2 1 
ATOM   1172 N N   . ASN A 1 151 ? 27.341 39.028 52.414 1.00 21.46 ? 151 ASN A N   1 
ATOM   1173 C CA  . ASN A 1 151 ? 26.355 38.066 52.851 1.00 21.33 ? 151 ASN A CA  1 
ATOM   1174 C C   . ASN A 1 151 ? 25.084 38.378 52.072 1.00 19.37 ? 151 ASN A C   1 
ATOM   1175 O O   . ASN A 1 151 ? 25.079 39.250 51.201 1.00 17.53 ? 151 ASN A O   1 
ATOM   1176 C CB  . ASN A 1 151 ? 26.121 38.125 54.371 1.00 21.70 ? 151 ASN A CB  1 
ATOM   1177 C CG  . ASN A 1 151 ? 25.843 39.514 54.873 1.00 24.70 ? 151 ASN A CG  1 
ATOM   1178 O OD1 . ASN A 1 151 ? 26.550 40.017 55.752 1.00 28.88 ? 151 ASN A OD1 1 
ATOM   1179 N ND2 . ASN A 1 151 ? 24.809 40.144 54.338 1.00 26.19 ? 151 ASN A ND2 1 
ATOM   1180 N N   . THR A 1 152 ? 24.021 37.656 52.383 1.00 17.20 ? 152 THR A N   1 
ATOM   1181 C CA  . THR A 1 152 ? 22.739 37.807 51.705 1.00 13.29 ? 152 THR A CA  1 
ATOM   1182 C C   . THR A 1 152 ? 21.768 37.171 52.679 1.00 10.06 ? 152 THR A C   1 
ATOM   1183 O O   . THR A 1 152 ? 22.186 36.634 53.693 1.00 12.13 ? 152 THR A O   1 
ATOM   1184 C CB  . THR A 1 152 ? 22.673 36.933 50.444 1.00 12.75 ? 152 THR A CB  1 
ATOM   1185 O OG1 . THR A 1 152 ? 22.770 35.551 50.836 1.00 12.96 ? 152 THR A OG1 1 
ATOM   1186 C CG2 . THR A 1 152 ? 23.815 37.246 49.489 1.00 14.14 ? 152 THR A CG2 1 
ATOM   1187 N N   . ILE A 1 153 ? 20.476 37.245 52.397 1.00 10.20 ? 153 ILE A N   1 
ATOM   1188 C CA  . ILE A 1 153 ? 19.564 36.535 53.264 1.00 10.34 ? 153 ILE A CA  1 
ATOM   1189 C C   . ILE A 1 153 ? 18.751 35.570 52.426 1.00 10.42 ? 153 ILE A C   1 
ATOM   1190 O O   . ILE A 1 153 ? 18.197 35.935 51.394 1.00 9.52  ? 153 ILE A O   1 
ATOM   1191 C CB  . ILE A 1 153 ? 18.611 37.439 54.078 1.00 11.47 ? 153 ILE A CB  1 
ATOM   1192 C CG1 . ILE A 1 153 ? 17.738 36.533 54.965 1.00 10.85 ? 153 ILE A CG1 1 
ATOM   1193 C CG2 . ILE A 1 153 ? 17.741 38.290 53.161 1.00 12.01 ? 153 ILE A CG2 1 
ATOM   1194 C CD1 . ILE A 1 153 ? 16.926 37.264 56.028 1.00 15.05 ? 153 ILE A CD1 1 
ATOM   1195 N N   . GLY A 1 154 ? 18.736 34.320 52.869 1.00 8.23  ? 154 GLY A N   1 
ATOM   1196 C CA  . GLY A 1 154 ? 17.966 33.294 52.202 1.00 5.36  ? 154 GLY A CA  1 
ATOM   1197 C C   . GLY A 1 154 ? 17.082 32.781 53.318 1.00 8.20  ? 154 GLY A C   1 
ATOM   1198 O O   . GLY A 1 154 ? 17.552 32.637 54.453 1.00 5.49  ? 154 GLY A O   1 
ATOM   1199 N N   . MET A 1 155 ? 15.808 32.540 53.025 1.00 6.47  ? 155 MET A N   1 
ATOM   1200 C CA  . MET A 1 155 ? 14.885 32.044 54.042 1.00 5.21  ? 155 MET A CA  1 
ATOM   1201 C C   . MET A 1 155 ? 13.983 30.957 53.451 1.00 6.19  ? 155 MET A C   1 
ATOM   1202 O O   . MET A 1 155 ? 13.501 31.083 52.327 1.00 5.02  ? 155 MET A O   1 
ATOM   1203 C CB  . MET A 1 155 ? 14.022 33.197 54.579 1.00 5.55  ? 155 MET A CB  1 
ATOM   1204 C CG  . MET A 1 155 ? 12.930 32.749 55.554 1.00 6.87  ? 155 MET A CG  1 
ATOM   1205 S SD  . MET A 1 155 ? 11.980 34.156 56.197 1.00 10.89 ? 155 MET A SD  1 
ATOM   1206 C CE  . MET A 1 155 ? 13.169 34.829 57.453 1.00 10.33 ? 155 MET A CE  1 
ATOM   1207 N N   . ILE A 1 156 ? 13.779 29.879 54.206 1.00 5.30  ? 156 ILE A N   1 
ATOM   1208 C CA  . ILE A 1 156 ? 12.916 28.787 53.770 1.00 5.36  ? 156 ILE A CA  1 
ATOM   1209 C C   . ILE A 1 156 ? 12.022 28.420 54.951 1.00 7.70  ? 156 ILE A C   1 
ATOM   1210 O O   . ILE A 1 156 ? 12.445 28.478 56.109 1.00 8.70  ? 156 ILE A O   1 
ATOM   1211 C CB  . ILE A 1 156 ? 13.726 27.541 53.341 1.00 7.40  ? 156 ILE A CB  1 
ATOM   1212 C CG1 . ILE A 1 156 ? 14.722 27.156 54.445 1.00 8.60  ? 156 ILE A CG1 1 
ATOM   1213 C CG2 . ILE A 1 156 ? 14.459 27.813 52.020 1.00 5.21  ? 156 ILE A CG2 1 
ATOM   1214 C CD1 . ILE A 1 156 ? 15.558 25.921 54.109 1.00 6.87  ? 156 ILE A CD1 1 
ATOM   1215 N N   . ALA A 1 157 ? 10.785 28.043 54.660 1.00 5.82  ? 157 ALA A N   1 
ATOM   1216 C CA  . ALA A 1 157 ? 9.853  27.707 55.719 1.00 5.76  ? 157 ALA A CA  1 
ATOM   1217 C C   . ALA A 1 157 ? 8.855  26.638 55.321 1.00 5.61  ? 157 ALA A C   1 
ATOM   1218 O O   . ALA A 1 157 ? 8.574  26.428 54.133 1.00 6.16  ? 157 ALA A O   1 
ATOM   1219 C CB  . ALA A 1 157 ? 9.108  28.958 56.143 1.00 5.04  ? 157 ALA A CB  1 
ATOM   1220 N N   . LEU A 1 158 ? 8.326  25.977 56.346 1.00 6.49  ? 158 LEU A N   1 
ATOM   1221 C CA  . LEU A 1 158 ? 7.311  24.951 56.214 1.00 6.47  ? 158 LEU A CA  1 
ATOM   1222 C C   . LEU A 1 158 ? 6.145  25.514 57.039 1.00 8.13  ? 158 LEU A C   1 
ATOM   1223 O O   . LEU A 1 158 ? 6.305  25.802 58.239 1.00 8.97  ? 158 LEU A O   1 
ATOM   1224 C CB  . LEU A 1 158 ? 7.826  23.644 56.818 1.00 7.52  ? 158 LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 158 ? 6.877  22.445 56.813 1.00 5.41  ? 158 LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 158 ? 6.528  22.057 55.394 1.00 7.42  ? 158 LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 158 ? 7.541  21.282 57.534 1.00 6.96  ? 158 LEU A CD2 1 
ATOM   1228 N N   . ASP A 1 159 ? 4.993  25.728 56.412 1.00 5.95  ? 159 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 159 ? 3.874  26.300 57.161 1.00 7.31  ? 159 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 159 ? 2.948  25.271 57.797 1.00 6.10  ? 159 ASP A C   1 
ATOM   1231 O O   . ASP A 1 159 ? 3.168  24.070 57.692 1.00 7.10  ? 159 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 159 ? 3.052  27.248 56.277 1.00 6.54  ? 159 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 159 ? 2.435  26.554 55.082 1.00 5.62  ? 159 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 159 ? 2.142  25.329 55.155 1.00 7.33  ? 159 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 159 ? 2.234  27.247 54.067 1.00 7.83  ? 159 ASP A OD2 1 
ATOM   1236 N N   . ALA A 1 160 ? 1.897  25.755 58.449 1.00 9.90  ? 160 ALA A N   1 
ATOM   1237 C CA  . ALA A 1 160 ? 0.933  24.876 59.119 1.00 11.39 ? 160 ALA A CA  1 
ATOM   1238 C C   . ALA A 1 160 ? 0.273  23.858 58.178 1.00 11.83 ? 160 ALA A C   1 
ATOM   1239 O O   . ALA A 1 160 ? -0.139 22.780 58.616 1.00 9.88  ? 160 ALA A O   1 
ATOM   1240 C CB  . ALA A 1 160 ? -0.148 25.726 59.822 1.00 12.53 ? 160 ALA A CB  1 
ATOM   1241 N N   . GLN A 1 161 ? 0.186  24.180 56.890 1.00 9.00  ? 161 GLN A N   1 
ATOM   1242 C CA  . GLN A 1 161 ? -0.429 23.261 55.931 1.00 11.02 ? 161 GLN A CA  1 
ATOM   1243 C C   . GLN A 1 161 ? 0.560  22.209 55.448 1.00 12.14 ? 161 GLN A C   1 
ATOM   1244 O O   . GLN A 1 161 ? 0.198  21.309 54.692 1.00 12.05 ? 161 GLN A O   1 
ATOM   1245 C CB  . GLN A 1 161 ? -0.944 24.018 54.706 1.00 15.24 ? 161 GLN A CB  1 
ATOM   1246 C CG  . GLN A 1 161 ? -2.040 25.028 54.972 1.00 17.28 ? 161 GLN A CG  1 
ATOM   1247 C CD  . GLN A 1 161 ? -2.242 25.970 53.787 1.00 21.39 ? 161 GLN A CD  1 
ATOM   1248 O OE1 . GLN A 1 161 ? -2.778 25.580 52.747 1.00 19.80 ? 161 GLN A OE1 1 
ATOM   1249 N NE2 . GLN A 1 161 ? -1.794 27.212 53.940 1.00 19.65 ? 161 GLN A NE2 1 
ATOM   1250 N N   . GLY A 1 162 ? 1.812  22.328 55.871 1.00 9.84  ? 162 GLY A N   1 
ATOM   1251 C CA  . GLY A 1 162 ? 2.817  21.383 55.431 1.00 9.08  ? 162 GLY A CA  1 
ATOM   1252 C C   . GLY A 1 162 ? 3.389  21.793 54.081 1.00 7.65  ? 162 GLY A C   1 
ATOM   1253 O O   . GLY A 1 162 ? 3.951  20.958 53.366 1.00 9.87  ? 162 GLY A O   1 
ATOM   1254 N N   . ASN A 1 163 ? 3.233  23.066 53.723 1.00 8.36  ? 163 ASN A N   1 
ATOM   1255 C CA  . ASN A 1 163 ? 3.755  23.572 52.450 1.00 6.06  ? 163 ASN A CA  1 
ATOM   1256 C C   . ASN A 1 163 ? 5.059  24.345 52.655 1.00 8.95  ? 163 ASN A C   1 
ATOM   1257 O O   . ASN A 1 163 ? 5.217  25.072 53.629 1.00 6.57  ? 163 ASN A O   1 
ATOM   1258 C CB  . ASN A 1 163 ? 2.727  24.477 51.755 1.00 6.09  ? 163 ASN A CB  1 
ATOM   1259 C CG  . ASN A 1 163 ? 1.510  23.713 51.260 1.00 9.84  ? 163 ASN A CG  1 
ATOM   1260 O OD1 . ASN A 1 163 ? 1.625  22.586 50.788 1.00 8.64  ? 163 ASN A OD1 1 
ATOM   1261 N ND2 . ASN A 1 163 ? 0.340  24.336 51.346 1.00 11.47 ? 163 ASN A ND2 1 
ATOM   1262 N N   . LEU A 1 164 ? 5.983  24.175 51.716 1.00 6.88  ? 164 LEU A N   1 
ATOM   1263 C CA  . LEU A 1 164 ? 7.277  24.826 51.758 1.00 8.43  ? 164 LEU A CA  1 
ATOM   1264 C C   . LEU A 1 164 ? 7.332  26.019 50.800 1.00 8.01  ? 164 LEU A C   1 
ATOM   1265 O O   . LEU A 1 164 ? 6.603  26.059 49.813 1.00 7.04  ? 164 LEU A O   1 
ATOM   1266 C CB  . LEU A 1 164 ? 8.358  23.821 51.346 1.00 5.68  ? 164 LEU A CB  1 
ATOM   1267 C CG  . LEU A 1 164 ? 8.612  22.629 52.277 1.00 6.33  ? 164 LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1 164 ? 9.161  21.461 51.482 1.00 9.52  ? 164 LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1 164 ? 9.594  23.052 53.373 1.00 7.18  ? 164 LEU A CD2 1 
ATOM   1270 N N   . SER A 1 165 ? 8.184  26.994 51.119 1.00 5.14  ? 165 SER A N   1 
ATOM   1271 C CA  . SER A 1 165 ? 8.405  28.156 50.261 1.00 4.85  ? 165 SER A CA  1 
ATOM   1272 C C   . SER A 1 165 ? 9.733  28.774 50.654 1.00 4.22  ? 165 SER A C   1 
ATOM   1273 O O   . SER A 1 165 ? 10.265 28.494 51.728 1.00 4.87  ? 165 SER A O   1 
ATOM   1274 C CB  . SER A 1 165 ? 7.279  29.188 50.383 1.00 5.53  ? 165 SER A CB  1 
ATOM   1275 O OG  . SER A 1 165 ? 6.070  28.691 49.818 1.00 6.36  ? 165 SER A OG  1 
ATOM   1276 N N   . GLY A 1 166 ? 10.276 29.615 49.786 1.00 5.39  ? 166 GLY A N   1 
ATOM   1277 C CA  . GLY A 1 166 ? 11.550 30.228 50.109 1.00 6.27  ? 166 GLY A CA  1 
ATOM   1278 C C   . GLY A 1 166 ? 11.756 31.534 49.386 1.00 5.21  ? 166 GLY A C   1 
ATOM   1279 O O   . GLY A 1 166 ? 11.068 31.827 48.415 1.00 1.89  ? 166 GLY A O   1 
ATOM   1280 N N   . ALA A 1 167 ? 12.710 32.317 49.870 1.00 4.02  ? 167 ALA A N   1 
ATOM   1281 C CA  . ALA A 1 167 ? 13.010 33.612 49.288 1.00 4.02  ? 167 ALA A CA  1 
ATOM   1282 C C   . ALA A 1 167 ? 14.493 33.900 49.484 1.00 3.75  ? 167 ALA A C   1 
ATOM   1283 O O   . ALA A 1 167 ? 15.093 33.483 50.484 1.00 6.65  ? 167 ALA A O   1 
ATOM   1284 C CB  . ALA A 1 167 ? 12.164 34.704 49.981 1.00 6.04  ? 167 ALA A CB  1 
ATOM   1285 N N   . CYS A 1 168 ? 15.082 34.619 48.537 1.00 4.99  ? 168 CYS A N   1 
ATOM   1286 C CA  . CYS A 1 168 ? 16.502 34.948 48.616 1.00 6.80  ? 168 CYS A CA  1 
ATOM   1287 C C   . CYS A 1 168 ? 16.661 36.349 48.031 1.00 8.03  ? 168 CYS A C   1 
ATOM   1288 O O   . CYS A 1 168 ? 16.133 36.638 46.955 1.00 8.76  ? 168 CYS A O   1 
ATOM   1289 C CB  . CYS A 1 168 ? 17.324 33.920 47.815 1.00 8.71  ? 168 CYS A CB  1 
ATOM   1290 S SG  . CYS A 1 168 ? 19.094 34.006 48.149 1.00 12.74 ? 168 CYS A SG  1 
ATOM   1291 N N   . THR A 1 169 ? 17.374 37.220 48.735 1.00 6.77  ? 169 THR A N   1 
ATOM   1292 C CA  . THR A 1 169 ? 17.547 38.581 48.247 1.00 7.20  ? 169 THR A CA  1 
ATOM   1293 C C   . THR A 1 169 ? 18.886 39.175 48.693 1.00 8.44  ? 169 THR A C   1 
ATOM   1294 O O   . THR A 1 169 ? 19.352 38.923 49.804 1.00 8.50  ? 169 THR A O   1 
ATOM   1295 C CB  . THR A 1 169 ? 16.353 39.447 48.723 1.00 5.49  ? 169 THR A CB  1 
ATOM   1296 O OG1 . THR A 1 169 ? 16.520 40.801 48.297 1.00 6.45  ? 169 THR A OG1 1 
ATOM   1297 C CG2 . THR A 1 169 ? 16.237 39.398 50.243 1.00 8.75  ? 169 THR A CG2 1 
ATOM   1298 N N   . THR A 1 170 ? 19.503 39.962 47.818 1.00 8.59  ? 170 THR A N   1 
ATOM   1299 C CA  . THR A 1 170 ? 20.802 40.559 48.123 1.00 8.32  ? 170 THR A CA  1 
ATOM   1300 C C   . THR A 1 170 ? 21.098 41.757 47.230 1.00 7.52  ? 170 THR A C   1 
ATOM   1301 O O   . THR A 1 170 ? 20.387 42.016 46.264 1.00 7.60  ? 170 THR A O   1 
ATOM   1302 C CB  . THR A 1 170 ? 21.944 39.543 47.893 1.00 7.58  ? 170 THR A CB  1 
ATOM   1303 O OG1 . THR A 1 170 ? 23.205 40.148 48.217 1.00 12.56 ? 170 THR A OG1 1 
ATOM   1304 C CG2 . THR A 1 170 ? 21.987 39.127 46.428 1.00 10.35 ? 170 THR A CG2 1 
ATOM   1305 N N   . SER A 1 171 ? 22.149 42.491 47.570 1.00 6.56  ? 171 SER A N   1 
ATOM   1306 C CA  . SER A 1 171 ? 22.574 43.620 46.751 1.00 8.74  ? 171 SER A CA  1 
ATOM   1307 C C   . SER A 1 171 ? 23.845 43.144 46.059 1.00 8.26  ? 171 SER A C   1 
ATOM   1308 O O   . SER A 1 171 ? 24.522 43.903 45.358 1.00 8.02  ? 171 SER A O   1 
ATOM   1309 C CB  . SER A 1 171 ? 22.834 44.879 47.598 1.00 8.06  ? 171 SER A CB  1 
ATOM   1310 O OG  . SER A 1 171 ? 23.743 44.632 48.640 1.00 11.40 ? 171 SER A OG  1 
ATOM   1311 N N   . GLY A 1 172 ? 24.159 41.867 46.274 1.00 8.74  ? 172 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 172 ? 25.317 41.263 45.638 1.00 8.42  ? 172 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 172 ? 26.675 41.690 46.159 1.00 7.82  ? 172 GLY A C   1 
ATOM   1314 O O   . GLY A 1 172 ? 26.773 42.478 47.091 1.00 7.71  ? 172 GLY A O   1 
ATOM   1315 N N   . MET A 1 173 ? 27.727 41.158 45.547 1.00 9.39  ? 173 MET A N   1 
ATOM   1316 C CA  . MET A 1 173 ? 29.105 41.456 45.944 1.00 12.88 ? 173 MET A CA  1 
ATOM   1317 C C   . MET A 1 173 ? 29.438 42.935 45.820 1.00 11.79 ? 173 MET A C   1 
ATOM   1318 O O   . MET A 1 173 ? 29.316 43.515 44.749 1.00 11.40 ? 173 MET A O   1 
ATOM   1319 C CB  . MET A 1 173 ? 30.098 40.659 45.082 1.00 16.25 ? 173 MET A CB  1 
ATOM   1320 C CG  . MET A 1 173 ? 30.069 39.154 45.283 1.00 29.67 ? 173 MET A CG  1 
ATOM   1321 S SD  . MET A 1 173 ? 30.387 38.620 46.992 1.00 40.62 ? 173 MET A SD  1 
ATOM   1322 C CE  . MET A 1 173 ? 31.736 39.702 47.458 1.00 33.32 ? 173 MET A CE  1 
ATOM   1323 N N   . ALA A 1 174 ? 29.866 43.542 46.917 1.00 10.15 ? 174 ALA A N   1 
ATOM   1324 C CA  . ALA A 1 174 ? 30.227 44.953 46.893 1.00 12.21 ? 174 ALA A CA  1 
ATOM   1325 C C   . ALA A 1 174 ? 31.264 45.236 45.796 1.00 8.86  ? 174 ALA A C   1 
ATOM   1326 O O   . ALA A 1 174 ? 32.232 44.487 45.635 1.00 10.55 ? 174 ALA A O   1 
ATOM   1327 C CB  . ALA A 1 174 ? 30.789 45.361 48.255 1.00 13.73 ? 174 ALA A CB  1 
ATOM   1328 N N   . TYR A 1 175 ? 31.045 46.304 45.036 1.00 8.99  ? 175 TYR A N   1 
ATOM   1329 C CA  . TYR A 1 175 ? 31.984 46.722 43.987 1.00 8.89  ? 175 TYR A CA  1 
ATOM   1330 C C   . TYR A 1 175 ? 32.193 45.736 42.843 1.00 9.95  ? 175 TYR A C   1 
ATOM   1331 O O   . TYR A 1 175 ? 33.254 45.691 42.210 1.00 10.59 ? 175 TYR A O   1 
ATOM   1332 C CB  . TYR A 1 175 ? 33.314 47.093 44.648 1.00 11.50 ? 175 TYR A CB  1 
ATOM   1333 C CG  . TYR A 1 175 ? 33.080 47.889 45.909 1.00 11.38 ? 175 TYR A CG  1 
ATOM   1334 C CD1 . TYR A 1 175 ? 33.686 47.524 47.112 1.00 14.88 ? 175 TYR A CD1 1 
ATOM   1335 C CD2 . TYR A 1 175 ? 32.196 48.973 45.914 1.00 11.96 ? 175 TYR A CD2 1 
ATOM   1336 C CE1 . TYR A 1 175 ? 33.414 48.224 48.304 1.00 13.59 ? 175 TYR A CE1 1 
ATOM   1337 C CE2 . TYR A 1 175 ? 31.915 49.673 47.089 1.00 12.46 ? 175 TYR A CE2 1 
ATOM   1338 C CZ  . TYR A 1 175 ? 32.529 49.292 48.279 1.00 14.67 ? 175 TYR A CZ  1 
ATOM   1339 O OH  . TYR A 1 175 ? 32.243 49.975 49.439 1.00 15.89 ? 175 TYR A OH  1 
ATOM   1340 N N   . LYS A 1 176 ? 31.149 44.960 42.571 1.00 9.45  ? 176 LYS A N   1 
ATOM   1341 C CA  . LYS A 1 176 ? 31.127 43.988 41.489 1.00 8.58  ? 176 LYS A CA  1 
ATOM   1342 C C   . LYS A 1 176 ? 31.145 44.766 40.171 1.00 10.39 ? 176 LYS A C   1 
ATOM   1343 O O   . LYS A 1 176 ? 30.894 45.972 40.156 1.00 10.35 ? 176 LYS A O   1 
ATOM   1344 C CB  . LYS A 1 176 ? 29.814 43.200 41.568 1.00 9.17  ? 176 LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 176 ? 28.605 44.137 41.567 1.00 4.75  ? 176 LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 176 ? 27.312 43.428 41.914 1.00 8.60  ? 176 LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 176 ? 26.165 44.428 41.963 1.00 8.68  ? 176 LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 176 ? 24.909 43.879 42.563 1.00 5.53  ? 176 LYS A NZ  1 
ATOM   1349 N N   . MET A 1 177 ? 31.432 44.083 39.066 1.00 10.55 ? 177 MET A N   1 
ATOM   1350 C CA  . MET A 1 177 ? 31.405 44.743 37.766 1.00 10.00 ? 177 MET A CA  1 
ATOM   1351 C C   . MET A 1 177 ? 29.935 45.070 37.522 1.00 10.94 ? 177 MET A C   1 
ATOM   1352 O O   . MET A 1 177 ? 29.049 44.313 37.944 1.00 7.03  ? 177 MET A O   1 
ATOM   1353 C CB  . MET A 1 177 ? 31.906 43.809 36.660 1.00 8.47  ? 177 MET A CB  1 
ATOM   1354 C CG  . MET A 1 177 ? 33.412 43.520 36.683 1.00 9.22  ? 177 MET A CG  1 
ATOM   1355 S SD  . MET A 1 177 ? 33.820 42.333 35.378 1.00 11.31 ? 177 MET A SD  1 
ATOM   1356 C CE  . MET A 1 177 ? 33.326 43.262 33.934 1.00 11.33 ? 177 MET A CE  1 
ATOM   1357 N N   . HIS A 1 178 ? 29.667 46.178 36.841 1.00 6.98  ? 178 HIS A N   1 
ATOM   1358 C CA  . HIS A 1 178 ? 28.294 46.562 36.582 1.00 9.07  ? 178 HIS A CA  1 
ATOM   1359 C C   . HIS A 1 178 ? 27.593 45.430 35.828 1.00 8.77  ? 178 HIS A C   1 
ATOM   1360 O O   . HIS A 1 178 ? 28.122 44.909 34.847 1.00 8.62  ? 178 HIS A O   1 
ATOM   1361 C CB  . HIS A 1 178 ? 28.256 47.859 35.767 1.00 11.85 ? 178 HIS A CB  1 
ATOM   1362 C CG  . HIS A 1 178 ? 26.871 48.321 35.440 1.00 12.47 ? 178 HIS A CG  1 
ATOM   1363 N ND1 . HIS A 1 178 ? 25.916 48.559 36.407 1.00 17.18 ? 178 HIS A ND1 1 
ATOM   1364 C CD2 . HIS A 1 178 ? 26.268 48.555 34.252 1.00 13.72 ? 178 HIS A CD2 1 
ATOM   1365 C CE1 . HIS A 1 178 ? 24.783 48.913 35.826 1.00 14.95 ? 178 HIS A CE1 1 
ATOM   1366 N NE2 . HIS A 1 178 ? 24.971 48.917 34.519 1.00 18.03 ? 178 HIS A NE2 1 
ATOM   1367 N N   . GLY A 1 179 ? 26.408 45.042 36.295 1.00 8.78  ? 179 GLY A N   1 
ATOM   1368 C CA  . GLY A 1 179 ? 25.678 43.972 35.634 1.00 5.20  ? 179 GLY A CA  1 
ATOM   1369 C C   . GLY A 1 179 ? 25.957 42.574 36.161 1.00 6.95  ? 179 GLY A C   1 
ATOM   1370 O O   . GLY A 1 179 ? 25.371 41.610 35.684 1.00 6.34  ? 179 GLY A O   1 
ATOM   1371 N N   . ARG A 1 180 ? 26.852 42.446 37.134 1.00 6.74  ? 180 ARG A N   1 
ATOM   1372 C CA  . ARG A 1 180 ? 27.168 41.132 37.690 1.00 9.25  ? 180 ARG A CA  1 
ATOM   1373 C C   . ARG A 1 180 ? 25.958 40.554 38.431 1.00 9.21  ? 180 ARG A C   1 
ATOM   1374 O O   . ARG A 1 180 ? 25.251 41.273 39.149 1.00 9.23  ? 180 ARG A O   1 
ATOM   1375 C CB  . ARG A 1 180 ? 28.363 41.224 38.654 1.00 7.38  ? 180 ARG A CB  1 
ATOM   1376 C CG  . ARG A 1 180 ? 28.697 39.922 39.397 1.00 8.55  ? 180 ARG A CG  1 
ATOM   1377 C CD  . ARG A 1 180 ? 27.989 39.804 40.761 1.00 7.55  ? 180 ARG A CD  1 
ATOM   1378 N NE  . ARG A 1 180 ? 28.425 38.624 41.522 1.00 9.58  ? 180 ARG A NE  1 
ATOM   1379 C CZ  . ARG A 1 180 ? 27.896 38.255 42.687 1.00 5.83  ? 180 ARG A CZ  1 
ATOM   1380 N NH1 . ARG A 1 180 ? 26.915 38.968 43.216 1.00 7.90  ? 180 ARG A NH1 1 
ATOM   1381 N NH2 . ARG A 1 180 ? 28.355 37.189 43.331 1.00 8.60  ? 180 ARG A NH2 1 
ATOM   1382 N N   . VAL A 1 181 ? 25.730 39.261 38.234 1.00 6.32  ? 181 VAL A N   1 
ATOM   1383 C CA  . VAL A 1 181 ? 24.634 38.545 38.882 1.00 8.40  ? 181 VAL A CA  1 
ATOM   1384 C C   . VAL A 1 181 ? 25.208 37.320 39.595 1.00 8.67  ? 181 VAL A C   1 
ATOM   1385 O O   . VAL A 1 181 ? 25.986 36.567 39.012 1.00 8.30  ? 181 VAL A O   1 
ATOM   1386 C CB  . VAL A 1 181 ? 23.578 38.085 37.854 1.00 8.08  ? 181 VAL A CB  1 
ATOM   1387 C CG1 . VAL A 1 181 ? 22.507 37.197 38.553 1.00 8.80  ? 181 VAL A CG1 1 
ATOM   1388 C CG2 . VAL A 1 181 ? 22.900 39.305 37.227 1.00 3.46  ? 181 VAL A CG2 1 
ATOM   1389 N N   . GLY A 1 182 ? 24.838 37.156 40.865 1.00 7.54  ? 182 GLY A N   1 
ATOM   1390 C CA  . GLY A 1 182 ? 25.299 36.035 41.667 1.00 7.92  ? 182 GLY A CA  1 
ATOM   1391 C C   . GLY A 1 182 ? 24.287 34.896 41.744 1.00 7.62  ? 182 GLY A C   1 
ATOM   1392 O O   . GLY A 1 182 ? 23.431 34.751 40.871 1.00 4.21  ? 182 GLY A O   1 
ATOM   1393 N N   . ASP A 1 183 ? 24.374 34.090 42.797 1.00 6.83  ? 183 ASP A N   1 
ATOM   1394 C CA  . ASP A 1 183 ? 23.486 32.943 42.925 1.00 7.91  ? 183 ASP A CA  1 
ATOM   1395 C C   . ASP A 1 183 ? 22.094 33.228 43.474 1.00 5.63  ? 183 ASP A C   1 
ATOM   1396 O O   . ASP A 1 183 ? 21.163 32.470 43.208 1.00 3.03  ? 183 ASP A O   1 
ATOM   1397 C CB  . ASP A 1 183 ? 24.147 31.864 43.804 1.00 5.92  ? 183 ASP A CB  1 
ATOM   1398 C CG  . ASP A 1 183 ? 24.202 32.264 45.267 1.00 9.45  ? 183 ASP A CG  1 
ATOM   1399 O OD1 . ASP A 1 183 ? 24.693 33.377 45.560 1.00 9.35  ? 183 ASP A OD1 1 
ATOM   1400 O OD2 . ASP A 1 183 ? 23.748 31.467 46.123 1.00 14.58 ? 183 ASP A OD2 1 
ATOM   1401 N N   . SER A 1 184 ? 21.945 34.312 44.230 1.00 5.83  ? 184 SER A N   1 
ATOM   1402 C CA  . SER A 1 184 ? 20.666 34.628 44.865 1.00 8.17  ? 184 SER A CA  1 
ATOM   1403 C C   . SER A 1 184 ? 19.384 34.652 44.024 1.00 8.67  ? 184 SER A C   1 
ATOM   1404 O O   . SER A 1 184 ? 18.320 34.304 44.538 1.00 9.58  ? 184 SER A O   1 
ATOM   1405 C CB  . SER A 1 184 ? 20.776 35.943 45.647 1.00 7.25  ? 184 SER A CB  1 
ATOM   1406 O OG  . SER A 1 184 ? 21.782 35.852 46.641 1.00 8.73  ? 184 SER A OG  1 
ATOM   1407 N N   . PRO A 1 185 ? 19.448 35.082 42.746 1.00 4.63  ? 185 PRO A N   1 
ATOM   1408 C CA  . PRO A 1 185 ? 18.220 35.106 41.943 1.00 5.67  ? 185 PRO A CA  1 
ATOM   1409 C C   . PRO A 1 185 ? 18.079 33.927 40.991 1.00 8.49  ? 185 PRO A C   1 
ATOM   1410 O O   . PRO A 1 185 ? 17.140 33.882 40.185 1.00 10.21 ? 185 PRO A O   1 
ATOM   1411 C CB  . PRO A 1 185 ? 18.359 36.401 41.166 1.00 6.25  ? 185 PRO A CB  1 
ATOM   1412 C CG  . PRO A 1 185 ? 19.809 36.331 40.770 1.00 6.26  ? 185 PRO A CG  1 
ATOM   1413 C CD  . PRO A 1 185 ? 20.510 35.860 42.066 1.00 5.42  ? 185 PRO A CD  1 
ATOM   1414 N N   . ILE A 1 186 ? 19.012 32.985 41.069 1.00 6.42  ? 186 ILE A N   1 
ATOM   1415 C CA  . ILE A 1 186 ? 18.996 31.830 40.186 1.00 7.47  ? 186 ILE A CA  1 
ATOM   1416 C C   . ILE A 1 186 ? 18.400 30.596 40.861 1.00 8.91  ? 186 ILE A C   1 
ATOM   1417 O O   . ILE A 1 186 ? 18.948 30.077 41.846 1.00 4.83  ? 186 ILE A O   1 
ATOM   1418 C CB  . ILE A 1 186 ? 20.425 31.517 39.688 1.00 9.75  ? 186 ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 186 ? 20.985 32.747 38.964 1.00 11.06 ? 186 ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 186 ? 20.414 30.299 38.767 1.00 8.21  ? 186 ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 186 ? 22.400 32.561 38.442 1.00 15.12 ? 186 ILE A CD1 1 
ATOM   1422 N N   . ILE A 1 187 ? 17.263 30.151 40.325 1.00 6.68  ? 187 ILE A N   1 
ATOM   1423 C CA  . ILE A 1 187 ? 16.561 28.990 40.845 1.00 7.04  ? 187 ILE A CA  1 
ATOM   1424 C C   . ILE A 1 187 ? 17.459 27.761 40.725 1.00 6.65  ? 187 ILE A C   1 
ATOM   1425 O O   . ILE A 1 187 ? 17.982 27.459 39.651 1.00 6.13  ? 187 ILE A O   1 
ATOM   1426 C CB  . ILE A 1 187 ? 15.218 28.772 40.075 1.00 7.63  ? 187 ILE A CB  1 
ATOM   1427 C CG1 . ILE A 1 187 ? 14.272 29.942 40.353 1.00 7.19  ? 187 ILE A CG1 1 
ATOM   1428 C CG2 . ILE A 1 187 ? 14.562 27.448 40.483 1.00 5.85  ? 187 ILE A CG2 1 
ATOM   1429 C CD1 . ILE A 1 187 ? 13.889 30.081 41.833 1.00 9.46  ? 187 ILE A CD1 1 
ATOM   1430 N N   . GLY A 1 188 ? 17.656 27.061 41.837 1.00 4.33  ? 188 GLY A N   1 
ATOM   1431 C CA  . GLY A 1 188 ? 18.506 25.882 41.800 1.00 3.97  ? 188 GLY A CA  1 
ATOM   1432 C C   . GLY A 1 188 ? 19.904 26.206 42.278 1.00 4.72  ? 188 GLY A C   1 
ATOM   1433 O O   . GLY A 1 188 ? 20.688 25.302 42.595 1.00 6.24  ? 188 GLY A O   1 
ATOM   1434 N N   . ALA A 1 189 ? 20.233 27.497 42.313 1.00 3.88  ? 189 ALA A N   1 
ATOM   1435 C CA  . ALA A 1 189 ? 21.543 27.916 42.784 1.00 6.68  ? 189 ALA A CA  1 
ATOM   1436 C C   . ALA A 1 189 ? 21.339 28.474 44.200 1.00 7.85  ? 189 ALA A C   1 
ATOM   1437 O O   . ALA A 1 189 ? 21.507 27.752 45.179 1.00 7.56  ? 189 ALA A O   1 
ATOM   1438 C CB  . ALA A 1 189 ? 22.141 28.976 41.853 1.00 8.41  ? 189 ALA A CB  1 
ATOM   1439 N N   . GLY A 1 190 ? 20.945 29.739 44.306 1.00 4.17  ? 190 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 190 ? 20.719 30.334 45.615 1.00 5.76  ? 190 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 190 ? 19.507 29.782 46.362 1.00 5.43  ? 190 GLY A C   1 
ATOM   1442 O O   . GLY A 1 190 ? 19.476 29.806 47.594 1.00 6.99  ? 190 GLY A O   1 
ATOM   1443 N N   . LEU A 1 191 ? 18.529 29.264 45.632 1.00 2.94  ? 191 LEU A N   1 
ATOM   1444 C CA  . LEU A 1 191 ? 17.297 28.751 46.253 1.00 3.92  ? 191 LEU A CA  1 
ATOM   1445 C C   . LEU A 1 191 ? 16.594 27.669 45.443 1.00 6.81  ? 191 LEU A C   1 
ATOM   1446 O O   . LEU A 1 191 ? 16.561 27.729 44.213 1.00 6.84  ? 191 LEU A O   1 
ATOM   1447 C CB  . LEU A 1 191 ? 16.306 29.912 46.442 1.00 4.63  ? 191 LEU A CB  1 
ATOM   1448 C CG  . LEU A 1 191 ? 14.890 29.555 46.906 1.00 3.53  ? 191 LEU A CG  1 
ATOM   1449 C CD1 . LEU A 1 191 ? 14.944 29.266 48.404 1.00 6.68  ? 191 LEU A CD1 1 
ATOM   1450 C CD2 . LEU A 1 191 ? 13.911 30.707 46.632 1.00 5.48  ? 191 LEU A CD2 1 
ATOM   1451 N N   . PHE A 1 192 ? 16.039 26.669 46.133 1.00 6.11  ? 192 PHE A N   1 
ATOM   1452 C CA  . PHE A 1 192 ? 15.268 25.643 45.454 1.00 5.59  ? 192 PHE A CA  1 
ATOM   1453 C C   . PHE A 1 192 ? 14.273 25.017 46.423 1.00 8.67  ? 192 PHE A C   1 
ATOM   1454 O O   . PHE A 1 192 ? 14.629 24.669 47.548 1.00 5.97  ? 192 PHE A O   1 
ATOM   1455 C CB  . PHE A 1 192 ? 16.136 24.548 44.831 1.00 5.54  ? 192 PHE A CB  1 
ATOM   1456 C CG  . PHE A 1 192 ? 15.363 23.665 43.904 1.00 6.55  ? 192 PHE A CG  1 
ATOM   1457 C CD1 . PHE A 1 192 ? 14.984 22.384 44.287 1.00 5.47  ? 192 PHE A CD1 1 
ATOM   1458 C CD2 . PHE A 1 192 ? 14.921 24.160 42.670 1.00 6.45  ? 192 PHE A CD2 1 
ATOM   1459 C CE1 . PHE A 1 192 ? 14.170 21.611 43.460 1.00 9.23  ? 192 PHE A CE1 1 
ATOM   1460 C CE2 . PHE A 1 192 ? 14.111 23.397 41.841 1.00 6.14  ? 192 PHE A CE2 1 
ATOM   1461 C CZ  . PHE A 1 192 ? 13.732 22.125 42.229 1.00 9.29  ? 192 PHE A CZ  1 
ATOM   1462 N N   . VAL A 1 193 ? 13.032 24.877 45.963 1.00 7.40  ? 193 VAL A N   1 
ATOM   1463 C CA  . VAL A 1 193 ? 11.934 24.316 46.757 1.00 6.16  ? 193 VAL A CA  1 
ATOM   1464 C C   . VAL A 1 193 ? 11.149 23.272 45.956 1.00 8.44  ? 193 VAL A C   1 
ATOM   1465 O O   . VAL A 1 193 ? 10.723 23.539 44.833 1.00 8.60  ? 193 VAL A O   1 
ATOM   1466 C CB  . VAL A 1 193 ? 10.924 25.432 47.176 1.00 4.67  ? 193 VAL A CB  1 
ATOM   1467 C CG1 . VAL A 1 193 ? 9.794  24.843 48.021 1.00 6.01  ? 193 VAL A CG1 1 
ATOM   1468 C CG2 . VAL A 1 193 ? 11.635 26.538 47.957 1.00 4.23  ? 193 VAL A CG2 1 
ATOM   1469 N N   . ASP A 1 194 ? 10.985 22.080 46.524 1.00 8.62  ? 194 ASP A N   1 
ATOM   1470 C CA  . ASP A 1 194 ? 10.205 21.014 45.888 1.00 8.57  ? 194 ASP A CA  1 
ATOM   1471 C C   . ASP A 1 194 ? 9.287  20.586 47.030 1.00 7.59  ? 194 ASP A C   1 
ATOM   1472 O O   . ASP A 1 194 ? 9.742  20.006 48.001 1.00 9.10  ? 194 ASP A O   1 
ATOM   1473 C CB  . ASP A 1 194 ? 11.104 19.842 45.464 1.00 10.37 ? 194 ASP A CB  1 
ATOM   1474 C CG  . ASP A 1 194 ? 10.319 18.708 44.809 1.00 14.99 ? 194 ASP A CG  1 
ATOM   1475 O OD1 . ASP A 1 194 ? 9.156  18.496 45.188 1.00 13.07 ? 194 ASP A OD1 1 
ATOM   1476 O OD2 . ASP A 1 194 ? 10.874 18.013 43.933 1.00 18.48 ? 194 ASP A OD2 1 
ATOM   1477 N N   . ASN A 1 195 ? 7.995  20.880 46.916 1.00 11.54 ? 195 ASN A N   1 
ATOM   1478 C CA  . ASN A 1 195 ? 7.059  20.570 47.995 1.00 11.59 ? 195 ASN A CA  1 
ATOM   1479 C C   . ASN A 1 195 ? 6.913  19.110 48.402 1.00 12.21 ? 195 ASN A C   1 
ATOM   1480 O O   . ASN A 1 195 ? 6.379  18.817 49.468 1.00 12.80 ? 195 ASN A O   1 
ATOM   1481 C CB  . ASN A 1 195 ? 5.686  21.156 47.683 1.00 9.31  ? 195 ASN A CB  1 
ATOM   1482 C CG  . ASN A 1 195 ? 4.906  21.464 48.938 1.00 11.22 ? 195 ASN A CG  1 
ATOM   1483 O OD1 . ASN A 1 195 ? 5.478  21.937 49.914 1.00 10.48 ? 195 ASN A OD1 1 
ATOM   1484 N ND2 . ASN A 1 195 ? 3.599  21.211 48.921 1.00 10.11 ? 195 ASN A ND2 1 
ATOM   1485 N N   . GLU A 1 196 ? 7.382  18.191 47.567 1.00 14.68 ? 196 GLU A N   1 
ATOM   1486 C CA  . GLU A 1 196 ? 7.301  16.773 47.916 1.00 16.41 ? 196 GLU A CA  1 
ATOM   1487 C C   . GLU A 1 196 ? 8.573  16.315 48.618 1.00 15.71 ? 196 GLU A C   1 
ATOM   1488 O O   . GLU A 1 196 ? 8.637  15.196 49.119 1.00 16.95 ? 196 GLU A O   1 
ATOM   1489 C CB  . GLU A 1 196 ? 7.112  15.921 46.654 1.00 19.89 ? 196 GLU A CB  1 
ATOM   1490 C CG  . GLU A 1 196 ? 5.799  16.169 45.939 1.00 26.65 ? 196 GLU A CG  1 
ATOM   1491 C CD  . GLU A 1 196 ? 4.612  15.947 46.853 1.00 31.11 ? 196 GLU A CD  1 
ATOM   1492 O OE1 . GLU A 1 196 ? 4.489  14.828 47.398 1.00 36.34 ? 196 GLU A OE1 1 
ATOM   1493 O OE2 . GLU A 1 196 ? 3.805  16.889 47.034 1.00 37.10 ? 196 GLU A OE2 1 
ATOM   1494 N N   . ILE A 1 197 ? 9.575  17.190 48.681 1.00 13.50 ? 197 ILE A N   1 
ATOM   1495 C CA  . ILE A 1 197 ? 10.864 16.810 49.253 1.00 10.67 ? 197 ILE A CA  1 
ATOM   1496 C C   . ILE A 1 197 ? 11.432 17.697 50.350 1.00 9.64  ? 197 ILE A C   1 
ATOM   1497 O O   . ILE A 1 197 ? 11.702 17.242 51.461 1.00 9.09  ? 197 ILE A O   1 
ATOM   1498 C CB  . ILE A 1 197 ? 11.930 16.776 48.154 1.00 10.61 ? 197 ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 197 ? 11.492 15.842 47.027 1.00 15.22 ? 197 ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 197 ? 13.272 16.334 48.741 1.00 13.01 ? 197 ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 197 ? 12.395 15.921 45.821 1.00 16.57 ? 197 ILE A CD1 1 
ATOM   1502 N N   . GLY A 1 198 ? 11.685 18.951 49.997 1.00 8.49  ? 198 GLY A N   1 
ATOM   1503 C CA  . GLY A 1 198 ? 12.267 19.880 50.939 1.00 6.46  ? 198 GLY A CA  1 
ATOM   1504 C C   . GLY A 1 198 ? 12.705 21.130 50.209 1.00 9.19  ? 198 GLY A C   1 
ATOM   1505 O O   . GLY A 1 198 ? 12.439 21.293 49.016 1.00 7.04  ? 198 GLY A O   1 
ATOM   1506 N N   . ALA A 1 199 ? 13.395 22.008 50.924 1.00 5.16  ? 199 ALA A N   1 
ATOM   1507 C CA  . ALA A 1 199 ? 13.844 23.267 50.354 1.00 4.30  ? 199 ALA A CA  1 
ATOM   1508 C C   . ALA A 1 199 ? 15.244 23.546 50.850 1.00 4.27  ? 199 ALA A C   1 
ATOM   1509 O O   . ALA A 1 199 ? 15.662 23.015 51.871 1.00 4.99  ? 199 ALA A O   1 
ATOM   1510 C CB  . ALA A 1 199 ? 12.908 24.393 50.806 1.00 5.94  ? 199 ALA A CB  1 
ATOM   1511 N N   . ALA A 1 200 ? 15.970 24.382 50.130 1.00 5.60  ? 200 ALA A N   1 
ATOM   1512 C CA  . ALA A 1 200 ? 17.314 24.734 50.555 1.00 3.02  ? 200 ALA A CA  1 
ATOM   1513 C C   . ALA A 1 200 ? 17.671 26.107 50.000 1.00 5.53  ? 200 ALA A C   1 
ATOM   1514 O O   . ALA A 1 200 ? 17.180 26.508 48.946 1.00 4.69  ? 200 ALA A O   1 
ATOM   1515 C CB  . ALA A 1 200 ? 18.315 23.684 50.062 1.00 3.74  ? 200 ALA A CB  1 
ATOM   1516 N N   . THR A 1 201 ? 18.500 26.844 50.733 1.00 5.97  ? 201 THR A N   1 
ATOM   1517 C CA  . THR A 1 201 ? 18.939 28.131 50.252 1.00 7.37  ? 201 THR A CA  1 
ATOM   1518 C C   . THR A 1 201 ? 20.416 28.230 50.624 1.00 8.23  ? 201 THR A C   1 
ATOM   1519 O O   . THR A 1 201 ? 20.876 27.622 51.609 1.00 6.63  ? 201 THR A O   1 
ATOM   1520 C CB  . THR A 1 201 ? 18.072 29.305 50.813 1.00 4.33  ? 201 THR A CB  1 
ATOM   1521 O OG1 . THR A 1 201 ? 18.418 30.505 50.116 1.00 7.29  ? 201 THR A OG1 1 
ATOM   1522 C CG2 . THR A 1 201 ? 18.285 29.507 52.295 1.00 4.98  ? 201 THR A CG2 1 
ATOM   1523 N N   . ALA A 1 202 ? 21.169 28.964 49.820 1.00 7.17  ? 202 ALA A N   1 
ATOM   1524 C CA  . ALA A 1 202 ? 22.602 29.084 50.033 1.00 9.31  ? 202 ALA A CA  1 
ATOM   1525 C C   . ALA A 1 202 ? 23.037 30.528 50.196 1.00 14.77 ? 202 ALA A C   1 
ATOM   1526 O O   . ALA A 1 202 ? 22.333 31.458 49.777 1.00 16.43 ? 202 ALA A O   1 
ATOM   1527 C CB  . ALA A 1 202 ? 23.336 28.479 48.853 1.00 10.69 ? 202 ALA A CB  1 
ATOM   1528 N N   . THR A 1 203 ? 24.221 30.706 50.770 1.00 13.90 ? 203 THR A N   1 
ATOM   1529 C CA  . THR A 1 203 ? 24.770 32.043 50.952 1.00 16.46 ? 203 THR A CA  1 
ATOM   1530 C C   . THR A 1 203 ? 26.291 31.930 50.901 1.00 16.66 ? 203 THR A C   1 
ATOM   1531 O O   . THR A 1 203 ? 26.848 30.927 51.323 1.00 18.32 ? 203 THR A O   1 
ATOM   1532 C CB  . THR A 1 203 ? 24.341 32.641 52.307 1.00 17.95 ? 203 THR A CB  1 
ATOM   1533 O OG1 . THR A 1 203 ? 24.593 34.053 52.310 1.00 18.68 ? 203 THR A OG1 1 
ATOM   1534 C CG2 . THR A 1 203 ? 25.123 31.985 53.447 1.00 18.69 ? 203 THR A CG2 1 
ATOM   1535 N N   . GLY A 1 204 ? 26.950 32.942 50.346 1.00 14.83 ? 204 GLY A N   1 
ATOM   1536 C CA  . GLY A 1 204 ? 28.403 32.926 50.267 1.00 14.77 ? 204 GLY A CA  1 
ATOM   1537 C C   . GLY A 1 204 ? 28.898 33.418 48.921 1.00 12.74 ? 204 GLY A C   1 
ATOM   1538 O O   . GLY A 1 204 ? 28.278 34.297 48.314 1.00 12.43 ? 204 GLY A O   1 
ATOM   1539 N N   . HIS A 1 205 ? 30.018 32.871 48.450 1.00 10.80 ? 205 HIS A N   1 
ATOM   1540 C CA  . HIS A 1 205 ? 30.539 33.269 47.148 1.00 11.05 ? 205 HIS A CA  1 
ATOM   1541 C C   . HIS A 1 205 ? 29.625 32.702 46.069 1.00 11.15 ? 205 HIS A C   1 
ATOM   1542 O O   . HIS A 1 205 ? 29.779 31.560 45.641 1.00 8.32  ? 205 HIS A O   1 
ATOM   1543 C CB  . HIS A 1 205 ? 31.972 32.780 46.974 1.00 13.34 ? 205 HIS A CB  1 
ATOM   1544 C CG  . HIS A 1 205 ? 32.961 33.575 47.769 1.00 17.43 ? 205 HIS A CG  1 
ATOM   1545 N ND1 . HIS A 1 205 ? 33.459 33.152 48.983 1.00 18.49 ? 205 HIS A ND1 1 
ATOM   1546 C CD2 . HIS A 1 205 ? 33.498 34.799 47.548 1.00 17.38 ? 205 HIS A CD2 1 
ATOM   1547 C CE1 . HIS A 1 205 ? 34.262 34.079 49.473 1.00 18.44 ? 205 HIS A CE1 1 
ATOM   1548 N NE2 . HIS A 1 205 ? 34.302 35.089 48.622 1.00 20.04 ? 205 HIS A NE2 1 
ATOM   1549 N N   . GLY A 1 206 ? 28.683 33.538 45.642 1.00 8.51  ? 206 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 206 ? 27.677 33.154 44.667 1.00 11.67 ? 206 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 206 ? 28.121 32.429 43.426 1.00 11.13 ? 206 GLY A C   1 
ATOM   1552 O O   . GLY A 1 206 ? 27.451 31.494 42.988 1.00 10.73 ? 206 GLY A O   1 
ATOM   1553 N N   . GLU A 1 207 ? 29.226 32.884 42.842 1.00 8.57  ? 207 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 207 ? 29.778 32.268 41.644 1.00 8.04  ? 207 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 207 ? 29.987 30.769 41.866 1.00 9.24  ? 207 GLU A C   1 
ATOM   1556 O O   . GLU A 1 207 ? 29.829 29.964 40.946 1.00 6.65  ? 207 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 207 ? 31.134 32.911 41.293 1.00 7.38  ? 207 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 207 ? 31.066 34.238 40.525 1.00 7.40  ? 207 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 207 ? 30.629 35.429 41.385 1.00 11.58 ? 207 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 207 ? 30.633 35.328 42.630 1.00 9.17  ? 207 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 207 ? 30.296 36.487 40.804 1.00 8.76  ? 207 GLU A OE2 1 
ATOM   1562 N N   . GLU A 1 208 ? 30.359 30.401 43.086 1.00 7.93  ? 208 GLU A N   1 
ATOM   1563 C CA  . GLU A 1 208 ? 30.616 28.997 43.398 1.00 5.25  ? 208 GLU A CA  1 
ATOM   1564 C C   . GLU A 1 208 ? 29.348 28.185 43.543 1.00 4.27  ? 208 GLU A C   1 
ATOM   1565 O O   . GLU A 1 208 ? 29.335 26.995 43.236 1.00 8.18  ? 208 GLU A O   1 
ATOM   1566 C CB  . GLU A 1 208 ? 31.459 28.890 44.673 1.00 4.82  ? 208 GLU A CB  1 
ATOM   1567 C CG  . GLU A 1 208 ? 32.814 29.594 44.568 1.00 4.85  ? 208 GLU A CG  1 
ATOM   1568 C CD  . GLU A 1 208 ? 33.555 29.252 43.274 1.00 7.35  ? 208 GLU A CD  1 
ATOM   1569 O OE1 . GLU A 1 208 ? 33.587 28.065 42.909 1.00 5.69  ? 208 GLU A OE1 1 
ATOM   1570 O OE2 . GLU A 1 208 ? 34.102 30.170 42.624 1.00 7.13  ? 208 GLU A OE2 1 
ATOM   1571 N N   . VAL A 1 209 ? 28.282 28.820 44.012 1.00 6.06  ? 209 VAL A N   1 
ATOM   1572 C CA  . VAL A 1 209 ? 27.006 28.131 44.171 1.00 6.52  ? 209 VAL A CA  1 
ATOM   1573 C C   . VAL A 1 209 ? 26.396 27.919 42.788 1.00 7.90  ? 209 VAL A C   1 
ATOM   1574 O O   . VAL A 1 209 ? 25.787 26.890 42.528 1.00 9.95  ? 209 VAL A O   1 
ATOM   1575 C CB  . VAL A 1 209 ? 26.038 28.946 45.053 1.00 7.19  ? 209 VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 209 ? 24.702 28.231 45.162 1.00 8.81  ? 209 VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 209 ? 26.634 29.105 46.456 1.00 7.74  ? 209 VAL A CG2 1 
ATOM   1578 N N   . ILE A 1 210 ? 26.577 28.897 41.900 1.00 8.94  ? 210 ILE A N   1 
ATOM   1579 C CA  . ILE A 1 210 ? 26.063 28.775 40.538 1.00 9.11  ? 210 ILE A CA  1 
ATOM   1580 C C   . ILE A 1 210 ? 26.760 27.630 39.798 1.00 9.93  ? 210 ILE A C   1 
ATOM   1581 O O   . ILE A 1 210 ? 26.112 26.811 39.141 1.00 9.61  ? 210 ILE A O   1 
ATOM   1582 C CB  . ILE A 1 210 ? 26.304 30.061 39.702 1.00 8.53  ? 210 ILE A CB  1 
ATOM   1583 C CG1 . ILE A 1 210 ? 25.469 31.217 40.248 1.00 8.61  ? 210 ILE A CG1 1 
ATOM   1584 C CG2 . ILE A 1 210 ? 25.939 29.790 38.223 1.00 7.21  ? 210 ILE A CG2 1 
ATOM   1585 C CD1 . ILE A 1 210 ? 25.744 32.545 39.530 1.00 5.89  ? 210 ILE A CD1 1 
ATOM   1586 N N   . ARG A 1 211 ? 28.087 27.569 39.890 1.00 9.19  ? 211 ARG A N   1 
ATOM   1587 C CA  . ARG A 1 211 ? 28.789 26.530 39.157 1.00 11.92 ? 211 ARG A CA  1 
ATOM   1588 C C   . ARG A 1 211 ? 28.491 25.111 39.637 1.00 12.52 ? 211 ARG A C   1 
ATOM   1589 O O   . ARG A 1 211 ? 28.643 24.159 38.872 1.00 12.57 ? 211 ARG A O   1 
ATOM   1590 C CB  . ARG A 1 211 ? 30.310 26.825 39.090 1.00 14.48 ? 211 ARG A CB  1 
ATOM   1591 C CG  . ARG A 1 211 ? 31.183 26.274 40.184 1.00 15.69 ? 211 ARG A CG  1 
ATOM   1592 C CD  . ARG A 1 211 ? 32.685 26.515 39.860 1.00 10.23 ? 211 ARG A CD  1 
ATOM   1593 N NE  . ARG A 1 211 ? 33.117 27.883 40.155 1.00 7.95  ? 211 ARG A NE  1 
ATOM   1594 C CZ  . ARG A 1 211 ? 33.410 28.808 39.243 1.00 10.30 ? 211 ARG A CZ  1 
ATOM   1595 N NH1 . ARG A 1 211 ? 33.329 28.538 37.937 1.00 7.85  ? 211 ARG A NH1 1 
ATOM   1596 N NH2 . ARG A 1 211 ? 33.769 30.018 39.635 1.00 10.41 ? 211 ARG A NH2 1 
ATOM   1597 N N   . THR A 1 212 ? 28.017 24.966 40.873 1.00 11.57 ? 212 THR A N   1 
ATOM   1598 C CA  . THR A 1 212 ? 27.687 23.645 41.393 1.00 11.87 ? 212 THR A CA  1 
ATOM   1599 C C   . THR A 1 212 ? 26.173 23.410 41.476 1.00 10.65 ? 212 THR A C   1 
ATOM   1600 O O   . THR A 1 212 ? 25.727 22.321 41.831 1.00 11.00 ? 212 THR A O   1 
ATOM   1601 C CB  . THR A 1 212 ? 28.328 23.425 42.787 1.00 15.02 ? 212 THR A CB  1 
ATOM   1602 O OG1 . THR A 1 212 ? 27.922 24.474 43.680 1.00 13.22 ? 212 THR A OG1 1 
ATOM   1603 C CG2 . THR A 1 212 ? 29.854 23.435 42.670 1.00 14.31 ? 212 THR A CG2 1 
ATOM   1604 N N   . VAL A 1 213 ? 25.393 24.437 41.133 1.00 8.58  ? 213 VAL A N   1 
ATOM   1605 C CA  . VAL A 1 213 ? 23.932 24.368 41.173 1.00 5.58  ? 213 VAL A CA  1 
ATOM   1606 C C   . VAL A 1 213 ? 23.560 23.859 42.564 1.00 8.20  ? 213 VAL A C   1 
ATOM   1607 O O   . VAL A 1 213 ? 22.772 22.917 42.724 1.00 7.36  ? 213 VAL A O   1 
ATOM   1608 C CB  . VAL A 1 213 ? 23.385 23.404 40.070 1.00 5.88  ? 213 VAL A CB  1 
ATOM   1609 C CG1 . VAL A 1 213 ? 21.900 23.684 39.825 1.00 7.17  ? 213 VAL A CG1 1 
ATOM   1610 C CG2 . VAL A 1 213 ? 24.177 23.598 38.757 1.00 10.14 ? 213 VAL A CG2 1 
ATOM   1611 N N   . GLY A 1 214 ? 24.147 24.526 43.553 1.00 6.85  ? 214 GLY A N   1 
ATOM   1612 C CA  . GLY A 1 214 ? 24.016 24.164 44.954 1.00 9.50  ? 214 GLY A CA  1 
ATOM   1613 C C   . GLY A 1 214 ? 22.723 23.692 45.596 1.00 9.17  ? 214 GLY A C   1 
ATOM   1614 O O   . GLY A 1 214 ? 22.667 22.572 46.100 1.00 6.76  ? 214 GLY A O   1 
ATOM   1615 N N   . THR A 1 215 ? 21.698 24.535 45.616 1.00 6.44  ? 215 THR A N   1 
ATOM   1616 C CA  . THR A 1 215 ? 20.456 24.130 46.253 1.00 8.22  ? 215 THR A CA  1 
ATOM   1617 C C   . THR A 1 215 ? 19.683 23.035 45.530 1.00 6.17  ? 215 THR A C   1 
ATOM   1618 O O   . THR A 1 215 ? 19.010 22.236 46.176 1.00 3.85  ? 215 THR A O   1 
ATOM   1619 C CB  . THR A 1 215 ? 19.547 25.343 46.523 1.00 6.54  ? 215 THR A CB  1 
ATOM   1620 O OG1 . THR A 1 215 ? 19.346 26.086 45.318 1.00 5.37  ? 215 THR A OG1 1 
ATOM   1621 C CG2 . THR A 1 215 ? 20.201 26.239 47.591 1.00 6.66  ? 215 THR A CG2 1 
ATOM   1622 N N   . HIS A 1 216 ? 19.763 22.982 44.206 1.00 5.35  ? 216 HIS A N   1 
ATOM   1623 C CA  . HIS A 1 216 ? 19.074 21.899 43.512 1.00 5.29  ? 216 HIS A CA  1 
ATOM   1624 C C   . HIS A 1 216 ? 19.728 20.576 43.946 1.00 4.97  ? 216 HIS A C   1 
ATOM   1625 O O   . HIS A 1 216 ? 19.042 19.568 44.165 1.00 7.81  ? 216 HIS A O   1 
ATOM   1626 C CB  . HIS A 1 216 ? 19.184 22.038 41.994 1.00 6.86  ? 216 HIS A CB  1 
ATOM   1627 C CG  . HIS A 1 216 ? 18.434 20.977 41.248 1.00 5.93  ? 216 HIS A CG  1 
ATOM   1628 N ND1 . HIS A 1 216 ? 17.061 20.845 41.311 1.00 8.87  ? 216 HIS A ND1 1 
ATOM   1629 C CD2 . HIS A 1 216 ? 18.871 19.972 40.455 1.00 5.20  ? 216 HIS A CD2 1 
ATOM   1630 C CE1 . HIS A 1 216 ? 16.688 19.799 40.591 1.00 4.94  ? 216 HIS A CE1 1 
ATOM   1631 N NE2 . HIS A 1 216 ? 17.766 19.251 40.061 1.00 12.62 ? 216 HIS A NE2 1 
ATOM   1632 N N   . LEU A 1 217 ? 21.053 20.593 44.071 1.00 5.96  ? 217 LEU A N   1 
ATOM   1633 C CA  . LEU A 1 217 ? 21.805 19.423 44.501 1.00 6.08  ? 217 LEU A CA  1 
ATOM   1634 C C   . LEU A 1 217 ? 21.387 19.005 45.915 1.00 6.80  ? 217 LEU A C   1 
ATOM   1635 O O   . LEU A 1 217 ? 21.157 17.818 46.181 1.00 6.94  ? 217 LEU A O   1 
ATOM   1636 C CB  . LEU A 1 217 ? 23.300 19.721 44.503 1.00 9.09  ? 217 LEU A CB  1 
ATOM   1637 C CG  . LEU A 1 217 ? 24.156 18.580 45.064 1.00 9.36  ? 217 LEU A CG  1 
ATOM   1638 C CD1 . LEU A 1 217 ? 23.928 17.324 44.244 1.00 12.26 ? 217 LEU A CD1 1 
ATOM   1639 C CD2 . LEU A 1 217 ? 25.617 18.986 45.036 1.00 11.88 ? 217 LEU A CD2 1 
ATOM   1640 N N   . VAL A 1 218 ? 21.306 19.977 46.824 1.00 5.04  ? 218 VAL A N   1 
ATOM   1641 C CA  . VAL A 1 218 ? 20.900 19.669 48.198 1.00 7.21  ? 218 VAL A CA  1 
ATOM   1642 C C   . VAL A 1 218 ? 19.520 19.023 48.232 1.00 6.64  ? 218 VAL A C   1 
ATOM   1643 O O   . VAL A 1 218 ? 19.315 18.011 48.899 1.00 6.53  ? 218 VAL A O   1 
ATOM   1644 C CB  . VAL A 1 218 ? 20.852 20.930 49.094 1.00 5.10  ? 218 VAL A CB  1 
ATOM   1645 C CG1 . VAL A 1 218 ? 20.263 20.566 50.474 1.00 5.21  ? 218 VAL A CG1 1 
ATOM   1646 C CG2 . VAL A 1 218 ? 22.257 21.506 49.269 1.00 6.06  ? 218 VAL A CG2 1 
ATOM   1647 N N   . VAL A 1 219 ? 18.562 19.609 47.519 1.00 7.00  ? 219 VAL A N   1 
ATOM   1648 C CA  . VAL A 1 219 ? 17.217 19.059 47.506 1.00 7.30  ? 219 VAL A CA  1 
ATOM   1649 C C   . VAL A 1 219 ? 17.164 17.676 46.862 1.00 8.00  ? 219 VAL A C   1 
ATOM   1650 O O   . VAL A 1 219 ? 16.476 16.768 47.366 1.00 7.63  ? 219 VAL A O   1 
ATOM   1651 C CB  . VAL A 1 219 ? 16.246 20.037 46.803 1.00 5.80  ? 219 VAL A CB  1 
ATOM   1652 C CG1 . VAL A 1 219 ? 14.895 19.401 46.610 1.00 9.20  ? 219 VAL A CG1 1 
ATOM   1653 C CG2 . VAL A 1 219 ? 16.110 21.306 47.664 1.00 8.21  ? 219 VAL A CG2 1 
ATOM   1654 N N   . GLU A 1 220 ? 17.903 17.499 45.771 1.00 8.29  ? 220 GLU A N   1 
ATOM   1655 C CA  . GLU A 1 220 ? 17.928 16.205 45.077 1.00 10.09 ? 220 GLU A CA  1 
ATOM   1656 C C   . GLU A 1 220 ? 18.520 15.132 45.988 1.00 10.70 ? 220 GLU A C   1 
ATOM   1657 O O   . GLU A 1 220 ? 18.091 13.973 45.953 1.00 11.66 ? 220 GLU A O   1 
ATOM   1658 C CB  . GLU A 1 220 ? 18.739 16.306 43.779 1.00 11.84 ? 220 GLU A CB  1 
ATOM   1659 C CG  . GLU A 1 220 ? 18.456 15.214 42.747 1.00 22.05 ? 220 GLU A CG  1 
ATOM   1660 C CD  . GLU A 1 220 ? 16.985 15.146 42.363 1.00 23.06 ? 220 GLU A CD  1 
ATOM   1661 O OE1 . GLU A 1 220 ? 16.378 16.206 42.091 1.00 27.51 ? 220 GLU A OE1 1 
ATOM   1662 O OE2 . GLU A 1 220 ? 16.435 14.031 42.329 1.00 30.27 ? 220 GLU A OE2 1 
ATOM   1663 N N   . LEU A 1 221 ? 19.491 15.510 46.816 1.00 9.18  ? 221 LEU A N   1 
ATOM   1664 C CA  . LEU A 1 221 ? 20.095 14.551 47.740 1.00 8.17  ? 221 LEU A CA  1 
ATOM   1665 C C   . LEU A 1 221 ? 19.041 14.169 48.784 1.00 12.16 ? 221 LEU A C   1 
ATOM   1666 O O   . LEU A 1 221 ? 18.916 12.994 49.157 1.00 12.27 ? 221 LEU A O   1 
ATOM   1667 C CB  . LEU A 1 221 ? 21.362 15.132 48.397 1.00 7.81  ? 221 LEU A CB  1 
ATOM   1668 C CG  . LEU A 1 221 ? 22.579 15.263 47.461 1.00 7.64  ? 221 LEU A CG  1 
ATOM   1669 C CD1 . LEU A 1 221 ? 23.724 15.943 48.193 1.00 8.92  ? 221 LEU A CD1 1 
ATOM   1670 C CD2 . LEU A 1 221 ? 23.025 13.877 46.957 1.00 9.85  ? 221 LEU A CD2 1 
ATOM   1671 N N   . MET A 1 222 ? 18.270 15.144 49.253 1.00 10.41 ? 222 MET A N   1 
ATOM   1672 C CA  . MET A 1 222 ? 17.209 14.816 50.200 1.00 14.33 ? 222 MET A CA  1 
ATOM   1673 C C   . MET A 1 222 ? 16.212 13.886 49.498 1.00 15.39 ? 222 MET A C   1 
ATOM   1674 O O   . MET A 1 222 ? 15.629 13.003 50.131 1.00 16.55 ? 222 MET A O   1 
ATOM   1675 C CB  . MET A 1 222 ? 16.496 16.081 50.699 1.00 12.46 ? 222 MET A CB  1 
ATOM   1676 C CG  . MET A 1 222 ? 17.308 16.877 51.727 1.00 11.10 ? 222 MET A CG  1 
ATOM   1677 S SD  . MET A 1 222 ? 16.344 18.171 52.522 1.00 10.30 ? 222 MET A SD  1 
ATOM   1678 C CE  . MET A 1 222 ? 16.254 19.392 51.178 1.00 8.68  ? 222 MET A CE  1 
ATOM   1679 N N   . ASN A 1 223 ? 16.035 14.071 48.189 1.00 16.00 ? 223 ASN A N   1 
ATOM   1680 C CA  . ASN A 1 223 ? 15.113 13.230 47.418 1.00 17.81 ? 223 ASN A CA  1 
ATOM   1681 C C   . ASN A 1 223 ? 15.658 11.804 47.375 1.00 20.44 ? 223 ASN A C   1 
ATOM   1682 O O   . ASN A 1 223 ? 14.902 10.828 47.314 1.00 18.65 ? 223 ASN A O   1 
ATOM   1683 C CB  . ASN A 1 223 ? 14.957 13.769 45.992 1.00 19.16 ? 223 ASN A CB  1 
ATOM   1684 C CG  . ASN A 1 223 ? 13.936 12.980 45.179 1.00 23.54 ? 223 ASN A CG  1 
ATOM   1685 O OD1 . ASN A 1 223 ? 12.899 12.565 45.699 1.00 24.36 ? 223 ASN A OD1 1 
ATOM   1686 N ND2 . ASN A 1 223 ? 14.220 12.783 43.898 1.00 27.90 ? 223 ASN A ND2 1 
ATOM   1687 N N   . GLN A 1 224 ? 16.981 11.698 47.413 1.00 20.77 ? 224 GLN A N   1 
ATOM   1688 C CA  . GLN A 1 224 ? 17.656 10.412 47.390 1.00 22.95 ? 224 GLN A CA  1 
ATOM   1689 C C   . GLN A 1 224 ? 17.861 9.821  48.786 1.00 24.14 ? 224 GLN A C   1 
ATOM   1690 O O   . GLN A 1 224 ? 18.759 9.005  48.985 1.00 26.61 ? 224 GLN A O   1 
ATOM   1691 C CB  . GLN A 1 224 ? 19.010 10.549 46.686 1.00 21.57 ? 224 GLN A CB  1 
ATOM   1692 C CG  . GLN A 1 224 ? 18.903 10.861 45.205 1.00 21.29 ? 224 GLN A CG  1 
ATOM   1693 C CD  . GLN A 1 224 ? 20.214 11.367 44.624 1.00 22.35 ? 224 GLN A CD  1 
ATOM   1694 O OE1 . GLN A 1 224 ? 20.290 12.477 44.089 1.00 23.56 ? 224 GLN A OE1 1 
ATOM   1695 N NE2 . GLN A 1 224 ? 21.251 10.557 44.728 1.00 15.81 ? 224 GLN A NE2 1 
ATOM   1696 N N   . GLY A 1 225 ? 17.061 10.254 49.759 1.00 22.68 ? 225 GLY A N   1 
ATOM   1697 C CA  . GLY A 1 225 ? 17.171 9.692  51.097 1.00 20.48 ? 225 GLY A CA  1 
ATOM   1698 C C   . GLY A 1 225 ? 18.082 10.321 52.133 1.00 20.76 ? 225 GLY A C   1 
ATOM   1699 O O   . GLY A 1 225 ? 18.136 9.845  53.264 1.00 20.81 ? 225 GLY A O   1 
ATOM   1700 N N   . ARG A 1 226 ? 18.805 11.376 51.776 1.00 15.90 ? 226 ARG A N   1 
ATOM   1701 C CA  . ARG A 1 226 ? 19.692 12.029 52.736 1.00 14.97 ? 226 ARG A CA  1 
ATOM   1702 C C   . ARG A 1 226 ? 18.879 12.908 53.686 1.00 15.03 ? 226 ARG A C   1 
ATOM   1703 O O   . ARG A 1 226 ? 17.855 13.466 53.288 1.00 13.46 ? 226 ARG A O   1 
ATOM   1704 C CB  . ARG A 1 226 ? 20.709 12.930 52.013 1.00 15.43 ? 226 ARG A CB  1 
ATOM   1705 C CG  . ARG A 1 226 ? 21.958 12.237 51.482 1.00 18.30 ? 226 ARG A CG  1 
ATOM   1706 C CD  . ARG A 1 226 ? 21.672 11.286 50.335 1.00 20.46 ? 226 ARG A CD  1 
ATOM   1707 N NE  . ARG A 1 226 ? 22.919 10.920 49.665 1.00 23.88 ? 226 ARG A NE  1 
ATOM   1708 C CZ  . ARG A 1 226 ? 23.009 10.129 48.603 1.00 23.05 ? 226 ARG A CZ  1 
ATOM   1709 N NH1 . ARG A 1 226 ? 21.925 9.597  48.066 1.00 24.78 ? 226 ARG A NH1 1 
ATOM   1710 N NH2 . ARG A 1 226 ? 24.196 9.879  48.066 1.00 24.88 ? 226 ARG A NH2 1 
ATOM   1711 N N   . THR A 1 227 ? 19.324 13.030 54.937 1.00 14.55 ? 227 THR A N   1 
ATOM   1712 C CA  . THR A 1 227 ? 18.637 13.918 55.876 1.00 13.39 ? 227 THR A CA  1 
ATOM   1713 C C   . THR A 1 227 ? 19.078 15.315 55.430 1.00 10.96 ? 227 THR A C   1 
ATOM   1714 O O   . THR A 1 227 ? 20.026 15.437 54.642 1.00 10.19 ? 227 THR A O   1 
ATOM   1715 C CB  . THR A 1 227 ? 19.095 13.699 57.328 1.00 12.88 ? 227 THR A CB  1 
ATOM   1716 O OG1 . THR A 1 227 ? 20.460 14.098 57.459 1.00 14.89 ? 227 THR A OG1 1 
ATOM   1717 C CG2 . THR A 1 227 ? 18.941 12.224 57.732 1.00 15.36 ? 227 THR A CG2 1 
ATOM   1718 N N   . PRO A 1 228 ? 18.402 16.381 55.906 1.00 9.06  ? 228 PRO A N   1 
ATOM   1719 C CA  . PRO A 1 228 ? 18.779 17.750 55.512 1.00 11.25 ? 228 PRO A CA  1 
ATOM   1720 C C   . PRO A 1 228 ? 20.240 18.069 55.799 1.00 11.13 ? 228 PRO A C   1 
ATOM   1721 O O   . PRO A 1 228 ? 20.952 18.633 54.967 1.00 7.72  ? 228 PRO A O   1 
ATOM   1722 C CB  . PRO A 1 228 ? 17.842 18.621 56.345 1.00 9.38  ? 228 PRO A CB  1 
ATOM   1723 C CG  . PRO A 1 228 ? 16.605 17.784 56.405 1.00 10.09 ? 228 PRO A CG  1 
ATOM   1724 C CD  . PRO A 1 228 ? 17.160 16.395 56.702 1.00 9.22  ? 228 PRO A CD  1 
ATOM   1725 N N   . GLN A 1 229 ? 20.695 17.699 56.988 1.00 12.35 ? 229 GLN A N   1 
ATOM   1726 C CA  . GLN A 1 229 ? 22.075 17.981 57.335 1.00 15.60 ? 229 GLN A CA  1 
ATOM   1727 C C   . GLN A 1 229 ? 23.064 17.206 56.453 1.00 15.49 ? 229 GLN A C   1 
ATOM   1728 O O   . GLN A 1 229 ? 24.076 17.757 56.025 1.00 16.12 ? 229 GLN A O   1 
ATOM   1729 C CB  . GLN A 1 229 ? 22.324 17.675 58.809 1.00 21.16 ? 229 GLN A CB  1 
ATOM   1730 C CG  . GLN A 1 229 ? 23.600 18.306 59.340 1.00 25.77 ? 229 GLN A CG  1 
ATOM   1731 C CD  . GLN A 1 229 ? 24.589 17.271 59.808 1.00 33.36 ? 229 GLN A CD  1 
ATOM   1732 O OE1 . GLN A 1 229 ? 25.145 16.516 59.007 1.00 35.84 ? 229 GLN A OE1 1 
ATOM   1733 N NE2 . GLN A 1 229 ? 24.808 17.216 61.120 1.00 35.32 ? 229 GLN A NE2 1 
ATOM   1734 N N   . GLN A 1 230 ? 22.778 15.938 56.184 1.00 14.52 ? 230 GLN A N   1 
ATOM   1735 C CA  . GLN A 1 230 ? 23.672 15.138 55.352 1.00 15.91 ? 230 GLN A CA  1 
ATOM   1736 C C   . GLN A 1 230 ? 23.685 15.692 53.932 1.00 13.10 ? 230 GLN A C   1 
ATOM   1737 O O   . GLN A 1 230 ? 24.728 15.701 53.269 1.00 12.69 ? 230 GLN A O   1 
ATOM   1738 C CB  . GLN A 1 230 ? 23.218 13.683 55.304 1.00 16.28 ? 230 GLN A CB  1 
ATOM   1739 C CG  . GLN A 1 230 ? 23.041 13.032 56.670 1.00 23.83 ? 230 GLN A CG  1 
ATOM   1740 C CD  . GLN A 1 230 ? 22.545 11.601 56.571 1.00 24.52 ? 230 GLN A CD  1 
ATOM   1741 O OE1 . GLN A 1 230 ? 21.650 11.288 55.777 1.00 21.06 ? 230 GLN A OE1 1 
ATOM   1742 N NE2 . GLN A 1 230 ? 23.119 10.719 57.390 1.00 30.22 ? 230 GLN A NE2 1 
ATOM   1743 N N   . ALA A 1 231 ? 22.517 16.127 53.465 1.00 9.81  ? 231 ALA A N   1 
ATOM   1744 C CA  . ALA A 1 231 ? 22.402 16.695 52.122 1.00 9.40  ? 231 ALA A CA  1 
ATOM   1745 C C   . ALA A 1 231 ? 23.276 17.960 52.005 1.00 8.41  ? 231 ALA A C   1 
ATOM   1746 O O   . ALA A 1 231 ? 24.018 18.128 51.028 1.00 10.32 ? 231 ALA A O   1 
ATOM   1747 C CB  . ALA A 1 231 ? 20.932 17.017 51.826 1.00 6.35  ? 231 ALA A CB  1 
ATOM   1748 N N   . CYS A 1 232 ? 23.185 18.851 52.994 1.00 10.85 ? 232 CYS A N   1 
ATOM   1749 C CA  . CYS A 1 232 ? 23.986 20.072 52.990 1.00 9.71  ? 232 CYS A CA  1 
ATOM   1750 C C   . CYS A 1 232 ? 25.466 19.725 53.043 1.00 12.89 ? 232 CYS A C   1 
ATOM   1751 O O   . CYS A 1 232 ? 26.282 20.337 52.352 1.00 13.56 ? 232 CYS A O   1 
ATOM   1752 C CB  . CYS A 1 232 ? 23.638 20.967 54.189 1.00 11.40 ? 232 CYS A CB  1 
ATOM   1753 S SG  . CYS A 1 232 ? 22.025 21.738 54.091 1.00 8.85  ? 232 CYS A SG  1 
ATOM   1754 N N   . LYS A 1 233 ? 25.810 18.737 53.866 1.00 13.09 ? 233 LYS A N   1 
ATOM   1755 C CA  . LYS A 1 233 ? 27.203 18.330 53.999 1.00 14.35 ? 233 LYS A CA  1 
ATOM   1756 C C   . LYS A 1 233 ? 27.752 17.725 52.705 1.00 13.74 ? 233 LYS A C   1 
ATOM   1757 O O   . LYS A 1 233 ? 28.856 18.050 52.287 1.00 15.94 ? 233 LYS A O   1 
ATOM   1758 C CB  . LYS A 1 233 ? 27.364 17.324 55.138 1.00 13.71 ? 233 LYS A CB  1 
ATOM   1759 C CG  . LYS A 1 233 ? 28.821 16.947 55.402 1.00 13.67 ? 233 LYS A CG  1 
ATOM   1760 C CD  . LYS A 1 233 ? 28.925 15.946 56.532 1.00 18.49 ? 233 LYS A CD  1 
ATOM   1761 C CE  . LYS A 1 233 ? 30.374 15.610 56.847 1.00 24.03 ? 233 LYS A CE  1 
ATOM   1762 N NZ  . LYS A 1 233 ? 30.437 14.685 58.009 1.00 26.75 ? 233 LYS A NZ  1 
ATOM   1763 N N   . GLU A 1 234 ? 26.987 16.839 52.078 1.00 15.97 ? 234 GLU A N   1 
ATOM   1764 C CA  . GLU A 1 234 ? 27.433 16.228 50.831 1.00 17.88 ? 234 GLU A CA  1 
ATOM   1765 C C   . GLU A 1 234 ? 27.575 17.262 49.728 1.00 18.79 ? 234 GLU A C   1 
ATOM   1766 O O   . GLU A 1 234 ? 28.498 17.178 48.908 1.00 18.09 ? 234 GLU A O   1 
ATOM   1767 C CB  . GLU A 1 234 ? 26.469 15.130 50.401 1.00 20.74 ? 234 GLU A CB  1 
ATOM   1768 C CG  . GLU A 1 234 ? 26.685 13.843 51.155 1.00 24.87 ? 234 GLU A CG  1 
ATOM   1769 C CD  . GLU A 1 234 ? 25.710 12.758 50.752 1.00 30.08 ? 234 GLU A CD  1 
ATOM   1770 O OE1 . GLU A 1 234 ? 25.405 12.650 49.541 1.00 26.18 ? 234 GLU A OE1 1 
ATOM   1771 O OE2 . GLU A 1 234 ? 25.264 12.008 51.653 1.00 31.36 ? 234 GLU A OE2 1 
ATOM   1772 N N   . ALA A 1 235 ? 26.676 18.246 49.712 1.00 16.07 ? 235 ALA A N   1 
ATOM   1773 C CA  . ALA A 1 235 ? 26.735 19.305 48.706 1.00 18.18 ? 235 ALA A CA  1 
ATOM   1774 C C   . ALA A 1 235 ? 28.034 20.097 48.883 1.00 20.63 ? 235 ALA A C   1 
ATOM   1775 O O   . ALA A 1 235 ? 28.756 20.355 47.916 1.00 21.13 ? 235 ALA A O   1 
ATOM   1776 C CB  . ALA A 1 235 ? 25.534 20.235 48.842 1.00 12.99 ? 235 ALA A CB  1 
ATOM   1777 N N   . VAL A 1 236 ? 28.316 20.482 50.125 1.00 18.95 ? 236 VAL A N   1 
ATOM   1778 C CA  . VAL A 1 236 ? 29.526 21.225 50.451 1.00 18.79 ? 236 VAL A CA  1 
ATOM   1779 C C   . VAL A 1 236 ? 30.765 20.444 50.040 1.00 17.85 ? 236 VAL A C   1 
ATOM   1780 O O   . VAL A 1 236 ? 31.706 20.999 49.471 1.00 19.69 ? 236 VAL A O   1 
ATOM   1781 C CB  . VAL A 1 236 ? 29.614 21.507 51.961 1.00 14.92 ? 236 VAL A CB  1 
ATOM   1782 C CG1 . VAL A 1 236 ? 31.019 21.993 52.327 1.00 15.41 ? 236 VAL A CG1 1 
ATOM   1783 C CG2 . VAL A 1 236 ? 28.578 22.555 52.344 1.00 18.64 ? 236 VAL A CG2 1 
ATOM   1784 N N   . GLU A 1 237 ? 30.782 19.157 50.350 1.00 18.89 ? 237 GLU A N   1 
ATOM   1785 C CA  . GLU A 1 237 ? 31.933 18.352 49.997 1.00 22.38 ? 237 GLU A CA  1 
ATOM   1786 C C   . GLU A 1 237 ? 32.122 18.321 48.476 1.00 25.17 ? 237 GLU A C   1 
ATOM   1787 O O   . GLU A 1 237 ? 33.207 18.010 47.985 1.00 20.30 ? 237 GLU A O   1 
ATOM   1788 C CB  . GLU A 1 237 ? 31.778 16.950 50.593 1.00 23.12 ? 237 GLU A CB  1 
ATOM   1789 C CG  . GLU A 1 237 ? 32.062 16.946 52.105 1.00 20.19 ? 237 GLU A CG  1 
ATOM   1790 C CD  . GLU A 1 237 ? 31.573 15.701 52.824 1.00 23.55 ? 237 GLU A CD  1 
ATOM   1791 O OE1 . GLU A 1 237 ? 31.943 15.520 54.007 1.00 20.11 ? 237 GLU A OE1 1 
ATOM   1792 O OE2 . GLU A 1 237 ? 30.812 14.908 52.226 1.00 24.45 ? 237 GLU A OE2 1 
ATOM   1793 N N   . ARG A 1 238 ? 31.068 18.676 47.741 1.00 27.33 ? 238 ARG A N   1 
ATOM   1794 C CA  . ARG A 1 238 ? 31.121 18.702 46.280 1.00 28.15 ? 238 ARG A CA  1 
ATOM   1795 C C   . ARG A 1 238 ? 31.773 19.989 45.817 1.00 25.73 ? 238 ARG A C   1 
ATOM   1796 O O   . ARG A 1 238 ? 32.474 20.011 44.807 1.00 28.63 ? 238 ARG A O   1 
ATOM   1797 C CB  . ARG A 1 238 ? 29.713 18.576 45.686 1.00 36.14 ? 238 ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 238 ? 29.636 18.818 44.181 1.00 45.10 ? 238 ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 238 ? 28.468 18.053 43.559 1.00 55.07 ? 238 ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 238 ? 28.042 18.609 42.273 1.00 63.00 ? 238 ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 238 ? 27.127 18.051 41.483 1.00 66.43 ? 238 ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 238 ? 26.539 16.914 41.841 1.00 67.28 ? 238 ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 238 ? 26.788 18.636 40.342 1.00 68.07 ? 238 ARG A NH2 1 
ATOM   1804 N N   . ILE A 1 239 ? 31.532 21.072 46.540 1.00 20.88 ? 239 ILE A N   1 
ATOM   1805 C CA  . ILE A 1 239 ? 32.162 22.334 46.189 1.00 23.30 ? 239 ILE A CA  1 
ATOM   1806 C C   . ILE A 1 239 ? 33.636 22.168 46.547 1.00 22.11 ? 239 ILE A C   1 
ATOM   1807 O O   . ILE A 1 239 ? 34.512 22.692 45.870 1.00 23.59 ? 239 ILE A O   1 
ATOM   1808 C CB  . ILE A 1 239 ? 31.549 23.515 46.983 1.00 21.52 ? 239 ILE A CB  1 
ATOM   1809 C CG1 . ILE A 1 239 ? 30.192 23.892 46.383 1.00 24.50 ? 239 ILE A CG1 1 
ATOM   1810 C CG2 . ILE A 1 239 ? 32.488 24.719 46.967 1.00 23.72 ? 239 ILE A CG2 1 
ATOM   1811 C CD1 . ILE A 1 239 ? 29.198 22.741 46.320 1.00 25.00 ? 239 ILE A CD1 1 
ATOM   1812 N N   . VAL A 1 240 ? 33.906 21.408 47.607 1.00 19.93 ? 240 VAL A N   1 
ATOM   1813 C CA  . VAL A 1 240 ? 35.286 21.195 48.034 1.00 18.68 ? 240 VAL A CA  1 
ATOM   1814 C C   . VAL A 1 240 ? 36.094 20.443 46.978 1.00 19.23 ? 240 VAL A C   1 
ATOM   1815 O O   . VAL A 1 240 ? 37.186 20.879 46.594 1.00 16.63 ? 240 VAL A O   1 
ATOM   1816 C CB  . VAL A 1 240 ? 35.343 20.412 49.363 1.00 15.61 ? 240 VAL A CB  1 
ATOM   1817 C CG1 . VAL A 1 240 ? 36.795 20.066 49.709 1.00 13.58 ? 240 VAL A CG1 1 
ATOM   1818 C CG2 . VAL A 1 240 ? 34.724 21.257 50.466 1.00 11.47 ? 240 VAL A CG2 1 
ATOM   1819 N N   . LYS A 1 241 ? 35.557 19.320 46.513 1.00 21.58 ? 241 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 241 ? 36.242 18.518 45.505 1.00 24.28 ? 241 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 241 ? 36.381 19.309 44.203 1.00 24.90 ? 241 LYS A C   1 
ATOM   1822 O O   . LYS A 1 241 ? 37.401 19.219 43.516 1.00 23.09 ? 241 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 241 ? 35.478 17.218 45.246 1.00 28.03 ? 241 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 241 ? 34.145 17.407 44.542 1.00 34.82 ? 241 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 241 ? 33.474 16.068 44.241 1.00 34.96 ? 241 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 241 ? 32.207 16.258 43.416 1.00 32.70 ? 241 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 241 ? 31.431 14.991 43.264 1.00 36.25 ? 241 LYS A NZ  1 
ATOM   1828 N N   . ILE A 1 242 ? 35.350 20.082 43.870 1.00 24.43 ? 242 ILE A N   1 
ATOM   1829 C CA  . ILE A 1 242 ? 35.357 20.892 42.660 1.00 23.45 ? 242 ILE A CA  1 
ATOM   1830 C C   . ILE A 1 242 ? 36.376 22.022 42.791 1.00 22.64 ? 242 ILE A C   1 
ATOM   1831 O O   . ILE A 1 242 ? 37.180 22.250 41.886 1.00 18.15 ? 242 ILE A O   1 
ATOM   1832 C CB  . ILE A 1 242 ? 33.923 21.424 42.358 1.00 25.52 ? 242 ILE A CB  1 
ATOM   1833 C CG1 . ILE A 1 242 ? 33.066 20.262 41.837 1.00 26.01 ? 242 ILE A CG1 1 
ATOM   1834 C CG2 . ILE A 1 242 ? 33.967 22.560 41.345 1.00 24.71 ? 242 ILE A CG2 1 
ATOM   1835 C CD1 . ILE A 1 242 ? 31.576 20.555 41.711 1.00 26.36 ? 242 ILE A CD1 1 
ATOM   1836 N N   . VAL A 1 243 ? 36.363 22.713 43.929 1.00 20.36 ? 243 VAL A N   1 
ATOM   1837 C CA  . VAL A 1 243 ? 37.318 23.786 44.180 1.00 18.99 ? 243 VAL A CA  1 
ATOM   1838 C C   . VAL A 1 243 ? 38.750 23.261 44.004 1.00 19.78 ? 243 VAL A C   1 
ATOM   1839 O O   . VAL A 1 243 ? 39.600 23.932 43.408 1.00 17.85 ? 243 VAL A O   1 
ATOM   1840 C CB  . VAL A 1 243 ? 37.172 24.361 45.624 1.00 18.30 ? 243 VAL A CB  1 
ATOM   1841 C CG1 . VAL A 1 243 ? 38.438 25.105 46.025 1.00 13.30 ? 243 VAL A CG1 1 
ATOM   1842 C CG2 . VAL A 1 243 ? 35.978 25.310 45.688 1.00 19.02 ? 243 VAL A CG2 1 
ATOM   1843 N N   . ASN A 1 244 ? 39.023 22.066 44.514 1.00 16.34 ? 244 ASN A N   1 
ATOM   1844 C CA  . ASN A 1 244 ? 40.368 21.528 44.372 1.00 18.78 ? 244 ASN A CA  1 
ATOM   1845 C C   . ASN A 1 244 ? 40.702 21.264 42.906 1.00 19.36 ? 244 ASN A C   1 
ATOM   1846 O O   . ASN A 1 244 ? 41.808 21.561 42.465 1.00 17.08 ? 244 ASN A O   1 
ATOM   1847 C CB  . ASN A 1 244 ? 40.541 20.247 45.183 1.00 20.97 ? 244 ASN A CB  1 
ATOM   1848 C CG  . ASN A 1 244 ? 41.977 19.735 45.158 1.00 26.37 ? 244 ASN A CG  1 
ATOM   1849 O OD1 . ASN A 1 244 ? 42.295 18.764 44.471 1.00 27.47 ? 244 ASN A OD1 1 
ATOM   1850 N ND2 . ASN A 1 244 ? 42.854 20.399 45.906 1.00 31.55 ? 244 ASN A ND2 1 
ATOM   1851 N N   . ARG A 1 245 ? 39.742 20.739 42.145 1.00 17.84 ? 245 ARG A N   1 
ATOM   1852 C CA  . ARG A 1 245 ? 39.990 20.447 40.734 1.00 19.21 ? 245 ARG A CA  1 
ATOM   1853 C C   . ARG A 1 245 ? 40.275 21.692 39.907 1.00 14.42 ? 245 ARG A C   1 
ATOM   1854 O O   . ARG A 1 245 ? 40.935 21.607 38.872 1.00 10.96 ? 245 ARG A O   1 
ATOM   1855 C CB  . ARG A 1 245 ? 38.820 19.661 40.127 1.00 23.53 ? 245 ARG A CB  1 
ATOM   1856 C CG  . ARG A 1 245 ? 38.477 18.419 40.913 1.00 29.39 ? 245 ARG A CG  1 
ATOM   1857 C CD  . ARG A 1 245 ? 37.776 17.367 40.075 1.00 36.84 ? 245 ARG A CD  1 
ATOM   1858 N NE  . ARG A 1 245 ? 38.726 16.553 39.320 1.00 43.84 ? 245 ARG A NE  1 
ATOM   1859 C CZ  . ARG A 1 245 ? 38.416 15.405 38.723 1.00 46.73 ? 245 ARG A CZ  1 
ATOM   1860 N NH1 . ARG A 1 245 ? 37.178 14.934 38.793 1.00 48.64 ? 245 ARG A NH1 1 
ATOM   1861 N NH2 . ARG A 1 245 ? 39.343 14.722 38.063 1.00 48.87 ? 245 ARG A NH2 1 
ATOM   1862 N N   . ARG A 1 246 ? 39.788 22.846 40.357 1.00 10.99 ? 246 ARG A N   1 
ATOM   1863 C CA  . ARG A 1 246 ? 40.034 24.088 39.641 1.00 13.00 ? 246 ARG A CA  1 
ATOM   1864 C C   . ARG A 1 246 ? 41.334 24.731 40.140 1.00 12.70 ? 246 ARG A C   1 
ATOM   1865 O O   . ARG A 1 246 ? 41.653 25.864 39.774 1.00 12.43 ? 246 ARG A O   1 
ATOM   1866 C CB  . ARG A 1 246 ? 38.870 25.075 39.823 1.00 14.56 ? 246 ARG A CB  1 
ATOM   1867 C CG  . ARG A 1 246 ? 37.504 24.550 39.379 1.00 16.00 ? 246 ARG A CG  1 
ATOM   1868 C CD  . ARG A 1 246 ? 36.441 25.657 39.468 1.00 14.87 ? 246 ARG A CD  1 
ATOM   1869 N NE  . ARG A 1 246 ? 36.661 26.710 38.471 1.00 15.60 ? 246 ARG A NE  1 
ATOM   1870 C CZ  . ARG A 1 246 ? 36.807 28.000 38.775 1.00 16.56 ? 246 ARG A CZ  1 
ATOM   1871 N NH1 . ARG A 1 246 ? 36.755 28.384 40.037 1.00 19.21 ? 246 ARG A NH1 1 
ATOM   1872 N NH2 . ARG A 1 246 ? 37.006 28.907 37.821 1.00 19.85 ? 246 ARG A NH2 1 
ATOM   1873 N N   . GLY A 1 247 ? 42.072 23.999 40.975 1.00 13.50 ? 247 GLY A N   1 
ATOM   1874 C CA  . GLY A 1 247 ? 43.330 24.502 41.512 1.00 14.18 ? 247 GLY A CA  1 
ATOM   1875 C C   . GLY A 1 247 ? 43.177 25.735 42.384 1.00 15.30 ? 247 GLY A C   1 
ATOM   1876 O O   . GLY A 1 247 ? 44.051 26.612 42.412 1.00 16.55 ? 247 GLY A O   1 
ATOM   1877 N N   . LYS A 1 248 ? 42.063 25.816 43.102 1.00 11.90 ? 248 LYS A N   1 
ATOM   1878 C CA  . LYS A 1 248 ? 41.811 26.965 43.951 1.00 13.69 ? 248 LYS A CA  1 
ATOM   1879 C C   . LYS A 1 248 ? 42.048 26.599 45.412 1.00 13.41 ? 248 LYS A C   1 
ATOM   1880 O O   . LYS A 1 248 ? 42.065 25.429 45.764 1.00 13.78 ? 248 LYS A O   1 
ATOM   1881 C CB  . LYS A 1 248 ? 40.376 27.452 43.749 1.00 14.69 ? 248 LYS A CB  1 
ATOM   1882 C CG  . LYS A 1 248 ? 40.071 27.844 42.311 1.00 17.13 ? 248 LYS A CG  1 
ATOM   1883 C CD  . LYS A 1 248 ? 41.066 28.873 41.796 1.00 15.81 ? 248 LYS A CD  1 
ATOM   1884 C CE  . LYS A 1 248 ? 40.673 29.393 40.411 1.00 22.26 ? 248 LYS A CE  1 
ATOM   1885 N NZ  . LYS A 1 248 ? 41.655 30.412 39.930 1.00 24.11 ? 248 LYS A NZ  1 
ATOM   1886 N N   . ASN A 1 249 ? 42.239 27.607 46.255 1.00 16.43 ? 249 ASN A N   1 
ATOM   1887 C CA  . ASN A 1 249 ? 42.488 27.358 47.674 1.00 12.92 ? 249 ASN A CA  1 
ATOM   1888 C C   . ASN A 1 249 ? 41.180 27.513 48.441 1.00 11.66 ? 249 ASN A C   1 
ATOM   1889 O O   . ASN A 1 249 ? 40.548 28.564 48.406 1.00 12.70 ? 249 ASN A O   1 
ATOM   1890 C CB  . ASN A 1 249 ? 43.543 28.335 48.201 1.00 13.47 ? 249 ASN A CB  1 
ATOM   1891 C CG  . ASN A 1 249 ? 43.976 28.009 49.618 1.00 17.20 ? 249 ASN A CG  1 
ATOM   1892 O OD1 . ASN A 1 249 ? 43.154 28.000 50.543 1.00 17.05 ? 249 ASN A OD1 1 
ATOM   1893 N ND2 . ASN A 1 249 ? 45.265 27.727 49.799 1.00 10.97 ? 249 ASN A ND2 1 
ATOM   1894 N N   . LEU A 1 250 ? 40.783 26.456 49.133 1.00 13.60 ? 250 LEU A N   1 
ATOM   1895 C CA  . LEU A 1 250 ? 39.533 26.462 49.880 1.00 14.23 ? 250 LEU A CA  1 
ATOM   1896 C C   . LEU A 1 250 ? 39.397 27.631 50.860 1.00 15.12 ? 250 LEU A C   1 
ATOM   1897 O O   . LEU A 1 250 ? 38.289 28.118 51.113 1.00 13.18 ? 250 LEU A O   1 
ATOM   1898 C CB  . LEU A 1 250 ? 39.377 25.126 50.609 1.00 14.44 ? 250 LEU A CB  1 
ATOM   1899 C CG  . LEU A 1 250 ? 37.979 24.787 51.134 1.00 16.12 ? 250 LEU A CG  1 
ATOM   1900 C CD1 . LEU A 1 250 ? 37.001 24.673 49.962 1.00 16.31 ? 250 LEU A CD1 1 
ATOM   1901 C CD2 . LEU A 1 250 ? 38.045 23.470 51.913 1.00 15.43 ? 250 LEU A CD2 1 
ATOM   1902 N N   . LYS A 1 251 ? 40.517 28.108 51.400 1.00 14.22 ? 251 LYS A N   1 
ATOM   1903 C CA  . LYS A 1 251 ? 40.452 29.213 52.346 1.00 14.31 ? 251 LYS A CA  1 
ATOM   1904 C C   . LYS A 1 251 ? 39.808 30.456 51.722 1.00 14.83 ? 251 LYS A C   1 
ATOM   1905 O O   . LYS A 1 251 ? 39.257 31.299 52.429 1.00 13.84 ? 251 LYS A O   1 
ATOM   1906 C CB  . LYS A 1 251 ? 41.856 29.566 52.860 1.00 15.58 ? 251 LYS A CB  1 
ATOM   1907 C CG  . LYS A 1 251 ? 41.858 30.318 54.172 1.00 16.46 ? 251 LYS A CG  1 
ATOM   1908 C CD  . LYS A 1 251 ? 41.378 29.394 55.286 1.00 20.61 ? 251 LYS A CD  1 
ATOM   1909 C CE  . LYS A 1 251 ? 41.544 30.011 56.663 1.00 23.28 ? 251 LYS A CE  1 
ATOM   1910 N NZ  . LYS A 1 251 ? 41.316 28.991 57.742 1.00 18.38 ? 251 LYS A NZ  1 
ATOM   1911 N N   . ASP A 1 252 ? 39.870 30.567 50.399 1.00 15.48 ? 252 ASP A N   1 
ATOM   1912 C CA  . ASP A 1 252 ? 39.308 31.735 49.721 1.00 16.59 ? 252 ASP A CA  1 
ATOM   1913 C C   . ASP A 1 252 ? 37.828 31.609 49.385 1.00 19.44 ? 252 ASP A C   1 
ATOM   1914 O O   . ASP A 1 252 ? 37.229 32.549 48.858 1.00 18.33 ? 252 ASP A O   1 
ATOM   1915 C CB  . ASP A 1 252 ? 40.082 32.017 48.426 1.00 17.42 ? 252 ASP A CB  1 
ATOM   1916 C CG  . ASP A 1 252 ? 41.574 32.195 48.666 1.00 17.08 ? 252 ASP A CG  1 
ATOM   1917 O OD1 . ASP A 1 252 ? 41.935 32.985 49.562 1.00 22.02 ? 252 ASP A OD1 1 
ATOM   1918 O OD2 . ASP A 1 252 ? 42.377 31.549 47.961 1.00 17.48 ? 252 ASP A OD2 1 
ATOM   1919 N N   . ILE A 1 253 ? 37.234 30.464 49.709 1.00 19.14 ? 253 ILE A N   1 
ATOM   1920 C CA  . ILE A 1 253 ? 35.831 30.212 49.379 1.00 19.47 ? 253 ILE A CA  1 
ATOM   1921 C C   . ILE A 1 253 ? 34.954 29.909 50.594 1.00 20.94 ? 253 ILE A C   1 
ATOM   1922 O O   . ILE A 1 253 ? 35.339 29.108 51.446 1.00 18.14 ? 253 ILE A O   1 
ATOM   1923 C CB  . ILE A 1 253 ? 35.728 29.010 48.414 1.00 21.97 ? 253 ILE A CB  1 
ATOM   1924 C CG1 . ILE A 1 253 ? 36.660 29.214 47.220 1.00 25.01 ? 253 ILE A CG1 1 
ATOM   1925 C CG2 . ILE A 1 253 ? 34.288 28.825 47.944 1.00 23.79 ? 253 ILE A CG2 1 
ATOM   1926 C CD1 . ILE A 1 253 ? 36.350 30.440 46.399 1.00 24.53 ? 253 ILE A CD1 1 
ATOM   1927 N N   . GLN A 1 254 ? 33.790 30.559 50.672 1.00 18.51 ? 254 GLN A N   1 
ATOM   1928 C CA  . GLN A 1 254 ? 32.842 30.316 51.763 1.00 20.40 ? 254 GLN A CA  1 
ATOM   1929 C C   . GLN A 1 254 ? 31.442 30.161 51.202 1.00 23.34 ? 254 GLN A C   1 
ATOM   1930 O O   . GLN A 1 254 ? 30.964 30.996 50.437 1.00 23.50 ? 254 GLN A O   1 
ATOM   1931 C CB  . GLN A 1 254 ? 32.838 31.455 52.789 1.00 18.71 ? 254 GLN A CB  1 
ATOM   1932 C CG  . GLN A 1 254 ? 31.693 31.401 53.835 1.00 19.11 ? 254 GLN A CG  1 
ATOM   1933 C CD  . GLN A 1 254 ? 31.756 30.202 54.799 1.00 18.82 ? 254 GLN A CD  1 
ATOM   1934 O OE1 . GLN A 1 254 ? 31.645 30.370 56.018 1.00 20.65 ? 254 GLN A OE1 1 
ATOM   1935 N NE2 . GLN A 1 254 ? 31.918 29.001 54.259 1.00 13.11 ? 254 GLN A NE2 1 
ATOM   1936 N N   . VAL A 1 255 ? 30.799 29.066 51.581 1.00 24.28 ? 255 VAL A N   1 
ATOM   1937 C CA  . VAL A 1 255 ? 29.441 28.779 51.155 1.00 23.84 ? 255 VAL A CA  1 
ATOM   1938 C C   . VAL A 1 255 ? 28.748 28.031 52.275 1.00 25.01 ? 255 VAL A C   1 
ATOM   1939 O O   . VAL A 1 255 ? 29.334 27.158 52.921 1.00 21.48 ? 255 VAL A O   1 
ATOM   1940 C CB  . VAL A 1 255 ? 29.392 27.891 49.903 1.00 20.73 ? 255 VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 255 ? 27.983 27.328 49.731 1.00 23.95 ? 255 VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 255 ? 29.769 28.699 48.671 1.00 25.50 ? 255 VAL A CG2 1 
ATOM   1943 N N   . GLY A 1 256 ? 27.499 28.398 52.514 1.00 23.44 ? 256 GLY A N   1 
ATOM   1944 C CA  . GLY A 1 256 ? 26.737 27.725 53.535 1.00 21.71 ? 256 GLY A CA  1 
ATOM   1945 C C   . GLY A 1 256 ? 25.404 27.378 52.917 1.00 21.44 ? 256 GLY A C   1 
ATOM   1946 O O   . GLY A 1 256 ? 24.916 28.111 52.051 1.00 22.22 ? 256 GLY A O   1 
ATOM   1947 N N   . PHE A 1 257 ? 24.843 26.240 53.314 1.00 15.20 ? 257 PHE A N   1 
ATOM   1948 C CA  . PHE A 1 257 ? 23.529 25.834 52.839 1.00 8.53  ? 257 PHE A CA  1 
ATOM   1949 C C   . PHE A 1 257 ? 22.726 25.522 54.091 1.00 7.56  ? 257 PHE A C   1 
ATOM   1950 O O   . PHE A 1 257 ? 23.279 25.042 55.085 1.00 8.28  ? 257 PHE A O   1 
ATOM   1951 C CB  . PHE A 1 257 ? 23.549 24.531 52.019 1.00 8.93  ? 257 PHE A CB  1 
ATOM   1952 C CG  . PHE A 1 257 ? 24.258 24.616 50.700 1.00 9.24  ? 257 PHE A CG  1 
ATOM   1953 C CD1 . PHE A 1 257 ? 25.557 24.110 50.557 1.00 11.13 ? 257 PHE A CD1 1 
ATOM   1954 C CD2 . PHE A 1 257 ? 23.616 25.143 49.580 1.00 9.76  ? 257 PHE A CD2 1 
ATOM   1955 C CE1 . PHE A 1 257 ? 26.199 24.122 49.313 1.00 15.45 ? 257 PHE A CE1 1 
ATOM   1956 C CE2 . PHE A 1 257 ? 24.254 25.158 48.332 1.00 10.81 ? 257 PHE A CE2 1 
ATOM   1957 C CZ  . PHE A 1 257 ? 25.544 24.647 48.199 1.00 8.51  ? 257 PHE A CZ  1 
ATOM   1958 N N   . ILE A 1 258 ? 21.435 25.811 54.053 1.00 5.90  ? 258 ILE A N   1 
ATOM   1959 C CA  . ILE A 1 258 ? 20.553 25.453 55.148 1.00 6.99  ? 258 ILE A CA  1 
ATOM   1960 C C   . ILE A 1 258 ? 19.437 24.739 54.409 1.00 7.89  ? 258 ILE A C   1 
ATOM   1961 O O   . ILE A 1 258 ? 19.138 25.081 53.250 1.00 5.11  ? 258 ILE A O   1 
ATOM   1962 C CB  . ILE A 1 258 ? 20.029 26.677 55.927 1.00 7.82  ? 258 ILE A CB  1 
ATOM   1963 C CG1 . ILE A 1 258 ? 19.276 27.626 54.993 1.00 7.43  ? 258 ILE A CG1 1 
ATOM   1964 C CG2 . ILE A 1 258 ? 21.207 27.368 56.623 1.00 9.63  ? 258 ILE A CG2 1 
ATOM   1965 C CD1 . ILE A 1 258 ? 18.704 28.850 55.697 1.00 6.60  ? 258 ILE A CD1 1 
ATOM   1966 N N   . ALA A 1 259 ? 18.843 23.736 55.055 1.00 6.96  ? 259 ALA A N   1 
ATOM   1967 C CA  . ALA A 1 259 ? 17.804 22.956 54.396 1.00 7.08  ? 259 ALA A CA  1 
ATOM   1968 C C   . ALA A 1 259 ? 16.711 22.495 55.331 1.00 7.28  ? 259 ALA A C   1 
ATOM   1969 O O   . ALA A 1 259 ? 16.892 22.412 56.543 1.00 6.64  ? 259 ALA A O   1 
ATOM   1970 C CB  . ALA A 1 259 ? 18.429 21.756 53.692 1.00 4.93  ? 259 ALA A CB  1 
ATOM   1971 N N   . LEU A 1 260 ? 15.575 22.168 54.737 1.00 7.64  ? 260 LEU A N   1 
ATOM   1972 C CA  . LEU A 1 260 ? 14.405 21.752 55.486 1.00 9.91  ? 260 LEU A CA  1 
ATOM   1973 C C   . LEU A 1 260 ? 13.709 20.674 54.658 1.00 10.47 ? 260 LEU A C   1 
ATOM   1974 O O   . LEU A 1 260 ? 13.671 20.771 53.435 1.00 8.25  ? 260 LEU A O   1 
ATOM   1975 C CB  . LEU A 1 260 ? 13.521 22.994 55.634 1.00 11.87 ? 260 LEU A CB  1 
ATOM   1976 C CG  . LEU A 1 260 ? 12.356 23.211 56.588 1.00 13.47 ? 260 LEU A CG  1 
ATOM   1977 C CD1 . LEU A 1 260 ? 12.745 22.904 58.031 1.00 7.38  ? 260 LEU A CD1 1 
ATOM   1978 C CD2 . LEU A 1 260 ? 11.922 24.668 56.424 1.00 8.85  ? 260 LEU A CD2 1 
ATOM   1979 N N   . ASN A 1 261 ? 13.215 19.608 55.285 1.00 11.64 ? 261 ASN A N   1 
ATOM   1980 C CA  . ASN A 1 261 ? 12.486 18.637 54.482 1.00 10.01 ? 261 ASN A CA  1 
ATOM   1981 C C   . ASN A 1 261 ? 11.016 18.748 54.827 1.00 10.24 ? 261 ASN A C   1 
ATOM   1982 O O   . ASN A 1 261 ? 10.633 19.558 55.672 1.00 10.27 ? 261 ASN A O   1 
ATOM   1983 C CB  . ASN A 1 261 ? 12.995 17.188 54.658 1.00 9.86  ? 261 ASN A CB  1 
ATOM   1984 C CG  . ASN A 1 261 ? 12.869 16.672 56.077 1.00 8.25  ? 261 ASN A CG  1 
ATOM   1985 O OD1 . ASN A 1 261 ? 12.015 17.106 56.844 1.00 10.15 ? 261 ASN A OD1 1 
ATOM   1986 N ND2 . ASN A 1 261 ? 13.715 15.708 56.421 1.00 12.37 ? 261 ASN A ND2 1 
ATOM   1987 N N   . LYS A 1 262 ? 10.204 17.940 54.157 1.00 10.91 ? 262 LYS A N   1 
ATOM   1988 C CA  . LYS A 1 262 ? 8.761  17.932 54.344 1.00 15.31 ? 262 LYS A CA  1 
ATOM   1989 C C   . LYS A 1 262 ? 8.337  17.625 55.781 1.00 13.42 ? 262 LYS A C   1 
ATOM   1990 O O   . LYS A 1 262 ? 7.237  17.997 56.201 1.00 10.84 ? 262 LYS A O   1 
ATOM   1991 C CB  . LYS A 1 262 ? 8.136  16.917 53.386 1.00 16.88 ? 262 LYS A CB  1 
ATOM   1992 C CG  . LYS A 1 262 ? 6.635  17.049 53.193 1.00 23.89 ? 262 LYS A CG  1 
ATOM   1993 C CD  . LYS A 1 262 ? 6.277  18.290 52.390 1.00 25.34 ? 262 LYS A CD  1 
ATOM   1994 C CE  . LYS A 1 262 ? 4.810  18.259 52.000 1.00 27.92 ? 262 LYS A CE  1 
ATOM   1995 N NZ  . LYS A 1 262 ? 4.416  19.478 51.265 1.00 27.77 ? 262 LYS A NZ  1 
ATOM   1996 N N   . LYS A 1 263 ? 9.196  16.936 56.527 1.00 11.51 ? 263 LYS A N   1 
ATOM   1997 C CA  . LYS A 1 263 ? 8.882  16.600 57.918 1.00 14.02 ? 263 LYS A CA  1 
ATOM   1998 C C   . LYS A 1 263 ? 9.306  17.682 58.913 1.00 13.47 ? 263 LYS A C   1 
ATOM   1999 O O   . LYS A 1 263 ? 9.127  17.530 60.127 1.00 13.24 ? 263 LYS A O   1 
ATOM   2000 C CB  . LYS A 1 263 ? 9.535  15.268 58.315 1.00 17.82 ? 263 LYS A CB  1 
ATOM   2001 C CG  . LYS A 1 263 ? 8.996  14.066 57.548 1.00 22.98 ? 263 LYS A CG  1 
ATOM   2002 C CD  . LYS A 1 263 ? 9.292  12.756 58.276 1.00 31.66 ? 263 LYS A CD  1 
ATOM   2003 C CE  . LYS A 1 263 ? 10.788 12.520 58.455 1.00 33.64 ? 263 LYS A CE  1 
ATOM   2004 N NZ  . LYS A 1 263 ? 11.065 11.232 59.156 1.00 37.55 ? 263 LYS A NZ  1 
ATOM   2005 N N   . GLY A 1 264 ? 9.876  18.773 58.408 1.00 10.87 ? 264 GLY A N   1 
ATOM   2006 C CA  . GLY A 1 264 ? 10.299 19.831 59.302 1.00 10.24 ? 264 GLY A CA  1 
ATOM   2007 C C   . GLY A 1 264 ? 11.650 19.587 59.933 1.00 10.08 ? 264 GLY A C   1 
ATOM   2008 O O   . GLY A 1 264 ? 12.049 20.307 60.845 1.00 10.58 ? 264 GLY A O   1 
ATOM   2009 N N   . GLU A 1 265 ? 12.354 18.557 59.479 1.00 10.55 ? 265 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 265 ? 13.691 18.312 60.009 1.00 9.70  ? 265 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 265 ? 14.535 19.326 59.256 1.00 8.47  ? 265 GLU A C   1 
ATOM   2012 O O   . GLU A 1 265 ? 14.225 19.655 58.115 1.00 9.74  ? 265 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 265 ? 14.183 16.910 59.665 1.00 13.57 ? 265 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 265 ? 13.466 15.789 60.369 1.00 21.10 ? 265 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 265 ? 13.998 14.438 59.941 1.00 21.92 ? 265 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 265 ? 13.747 14.043 58.785 1.00 24.89 ? 265 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 265 ? 14.677 13.781 60.756 1.00 28.46 ? 265 GLU A OE2 1 
ATOM   2018 N N   . TYR A 1 266 ? 15.595 19.822 59.877 1.00 6.71  ? 266 TYR A N   1 
ATOM   2019 C CA  . TYR A 1 266 ? 16.430 20.807 59.206 1.00 6.23  ? 266 TYR A CA  1 
ATOM   2020 C C   . TYR A 1 266 ? 17.905 20.506 59.392 1.00 8.88  ? 266 TYR A C   1 
ATOM   2021 O O   . TYR A 1 266 ? 18.297 19.650 60.190 1.00 7.73  ? 266 TYR A O   1 
ATOM   2022 C CB  . TYR A 1 266 ? 16.105 22.211 59.737 1.00 6.42  ? 266 TYR A CB  1 
ATOM   2023 C CG  . TYR A 1 266 ? 16.441 22.434 61.190 1.00 7.61  ? 266 TYR A CG  1 
ATOM   2024 C CD1 . TYR A 1 266 ? 17.712 22.868 61.577 1.00 8.94  ? 266 TYR A CD1 1 
ATOM   2025 C CD2 . TYR A 1 266 ? 15.495 22.193 62.189 1.00 8.19  ? 266 TYR A CD2 1 
ATOM   2026 C CE1 . TYR A 1 266 ? 18.026 23.056 62.925 1.00 9.64  ? 266 TYR A CE1 1 
ATOM   2027 C CE2 . TYR A 1 266 ? 15.798 22.373 63.529 1.00 11.46 ? 266 TYR A CE2 1 
ATOM   2028 C CZ  . TYR A 1 266 ? 17.067 22.806 63.893 1.00 10.81 ? 266 TYR A CZ  1 
ATOM   2029 O OH  . TYR A 1 266 ? 17.377 22.992 65.225 1.00 13.14 ? 266 TYR A OH  1 
ATOM   2030 N N   . GLY A 1 267 ? 18.733 21.215 58.643 1.00 10.89 ? 267 GLY A N   1 
ATOM   2031 C CA  . GLY A 1 267 ? 20.156 20.994 58.757 1.00 10.86 ? 267 GLY A CA  1 
ATOM   2032 C C   . GLY A 1 267 ? 20.902 22.094 58.045 1.00 8.39  ? 267 GLY A C   1 
ATOM   2033 O O   . GLY A 1 267 ? 20.295 22.916 57.360 1.00 5.36  ? 267 GLY A O   1 
ATOM   2034 N N   . ALA A 1 268 ? 22.221 22.099 58.210 1.00 6.45  ? 268 ALA A N   1 
ATOM   2035 C CA  . ALA A 1 268 ? 23.058 23.103 57.573 1.00 7.78  ? 268 ALA A CA  1 
ATOM   2036 C C   . ALA A 1 268 ? 24.505 22.651 57.590 1.00 9.09  ? 268 ALA A C   1 
ATOM   2037 O O   . ALA A 1 268 ? 24.904 21.779 58.378 1.00 8.83  ? 268 ALA A O   1 
ATOM   2038 C CB  . ALA A 1 268 ? 22.924 24.442 58.294 1.00 7.55  ? 268 ALA A CB  1 
ATOM   2039 N N   . TYR A 1 269 ? 25.293 23.233 56.705 1.00 8.51  ? 269 TYR A N   1 
ATOM   2040 C CA  . TYR A 1 269 ? 26.700 22.913 56.650 1.00 9.49  ? 269 TYR A CA  1 
ATOM   2041 C C   . TYR A 1 269 ? 27.356 24.023 55.870 1.00 12.09 ? 269 TYR A C   1 
ATOM   2042 O O   . TYR A 1 269 ? 26.704 24.712 55.076 1.00 9.67  ? 269 TYR A O   1 
ATOM   2043 C CB  . TYR A 1 269 ? 26.941 21.588 55.938 1.00 10.47 ? 269 TYR A CB  1 
ATOM   2044 C CG  . TYR A 1 269 ? 28.189 20.894 56.415 1.00 12.11 ? 269 TYR A CG  1 
ATOM   2045 C CD1 . TYR A 1 269 ? 28.171 20.132 57.580 1.00 11.53 ? 269 TYR A CD1 1 
ATOM   2046 C CD2 . TYR A 1 269 ? 29.393 21.010 55.715 1.00 13.66 ? 269 TYR A CD2 1 
ATOM   2047 C CE1 . TYR A 1 269 ? 29.320 19.492 58.041 1.00 12.82 ? 269 TYR A CE1 1 
ATOM   2048 C CE2 . TYR A 1 269 ? 30.545 20.377 56.163 1.00 15.93 ? 269 TYR A CE2 1 
ATOM   2049 C CZ  . TYR A 1 269 ? 30.497 19.613 57.329 1.00 16.34 ? 269 TYR A CZ  1 
ATOM   2050 O OH  . TYR A 1 269 ? 31.610 18.933 57.758 1.00 18.86 ? 269 TYR A OH  1 
ATOM   2051 N N   . CYS A 1 270 ? 28.645 24.214 56.105 1.00 8.94  ? 270 CYS A N   1 
ATOM   2052 C CA  . CYS A 1 270 ? 29.347 25.256 55.385 1.00 12.71 ? 270 CYS A CA  1 
ATOM   2053 C C   . CYS A 1 270 ? 30.786 24.838 55.133 1.00 13.96 ? 270 CYS A C   1 
ATOM   2054 O O   . CYS A 1 270 ? 31.265 23.834 55.672 1.00 9.32  ? 270 CYS A O   1 
ATOM   2055 C CB  . CYS A 1 270 ? 29.247 26.581 56.159 1.00 13.10 ? 270 CYS A CB  1 
ATOM   2056 S SG  . CYS A 1 270 ? 29.840 26.543 57.897 1.00 21.81 ? 270 CYS A SG  1 
ATOM   2057 N N   . ILE A 1 271 ? 31.465 25.579 54.268 1.00 15.28 ? 271 ILE A N   1 
ATOM   2058 C CA  . ILE A 1 271 ? 32.846 25.266 53.949 1.00 16.08 ? 271 ILE A CA  1 
ATOM   2059 C C   . ILE A 1 271 ? 33.749 25.638 55.110 1.00 14.86 ? 271 ILE A C   1 
ATOM   2060 O O   . ILE A 1 271 ? 34.583 24.839 55.546 1.00 14.23 ? 271 ILE A O   1 
ATOM   2061 C CB  . ILE A 1 271 ? 33.316 26.041 52.695 1.00 17.17 ? 271 ILE A CB  1 
ATOM   2062 C CG1 . ILE A 1 271 ? 32.615 25.476 51.457 1.00 20.15 ? 271 ILE A CG1 1 
ATOM   2063 C CG2 . ILE A 1 271 ? 34.840 25.957 52.565 1.00 18.23 ? 271 ILE A CG2 1 
ATOM   2064 C CD1 . ILE A 1 271 ? 32.907 26.230 50.158 1.00 19.91 ? 271 ILE A CD1 1 
ATOM   2065 N N   . GLN A 1 272 ? 33.583 26.864 55.593 1.00 15.88 ? 272 GLN A N   1 
ATOM   2066 C CA  . GLN A 1 272 ? 34.394 27.379 56.681 1.00 15.29 ? 272 GLN A CA  1 
ATOM   2067 C C   . GLN A 1 272 ? 33.585 27.731 57.905 1.00 15.96 ? 272 GLN A C   1 
ATOM   2068 O O   . GLN A 1 272 ? 32.424 28.127 57.807 1.00 19.29 ? 272 GLN A O   1 
ATOM   2069 C CB  . GLN A 1 272 ? 35.153 28.624 56.222 1.00 14.46 ? 272 GLN A CB  1 
ATOM   2070 C CG  . GLN A 1 272 ? 36.024 28.391 55.015 1.00 14.59 ? 272 GLN A CG  1 
ATOM   2071 C CD  . GLN A 1 272 ? 36.921 29.568 54.728 1.00 16.05 ? 272 GLN A CD  1 
ATOM   2072 O OE1 . GLN A 1 272 ? 37.615 30.055 55.614 1.00 18.88 ? 272 GLN A OE1 1 
ATOM   2073 N NE2 . GLN A 1 272 ? 36.920 30.026 53.485 1.00 13.54 ? 272 GLN A NE2 1 
ATOM   2074 N N   . ASP A 1 273 ? 34.228 27.615 59.060 1.00 17.08 ? 273 ASP A N   1 
ATOM   2075 C CA  . ASP A 1 273 ? 33.599 27.925 60.331 1.00 16.66 ? 273 ASP A CA  1 
ATOM   2076 C C   . ASP A 1 273 ? 33.260 29.415 60.381 1.00 19.03 ? 273 ASP A C   1 
ATOM   2077 O O   . ASP A 1 273 ? 33.882 30.223 59.688 1.00 20.26 ? 273 ASP A O   1 
ATOM   2078 C CB  . ASP A 1 273 ? 34.554 27.539 61.467 1.00 19.47 ? 273 ASP A CB  1 
ATOM   2079 C CG  . ASP A 1 273 ? 33.902 27.617 62.832 1.00 20.71 ? 273 ASP A CG  1 
ATOM   2080 O OD1 . ASP A 1 273 ? 32.672 27.395 62.922 1.00 20.44 ? 273 ASP A OD1 1 
ATOM   2081 O OD2 . ASP A 1 273 ? 34.628 27.885 63.811 1.00 19.73 ? 273 ASP A OD2 1 
ATOM   2082 N N   . GLY A 1 274 ? 32.256 29.779 61.171 1.00 15.75 ? 274 GLY A N   1 
ATOM   2083 C CA  . GLY A 1 274 ? 31.891 31.182 61.279 1.00 16.54 ? 274 GLY A CA  1 
ATOM   2084 C C   . GLY A 1 274 ? 30.525 31.540 60.714 1.00 16.12 ? 274 GLY A C   1 
ATOM   2085 O O   . GLY A 1 274 ? 30.029 32.637 60.922 1.00 16.57 ? 274 GLY A O   1 
ATOM   2086 N N   . PHE A 1 275 ? 29.918 30.626 59.974 1.00 12.47 ? 275 PHE A N   1 
ATOM   2087 C CA  . PHE A 1 275 ? 28.599 30.894 59.421 1.00 14.49 ? 275 PHE A CA  1 
ATOM   2088 C C   . PHE A 1 275 ? 27.588 30.428 60.455 1.00 14.50 ? 275 PHE A C   1 
ATOM   2089 O O   . PHE A 1 275 ? 27.837 29.462 61.165 1.00 16.55 ? 275 PHE A O   1 
ATOM   2090 C CB  . PHE A 1 275 ? 28.389 30.109 58.112 1.00 11.95 ? 275 PHE A CB  1 
ATOM   2091 C CG  . PHE A 1 275 ? 26.965 30.108 57.633 1.00 13.26 ? 275 PHE A CG  1 
ATOM   2092 C CD1 . PHE A 1 275 ? 26.395 31.261 57.099 1.00 12.33 ? 275 PHE A CD1 1 
ATOM   2093 C CD2 . PHE A 1 275 ? 26.181 28.964 57.747 1.00 13.28 ? 275 PHE A CD2 1 
ATOM   2094 C CE1 . PHE A 1 275 ? 25.062 31.274 56.687 1.00 12.88 ? 275 PHE A CE1 1 
ATOM   2095 C CE2 . PHE A 1 275 ? 24.844 28.969 57.339 1.00 15.49 ? 275 PHE A CE2 1 
ATOM   2096 C CZ  . PHE A 1 275 ? 24.286 30.126 56.808 1.00 11.94 ? 275 PHE A CZ  1 
ATOM   2097 N N   . ASN A 1 276 ? 26.472 31.134 60.575 1.00 13.82 ? 276 ASN A N   1 
ATOM   2098 C CA  . ASN A 1 276 ? 25.424 30.699 61.485 1.00 12.83 ? 276 ASN A CA  1 
ATOM   2099 C C   . ASN A 1 276 ? 24.078 30.940 60.824 1.00 10.80 ? 276 ASN A C   1 
ATOM   2100 O O   . ASN A 1 276 ? 23.987 31.677 59.838 1.00 13.52 ? 276 ASN A O   1 
ATOM   2101 C CB  . ASN A 1 276 ? 25.515 31.408 62.842 1.00 18.26 ? 276 ASN A CB  1 
ATOM   2102 C CG  . ASN A 1 276 ? 25.578 32.911 62.730 1.00 22.59 ? 276 ASN A CG  1 
ATOM   2103 O OD1 . ASN A 1 276 ? 25.940 33.586 63.693 1.00 32.69 ? 276 ASN A OD1 1 
ATOM   2104 N ND2 . ASN A 1 276 ? 25.223 33.448 61.575 1.00 23.62 ? 276 ASN A ND2 1 
ATOM   2105 N N   . PHE A 1 277 ? 23.040 30.305 61.352 1.00 8.08  ? 277 PHE A N   1 
ATOM   2106 C CA  . PHE A 1 277 ? 21.705 30.457 60.785 1.00 7.31  ? 277 PHE A CA  1 
ATOM   2107 C C   . PHE A 1 277 ? 20.701 30.492 61.927 1.00 7.39  ? 277 PHE A C   1 
ATOM   2108 O O   . PHE A 1 277 ? 20.987 30.033 63.027 1.00 7.75  ? 277 PHE A O   1 
ATOM   2109 C CB  . PHE A 1 277 ? 21.393 29.299 59.805 1.00 6.57  ? 277 PHE A CB  1 
ATOM   2110 C CG  . PHE A 1 277 ? 21.291 27.940 60.450 1.00 8.58  ? 277 PHE A CG  1 
ATOM   2111 C CD1 . PHE A 1 277 ? 20.053 27.412 60.796 1.00 7.07  ? 277 PHE A CD1 1 
ATOM   2112 C CD2 . PHE A 1 277 ? 22.437 27.198 60.747 1.00 8.01  ? 277 PHE A CD2 1 
ATOM   2113 C CE1 . PHE A 1 277 ? 19.954 26.180 61.426 1.00 8.17  ? 277 PHE A CE1 1 
ATOM   2114 C CE2 . PHE A 1 277 ? 22.341 25.962 61.381 1.00 9.56  ? 277 PHE A CE2 1 
ATOM   2115 C CZ  . PHE A 1 277 ? 21.096 25.452 61.722 1.00 8.71  ? 277 PHE A CZ  1 
ATOM   2116 N N   . ALA A 1 278 ? 19.529 31.051 61.660 1.00 7.00  ? 278 ALA A N   1 
ATOM   2117 C CA  . ALA A 1 278 ? 18.492 31.146 62.680 1.00 7.86  ? 278 ALA A CA  1 
ATOM   2118 C C   . ALA A 1 278 ? 17.348 30.190 62.376 1.00 7.76  ? 278 ALA A C   1 
ATOM   2119 O O   . ALA A 1 278 ? 16.906 30.095 61.234 1.00 8.16  ? 278 ALA A O   1 
ATOM   2120 C CB  . ALA A 1 278 ? 17.970 32.574 62.732 1.00 4.33  ? 278 ALA A CB  1 
ATOM   2121 N N   . VAL A 1 279 ? 16.873 29.477 63.395 1.00 6.52  ? 279 VAL A N   1 
ATOM   2122 C CA  . VAL A 1 279 ? 15.749 28.571 63.207 1.00 8.41  ? 279 VAL A CA  1 
ATOM   2123 C C   . VAL A 1 279 ? 14.676 28.923 64.231 1.00 8.08  ? 279 VAL A C   1 
ATOM   2124 O O   . VAL A 1 279 ? 14.976 29.182 65.398 1.00 6.15  ? 279 VAL A O   1 
ATOM   2125 C CB  . VAL A 1 279 ? 16.171 27.074 63.338 1.00 11.60 ? 279 VAL A CB  1 
ATOM   2126 C CG1 . VAL A 1 279 ? 16.988 26.852 64.586 1.00 13.15 ? 279 VAL A CG1 1 
ATOM   2127 C CG2 . VAL A 1 279 ? 14.922 26.183 63.348 1.00 11.34 ? 279 VAL A CG2 1 
ATOM   2128 N N   . HIS A 1 280 ? 13.433 28.974 63.773 1.00 5.97  ? 280 HIS A N   1 
ATOM   2129 C CA  . HIS A 1 280 ? 12.310 29.300 64.633 1.00 9.13  ? 280 HIS A CA  1 
ATOM   2130 C C   . HIS A 1 280 ? 11.226 28.246 64.451 1.00 9.57  ? 280 HIS A C   1 
ATOM   2131 O O   . HIS A 1 280 ? 10.731 28.043 63.342 1.00 8.54  ? 280 HIS A O   1 
ATOM   2132 C CB  . HIS A 1 280 ? 11.742 30.678 64.258 1.00 7.50  ? 280 HIS A CB  1 
ATOM   2133 C CG  . HIS A 1 280 ? 10.839 31.277 65.300 1.00 6.82  ? 280 HIS A CG  1 
ATOM   2134 N ND1 . HIS A 1 280 ? 10.048 30.517 66.133 1.00 9.87  ? 280 HIS A ND1 1 
ATOM   2135 C CD2 . HIS A 1 280 ? 10.621 32.567 65.652 1.00 9.95  ? 280 HIS A CD2 1 
ATOM   2136 C CE1 . HIS A 1 280 ? 9.388  31.309 66.961 1.00 9.09  ? 280 HIS A CE1 1 
ATOM   2137 N NE2 . HIS A 1 280 ? 9.717  32.558 66.691 1.00 8.08  ? 280 HIS A NE2 1 
ATOM   2138 N N   . ASP A 1 281 ? 10.889 27.547 65.531 1.00 8.40  ? 281 ASP A N   1 
ATOM   2139 C CA  . ASP A 1 281 ? 9.806  26.571 65.496 1.00 8.82  ? 281 ASP A CA  1 
ATOM   2140 C C   . ASP A 1 281 ? 9.086  26.657 66.836 1.00 9.45  ? 281 ASP A C   1 
ATOM   2141 O O   . ASP A 1 281 ? 9.189  27.678 67.509 1.00 9.41  ? 281 ASP A O   1 
ATOM   2142 C CB  . ASP A 1 281 ? 10.309 25.147 65.208 1.00 11.12 ? 281 ASP A CB  1 
ATOM   2143 C CG  . ASP A 1 281 ? 11.263 24.609 66.263 1.00 15.23 ? 281 ASP A CG  1 
ATOM   2144 O OD1 . ASP A 1 281 ? 11.745 23.475 66.063 1.00 16.30 ? 281 ASP A OD1 1 
ATOM   2145 O OD2 . ASP A 1 281 ? 11.534 25.288 67.272 1.00 14.56 ? 281 ASP A OD2 1 
ATOM   2146 N N   . GLN A 1 282 ? 8.358  25.612 67.217 1.00 11.93 ? 282 GLN A N   1 
ATOM   2147 C CA  . GLN A 1 282 ? 7.629  25.598 68.489 1.00 13.62 ? 282 GLN A CA  1 
ATOM   2148 C C   . GLN A 1 282 ? 8.523  25.835 69.719 1.00 13.75 ? 282 GLN A C   1 
ATOM   2149 O O   . GLN A 1 282 ? 8.029  26.206 70.785 1.00 12.23 ? 282 GLN A O   1 
ATOM   2150 C CB  . GLN A 1 282 ? 6.895  24.264 68.646 1.00 18.09 ? 282 GLN A CB  1 
ATOM   2151 C CG  . GLN A 1 282 ? 7.814  23.053 68.618 0.00 19.28 ? 282 GLN A CG  1 
ATOM   2152 C CD  . GLN A 1 282 ? 7.065  21.744 68.769 0.00 20.52 ? 282 GLN A CD  1 
ATOM   2153 O OE1 . GLN A 1 282 ? 6.203  21.411 67.955 0.00 21.10 ? 282 GLN A OE1 1 
ATOM   2154 N NE2 . GLN A 1 282 ? 7.392  20.993 69.813 0.00 21.10 ? 282 GLN A NE2 1 
ATOM   2155 N N   . LYS A 1 283 ? 9.828  25.616 69.570 1.00 11.80 ? 283 LYS A N   1 
ATOM   2156 C CA  . LYS A 1 283 ? 10.778 25.818 70.668 1.00 13.55 ? 283 LYS A CA  1 
ATOM   2157 C C   . LYS A 1 283 ? 11.285 27.256 70.684 1.00 14.12 ? 283 LYS A C   1 
ATOM   2158 O O   . LYS A 1 283 ? 12.099 27.633 71.528 1.00 14.27 ? 283 LYS A O   1 
ATOM   2159 C CB  . LYS A 1 283 ? 11.982 24.889 70.519 1.00 15.78 ? 283 LYS A CB  1 
ATOM   2160 C CG  . LYS A 1 283 ? 11.763 23.447 70.962 1.00 21.89 ? 283 LYS A CG  1 
ATOM   2161 C CD  . LYS A 1 283 ? 12.949 22.584 70.519 1.00 25.88 ? 283 LYS A CD  1 
ATOM   2162 C CE  . LYS A 1 283 ? 13.024 21.264 71.270 1.00 27.95 ? 283 LYS A CE  1 
ATOM   2163 N NZ  . LYS A 1 283 ? 11.775 20.465 71.166 1.00 33.28 ? 283 LYS A NZ  1 
ATOM   2164 N N   . GLY A 1 284 ? 10.811 28.065 69.747 1.00 12.26 ? 284 GLY A N   1 
ATOM   2165 C CA  . GLY A 1 284 ? 11.272 29.435 69.714 1.00 9.73  ? 284 GLY A CA  1 
ATOM   2166 C C   . GLY A 1 284 ? 12.344 29.648 68.663 1.00 7.52  ? 284 GLY A C   1 
ATOM   2167 O O   . GLY A 1 284 ? 12.708 28.739 67.901 1.00 8.20  ? 284 GLY A O   1 
ATOM   2168 N N   . ASN A 1 285 ? 12.874 30.861 68.675 1.00 6.91  ? 285 ASN A N   1 
ATOM   2169 C CA  . ASN A 1 285 ? 13.875 31.341 67.722 1.00 8.63  ? 285 ASN A CA  1 
ATOM   2170 C C   . ASN A 1 285 ? 15.274 31.315 68.345 1.00 9.03  ? 285 ASN A C   1 
ATOM   2171 O O   . ASN A 1 285 ? 15.443 31.704 69.501 1.00 6.15  ? 285 ASN A O   1 
ATOM   2172 C CB  . ASN A 1 285 ? 13.464 32.772 67.370 1.00 7.17  ? 285 ASN A CB  1 
ATOM   2173 C CG  . ASN A 1 285 ? 14.079 33.294 66.088 1.00 10.26 ? 285 ASN A CG  1 
ATOM   2174 O OD1 . ASN A 1 285 ? 14.398 32.545 65.170 1.00 10.72 ? 285 ASN A OD1 1 
ATOM   2175 N ND2 . ASN A 1 285 ? 14.196 34.614 66.009 1.00 10.40 ? 285 ASN A ND2 1 
ATOM   2176 N N   . ARG A 1 286 ? 16.265 30.852 67.589 1.00 7.35  ? 286 ARG A N   1 
ATOM   2177 C CA  . ARG A 1 286 ? 17.640 30.825 68.088 1.00 11.88 ? 286 ARG A CA  1 
ATOM   2178 C C   . ARG A 1 286 ? 18.628 30.770 66.928 1.00 11.49 ? 286 ARG A C   1 
ATOM   2179 O O   . ARG A 1 286 ? 18.245 30.463 65.787 1.00 10.26 ? 286 ARG A O   1 
ATOM   2180 C CB  . ARG A 1 286 ? 17.870 29.621 69.016 1.00 7.66  ? 286 ARG A CB  1 
ATOM   2181 C CG  . ARG A 1 286 ? 17.825 28.246 68.336 1.00 10.47 ? 286 ARG A CG  1 
ATOM   2182 C CD  . ARG A 1 286 ? 16.390 27.764 68.114 1.00 9.25  ? 286 ARG A CD  1 
ATOM   2183 N NE  . ARG A 1 286 ? 16.344 26.352 67.726 1.00 7.00  ? 286 ARG A NE  1 
ATOM   2184 C CZ  . ARG A 1 286 ? 15.219 25.676 67.517 1.00 10.09 ? 286 ARG A CZ  1 
ATOM   2185 N NH1 . ARG A 1 286 ? 14.045 26.281 67.655 1.00 7.32  ? 286 ARG A NH1 1 
ATOM   2186 N NH2 . ARG A 1 286 ? 15.262 24.396 67.180 1.00 11.56 ? 286 ARG A NH2 1 
ATOM   2187 N N   . LEU A 1 287 ? 19.892 31.069 67.217 1.00 9.17  ? 287 LEU A N   1 
ATOM   2188 C CA  . LEU A 1 287 ? 20.942 31.029 66.197 1.00 7.17  ? 287 LEU A CA  1 
ATOM   2189 C C   . LEU A 1 287 ? 21.763 29.766 66.416 1.00 9.76  ? 287 LEU A C   1 
ATOM   2190 O O   . LEU A 1 287 ? 22.236 29.506 67.528 1.00 10.66 ? 287 LEU A O   1 
ATOM   2191 C CB  . LEU A 1 287 ? 21.840 32.263 66.298 1.00 9.58  ? 287 LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 287 ? 21.299 33.578 65.720 1.00 9.32  ? 287 LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 287 ? 22.141 34.754 66.202 1.00 10.70 ? 287 LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 287 ? 21.335 33.503 64.193 1.00 10.11 ? 287 LEU A CD2 1 
ATOM   2195 N N   . GLU A 1 288 ? 21.906 28.960 65.372 1.00 8.32  ? 288 GLU A N   1 
ATOM   2196 C CA  . GLU A 1 288 ? 22.661 27.720 65.494 1.00 8.96  ? 288 GLU A CA  1 
ATOM   2197 C C   . GLU A 1 288 ? 23.883 27.749 64.585 1.00 12.16 ? 288 GLU A C   1 
ATOM   2198 O O   . GLU A 1 288 ? 23.943 28.510 63.606 1.00 8.34  ? 288 GLU A O   1 
ATOM   2199 C CB  . GLU A 1 288 ? 21.744 26.517 65.204 1.00 8.41  ? 288 GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 288 ? 20.624 26.403 66.264 1.00 11.37 ? 288 GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 288 ? 19.725 25.170 66.141 1.00 14.26 ? 288 GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 288 ? 18.763 25.087 66.932 1.00 15.88 ? 288 GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 288 ? 19.968 24.291 65.280 1.00 12.06 ? 288 GLU A OE2 1 
ATOM   2204 N N   . THR A 1 289 ? 24.874 26.941 64.932 1.00 14.00 ? 289 THR A N   1 
ATOM   2205 C CA  . THR A 1 289 ? 26.111 26.904 64.173 1.00 16.68 ? 289 THR A CA  1 
ATOM   2206 C C   . THR A 1 289 ? 26.298 25.512 63.578 1.00 17.75 ? 289 THR A C   1 
ATOM   2207 O O   . THR A 1 289 ? 26.366 24.521 64.313 1.00 19.86 ? 289 THR A O   1 
ATOM   2208 C CB  . THR A 1 289 ? 27.292 27.251 65.094 1.00 19.27 ? 289 THR A CB  1 
ATOM   2209 O OG1 . THR A 1 289 ? 27.047 28.520 65.717 1.00 23.25 ? 289 THR A OG1 1 
ATOM   2210 C CG2 . THR A 1 289 ? 28.586 27.328 64.307 1.00 22.41 ? 289 THR A CG2 1 
ATOM   2211 N N   . PRO A 1 290 ? 26.397 25.420 62.240 1.00 13.54 ? 290 PRO A N   1 
ATOM   2212 C CA  . PRO A 1 290 ? 26.573 24.127 61.566 1.00 14.44 ? 290 PRO A CA  1 
ATOM   2213 C C   . PRO A 1 290 ? 28.000 23.596 61.485 1.00 12.42 ? 290 PRO A C   1 
ATOM   2214 O O   . PRO A 1 290 ? 28.956 24.273 61.846 1.00 11.05 ? 290 PRO A O   1 
ATOM   2215 C CB  . PRO A 1 290 ? 26.001 24.391 60.183 1.00 13.27 ? 290 PRO A CB  1 
ATOM   2216 C CG  . PRO A 1 290 ? 26.480 25.788 59.914 1.00 13.82 ? 290 PRO A CG  1 
ATOM   2217 C CD  . PRO A 1 290 ? 26.208 26.499 61.251 1.00 12.59 ? 290 PRO A CD  1 
ATOM   2218 N N   . GLY A 1 291 ? 28.125 22.369 60.988 1.00 13.33 ? 291 GLY A N   1 
ATOM   2219 C CA  . GLY A 1 291 ? 29.436 21.769 60.832 1.00 11.93 ? 291 GLY A CA  1 
ATOM   2220 C C   . GLY A 1 291 ? 30.136 22.447 59.670 1.00 12.89 ? 291 GLY A C   1 
ATOM   2221 O O   . GLY A 1 291 ? 29.488 23.115 58.858 1.00 8.64  ? 291 GLY A O   1 
ATOM   2222 N N   . PHE A 1 292 ? 31.451 22.302 59.589 1.00 9.65  ? 292 PHE A N   1 
ATOM   2223 C CA  . PHE A 1 292 ? 32.190 22.915 58.486 1.00 12.87 ? 292 PHE A CA  1 
ATOM   2224 C C   . PHE A 1 292 ? 33.271 21.966 57.987 1.00 12.36 ? 292 PHE A C   1 
ATOM   2225 O O   . PHE A 1 292 ? 33.818 21.175 58.762 1.00 12.78 ? 292 PHE A O   1 
ATOM   2226 C CB  . PHE A 1 292 ? 32.769 24.274 58.911 1.00 11.38 ? 292 PHE A CB  1 
ATOM   2227 C CG  . PHE A 1 292 ? 33.595 24.227 60.171 1.00 15.33 ? 292 PHE A CG  1 
ATOM   2228 C CD1 . PHE A 1 292 ? 34.980 24.085 60.105 1.00 15.41 ? 292 PHE A CD1 1 
ATOM   2229 C CD2 . PHE A 1 292 ? 32.985 24.321 61.423 1.00 17.08 ? 292 PHE A CD2 1 
ATOM   2230 C CE1 . PHE A 1 292 ? 35.754 24.037 61.270 1.00 21.79 ? 292 PHE A CE1 1 
ATOM   2231 C CE2 . PHE A 1 292 ? 33.750 24.274 62.598 1.00 21.92 ? 292 PHE A CE2 1 
ATOM   2232 C CZ  . PHE A 1 292 ? 35.139 24.132 62.518 1.00 19.65 ? 292 PHE A CZ  1 
ATOM   2233 N N   . ALA A 1 293 ? 33.554 22.032 56.687 1.00 10.84 ? 293 ALA A N   1 
ATOM   2234 C CA  . ALA A 1 293 ? 34.535 21.152 56.057 1.00 12.95 ? 293 ALA A CA  1 
ATOM   2235 C C   . ALA A 1 293 ? 35.997 21.511 56.307 1.00 13.51 ? 293 ALA A C   1 
ATOM   2236 O O   . ALA A 1 293 ? 36.819 20.639 56.581 1.00 15.85 ? 293 ALA A O   1 
ATOM   2237 C CB  . ALA A 1 293 ? 34.276 21.101 54.547 1.00 12.65 ? 293 ALA A CB  1 
ATOM   2238 N N   . LEU A 1 294 ? 36.318 22.794 56.222 1.00 13.28 ? 294 LEU A N   1 
ATOM   2239 C CA  . LEU A 1 294 ? 37.697 23.230 56.388 1.00 14.96 ? 294 LEU A CA  1 
ATOM   2240 C C   . LEU A 1 294 ? 38.154 23.205 57.845 1.00 17.79 ? 294 LEU A C   1 
ATOM   2241 O O   . LEU A 1 294 ? 37.931 24.147 58.602 1.00 16.45 ? 294 LEU A O   1 
ATOM   2242 C CB  . LEU A 1 294 ? 37.868 24.626 55.782 1.00 15.24 ? 294 LEU A CB  1 
ATOM   2243 C CG  . LEU A 1 294 ? 39.286 24.924 55.276 1.00 18.86 ? 294 LEU A CG  1 
ATOM   2244 C CD1 . LEU A 1 294 ? 39.291 26.195 54.419 1.00 14.21 ? 294 LEU A CD1 1 
ATOM   2245 C CD2 . LEU A 1 294 ? 40.231 25.045 56.465 1.00 17.49 ? 294 LEU A CD2 1 
ATOM   2246 N N   . LYS A 1 295 ? 38.812 22.115 58.218 1.00 21.34 ? 295 LYS A N   1 
ATOM   2247 C CA  . LYS A 1 295 ? 39.304 21.932 59.578 1.00 27.76 ? 295 LYS A CA  1 
ATOM   2248 C C   . LYS A 1 295 ? 40.676 22.560 59.769 1.00 30.60 ? 295 LYS A C   1 
ATOM   2249 O O   . LYS A 1 295 ? 40.852 23.282 60.771 1.00 32.20 ? 295 LYS A O   1 
ATOM   2250 C CB  . LYS A 1 295 ? 39.368 20.442 59.909 1.00 28.86 ? 295 LYS A CB  1 
ATOM   2251 C CG  . LYS A 1 295 ? 38.048 19.722 59.722 1.00 32.98 ? 295 LYS A CG  1 
ATOM   2252 C CD  . LYS A 1 295 ? 36.954 20.374 60.545 1.00 32.74 ? 295 LYS A CD  1 
ATOM   2253 C CE  . LYS A 1 295 ? 35.683 19.540 60.534 1.00 34.69 ? 295 LYS A CE  1 
ATOM   2254 N NZ  . LYS A 1 295 ? 34.623 20.185 61.350 1.00 36.77 ? 295 LYS A NZ  1 
ATOM   2255 O OXT . LYS A 1 295 ? 41.557 22.311 58.920 1.00 36.45 ? 295 LYS A OXT 1 
ATOM   2256 N N   . THR B 1 1   ? 35.175 0.700  25.124 1.00 25.03 ? 301 THR C N   1 
ATOM   2257 C CA  . THR B 1 1   ? 34.620 1.396  23.929 1.00 25.83 ? 301 THR C CA  1 
ATOM   2258 C C   . THR B 1 1   ? 34.135 2.792  24.291 1.00 25.90 ? 301 THR C C   1 
ATOM   2259 O O   . THR B 1 1   ? 33.289 2.964  25.173 1.00 25.77 ? 301 THR C O   1 
ATOM   2260 C CB  . THR B 1 1   ? 33.425 0.622  23.321 1.00 27.52 ? 301 THR C CB  1 
ATOM   2261 O OG1 . THR B 1 1   ? 33.854 -0.680 22.900 1.00 29.05 ? 301 THR C OG1 1 
ATOM   2262 C CG2 . THR B 1 1   ? 32.855 1.374  22.118 1.00 26.81 ? 301 THR C CG2 1 
ATOM   2263 N N   . THR B 1 2   ? 34.689 3.791  23.620 1.00 24.77 ? 302 THR C N   1 
ATOM   2264 C CA  . THR B 1 2   ? 34.281 5.167  23.852 1.00 24.11 ? 302 THR C CA  1 
ATOM   2265 C C   . THR B 1 2   ? 34.089 5.783  22.476 1.00 23.66 ? 302 THR C C   1 
ATOM   2266 O O   . THR B 1 2   ? 34.950 5.649  21.607 1.00 24.78 ? 302 THR C O   1 
ATOM   2267 C CB  . THR B 1 2   ? 35.353 5.965  24.643 1.00 26.26 ? 302 THR C CB  1 
ATOM   2268 O OG1 . THR B 1 2   ? 35.412 5.485  25.994 1.00 26.76 ? 302 THR C OG1 1 
ATOM   2269 C CG2 . THR B 1 2   ? 35.006 7.454  24.670 1.00 25.86 ? 302 THR C CG2 1 
ATOM   2270 N N   . ASN B 1 3   ? 32.950 6.432  22.269 1.00 19.26 ? 303 ASN C N   1 
ATOM   2271 C CA  . ASN B 1 3   ? 32.676 7.066  20.985 1.00 15.80 ? 303 ASN C CA  1 
ATOM   2272 C C   . ASN B 1 3   ? 33.079 8.529  21.118 1.00 13.88 ? 303 ASN C C   1 
ATOM   2273 O O   . ASN B 1 3   ? 32.371 9.316  21.744 1.00 15.05 ? 303 ASN C O   1 
ATOM   2274 C CB  . ASN B 1 3   ? 31.183 6.941  20.654 1.00 12.70 ? 303 ASN C CB  1 
ATOM   2275 C CG  . ASN B 1 3   ? 30.846 7.422  19.246 1.00 15.65 ? 303 ASN C CG  1 
ATOM   2276 O OD1 . ASN B 1 3   ? 31.739 7.698  18.438 1.00 13.40 ? 303 ASN C OD1 1 
ATOM   2277 N ND2 . ASN B 1 3   ? 29.547 7.510  18.941 1.00 13.86 ? 303 ASN C ND2 1 
ATOM   2278 N N   . LYS B 1 4   ? 34.244 8.880  20.581 1.00 11.92 ? 304 LYS C N   1 
ATOM   2279 C CA  . LYS B 1 4   ? 34.714 10.265 20.642 1.00 10.41 ? 304 LYS C CA  1 
ATOM   2280 C C   . LYS B 1 4   ? 35.706 10.474 19.513 1.00 11.68 ? 304 LYS C C   1 
ATOM   2281 O O   . LYS B 1 4   ? 36.401 9.533  19.121 1.00 10.95 ? 304 LYS C O   1 
ATOM   2282 C CB  . LYS B 1 4   ? 35.386 10.576 21.995 1.00 12.33 ? 304 LYS C CB  1 
ATOM   2283 C CG  . LYS B 1 4   ? 36.778 9.964  22.203 1.00 16.06 ? 304 LYS C CG  1 
ATOM   2284 C CD  . LYS B 1 4   ? 37.322 10.286 23.603 1.00 18.79 ? 304 LYS C CD  1 
ATOM   2285 C CE  . LYS B 1 4   ? 38.465 9.364  24.016 1.00 21.74 ? 304 LYS C CE  1 
ATOM   2286 N NZ  . LYS B 1 4   ? 39.739 9.623  23.302 1.00 25.49 ? 304 LYS C NZ  1 
ATOM   2287 N N   . PRO B 1 5   ? 35.777 11.702 18.964 1.00 7.61  ? 305 PRO C N   1 
ATOM   2288 C CA  . PRO B 1 5   ? 34.969 12.861 19.372 1.00 8.45  ? 305 PRO C CA  1 
ATOM   2289 C C   . PRO B 1 5   ? 33.521 12.692 18.927 1.00 8.61  ? 305 PRO C C   1 
ATOM   2290 O O   . PRO B 1 5   ? 33.234 11.905 18.033 1.00 8.20  ? 305 PRO C O   1 
ATOM   2291 C CB  . PRO B 1 5   ? 35.615 14.039 18.630 1.00 8.95  ? 305 PRO C CB  1 
ATOM   2292 C CG  . PRO B 1 5   ? 36.943 13.520 18.157 1.00 10.66 ? 305 PRO C CG  1 
ATOM   2293 C CD  . PRO B 1 5   ? 36.717 12.067 17.891 1.00 11.08 ? 305 PRO C CD  1 
ATOM   2294 N N   . ILE B 1 6   ? 32.618 13.436 19.555 1.00 8.93  ? 306 ILE C N   1 
ATOM   2295 C CA  . ILE B 1 6   ? 31.205 13.408 19.193 1.00 5.99  ? 306 ILE C CA  1 
ATOM   2296 C C   . ILE B 1 6   ? 30.586 14.726 19.634 1.00 7.16  ? 306 ILE C C   1 
ATOM   2297 O O   . ILE B 1 6   ? 30.975 15.286 20.660 1.00 7.48  ? 306 ILE C O   1 
ATOM   2298 C CB  . ILE B 1 6   ? 30.445 12.216 19.871 1.00 5.99  ? 306 ILE C CB  1 
ATOM   2299 C CG1 . ILE B 1 6   ? 28.947 12.311 19.566 1.00 8.22  ? 306 ILE C CG1 1 
ATOM   2300 C CG2 . ILE B 1 6   ? 30.698 12.209 21.382 1.00 6.48  ? 306 ILE C CG2 1 
ATOM   2301 C CD1 . ILE B 1 6   ? 28.149 11.094 19.985 1.00 7.05  ? 306 ILE C CD1 1 
ATOM   2302 N N   . VAL B 1 7   ? 29.649 15.237 18.838 1.00 5.76  ? 307 VAL C N   1 
ATOM   2303 C CA  . VAL B 1 7   ? 28.961 16.465 19.171 1.00 4.13  ? 307 VAL C CA  1 
ATOM   2304 C C   . VAL B 1 7   ? 27.470 16.337 18.849 1.00 7.45  ? 307 VAL C C   1 
ATOM   2305 O O   . VAL B 1 7   ? 27.092 15.715 17.853 1.00 5.62  ? 307 VAL C O   1 
ATOM   2306 C CB  . VAL B 1 7   ? 29.560 17.671 18.404 1.00 5.47  ? 307 VAL C CB  1 
ATOM   2307 C CG1 . VAL B 1 7   ? 29.527 17.414 16.885 1.00 6.76  ? 307 VAL C CG1 1 
ATOM   2308 C CG2 . VAL B 1 7   ? 28.769 18.939 18.735 1.00 7.72  ? 307 VAL C CG2 1 
ATOM   2309 N N   . LEU B 1 8   ? 26.634 16.893 19.726 1.00 7.18  ? 308 LEU C N   1 
ATOM   2310 C CA  . LEU B 1 8   ? 25.188 16.893 19.545 1.00 8.15  ? 308 LEU C CA  1 
ATOM   2311 C C   . LEU B 1 8   ? 24.681 18.322 19.659 1.00 7.31  ? 308 LEU C C   1 
ATOM   2312 O O   . LEU B 1 8   ? 25.223 19.120 20.423 1.00 4.38  ? 308 LEU C O   1 
ATOM   2313 C CB  . LEU B 1 8   ? 24.475 16.074 20.629 1.00 9.26  ? 308 LEU C CB  1 
ATOM   2314 C CG  . LEU B 1 8   ? 24.266 14.561 20.531 1.00 10.87 ? 308 LEU C CG  1 
ATOM   2315 C CD1 . LEU B 1 8   ? 25.557 13.838 20.831 1.00 13.72 ? 308 LEU C CD1 1 
ATOM   2316 C CD2 . LEU B 1 8   ? 23.187 14.150 21.555 1.00 14.66 ? 308 LEU C CD2 1 
ATOM   2317 N N   . SER B 1 9   ? 23.648 18.652 18.893 1.00 5.82  ? 309 SER C N   1 
ATOM   2318 C CA  . SER B 1 9   ? 23.067 19.974 18.996 1.00 5.91  ? 309 SER C CA  1 
ATOM   2319 C C   . SER B 1 9   ? 21.568 19.877 18.721 1.00 7.30  ? 309 SER C C   1 
ATOM   2320 O O   . SER B 1 9   ? 21.085 18.940 18.077 1.00 6.54  ? 309 SER C O   1 
ATOM   2321 C CB  . SER B 1 9   ? 23.764 20.973 18.051 1.00 6.17  ? 309 SER C CB  1 
ATOM   2322 O OG  . SER B 1 9   ? 23.757 20.536 16.708 1.00 7.51  ? 309 SER C OG  1 
ATOM   2323 N N   . THR B 1 10  ? 20.838 20.861 19.213 1.00 5.79  ? 310 THR C N   1 
ATOM   2324 C CA  . THR B 1 10  ? 19.391 20.879 19.110 1.00 5.34  ? 310 THR C CA  1 
ATOM   2325 C C   . THR B 1 10  ? 18.796 21.353 17.786 1.00 6.47  ? 310 THR C C   1 
ATOM   2326 O O   . THR B 1 10  ? 19.337 22.241 17.151 1.00 5.58  ? 310 THR C O   1 
ATOM   2327 C CB  . THR B 1 10  ? 18.817 21.769 20.216 1.00 6.23  ? 310 THR C CB  1 
ATOM   2328 O OG1 . THR B 1 10  ? 19.343 23.091 20.078 1.00 6.23  ? 310 THR C OG1 1 
ATOM   2329 C CG2 . THR B 1 10  ? 19.209 21.232 21.605 1.00 7.07  ? 310 THR C CG2 1 
ATOM   2330 N N   . TRP B 1 11  ? 17.683 20.733 17.392 1.00 11.12 ? 311 TRP C N   1 
ATOM   2331 C CA  . TRP B 1 11  ? 16.942 21.120 16.186 1.00 11.12 ? 311 TRP C CA  1 
ATOM   2332 C C   . TRP B 1 11  ? 17.631 20.824 14.869 1.00 11.12 ? 311 TRP C C   1 
ATOM   2333 O O   . TRP B 1 11  ? 18.792 20.454 14.834 1.00 11.12 ? 311 TRP C O   1 
ATOM   2334 C CB  . TRP B 1 11  ? 16.545 22.608 16.240 1.00 11.12 ? 311 TRP C CB  1 
ATOM   2335 C CG  . TRP B 1 11  ? 15.738 22.978 17.461 1.00 11.12 ? 311 TRP C CG  1 
ATOM   2336 C CD1 . TRP B 1 11  ? 16.178 23.682 18.544 1.00 11.12 ? 311 TRP C CD1 1 
ATOM   2337 C CD2 . TRP B 1 11  ? 14.361 22.675 17.715 1.00 11.12 ? 311 TRP C CD2 1 
ATOM   2338 N NE1 . TRP B 1 11  ? 15.160 23.845 19.457 1.00 11.12 ? 311 TRP C NE1 1 
ATOM   2339 C CE2 . TRP B 1 11  ? 14.035 23.235 18.976 1.00 11.12 ? 311 TRP C CE2 1 
ATOM   2340 C CE3 . TRP B 1 11  ? 13.371 21.987 17.006 1.00 11.12 ? 311 TRP C CE3 1 
ATOM   2341 C CZ2 . TRP B 1 11  ? 12.763 23.128 19.539 1.00 11.12 ? 311 TRP C CZ2 1 
ATOM   2342 C CZ3 . TRP B 1 11  ? 12.098 21.879 17.572 1.00 11.12 ? 311 TRP C CZ3 1 
ATOM   2343 C CH2 . TRP B 1 11  ? 11.810 22.448 18.825 1.00 11.12 ? 311 TRP C CH2 1 
ATOM   2344 N N   . ASN B 1 12  ? 16.892 20.988 13.780 1.00 11.12 ? 312 ASN C N   1 
ATOM   2345 C CA  . ASN B 1 12  ? 17.437 20.673 12.467 1.00 11.12 ? 312 ASN C CA  1 
ATOM   2346 C C   . ASN B 1 12  ? 18.687 21.465 12.088 1.00 11.12 ? 312 ASN C C   1 
ATOM   2347 O O   . ASN B 1 12  ? 19.602 20.910 11.471 1.00 11.12 ? 312 ASN C O   1 
ATOM   2348 C CB  . ASN B 1 12  ? 16.366 20.864 11.385 1.00 11.12 ? 312 ASN C CB  1 
ATOM   2349 C CG  . ASN B 1 12  ? 15.315 19.754 11.380 1.00 11.12 ? 312 ASN C CG  1 
ATOM   2350 O OD1 . ASN B 1 12  ? 14.576 19.600 10.390 1.00 11.12 ? 312 ASN C OD1 1 
ATOM   2351 N ND2 . ASN B 1 12  ? 15.226 18.983 12.473 1.00 11.12 ? 312 ASN C ND2 1 
ATOM   2352 N N   . PHE B 1 13  ? 18.729 22.753 12.431 1.00 7.62  ? 313 PHE C N   1 
ATOM   2353 C CA  . PHE B 1 13  ? 19.893 23.567 12.077 1.00 10.19 ? 313 PHE C CA  1 
ATOM   2354 C C   . PHE B 1 13  ? 21.143 23.107 12.811 1.00 10.15 ? 313 PHE C C   1 
ATOM   2355 O O   . PHE B 1 13  ? 22.248 23.554 12.505 1.00 8.93  ? 313 PHE C O   1 
ATOM   2356 C CB  . PHE B 1 13  ? 19.629 25.069 12.313 1.00 12.21 ? 313 PHE C CB  1 
ATOM   2357 C CG  . PHE B 1 13  ? 19.153 25.421 13.706 1.00 18.14 ? 313 PHE C CG  1 
ATOM   2358 C CD1 . PHE B 1 13  ? 18.088 26.301 13.870 1.00 20.74 ? 313 PHE C CD1 1 
ATOM   2359 C CD2 . PHE B 1 13  ? 19.781 24.921 14.840 1.00 18.32 ? 313 PHE C CD2 1 
ATOM   2360 C CE1 . PHE B 1 13  ? 17.659 26.678 15.142 1.00 23.89 ? 313 PHE C CE1 1 
ATOM   2361 C CE2 . PHE B 1 13  ? 19.356 25.295 16.117 1.00 18.77 ? 313 PHE C CE2 1 
ATOM   2362 C CZ  . PHE B 1 13  ? 18.298 26.173 16.265 1.00 19.85 ? 313 PHE C CZ  1 
ATOM   2363 N N   . GLY B 1 14  ? 20.952 22.195 13.766 1.00 10.13 ? 314 GLY C N   1 
ATOM   2364 C CA  . GLY B 1 14  ? 22.073 21.650 14.511 1.00 11.39 ? 314 GLY C CA  1 
ATOM   2365 C C   . GLY B 1 14  ? 22.923 20.799 13.588 1.00 10.43 ? 314 GLY C C   1 
ATOM   2366 O O   . GLY B 1 14  ? 24.100 20.561 13.832 1.00 11.26 ? 314 GLY C O   1 
ATOM   2367 N N   . LEU B 1 15  ? 22.335 20.341 12.491 1.00 10.87 ? 315 LEU C N   1 
ATOM   2368 C CA  . LEU B 1 15  ? 23.104 19.532 11.556 1.00 10.71 ? 315 LEU C CA  1 
ATOM   2369 C C   . LEU B 1 15  ? 24.232 20.355 10.917 1.00 11.98 ? 315 LEU C C   1 
ATOM   2370 O O   . LEU B 1 15  ? 25.371 19.892 10.859 1.00 11.07 ? 315 LEU C O   1 
ATOM   2371 C CB  . LEU B 1 15  ? 22.190 18.960 10.473 1.00 11.27 ? 315 LEU C CB  1 
ATOM   2372 C CG  . LEU B 1 15  ? 22.706 17.730 9.724  1.00 13.34 ? 315 LEU C CG  1 
ATOM   2373 C CD1 . LEU B 1 15  ? 22.858 16.532 10.686 1.00 9.98  ? 315 LEU C CD1 1 
ATOM   2374 C CD2 . LEU B 1 15  ? 21.711 17.368 8.630  1.00 10.44 ? 315 LEU C CD2 1 
ATOM   2375 N N   . HIS B 1 16  ? 23.922 21.568 10.449 1.00 10.93 ? 316 HIS C N   1 
ATOM   2376 C CA  . HIS B 1 16  ? 24.936 22.429 9.823  1.00 11.93 ? 316 HIS C CA  1 
ATOM   2377 C C   . HIS B 1 16  ? 25.920 22.923 10.867 1.00 9.18  ? 316 HIS C C   1 
ATOM   2378 O O   . HIS B 1 16  ? 27.110 23.038 10.582 1.00 8.37  ? 316 HIS C O   1 
ATOM   2379 C CB  . HIS B 1 16  ? 24.330 23.673 9.146  1.00 16.94 ? 316 HIS C CB  1 
ATOM   2380 C CG  . HIS B 1 16  ? 22.859 23.595 8.919  1.00 24.18 ? 316 HIS C CG  1 
ATOM   2381 N ND1 . HIS B 1 16  ? 22.265 22.537 8.266  1.00 30.79 ? 316 HIS C ND1 1 
ATOM   2382 C CD2 . HIS B 1 16  ? 21.861 24.460 9.224  1.00 26.76 ? 316 HIS C CD2 1 
ATOM   2383 C CE1 . HIS B 1 16  ? 20.963 22.753 8.179  1.00 31.44 ? 316 HIS C CE1 1 
ATOM   2384 N NE2 . HIS B 1 16  ? 20.692 23.914 8.750  1.00 29.04 ? 316 HIS C NE2 1 
ATOM   2385 N N   . ALA B 1 17  ? 25.417 23.240 12.064 1.00 7.54  ? 317 ALA C N   1 
ATOM   2386 C CA  . ALA B 1 17  ? 26.270 23.703 13.156 1.00 7.79  ? 317 ALA C CA  1 
ATOM   2387 C C   . ALA B 1 17  ? 27.288 22.615 13.535 1.00 5.91  ? 317 ALA C C   1 
ATOM   2388 O O   . ALA B 1 17  ? 28.429 22.916 13.852 1.00 7.46  ? 317 ALA C O   1 
ATOM   2389 C CB  . ALA B 1 17  ? 25.414 24.077 14.374 1.00 7.27  ? 317 ALA C CB  1 
ATOM   2390 N N   . ASN B 1 18  ? 26.864 21.351 13.516 1.00 6.96  ? 318 ASN C N   1 
ATOM   2391 C CA  . ASN B 1 18  ? 27.757 20.241 13.847 1.00 7.77  ? 318 ASN C CA  1 
ATOM   2392 C C   . ASN B 1 18  ? 28.931 20.161 12.873 1.00 9.34  ? 318 ASN C C   1 
ATOM   2393 O O   . ASN B 1 18  ? 30.036 19.765 13.249 1.00 8.76  ? 318 ASN C O   1 
ATOM   2394 C CB  . ASN B 1 18  ? 27.021 18.907 13.792 1.00 6.20  ? 318 ASN C CB  1 
ATOM   2395 C CG  . ASN B 1 18  ? 26.213 18.625 15.036 1.00 6.80  ? 318 ASN C CG  1 
ATOM   2396 O OD1 . ASN B 1 18  ? 26.177 19.423 15.978 1.00 4.31  ? 318 ASN C OD1 1 
ATOM   2397 N ND2 . ASN B 1 18  ? 25.559 17.473 15.048 1.00 9.49  ? 318 ASN C ND2 1 
ATOM   2398 N N   . VAL B 1 19  ? 28.682 20.496 11.613 1.00 8.70  ? 319 VAL C N   1 
ATOM   2399 C CA  . VAL B 1 19  ? 29.757 20.458 10.621 1.00 9.86  ? 319 VAL C CA  1 
ATOM   2400 C C   . VAL B 1 19  ? 30.873 21.415 11.037 1.00 8.54  ? 319 VAL C C   1 
ATOM   2401 O O   . VAL B 1 19  ? 32.054 21.072 10.931 1.00 7.02  ? 319 VAL C O   1 
ATOM   2402 C CB  . VAL B 1 19  ? 29.234 20.836 9.217  1.00 8.03  ? 319 VAL C CB  1 
ATOM   2403 C CG1 . VAL B 1 19  ? 30.388 20.978 8.249  1.00 11.98 ? 319 VAL C CG1 1 
ATOM   2404 C CG2 . VAL B 1 19  ? 28.271 19.777 8.731  1.00 8.96  ? 319 VAL C CG2 1 
ATOM   2405 N N   . GLU B 1 20  ? 30.506 22.604 11.517 1.00 9.18  ? 320 GLU C N   1 
ATOM   2406 C CA  . GLU B 1 20  ? 31.506 23.586 11.966 1.00 10.00 ? 320 GLU C CA  1 
ATOM   2407 C C   . GLU B 1 20  ? 32.259 23.102 13.203 1.00 9.33  ? 320 GLU C C   1 
ATOM   2408 O O   . GLU B 1 20  ? 33.487 23.248 13.296 1.00 8.94  ? 320 GLU C O   1 
ATOM   2409 C CB  . GLU B 1 20  ? 30.845 24.930 12.273 1.00 12.94 ? 320 GLU C CB  1 
ATOM   2410 C CG  . GLU B 1 20  ? 30.272 25.614 11.055 1.00 18.96 ? 320 GLU C CG  1 
ATOM   2411 C CD  . GLU B 1 20  ? 31.271 25.659 9.908  1.00 20.84 ? 320 GLU C CD  1 
ATOM   2412 O OE1 . GLU B 1 20  ? 32.375 26.209 10.109 1.00 17.08 ? 320 GLU C OE1 1 
ATOM   2413 O OE2 . GLU B 1 20  ? 30.948 25.135 8.813  1.00 22.95 ? 320 GLU C OE2 1 
ATOM   2414 N N   . ALA B 1 21  ? 31.521 22.527 14.155 1.00 8.11  ? 321 ALA C N   1 
ATOM   2415 C CA  . ALA B 1 21  ? 32.121 22.000 15.375 1.00 8.95  ? 321 ALA C CA  1 
ATOM   2416 C C   . ALA B 1 21  ? 33.065 20.842 15.030 1.00 6.60  ? 321 ALA C C   1 
ATOM   2417 O O   . ALA B 1 21  ? 34.110 20.677 15.645 1.00 6.53  ? 321 ALA C O   1 
ATOM   2418 C CB  . ALA B 1 21  ? 31.011 21.514 16.340 1.00 8.13  ? 321 ALA C CB  1 
ATOM   2419 N N   . TRP B 1 22  ? 32.689 20.046 14.035 1.00 7.40  ? 322 TRP C N   1 
ATOM   2420 C CA  . TRP B 1 22  ? 33.495 18.892 13.644 1.00 8.10  ? 322 TRP C CA  1 
ATOM   2421 C C   . TRP B 1 22  ? 34.839 19.319 13.058 1.00 8.93  ? 322 TRP C C   1 
ATOM   2422 O O   . TRP B 1 22  ? 35.812 18.567 13.137 1.00 8.93  ? 322 TRP C O   1 
ATOM   2423 C CB  . TRP B 1 22  ? 32.726 18.007 12.645 1.00 9.17  ? 322 TRP C CB  1 
ATOM   2424 C CG  . TRP B 1 22  ? 33.309 16.622 12.497 1.00 7.24  ? 322 TRP C CG  1 
ATOM   2425 C CD1 . TRP B 1 22  ? 33.973 16.119 11.412 1.00 8.37  ? 322 TRP C CD1 1 
ATOM   2426 C CD2 . TRP B 1 22  ? 33.346 15.594 13.500 1.00 8.09  ? 322 TRP C CD2 1 
ATOM   2427 N NE1 . TRP B 1 22  ? 34.427 14.846 11.677 1.00 6.06  ? 322 TRP C NE1 1 
ATOM   2428 C CE2 . TRP B 1 22  ? 34.057 14.498 12.951 1.00 8.29  ? 322 TRP C CE2 1 
ATOM   2429 C CE3 . TRP B 1 22  ? 32.851 15.494 14.809 1.00 6.46  ? 322 TRP C CE3 1 
ATOM   2430 C CZ2 . TRP B 1 22  ? 34.289 13.315 13.670 1.00 8.23  ? 322 TRP C CZ2 1 
ATOM   2431 C CZ3 . TRP B 1 22  ? 33.084 14.316 15.530 1.00 7.39  ? 322 TRP C CZ3 1 
ATOM   2432 C CH2 . TRP B 1 22  ? 33.798 13.243 14.956 1.00 8.09  ? 322 TRP C CH2 1 
ATOM   2433 N N   . LYS B 1 23  ? 34.892 20.516 12.469 1.00 7.83  ? 323 LYS C N   1 
ATOM   2434 C CA  . LYS B 1 23  ? 36.146 21.029 11.913 1.00 8.80  ? 323 LYS C CA  1 
ATOM   2435 C C   . LYS B 1 23  ? 37.193 21.111 13.025 1.00 9.84  ? 323 LYS C C   1 
ATOM   2436 O O   . LYS B 1 23  ? 38.381 20.900 12.805 1.00 10.02 ? 323 LYS C O   1 
ATOM   2437 C CB  . LYS B 1 23  ? 35.924 22.416 11.300 1.00 11.66 ? 323 LYS C CB  1 
ATOM   2438 C CG  . LYS B 1 23  ? 35.142 22.396 9.986  1.00 13.70 ? 323 LYS C CG  1 
ATOM   2439 C CD  . LYS B 1 23  ? 34.931 23.811 9.453  1.00 17.01 ? 323 LYS C CD  1 
ATOM   2440 C CE  . LYS B 1 23  ? 34.219 23.805 8.105  1.00 22.41 ? 323 LYS C CE  1 
ATOM   2441 N NZ  . LYS B 1 23  ? 33.826 25.186 7.685  1.00 24.56 ? 323 LYS C NZ  1 
ATOM   2442 N N   . VAL B 1 24  ? 36.743 21.445 14.225 1.00 8.28  ? 324 VAL C N   1 
ATOM   2443 C CA  . VAL B 1 24  ? 37.633 21.518 15.375 1.00 8.27  ? 324 VAL C CA  1 
ATOM   2444 C C   . VAL B 1 24  ? 37.844 20.118 15.968 1.00 8.13  ? 324 VAL C C   1 
ATOM   2445 O O   . VAL B 1 24  ? 38.970 19.656 16.135 1.00 7.60  ? 324 VAL C O   1 
ATOM   2446 C CB  . VAL B 1 24  ? 37.033 22.435 16.469 1.00 7.21  ? 324 VAL C CB  1 
ATOM   2447 C CG1 . VAL B 1 24  ? 37.908 22.427 17.714 1.00 8.14  ? 324 VAL C CG1 1 
ATOM   2448 C CG2 . VAL B 1 24  ? 36.893 23.835 15.941 1.00 7.93  ? 324 VAL C CG2 1 
ATOM   2449 N N   . LEU B 1 25  ? 36.750 19.432 16.276 1.00 9.30  ? 325 LEU C N   1 
ATOM   2450 C CA  . LEU B 1 25  ? 36.848 18.108 16.886 1.00 7.12  ? 325 LEU C CA  1 
ATOM   2451 C C   . LEU B 1 25  ? 37.640 17.082 16.085 1.00 9.14  ? 325 LEU C C   1 
ATOM   2452 O O   . LEU B 1 25  ? 38.412 16.308 16.663 1.00 7.01  ? 325 LEU C O   1 
ATOM   2453 C CB  . LEU B 1 25  ? 35.454 17.545 17.147 1.00 5.78  ? 325 LEU C CB  1 
ATOM   2454 C CG  . LEU B 1 25  ? 34.609 18.352 18.121 1.00 5.55  ? 325 LEU C CG  1 
ATOM   2455 C CD1 . LEU B 1 25  ? 33.198 17.780 18.151 1.00 4.80  ? 325 LEU C CD1 1 
ATOM   2456 C CD2 . LEU B 1 25  ? 35.256 18.321 19.506 1.00 8.45  ? 325 LEU C CD2 1 
ATOM   2457 N N   . SER B 1 26  ? 37.449 17.069 14.770 1.00 7.70  ? 326 SER C N   1 
ATOM   2458 C CA  . SER B 1 26  ? 38.133 16.081 13.929 1.00 10.70 ? 326 SER C CA  1 
ATOM   2459 C C   . SER B 1 26  ? 39.634 16.310 13.845 1.00 11.08 ? 326 SER C C   1 
ATOM   2460 O O   . SER B 1 26  ? 40.377 15.407 13.446 1.00 13.66 ? 326 SER C O   1 
ATOM   2461 C CB  . SER B 1 26  ? 37.546 16.076 12.512 1.00 11.69 ? 326 SER C CB  1 
ATOM   2462 O OG  . SER B 1 26  ? 37.869 17.273 11.828 1.00 11.21 ? 326 SER C OG  1 
ATOM   2463 N N   . LYS B 1 27  ? 40.080 17.508 14.207 1.00 11.36 ? 327 LYS C N   1 
ATOM   2464 C CA  . LYS B 1 27  ? 41.508 17.831 14.178 1.00 14.00 ? 327 LYS C CA  1 
ATOM   2465 C C   . LYS B 1 27  ? 42.101 17.651 15.577 1.00 15.29 ? 327 LYS C C   1 
ATOM   2466 O O   . LYS B 1 27  ? 43.257 17.984 15.821 1.00 12.75 ? 327 LYS C O   1 
ATOM   2467 C CB  . LYS B 1 27  ? 41.723 19.279 13.720 1.00 15.19 ? 327 LYS C CB  1 
ATOM   2468 C CG  . LYS B 1 27  ? 41.183 19.594 12.333 1.00 17.99 ? 327 LYS C CG  1 
ATOM   2469 C CD  . LYS B 1 27  ? 41.983 18.899 11.238 1.00 26.58 ? 327 LYS C CD  1 
ATOM   2470 C CE  . LYS B 1 27  ? 41.477 19.297 9.855  1.00 27.85 ? 327 LYS C CE  1 
ATOM   2471 N NZ  . LYS B 1 27  ? 42.281 18.679 8.756  1.00 36.46 ? 327 LYS C NZ  1 
ATOM   2472 N N   . GLY B 1 28  ? 41.299 17.129 16.497 1.00 12.61 ? 328 GLY C N   1 
ATOM   2473 C CA  . GLY B 1 28  ? 41.782 16.922 17.851 1.00 11.77 ? 328 GLY C CA  1 
ATOM   2474 C C   . GLY B 1 28  ? 41.649 18.164 18.716 1.00 11.54 ? 328 GLY C C   1 
ATOM   2475 O O   . GLY B 1 28  ? 42.191 18.222 19.818 1.00 11.58 ? 328 GLY C O   1 
ATOM   2476 N N   . GLY B 1 29  ? 40.924 19.159 18.216 1.00 11.40 ? 329 GLY C N   1 
ATOM   2477 C CA  . GLY B 1 29  ? 40.732 20.393 18.965 1.00 9.34  ? 329 GLY C CA  1 
ATOM   2478 C C   . GLY B 1 29  ? 39.912 20.230 20.235 1.00 10.46 ? 329 GLY C C   1 
ATOM   2479 O O   . GLY B 1 29  ? 39.261 19.197 20.433 1.00 10.51 ? 329 GLY C O   1 
ATOM   2480 N N   . LYS B 1 30  ? 39.941 21.256 21.092 1.00 8.34  ? 330 LYS C N   1 
ATOM   2481 C CA  . LYS B 1 30  ? 39.221 21.245 22.368 1.00 5.68  ? 330 LYS C CA  1 
ATOM   2482 C C   . LYS B 1 30  ? 37.716 21.337 22.186 1.00 6.89  ? 330 LYS C C   1 
ATOM   2483 O O   . LYS B 1 30  ? 37.233 22.066 21.319 1.00 4.95  ? 330 LYS C O   1 
ATOM   2484 C CB  . LYS B 1 30  ? 39.690 22.417 23.248 1.00 8.96  ? 330 LYS C CB  1 
ATOM   2485 C CG  . LYS B 1 30  ? 41.205 22.425 23.515 1.00 11.05 ? 330 LYS C CG  1 
ATOM   2486 C CD  . LYS B 1 30  ? 41.634 23.386 24.642 1.00 16.64 ? 330 LYS C CD  1 
ATOM   2487 C CE  . LYS B 1 30  ? 41.275 24.844 24.374 1.00 18.53 ? 330 LYS C CE  1 
ATOM   2488 N NZ  . LYS B 1 30  ? 41.855 25.797 25.404 1.00 9.89  ? 330 LYS C NZ  1 
ATOM   2489 N N   . ALA B 1 31  ? 36.975 20.605 23.011 1.00 6.95  ? 331 ALA C N   1 
ATOM   2490 C CA  . ALA B 1 31  ? 35.515 20.634 22.937 1.00 5.95  ? 331 ALA C CA  1 
ATOM   2491 C C   . ALA B 1 31  ? 35.004 22.057 23.151 1.00 5.03  ? 331 ALA C C   1 
ATOM   2492 O O   . ALA B 1 31  ? 34.027 22.473 22.531 1.00 5.25  ? 331 ALA C O   1 
ATOM   2493 C CB  . ALA B 1 31  ? 34.915 19.693 24.002 1.00 6.09  ? 331 ALA C CB  1 
ATOM   2494 N N   . LEU B 1 32  ? 35.668 22.806 24.030 1.00 3.76  ? 332 LEU C N   1 
ATOM   2495 C CA  . LEU B 1 32  ? 35.251 24.179 24.310 1.00 5.06  ? 332 LEU C CA  1 
ATOM   2496 C C   . LEU B 1 32  ? 35.268 25.024 23.030 1.00 6.57  ? 332 LEU C C   1 
ATOM   2497 O O   . LEU B 1 32  ? 34.323 25.779 22.747 1.00 3.47  ? 332 LEU C O   1 
ATOM   2498 C CB  . LEU B 1 32  ? 36.179 24.815 25.361 1.00 5.71  ? 332 LEU C CB  1 
ATOM   2499 C CG  . LEU B 1 32  ? 35.858 26.272 25.716 1.00 7.72  ? 332 LEU C CG  1 
ATOM   2500 C CD1 . LEU B 1 32  ? 34.437 26.349 26.290 1.00 8.18  ? 332 LEU C CD1 1 
ATOM   2501 C CD2 . LEU B 1 32  ? 36.871 26.805 26.724 1.00 10.51 ? 332 LEU C CD2 1 
ATOM   2502 N N   . ASP B 1 33  ? 36.350 24.918 22.265 1.00 6.39  ? 333 ASP C N   1 
ATOM   2503 C CA  . ASP B 1 33  ? 36.447 25.669 21.016 1.00 6.70  ? 333 ASP C CA  1 
ATOM   2504 C C   . ASP B 1 33  ? 35.423 25.170 19.998 1.00 7.04  ? 333 ASP C C   1 
ATOM   2505 O O   . ASP B 1 33  ? 34.839 25.958 19.249 1.00 6.33  ? 333 ASP C O   1 
ATOM   2506 C CB  . ASP B 1 33  ? 37.845 25.535 20.404 1.00 8.40  ? 333 ASP C CB  1 
ATOM   2507 C CG  . ASP B 1 33  ? 38.908 26.266 21.199 1.00 10.97 ? 333 ASP C CG  1 
ATOM   2508 O OD1 . ASP B 1 33  ? 38.646 27.395 21.637 1.00 12.97 ? 333 ASP C OD1 1 
ATOM   2509 O OD2 . ASP B 1 33  ? 40.011 25.719 21.365 1.00 12.38 ? 333 ASP C OD2 1 
ATOM   2510 N N   . ALA B 1 34  ? 35.205 23.857 19.967 1.00 6.47  ? 334 ALA C N   1 
ATOM   2511 C CA  . ALA B 1 34  ? 34.269 23.279 19.003 1.00 5.71  ? 334 ALA C CA  1 
ATOM   2512 C C   . ALA B 1 34  ? 32.836 23.753 19.211 1.00 6.68  ? 334 ALA C C   1 
ATOM   2513 O O   . ALA B 1 34  ? 32.159 24.122 18.245 1.00 5.80  ? 334 ALA C O   1 
ATOM   2514 C CB  . ALA B 1 34  ? 34.328 21.739 19.055 1.00 6.00  ? 334 ALA C CB  1 
ATOM   2515 N N   . VAL B 1 35  ? 32.360 23.747 20.459 1.00 5.17  ? 335 VAL C N   1 
ATOM   2516 C CA  . VAL B 1 35  ? 30.985 24.175 20.694 1.00 4.69  ? 335 VAL C CA  1 
ATOM   2517 C C   . VAL B 1 35  ? 30.813 25.665 20.501 1.00 7.01  ? 335 VAL C C   1 
ATOM   2518 O O   . VAL B 1 35  ? 29.749 26.094 20.061 1.00 5.44  ? 335 VAL C O   1 
ATOM   2519 C CB  . VAL B 1 35  ? 30.451 23.729 22.079 1.00 4.79  ? 335 VAL C CB  1 
ATOM   2520 C CG1 . VAL B 1 35  ? 30.526 22.206 22.159 1.00 3.49  ? 335 VAL C CG1 1 
ATOM   2521 C CG2 . VAL B 1 35  ? 31.221 24.392 23.213 1.00 4.29  ? 335 VAL C CG2 1 
ATOM   2522 N N   . GLU B 1 36  ? 31.853 26.454 20.797 1.00 5.85  ? 336 GLU C N   1 
ATOM   2523 C CA  . GLU B 1 36  ? 31.757 27.891 20.572 1.00 7.02  ? 336 GLU C CA  1 
ATOM   2524 C C   . GLU B 1 36  ? 31.645 28.149 19.070 1.00 6.36  ? 336 GLU C C   1 
ATOM   2525 O O   . GLU B 1 36  ? 30.772 28.887 18.622 1.00 6.06  ? 336 GLU C O   1 
ATOM   2526 C CB  . GLU B 1 36  ? 32.979 28.648 21.106 1.00 5.64  ? 336 GLU C CB  1 
ATOM   2527 C CG  . GLU B 1 36  ? 32.937 30.143 20.720 1.00 6.17  ? 336 GLU C CG  1 
ATOM   2528 C CD  . GLU B 1 36  ? 34.139 30.919 21.228 1.00 11.17 ? 336 GLU C CD  1 
ATOM   2529 O OE1 . GLU B 1 36  ? 35.208 30.290 21.381 1.00 8.85  ? 336 GLU C OE1 1 
ATOM   2530 O OE2 . GLU B 1 36  ? 34.017 32.149 21.461 1.00 9.56  ? 336 GLU C OE2 1 
ATOM   2531 N N   . LYS B 1 37  ? 32.531 27.530 18.296 1.00 6.10  ? 337 LYS C N   1 
ATOM   2532 C CA  . LYS B 1 37  ? 32.520 27.693 16.847 1.00 9.02  ? 337 LYS C CA  1 
ATOM   2533 C C   . LYS B 1 37  ? 31.183 27.230 16.257 1.00 5.93  ? 337 LYS C C   1 
ATOM   2534 O O   . LYS B 1 37  ? 30.621 27.879 15.379 1.00 6.15  ? 337 LYS C O   1 
ATOM   2535 C CB  . LYS B 1 37  ? 33.669 26.883 16.238 1.00 10.51 ? 337 LYS C CB  1 
ATOM   2536 C CG  . LYS B 1 37  ? 33.795 26.940 14.729 1.00 17.01 ? 337 LYS C CG  1 
ATOM   2537 C CD  . LYS B 1 37  ? 34.905 25.973 14.272 1.00 18.71 ? 337 LYS C CD  1 
ATOM   2538 C CE  . LYS B 1 37  ? 35.053 25.914 12.777 1.00 19.69 ? 337 LYS C CE  1 
ATOM   2539 N NZ  . LYS B 1 37  ? 35.498 27.237 12.228 1.00 25.73 ? 337 LYS C NZ  1 
ATOM   2540 N N   . GLY B 1 38  ? 30.686 26.100 16.748 1.00 6.73  ? 338 GLY C N   1 
ATOM   2541 C CA  . GLY B 1 38  ? 29.434 25.559 16.244 1.00 7.36  ? 338 GLY C CA  1 
ATOM   2542 C C   . GLY B 1 38  ? 28.224 26.464 16.411 1.00 6.78  ? 338 GLY C C   1 
ATOM   2543 O O   . GLY B 1 38  ? 27.466 26.695 15.459 1.00 6.67  ? 338 GLY C O   1 
ATOM   2544 N N   . VAL B 1 39  ? 28.029 27.000 17.607 1.00 3.82  ? 339 VAL C N   1 
ATOM   2545 C CA  . VAL B 1 39  ? 26.866 27.847 17.809 1.00 6.06  ? 339 VAL C CA  1 
ATOM   2546 C C   . VAL B 1 39  ? 27.047 29.232 17.222 1.00 5.56  ? 339 VAL C C   1 
ATOM   2547 O O   . VAL B 1 39  ? 26.064 29.887 16.876 1.00 7.05  ? 339 VAL C O   1 
ATOM   2548 C CB  . VAL B 1 39  ? 26.463 27.932 19.298 1.00 6.80  ? 339 VAL C CB  1 
ATOM   2549 C CG1 . VAL B 1 39  ? 26.189 26.525 19.827 1.00 5.11  ? 339 VAL C CG1 1 
ATOM   2550 C CG2 . VAL B 1 39  ? 27.539 28.631 20.114 1.00 7.23  ? 339 VAL C CG2 1 
ATOM   2551 N N   . ARG B 1 40  ? 28.293 29.686 17.089 1.00 7.72  ? 340 ARG C N   1 
ATOM   2552 C CA  . ARG B 1 40  ? 28.527 31.001 16.487 1.00 9.41  ? 340 ARG C CA  1 
ATOM   2553 C C   . ARG B 1 40  ? 27.982 31.018 15.061 1.00 10.22 ? 340 ARG C C   1 
ATOM   2554 O O   . ARG B 1 40  ? 27.543 32.061 14.570 1.00 9.79  ? 340 ARG C O   1 
ATOM   2555 C CB  . ARG B 1 40  ? 30.023 31.346 16.443 1.00 9.70  ? 340 ARG C CB  1 
ATOM   2556 C CG  . ARG B 1 40  ? 30.595 31.903 17.742 1.00 10.62 ? 340 ARG C CG  1 
ATOM   2557 C CD  . ARG B 1 40  ? 32.071 32.281 17.575 1.00 10.95 ? 340 ARG C CD  1 
ATOM   2558 N NE  . ARG B 1 40  ? 32.283 33.239 16.484 1.00 11.30 ? 340 ARG C NE  1 
ATOM   2559 C CZ  . ARG B 1 40  ? 32.553 34.531 16.653 1.00 14.18 ? 340 ARG C CZ  1 
ATOM   2560 N NH1 . ARG B 1 40  ? 32.654 35.042 17.875 1.00 9.68  ? 340 ARG C NH1 1 
ATOM   2561 N NH2 . ARG B 1 40  ? 32.721 35.319 15.595 1.00 13.47 ? 340 ARG C NH2 1 
ATOM   2562 N N   . LEU B 1 41  ? 28.005 29.866 14.396 1.00 8.93  ? 341 LEU C N   1 
ATOM   2563 C CA  . LEU B 1 41  ? 27.508 29.800 13.019 1.00 8.71  ? 341 LEU C CA  1 
ATOM   2564 C C   . LEU B 1 41  ? 26.052 30.256 12.961 1.00 10.58 ? 341 LEU C C   1 
ATOM   2565 O O   . LEU B 1 41  ? 25.649 30.999 12.051 1.00 9.17  ? 341 LEU C O   1 
ATOM   2566 C CB  . LEU B 1 41  ? 27.617 28.373 12.468 1.00 9.37  ? 341 LEU C CB  1 
ATOM   2567 C CG  . LEU B 1 41  ? 27.114 28.182 11.030 1.00 12.10 ? 341 LEU C CG  1 
ATOM   2568 C CD1 . LEU B 1 41  ? 28.174 28.672 10.057 1.00 14.21 ? 341 LEU C CD1 1 
ATOM   2569 C CD2 . LEU B 1 41  ? 26.815 26.711 10.760 1.00 13.77 ? 341 LEU C CD2 1 
ATOM   2570 N N   . VAL B 1 42  ? 25.269 29.824 13.945 1.00 8.32  ? 342 VAL C N   1 
ATOM   2571 C CA  . VAL B 1 42  ? 23.843 30.155 14.017 1.00 6.84  ? 342 VAL C CA  1 
ATOM   2572 C C   . VAL B 1 42  ? 23.619 31.603 14.461 1.00 5.94  ? 342 VAL C C   1 
ATOM   2573 O O   . VAL B 1 42  ? 22.707 32.276 13.982 1.00 9.27  ? 342 VAL C O   1 
ATOM   2574 C CB  . VAL B 1 42  ? 23.123 29.158 14.975 1.00 8.25  ? 342 VAL C CB  1 
ATOM   2575 C CG1 . VAL B 1 42  ? 21.618 29.389 14.974 1.00 9.12  ? 342 VAL C CG1 1 
ATOM   2576 C CG2 . VAL B 1 42  ? 23.448 27.726 14.541 1.00 9.64  ? 342 VAL C CG2 1 
ATOM   2577 N N   . GLU B 1 43  ? 24.446 32.081 15.382 1.00 6.63  ? 343 GLU C N   1 
ATOM   2578 C CA  . GLU B 1 43  ? 24.344 33.460 15.840 1.00 5.41  ? 343 GLU C CA  1 
ATOM   2579 C C   . GLU B 1 43  ? 24.544 34.391 14.644 1.00 8.24  ? 343 GLU C C   1 
ATOM   2580 O O   . GLU B 1 43  ? 23.859 35.402 14.518 1.00 7.37  ? 343 GLU C O   1 
ATOM   2581 C CB  . GLU B 1 43  ? 25.420 33.759 16.884 1.00 4.05  ? 343 GLU C CB  1 
ATOM   2582 C CG  . GLU B 1 43  ? 25.290 32.947 18.171 1.00 5.36  ? 343 GLU C CG  1 
ATOM   2583 C CD  . GLU B 1 43  ? 26.361 33.306 19.204 1.00 8.86  ? 343 GLU C CD  1 
ATOM   2584 O OE1 . GLU B 1 43  ? 27.509 33.583 18.800 1.00 9.41  ? 343 GLU C OE1 1 
ATOM   2585 O OE2 . GLU B 1 43  ? 26.058 33.295 20.420 1.00 5.61  ? 343 GLU C OE2 1 
ATOM   2586 N N   . ASP B 1 44  ? 25.482 34.020 13.771 1.00 8.94  ? 344 ASP C N   1 
ATOM   2587 C CA  . ASP B 1 44  ? 25.829 34.805 12.577 1.00 9.75  ? 344 ASP C CA  1 
ATOM   2588 C C   . ASP B 1 44  ? 24.775 34.797 11.474 1.00 12.38 ? 344 ASP C C   1 
ATOM   2589 O O   . ASP B 1 44  ? 24.730 35.707 10.643 1.00 11.26 ? 344 ASP C O   1 
ATOM   2590 C CB  . ASP B 1 44  ? 27.122 34.276 11.957 1.00 9.22  ? 344 ASP C CB  1 
ATOM   2591 C CG  . ASP B 1 44  ? 28.354 34.637 12.751 1.00 14.58 ? 344 ASP C CG  1 
ATOM   2592 O OD1 . ASP B 1 44  ? 28.253 35.398 13.739 1.00 11.47 ? 344 ASP C OD1 1 
ATOM   2593 O OD2 . ASP B 1 44  ? 29.436 34.156 12.368 1.00 11.82 ? 344 ASP C OD2 1 
ATOM   2594 N N   . ASP B 1 45  ? 23.950 33.761 11.462 1.00 11.34 ? 345 ASP C N   1 
ATOM   2595 C CA  . ASP B 1 45  ? 22.917 33.572 10.439 1.00 14.14 ? 345 ASP C CA  1 
ATOM   2596 C C   . ASP B 1 45  ? 21.640 34.395 10.652 1.00 11.43 ? 345 ASP C C   1 
ATOM   2597 O O   . ASP B 1 45  ? 20.824 34.075 11.513 1.00 9.95  ? 345 ASP C O   1 
ATOM   2598 C CB  . ASP B 1 45  ? 22.558 32.086 10.386 1.00 16.15 ? 345 ASP C CB  1 
ATOM   2599 C CG  . ASP B 1 45  ? 21.826 31.704 9.116  1.00 19.26 ? 345 ASP C CG  1 
ATOM   2600 O OD1 . ASP B 1 45  ? 21.238 32.589 8.457  1.00 15.71 ? 345 ASP C OD1 1 
ATOM   2601 O OD2 . ASP B 1 45  ? 21.834 30.504 8.789  1.00 19.34 ? 345 ASP C OD2 1 
ATOM   2602 N N   . PRO B 1 46  ? 21.436 35.447 9.844  1.00 14.05 ? 346 PRO C N   1 
ATOM   2603 C CA  . PRO B 1 46  ? 20.247 36.301 9.971  1.00 14.39 ? 346 PRO C CA  1 
ATOM   2604 C C   . PRO B 1 46  ? 18.938 35.555 9.748  1.00 11.67 ? 346 PRO C C   1 
ATOM   2605 O O   . PRO B 1 46  ? 17.888 35.997 10.224 1.00 10.42 ? 346 PRO C O   1 
ATOM   2606 C CB  . PRO B 1 46  ? 20.457 37.378 8.900  1.00 17.10 ? 346 PRO C CB  1 
ATOM   2607 C CG  . PRO B 1 46  ? 21.909 37.273 8.538  1.00 22.12 ? 346 PRO C CG  1 
ATOM   2608 C CD  . PRO B 1 46  ? 22.233 35.831 8.669  1.00 15.36 ? 346 PRO C CD  1 
ATOM   2609 N N   . THR B 1 47  ? 18.996 34.432 9.027  1.00 10.64 ? 347 THR C N   1 
ATOM   2610 C CA  . THR B 1 47  ? 17.793 33.650 8.745  1.00 11.73 ? 347 THR C CA  1 
ATOM   2611 C C   . THR B 1 47  ? 17.387 32.724 9.894  1.00 12.98 ? 347 THR C C   1 
ATOM   2612 O O   . THR B 1 47  ? 16.321 32.112 9.845  1.00 12.73 ? 347 THR C O   1 
ATOM   2613 C CB  . THR B 1 47  ? 17.932 32.811 7.439  1.00 13.77 ? 347 THR C CB  1 
ATOM   2614 O OG1 . THR B 1 47  ? 18.912 31.783 7.613  1.00 16.26 ? 347 THR C OG1 1 
ATOM   2615 C CG2 . THR B 1 47  ? 18.343 33.714 6.269  1.00 14.73 ? 347 THR C CG2 1 
ATOM   2616 N N   . GLU B 1 48  ? 18.245 32.595 10.909 1.00 12.48 ? 348 GLU C N   1 
ATOM   2617 C CA  . GLU B 1 48  ? 17.904 31.798 12.087 1.00 12.12 ? 348 GLU C CA  1 
ATOM   2618 C C   . GLU B 1 48  ? 17.378 32.857 13.054 1.00 9.29  ? 348 GLU C C   1 
ATOM   2619 O O   . GLU B 1 48  ? 18.145 33.562 13.714 1.00 12.54 ? 348 GLU C O   1 
ATOM   2620 C CB  . GLU B 1 48  ? 19.132 31.086 12.651 1.00 13.64 ? 348 GLU C CB  1 
ATOM   2621 C CG  . GLU B 1 48  ? 19.491 29.792 11.909 1.00 17.02 ? 348 GLU C CG  1 
ATOM   2622 C CD  . GLU B 1 48  ? 18.291 28.856 11.724 1.00 18.52 ? 348 GLU C CD  1 
ATOM   2623 O OE1 . GLU B 1 48  ? 17.400 28.825 12.606 1.00 19.77 ? 348 GLU C OE1 1 
ATOM   2624 O OE2 . GLU B 1 48  ? 18.244 28.138 10.698 1.00 19.34 ? 348 GLU C OE2 1 
ATOM   2625 N N   . ARG B 1 49  ? 16.054 32.951 13.118 1.00 6.80  ? 349 ARG C N   1 
ATOM   2626 C CA  . ARG B 1 49  ? 15.349 33.973 13.889 1.00 9.18  ? 349 ARG C CA  1 
ATOM   2627 C C   . ARG B 1 49  ? 15.247 33.855 15.409 1.00 10.59 ? 349 ARG C C   1 
ATOM   2628 O O   . ARG B 1 49  ? 14.605 34.692 16.048 1.00 10.80 ? 349 ARG C O   1 
ATOM   2629 C CB  . ARG B 1 49  ? 13.943 34.121 13.312 1.00 11.01 ? 349 ARG C CB  1 
ATOM   2630 C CG  . ARG B 1 49  ? 13.910 34.100 11.789 1.00 14.70 ? 349 ARG C CG  1 
ATOM   2631 C CD  . ARG B 1 49  ? 14.574 35.347 11.225 1.00 13.28 ? 349 ARG C CD  1 
ATOM   2632 N NE  . ARG B 1 49  ? 13.925 36.547 11.739 1.00 15.45 ? 349 ARG C NE  1 
ATOM   2633 C CZ  . ARG B 1 49  ? 12.655 36.868 11.511 1.00 15.66 ? 349 ARG C CZ  1 
ATOM   2634 N NH1 . ARG B 1 49  ? 11.890 36.077 10.766 1.00 16.95 ? 349 ARG C NH1 1 
ATOM   2635 N NH2 . ARG B 1 49  ? 12.144 37.969 12.042 1.00 13.54 ? 349 ARG C NH2 1 
ATOM   2636 N N   . SER B 1 50  ? 15.853 32.838 16.005 1.00 11.10 ? 350 SER C N   1 
ATOM   2637 C CA  . SER B 1 50  ? 15.771 32.725 17.466 1.00 9.77  ? 350 SER C CA  1 
ATOM   2638 C C   . SER B 1 50  ? 17.158 32.629 18.095 1.00 9.61  ? 350 SER C C   1 
ATOM   2639 O O   . SER B 1 50  ? 17.302 32.224 19.253 1.00 6.81  ? 350 SER C O   1 
ATOM   2640 C CB  . SER B 1 50  ? 14.922 31.512 17.864 1.00 10.20 ? 350 SER C CB  1 
ATOM   2641 O OG  . SER B 1 50  ? 13.574 31.665 17.412 1.00 12.31 ? 350 SER C OG  1 
ATOM   2642 N N   . VAL B 1 51  ? 18.174 33.019 17.328 1.00 8.10  ? 351 VAL C N   1 
ATOM   2643 C CA  . VAL B 1 51  ? 19.561 32.993 17.807 1.00 8.82  ? 351 VAL C CA  1 
ATOM   2644 C C   . VAL B 1 51  ? 20.361 34.154 17.220 1.00 10.57 ? 351 VAL C C   1 
ATOM   2645 O O   . VAL B 1 51  ? 20.406 34.321 16.007 1.00 8.15  ? 351 VAL C O   1 
ATOM   2646 C CB  . VAL B 1 51  ? 20.270 31.673 17.404 1.00 8.87  ? 351 VAL C CB  1 
ATOM   2647 C CG1 . VAL B 1 51  ? 21.686 31.647 17.958 1.00 7.21  ? 351 VAL C CG1 1 
ATOM   2648 C CG2 . VAL B 1 51  ? 19.469 30.467 17.918 1.00 11.57 ? 351 VAL C CG2 1 
ATOM   2649 N N   . GLY B 1 52  ? 20.969 34.964 18.085 1.00 8.77  ? 352 GLY C N   1 
ATOM   2650 C CA  . GLY B 1 52  ? 21.793 36.081 17.639 1.00 7.06  ? 352 GLY C CA  1 
ATOM   2651 C C   . GLY B 1 52  ? 21.233 37.015 16.575 1.00 6.92  ? 352 GLY C C   1 
ATOM   2652 O O   . GLY B 1 52  ? 20.104 37.477 16.673 1.00 8.19  ? 352 GLY C O   1 
ATOM   2653 N N   . TYR B 1 53  ? 22.050 37.291 15.561 1.00 7.04  ? 353 TYR C N   1 
ATOM   2654 C CA  . TYR B 1 53  ? 21.676 38.171 14.452 1.00 8.11  ? 353 TYR C CA  1 
ATOM   2655 C C   . TYR B 1 53  ? 20.404 37.684 13.751 1.00 8.33  ? 353 TYR C C   1 
ATOM   2656 O O   . TYR B 1 53  ? 20.310 36.529 13.324 1.00 9.56  ? 353 TYR C O   1 
ATOM   2657 C CB  . TYR B 1 53  ? 22.852 38.253 13.467 1.00 11.09 ? 353 TYR C CB  1 
ATOM   2658 C CG  . TYR B 1 53  ? 22.677 39.213 12.313 1.00 14.47 ? 353 TYR C CG  1 
ATOM   2659 C CD1 . TYR B 1 53  ? 22.034 40.444 12.489 1.00 16.88 ? 353 TYR C CD1 1 
ATOM   2660 C CD2 . TYR B 1 53  ? 23.212 38.921 11.057 1.00 12.80 ? 353 TYR C CD2 1 
ATOM   2661 C CE1 . TYR B 1 53  ? 21.929 41.367 11.438 1.00 16.63 ? 353 TYR C CE1 1 
ATOM   2662 C CE2 . TYR B 1 53  ? 23.117 39.839 9.998  1.00 17.01 ? 353 TYR C CE2 1 
ATOM   2663 C CZ  . TYR B 1 53  ? 22.474 41.055 10.201 1.00 20.07 ? 353 TYR C CZ  1 
ATOM   2664 O OH  . TYR B 1 53  ? 22.379 41.954 9.169  1.00 20.62 ? 353 TYR C OH  1 
ATOM   2665 N N   . GLY B 1 54  ? 19.425 38.575 13.630 1.00 8.07  ? 354 GLY C N   1 
ATOM   2666 C CA  . GLY B 1 54  ? 18.169 38.208 13.005 1.00 8.40  ? 354 GLY C CA  1 
ATOM   2667 C C   . GLY B 1 54  ? 17.146 37.713 14.018 1.00 10.81 ? 354 GLY C C   1 
ATOM   2668 O O   . GLY B 1 54  ? 15.988 37.440 13.675 1.00 10.01 ? 354 GLY C O   1 
ATOM   2669 N N   . GLY B 1 55  ? 17.567 37.600 15.276 1.00 9.53  ? 355 GLY C N   1 
ATOM   2670 C CA  . GLY B 1 55  ? 16.661 37.139 16.314 1.00 8.21  ? 355 GLY C CA  1 
ATOM   2671 C C   . GLY B 1 55  ? 15.494 38.095 16.503 1.00 12.19 ? 355 GLY C C   1 
ATOM   2672 O O   . GLY B 1 55  ? 15.670 39.326 16.427 1.00 10.61 ? 355 GLY C O   1 
ATOM   2673 N N   . ARG B 1 56  ? 14.303 37.542 16.737 1.00 10.26 ? 356 ARG C N   1 
ATOM   2674 C CA  . ARG B 1 56  ? 13.122 38.378 16.947 1.00 10.08 ? 356 ARG C CA  1 
ATOM   2675 C C   . ARG B 1 56  ? 13.283 39.151 18.245 1.00 10.29 ? 356 ARG C C   1 
ATOM   2676 O O   . ARG B 1 56  ? 13.731 38.610 19.257 1.00 8.45  ? 356 ARG C O   1 
ATOM   2677 C CB  . ARG B 1 56  ? 11.851 37.525 16.952 1.00 9.49  ? 356 ARG C CB  1 
ATOM   2678 C CG  . ARG B 1 56  ? 11.638 36.814 15.615 1.00 12.17 ? 356 ARG C CG  1 
ATOM   2679 C CD  . ARG B 1 56  ? 10.182 36.433 15.383 1.00 15.42 ? 356 ARG C CD  1 
ATOM   2680 N NE  . ARG B 1 56  ? 10.049 35.581 14.202 1.00 18.86 ? 356 ARG C NE  1 
ATOM   2681 C CZ  . ARG B 1 56  ? 10.434 34.308 14.157 1.00 21.72 ? 356 ARG C CZ  1 
ATOM   2682 N NH1 . ARG B 1 56  ? 10.975 33.733 15.225 1.00 20.73 ? 356 ARG C NH1 1 
ATOM   2683 N NH2 . ARG B 1 56  ? 10.271 33.599 13.046 1.00 22.15 ? 356 ARG C NH2 1 
ATOM   2684 N N   . PRO B 1 57  ? 12.953 40.450 18.220 1.00 10.98 ? 357 PRO C N   1 
ATOM   2685 C CA  . PRO B 1 57  ? 13.068 41.329 19.388 1.00 10.05 ? 357 PRO C CA  1 
ATOM   2686 C C   . PRO B 1 57  ? 12.043 41.109 20.484 1.00 9.63  ? 357 PRO C C   1 
ATOM   2687 O O   . PRO B 1 57  ? 11.075 40.359 20.302 1.00 9.13  ? 357 PRO C O   1 
ATOM   2688 C CB  . PRO B 1 57  ? 12.931 42.717 18.774 1.00 11.41 ? 357 PRO C CB  1 
ATOM   2689 C CG  . PRO B 1 57  ? 11.924 42.476 17.677 1.00 12.61 ? 357 PRO C CG  1 
ATOM   2690 C CD  . PRO B 1 57  ? 12.439 41.190 17.050 1.00 10.17 ? 357 PRO C CD  1 
ATOM   2691 N N   . ASP B 1 58  ? 12.274 41.759 21.627 1.00 8.60  ? 358 ASP C N   1 
ATOM   2692 C CA  . ASP B 1 58  ? 11.328 41.702 22.723 1.00 9.10  ? 358 ASP C CA  1 
ATOM   2693 C C   . ASP B 1 58  ? 10.179 42.572 22.218 1.00 11.19 ? 358 ASP C C   1 
ATOM   2694 O O   . ASP B 1 58  ? 10.259 43.110 21.104 1.00 10.78 ? 358 ASP C O   1 
ATOM   2695 C CB  . ASP B 1 58  ? 11.939 42.246 24.038 1.00 9.24  ? 358 ASP C CB  1 
ATOM   2696 C CG  . ASP B 1 58  ? 12.394 43.711 23.947 1.00 12.97 ? 358 ASP C CG  1 
ATOM   2697 O OD1 . ASP B 1 58  ? 13.214 44.114 24.803 1.00 10.93 ? 358 ASP C OD1 1 
ATOM   2698 O OD2 . ASP B 1 58  ? 11.939 44.460 23.053 1.00 12.77 ? 358 ASP C OD2 1 
ATOM   2699 N N   . ARG B 1 59  ? 9.123  42.718 23.009 1.00 9.78  ? 359 ARG C N   1 
ATOM   2700 C CA  . ARG B 1 59  ? 7.962  43.490 22.572 1.00 11.83 ? 359 ARG C CA  1 
ATOM   2701 C C   . ARG B 1 59  ? 8.202  44.979 22.367 1.00 12.55 ? 359 ARG C C   1 
ATOM   2702 O O   . ARG B 1 59  ? 7.349  45.677 21.807 1.00 14.68 ? 359 ARG C O   1 
ATOM   2703 C CB  . ARG B 1 59  ? 6.789  43.277 23.536 1.00 12.40 ? 359 ARG C CB  1 
ATOM   2704 C CG  . ARG B 1 59  ? 7.022  43.770 24.952 1.00 15.30 ? 359 ARG C CG  1 
ATOM   2705 C CD  . ARG B 1 59  ? 5.830  43.389 25.831 1.00 20.04 ? 359 ARG C CD  1 
ATOM   2706 N NE  . ARG B 1 59  ? 5.855  44.063 27.126 1.00 27.30 ? 359 ARG C NE  1 
ATOM   2707 C CZ  . ARG B 1 59  ? 4.972  43.849 28.099 1.00 31.16 ? 359 ARG C CZ  1 
ATOM   2708 N NH1 . ARG B 1 59  ? 3.986  42.970 27.927 1.00 32.82 ? 359 ARG C NH1 1 
ATOM   2709 N NH2 . ARG B 1 59  ? 5.067  44.517 29.241 1.00 29.35 ? 359 ARG C NH2 1 
ATOM   2710 N N   . ASP B 1 60  ? 9.346  45.477 22.815 1.00 10.29 ? 360 ASP C N   1 
ATOM   2711 C CA  . ASP B 1 60  ? 9.650  46.886 22.621 1.00 11.34 ? 360 ASP C CA  1 
ATOM   2712 C C   . ASP B 1 60  ? 10.499 47.084 21.378 1.00 11.36 ? 360 ASP C C   1 
ATOM   2713 O O   . ASP B 1 60  ? 10.902 48.201 21.086 1.00 11.34 ? 360 ASP C O   1 
ATOM   2714 C CB  . ASP B 1 60  ? 10.391 47.469 23.827 1.00 11.79 ? 360 ASP C CB  1 
ATOM   2715 C CG  . ASP B 1 60  ? 9.583  47.385 25.104 1.00 14.54 ? 360 ASP C CG  1 
ATOM   2716 O OD1 . ASP B 1 60  ? 8.343  47.497 25.037 1.00 23.08 ? 360 ASP C OD1 1 
ATOM   2717 O OD2 . ASP B 1 60  ? 10.192 47.226 26.175 1.00 21.43 ? 360 ASP C OD2 1 
ATOM   2718 N N   . GLY B 1 61  ? 10.798 45.993 20.676 1.00 10.04 ? 361 GLY C N   1 
ATOM   2719 C CA  . GLY B 1 61  ? 11.600 46.082 19.467 1.00 11.72 ? 361 GLY C CA  1 
ATOM   2720 C C   . GLY B 1 61  ? 13.102 45.964 19.656 1.00 13.31 ? 361 GLY C C   1 
ATOM   2721 O O   . GLY B 1 61  ? 13.865 46.193 18.713 1.00 14.00 ? 361 GLY C O   1 
ATOM   2722 N N   . ARG B 1 62  ? 13.537 45.605 20.865 1.00 10.35 ? 362 ARG C N   1 
ATOM   2723 C CA  . ARG B 1 62  ? 14.958 45.457 21.144 1.00 11.70 ? 362 ARG C CA  1 
ATOM   2724 C C   . ARG B 1 62  ? 15.379 43.991 21.072 1.00 12.10 ? 362 ARG C C   1 
ATOM   2725 O O   . ARG B 1 62  ? 14.746 43.124 21.680 1.00 11.03 ? 362 ARG C O   1 
ATOM   2726 C CB  . ARG B 1 62  ? 15.294 45.976 22.553 1.00 16.62 ? 362 ARG C CB  1 
ATOM   2727 C CG  . ARG B 1 62  ? 14.868 47.414 22.812 1.00 22.16 ? 362 ARG C CG  1 
ATOM   2728 C CD  . ARG B 1 62  ? 15.001 47.815 24.276 1.00 27.36 ? 362 ARG C CD  1 
ATOM   2729 N NE  . ARG B 1 62  ? 16.371 48.148 24.653 1.00 34.18 ? 362 ARG C NE  1 
ATOM   2730 C CZ  . ARG B 1 62  ? 16.691 48.936 25.677 1.00 34.45 ? 362 ARG C CZ  1 
ATOM   2731 N NH1 . ARG B 1 62  ? 15.735 49.475 26.423 1.00 37.92 ? 362 ARG C NH1 1 
ATOM   2732 N NH2 . ARG B 1 62  ? 17.963 49.181 25.959 1.00 32.30 ? 362 ARG C NH2 1 
ATOM   2733 N N   . VAL B 1 63  ? 16.450 43.713 20.339 1.00 10.95 ? 363 VAL C N   1 
ATOM   2734 C CA  . VAL B 1 63  ? 16.955 42.350 20.269 1.00 9.77  ? 363 VAL C CA  1 
ATOM   2735 C C   . VAL B 1 63  ? 17.905 42.199 21.456 1.00 9.66  ? 363 VAL C C   1 
ATOM   2736 O O   . VAL B 1 63  ? 18.918 42.906 21.549 1.00 8.92  ? 363 VAL C O   1 
ATOM   2737 C CB  . VAL B 1 63  ? 17.721 42.087 18.952 1.00 12.47 ? 363 VAL C CB  1 
ATOM   2738 C CG1 . VAL B 1 63  ? 18.293 40.675 18.953 1.00 12.40 ? 363 VAL C CG1 1 
ATOM   2739 C CG2 . VAL B 1 63  ? 16.777 42.258 17.751 1.00 13.13 ? 363 VAL C CG2 1 
ATOM   2740 N N   . THR B 1 64  ? 17.551 41.334 22.406 1.00 7.19  ? 364 THR C N   1 
ATOM   2741 C CA  . THR B 1 64  ? 18.422 41.122 23.557 1.00 6.65  ? 364 THR C CA  1 
ATOM   2742 C C   . THR B 1 64  ? 18.763 39.633 23.563 1.00 6.99  ? 364 THR C C   1 
ATOM   2743 O O   . THR B 1 64  ? 17.879 38.771 23.483 1.00 7.48  ? 364 THR C O   1 
ATOM   2744 C CB  . THR B 1 64  ? 17.755 41.609 24.895 1.00 8.06  ? 364 THR C CB  1 
ATOM   2745 O OG1 . THR B 1 64  ? 16.610 40.811 25.221 1.00 6.43  ? 364 THR C OG1 1 
ATOM   2746 C CG2 . THR B 1 64  ? 17.302 43.077 24.744 1.00 10.84 ? 364 THR C CG2 1 
ATOM   2747 N N   . LEU B 1 65  ? 20.056 39.338 23.632 1.00 7.76  ? 365 LEU C N   1 
ATOM   2748 C CA  . LEU B 1 65  ? 20.526 37.961 23.561 1.00 5.77  ? 365 LEU C CA  1 
ATOM   2749 C C   . LEU B 1 65  ? 21.008 37.380 24.876 1.00 4.27  ? 365 LEU C C   1 
ATOM   2750 O O   . LEU B 1 65  ? 21.469 38.109 25.761 1.00 7.82  ? 365 LEU C O   1 
ATOM   2751 C CB  . LEU B 1 65  ? 21.655 37.865 22.542 1.00 4.32  ? 365 LEU C CB  1 
ATOM   2752 C CG  . LEU B 1 65  ? 21.417 38.537 21.187 1.00 6.44  ? 365 LEU C CG  1 
ATOM   2753 C CD1 . LEU B 1 65  ? 22.668 38.319 20.319 1.00 2.95  ? 365 LEU C CD1 1 
ATOM   2754 C CD2 . LEU B 1 65  ? 20.154 37.933 20.513 1.00 4.42  ? 365 LEU C CD2 1 
ATOM   2755 N N   . ASP B 1 66  ? 20.932 36.055 24.969 1.00 6.15  ? 366 ASP C N   1 
ATOM   2756 C CA  . ASP B 1 66  ? 21.341 35.317 26.164 1.00 5.99  ? 366 ASP C CA  1 
ATOM   2757 C C   . ASP B 1 66  ? 22.200 34.125 25.749 1.00 4.29  ? 366 ASP C C   1 
ATOM   2758 O O   . ASP B 1 66  ? 21.941 33.505 24.726 1.00 6.39  ? 366 ASP C O   1 
ATOM   2759 C CB  . ASP B 1 66  ? 20.117 34.746 26.904 1.00 7.53  ? 366 ASP C CB  1 
ATOM   2760 C CG  . ASP B 1 66  ? 18.964 35.724 26.997 1.00 11.08 ? 366 ASP C CG  1 
ATOM   2761 O OD1 . ASP B 1 66  ? 19.189 36.887 27.391 1.00 5.65  ? 366 ASP C OD1 1 
ATOM   2762 O OD2 . ASP B 1 66  ? 17.822 35.311 26.678 1.00 10.32 ? 366 ASP C OD2 1 
ATOM   2763 N N   . ALA B 1 67  ? 23.210 33.795 26.544 1.00 5.46  ? 367 ALA C N   1 
ATOM   2764 C CA  . ALA B 1 67  ? 24.046 32.637 26.235 1.00 5.87  ? 367 ALA C CA  1 
ATOM   2765 C C   . ALA B 1 67  ? 24.922 32.285 27.411 1.00 5.39  ? 367 ALA C C   1 
ATOM   2766 O O   . ALA B 1 67  ? 25.216 33.133 28.246 1.00 4.75  ? 367 ALA C O   1 
ATOM   2767 C CB  . ALA B 1 67  ? 24.933 32.926 25.006 1.00 5.62  ? 367 ALA C CB  1 
ATOM   2768 N N   . CYS B 1 68  ? 25.319 31.019 27.493 1.00 6.68  ? 368 CYS C N   1 
ATOM   2769 C CA  . CYS B 1 68  ? 26.240 30.608 28.535 1.00 4.76  ? 368 CYS C CA  1 
ATOM   2770 C C   . CYS B 1 68  ? 27.092 29.500 27.949 1.00 4.97  ? 368 CYS C C   1 
ATOM   2771 O O   . CYS B 1 68  ? 26.741 28.892 26.927 1.00 4.89  ? 368 CYS C O   1 
ATOM   2772 C CB  . CYS B 1 68  ? 25.527 30.172 29.823 1.00 4.89  ? 368 CYS C CB  1 
ATOM   2773 S SG  . CYS B 1 68  ? 24.646 28.610 29.793 1.00 7.88  ? 368 CYS C SG  1 
ATOM   2774 N N   . ILE B 1 69  ? 28.230 29.264 28.581 1.00 3.82  ? 369 ILE C N   1 
ATOM   2775 C CA  . ILE B 1 69  ? 29.174 28.280 28.098 1.00 3.75  ? 369 ILE C CA  1 
ATOM   2776 C C   . ILE B 1 69  ? 29.768 27.616 29.331 1.00 6.12  ? 369 ILE C C   1 
ATOM   2777 O O   . ILE B 1 69  ? 29.816 28.222 30.405 1.00 4.99  ? 369 ILE C O   1 
ATOM   2778 C CB  . ILE B 1 69  ? 30.269 28.993 27.254 1.00 5.23  ? 369 ILE C CB  1 
ATOM   2779 C CG1 . ILE B 1 69  ? 31.078 27.977 26.453 1.00 2.83  ? 369 ILE C CG1 1 
ATOM   2780 C CG2 . ILE B 1 69  ? 31.206 29.823 28.190 1.00 2.89  ? 369 ILE C CG2 1 
ATOM   2781 C CD1 . ILE B 1 69  ? 31.988 28.645 25.405 1.00 4.56  ? 369 ILE C CD1 1 
ATOM   2782 N N   . MET B 1 70  ? 30.181 26.359 29.190 1.00 3.86  ? 370 MET C N   1 
ATOM   2783 C CA  . MET B 1 70  ? 30.750 25.639 30.321 1.00 5.93  ? 370 MET C CA  1 
ATOM   2784 C C   . MET B 1 70  ? 31.786 24.679 29.776 1.00 5.42  ? 370 MET C C   1 
ATOM   2785 O O   . MET B 1 70  ? 31.530 23.953 28.805 1.00 3.82  ? 370 MET C O   1 
ATOM   2786 C CB  . MET B 1 70  ? 29.643 24.884 31.077 1.00 5.27  ? 370 MET C CB  1 
ATOM   2787 C CG  . MET B 1 70  ? 30.105 24.187 32.366 1.00 5.44  ? 370 MET C CG  1 
ATOM   2788 S SD  . MET B 1 70  ? 28.727 23.852 33.514 1.00 5.82  ? 370 MET C SD  1 
ATOM   2789 C CE  . MET B 1 70  ? 27.316 24.277 32.536 1.00 16.61 ? 370 MET C CE  1 
ATOM   2790 N N   . ASP B 1 71  ? 32.966 24.669 30.389 1.00 3.29  ? 371 ASP C N   1 
ATOM   2791 C CA  . ASP B 1 71  ? 34.023 23.798 29.892 1.00 3.22  ? 371 ASP C CA  1 
ATOM   2792 C C   . ASP B 1 71  ? 34.162 22.497 30.673 1.00 5.20  ? 371 ASP C C   1 
ATOM   2793 O O   . ASP B 1 71  ? 33.248 22.095 31.402 1.00 3.99  ? 371 ASP C O   1 
ATOM   2794 C CB  . ASP B 1 71  ? 35.357 24.567 29.826 1.00 3.84  ? 371 ASP C CB  1 
ATOM   2795 C CG  . ASP B 1 71  ? 36.020 24.745 31.185 1.00 8.89  ? 371 ASP C CG  1 
ATOM   2796 O OD1 . ASP B 1 71  ? 35.429 24.367 32.226 1.00 5.38  ? 371 ASP C OD1 1 
ATOM   2797 O OD2 . ASP B 1 71  ? 37.151 25.270 31.200 1.00 8.01  ? 371 ASP C OD2 1 
ATOM   2798 N N   . GLU B 1 72  ? 35.301 21.837 30.540 1.00 3.85  ? 372 GLU C N   1 
ATOM   2799 C CA  . GLU B 1 72  ? 35.479 20.552 31.214 1.00 5.35  ? 372 GLU C CA  1 
ATOM   2800 C C   . GLU B 1 72  ? 35.929 20.583 32.672 1.00 7.21  ? 372 GLU C C   1 
ATOM   2801 O O   . GLU B 1 72  ? 36.143 19.520 33.272 1.00 9.01  ? 372 GLU C O   1 
ATOM   2802 C CB  . GLU B 1 72  ? 36.454 19.685 30.408 1.00 6.62  ? 372 GLU C CB  1 
ATOM   2803 C CG  . GLU B 1 72  ? 37.918 20.102 30.525 1.00 9.32  ? 372 GLU C CG  1 
ATOM   2804 C CD  . GLU B 1 72  ? 38.263 21.371 29.750 1.00 15.51 ? 372 GLU C CD  1 
ATOM   2805 O OE1 . GLU B 1 72  ? 39.418 21.820 29.882 1.00 16.18 ? 372 GLU C OE1 1 
ATOM   2806 O OE2 . GLU B 1 72  ? 37.404 21.914 29.016 1.00 15.28 ? 372 GLU C OE2 1 
ATOM   2807 N N   . ASN B 1 73  ? 36.073 21.770 33.250 1.00 8.66  ? 373 ASN C N   1 
ATOM   2808 C CA  . ASN B 1 73  ? 36.524 21.863 34.638 1.00 10.39 ? 373 ASN C CA  1 
ATOM   2809 C C   . ASN B 1 73  ? 35.717 22.865 35.462 1.00 6.88  ? 373 ASN C C   1 
ATOM   2810 O O   . ASN B 1 73  ? 36.259 23.635 36.248 1.00 7.29  ? 373 ASN C O   1 
ATOM   2811 C CB  . ASN B 1 73  ? 38.026 22.198 34.678 1.00 9.74  ? 373 ASN C CB  1 
ATOM   2812 C CG  . ASN B 1 73  ? 38.705 21.708 35.961 1.00 13.18 ? 373 ASN C CG  1 
ATOM   2813 O OD1 . ASN B 1 73  ? 38.295 20.699 36.554 1.00 10.71 ? 373 ASN C OD1 1 
ATOM   2814 N ND2 . ASN B 1 73  ? 39.760 22.410 36.384 1.00 9.30  ? 373 ASN C ND2 1 
ATOM   2815 N N   . TYR B 1 74  ? 34.402 22.836 35.270 1.00 6.54  ? 374 TYR C N   1 
ATOM   2816 C CA  . TYR B 1 74  ? 33.483 23.705 35.991 1.00 7.27  ? 374 TYR C CA  1 
ATOM   2817 C C   . TYR B 1 74  ? 33.670 25.209 35.808 1.00 8.62  ? 374 TYR C C   1 
ATOM   2818 O O   . TYR B 1 74  ? 33.237 26.000 36.647 1.00 6.13  ? 374 TYR C O   1 
ATOM   2819 C CB  . TYR B 1 74  ? 33.494 23.365 37.484 1.00 8.83  ? 374 TYR C CB  1 
ATOM   2820 C CG  . TYR B 1 74  ? 32.526 22.247 37.841 1.00 16.36 ? 374 TYR C CG  1 
ATOM   2821 C CD1 . TYR B 1 74  ? 32.920 20.909 37.805 1.00 16.13 ? 374 TYR C CD1 1 
ATOM   2822 C CD2 . TYR B 1 74  ? 31.197 22.535 38.178 1.00 16.62 ? 374 TYR C CD2 1 
ATOM   2823 C CE1 . TYR B 1 74  ? 32.012 19.880 38.095 1.00 19.57 ? 374 TYR C CE1 1 
ATOM   2824 C CE2 . TYR B 1 74  ? 30.284 21.517 38.470 1.00 22.52 ? 374 TYR C CE2 1 
ATOM   2825 C CZ  . TYR B 1 74  ? 30.694 20.196 38.428 1.00 20.58 ? 374 TYR C CZ  1 
ATOM   2826 O OH  . TYR B 1 74  ? 29.789 19.195 38.735 1.00 23.11 ? 374 TYR C OH  1 
ATOM   2827 N N   . ASN B 1 75  ? 34.323 25.610 34.724 1.00 5.49  ? 375 ASN C N   1 
ATOM   2828 C CA  . ASN B 1 75  ? 34.489 27.027 34.470 1.00 5.02  ? 375 ASN C CA  1 
ATOM   2829 C C   . ASN B 1 75  ? 33.227 27.402 33.697 1.00 5.71  ? 375 ASN C C   1 
ATOM   2830 O O   . ASN B 1 75  ? 32.754 26.627 32.871 1.00 4.23  ? 375 ASN C O   1 
ATOM   2831 C CB  . ASN B 1 75  ? 35.770 27.282 33.665 1.00 5.56  ? 375 ASN C CB  1 
ATOM   2832 C CG  . ASN B 1 75  ? 37.025 26.882 34.439 1.00 7.42  ? 375 ASN C CG  1 
ATOM   2833 O OD1 . ASN B 1 75  ? 37.822 26.055 33.988 1.00 11.37 ? 375 ASN C OD1 1 
ATOM   2834 N ND2 . ASN B 1 75  ? 37.198 27.466 35.606 1.00 4.36  ? 375 ASN C ND2 1 
ATOM   2835 N N   . ILE B 1 76  ? 32.660 28.569 33.999 1.00 2.31  ? 376 ILE C N   1 
ATOM   2836 C CA  . ILE B 1 76  ? 31.420 28.981 33.350 1.00 5.70  ? 376 ILE C CA  1 
ATOM   2837 C C   . ILE B 1 76  ? 31.377 30.461 33.055 1.00 2.14  ? 376 ILE C C   1 
ATOM   2838 O O   . ILE B 1 76  ? 32.005 31.268 33.754 1.00 3.61  ? 376 ILE C O   1 
ATOM   2839 C CB  . ILE B 1 76  ? 30.180 28.663 34.229 1.00 5.14  ? 376 ILE C CB  1 
ATOM   2840 C CG1 . ILE B 1 76  ? 30.418 29.148 35.666 1.00 7.11  ? 376 ILE C CG1 1 
ATOM   2841 C CG2 . ILE B 1 76  ? 29.901 27.167 34.229 1.00 7.73  ? 376 ILE C CG2 1 
ATOM   2842 C CD1 . ILE B 1 76  ? 29.147 29.194 36.514 1.00 6.45  ? 376 ILE C CD1 1 
ATOM   2843 N N   . GLY B 1 77  ? 30.618 30.810 32.020 1.00 4.09  ? 377 GLY C N   1 
ATOM   2844 C CA  . GLY B 1 77  ? 30.471 32.199 31.626 1.00 4.83  ? 377 GLY C CA  1 
ATOM   2845 C C   . GLY B 1 77  ? 29.076 32.382 31.059 1.00 4.40  ? 377 GLY C C   1 
ATOM   2846 O O   . GLY B 1 77  ? 28.553 31.499 30.382 1.00 6.02  ? 377 GLY C O   1 
ATOM   2847 N N   . SER B 1 78  ? 28.474 33.533 31.337 1.00 6.78  ? 378 SER C N   1 
ATOM   2848 C CA  . SER B 1 78  ? 27.121 33.783 30.896 1.00 5.71  ? 378 SER C CA  1 
ATOM   2849 C C   . SER B 1 78  ? 26.812 35.256 30.723 1.00 7.08  ? 378 SER C C   1 
ATOM   2850 O O   . SER B 1 78  ? 27.312 36.103 31.473 1.00 7.32  ? 378 SER C O   1 
ATOM   2851 C CB  . SER B 1 78  ? 26.136 33.189 31.932 1.00 6.55  ? 378 SER C CB  1 
ATOM   2852 O OG  . SER B 1 78  ? 24.810 33.674 31.740 1.00 6.52  ? 378 SER C OG  1 
ATOM   2853 N N   . VAL B 1 79  ? 26.002 35.551 29.712 1.00 6.19  ? 379 VAL C N   1 
ATOM   2854 C CA  . VAL B 1 79  ? 25.524 36.908 29.486 1.00 6.65  ? 379 VAL C CA  1 
ATOM   2855 C C   . VAL B 1 79  ? 24.031 36.780 29.230 1.00 6.44  ? 379 VAL C C   1 
ATOM   2856 O O   . VAL B 1 79  ? 23.589 35.818 28.612 1.00 3.97  ? 379 VAL C O   1 
ATOM   2857 C CB  . VAL B 1 79  ? 26.190 37.610 28.275 1.00 6.92  ? 379 VAL C CB  1 
ATOM   2858 C CG1 . VAL B 1 79  ? 27.650 37.950 28.623 1.00 7.32  ? 379 VAL C CG1 1 
ATOM   2859 C CG2 . VAL B 1 79  ? 26.108 36.734 27.027 1.00 6.13  ? 379 VAL C CG2 1 
ATOM   2860 N N   . ALA B 1 80  ? 23.251 37.736 29.723 1.00 4.52  ? 380 ALA C N   1 
ATOM   2861 C CA  . ALA B 1 80  ? 21.822 37.681 29.500 1.00 6.39  ? 380 ALA C CA  1 
ATOM   2862 C C   . ALA B 1 80  ? 21.321 39.078 29.229 1.00 8.22  ? 380 ALA C C   1 
ATOM   2863 O O   . ALA B 1 80  ? 21.836 40.052 29.789 1.00 9.91  ? 380 ALA C O   1 
ATOM   2864 C CB  . ALA B 1 80  ? 21.104 37.082 30.715 1.00 4.62  ? 380 ALA C CB  1 
ATOM   2865 N N   . CYS B 1 81  ? 20.327 39.157 28.349 1.00 5.97  ? 381 CYS C N   1 
ATOM   2866 C CA  . CYS B 1 81  ? 19.711 40.418 27.961 1.00 7.27  ? 381 CYS C CA  1 
ATOM   2867 C C   . CYS B 1 81  ? 20.759 41.417 27.479 1.00 7.84  ? 381 CYS C C   1 
ATOM   2868 O O   . CYS B 1 81  ? 20.778 42.578 27.899 1.00 9.37  ? 381 CYS C O   1 
ATOM   2869 C CB  . CYS B 1 81  ? 18.920 41.010 29.136 1.00 9.59  ? 381 CYS C CB  1 
ATOM   2870 S SG  . CYS B 1 81  ? 17.717 42.265 28.603 1.00 13.89 ? 381 CYS C SG  1 
ATOM   2871 N N   . MET B 1 82  ? 21.636 40.963 26.592 1.00 5.70  ? 382 MET C N   1 
ATOM   2872 C CA  . MET B 1 82  ? 22.673 41.840 26.072 1.00 8.16  ? 382 MET C CA  1 
ATOM   2873 C C   . MET B 1 82  ? 22.312 42.275 24.650 1.00 7.87  ? 382 MET C C   1 
ATOM   2874 O O   . MET B 1 82  ? 21.854 41.472 23.830 1.00 5.49  ? 382 MET C O   1 
ATOM   2875 C CB  . MET B 1 82  ? 24.032 41.131 26.088 1.00 7.30  ? 382 MET C CB  1 
ATOM   2876 C CG  . MET B 1 82  ? 25.149 41.955 25.483 1.00 7.65  ? 382 MET C CG  1 
ATOM   2877 S SD  . MET B 1 82  ? 26.734 41.115 25.528 1.00 9.75  ? 382 MET C SD  1 
ATOM   2878 C CE  . MET B 1 82  ? 26.464 39.757 24.404 1.00 8.32  ? 382 MET C CE  1 
ATOM   2879 N N   . GLU B 1 83  ? 22.519 43.555 24.365 1.00 9.36  ? 383 GLU C N   1 
ATOM   2880 C CA  . GLU B 1 83  ? 22.202 44.101 23.043 1.00 10.07 ? 383 GLU C CA  1 
ATOM   2881 C C   . GLU B 1 83  ? 23.429 44.474 22.212 1.00 10.12 ? 383 GLU C C   1 
ATOM   2882 O O   . GLU B 1 83  ? 24.522 44.682 22.744 1.00 12.93 ? 383 GLU C O   1 
ATOM   2883 C CB  . GLU B 1 83  ? 21.357 45.375 23.176 1.00 12.14 ? 383 GLU C CB  1 
ATOM   2884 C CG  . GLU B 1 83  ? 20.103 45.263 24.007 1.00 15.67 ? 383 GLU C CG  1 
ATOM   2885 C CD  . GLU B 1 83  ? 19.403 46.604 24.148 1.00 19.89 ? 383 GLU C CD  1 
ATOM   2886 O OE1 . GLU B 1 83  ? 18.668 47.002 23.219 1.00 19.55 ? 383 GLU C OE1 1 
ATOM   2887 O OE2 . GLU B 1 83  ? 19.609 47.271 25.182 1.00 22.71 ? 383 GLU C OE2 1 
ATOM   2888 N N   . HIS B 1 84  ? 23.220 44.556 20.899 1.00 9.45  ? 384 HIS C N   1 
ATOM   2889 C CA  . HIS B 1 84  ? 24.234 44.988 19.938 1.00 10.45 ? 384 HIS C CA  1 
ATOM   2890 C C   . HIS B 1 84  ? 25.498 44.171 19.691 1.00 11.10 ? 384 HIS C C   1 
ATOM   2891 O O   . HIS B 1 84  ? 26.403 44.647 18.985 1.00 10.64 ? 384 HIS C O   1 
ATOM   2892 C CB  . HIS B 1 84  ? 24.638 46.426 20.284 1.00 10.10 ? 384 HIS C CB  1 
ATOM   2893 C CG  . HIS B 1 84  ? 23.472 47.345 20.454 1.00 12.73 ? 384 HIS C CG  1 
ATOM   2894 N ND1 . HIS B 1 84  ? 23.321 48.163 21.554 1.00 16.65 ? 384 HIS C ND1 1 
ATOM   2895 C CD2 . HIS B 1 84  ? 22.383 47.553 19.676 1.00 11.09 ? 384 HIS C CD2 1 
ATOM   2896 C CE1 . HIS B 1 84  ? 22.185 48.831 21.448 1.00 12.31 ? 384 HIS C CE1 1 
ATOM   2897 N NE2 . HIS B 1 84  ? 21.597 48.478 20.319 1.00 16.27 ? 384 HIS C NE2 1 
ATOM   2898 N N   . ILE B 1 85  ? 25.576 42.971 20.265 1.00 8.37  ? 385 ILE C N   1 
ATOM   2899 C CA  . ILE B 1 85  ? 26.733 42.113 20.077 1.00 8.19  ? 385 ILE C CA  1 
ATOM   2900 C C   . ILE B 1 85  ? 26.230 40.834 19.439 1.00 9.58  ? 385 ILE C C   1 
ATOM   2901 O O   . ILE B 1 85  ? 25.432 40.091 20.029 1.00 7.41  ? 385 ILE C O   1 
ATOM   2902 C CB  . ILE B 1 85  ? 27.434 41.784 21.409 1.00 8.34  ? 385 ILE C CB  1 
ATOM   2903 C CG1 . ILE B 1 85  ? 27.833 43.077 22.131 1.00 10.32 ? 385 ILE C CG1 1 
ATOM   2904 C CG2 . ILE B 1 85  ? 28.657 40.924 21.134 1.00 8.38  ? 385 ILE C CG2 1 
ATOM   2905 C CD1 . ILE B 1 85  ? 28.822 43.964 21.340 1.00 10.89 ? 385 ILE C CD1 1 
ATOM   2906 N N   . LYS B 1 86  ? 26.711 40.571 18.232 1.00 7.83  ? 386 LYS C N   1 
ATOM   2907 C CA  . LYS B 1 86  ? 26.262 39.412 17.478 1.00 10.03 ? 386 LYS C CA  1 
ATOM   2908 C C   . LYS B 1 86  ? 26.578 38.041 18.058 1.00 8.50  ? 386 LYS C C   1 
ATOM   2909 O O   . LYS B 1 86  ? 25.812 37.097 17.852 1.00 8.07  ? 386 LYS C O   1 
ATOM   2910 C CB  . LYS B 1 86  ? 26.803 39.482 16.044 1.00 7.67  ? 386 LYS C CB  1 
ATOM   2911 C CG  . LYS B 1 86  ? 26.248 38.396 15.128 1.00 13.85 ? 386 LYS C CG  1 
ATOM   2912 C CD  . LYS B 1 86  ? 26.329 38.787 13.650 1.00 18.92 ? 386 LYS C CD  1 
ATOM   2913 C CE  . LYS B 1 86  ? 27.758 39.005 13.189 1.00 23.82 ? 386 LYS C CE  1 
ATOM   2914 N NZ  . LYS B 1 86  ? 27.831 39.380 11.740 1.00 26.62 ? 386 LYS C NZ  1 
ATOM   2915 N N   . ASN B 1 87  ? 27.696 37.931 18.768 1.00 7.71  ? 387 ASN C N   1 
ATOM   2916 C CA  . ASN B 1 87  ? 28.120 36.648 19.308 1.00 8.53  ? 387 ASN C CA  1 
ATOM   2917 C C   . ASN B 1 87  ? 28.176 36.589 20.830 1.00 7.37  ? 387 ASN C C   1 
ATOM   2918 O O   . ASN B 1 87  ? 29.251 36.652 21.435 1.00 7.03  ? 387 ASN C O   1 
ATOM   2919 C CB  . ASN B 1 87  ? 29.483 36.276 18.693 1.00 7.43  ? 387 ASN C CB  1 
ATOM   2920 C CG  . ASN B 1 87  ? 29.427 36.195 17.168 1.00 10.66 ? 387 ASN C CG  1 
ATOM   2921 O OD1 . ASN B 1 87  ? 28.808 35.282 16.602 1.00 12.08 ? 387 ASN C OD1 1 
ATOM   2922 N ND2 . ASN B 1 87  ? 30.054 37.164 16.496 1.00 3.90  ? 387 ASN C ND2 1 
ATOM   2923 N N   . PRO B 1 88  ? 27.002 36.485 21.472 1.00 8.00  ? 388 PRO C N   1 
ATOM   2924 C CA  . PRO B 1 88  ? 26.978 36.416 22.937 1.00 7.03  ? 388 PRO C CA  1 
ATOM   2925 C C   . PRO B 1 88  ? 27.697 35.184 23.500 1.00 7.66  ? 388 PRO C C   1 
ATOM   2926 O O   . PRO B 1 88  ? 28.216 35.249 24.608 1.00 6.31  ? 388 PRO C O   1 
ATOM   2927 C CB  . PRO B 1 88  ? 25.479 36.433 23.271 1.00 5.41  ? 388 PRO C CB  1 
ATOM   2928 C CG  . PRO B 1 88  ? 24.819 35.861 22.012 1.00 5.70  ? 388 PRO C CG  1 
ATOM   2929 C CD  . PRO B 1 88  ? 25.636 36.550 20.919 1.00 6.37  ? 388 PRO C CD  1 
ATOM   2930 N N   . ILE B 1 89  ? 27.759 34.080 22.743 1.00 6.84  ? 389 ILE C N   1 
ATOM   2931 C CA  . ILE B 1 89  ? 28.450 32.904 23.275 1.00 8.43  ? 389 ILE C CA  1 
ATOM   2932 C C   . ILE B 1 89  ? 29.924 33.248 23.520 1.00 6.40  ? 389 ILE C C   1 
ATOM   2933 O O   . ILE B 1 89  ? 30.547 32.748 24.461 1.00 6.84  ? 389 ILE C O   1 
ATOM   2934 C CB  . ILE B 1 89  ? 28.339 31.651 22.337 1.00 5.40  ? 389 ILE C CB  1 
ATOM   2935 C CG1 . ILE B 1 89  ? 28.812 30.410 23.103 1.00 7.54  ? 389 ILE C CG1 1 
ATOM   2936 C CG2 . ILE B 1 89  ? 29.183 31.819 21.060 1.00 3.22  ? 389 ILE C CG2 1 
ATOM   2937 C CD1 . ILE B 1 89  ? 28.002 30.134 24.407 1.00 4.63  ? 389 ILE C CD1 1 
ATOM   2938 N N   . SER B 1 90  ? 30.477 34.127 22.688 1.00 7.21  ? 390 SER C N   1 
ATOM   2939 C CA  . SER B 1 90  ? 31.882 34.499 22.843 1.00 5.44  ? 390 SER C CA  1 
ATOM   2940 C C   . SER B 1 90  ? 32.100 35.506 23.959 1.00 4.25  ? 390 SER C C   1 
ATOM   2941 O O   . SER B 1 90  ? 33.173 35.534 24.568 1.00 6.27  ? 390 SER C O   1 
ATOM   2942 C CB  . SER B 1 90  ? 32.431 35.036 21.516 1.00 5.05  ? 390 SER C CB  1 
ATOM   2943 O OG  . SER B 1 90  ? 32.380 34.009 20.540 1.00 7.65  ? 390 SER C OG  1 
ATOM   2944 N N   . VAL B 1 91  ? 31.103 36.353 24.215 1.00 4.84  ? 391 VAL C N   1 
ATOM   2945 C CA  . VAL B 1 91  ? 31.226 37.315 25.302 1.00 5.06  ? 391 VAL C CA  1 
ATOM   2946 C C   . VAL B 1 91  ? 31.117 36.476 26.565 1.00 4.42  ? 391 VAL C C   1 
ATOM   2947 O O   . VAL B 1 91  ? 31.792 36.731 27.556 1.00 6.43  ? 391 VAL C O   1 
ATOM   2948 C CB  . VAL B 1 91  ? 30.089 38.365 25.310 1.00 4.13  ? 391 VAL C CB  1 
ATOM   2949 C CG1 . VAL B 1 91  ? 30.355 39.401 26.419 1.00 4.34  ? 391 VAL C CG1 1 
ATOM   2950 C CG2 . VAL B 1 91  ? 30.001 39.049 23.950 1.00 6.05  ? 391 VAL C CG2 1 
ATOM   2951 N N   . ALA B 1 92  ? 30.249 35.468 26.528 1.00 5.40  ? 392 ALA C N   1 
ATOM   2952 C CA  . ALA B 1 92  ? 30.102 34.581 27.687 1.00 7.58  ? 392 ALA C CA  1 
ATOM   2953 C C   . ALA B 1 92  ? 31.444 33.918 27.999 1.00 3.82  ? 392 ALA C C   1 
ATOM   2954 O O   . ALA B 1 92  ? 31.833 33.808 29.160 1.00 6.63  ? 392 ALA C O   1 
ATOM   2955 C CB  . ALA B 1 92  ? 29.029 33.505 27.410 1.00 4.25  ? 392 ALA C CB  1 
ATOM   2956 N N   . ARG B 1 93  ? 32.153 33.464 26.967 1.00 5.50  ? 393 ARG C N   1 
ATOM   2957 C CA  . ARG B 1 93  ? 33.452 32.831 27.183 1.00 6.29  ? 393 ARG C CA  1 
ATOM   2958 C C   . ARG B 1 93  ? 34.433 33.847 27.785 1.00 6.91  ? 393 ARG C C   1 
ATOM   2959 O O   . ARG B 1 93  ? 35.304 33.493 28.588 1.00 6.39  ? 393 ARG C O   1 
ATOM   2960 C CB  . ARG B 1 93  ? 34.007 32.270 25.866 1.00 5.92  ? 393 ARG C CB  1 
ATOM   2961 C CG  . ARG B 1 93  ? 35.415 31.700 25.992 1.00 6.84  ? 393 ARG C CG  1 
ATOM   2962 C CD  . ARG B 1 93  ? 35.797 30.861 24.769 1.00 7.08  ? 393 ARG C CD  1 
ATOM   2963 N NE  . ARG B 1 93  ? 37.084 30.211 24.971 1.00 6.70  ? 393 ARG C NE  1 
ATOM   2964 C CZ  . ARG B 1 93  ? 37.636 29.348 24.129 1.00 10.56 ? 393 ARG C CZ  1 
ATOM   2965 N NH1 . ARG B 1 93  ? 37.014 29.014 23.003 1.00 8.10  ? 393 ARG C NH1 1 
ATOM   2966 N NH2 . ARG B 1 93  ? 38.813 28.809 24.423 1.00 11.16 ? 393 ARG C NH2 1 
ATOM   2967 N N   . ALA B 1 94  ? 34.275 35.115 27.412 1.00 5.78  ? 394 ALA C N   1 
ATOM   2968 C CA  . ALA B 1 94  ? 35.135 36.167 27.931 1.00 6.87  ? 394 ALA C CA  1 
ATOM   2969 C C   . ALA B 1 94  ? 34.802 36.434 29.397 1.00 5.90  ? 394 ALA C C   1 
ATOM   2970 O O   . ALA B 1 94  ? 35.686 36.721 30.201 1.00 4.07  ? 394 ALA C O   1 
ATOM   2971 C CB  . ALA B 1 94  ? 34.977 37.435 27.091 1.00 4.67  ? 394 ALA C CB  1 
ATOM   2972 N N   . VAL B 1 95  ? 33.526 36.328 29.757 1.00 4.63  ? 395 VAL C N   1 
ATOM   2973 C CA  . VAL B 1 95  ? 33.148 36.530 31.144 1.00 5.96  ? 395 VAL C CA  1 
ATOM   2974 C C   . VAL B 1 95  ? 33.846 35.430 31.955 1.00 5.52  ? 395 VAL C C   1 
ATOM   2975 O O   . VAL B 1 95  ? 34.440 35.684 32.999 1.00 6.78  ? 395 VAL C O   1 
ATOM   2976 C CB  . VAL B 1 95  ? 31.602 36.442 31.322 1.00 6.72  ? 395 VAL C CB  1 
ATOM   2977 C CG1 . VAL B 1 95  ? 31.239 36.360 32.802 1.00 5.70  ? 395 VAL C CG1 1 
ATOM   2978 C CG2 . VAL B 1 95  ? 30.942 37.671 30.697 1.00 6.62  ? 395 VAL C CG2 1 
ATOM   2979 N N   . MET B 1 96  ? 33.784 34.209 31.443 1.00 5.42  ? 396 MET C N   1 
ATOM   2980 C CA  . MET B 1 96  ? 34.400 33.059 32.090 1.00 3.63  ? 396 MET C CA  1 
ATOM   2981 C C   . MET B 1 96  ? 35.917 33.177 32.256 1.00 7.14  ? 396 MET C C   1 
ATOM   2982 O O   . MET B 1 96  ? 36.448 32.966 33.349 1.00 6.61  ? 396 MET C O   1 
ATOM   2983 C CB  . MET B 1 96  ? 34.107 31.800 31.275 1.00 5.18  ? 396 MET C CB  1 
ATOM   2984 C CG  . MET B 1 96  ? 34.747 30.519 31.826 1.00 6.18  ? 396 MET C CG  1 
ATOM   2985 S SD  . MET B 1 96  ? 34.241 29.072 30.858 1.00 9.92  ? 396 MET C SD  1 
ATOM   2986 C CE  . MET B 1 96  ? 35.187 29.318 29.318 1.00 6.11  ? 396 MET C CE  1 
ATOM   2987 N N   . GLU B 1 97  ? 36.605 33.502 31.163 1.00 6.14  ? 397 GLU C N   1 
ATOM   2988 C CA  . GLU B 1 97  ? 38.065 33.575 31.161 1.00 10.12 ? 397 GLU C CA  1 
ATOM   2989 C C   . GLU B 1 97  ? 38.717 34.864 31.670 1.00 12.58 ? 397 GLU C C   1 
ATOM   2990 O O   . GLU B 1 97  ? 39.827 34.827 32.212 1.00 11.09 ? 397 GLU C O   1 
ATOM   2991 C CB  . GLU B 1 97  ? 38.581 33.288 29.739 1.00 12.15 ? 397 GLU C CB  1 
ATOM   2992 C CG  . GLU B 1 97  ? 38.096 31.965 29.144 1.00 10.09 ? 397 GLU C CG  1 
ATOM   2993 C CD  . GLU B 1 97  ? 38.559 31.751 27.702 1.00 12.52 ? 397 GLU C CD  1 
ATOM   2994 O OE1 . GLU B 1 97  ? 38.886 32.747 27.033 1.00 11.81 ? 397 GLU C OE1 1 
ATOM   2995 O OE2 . GLU B 1 97  ? 38.575 30.592 27.231 1.00 13.63 ? 397 GLU C OE2 1 
ATOM   2996 N N   . LYS B 1 98  ? 38.022 35.988 31.543 1.00 10.00 ? 398 LYS C N   1 
ATOM   2997 C CA  . LYS B 1 98  ? 38.619 37.277 31.903 1.00 11.12 ? 398 LYS C CA  1 
ATOM   2998 C C   . LYS B 1 98  ? 38.110 38.043 33.121 1.00 10.85 ? 398 LYS C C   1 
ATOM   2999 O O   . LYS B 1 98  ? 38.640 39.108 33.443 1.00 12.87 ? 398 LYS C O   1 
ATOM   3000 C CB  . LYS B 1 98  ? 38.546 38.202 30.684 1.00 11.96 ? 398 LYS C CB  1 
ATOM   3001 C CG  . LYS B 1 98  ? 39.077 37.609 29.384 1.00 16.72 ? 398 LYS C CG  1 
ATOM   3002 C CD  . LYS B 1 98  ? 40.557 37.274 29.472 1.00 22.19 ? 398 LYS C CD  1 
ATOM   3003 C CE  . LYS B 1 98  ? 41.217 37.252 28.094 1.00 26.60 ? 398 LYS C CE  1 
ATOM   3004 N NZ  . LYS B 1 98  ? 40.539 36.348 27.126 1.00 30.22 ? 398 LYS C NZ  1 
ATOM   3005 N N   . THR B 1 99  ? 37.102 37.523 33.808 1.00 8.92  ? 399 THR C N   1 
ATOM   3006 C CA  . THR B 1 99  ? 36.560 38.215 34.966 1.00 8.55  ? 399 THR C CA  1 
ATOM   3007 C C   . THR B 1 99  ? 36.416 37.283 36.158 1.00 10.70 ? 399 THR C C   1 
ATOM   3008 O O   . THR B 1 99  ? 36.507 36.065 36.021 1.00 13.39 ? 399 THR C O   1 
ATOM   3009 C CB  . THR B 1 99  ? 35.145 38.792 34.688 1.00 8.26  ? 399 THR C CB  1 
ATOM   3010 O OG1 . THR B 1 99  ? 34.161 37.757 34.857 1.00 8.78  ? 399 THR C OG1 1 
ATOM   3011 C CG2 . THR B 1 99  ? 35.043 39.326 33.275 1.00 6.39  ? 399 THR C CG2 1 
ATOM   3012 N N   . PRO B 1 100 ? 36.183 37.858 37.348 1.00 14.35 ? 400 PRO C N   1 
ATOM   3013 C CA  . PRO B 1 100 ? 35.999 37.147 38.619 1.00 15.80 ? 400 PRO C CA  1 
ATOM   3014 C C   . PRO B 1 100 ? 34.527 36.738 38.772 1.00 13.55 ? 400 PRO C C   1 
ATOM   3015 O O   . PRO B 1 100 ? 34.131 36.190 39.795 1.00 15.00 ? 400 PRO C O   1 
ATOM   3016 C CB  . PRO B 1 100 ? 36.376 38.193 39.672 1.00 16.37 ? 400 PRO C CB  1 
ATOM   3017 C CG  . PRO B 1 100 ? 37.085 39.276 38.908 1.00 20.65 ? 400 PRO C CG  1 
ATOM   3018 C CD  . PRO B 1 100 ? 36.389 39.294 37.592 1.00 16.53 ? 400 PRO C CD  1 
ATOM   3019 N N   . HIS B 1 101 ? 33.719 37.034 37.763 1.00 7.27  ? 401 HIS C N   1 
ATOM   3020 C CA  . HIS B 1 101 ? 32.287 36.710 37.799 1.00 6.73  ? 401 HIS C CA  1 
ATOM   3021 C C   . HIS B 1 101 ? 31.934 35.625 36.790 1.00 7.87  ? 401 HIS C C   1 
ATOM   3022 O O   . HIS B 1 101 ? 32.769 35.251 35.963 1.00 5.97  ? 401 HIS C O   1 
ATOM   3023 C CB  . HIS B 1 101 ? 31.487 37.975 37.488 1.00 7.38  ? 401 HIS C CB  1 
ATOM   3024 C CG  . HIS B 1 101 ? 31.816 39.117 38.399 1.00 5.55  ? 401 HIS C CG  1 
ATOM   3025 N ND1 . HIS B 1 101 ? 31.929 40.420 37.962 1.00 9.92  ? 401 HIS C ND1 1 
ATOM   3026 C CD2 . HIS B 1 101 ? 32.073 39.141 39.726 1.00 5.29  ? 401 HIS C CD2 1 
ATOM   3027 C CE1 . HIS B 1 101 ? 32.245 41.198 38.982 1.00 6.52  ? 401 HIS C CE1 1 
ATOM   3028 N NE2 . HIS B 1 101 ? 32.339 40.446 40.065 1.00 11.37 ? 401 HIS C NE2 1 
ATOM   3029 N N   . VAL B 1 102 ? 30.703 35.113 36.847 1.00 5.09  ? 402 VAL C N   1 
ATOM   3030 C CA  . VAL B 1 102 ? 30.308 34.093 35.881 1.00 4.79  ? 402 VAL C CA  1 
ATOM   3031 C C   . VAL B 1 102 ? 29.083 34.514 35.090 1.00 5.29  ? 402 VAL C C   1 
ATOM   3032 O O   . VAL B 1 102 ? 28.662 33.818 34.162 1.00 5.68  ? 402 VAL C O   1 
ATOM   3033 C CB  . VAL B 1 102 ? 30.025 32.722 36.550 1.00 6.43  ? 402 VAL C CB  1 
ATOM   3034 C CG1 . VAL B 1 102 ? 31.284 32.231 37.249 1.00 3.37  ? 402 VAL C CG1 1 
ATOM   3035 C CG2 . VAL B 1 102 ? 28.821 32.817 37.506 1.00 6.07  ? 402 VAL C CG2 1 
ATOM   3036 N N   . MET B 1 103 ? 28.506 35.655 35.451 1.00 2.65  ? 403 MET C N   1 
ATOM   3037 C CA  . MET B 1 103 ? 27.327 36.140 34.743 1.00 5.61  ? 403 MET C CA  1 
ATOM   3038 C C   . MET B 1 103 ? 27.198 37.659 34.775 1.00 5.73  ? 403 MET C C   1 
ATOM   3039 O O   . MET B 1 103 ? 27.258 38.277 35.845 1.00 6.06  ? 403 MET C O   1 
ATOM   3040 C CB  . MET B 1 103 ? 26.056 35.524 35.347 1.00 8.99  ? 403 MET C CB  1 
ATOM   3041 C CG  . MET B 1 103 ? 24.772 35.911 34.626 1.00 8.14  ? 403 MET C CG  1 
ATOM   3042 S SD  . MET B 1 103 ? 23.353 34.951 35.254 1.00 11.99 ? 403 MET C SD  1 
ATOM   3043 C CE  . MET B 1 103 ? 22.190 35.157 33.945 1.00 9.47  ? 403 MET C CE  1 
ATOM   3044 N N   . LEU B 1 104 ? 27.004 38.242 33.592 1.00 6.80  ? 404 LEU C N   1 
ATOM   3045 C CA  . LEU B 1 104 ? 26.821 39.682 33.422 1.00 7.19  ? 404 LEU C CA  1 
ATOM   3046 C C   . LEU B 1 104 ? 25.538 39.869 32.622 1.00 7.14  ? 404 LEU C C   1 
ATOM   3047 O O   . LEU B 1 104 ? 25.294 39.142 31.665 1.00 6.91  ? 404 LEU C O   1 
ATOM   3048 C CB  . LEU B 1 104 ? 27.981 40.297 32.626 1.00 7.28  ? 404 LEU C CB  1 
ATOM   3049 C CG  . LEU B 1 104 ? 29.365 40.240 33.272 1.00 7.34  ? 404 LEU C CG  1 
ATOM   3050 C CD1 . LEU B 1 104 ? 30.337 40.992 32.382 1.00 8.89  ? 404 LEU C CD1 1 
ATOM   3051 C CD2 . LEU B 1 104 ? 29.324 40.865 34.689 1.00 5.81  ? 404 LEU C CD2 1 
ATOM   3052 N N   . VAL B 1 105 ? 24.720 40.842 32.998 1.00 6.12  ? 405 VAL C N   1 
ATOM   3053 C CA  . VAL B 1 105 ? 23.479 41.060 32.263 1.00 7.03  ? 405 VAL C CA  1 
ATOM   3054 C C   . VAL B 1 105 ? 23.304 42.527 31.898 1.00 11.05 ? 405 VAL C C   1 
ATOM   3055 O O   . VAL B 1 105 ? 23.924 43.406 32.504 1.00 11.89 ? 405 VAL C O   1 
ATOM   3056 C CB  . VAL B 1 105 ? 22.247 40.632 33.096 1.00 9.16  ? 405 VAL C CB  1 
ATOM   3057 C CG1 . VAL B 1 105 ? 22.444 39.222 33.620 1.00 7.54  ? 405 VAL C CG1 1 
ATOM   3058 C CG2 . VAL B 1 105 ? 22.032 41.607 34.258 1.00 8.00  ? 405 VAL C CG2 1 
ATOM   3059 N N   . GLY B 1 106 ? 22.466 42.773 30.892 1.00 8.30  ? 406 GLY C N   1 
ATOM   3060 C CA  . GLY B 1 106 ? 22.143 44.130 30.471 1.00 8.76  ? 406 GLY C CA  1 
ATOM   3061 C C   . GLY B 1 106 ? 23.268 45.025 29.998 1.00 11.21 ? 406 GLY C C   1 
ATOM   3062 O O   . GLY B 1 106 ? 24.212 44.567 29.353 1.00 10.85 ? 406 GLY C O   1 
ATOM   3063 N N   . ASP B 1 107 ? 23.149 46.317 30.306 1.00 12.17 ? 407 ASP C N   1 
ATOM   3064 C CA  . ASP B 1 107 ? 24.159 47.304 29.921 1.00 13.09 ? 407 ASP C CA  1 
ATOM   3065 C C   . ASP B 1 107 ? 25.568 46.854 30.286 1.00 11.80 ? 407 ASP C C   1 
ATOM   3066 O O   . ASP B 1 107 ? 26.495 46.978 29.486 1.00 11.23 ? 407 ASP C O   1 
ATOM   3067 C CB  . ASP B 1 107 ? 23.889 48.648 30.607 1.00 14.87 ? 407 ASP C CB  1 
ATOM   3068 C CG  . ASP B 1 107 ? 22.615 49.320 30.122 1.00 19.81 ? 407 ASP C CG  1 
ATOM   3069 O OD1 . ASP B 1 107 ? 22.216 50.324 30.749 1.00 18.58 ? 407 ASP C OD1 1 
ATOM   3070 O OD2 . ASP B 1 107 ? 22.015 48.857 29.130 1.00 17.48 ? 407 ASP C OD2 1 
ATOM   3071 N N   . GLY B 1 108 ? 25.727 46.348 31.505 1.00 8.29  ? 408 GLY C N   1 
ATOM   3072 C CA  . GLY B 1 108 ? 27.034 45.899 31.957 1.00 9.89  ? 408 GLY C CA  1 
ATOM   3073 C C   . GLY B 1 108 ? 27.649 44.833 31.063 1.00 8.49  ? 408 GLY C C   1 
ATOM   3074 O O   . GLY B 1 108 ? 28.866 44.812 30.858 1.00 7.72  ? 408 GLY C O   1 
ATOM   3075 N N   . ALA B 1 109 ? 26.821 43.940 30.537 1.00 8.65  ? 409 ALA C N   1 
ATOM   3076 C CA  . ALA B 1 109 ? 27.318 42.895 29.649 1.00 9.33  ? 409 ALA C CA  1 
ATOM   3077 C C   . ALA B 1 109 ? 27.876 43.528 28.371 1.00 10.23 ? 409 ALA C C   1 
ATOM   3078 O O   . ALA B 1 109 ? 28.947 43.146 27.890 1.00 12.56 ? 409 ALA C O   1 
ATOM   3079 C CB  . ALA B 1 109 ? 26.206 41.920 29.312 1.00 9.83  ? 409 ALA C CB  1 
ATOM   3080 N N   . LEU B 1 110 ? 27.155 44.502 27.827 1.00 10.31 ? 410 LEU C N   1 
ATOM   3081 C CA  . LEU B 1 110 ? 27.597 45.184 26.600 1.00 9.09  ? 410 LEU C CA  1 
ATOM   3082 C C   . LEU B 1 110 ? 28.888 45.967 26.855 1.00 10.78 ? 410 LEU C C   1 
ATOM   3083 O O   . LEU B 1 110 ? 29.830 45.923 26.056 1.00 11.25 ? 410 LEU C O   1 
ATOM   3084 C CB  . LEU B 1 110 ? 26.503 46.134 26.104 1.00 8.68  ? 410 LEU C CB  1 
ATOM   3085 C CG  . LEU B 1 110 ? 26.891 47.070 24.953 1.00 9.62  ? 410 LEU C CG  1 
ATOM   3086 C CD1 . LEU B 1 110 ? 27.340 46.265 23.752 1.00 11.51 ? 410 LEU C CD1 1 
ATOM   3087 C CD2 . LEU B 1 110 ? 25.693 47.939 24.597 1.00 12.67 ? 410 LEU C CD2 1 
ATOM   3088 N N   . GLU B 1 111 ? 28.934 46.680 27.975 1.00 9.52  ? 411 GLU C N   1 
ATOM   3089 C CA  . GLU B 1 111 ? 30.115 47.460 28.323 1.00 11.40 ? 411 GLU C CA  1 
ATOM   3090 C C   . GLU B 1 111 ? 31.342 46.556 28.382 1.00 10.71 ? 411 GLU C C   1 
ATOM   3091 O O   . GLU B 1 111 ? 32.413 46.903 27.855 1.00 10.06 ? 411 GLU C O   1 
ATOM   3092 C CB  . GLU B 1 111 ? 29.901 48.158 29.665 1.00 11.62 ? 411 GLU C CB  1 
ATOM   3093 C CG  . GLU B 1 111 ? 28.885 49.296 29.616 1.00 18.58 ? 411 GLU C CG  1 
ATOM   3094 C CD  . GLU B 1 111 ? 28.278 49.607 30.983 1.00 24.68 ? 411 GLU C CD  1 
ATOM   3095 O OE1 . GLU B 1 111 ? 28.852 49.187 32.015 1.00 24.21 ? 411 GLU C OE1 1 
ATOM   3096 O OE2 . GLU B 1 111 ? 27.222 50.279 31.025 1.00 26.88 ? 411 GLU C OE2 1 
ATOM   3097 N N   . PHE B 1 112 ? 31.194 45.398 29.020 1.00 7.90  ? 412 PHE C N   1 
ATOM   3098 C CA  . PHE B 1 112 ? 32.290 44.439 29.109 1.00 6.07  ? 412 PHE C CA  1 
ATOM   3099 C C   . PHE B 1 112 ? 32.677 43.960 27.711 1.00 8.77  ? 412 PHE C C   1 
ATOM   3100 O O   . PHE B 1 112 ? 33.857 43.957 27.362 1.00 9.21  ? 412 PHE C O   1 
ATOM   3101 C CB  . PHE B 1 112 ? 31.886 43.241 29.983 1.00 6.73  ? 412 PHE C CB  1 
ATOM   3102 C CG  . PHE B 1 112 ? 32.874 42.101 29.948 1.00 5.63  ? 412 PHE C CG  1 
ATOM   3103 C CD1 . PHE B 1 112 ? 34.160 42.261 30.443 1.00 5.92  ? 412 PHE C CD1 1 
ATOM   3104 C CD2 . PHE B 1 112 ? 32.514 40.872 29.396 1.00 7.41  ? 412 PHE C CD2 1 
ATOM   3105 C CE1 . PHE B 1 112 ? 35.083 41.217 30.392 1.00 8.14  ? 412 PHE C CE1 1 
ATOM   3106 C CE2 . PHE B 1 112 ? 33.419 39.822 29.339 1.00 3.60  ? 412 PHE C CE2 1 
ATOM   3107 C CZ  . PHE B 1 112 ? 34.713 39.992 29.837 1.00 6.69  ? 412 PHE C CZ  1 
ATOM   3108 N N   . ALA B 1 113 ? 31.687 43.568 26.910 1.00 8.92  ? 413 ALA C N   1 
ATOM   3109 C CA  . ALA B 1 113 ? 31.950 43.093 25.558 1.00 8.40  ? 413 ALA C CA  1 
ATOM   3110 C C   . ALA B 1 113 ? 32.792 44.107 24.788 1.00 12.32 ? 413 ALA C C   1 
ATOM   3111 O O   . ALA B 1 113 ? 33.775 43.744 24.129 1.00 10.11 ? 413 ALA C O   1 
ATOM   3112 C CB  . ALA B 1 113 ? 30.634 42.840 24.810 1.00 7.39  ? 413 ALA C CB  1 
ATOM   3113 N N   . LEU B 1 114 ? 32.401 45.378 24.875 1.00 12.45 ? 414 LEU C N   1 
ATOM   3114 C CA  . LEU B 1 114 ? 33.117 46.440 24.175 1.00 11.80 ? 414 LEU C CA  1 
ATOM   3115 C C   . LEU B 1 114 ? 34.549 46.566 24.677 1.00 13.56 ? 414 LEU C C   1 
ATOM   3116 O O   . LEU B 1 114 ? 35.469 46.820 23.889 1.00 14.19 ? 414 LEU C O   1 
ATOM   3117 C CB  . LEU B 1 114 ? 32.365 47.770 24.334 1.00 14.74 ? 414 LEU C CB  1 
ATOM   3118 C CG  . LEU B 1 114 ? 30.957 47.767 23.724 1.00 10.48 ? 414 LEU C CG  1 
ATOM   3119 C CD1 . LEU B 1 114 ? 30.248 49.075 23.998 1.00 13.19 ? 414 LEU C CD1 1 
ATOM   3120 C CD2 . LEU B 1 114 ? 31.058 47.525 22.223 1.00 16.68 ? 414 LEU C CD2 1 
ATOM   3121 N N   . SER B 1 115 ? 34.746 46.369 25.979 1.00 11.46 ? 415 SER C N   1 
ATOM   3122 C CA  . SER B 1 115 ? 36.076 46.460 26.561 1.00 12.52 ? 415 SER C CA  1 
ATOM   3123 C C   . SER B 1 115 ? 36.964 45.324 26.064 1.00 13.86 ? 415 SER C C   1 
ATOM   3124 O O   . SER B 1 115 ? 38.199 45.423 26.092 1.00 13.54 ? 415 SER C O   1 
ATOM   3125 C CB  . SER B 1 115 ? 36.004 46.415 28.097 1.00 13.63 ? 415 SER C CB  1 
ATOM   3126 O OG  . SER B 1 115 ? 35.832 45.089 28.587 1.00 12.68 ? 415 SER C OG  1 
ATOM   3127 N N   . GLN B 1 116 ? 36.336 44.240 25.619 1.00 11.75 ? 416 GLN C N   1 
ATOM   3128 C CA  . GLN B 1 116 ? 37.074 43.087 25.129 1.00 11.89 ? 416 GLN C CA  1 
ATOM   3129 C C   . GLN B 1 116 ? 37.240 43.099 23.618 1.00 13.04 ? 416 GLN C C   1 
ATOM   3130 O O   . GLN B 1 116 ? 37.659 42.104 23.034 1.00 13.48 ? 416 GLN C O   1 
ATOM   3131 C CB  . GLN B 1 116 ? 36.372 41.791 25.552 1.00 14.89 ? 416 GLN C CB  1 
ATOM   3132 C CG  . GLN B 1 116 ? 36.325 41.613 27.055 1.00 19.52 ? 416 GLN C CG  1 
ATOM   3133 C CD  . GLN B 1 116 ? 37.708 41.544 27.655 1.00 19.19 ? 416 GLN C CD  1 
ATOM   3134 O OE1 . GLN B 1 116 ? 38.466 40.627 27.379 1.00 20.56 ? 416 GLN C OE1 1 
ATOM   3135 N NE2 . GLN B 1 116 ? 38.046 42.526 28.474 1.00 25.05 ? 416 GLN C NE2 1 
ATOM   3136 N N   . GLY B 1 117 ? 36.884 44.208 22.981 1.00 13.41 ? 417 GLY C N   1 
ATOM   3137 C CA  . GLY B 1 117 ? 37.049 44.298 21.538 1.00 14.17 ? 417 GLY C CA  1 
ATOM   3138 C C   . GLY B 1 117 ? 35.874 43.893 20.668 1.00 16.08 ? 417 GLY C C   1 
ATOM   3139 O O   . GLY B 1 117 ? 35.957 43.972 19.443 1.00 13.75 ? 417 GLY C O   1 
ATOM   3140 N N   . PHE B 1 118 ? 34.782 43.439 21.264 1.00 14.99 ? 418 PHE C N   1 
ATOM   3141 C CA  . PHE B 1 118 ? 33.638 43.064 20.437 1.00 15.15 ? 418 PHE C CA  1 
ATOM   3142 C C   . PHE B 1 118 ? 33.078 44.336 19.809 1.00 17.60 ? 418 PHE C C   1 
ATOM   3143 O O   . PHE B 1 118 ? 33.210 45.419 20.382 1.00 17.80 ? 418 PHE C O   1 
ATOM   3144 C CB  . PHE B 1 118 ? 32.566 42.367 21.271 1.00 13.87 ? 418 PHE C CB  1 
ATOM   3145 C CG  . PHE B 1 118 ? 32.964 40.997 21.738 1.00 15.03 ? 418 PHE C CG  1 
ATOM   3146 C CD1 . PHE B 1 118 ? 33.683 40.828 22.915 1.00 11.62 ? 418 PHE C CD1 1 
ATOM   3147 C CD2 . PHE B 1 118 ? 32.657 39.871 20.970 1.00 16.85 ? 418 PHE C CD2 1 
ATOM   3148 C CE1 . PHE B 1 118 ? 34.098 39.550 23.330 1.00 12.29 ? 418 PHE C CE1 1 
ATOM   3149 C CE2 . PHE B 1 118 ? 33.065 38.600 21.372 1.00 14.65 ? 418 PHE C CE2 1 
ATOM   3150 C CZ  . PHE B 1 118 ? 33.791 38.444 22.562 1.00 13.43 ? 418 PHE C CZ  1 
ATOM   3151 N N   . LYS B 1 119 ? 32.469 44.206 18.634 1.00 15.50 ? 419 LYS C N   1 
ATOM   3152 C CA  . LYS B 1 119 ? 31.916 45.360 17.942 1.00 19.19 ? 419 LYS C CA  1 
ATOM   3153 C C   . LYS B 1 119 ? 30.411 45.470 18.053 1.00 17.53 ? 419 LYS C C   1 
ATOM   3154 O O   . LYS B 1 119 ? 29.687 44.478 17.930 1.00 15.12 ? 419 LYS C O   1 
ATOM   3155 C CB  . LYS B 1 119 ? 32.289 45.328 16.458 1.00 24.47 ? 419 LYS C CB  1 
ATOM   3156 C CG  . LYS B 1 119 ? 33.776 45.381 16.184 1.00 32.37 ? 419 LYS C CG  1 
ATOM   3157 C CD  . LYS B 1 119 ? 34.416 46.596 16.825 1.00 35.42 ? 419 LYS C CD  1 
ATOM   3158 C CE  . LYS B 1 119 ? 35.888 46.677 16.469 1.00 38.58 ? 419 LYS C CE  1 
ATOM   3159 N NZ  . LYS B 1 119 ? 36.512 47.887 17.053 1.00 40.17 ? 419 LYS C NZ  1 
ATOM   3160 N N   . LYS B 1 120 ? 29.954 46.695 18.276 1.00 16.87 ? 420 LYS C N   1 
ATOM   3161 C CA  . LYS B 1 120 ? 28.537 46.996 18.371 1.00 20.09 ? 420 LYS C CA  1 
ATOM   3162 C C   . LYS B 1 120 ? 27.969 46.908 16.955 1.00 20.17 ? 420 LYS C C   1 
ATOM   3163 O O   . LYS B 1 120 ? 28.589 47.394 15.999 1.00 17.92 ? 420 LYS C O   1 
ATOM   3164 C CB  . LYS B 1 120 ? 28.350 48.404 18.954 1.00 22.15 ? 420 LYS C CB  1 
ATOM   3165 C CG  . LYS B 1 120 ? 26.911 48.869 19.035 1.00 29.52 ? 420 LYS C CG  1 
ATOM   3166 C CD  . LYS B 1 120 ? 26.777 50.183 19.799 1.00 32.36 ? 420 LYS C CD  1 
ATOM   3167 C CE  . LYS B 1 120 ? 25.391 50.783 19.570 1.00 34.25 ? 420 LYS C CE  1 
ATOM   3168 N NZ  . LYS B 1 120 ? 25.083 51.929 20.473 1.00 39.72 ? 420 LYS C NZ  1 
ATOM   3169 N N   . GLU B 1 121 ? 26.813 46.264 16.812 1.00 18.37 ? 421 GLU C N   1 
ATOM   3170 C CA  . GLU B 1 121 ? 26.174 46.115 15.505 1.00 18.92 ? 421 GLU C CA  1 
ATOM   3171 C C   . GLU B 1 121 ? 24.661 46.132 15.661 1.00 18.61 ? 421 GLU C C   1 
ATOM   3172 O O   . GLU B 1 121 ? 24.145 45.876 16.746 1.00 15.04 ? 421 GLU C O   1 
ATOM   3173 C CB  . GLU B 1 121 ? 26.584 44.793 14.855 1.00 22.41 ? 421 GLU C CB  1 
ATOM   3174 C CG  . GLU B 1 121 ? 28.056 44.472 14.969 1.00 27.02 ? 421 GLU C CG  1 
ATOM   3175 C CD  . GLU B 1 121 ? 28.458 43.307 14.097 1.00 30.26 ? 421 GLU C CD  1 
ATOM   3176 O OE1 . GLU B 1 121 ? 28.595 43.508 12.874 1.00 30.69 ? 421 GLU C OE1 1 
ATOM   3177 O OE2 . GLU B 1 121 ? 28.625 42.187 14.629 1.00 27.18 ? 421 GLU C OE2 1 
ATOM   3178 N N   . ASN B 1 122 ? 23.949 46.436 14.580 1.00 16.46 ? 422 ASN C N   1 
ATOM   3179 C CA  . ASN B 1 122 ? 22.490 46.462 14.621 1.00 16.67 ? 422 ASN C CA  1 
ATOM   3180 C C   . ASN B 1 122 ? 22.010 45.049 14.359 1.00 16.07 ? 422 ASN C C   1 
ATOM   3181 O O   . ASN B 1 122 ? 22.135 44.539 13.245 1.00 17.53 ? 422 ASN C O   1 
ATOM   3182 C CB  . ASN B 1 122 ? 21.938 47.420 13.559 1.00 18.55 ? 422 ASN C CB  1 
ATOM   3183 C CG  . ASN B 1 122 ? 20.419 47.439 13.521 1.00 20.20 ? 422 ASN C CG  1 
ATOM   3184 O OD1 . ASN B 1 122 ? 19.758 46.954 14.432 1.00 16.07 ? 422 ASN C OD1 1 
ATOM   3185 N ND2 . ASN B 1 122 ? 19.861 48.019 12.461 1.00 24.40 ? 422 ASN C ND2 1 
ATOM   3186 N N   . LEU B 1 123 ? 21.455 44.415 15.390 1.00 13.19 ? 423 LEU C N   1 
ATOM   3187 C CA  . LEU B 1 123 ? 20.996 43.039 15.276 1.00 12.10 ? 423 LEU C CA  1 
ATOM   3188 C C   . LEU B 1 123 ? 19.578 42.900 14.734 1.00 10.49 ? 423 LEU C C   1 
ATOM   3189 O O   . LEU B 1 123 ? 19.165 41.816 14.345 1.00 10.56 ? 423 LEU C O   1 
ATOM   3190 C CB  . LEU B 1 123 ? 21.103 42.349 16.644 1.00 12.60 ? 423 LEU C CB  1 
ATOM   3191 C CG  . LEU B 1 123 ? 22.499 42.406 17.276 1.00 14.17 ? 423 LEU C CG  1 
ATOM   3192 C CD1 . LEU B 1 123 ? 22.485 41.733 18.653 1.00 12.80 ? 423 LEU C CD1 1 
ATOM   3193 C CD2 . LEU B 1 123 ? 23.491 41.728 16.352 1.00 13.29 ? 423 LEU C CD2 1 
ATOM   3194 N N   . LEU B 1 124 ? 18.828 43.996 14.719 1.00 11.77 ? 424 LEU C N   1 
ATOM   3195 C CA  . LEU B 1 124 ? 17.467 43.960 14.212 1.00 12.01 ? 424 LEU C CA  1 
ATOM   3196 C C   . LEU B 1 124 ? 17.497 44.086 12.690 1.00 14.67 ? 424 LEU C C   1 
ATOM   3197 O O   . LEU B 1 124 ? 17.805 45.150 12.139 1.00 14.93 ? 424 LEU C O   1 
ATOM   3198 C CB  . LEU B 1 124 ? 16.650 45.104 14.816 1.00 11.30 ? 424 LEU C CB  1 
ATOM   3199 C CG  . LEU B 1 124 ? 15.164 45.173 14.465 1.00 10.21 ? 424 LEU C CG  1 
ATOM   3200 C CD1 . LEU B 1 124 ? 14.414 44.019 15.111 1.00 10.60 ? 424 LEU C CD1 1 
ATOM   3201 C CD2 . LEU B 1 124 ? 14.600 46.513 14.951 1.00 13.08 ? 424 LEU C CD2 1 
ATOM   3202 N N   . THR B 1 125 ? 17.184 42.990 12.012 1.00 14.96 ? 425 THR C N   1 
ATOM   3203 C CA  . THR B 1 125 ? 17.170 42.976 10.553 1.00 14.52 ? 425 THR C CA  1 
ATOM   3204 C C   . THR B 1 125 ? 15.884 43.647 10.074 1.00 13.89 ? 425 THR C C   1 
ATOM   3205 O O   . THR B 1 125 ? 14.959 43.866 10.858 1.00 11.31 ? 425 THR C O   1 
ATOM   3206 C CB  . THR B 1 125 ? 17.202 41.534 10.033 1.00 14.52 ? 425 THR C CB  1 
ATOM   3207 O OG1 . THR B 1 125 ? 16.078 40.822 10.571 1.00 14.54 ? 425 THR C OG1 1 
ATOM   3208 C CG2 . THR B 1 125 ? 18.501 40.836 10.473 1.00 10.81 ? 425 THR C CG2 1 
ATOM   3209 N N   . ALA B 1 126 ? 15.819 43.986 8.792  1.00 15.13 ? 426 ALA C N   1 
ATOM   3210 C CA  . ALA B 1 126 ? 14.615 44.616 8.264  1.00 15.68 ? 426 ALA C CA  1 
ATOM   3211 C C   . ALA B 1 126 ? 13.431 43.673 8.450  1.00 13.09 ? 426 ALA C C   1 
ATOM   3212 O O   . ALA B 1 126 ? 12.324 44.105 8.777  1.00 13.11 ? 426 ALA C O   1 
ATOM   3213 C CB  . ALA B 1 126 ? 14.805 44.950 6.782  1.00 17.58 ? 426 ALA C CB  1 
ATOM   3214 N N   . GLU B 1 127 ? 13.670 42.382 8.238  1.00 14.40 ? 427 GLU C N   1 
ATOM   3215 C CA  . GLU B 1 127 ? 12.620 41.378 8.380  1.00 15.39 ? 427 GLU C CA  1 
ATOM   3216 C C   . GLU B 1 127 ? 12.062 41.329 9.802  1.00 15.31 ? 427 GLU C C   1 
ATOM   3217 O O   . GLU B 1 127 ? 10.847 41.289 10.000 1.00 14.29 ? 427 GLU C O   1 
ATOM   3218 C CB  . GLU B 1 127 ? 13.151 39.998 7.980  1.00 19.71 ? 427 GLU C CB  1 
ATOM   3219 C CG  . GLU B 1 127 ? 12.210 38.846 8.299  1.00 20.40 ? 427 GLU C CG  1 
ATOM   3220 C CD  . GLU B 1 127 ? 12.765 37.503 7.862  1.00 24.00 ? 427 GLU C CD  1 
ATOM   3221 O OE1 . GLU B 1 127 ? 13.926 37.188 8.220  1.00 24.01 ? 427 GLU C OE1 1 
ATOM   3222 O OE2 . GLU B 1 127 ? 12.040 36.761 7.161  1.00 22.71 ? 427 GLU C OE2 1 
ATOM   3223 N N   . SER B 1 128 ? 12.947 41.315 10.793 1.00 15.01 ? 428 SER C N   1 
ATOM   3224 C CA  . SER B 1 128 ? 12.502 41.281 12.183 1.00 14.23 ? 428 SER C CA  1 
ATOM   3225 C C   . SER B 1 128 ? 11.775 42.564 12.567 1.00 13.47 ? 428 SER C C   1 
ATOM   3226 O O   . SER B 1 128 ? 10.818 42.528 13.334 1.00 13.68 ? 428 SER C O   1 
ATOM   3227 C CB  . SER B 1 128 ? 13.693 41.051 13.130 1.00 13.82 ? 428 SER C CB  1 
ATOM   3228 O OG  . SER B 1 128 ? 14.214 39.741 12.954 1.00 14.72 ? 428 SER C OG  1 
ATOM   3229 N N   . GLU B 1 129 ? 12.227 43.699 12.047 1.00 14.57 ? 429 GLU C N   1 
ATOM   3230 C CA  . GLU B 1 129 ? 11.565 44.959 12.375 1.00 16.32 ? 429 GLU C CA  1 
ATOM   3231 C C   . GLU B 1 129 ? 10.152 44.955 11.806 1.00 15.68 ? 429 GLU C C   1 
ATOM   3232 O O   . GLU B 1 129 ? 9.203  45.387 12.468 1.00 16.32 ? 429 GLU C O   1 
ATOM   3233 C CB  . GLU B 1 129 ? 12.340 46.154 11.813 1.00 16.79 ? 429 GLU C CB  1 
ATOM   3234 C CG  . GLU B 1 129 ? 11.715 47.496 12.188 1.00 20.84 ? 429 GLU C CG  1 
ATOM   3235 C CD  . GLU B 1 129 ? 12.457 48.675 11.590 1.00 26.73 ? 429 GLU C CD  1 
ATOM   3236 O OE1 . GLU B 1 129 ? 12.675 48.671 10.363 1.00 27.73 ? 429 GLU C OE1 1 
ATOM   3237 O OE2 . GLU B 1 129 ? 12.816 49.606 12.344 1.00 29.07 ? 429 GLU C OE2 1 
ATOM   3238 N N   . LYS B 1 130 ? 10.025 44.465 10.575 1.00 18.74 ? 430 LYS C N   1 
ATOM   3239 C CA  . LYS B 1 130 ? 8.729  44.382 9.898  1.00 19.08 ? 430 LYS C CA  1 
ATOM   3240 C C   . LYS B 1 130 ? 7.751  43.496 10.683 1.00 18.63 ? 430 LYS C C   1 
ATOM   3241 O O   . LYS B 1 130 ? 6.629  43.913 10.997 1.00 17.11 ? 430 LYS C O   1 
ATOM   3242 C CB  . LYS B 1 130 ? 8.917  43.823 8.483  1.00 18.99 ? 430 LYS C CB  1 
ATOM   3243 C CG  . LYS B 1 130 ? 7.639  43.793 7.649  1.00 22.70 ? 430 LYS C CG  1 
ATOM   3244 C CD  . LYS B 1 130 ? 7.880  43.164 6.287  0.00 23.25 ? 430 LYS C CD  1 
ATOM   3245 C CE  . LYS B 1 130 ? 6.600  43.117 5.469  0.00 24.11 ? 430 LYS C CE  1 
ATOM   3246 N NZ  . LYS B 1 130 ? 6.818  42.503 4.130  0.00 24.64 ? 430 LYS C NZ  1 
ATOM   3247 N N   . GLU B 1 131 ? 8.178  42.277 11.003 1.00 18.26 ? 431 GLU C N   1 
ATOM   3248 C CA  . GLU B 1 131 ? 7.342  41.346 11.761 1.00 19.61 ? 431 GLU C CA  1 
ATOM   3249 C C   . GLU B 1 131 ? 6.932  41.921 13.115 1.00 19.12 ? 431 GLU C C   1 
ATOM   3250 O O   . GLU B 1 131 ? 5.797  41.737 13.554 1.00 20.51 ? 431 GLU C O   1 
ATOM   3251 C CB  . GLU B 1 131 ? 8.075  40.016 11.988 1.00 20.67 ? 431 GLU C CB  1 
ATOM   3252 C CG  . GLU B 1 131 ? 8.142  39.100 10.770 1.00 26.90 ? 431 GLU C CG  1 
ATOM   3253 C CD  . GLU B 1 131 ? 8.841  37.782 11.075 1.00 30.02 ? 431 GLU C CD  1 
ATOM   3254 O OE1 . GLU B 1 131 ? 8.629  37.232 12.180 1.00 33.04 ? 431 GLU C OE1 1 
ATOM   3255 O OE2 . GLU B 1 131 ? 9.592  37.289 10.210 1.00 32.04 ? 431 GLU C OE2 1 
ATOM   3256 N N   . TRP B 1 132 ? 7.858  42.605 13.781 1.00 16.83 ? 432 TRP C N   1 
ATOM   3257 C CA  . TRP B 1 132 ? 7.574  43.187 15.084 1.00 16.55 ? 432 TRP C CA  1 
ATOM   3258 C C   . TRP B 1 132 ? 6.493  44.258 14.997 1.00 19.51 ? 432 TRP C C   1 
ATOM   3259 O O   . TRP B 1 132 ? 5.559  44.276 15.798 1.00 18.55 ? 432 TRP C O   1 
ATOM   3260 C CB  . TRP B 1 132 ? 8.846  43.788 15.687 1.00 16.31 ? 432 TRP C CB  1 
ATOM   3261 C CG  . TRP B 1 132 ? 8.579  44.635 16.896 1.00 14.76 ? 432 TRP C CG  1 
ATOM   3262 C CD1 . TRP B 1 132 ? 7.969  44.249 18.057 1.00 18.19 ? 432 TRP C CD1 1 
ATOM   3263 C CD2 . TRP B 1 132 ? 8.886  46.022 17.046 1.00 15.59 ? 432 TRP C CD2 1 
ATOM   3264 N NE1 . TRP B 1 132 ? 7.875  45.319 18.921 1.00 17.92 ? 432 TRP C NE1 1 
ATOM   3265 C CE2 . TRP B 1 132 ? 8.432  46.418 18.321 1.00 16.75 ? 432 TRP C CE2 1 
ATOM   3266 C CE3 . TRP B 1 132 ? 9.501  46.973 16.219 1.00 17.57 ? 432 TRP C CE3 1 
ATOM   3267 C CZ2 . TRP B 1 132 ? 8.576  47.723 18.793 1.00 18.97 ? 432 TRP C CZ2 1 
ATOM   3268 C CZ3 . TRP B 1 132 ? 9.643  48.270 16.686 1.00 16.60 ? 432 TRP C CZ3 1 
ATOM   3269 C CH2 . TRP B 1 132 ? 9.181  48.634 17.963 1.00 20.64 ? 432 TRP C CH2 1 
ATOM   3270 N N   . LYS B 1 133 ? 6.626  45.159 14.029 1.00 20.00 ? 433 LYS C N   1 
ATOM   3271 C CA  . LYS B 1 133 ? 5.637  46.215 13.853 1.00 22.40 ? 433 LYS C CA  1 
ATOM   3272 C C   . LYS B 1 133 ? 4.279  45.605 13.508 1.00 23.13 ? 433 LYS C C   1 
ATOM   3273 O O   . LYS B 1 133 ? 3.234  46.125 13.901 1.00 24.44 ? 433 LYS C O   1 
ATOM   3274 C CB  . LYS B 1 133 ? 6.092  47.183 12.763 1.00 22.54 ? 433 LYS C CB  1 
ATOM   3275 C CG  . LYS B 1 133 ? 7.323  47.973 13.161 1.00 24.69 ? 433 LYS C CG  1 
ATOM   3276 C CD  . LYS B 1 133 ? 7.714  48.984 12.110 1.00 26.67 ? 433 LYS C CD  1 
ATOM   3277 C CE  . LYS B 1 133 ? 8.916  49.793 12.565 1.00 29.95 ? 433 LYS C CE  1 
ATOM   3278 N NZ  . LYS B 1 133 ? 9.271  50.859 11.589 1.00 29.80 ? 433 LYS C NZ  1 
ATOM   3279 N N   . GLU B 1 134 ? 4.295  44.498 12.774 1.00 23.44 ? 434 GLU C N   1 
ATOM   3280 C CA  . GLU B 1 134 ? 3.055  43.820 12.426 1.00 24.67 ? 434 GLU C CA  1 
ATOM   3281 C C   . GLU B 1 134 ? 2.442  43.230 13.699 1.00 23.86 ? 434 GLU C C   1 
ATOM   3282 O O   . GLU B 1 134 ? 1.246  43.374 13.944 1.00 23.89 ? 434 GLU C O   1 
ATOM   3283 C CB  . GLU B 1 134 ? 3.329  42.712 11.408 1.00 28.27 ? 434 GLU C CB  1 
ATOM   3284 C CG  . GLU B 1 134 ? 2.113  41.867 11.042 1.00 32.49 ? 434 GLU C CG  1 
ATOM   3285 C CD  . GLU B 1 134 ? 0.914  42.706 10.630 1.00 32.96 ? 434 GLU C CD  1 
ATOM   3286 O OE1 . GLU B 1 134 ? 1.104  43.702 9.901  1.00 33.72 ? 434 GLU C OE1 1 
ATOM   3287 O OE2 . GLU B 1 134 ? -0.219 42.364 11.027 1.00 36.20 ? 434 GLU C OE2 1 
ATOM   3288 N N   . TRP B 1 135 ? 3.275  42.582 14.512 1.00 23.00 ? 435 TRP C N   1 
ATOM   3289 C CA  . TRP B 1 135 ? 2.826  41.972 15.767 1.00 21.42 ? 435 TRP C CA  1 
ATOM   3290 C C   . TRP B 1 135 ? 2.238  43.008 16.725 1.00 20.58 ? 435 TRP C C   1 
ATOM   3291 O O   . TRP B 1 135 ? 1.288  42.727 17.451 1.00 21.07 ? 435 TRP C O   1 
ATOM   3292 C CB  . TRP B 1 135 ? 4.002  41.267 16.456 1.00 18.22 ? 435 TRP C CB  1 
ATOM   3293 C CG  . TRP B 1 135 ? 3.652  40.707 17.814 1.00 19.75 ? 435 TRP C CG  1 
ATOM   3294 C CD1 . TRP B 1 135 ? 3.062  39.503 18.080 1.00 17.93 ? 435 TRP C CD1 1 
ATOM   3295 C CD2 . TRP B 1 135 ? 3.828  41.354 19.075 1.00 18.46 ? 435 TRP C CD2 1 
ATOM   3296 N NE1 . TRP B 1 135 ? 2.860  39.359 19.432 1.00 20.11 ? 435 TRP C NE1 1 
ATOM   3297 C CE2 . TRP B 1 135 ? 3.321  40.482 20.068 1.00 17.04 ? 435 TRP C CE2 1 
ATOM   3298 C CE3 . TRP B 1 135 ? 4.364  42.589 19.468 1.00 16.61 ? 435 TRP C CE3 1 
ATOM   3299 C CZ2 . TRP B 1 135 ? 3.335  40.804 21.427 1.00 18.80 ? 435 TRP C CZ2 1 
ATOM   3300 C CZ3 . TRP B 1 135 ? 4.379  42.911 20.829 1.00 18.20 ? 435 TRP C CZ3 1 
ATOM   3301 C CH2 . TRP B 1 135 ? 3.867  42.018 21.788 1.00 16.14 ? 435 TRP C CH2 1 
ATOM   3302 N N   . LEU B 1 136 ? 2.820  44.200 16.736 1.00 23.83 ? 436 LEU C N   1 
ATOM   3303 C CA  . LEU B 1 136 ? 2.357  45.273 17.611 1.00 26.10 ? 436 LEU C CA  1 
ATOM   3304 C C   . LEU B 1 136 ? 0.894  45.640 17.429 1.00 29.02 ? 436 LEU C C   1 
ATOM   3305 O O   . LEU B 1 136 ? 0.251  46.106 18.368 1.00 30.14 ? 436 LEU C O   1 
ATOM   3306 C CB  . LEU B 1 136 ? 3.203  46.527 17.411 1.00 26.66 ? 436 LEU C CB  1 
ATOM   3307 C CG  . LEU B 1 136 ? 4.550  46.570 18.129 1.00 24.46 ? 436 LEU C CG  1 
ATOM   3308 C CD1 . LEU B 1 136 ? 5.281  47.846 17.740 1.00 27.00 ? 436 LEU C CD1 1 
ATOM   3309 C CD2 . LEU B 1 136 ? 4.339  46.504 19.636 1.00 25.30 ? 436 LEU C CD2 1 
ATOM   3310 N N   . LYS B 1 137 ? 0.373  45.436 16.224 1.00 30.23 ? 437 LYS C N   1 
ATOM   3311 C CA  . LYS B 1 137 ? -1.018 45.758 15.930 1.00 32.94 ? 437 LYS C CA  1 
ATOM   3312 C C   . LYS B 1 137 ? -2.008 45.189 16.952 1.00 32.35 ? 437 LYS C C   1 
ATOM   3313 O O   . LYS B 1 137 ? -2.974 45.860 17.335 1.00 29.11 ? 437 LYS C O   1 
ATOM   3314 C CB  . LYS B 1 137 ? -1.364 45.288 14.513 1.00 35.89 ? 437 LYS C CB  1 
ATOM   3315 C CG  . LYS B 1 137 ? -0.618 46.085 13.442 1.00 38.42 ? 437 LYS C CG  1 
ATOM   3316 C CD  . LYS B 1 137 ? -0.915 45.600 12.032 1.00 43.64 ? 437 LYS C CD  1 
ATOM   3317 C CE  . LYS B 1 137 ? -0.218 46.487 11.001 1.00 45.74 ? 437 LYS C CE  1 
ATOM   3318 N NZ  . LYS B 1 137 ? -0.423 46.003 9.607  1.00 47.60 ? 437 LYS C NZ  1 
ATOM   3319 N N   . THR B 1 138 ? -1.767 43.966 17.407 1.00 30.28 ? 438 THR C N   1 
ATOM   3320 C CA  . THR B 1 138 ? -2.652 43.362 18.395 1.00 29.17 ? 438 THR C CA  1 
ATOM   3321 C C   . THR B 1 138 ? -1.907 43.022 19.687 1.00 29.27 ? 438 THR C C   1 
ATOM   3322 O O   . THR B 1 138 ? -2.525 42.801 20.731 1.00 27.88 ? 438 THR C O   1 
ATOM   3323 C CB  . THR B 1 138 ? -3.320 42.093 17.839 1.00 30.29 ? 438 THR C CB  1 
ATOM   3324 O OG1 . THR B 1 138 ? -2.316 41.171 17.402 1.00 30.39 ? 438 THR C OG1 1 
ATOM   3325 C CG2 . THR B 1 138 ? -4.228 42.446 16.667 1.00 30.13 ? 438 THR C CG2 1 
ATOM   3326 N N   . SER B 1 139 ? -0.579 42.995 19.604 1.00 27.89 ? 439 SER C N   1 
ATOM   3327 C CA  . SER B 1 139 ? 0.277  42.696 20.748 1.00 27.55 ? 439 SER C CA  1 
ATOM   3328 C C   . SER B 1 139 ? -0.192 41.474 21.530 1.00 27.16 ? 439 SER C C   1 
ATOM   3329 O O   . SER B 1 139 ? -0.357 41.543 22.748 1.00 25.59 ? 439 SER C O   1 
ATOM   3330 C CB  . SER B 1 139 ? 0.337  43.899 21.698 1.00 29.05 ? 439 SER C CB  1 
ATOM   3331 O OG  . SER B 1 139 ? 0.970  45.011 21.094 1.00 29.37 ? 439 SER C OG  1 
ATOM   3332 N N   . GLN B 1 140 ? -0.404 40.358 20.844 1.00 26.19 ? 440 GLN C N   1 
ATOM   3333 C CA  . GLN B 1 140 ? -0.855 39.151 21.529 1.00 29.97 ? 440 GLN C CA  1 
ATOM   3334 C C   . GLN B 1 140 ? 0.315  38.189 21.756 1.00 30.01 ? 440 GLN C C   1 
ATOM   3335 O O   . GLN B 1 140 ? 0.723  37.469 20.843 1.00 29.21 ? 440 GLN C O   1 
ATOM   3336 C CB  . GLN B 1 140 ? -1.950 38.455 20.714 1.00 32.44 ? 440 GLN C CB  1 
ATOM   3337 C CG  . GLN B 1 140 ? -3.210 39.292 20.469 1.00 36.92 ? 440 GLN C CG  1 
ATOM   3338 C CD  . GLN B 1 140 ? -4.001 39.583 21.736 1.00 38.83 ? 440 GLN C CD  1 
ATOM   3339 O OE1 . GLN B 1 140 ? -3.671 40.490 22.499 1.00 40.59 ? 440 GLN C OE1 1 
ATOM   3340 N NE2 . GLN B 1 140 ? -5.053 38.804 21.965 1.00 41.58 ? 440 GLN C NE2 1 
ATOM   3341 N N   . TYR B 1 141 ? 0.849  38.179 22.974 1.00 28.28 ? 441 TYR C N   1 
ATOM   3342 C CA  . TYR B 1 141 ? 1.976  37.307 23.304 1.00 29.10 ? 441 TYR C CA  1 
ATOM   3343 C C   . TYR B 1 141 ? 1.561  35.835 23.332 1.00 30.00 ? 441 TYR C C   1 
ATOM   3344 O O   . TYR B 1 141 ? 0.834  35.405 24.226 1.00 28.25 ? 441 TYR C O   1 
ATOM   3345 C CB  . TYR B 1 141 ? 2.565  37.693 24.666 1.00 27.64 ? 441 TYR C CB  1 
ATOM   3346 C CG  . TYR B 1 141 ? 3.802  36.904 25.026 1.00 27.36 ? 441 TYR C CG  1 
ATOM   3347 C CD1 . TYR B 1 141 ? 4.965  37.016 24.262 1.00 25.98 ? 441 TYR C CD1 1 
ATOM   3348 C CD2 . TYR B 1 141 ? 3.805  36.023 26.111 1.00 26.02 ? 441 TYR C CD2 1 
ATOM   3349 C CE1 . TYR B 1 141 ? 6.099  36.271 24.566 1.00 25.28 ? 441 TYR C CE1 1 
ATOM   3350 C CE2 . TYR B 1 141 ? 4.940  35.273 26.424 1.00 26.55 ? 441 TYR C CE2 1 
ATOM   3351 C CZ  . TYR B 1 141 ? 6.082  35.403 25.643 1.00 23.97 ? 441 TYR C CZ  1 
ATOM   3352 O OH  . TYR B 1 141 ? 7.207  34.658 25.925 1.00 23.34 ? 441 TYR C OH  1 
ATOM   3353 N N   . LYS B 1 142 ? 2.034  35.066 22.354 1.00 33.05 ? 442 LYS C N   1 
ATOM   3354 C CA  . LYS B 1 142 ? 1.719  33.639 22.264 1.00 33.78 ? 442 LYS C CA  1 
ATOM   3355 C C   . LYS B 1 142 ? 3.006  32.820 22.106 1.00 34.69 ? 442 LYS C C   1 
ATOM   3356 O O   . LYS B 1 142 ? 3.467  32.583 20.989 1.00 37.61 ? 442 LYS C O   1 
ATOM   3357 C CB  . LYS B 1 142 ? 0.789  33.386 21.072 1.00 34.09 ? 442 LYS C CB  1 
ATOM   3358 C CG  . LYS B 1 142 ? -0.548 34.102 21.163 0.00 34.38 ? 442 LYS C CG  1 
ATOM   3359 C CD  . LYS B 1 142 ? -1.427 33.785 19.964 0.00 35.56 ? 442 LYS C CD  1 
ATOM   3360 C CE  . LYS B 1 142 ? -2.772 34.486 20.063 0.00 36.52 ? 442 LYS C CE  1 
ATOM   3361 N NZ  . LYS B 1 142 ? -3.646 34.177 18.898 0.00 36.67 ? 442 LYS C NZ  1 
ATOM   3362 N N   . PRO B 1 143 ? 3.594  32.371 23.231 1.00 31.98 ? 443 PRO C N   1 
ATOM   3363 C CA  . PRO B 1 143 ? 4.831  31.578 23.278 1.00 31.19 ? 443 PRO C CA  1 
ATOM   3364 C C   . PRO B 1 143 ? 4.725  30.295 22.462 1.00 29.71 ? 443 PRO C C   1 
ATOM   3365 O O   . PRO B 1 143 ? 4.241  29.284 22.961 1.00 26.74 ? 443 PRO C O   1 
ATOM   3366 C CB  . PRO B 1 143 ? 4.996  31.272 24.766 1.00 32.40 ? 443 PRO C CB  1 
ATOM   3367 C CG  . PRO B 1 143 ? 4.233  32.357 25.444 1.00 33.79 ? 443 PRO C CG  1 
ATOM   3368 C CD  . PRO B 1 143 ? 3.026  32.520 24.581 1.00 33.05 ? 443 PRO C CD  1 
ATOM   3369 N N   . ILE B 1 144 ? 5.192  30.331 21.221 1.00 28.03 ? 444 ILE C N   1 
ATOM   3370 C CA  . ILE B 1 144 ? 5.113  29.160 20.360 1.00 29.15 ? 444 ILE C CA  1 
ATOM   3371 C C   . ILE B 1 144 ? 6.474  28.501 20.099 1.00 27.45 ? 444 ILE C C   1 
ATOM   3372 O O   . ILE B 1 144 ? 7.428  29.151 19.663 1.00 25.05 ? 444 ILE C O   1 
ATOM   3373 C CB  . ILE B 1 144 ? 4.430  29.539 19.017 1.00 32.24 ? 444 ILE C CB  1 
ATOM   3374 C CG1 . ILE B 1 144 ? 4.093  28.284 18.211 1.00 35.44 ? 444 ILE C CG1 1 
ATOM   3375 C CG2 . ILE B 1 144 ? 5.324  30.491 18.232 1.00 33.81 ? 444 ILE C CG2 1 
ATOM   3376 C CD1 . ILE B 1 144 ? 5.277  27.595 17.591 1.00 35.66 ? 444 ILE C CD1 1 
ATOM   3377 N N   . VAL B 1 145 ? 6.551  27.201 20.374 1.00 25.06 ? 445 VAL C N   1 
ATOM   3378 C CA  . VAL B 1 145 ? 7.775  26.437 20.159 1.00 25.27 ? 445 VAL C CA  1 
ATOM   3379 C C   . VAL B 1 145 ? 7.473  25.160 19.379 1.00 27.38 ? 445 VAL C C   1 
ATOM   3380 O O   . VAL B 1 145 ? 6.635  24.355 19.793 1.00 27.67 ? 445 VAL C O   1 
ATOM   3381 C CB  . VAL B 1 145 ? 8.443  26.022 21.499 1.00 26.02 ? 445 VAL C CB  1 
ATOM   3382 C CG1 . VAL B 1 145 ? 9.707  25.212 21.217 1.00 18.82 ? 445 VAL C CG1 1 
ATOM   3383 C CG2 . VAL B 1 145 ? 8.762  27.259 22.341 1.00 21.88 ? 445 VAL C CG2 1 
ATOM   3384 N N   . ASN B 1 146 ? 8.144  24.992 18.245 1.00 29.56 ? 446 ASN C N   1 
ATOM   3385 C CA  . ASN B 1 146 ? 7.983  23.802 17.416 1.00 31.44 ? 446 ASN C CA  1 
ATOM   3386 C C   . ASN B 1 146 ? 9.015  23.772 16.290 1.00 31.95 ? 446 ASN C C   1 
ATOM   3387 O O   . ASN B 1 146 ? 9.868  24.659 16.200 1.00 30.55 ? 446 ASN C O   1 
ATOM   3388 C CB  . ASN B 1 146 ? 6.558  23.700 16.841 1.00 31.20 ? 446 ASN C CB  1 
ATOM   3389 C CG  . ASN B 1 146 ? 6.169  24.904 16.000 1.00 31.56 ? 446 ASN C CG  1 
ATOM   3390 O OD1 . ASN B 1 146 ? 7.010  25.528 15.344 1.00 29.88 ? 446 ASN C OD1 1 
ATOM   3391 N ND2 . ASN B 1 146 ? 4.880  25.222 15.999 1.00 29.08 ? 446 ASN C ND2 1 
ATOM   3392 N N   . ILE B 1 147 ? 8.935  22.750 15.440 1.00 34.23 ? 447 ILE C N   1 
ATOM   3393 C CA  . ILE B 1 147 ? 9.875  22.590 14.330 1.00 36.83 ? 447 ILE C CA  1 
ATOM   3394 C C   . ILE B 1 147 ? 10.182 23.882 13.569 1.00 39.22 ? 447 ILE C C   1 
ATOM   3395 O O   . ILE B 1 147 ? 11.287 24.047 13.047 1.00 40.24 ? 447 ILE C O   1 
ATOM   3396 C CB  . ILE B 1 147 ? 9.376  21.526 13.308 1.00 36.87 ? 447 ILE C CB  1 
ATOM   3397 C CG1 . ILE B 1 147 ? 8.169  22.049 12.519 1.00 36.44 ? 447 ILE C CG1 1 
ATOM   3398 C CG2 . ILE B 1 147 ? 8.995  20.255 14.037 1.00 39.23 ? 447 ILE C CG2 1 
ATOM   3399 C CD1 . ILE B 1 147 ? 6.917  22.281 13.350 1.00 35.91 ? 447 ILE C CD1 1 
ATOM   3400 N N   . GLU B 1 148 ? 9.216  24.798 13.517 1.00 39.40 ? 448 GLU C N   1 
ATOM   3401 C CA  . GLU B 1 148 ? 9.391  26.059 12.800 1.00 39.81 ? 448 GLU C CA  1 
ATOM   3402 C C   . GLU B 1 148 ? 9.325  27.328 13.659 1.00 39.12 ? 448 GLU C C   1 
ATOM   3403 O O   . GLU B 1 148 ? 9.217  28.427 13.118 1.00 38.05 ? 448 GLU C O   1 
ATOM   3404 C CB  . GLU B 1 148 ? 8.352  26.153 11.672 1.00 40.08 ? 448 GLU C CB  1 
ATOM   3405 C CG  . GLU B 1 148 ? 8.578  25.158 10.534 1.00 42.38 ? 448 GLU C CG  1 
ATOM   3406 C CD  . GLU B 1 148 ? 7.446  25.146 9.519  1.00 44.34 ? 448 GLU C CD  1 
ATOM   3407 O OE1 . GLU B 1 148 ? 6.826  26.210 9.299  1.00 44.81 ? 448 GLU C OE1 1 
ATOM   3408 O OE2 . GLU B 1 148 ? 7.184  24.075 8.928  1.00 43.84 ? 448 GLU C OE2 1 
ATOM   3409 N N   . ASN B 1 149 ? 9.393  27.188 14.983 1.00 38.54 ? 449 ASN C N   1 
ATOM   3410 C CA  . ASN B 1 149 ? 9.333  28.354 15.875 1.00 37.02 ? 449 ASN C CA  1 
ATOM   3411 C C   . ASN B 1 149 ? 10.231 28.235 17.108 1.00 37.19 ? 449 ASN C C   1 
ATOM   3412 O O   . ASN B 1 149 ? 10.437 27.139 17.634 1.00 37.81 ? 449 ASN C O   1 
ATOM   3413 C CB  . ASN B 1 149 ? 7.890  28.603 16.329 1.00 37.64 ? 449 ASN C CB  1 
ATOM   3414 C CG  . ASN B 1 149 ? 7.015  29.190 15.228 1.00 38.46 ? 449 ASN C CG  1 
ATOM   3415 O OD1 . ASN B 1 149 ? 7.152  30.358 14.872 1.00 40.19 ? 449 ASN C OD1 1 
ATOM   3416 N ND2 . ASN B 1 149 ? 6.116  28.377 14.683 1.00 33.19 ? 449 ASN C ND2 1 
ATOM   3417 N N   . HIS B 1 150 ? 10.736 29.380 17.569 1.00 35.64 ? 450 HIS C N   1 
ATOM   3418 C CA  . HIS B 1 150 ? 11.627 29.473 18.734 1.00 34.86 ? 450 HIS C CA  1 
ATOM   3419 C C   . HIS B 1 150 ? 12.592 28.298 18.869 1.00 34.38 ? 450 HIS C C   1 
ATOM   3420 O O   . HIS B 1 150 ? 12.475 27.473 19.772 1.00 36.33 ? 450 HIS C O   1 
ATOM   3421 C CB  . HIS B 1 150 ? 10.824 29.625 20.033 1.00 33.05 ? 450 HIS C CB  1 
ATOM   3422 C CG  . HIS B 1 150 ? 11.668 29.999 21.216 1.00 31.07 ? 450 HIS C CG  1 
ATOM   3423 N ND1 . HIS B 1 150 ? 11.823 29.178 22.312 1.00 31.68 ? 450 HIS C ND1 1 
ATOM   3424 C CD2 . HIS B 1 150 ? 12.436 31.089 21.453 1.00 29.89 ? 450 HIS C CD2 1 
ATOM   3425 C CE1 . HIS B 1 150 ? 12.651 29.744 23.171 1.00 30.29 ? 450 HIS C CE1 1 
ATOM   3426 N NE2 . HIS B 1 150 ? 13.039 30.905 22.675 1.00 28.95 ? 450 HIS C NE2 1 
ATOM   3427 N N   . ASN B 1 151 ? 13.546 28.233 17.951 1.00 34.30 ? 451 ASN C N   1 
ATOM   3428 C CA  . ASN B 1 151 ? 14.541 27.176 17.940 1.00 31.91 ? 451 ASN C CA  1 
ATOM   3429 C C   . ASN B 1 151 ? 15.891 27.709 18.436 1.00 29.94 ? 451 ASN C C   1 
ATOM   3430 O O   . ASN B 1 151 ? 16.663 28.250 17.646 1.00 30.55 ? 451 ASN C O   1 
ATOM   3431 C CB  . ASN B 1 151 ? 14.696 26.637 16.515 1.00 35.70 ? 451 ASN C CB  1 
ATOM   3432 C CG  . ASN B 1 151 ? 13.539 25.742 16.089 1.00 39.08 ? 451 ASN C CG  1 
ATOM   3433 O OD1 . ASN B 1 151 ? 12.435 25.820 16.637 1.00 39.98 ? 451 ASN C OD1 1 
ATOM   3434 N ND2 . ASN B 1 151 ? 13.788 24.892 15.092 1.00 37.98 ? 451 ASN C ND2 1 
ATOM   3435 N N   . THR B 1 152 ? 16.160 27.585 19.738 1.00 22.70 ? 452 THR C N   1 
ATOM   3436 C CA  . THR B 1 152 ? 17.440 28.038 20.297 1.00 18.71 ? 452 THR C CA  1 
ATOM   3437 C C   . THR B 1 152 ? 18.452 26.962 19.937 1.00 14.20 ? 452 THR C C   1 
ATOM   3438 O O   . THR B 1 152 ? 18.073 25.908 19.437 1.00 16.31 ? 452 THR C O   1 
ATOM   3439 C CB  . THR B 1 152 ? 17.438 28.090 21.837 1.00 17.85 ? 452 THR C CB  1 
ATOM   3440 O OG1 . THR B 1 152 ? 17.406 26.750 22.352 1.00 19.99 ? 452 THR C OG1 1 
ATOM   3441 C CG2 . THR B 1 152 ? 16.259 28.870 22.369 1.00 19.28 ? 452 THR C CG2 1 
ATOM   3442 N N   . ILE B 1 153 ? 19.736 27.217 20.165 1.00 10.26 ? 453 ILE C N   1 
ATOM   3443 C CA  . ILE B 1 153 ? 20.703 26.171 19.908 1.00 10.02 ? 453 ILE C CA  1 
ATOM   3444 C C   . ILE B 1 153 ? 21.554 25.868 21.139 1.00 9.36  ? 453 ILE C C   1 
ATOM   3445 O O   . ILE B 1 153 ? 22.184 26.750 21.731 1.00 8.28  ? 453 ILE C O   1 
ATOM   3446 C CB  . ILE B 1 153 ? 21.642 26.465 18.706 1.00 10.25 ? 453 ILE C CB  1 
ATOM   3447 C CG1 . ILE B 1 153 ? 22.527 25.230 18.469 1.00 8.64  ? 453 ILE C CG1 1 
ATOM   3448 C CG2 . ILE B 1 153 ? 22.516 27.688 18.983 1.00 8.60  ? 453 ILE C CG2 1 
ATOM   3449 C CD1 . ILE B 1 153 ? 23.310 25.243 17.167 1.00 12.80 ? 453 ILE C CD1 1 
ATOM   3450 N N   . GLY B 1 154 ? 21.515 24.609 21.542 1.00 5.79  ? 454 GLY C N   1 
ATOM   3451 C CA  . GLY B 1 154 ? 22.316 24.140 22.654 1.00 4.63  ? 454 GLY C CA  1 
ATOM   3452 C C   . GLY B 1 154 ? 23.225 23.122 21.979 1.00 5.28  ? 454 GLY C C   1 
ATOM   3453 O O   . GLY B 1 154 ? 22.762 22.381 21.105 1.00 4.85  ? 454 GLY C O   1 
ATOM   3454 N N   . MET B 1 155 ? 24.506 23.101 22.340 1.00 4.14  ? 455 MET C N   1 
ATOM   3455 C CA  . MET B 1 155 ? 25.440 22.159 21.731 1.00 4.25  ? 455 MET C CA  1 
ATOM   3456 C C   . MET B 1 155 ? 26.390 21.635 22.803 1.00 2.71  ? 455 MET C C   1 
ATOM   3457 O O   . MET B 1 155 ? 26.908 22.404 23.608 1.00 4.41  ? 455 MET C O   1 
ATOM   3458 C CB  . MET B 1 155 ? 26.245 22.850 20.611 1.00 6.22  ? 455 MET C CB  1 
ATOM   3459 C CG  . MET B 1 155 ? 27.280 21.945 19.926 1.00 3.84  ? 455 MET C CG  1 
ATOM   3460 S SD  . MET B 1 155 ? 28.191 22.803 18.575 1.00 8.11  ? 455 MET C SD  1 
ATOM   3461 C CE  . MET B 1 155 ? 27.039 22.551 17.227 1.00 9.20  ? 455 MET C CE  1 
ATOM   3462 N N   . ILE B 1 156 ? 26.590 20.323 22.813 1.00 3.74  ? 456 ILE C N   1 
ATOM   3463 C CA  . ILE B 1 156 ? 27.473 19.674 23.767 1.00 4.23  ? 456 ILE C CA  1 
ATOM   3464 C C   . ILE B 1 156 ? 28.391 18.720 22.995 1.00 8.33  ? 456 ILE C C   1 
ATOM   3465 O O   . ILE B 1 156 ? 27.975 18.121 22.000 1.00 7.20  ? 456 ILE C O   1 
ATOM   3466 C CB  . ILE B 1 156 ? 26.667 18.901 24.847 1.00 7.61  ? 456 ILE C CB  1 
ATOM   3467 C CG1 . ILE B 1 156 ? 25.624 17.976 24.202 1.00 7.36  ? 456 ILE C CG1 1 
ATOM   3468 C CG2 . ILE B 1 156 ? 25.997 19.893 25.796 1.00 5.57  ? 456 ILE C CG2 1 
ATOM   3469 C CD1 . ILE B 1 156 ? 24.870 17.092 25.214 1.00 4.22  ? 456 ILE C CD1 1 
ATOM   3470 N N   . ALA B 1 157 ? 29.648 18.608 23.425 1.00 5.72  ? 457 ALA C N   1 
ATOM   3471 C CA  . ALA B 1 157 ? 30.589 17.740 22.729 1.00 7.88  ? 457 ALA C CA  1 
ATOM   3472 C C   . ALA B 1 157 ? 31.603 17.090 23.661 1.00 7.21  ? 457 ALA C C   1 
ATOM   3473 O O   . ALA B 1 157 ? 31.889 17.597 24.748 1.00 7.27  ? 457 ALA C O   1 
ATOM   3474 C CB  . ALA B 1 157 ? 31.327 18.531 21.647 1.00 3.60  ? 457 ALA C CB  1 
ATOM   3475 N N   . LEU B 1 158 ? 32.132 15.958 23.209 1.00 7.25  ? 458 LEU C N   1 
ATOM   3476 C CA  . LEU B 1 158 ? 33.146 15.192 23.926 1.00 6.63  ? 458 LEU C CA  1 
ATOM   3477 C C   . LEU B 1 158 ? 34.304 15.161 22.935 1.00 6.30  ? 458 LEU C C   1 
ATOM   3478 O O   . LEU B 1 158 ? 34.145 14.624 21.832 1.00 7.82  ? 458 LEU C O   1 
ATOM   3479 C CB  . LEU B 1 158 ? 32.631 13.769 24.184 1.00 6.96  ? 458 LEU C CB  1 
ATOM   3480 C CG  . LEU B 1 158 ? 33.589 12.767 24.845 1.00 9.18  ? 458 LEU C CG  1 
ATOM   3481 C CD1 . LEU B 1 158 ? 33.949 13.231 26.250 1.00 7.11  ? 458 LEU C CD1 1 
ATOM   3482 C CD2 . LEU B 1 158 ? 32.928 11.394 24.897 1.00 9.40  ? 458 LEU C CD2 1 
ATOM   3483 N N   . ASP B 1 159 ? 35.443 15.765 23.278 1.00 5.66  ? 459 ASP C N   1 
ATOM   3484 C CA  . ASP B 1 159 ? 36.562 15.778 22.334 1.00 5.76  ? 459 ASP C CA  1 
ATOM   3485 C C   . ASP B 1 159 ? 37.470 14.547 22.373 1.00 6.65  ? 459 ASP C C   1 
ATOM   3486 O O   . ASP B 1 159 ? 37.250 13.614 23.151 1.00 7.89  ? 459 ASP C O   1 
ATOM   3487 C CB  . ASP B 1 159 ? 37.407 17.045 22.498 1.00 4.95  ? 459 ASP C CB  1 
ATOM   3488 C CG  . ASP B 1 159 ? 37.996 17.189 23.885 1.00 4.45  ? 459 ASP C CG  1 
ATOM   3489 O OD1 . ASP B 1 159 ? 38.368 16.165 24.485 1.00 7.96  ? 459 ASP C OD1 1 
ATOM   3490 O OD2 . ASP B 1 159 ? 38.108 18.341 24.361 1.00 7.72  ? 459 ASP C OD2 1 
ATOM   3491 N N   . ALA B 1 160 ? 38.491 14.546 21.520 1.00 6.58  ? 460 ALA C N   1 
ATOM   3492 C CA  . ALA B 1 160 ? 39.422 13.423 21.446 1.00 9.85  ? 460 ALA C CA  1 
ATOM   3493 C C   . ALA B 1 160 ? 40.171 13.170 22.753 1.00 11.47 ? 460 ALA C C   1 
ATOM   3494 O O   . ALA B 1 160 ? 40.655 12.062 22.982 1.00 10.80 ? 460 ALA C O   1 
ATOM   3495 C CB  . ALA B 1 160 ? 40.426 13.639 20.306 1.00 12.37 ? 460 ALA C CB  1 
ATOM   3496 N N   . GLN B 1 161 ? 40.281 14.182 23.613 1.00 10.29 ? 461 GLN C N   1 
ATOM   3497 C CA  . GLN B 1 161 ? 40.976 13.989 24.890 1.00 6.85  ? 461 GLN C CA  1 
ATOM   3498 C C   . GLN B 1 161 ? 40.006 13.417 25.920 1.00 9.61  ? 461 GLN C C   1 
ATOM   3499 O O   . GLN B 1 161 ? 40.381 13.124 27.049 1.00 8.32  ? 461 GLN C O   1 
ATOM   3500 C CB  . GLN B 1 161 ? 41.493 15.311 25.437 1.00 9.21  ? 461 GLN C CB  1 
ATOM   3501 C CG  . GLN B 1 161 ? 42.612 15.923 24.679 1.00 10.77 ? 461 GLN C CG  1 
ATOM   3502 C CD  . GLN B 1 161 ? 42.768 17.366 25.058 1.00 12.75 ? 461 GLN C CD  1 
ATOM   3503 O OE1 . GLN B 1 161 ? 43.212 17.695 26.167 1.00 18.67 ? 461 GLN C OE1 1 
ATOM   3504 N NE2 . GLN B 1 161 ? 42.380 18.244 24.154 1.00 9.70  ? 461 GLN C NE2 1 
ATOM   3505 N N   . GLY B 1 162 ? 38.749 13.285 25.532 1.00 6.77  ? 462 GLY C N   1 
ATOM   3506 C CA  . GLY B 1 162 ? 37.765 12.775 26.456 1.00 7.54  ? 462 GLY C CA  1 
ATOM   3507 C C   . GLY B 1 162 ? 37.183 13.862 27.341 1.00 6.51  ? 462 GLY C C   1 
ATOM   3508 O O   . GLY B 1 162 ? 36.651 13.557 28.408 1.00 8.09  ? 462 GLY C O   1 
ATOM   3509 N N   . ASN B 1 163 ? 37.274 15.120 26.921 1.00 5.10  ? 463 ASN C N   1 
ATOM   3510 C CA  . ASN B 1 163 ? 36.717 16.220 27.723 1.00 5.23  ? 463 ASN C CA  1 
ATOM   3511 C C   . ASN B 1 163 ? 35.405 16.735 27.136 1.00 5.05  ? 463 ASN C C   1 
ATOM   3512 O O   . ASN B 1 163 ? 35.222 16.787 25.915 1.00 6.65  ? 463 ASN C O   1 
ATOM   3513 C CB  . ASN B 1 163 ? 37.710 17.383 27.826 1.00 6.09  ? 463 ASN C CB  1 
ATOM   3514 C CG  . ASN B 1 163 ? 38.940 17.029 28.651 1.00 8.92  ? 463 ASN C CG  1 
ATOM   3515 O OD1 . ASN B 1 163 ? 38.836 16.381 29.691 1.00 7.48  ? 463 ASN C OD1 1 
ATOM   3516 N ND2 . ASN B 1 163 ? 40.110 17.468 28.194 1.00 11.94 ? 463 ASN C ND2 1 
ATOM   3517 N N   . LEU B 1 164 ? 34.499 17.118 28.020 1.00 5.70  ? 464 LEU C N   1 
ATOM   3518 C CA  . LEU B 1 164 ? 33.183 17.628 27.637 1.00 6.33  ? 464 LEU C CA  1 
ATOM   3519 C C   . LEU B 1 164 ? 33.085 19.145 27.768 1.00 7.40  ? 464 LEU C C   1 
ATOM   3520 O O   . LEU B 1 164 ? 33.765 19.746 28.602 1.00 5.34  ? 464 LEU C O   1 
ATOM   3521 C CB  . LEU B 1 164 ? 32.113 17.008 28.541 1.00 5.44  ? 464 LEU C CB  1 
ATOM   3522 C CG  . LEU B 1 164 ? 31.930 15.493 28.439 1.00 7.99  ? 464 LEU C CG  1 
ATOM   3523 C CD1 . LEU B 1 164 ? 31.427 14.951 29.773 1.00 8.88  ? 464 LEU C CD1 1 
ATOM   3524 C CD2 . LEU B 1 164 ? 30.942 15.175 27.299 1.00 6.69  ? 464 LEU C CD2 1 
ATOM   3525 N N   . SER B 1 165 ? 32.244 19.751 26.926 1.00 3.71  ? 465 SER C N   1 
ATOM   3526 C CA  . SER B 1 165 ? 31.984 21.181 26.983 1.00 4.95  ? 465 SER C CA  1 
ATOM   3527 C C   . SER B 1 165 ? 30.642 21.444 26.310 1.00 5.01  ? 465 SER C C   1 
ATOM   3528 O O   . SER B 1 165 ? 30.142 20.621 25.541 1.00 6.09  ? 465 SER C O   1 
ATOM   3529 C CB  . SER B 1 165 ? 33.096 21.993 26.299 1.00 8.29  ? 465 SER C CB  1 
ATOM   3530 O OG  . SER B 1 165 ? 34.292 21.959 27.061 1.00 8.07  ? 465 SER C OG  1 
ATOM   3531 N N   . GLY B 1 166 ? 30.062 22.598 26.589 1.00 5.06  ? 466 GLY C N   1 
ATOM   3532 C CA  . GLY B 1 166 ? 28.774 22.906 25.998 1.00 5.57  ? 466 GLY C CA  1 
ATOM   3533 C C   . GLY B 1 166 ? 28.569 24.396 25.844 1.00 5.42  ? 466 GLY C C   1 
ATOM   3534 O O   . GLY B 1 166 ? 29.250 25.197 26.485 1.00 5.40  ? 466 GLY C O   1 
ATOM   3535 N N   . ALA B 1 167 ? 27.610 24.761 25.001 1.00 5.01  ? 467 ALA C N   1 
ATOM   3536 C CA  . ALA B 1 167 ? 27.298 26.154 24.739 1.00 6.61  ? 467 ALA C CA  1 
ATOM   3537 C C   . ALA B 1 167 ? 25.804 26.267 24.448 1.00 4.59  ? 467 ALA C C   1 
ATOM   3538 O O   . ALA B 1 167 ? 25.221 25.377 23.835 1.00 3.66  ? 467 ALA C O   1 
ATOM   3539 C CB  . ALA B 1 167 ? 28.108 26.643 23.516 1.00 6.29  ? 467 ALA C CB  1 
ATOM   3540 N N   . CYS B 1 168 ? 25.183 27.359 24.882 1.00 3.92  ? 468 CYS C N   1 
ATOM   3541 C CA  . CYS B 1 168 ? 23.755 27.555 24.626 1.00 3.52  ? 468 CYS C CA  1 
ATOM   3542 C C   . CYS B 1 168 ? 23.552 29.035 24.306 1.00 4.75  ? 468 CYS C C   1 
ATOM   3543 O O   . CYS B 1 168 ? 24.018 29.892 25.043 1.00 6.45  ? 468 CYS C O   1 
ATOM   3544 C CB  . CYS B 1 168 ? 22.940 27.155 25.857 1.00 5.79  ? 468 CYS C CB  1 
ATOM   3545 S SG  . CYS B 1 168 ? 21.169 27.019 25.540 1.00 9.06  ? 468 CYS C SG  1 
ATOM   3546 N N   . THR B 1 169 ? 22.869 29.341 23.211 1.00 6.06  ? 469 THR C N   1 
ATOM   3547 C CA  . THR B 1 169 ? 22.679 30.741 22.849 1.00 5.14  ? 469 THR C CA  1 
ATOM   3548 C C   . THR B 1 169 ? 21.327 30.958 22.164 1.00 7.82  ? 469 THR C C   1 
ATOM   3549 O O   . THR B 1 169 ? 20.851 30.095 21.430 1.00 7.78  ? 469 THR C O   1 
ATOM   3550 C CB  . THR B 1 169 ? 23.860 31.217 21.949 1.00 5.62  ? 469 THR C CB  1 
ATOM   3551 O OG1 . THR B 1 169 ? 23.679 32.592 21.574 1.00 5.66  ? 469 THR C OG1 1 
ATOM   3552 C CG2 . THR B 1 169 ? 23.946 30.358 20.707 1.00 7.29  ? 469 THR C CG2 1 
ATOM   3553 N N   . THR B 1 170 ? 20.710 32.111 22.419 1.00 7.83  ? 470 THR C N   1 
ATOM   3554 C CA  . THR B 1 170 ? 19.391 32.412 21.854 1.00 7.11  ? 470 THR C CA  1 
ATOM   3555 C C   . THR B 1 170 ? 19.084 33.907 21.884 1.00 7.79  ? 470 THR C C   1 
ATOM   3556 O O   . THR B 1 170 ? 19.788 34.683 22.529 1.00 3.26  ? 470 THR C O   1 
ATOM   3557 C CB  . THR B 1 170 ? 18.286 31.739 22.689 1.00 6.99  ? 470 THR C CB  1 
ATOM   3558 O OG1 . THR B 1 170 ? 17.000 32.023 22.127 1.00 7.07  ? 470 THR C OG1 1 
ATOM   3559 C CG2 . THR B 1 170 ? 18.307 32.298 24.097 1.00 12.12 ? 470 THR C CG2 1 
ATOM   3560 N N   . SER B 1 171 ? 18.024 34.300 21.181 1.00 7.28  ? 471 SER C N   1 
ATOM   3561 C CA  . SER B 1 171 ? 17.573 35.685 21.200 1.00 8.59  ? 471 SER C CA  1 
ATOM   3562 C C   . SER B 1 171 ? 16.313 35.697 22.070 1.00 6.68  ? 471 SER C C   1 
ATOM   3563 O O   . SER B 1 171 ? 15.634 36.721 22.221 1.00 6.40  ? 471 SER C O   1 
ATOM   3564 C CB  . SER B 1 171 ? 17.270 36.195 19.783 1.00 7.07  ? 471 SER C CB  1 
ATOM   3565 O OG  . SER B 1 171 ? 16.354 35.349 19.116 1.00 12.83 ? 471 SER C OG  1 
ATOM   3566 N N   . GLY B 1 172 ? 15.995 34.538 22.648 1.00 4.51  ? 472 GLY C N   1 
ATOM   3567 C CA  . GLY B 1 172 ? 14.844 34.459 23.530 1.00 5.90  ? 472 GLY C CA  1 
ATOM   3568 C C   . GLY B 1 172 ? 13.463 34.423 22.885 1.00 6.85  ? 472 GLY C C   1 
ATOM   3569 O O   . GLY B 1 172 ? 13.326 34.509 21.667 1.00 8.69  ? 472 GLY C O   1 
ATOM   3570 N N   . MET B 1 173 ? 12.432 34.306 23.714 1.00 6.95  ? 473 MET C N   1 
ATOM   3571 C CA  . MET B 1 173 ? 11.053 34.241 23.215 1.00 11.40 ? 473 MET C CA  1 
ATOM   3572 C C   . MET B 1 173 ? 10.659 35.505 22.457 1.00 9.82  ? 473 MET C C   1 
ATOM   3573 O O   . MET B 1 173 ? 10.771 36.607 22.977 1.00 10.42 ? 473 MET C O   1 
ATOM   3574 C CB  . MET B 1 173 ? 10.063 34.013 24.368 1.00 12.80 ? 473 MET C CB  1 
ATOM   3575 C CG  . MET B 1 173 ? 9.662  32.554 24.592 1.00 23.88 ? 473 MET C CG  1 
ATOM   3576 S SD  . MET B 1 173 ? 9.068  31.679 23.093 1.00 25.71 ? 473 MET C SD  1 
ATOM   3577 C CE  . MET B 1 173 ? 7.777  32.781 22.525 1.00 35.00 ? 473 MET C CE  1 
ATOM   3578 N N   . ALA B 1 174 ? 10.208 35.340 21.219 1.00 9.11  ? 474 ALA C N   1 
ATOM   3579 C CA  . ALA B 1 174 ? 9.813  36.485 20.417 1.00 9.30  ? 474 ALA C CA  1 
ATOM   3580 C C   . ALA B 1 174 ? 8.750  37.329 21.133 1.00 10.03 ? 474 ALA C C   1 
ATOM   3581 O O   . ALA B 1 174 ? 7.755  36.797 21.632 1.00 11.64 ? 474 ALA C O   1 
ATOM   3582 C CB  . ALA B 1 174 ? 9.285  36.013 19.054 1.00 8.80  ? 474 ALA C CB  1 
ATOM   3583 N N   . TYR B 1 175 ? 8.991  38.634 21.209 1.00 10.65 ? 475 TYR C N   1 
ATOM   3584 C CA  . TYR B 1 175 ? 8.050  39.580 21.819 1.00 11.92 ? 475 TYR C CA  1 
ATOM   3585 C C   . TYR B 1 175 ? 7.864  39.425 23.317 1.00 11.91 ? 475 TYR C C   1 
ATOM   3586 O O   . TYR B 1 175 ? 6.818  39.770 23.885 1.00 12.38 ? 475 TYR C O   1 
ATOM   3587 C CB  . TYR B 1 175 ? 6.711  39.496 21.086 1.00 11.12 ? 475 TYR C CB  1 
ATOM   3588 C CG  . TYR B 1 175 ? 6.921  39.519 19.591 1.00 13.03 ? 475 TYR C CG  1 
ATOM   3589 C CD1 . TYR B 1 175 ? 6.272  38.608 18.757 1.00 13.86 ? 475 TYR C CD1 1 
ATOM   3590 C CD2 . TYR B 1 175 ? 7.843  40.399 19.018 1.00 13.11 ? 475 TYR C CD2 1 
ATOM   3591 C CE1 . TYR B 1 175 ? 6.542  38.566 17.387 1.00 15.82 ? 475 TYR C CE1 1 
ATOM   3592 C CE2 . TYR B 1 175 ? 8.123  40.360 17.649 1.00 13.86 ? 475 TYR C CE2 1 
ATOM   3593 C CZ  . TYR B 1 175 ? 7.471  39.441 16.841 1.00 15.63 ? 475 TYR C CZ  1 
ATOM   3594 O OH  . TYR B 1 175 ? 7.763  39.379 15.490 1.00 14.43 ? 475 TYR C OH  1 
ATOM   3595 N N   . LYS B 1 176 ? 8.911  38.916 23.952 1.00 10.42 ? 476 LYS C N   1 
ATOM   3596 C CA  . LYS B 1 176 ? 8.953  38.741 25.391 1.00 9.45  ? 476 LYS C CA  1 
ATOM   3597 C C   . LYS B 1 176 ? 8.934  40.137 26.012 1.00 9.28  ? 476 LYS C C   1 
ATOM   3598 O O   . LYS B 1 176 ? 9.182  41.126 25.322 1.00 8.13  ? 476 LYS C O   1 
ATOM   3599 C CB  . LYS B 1 176 ? 10.276 38.070 25.760 1.00 7.86  ? 476 LYS C CB  1 
ATOM   3600 C CG  . LYS B 1 176 ? 11.478 38.906 25.280 1.00 6.96  ? 476 LYS C CG  1 
ATOM   3601 C CD  . LYS B 1 176 ? 12.764 38.120 25.245 1.00 5.98  ? 476 LYS C CD  1 
ATOM   3602 C CE  . LYS B 1 176 ? 13.920 38.998 24.811 1.00 4.54  ? 476 LYS C CE  1 
ATOM   3603 N NZ  . LYS B 1 176 ? 15.162 38.220 24.547 1.00 5.54  ? 476 LYS C NZ  1 
ATOM   3604 N N   . MET B 1 177 ? 8.656  40.213 27.312 1.00 9.54  ? 477 MET C N   1 
ATOM   3605 C CA  . MET B 1 177 ? 8.683  41.485 28.022 1.00 8.26  ? 477 MET C CA  1 
ATOM   3606 C C   . MET B 1 177 ? 10.143 41.913 28.017 1.00 10.11 ? 477 MET C C   1 
ATOM   3607 O O   . MET B 1 177 ? 11.033 41.058 28.028 1.00 6.71  ? 477 MET C O   1 
ATOM   3608 C CB  . MET B 1 177 ? 8.243  41.309 29.483 1.00 5.47  ? 477 MET C CB  1 
ATOM   3609 C CG  . MET B 1 177 ? 6.787  40.928 29.649 1.00 8.83  ? 477 MET C CG  1 
ATOM   3610 S SD  . MET B 1 177 ? 6.317  40.707 31.363 1.00 13.39 ? 477 MET C SD  1 
ATOM   3611 C CE  . MET B 1 177 ? 6.749  42.320 32.071 1.00 13.98 ? 477 MET C CE  1 
ATOM   3612 N N   . HIS B 1 178 ? 10.387 43.224 28.013 1.00 7.13  ? 478 HIS C N   1 
ATOM   3613 C CA  . HIS B 1 178 ? 11.752 43.744 28.028 1.00 9.07  ? 478 HIS C CA  1 
ATOM   3614 C C   . HIS B 1 178 ? 12.444 43.214 29.289 1.00 8.56  ? 478 HIS C C   1 
ATOM   3615 O O   . HIS B 1 178 ? 11.862 43.242 30.381 1.00 8.82  ? 478 HIS C O   1 
ATOM   3616 C CB  . HIS B 1 178 ? 11.726 45.281 28.044 1.00 11.37 ? 478 HIS C CB  1 
ATOM   3617 C CG  . HIS B 1 178 ? 13.084 45.910 28.109 1.00 12.92 ? 478 HIS C CG  1 
ATOM   3618 N ND1 . HIS B 1 178 ? 14.132 45.501 27.314 1.00 17.17 ? 478 HIS C ND1 1 
ATOM   3619 C CD2 . HIS B 1 178 ? 13.560 46.928 28.865 1.00 16.36 ? 478 HIS C CD2 1 
ATOM   3620 C CE1 . HIS B 1 178 ? 15.198 46.238 27.579 1.00 19.67 ? 478 HIS C CE1 1 
ATOM   3621 N NE2 . HIS B 1 178 ? 14.877 47.111 28.516 1.00 18.23 ? 478 HIS C NE2 1 
ATOM   3622 N N   . GLY B 1 179 ? 13.663 42.700 29.132 1.00 8.38  ? 479 GLY C N   1 
ATOM   3623 C CA  . GLY B 1 179 ? 14.397 42.169 30.275 1.00 6.84  ? 479 GLY C CA  1 
ATOM   3624 C C   . GLY B 1 179 ? 14.142 40.700 30.602 1.00 8.84  ? 479 GLY C C   1 
ATOM   3625 O O   . GLY B 1 179 ? 14.753 40.153 31.520 1.00 7.23  ? 479 GLY C O   1 
ATOM   3626 N N   . ARG B 1 180 ? 13.252 40.042 29.865 1.00 7.09  ? 480 ARG C N   1 
ATOM   3627 C CA  . ARG B 1 180 ? 12.959 38.632 30.150 1.00 8.88  ? 480 ARG C CA  1 
ATOM   3628 C C   . ARG B 1 180 ? 14.167 37.752 29.852 1.00 7.82  ? 480 ARG C C   1 
ATOM   3629 O O   . ARG B 1 180 ? 14.849 37.935 28.838 1.00 5.96  ? 480 ARG C O   1 
ATOM   3630 C CB  . ARG B 1 180 ? 11.744 38.160 29.323 1.00 9.18  ? 480 ARG C CB  1 
ATOM   3631 C CG  . ARG B 1 180 ? 11.409 36.657 29.409 1.00 8.82  ? 480 ARG C CG  1 
ATOM   3632 C CD  . ARG B 1 180 ? 12.236 35.809 28.437 1.00 8.59  ? 480 ARG C CD  1 
ATOM   3633 N NE  . ARG B 1 180 ? 11.758 34.420 28.342 1.00 7.03  ? 480 ARG C NE  1 
ATOM   3634 C CZ  . ARG B 1 180 ? 12.342 33.491 27.593 1.00 8.61  ? 480 ARG C CZ  1 
ATOM   3635 N NH1 . ARG B 1 180 ? 13.417 33.810 26.887 1.00 7.83  ? 480 ARG C NH1 1 
ATOM   3636 N NH2 . ARG B 1 180 ? 11.855 32.249 27.538 1.00 10.69 ? 480 ARG C NH2 1 
ATOM   3637 N N   . VAL B 1 181 ? 14.438 36.818 30.758 1.00 5.89  ? 481 VAL C N   1 
ATOM   3638 C CA  . VAL B 1 181 ? 15.529 35.873 30.588 1.00 3.80  ? 481 VAL C CA  1 
ATOM   3639 C C   . VAL B 1 181 ? 14.961 34.457 30.711 1.00 7.22  ? 481 VAL C C   1 
ATOM   3640 O O   . VAL B 1 181 ? 14.165 34.178 31.610 1.00 7.68  ? 481 VAL C O   1 
ATOM   3641 C CB  . VAL B 1 181 ? 16.626 36.083 31.656 1.00 8.08  ? 481 VAL C CB  1 
ATOM   3642 C CG1 . VAL B 1 181 ? 17.712 35.002 31.524 1.00 7.11  ? 481 VAL C CG1 1 
ATOM   3643 C CG2 . VAL B 1 181 ? 17.256 37.462 31.478 1.00 3.68  ? 481 VAL C CG2 1 
ATOM   3644 N N   . GLY B 1 182 ? 15.375 33.578 29.799 1.00 4.74  ? 482 GLY C N   1 
ATOM   3645 C CA  . GLY B 1 182 ? 14.929 32.197 29.805 1.00 8.11  ? 482 GLY C CA  1 
ATOM   3646 C C   . GLY B 1 182 ? 15.984 31.251 30.374 1.00 7.83  ? 482 GLY C C   1 
ATOM   3647 O O   . GLY B 1 182 ? 16.808 31.647 31.194 1.00 7.88  ? 482 GLY C O   1 
ATOM   3648 N N   . ASP B 1 183 ? 15.973 29.999 29.936 1.00 6.03  ? 483 ASP C N   1 
ATOM   3649 C CA  . ASP B 1 183 ? 16.917 29.030 30.478 1.00 7.76  ? 483 ASP C CA  1 
ATOM   3650 C C   . ASP B 1 183 ? 18.291 28.998 29.816 1.00 4.82  ? 483 ASP C C   1 
ATOM   3651 O O   . ASP B 1 183 ? 19.257 28.565 30.434 1.00 4.48  ? 483 ASP C O   1 
ATOM   3652 C CB  . ASP B 1 183 ? 16.305 27.615 30.429 1.00 5.98  ? 483 ASP C CB  1 
ATOM   3653 C CG  . ASP B 1 183 ? 16.209 27.063 29.010 1.00 8.93  ? 483 ASP C CG  1 
ATOM   3654 O OD1 . ASP B 1 183 ? 15.792 27.821 28.099 1.00 8.26  ? 483 ASP C OD1 1 
ATOM   3655 O OD2 . ASP B 1 183 ? 16.549 25.868 28.801 1.00 6.68  ? 483 ASP C OD2 1 
ATOM   3656 N N   . SER B 1 184 ? 18.386 29.475 28.580 1.00 5.41  ? 484 SER C N   1 
ATOM   3657 C CA  . SER B 1 184 ? 19.638 29.422 27.824 1.00 5.68  ? 484 SER C CA  1 
ATOM   3658 C C   . SER B 1 184 ? 20.930 29.944 28.470 1.00 6.39  ? 484 SER C C   1 
ATOM   3659 O O   . SER B 1 184 ? 21.999 29.378 28.225 1.00 9.31  ? 484 SER C O   1 
ATOM   3660 C CB  . SER B 1 184 ? 19.460 30.088 26.452 1.00 6.62  ? 484 SER C CB  1 
ATOM   3661 O OG  . SER B 1 184 ? 18.488 29.394 25.670 1.00 8.92  ? 484 SER C OG  1 
ATOM   3662 N N   . PRO B 1 185 ? 20.864 31.015 29.291 1.00 4.30  ? 485 PRO C N   1 
ATOM   3663 C CA  . PRO B 1 185 ? 22.124 31.481 29.882 1.00 5.81  ? 485 PRO C CA  1 
ATOM   3664 C C   . PRO B 1 185 ? 22.296 31.046 31.329 1.00 4.82  ? 485 PRO C C   1 
ATOM   3665 O O   . PRO B 1 185 ? 23.243 31.454 31.991 1.00 6.63  ? 485 PRO C O   1 
ATOM   3666 C CB  . PRO B 1 185 ? 21.996 32.989 29.779 1.00 4.07  ? 485 PRO C CB  1 
ATOM   3667 C CG  . PRO B 1 185 ? 20.552 33.177 30.200 1.00 4.74  ? 485 PRO C CG  1 
ATOM   3668 C CD  . PRO B 1 185 ? 19.820 32.052 29.432 1.00 5.84  ? 485 PRO C CD  1 
ATOM   3669 N N   . ILE B 1 186 ? 21.375 30.230 31.827 1.00 6.25  ? 486 ILE C N   1 
ATOM   3670 C CA  . ILE B 1 186 ? 21.442 29.801 33.217 1.00 6.00  ? 486 ILE C CA  1 
ATOM   3671 C C   . ILE B 1 186 ? 22.065 28.420 33.392 1.00 6.59  ? 486 ILE C C   1 
ATOM   3672 O O   . ILE B 1 186 ? 21.533 27.416 32.919 1.00 3.47  ? 486 ILE C O   1 
ATOM   3673 C CB  . ILE B 1 186 ? 20.038 29.842 33.852 1.00 10.01 ? 486 ILE C CB  1 
ATOM   3674 C CG1 . ILE B 1 186 ? 19.488 31.271 33.759 1.00 10.32 ? 486 ILE C CG1 1 
ATOM   3675 C CG2 . ILE B 1 186 ? 20.102 29.380 35.315 1.00 6.00  ? 486 ILE C CG2 1 
ATOM   3676 C CD1 . ILE B 1 186 ? 18.117 31.440 34.384 1.00 14.81 ? 486 ILE C CD1 1 
ATOM   3677 N N   . ILE B 1 187 ? 23.209 28.382 34.069 1.00 4.34  ? 487 ILE C N   1 
ATOM   3678 C CA  . ILE B 1 187 ? 23.917 27.125 34.298 1.00 5.58  ? 487 ILE C CA  1 
ATOM   3679 C C   . ILE B 1 187 ? 23.045 26.221 35.169 1.00 6.47  ? 487 ILE C C   1 
ATOM   3680 O O   . ILE B 1 187 ? 22.539 26.649 36.207 1.00 6.77  ? 487 ILE C O   1 
ATOM   3681 C CB  . ILE B 1 187 ? 25.274 27.387 34.983 1.00 8.38  ? 487 ILE C CB  1 
ATOM   3682 C CG1 . ILE B 1 187 ? 26.197 28.165 34.034 1.00 9.58  ? 487 ILE C CG1 1 
ATOM   3683 C CG2 . ILE B 1 187 ? 25.896 26.078 35.437 1.00 8.85  ? 487 ILE C CG2 1 
ATOM   3684 C CD1 . ILE B 1 187 ? 26.664 27.378 32.808 1.00 6.81  ? 487 ILE C CD1 1 
ATOM   3685 N N   . GLY B 1 188 ? 22.853 24.978 34.739 1.00 6.14  ? 488 GLY C N   1 
ATOM   3686 C CA  . GLY B 1 188 ? 22.014 24.070 35.505 1.00 5.56  ? 488 GLY C CA  1 
ATOM   3687 C C   . GLY B 1 188 ? 20.607 24.018 34.929 1.00 8.33  ? 488 GLY C C   1 
ATOM   3688 O O   . GLY B 1 188 ? 19.849 23.067 35.197 1.00 5.20  ? 488 GLY C O   1 
ATOM   3689 N N   . ALA B 1 189 ? 20.237 25.049 34.166 1.00 6.41  ? 489 ALA C N   1 
ATOM   3690 C CA  . ALA B 1 189 ? 18.926 25.077 33.522 1.00 4.85  ? 489 ALA C CA  1 
ATOM   3691 C C   . ALA B 1 189 ? 19.152 24.755 32.043 1.00 6.73  ? 489 ALA C C   1 
ATOM   3692 O O   . ALA B 1 189 ? 18.989 23.618 31.628 1.00 3.21  ? 489 ALA C O   1 
ATOM   3693 C CB  . ALA B 1 189 ? 18.261 26.448 33.675 1.00 5.02  ? 489 ALA C CB  1 
ATOM   3694 N N   . GLY B 1 190 ? 19.569 25.744 31.255 1.00 6.10  ? 490 GLY C N   1 
ATOM   3695 C CA  . GLY B 1 190 ? 19.794 25.485 29.841 1.00 5.06  ? 490 GLY C CA  1 
ATOM   3696 C C   . GLY B 1 190 ? 21.015 24.644 29.516 1.00 6.59  ? 490 GLY C C   1 
ATOM   3697 O O   . GLY B 1 190 ? 21.101 24.029 28.445 1.00 5.71  ? 490 GLY C O   1 
ATOM   3698 N N   . LEU B 1 191 ? 21.966 24.596 30.436 1.00 4.07  ? 491 LEU C N   1 
ATOM   3699 C CA  . LEU B 1 191 ? 23.177 23.846 30.167 1.00 5.48  ? 491 LEU C CA  1 
ATOM   3700 C C   . LEU B 1 191 ? 23.915 23.422 31.420 1.00 3.98  ? 491 LEU C C   1 
ATOM   3701 O O   . LEU B 1 191 ? 23.989 24.164 32.397 1.00 4.94  ? 491 LEU C O   1 
ATOM   3702 C CB  . LEU B 1 191 ? 24.123 24.706 29.317 1.00 5.94  ? 491 LEU C CB  1 
ATOM   3703 C CG  . LEU B 1 191 ? 25.547 24.199 29.086 1.00 5.45  ? 491 LEU C CG  1 
ATOM   3704 C CD1 . LEU B 1 191 ? 25.540 23.073 28.057 1.00 5.37  ? 491 LEU C CD1 1 
ATOM   3705 C CD2 . LEU B 1 191 ? 26.430 25.364 28.586 1.00 8.19  ? 491 LEU C CD2 1 
ATOM   3706 N N   . PHE B 1 192 ? 24.466 22.215 31.395 1.00 4.22  ? 492 PHE C N   1 
ATOM   3707 C CA  . PHE B 1 192 ? 25.258 21.762 32.521 1.00 4.60  ? 492 PHE C CA  1 
ATOM   3708 C C   . PHE B 1 192 ? 26.243 20.707 32.060 1.00 6.23  ? 492 PHE C C   1 
ATOM   3709 O O   . PHE B 1 192 ? 25.891 19.823 31.279 1.00 4.20  ? 492 PHE C O   1 
ATOM   3710 C CB  . PHE B 1 192 ? 24.405 21.227 33.660 1.00 4.37  ? 492 PHE C CB  1 
ATOM   3711 C CG  . PHE B 1 192 ? 25.194 21.008 34.916 1.00 4.40  ? 492 PHE C CG  1 
ATOM   3712 C CD1 . PHE B 1 192 ? 25.561 19.724 35.317 1.00 6.95  ? 492 PHE C CD1 1 
ATOM   3713 C CD2 . PHE B 1 192 ? 25.651 22.107 35.651 1.00 7.75  ? 492 PHE C CD2 1 
ATOM   3714 C CE1 . PHE B 1 192 ? 26.381 19.540 36.436 1.00 7.52  ? 492 PHE C CE1 1 
ATOM   3715 C CE2 . PHE B 1 192 ? 26.468 21.938 36.766 1.00 6.62  ? 492 PHE C CE2 1 
ATOM   3716 C CZ  . PHE B 1 192 ? 26.835 20.656 37.159 1.00 9.24  ? 492 PHE C CZ  1 
ATOM   3717 N N   . VAL B 1 193 ? 27.480 20.835 32.543 1.00 5.31  ? 493 VAL C N   1 
ATOM   3718 C CA  . VAL B 1 193 ? 28.572 19.936 32.186 1.00 4.24  ? 493 VAL C CA  1 
ATOM   3719 C C   . VAL B 1 193 ? 29.396 19.513 33.401 1.00 5.93  ? 493 VAL C C   1 
ATOM   3720 O O   . VAL B 1 193 ? 29.906 20.347 34.139 1.00 6.67  ? 493 VAL C O   1 
ATOM   3721 C CB  . VAL B 1 193 ? 29.560 20.620 31.180 1.00 4.85  ? 493 VAL C CB  1 
ATOM   3722 C CG1 . VAL B 1 193 ? 30.671 19.655 30.803 1.00 4.53  ? 493 VAL C CG1 1 
ATOM   3723 C CG2 . VAL B 1 193 ? 28.817 21.094 29.926 1.00 4.32  ? 493 VAL C CG2 1 
ATOM   3724 N N   . ASP B 1 194 ? 29.518 18.206 33.605 1.00 6.79  ? 494 ASP C N   1 
ATOM   3725 C CA  . ASP B 1 194 ? 30.340 17.676 34.693 1.00 6.99  ? 494 ASP C CA  1 
ATOM   3726 C C   . ASP B 1 194 ? 31.225 16.656 33.988 1.00 6.31  ? 494 ASP C C   1 
ATOM   3727 O O   . ASP B 1 194 ? 30.740 15.625 33.520 1.00 8.20  ? 494 ASP C O   1 
ATOM   3728 C CB  . ASP B 1 194 ? 29.475 17.001 35.751 1.00 7.58  ? 494 ASP C CB  1 
ATOM   3729 C CG  . ASP B 1 194 ? 30.297 16.461 36.912 1.00 14.21 ? 494 ASP C CG  1 
ATOM   3730 O OD1 . ASP B 1 194 ? 31.424 15.972 36.677 1.00 13.05 ? 494 ASP C OD1 1 
ATOM   3731 O OD2 . ASP B 1 194 ? 29.809 16.512 38.058 1.00 17.38 ? 494 ASP C OD2 1 
ATOM   3732 N N   . ASN B 1 195 ? 32.514 16.956 33.889 1.00 6.54  ? 495 ASN C N   1 
ATOM   3733 C CA  . ASN B 1 195 ? 33.450 16.088 33.176 1.00 7.12  ? 495 ASN C CA  1 
ATOM   3734 C C   . ASN B 1 195 ? 33.588 14.671 33.713 1.00 7.91  ? 495 ASN C C   1 
ATOM   3735 O O   . ASN B 1 195 ? 34.114 13.806 33.017 1.00 7.76  ? 495 ASN C O   1 
ATOM   3736 C CB  . ASN B 1 195 ? 34.826 16.750 33.103 1.00 6.61  ? 495 ASN C CB  1 
ATOM   3737 C CG  . ASN B 1 195 ? 35.568 16.401 31.834 1.00 8.62  ? 495 ASN C CG  1 
ATOM   3738 O OD1 . ASN B 1 195 ? 34.964 16.255 30.772 1.00 6.74  ? 495 ASN C OD1 1 
ATOM   3739 N ND2 . ASN B 1 195 ? 36.889 16.283 31.930 1.00 9.14  ? 495 ASN C ND2 1 
ATOM   3740 N N   . GLU B 1 196 ? 33.142 14.423 34.943 1.00 8.13  ? 496 GLU C N   1 
ATOM   3741 C CA  . GLU B 1 196 ? 33.227 13.062 35.492 1.00 13.34 ? 496 GLU C CA  1 
ATOM   3742 C C   . GLU B 1 196 ? 31.928 12.295 35.240 1.00 14.00 ? 496 GLU C C   1 
ATOM   3743 O O   . GLU B 1 196 ? 31.808 11.126 35.600 1.00 15.95 ? 496 GLU C O   1 
ATOM   3744 C CB  . GLU B 1 196 ? 33.495 13.091 37.002 1.00 13.74 ? 496 GLU C CB  1 
ATOM   3745 C CG  . GLU B 1 196 ? 34.833 13.678 37.372 1.00 21.67 ? 496 GLU C CG  1 
ATOM   3746 C CD  . GLU B 1 196 ? 35.950 13.089 36.546 1.00 26.35 ? 496 GLU C CD  1 
ATOM   3747 O OE1 . GLU B 1 196 ? 36.101 11.848 36.551 1.00 29.44 ? 496 GLU C OE1 1 
ATOM   3748 O OE2 . GLU B 1 196 ? 36.676 13.866 35.886 1.00 32.31 ? 496 GLU C OE2 1 
ATOM   3749 N N   . ILE B 1 197 ? 30.962 12.947 34.600 1.00 10.58 ? 497 ILE C N   1 
ATOM   3750 C CA  . ILE B 1 197 ? 29.667 12.305 34.365 1.00 8.51  ? 497 ILE C CA  1 
ATOM   3751 C C   . ILE B 1 197 ? 29.131 12.428 32.938 1.00 7.71  ? 497 ILE C C   1 
ATOM   3752 O O   . ILE B 1 197 ? 28.948 11.430 32.223 1.00 5.94  ? 497 ILE C O   1 
ATOM   3753 C CB  . ILE B 1 197 ? 28.600 12.910 35.315 1.00 7.02  ? 497 ILE C CB  1 
ATOM   3754 C CG1 . ILE B 1 197 ? 29.044 12.747 36.768 1.00 11.52 ? 497 ILE C CG1 1 
ATOM   3755 C CG2 . ILE B 1 197 ? 27.244 12.262 35.067 1.00 7.02  ? 497 ILE C CG2 1 
ATOM   3756 C CD1 . ILE B 1 197 ? 28.212 13.567 37.757 1.00 15.25 ? 497 ILE C CD1 1 
ATOM   3757 N N   . GLY B 1 198 ? 28.847 13.664 32.535 1.00 6.82  ? 498 GLY C N   1 
ATOM   3758 C CA  . GLY B 1 198 ? 28.295 13.900 31.215 1.00 5.83  ? 498 GLY C CA  1 
ATOM   3759 C C   . GLY B 1 198 ? 27.835 15.340 31.091 1.00 6.97  ? 498 GLY C C   1 
ATOM   3760 O O   . GLY B 1 198 ? 28.114 16.157 31.962 1.00 5.30  ? 498 GLY C O   1 
ATOM   3761 N N   . ALA B 1 199 ? 27.131 15.656 30.013 1.00 5.52  ? 499 ALA C N   1 
ATOM   3762 C CA  . ALA B 1 199 ? 26.653 17.026 29.802 1.00 5.30  ? 499 ALA C CA  1 
ATOM   3763 C C   . ALA B 1 199 ? 25.263 16.976 29.217 1.00 4.80  ? 499 ALA C C   1 
ATOM   3764 O O   . ALA B 1 199 ? 24.864 15.974 28.636 1.00 4.35  ? 499 ALA C O   1 
ATOM   3765 C CB  . ALA B 1 199 ? 27.576 17.757 28.825 1.00 8.48  ? 499 ALA C CB  1 
ATOM   3766 N N   . ALA B 1 200 ? 24.531 18.074 29.346 1.00 4.17  ? 500 ALA C N   1 
ATOM   3767 C CA  . ALA B 1 200 ? 23.189 18.111 28.797 1.00 4.37  ? 500 ALA C CA  1 
ATOM   3768 C C   . ALA B 1 200 ? 22.842 19.556 28.506 1.00 5.31  ? 500 ALA C C   1 
ATOM   3769 O O   . ALA B 1 200 ? 23.320 20.459 29.189 1.00 4.86  ? 500 ALA C O   1 
ATOM   3770 C CB  . ALA B 1 200 ? 22.190 17.521 29.809 1.00 3.50  ? 500 ALA C CB  1 
ATOM   3771 N N   . THR B 1 201 ? 22.037 19.769 27.476 1.00 5.76  ? 501 THR C N   1 
ATOM   3772 C CA  . THR B 1 201 ? 21.589 21.106 27.167 1.00 5.47  ? 501 THR C CA  1 
ATOM   3773 C C   . THR B 1 201 ? 20.109 20.988 26.822 1.00 5.17  ? 501 THR C C   1 
ATOM   3774 O O   . THR B 1 201 ? 19.641 19.920 26.406 1.00 6.47  ? 501 THR C O   1 
ATOM   3775 C CB  . THR B 1 201 ? 22.430 21.754 26.030 1.00 5.82  ? 501 THR C CB  1 
ATOM   3776 O OG1 . THR B 1 201 ? 22.064 23.129 25.899 1.00 6.89  ? 501 THR C OG1 1 
ATOM   3777 C CG2 . THR B 1 201 ? 22.231 21.053 24.705 1.00 4.19  ? 501 THR C CG2 1 
ATOM   3778 N N   . ALA B 1 202 ? 19.375 22.076 27.024 1.00 5.09  ? 502 ALA C N   1 
ATOM   3779 C CA  . ALA B 1 202 ? 17.930 22.092 26.792 1.00 6.95  ? 502 ALA C CA  1 
ATOM   3780 C C   . ALA B 1 202 ? 17.484 23.184 25.825 1.00 8.91  ? 502 ALA C C   1 
ATOM   3781 O O   . ALA B 1 202 ? 18.214 24.161 25.575 1.00 7.98  ? 502 ALA C O   1 
ATOM   3782 C CB  . ALA B 1 202 ? 17.213 22.293 28.115 1.00 4.72  ? 502 ALA C CB  1 
ATOM   3783 N N   . THR B 1 203 ? 16.261 23.031 25.321 1.00 6.75  ? 503 THR C N   1 
ATOM   3784 C CA  . THR B 1 203 ? 15.680 24.005 24.401 1.00 6.23  ? 503 THR C CA  1 
ATOM   3785 C C   . THR B 1 203 ? 14.162 23.927 24.521 1.00 8.01  ? 503 THR C C   1 
ATOM   3786 O O   . THR B 1 203 ? 13.615 22.886 24.905 1.00 8.45  ? 503 THR C O   1 
ATOM   3787 C CB  . THR B 1 203 ? 16.100 23.710 22.941 1.00 6.97  ? 503 THR C CB  1 
ATOM   3788 O OG1 . THR B 1 203 ? 15.672 24.786 22.095 1.00 10.41 ? 503 THR C OG1 1 
ATOM   3789 C CG2 . THR B 1 203 ? 15.440 22.406 22.444 1.00 6.44  ? 503 THR C CG2 1 
ATOM   3790 N N   . GLY B 1 204 ? 13.481 25.029 24.228 1.00 6.86  ? 504 GLY C N   1 
ATOM   3791 C CA  . GLY B 1 204 ? 12.028 25.030 24.300 1.00 7.41  ? 504 GLY C CA  1 
ATOM   3792 C C   . GLY B 1 204 ? 11.519 26.150 25.179 1.00 9.39  ? 504 GLY C C   1 
ATOM   3793 O O   . GLY B 1 204 ? 12.133 27.222 25.219 1.00 9.29  ? 504 GLY C O   1 
ATOM   3794 N N   . HIS B 1 205 ? 10.406 25.913 25.873 1.00 5.51  ? 505 HIS C N   1 
ATOM   3795 C CA  . HIS B 1 205 ? 9.838  26.916 26.770 1.00 9.93  ? 505 HIS C CA  1 
ATOM   3796 C C   . HIS B 1 205 ? 10.746 27.017 27.984 1.00 8.14  ? 505 HIS C C   1 
ATOM   3797 O O   . HIS B 1 205 ? 10.579 26.274 28.954 1.00 9.47  ? 505 HIS C O   1 
ATOM   3798 C CB  . HIS B 1 205 ? 8.421  26.534 27.196 1.00 10.00 ? 505 HIS C CB  1 
ATOM   3799 C CG  . HIS B 1 205 ? 7.401  26.772 26.128 1.00 16.09 ? 505 HIS C CG  1 
ATOM   3800 N ND1 . HIS B 1 205 ? 6.874  25.754 25.368 1.00 16.75 ? 505 HIS C ND1 1 
ATOM   3801 C CD2 . HIS B 1 205 ? 6.845  27.917 25.662 1.00 17.83 ? 505 HIS C CD2 1 
ATOM   3802 C CE1 . HIS B 1 205 ? 6.034  26.255 24.481 1.00 17.04 ? 505 HIS C CE1 1 
ATOM   3803 N NE2 . HIS B 1 205 ? 5.998  27.567 24.637 1.00 16.18 ? 505 HIS C NE2 1 
ATOM   3804 N N   . GLY B 1 206 ? 11.706 27.939 27.892 1.00 6.63  ? 506 GLY C N   1 
ATOM   3805 C CA  . GLY B 1 206 ? 12.704 28.139 28.931 1.00 8.11  ? 506 GLY C CA  1 
ATOM   3806 C C   . GLY B 1 206 ? 12.236 28.233 30.362 1.00 8.62  ? 506 GLY C C   1 
ATOM   3807 O O   . GLY B 1 206 ? 12.891 27.688 31.246 1.00 5.56  ? 506 GLY C O   1 
ATOM   3808 N N   . GLU B 1 207 ? 11.133 28.941 30.596 1.00 5.84  ? 507 GLU C N   1 
ATOM   3809 C CA  . GLU B 1 207 ? 10.587 29.079 31.944 1.00 8.26  ? 507 GLU C CA  1 
ATOM   3810 C C   . GLU B 1 207 ? 10.425 27.709 32.608 1.00 7.10  ? 507 GLU C C   1 
ATOM   3811 O O   . GLU B 1 207 ? 10.637 27.555 33.815 1.00 6.74  ? 507 GLU C O   1 
ATOM   3812 C CB  . GLU B 1 207 ? 9.209  29.765 31.892 1.00 9.91  ? 507 GLU C CB  1 
ATOM   3813 C CG  . GLU B 1 207 ? 9.223  31.290 31.726 1.00 8.87  ? 507 GLU C CG  1 
ATOM   3814 C CD  . GLU B 1 207 ? 9.676  31.767 30.345 1.00 12.39 ? 507 GLU C CD  1 
ATOM   3815 O OE1 . GLU B 1 207 ? 9.739  30.949 29.399 1.00 6.90  ? 507 GLU C OE1 1 
ATOM   3816 O OE2 . GLU B 1 207 ? 9.957  32.979 30.214 1.00 10.50 ? 507 GLU C OE2 1 
ATOM   3817 N N   . GLU B 1 208 ? 10.045 26.710 31.817 1.00 7.31  ? 508 GLU C N   1 
ATOM   3818 C CA  . GLU B 1 208 ? 9.818  25.368 32.359 1.00 5.64  ? 508 GLU C CA  1 
ATOM   3819 C C   . GLU B 1 208 ? 11.100 24.626 32.703 1.00 6.43  ? 508 GLU C C   1 
ATOM   3820 O O   . GLU B 1 208 ? 11.124 23.790 33.602 1.00 5.82  ? 508 GLU C O   1 
ATOM   3821 C CB  . GLU B 1 208 ? 8.976  24.546 31.377 1.00 6.08  ? 508 GLU C CB  1 
ATOM   3822 C CG  . GLU B 1 208 ? 7.609  25.172 31.077 1.00 8.39  ? 508 GLU C CG  1 
ATOM   3823 C CD  . GLU B 1 208 ? 6.857  25.607 32.338 1.00 9.94  ? 508 GLU C CD  1 
ATOM   3824 O OE1 . GLU B 1 208 ? 6.857  24.848 33.327 1.00 7.17  ? 508 GLU C OE1 1 
ATOM   3825 O OE2 . GLU B 1 208 ? 6.258  26.705 32.333 1.00 10.93 ? 508 GLU C OE2 1 
ATOM   3826 N N   . VAL B 1 209 ? 12.169 24.929 31.978 1.00 5.25  ? 509 VAL C N   1 
ATOM   3827 C CA  . VAL B 1 209 ? 13.459 24.311 32.233 1.00 5.40  ? 509 VAL C CA  1 
ATOM   3828 C C   . VAL B 1 209 ? 14.072 24.946 33.474 1.00 7.15  ? 509 VAL C C   1 
ATOM   3829 O O   . VAL B 1 209 ? 14.737 24.281 34.262 1.00 9.20  ? 509 VAL C O   1 
ATOM   3830 C CB  . VAL B 1 209 ? 14.408 24.496 31.025 1.00 4.65  ? 509 VAL C CB  1 
ATOM   3831 C CG1 . VAL B 1 209 ? 15.792 23.965 31.367 1.00 8.33  ? 509 VAL C CG1 1 
ATOM   3832 C CG2 . VAL B 1 209 ? 13.858 23.740 29.824 1.00 6.13  ? 509 VAL C CG2 1 
ATOM   3833 N N   . ILE B 1 210 ? 13.851 26.243 33.650 1.00 4.19  ? 510 ILE C N   1 
ATOM   3834 C CA  . ILE B 1 210 ? 14.364 26.908 34.839 1.00 4.31  ? 510 ILE C CA  1 
ATOM   3835 C C   . ILE B 1 210 ? 13.667 26.361 36.087 1.00 6.39  ? 510 ILE C C   1 
ATOM   3836 O O   . ILE B 1 210 ? 14.315 26.058 37.101 1.00 5.00  ? 510 ILE C O   1 
ATOM   3837 C CB  . ILE B 1 210 ? 14.106 28.432 34.807 1.00 5.29  ? 510 ILE C CB  1 
ATOM   3838 C CG1 . ILE B 1 210 ? 14.940 29.086 33.713 1.00 3.03  ? 510 ILE C CG1 1 
ATOM   3839 C CG2 . ILE B 1 210 ? 14.469 29.045 36.170 1.00 4.36  ? 510 ILE C CG2 1 
ATOM   3840 C CD1 . ILE B 1 210 ? 14.565 30.549 33.474 1.00 4.17  ? 510 ILE C CD1 1 
ATOM   3841 N N   . ARG B 1 211 ? 12.345 26.224 36.025 1.00 7.81  ? 511 ARG C N   1 
ATOM   3842 C CA  . ARG B 1 211 ? 11.633 25.767 37.206 1.00 9.07  ? 511 ARG C CA  1 
ATOM   3843 C C   . ARG B 1 211 ? 11.947 24.329 37.628 1.00 9.33  ? 511 ARG C C   1 
ATOM   3844 O O   . ARG B 1 211 ? 11.706 23.952 38.777 1.00 10.38 ? 511 ARG C O   1 
ATOM   3845 C CB  . ARG B 1 211 ? 10.113 26.039 37.058 1.00 16.63 ? 511 ARG C CB  1 
ATOM   3846 C CG  . ARG B 1 211 ? 9.243  24.903 36.621 1.00 17.62 ? 511 ARG C CG  1 
ATOM   3847 C CD  . ARG B 1 211 ? 7.748  25.285 36.723 1.00 12.59 ? 511 ARG C CD  1 
ATOM   3848 N NE  . ARG B 1 211 ? 7.341  26.255 35.711 1.00 8.41  ? 511 ARG C NE  1 
ATOM   3849 C CZ  . ARG B 1 211 ? 7.009  27.515 35.952 1.00 8.00  ? 511 ARG C CZ  1 
ATOM   3850 N NH1 . ARG B 1 211 ? 7.029  27.988 37.196 1.00 5.80  ? 511 ARG C NH1 1 
ATOM   3851 N NH2 . ARG B 1 211 ? 6.650  28.303 34.941 1.00 8.50  ? 511 ARG C NH2 1 
ATOM   3852 N N   . THR B 1 212 ? 12.525 23.536 36.727 1.00 8.51  ? 512 THR C N   1 
ATOM   3853 C CA  . THR B 1 212 ? 12.907 22.164 37.058 1.00 10.53 ? 512 THR C CA  1 
ATOM   3854 C C   . THR B 1 212 ? 14.441 21.978 37.107 1.00 8.23  ? 512 THR C C   1 
ATOM   3855 O O   . THR B 1 212 ? 14.927 20.880 37.363 1.00 8.01  ? 512 THR C O   1 
ATOM   3856 C CB  . THR B 1 212 ? 12.307 21.155 36.040 1.00 12.80 ? 512 THR C CB  1 
ATOM   3857 O OG1 . THR B 1 212 ? 12.665 21.545 34.704 1.00 13.89 ? 512 THR C OG1 1 
ATOM   3858 C CG2 . THR B 1 212 ? 10.776 21.133 36.152 1.00 17.51 ? 512 THR C CG2 1 
ATOM   3859 N N   . VAL B 1 213 ? 15.192 23.055 36.867 1.00 6.70  ? 513 VAL C N   1 
ATOM   3860 C CA  . VAL B 1 213 ? 16.667 23.035 36.849 1.00 3.82  ? 513 VAL C CA  1 
ATOM   3861 C C   . VAL B 1 213 ? 17.076 21.853 35.971 1.00 5.26  ? 513 VAL C C   1 
ATOM   3862 O O   . VAL B 1 213 ? 17.936 21.025 36.317 1.00 5.73  ? 513 VAL C O   1 
ATOM   3863 C CB  . VAL B 1 213 ? 17.276 22.887 38.284 1.00 5.04  ? 513 VAL C CB  1 
ATOM   3864 C CG1 . VAL B 1 213 ? 18.750 23.328 38.254 1.00 6.89  ? 513 VAL C CG1 1 
ATOM   3865 C CG2 . VAL B 1 213 ? 16.523 23.774 39.284 1.00 7.33  ? 513 VAL C CG2 1 
ATOM   3866 N N   . GLY B 1 214 ? 16.423 21.815 34.818 1.00 4.35  ? 514 GLY C N   1 
ATOM   3867 C CA  . GLY B 1 214 ? 16.562 20.745 33.852 1.00 4.69  ? 514 GLY C CA  1 
ATOM   3868 C C   . GLY B 1 214 ? 17.861 20.022 33.558 1.00 5.69  ? 514 GLY C C   1 
ATOM   3869 O O   . GLY B 1 214 ? 17.952 18.814 33.777 1.00 6.47  ? 514 GLY C O   1 
ATOM   3870 N N   . THR B 1 215 ? 18.865 20.723 33.047 1.00 2.95  ? 515 THR C N   1 
ATOM   3871 C CA  . THR B 1 215 ? 20.093 20.019 32.696 1.00 3.13  ? 515 THR C CA  1 
ATOM   3872 C C   . THR B 1 215 ? 20.874 19.519 33.893 1.00 3.46  ? 515 THR C C   1 
ATOM   3873 O O   . THR B 1 215 ? 21.561 18.506 33.785 1.00 4.06  ? 515 THR C O   1 
ATOM   3874 C CB  . THR B 1 215 ? 20.990 20.872 31.780 1.00 5.29  ? 515 THR C CB  1 
ATOM   3875 O OG1 . THR B 1 215 ? 21.200 22.160 32.370 1.00 2.65  ? 515 THR C OG1 1 
ATOM   3876 C CG2 . THR B 1 215 ? 20.314 21.045 30.416 1.00 2.47  ? 515 THR C CG2 1 
ATOM   3877 N N   . HIS B 1 216 ? 20.792 20.216 35.026 1.00 3.67  ? 516 HIS C N   1 
ATOM   3878 C CA  . HIS B 1 216 ? 21.499 19.719 36.207 1.00 2.44  ? 516 HIS C CA  1 
ATOM   3879 C C   . HIS B 1 216 ? 20.848 18.387 36.589 1.00 4.59  ? 516 HIS C C   1 
ATOM   3880 O O   . HIS B 1 216 ? 21.537 17.427 36.948 1.00 6.53  ? 516 HIS C O   1 
ATOM   3881 C CB  . HIS B 1 216 ? 21.386 20.691 37.382 1.00 5.40  ? 516 HIS C CB  1 
ATOM   3882 C CG  . HIS B 1 216 ? 22.097 20.221 38.611 1.00 5.23  ? 516 HIS C CG  1 
ATOM   3883 N ND1 . HIS B 1 216 ? 23.465 20.086 38.673 1.00 6.75  ? 516 HIS C ND1 1 
ATOM   3884 C CD2 . HIS B 1 216 ? 21.624 19.802 39.809 1.00 4.44  ? 516 HIS C CD2 1 
ATOM   3885 C CE1 . HIS B 1 216 ? 23.806 19.603 39.857 1.00 4.03  ? 516 HIS C CE1 1 
ATOM   3886 N NE2 . HIS B 1 216 ? 22.707 19.420 40.563 1.00 9.87  ? 516 HIS C NE2 1 
ATOM   3887 N N   . LEU B 1 217 ? 19.517 18.338 36.511 1.00 6.29  ? 517 LEU C N   1 
ATOM   3888 C CA  . LEU B 1 217 ? 18.773 17.117 36.832 1.00 7.31  ? 517 LEU C CA  1 
ATOM   3889 C C   . LEU B 1 217 ? 19.184 15.979 35.892 1.00 6.41  ? 517 LEU C C   1 
ATOM   3890 O O   . LEU B 1 217 ? 19.420 14.845 36.331 1.00 6.92  ? 517 LEU C O   1 
ATOM   3891 C CB  . LEU B 1 217 ? 17.274 17.352 36.680 1.00 7.46  ? 517 LEU C CB  1 
ATOM   3892 C CG  . LEU B 1 217 ? 16.408 16.102 36.896 1.00 5.59  ? 517 LEU C CG  1 
ATOM   3893 C CD1 . LEU B 1 217 ? 16.608 15.580 38.310 1.00 8.75  ? 517 LEU C CD1 1 
ATOM   3894 C CD2 . LEU B 1 217 ? 14.942 16.446 36.647 1.00 11.48 ? 517 LEU C CD2 1 
ATOM   3895 N N   . VAL B 1 218 ? 19.255 16.278 34.595 1.00 4.90  ? 518 VAL C N   1 
ATOM   3896 C CA  . VAL B 1 218 ? 19.637 15.258 33.619 1.00 3.91  ? 518 VAL C CA  1 
ATOM   3897 C C   . VAL B 1 218 ? 21.014 14.694 33.945 1.00 4.73  ? 518 VAL C C   1 
ATOM   3898 O O   . VAL B 1 218 ? 21.218 13.474 33.917 1.00 4.96  ? 518 VAL C O   1 
ATOM   3899 C CB  . VAL B 1 218 ? 19.668 15.817 32.172 1.00 3.21  ? 518 VAL C CB  1 
ATOM   3900 C CG1 . VAL B 1 218 ? 20.296 14.781 31.214 1.00 1.46  ? 518 VAL C CG1 1 
ATOM   3901 C CG2 . VAL B 1 218 ? 18.245 16.130 31.711 1.00 3.72  ? 518 VAL C CG2 1 
ATOM   3902 N N   . VAL B 1 219 ? 21.958 15.575 34.260 1.00 2.50  ? 519 VAL C N   1 
ATOM   3903 C CA  . VAL B 1 219 ? 23.318 15.134 34.564 1.00 4.98  ? 519 VAL C CA  1 
ATOM   3904 C C   . VAL B 1 219 ? 23.373 14.370 35.886 1.00 6.09  ? 519 VAL C C   1 
ATOM   3905 O O   . VAL B 1 219 ? 24.067 13.358 36.000 1.00 6.01  ? 519 VAL C O   1 
ATOM   3906 C CB  . VAL B 1 219 ? 24.293 16.342 34.570 1.00 5.34  ? 519 VAL C CB  1 
ATOM   3907 C CG1 . VAL B 1 219 ? 25.657 15.928 35.063 1.00 4.92  ? 519 VAL C CG1 1 
ATOM   3908 C CG2 . VAL B 1 219 ? 24.406 16.909 33.127 1.00 4.13  ? 519 VAL C CG2 1 
ATOM   3909 N N   . GLU B 1 220 ? 22.626 14.841 36.875 1.00 6.36  ? 520 GLU C N   1 
ATOM   3910 C CA  . GLU B 1 220 ? 22.590 14.158 38.174 1.00 10.16 ? 520 GLU C CA  1 
ATOM   3911 C C   . GLU B 1 220 ? 21.996 12.756 38.004 1.00 6.94  ? 520 GLU C C   1 
ATOM   3912 O O   . GLU B 1 220 ? 22.402 11.808 38.689 1.00 9.84  ? 520 GLU C O   1 
ATOM   3913 C CB  . GLU B 1 220 ? 21.762 14.965 39.173 1.00 12.48 ? 520 GLU C CB  1 
ATOM   3914 C CG  . GLU B 1 220 ? 22.068 14.650 40.628 1.00 21.95 ? 520 GLU C CG  1 
ATOM   3915 C CD  . GLU B 1 220 ? 23.551 14.778 40.941 1.00 24.09 ? 520 GLU C CD  1 
ATOM   3916 O OE1 . GLU B 1 220 ? 24.156 15.813 40.583 1.00 29.48 ? 520 GLU C OE1 1 
ATOM   3917 O OE2 . GLU B 1 220 ? 24.110 13.848 41.547 1.00 24.44 ? 520 GLU C OE2 1 
ATOM   3918 N N   . LEU B 1 221 ? 21.031 12.617 37.099 1.00 6.73  ? 521 LEU C N   1 
ATOM   3919 C CA  . LEU B 1 221 ? 20.444 11.303 36.843 1.00 5.99  ? 521 LEU C CA  1 
ATOM   3920 C C   . LEU B 1 221 ? 21.493 10.401 36.198 1.00 7.19  ? 521 LEU C C   1 
ATOM   3921 O O   . LEU B 1 221 ? 21.589 9.215  36.532 1.00 5.99  ? 521 LEU C O   1 
ATOM   3922 C CB  . LEU B 1 221 ? 19.195 11.411 35.956 1.00 6.32  ? 521 LEU C CB  1 
ATOM   3923 C CG  . LEU B 1 221 ? 18.020 12.059 36.696 1.00 4.76  ? 521 LEU C CG  1 
ATOM   3924 C CD1 . LEU B 1 221 ? 16.848 12.255 35.729 1.00 7.77  ? 521 LEU C CD1 1 
ATOM   3925 C CD2 . LEU B 1 221 ? 17.598 11.155 37.881 1.00 7.82  ? 521 LEU C CD2 1 
ATOM   3926 N N   . MET B 1 222 ? 22.275 10.940 35.266 1.00 5.88  ? 522 MET C N   1 
ATOM   3927 C CA  . MET B 1 222 ? 23.339 10.128 34.678 1.00 7.82  ? 522 MET C CA  1 
ATOM   3928 C C   . MET B 1 222 ? 24.344 9.751  35.784 1.00 8.07  ? 522 MET C C   1 
ATOM   3929 O O   . MET B 1 222 ? 24.931 8.666  35.760 1.00 5.99  ? 522 MET C O   1 
ATOM   3930 C CB  . MET B 1 222 ? 24.053 10.882 33.553 1.00 7.37  ? 522 MET C CB  1 
ATOM   3931 C CG  . MET B 1 222 ? 23.199 11.029 32.278 1.00 7.93  ? 522 MET C CG  1 
ATOM   3932 S SD  . MET B 1 222 ? 24.152 11.591 30.837 1.00 8.53  ? 522 MET C SD  1 
ATOM   3933 C CE  . MET B 1 222 ? 24.350 13.349 31.245 1.00 6.75  ? 522 MET C CE  1 
ATOM   3934 N N   . ASN B 1 223 ? 24.527 10.641 36.757 1.00 6.84  ? 523 ASN C N   1 
ATOM   3935 C CA  . ASN B 1 223 ? 25.451 10.374 37.863 1.00 8.05  ? 523 ASN C CA  1 
ATOM   3936 C C   . ASN B 1 223 ? 24.908 9.180  38.648 1.00 12.06 ? 523 ASN C C   1 
ATOM   3937 O O   . ASN B 1 223 ? 25.669 8.362  39.170 1.00 9.54  ? 523 ASN C O   1 
ATOM   3938 C CB  . ASN B 1 223 ? 25.558 11.594 38.787 1.00 9.53  ? 523 ASN C CB  1 
ATOM   3939 C CG  . ASN B 1 223 ? 26.637 11.429 39.849 1.00 13.64 ? 523 ASN C CG  1 
ATOM   3940 O OD1 . ASN B 1 223 ? 27.685 10.833 39.600 1.00 11.72 ? 523 ASN C OD1 1 
ATOM   3941 N ND2 . ASN B 1 223 ? 26.390 11.977 41.029 1.00 18.92 ? 523 ASN C ND2 1 
ATOM   3942 N N   . GLN B 1 224 ? 23.583 9.083  38.714 1.00 11.57 ? 524 GLN C N   1 
ATOM   3943 C CA  . GLN B 1 224 ? 22.938 7.982  39.429 1.00 12.24 ? 524 GLN C CA  1 
ATOM   3944 C C   . GLN B 1 224 ? 22.880 6.706  38.594 1.00 12.13 ? 524 GLN C C   1 
ATOM   3945 O O   . GLN B 1 224 ? 22.333 5.689  39.042 1.00 12.81 ? 524 GLN C O   1 
ATOM   3946 C CB  . GLN B 1 224 ? 21.532 8.400  39.861 1.00 13.69 ? 524 GLN C CB  1 
ATOM   3947 C CG  . GLN B 1 224 ? 21.544 9.504  40.904 1.00 15.69 ? 524 GLN C CG  1 
ATOM   3948 C CD  . GLN B 1 224 ? 20.163 10.026 41.235 1.00 18.06 ? 524 GLN C CD  1 
ATOM   3949 O OE1 . GLN B 1 224 ? 19.285 9.266  41.634 1.00 17.72 ? 524 GLN C OE1 1 
ATOM   3950 N NE2 . GLN B 1 224 ? 19.966 11.338 41.086 1.00 16.00 ? 524 GLN C NE2 1 
ATOM   3951 N N   . GLY B 1 225 ? 23.423 6.759  37.377 1.00 6.85  ? 525 GLY C N   1 
ATOM   3952 C CA  . GLY B 1 225 ? 23.433 5.571  36.533 1.00 7.64  ? 525 GLY C CA  1 
ATOM   3953 C C   . GLY B 1 225 ? 22.472 5.494  35.365 1.00 6.66  ? 525 GLY C C   1 
ATOM   3954 O O   . GLY B 1 225 ? 22.485 4.510  34.615 1.00 5.93  ? 525 GLY C O   1 
ATOM   3955 N N   . ARG B 1 226 ? 21.617 6.498  35.196 1.00 7.03  ? 526 ARG C N   1 
ATOM   3956 C CA  . ARG B 1 226 ? 20.687 6.488  34.057 1.00 6.97  ? 526 ARG C CA  1 
ATOM   3957 C C   . ARG B 1 226 ? 21.473 6.660  32.770 1.00 8.46  ? 526 ARG C C   1 
ATOM   3958 O O   . ARG B 1 226 ? 22.503 7.333  32.772 1.00 6.00  ? 526 ARG C O   1 
ATOM   3959 C CB  . ARG B 1 226 ? 19.709 7.652  34.139 1.00 6.11  ? 526 ARG C CB  1 
ATOM   3960 C CG  . ARG B 1 226 ? 18.388 7.347  34.845 1.00 11.80 ? 526 ARG C CG  1 
ATOM   3961 C CD  . ARG B 1 226 ? 18.580 7.072  36.314 1.00 12.79 ? 526 ARG C CD  1 
ATOM   3962 N NE  . ARG B 1 226 ? 17.344 7.341  37.047 1.00 16.28 ? 526 ARG C NE  1 
ATOM   3963 C CZ  . ARG B 1 226 ? 17.169 7.107  38.340 1.00 15.39 ? 526 ARG C CZ  1 
ATOM   3964 N NH1 . ARG B 1 226 ? 18.155 6.585  39.060 1.00 16.27 ? 526 ARG C NH1 1 
ATOM   3965 N NH2 . ARG B 1 226 ? 16.012 7.419  38.917 1.00 14.28 ? 526 ARG C NH2 1 
ATOM   3966 N N   . THR B 1 227 ? 21.010 6.052  31.675 1.00 8.57  ? 527 THR C N   1 
ATOM   3967 C CA  . THR B 1 227 ? 21.694 6.232  30.399 1.00 7.79  ? 527 THR C CA  1 
ATOM   3968 C C   . THR B 1 227 ? 21.340 7.663  29.969 1.00 9.32  ? 527 THR C C   1 
ATOM   3969 O O   . THR B 1 227 ? 20.410 8.275  30.511 1.00 8.44  ? 527 THR C O   1 
ATOM   3970 C CB  . THR B 1 227 ? 21.161 5.287  29.301 1.00 12.09 ? 527 THR C CB  1 
ATOM   3971 O OG1 . THR B 1 227 ? 19.785 5.603  29.032 1.00 8.25  ? 527 THR C OG1 1 
ATOM   3972 C CG2 . THR B 1 227 ? 21.272 3.817  29.738 1.00 15.02 ? 527 THR C CG2 1 
ATOM   3973 N N   . PRO B 1 228 ? 22.084 8.228  29.010 1.00 5.45  ? 528 PRO C N   1 
ATOM   3974 C CA  . PRO B 1 228 ? 21.735 9.588  28.595 1.00 8.49  ? 528 PRO C CA  1 
ATOM   3975 C C   . PRO B 1 228 ? 20.269 9.684  28.171 1.00 9.03  ? 528 PRO C C   1 
ATOM   3976 O O   . PRO B 1 228 ? 19.554 10.608 28.569 1.00 6.85  ? 528 PRO C O   1 
ATOM   3977 C CB  . PRO B 1 228 ? 22.702 9.849  27.439 1.00 7.34  ? 528 PRO C CB  1 
ATOM   3978 C CG  . PRO B 1 228 ? 23.938 9.152  27.916 1.00 9.11  ? 528 PRO C CG  1 
ATOM   3979 C CD  . PRO B 1 228 ? 23.378 7.815  28.439 1.00 7.82  ? 528 PRO C CD  1 
ATOM   3980 N N   . GLN B 1 229 ? 19.808 8.718  27.378 1.00 7.24  ? 529 GLN C N   1 
ATOM   3981 C CA  . GLN B 1 229 ? 18.420 8.742  26.929 1.00 8.38  ? 529 GLN C CA  1 
ATOM   3982 C C   . GLN B 1 229 ? 17.445 8.640  28.104 1.00 8.97  ? 529 GLN C C   1 
ATOM   3983 O O   . GLN B 1 229 ? 16.450 9.397  28.162 1.00 6.44  ? 529 GLN C O   1 
ATOM   3984 C CB  . GLN B 1 229 ? 18.168 7.614  25.922 1.00 10.42 ? 529 GLN C CB  1 
ATOM   3985 C CG  . GLN B 1 229 ? 16.811 7.683  25.212 1.00 17.12 ? 529 GLN C CG  1 
ATOM   3986 C CD  . GLN B 1 229 ? 15.689 7.036  26.011 1.00 22.00 ? 529 GLN C CD  1 
ATOM   3987 O OE1 . GLN B 1 229 ? 15.928 6.397  27.038 1.00 24.14 ? 529 GLN C OE1 1 
ATOM   3988 N NE2 . GLN B 1 229 ? 14.458 7.189  25.534 1.00 22.83 ? 529 GLN C NE2 1 
ATOM   3989 N N   . GLN B 1 230 ? 17.725 7.723  29.036 1.00 8.92  ? 530 GLN C N   1 
ATOM   3990 C CA  . GLN B 1 230 ? 16.858 7.531  30.205 1.00 11.69 ? 530 GLN C CA  1 
ATOM   3991 C C   . GLN B 1 230 ? 16.820 8.816  31.038 1.00 10.23 ? 530 GLN C C   1 
ATOM   3992 O O   . GLN B 1 230 ? 15.756 9.215  31.526 1.00 8.59  ? 530 GLN C O   1 
ATOM   3993 C CB  . GLN B 1 230 ? 17.346 6.368  31.094 1.00 13.66 ? 530 GLN C CB  1 
ATOM   3994 C CG  . GLN B 1 230 ? 17.493 5.009  30.383 1.00 18.79 ? 530 GLN C CG  1 
ATOM   3995 C CD  . GLN B 1 230 ? 18.027 3.900  31.286 1.00 21.79 ? 530 GLN C CD  1 
ATOM   3996 O OE1 . GLN B 1 230 ? 18.858 4.140  32.173 1.00 13.24 ? 530 GLN C OE1 1 
ATOM   3997 N NE2 . GLN B 1 230 ? 17.565 2.669  31.046 1.00 22.80 ? 530 GLN C NE2 1 
ATOM   3998 N N   . ALA B 1 231 ? 17.981 9.448  31.213 1.00 6.72  ? 531 ALA C N   1 
ATOM   3999 C CA  . ALA B 1 231 ? 18.064 10.683 31.987 1.00 6.39  ? 531 ALA C CA  1 
ATOM   4000 C C   . ALA B 1 231 ? 17.223 11.795 31.364 1.00 6.39  ? 531 ALA C C   1 
ATOM   4001 O O   . ALA B 1 231 ? 16.500 12.518 32.064 1.00 6.63  ? 531 ALA C O   1 
ATOM   4002 C CB  . ALA B 1 231 ? 19.526 11.127 32.114 1.00 5.04  ? 531 ALA C CB  1 
ATOM   4003 N N   . CYS B 1 232 ? 17.315 11.951 30.047 1.00 4.83  ? 532 CYS C N   1 
ATOM   4004 C CA  . CYS B 1 232 ? 16.528 12.984 29.380 1.00 6.23  ? 532 CYS C CA  1 
ATOM   4005 C C   . CYS B 1 232 ? 15.033 12.726 29.532 1.00 7.28  ? 532 CYS C C   1 
ATOM   4006 O O   . CYS B 1 232 ? 14.253 13.647 29.784 1.00 6.88  ? 532 CYS C O   1 
ATOM   4007 C CB  . CYS B 1 232 ? 16.883 13.060 27.892 1.00 5.39  ? 532 CYS C CB  1 
ATOM   4008 S SG  . CYS B 1 232 ? 18.529 13.749 27.593 1.00 5.02  ? 532 CYS C SG  1 
ATOM   4009 N N   . LYS B 1 233 ? 14.645 11.468 29.376 1.00 7.28  ? 533 LYS C N   1 
ATOM   4010 C CA  . LYS B 1 233 ? 13.257 11.080 29.484 1.00 7.56  ? 533 LYS C CA  1 
ATOM   4011 C C   . LYS B 1 233 ? 12.639 11.365 30.851 1.00 7.98  ? 533 LYS C C   1 
ATOM   4012 O O   . LYS B 1 233 ? 11.503 11.837 30.944 1.00 8.32  ? 533 LYS C O   1 
ATOM   4013 C CB  . LYS B 1 233 ? 13.123 9.590  29.161 1.00 4.74  ? 533 LYS C CB  1 
ATOM   4014 C CG  . LYS B 1 233 ? 11.686 9.079  29.280 1.00 8.17  ? 533 LYS C CG  1 
ATOM   4015 C CD  . LYS B 1 233 ? 11.560 7.631  28.804 1.00 11.26 ? 533 LYS C CD  1 
ATOM   4016 C CE  . LYS B 1 233 ? 10.144 7.094  29.020 1.00 17.36 ? 533 LYS C CE  1 
ATOM   4017 N NZ  . LYS B 1 233 ? 9.979  5.791  28.330 1.00 21.28 ? 533 LYS C NZ  1 
ATOM   4018 N N   . GLU B 1 234 ? 13.378 11.060 31.911 1.00 8.59  ? 534 GLU C N   1 
ATOM   4019 C CA  . GLU B 1 234 ? 12.877 11.275 33.262 1.00 6.95  ? 534 GLU C CA  1 
ATOM   4020 C C   . GLU B 1 234 ? 12.757 12.759 33.580 1.00 8.60  ? 534 GLU C C   1 
ATOM   4021 O O   . GLU B 1 234 ? 11.851 13.172 34.311 1.00 7.75  ? 534 GLU C O   1 
ATOM   4022 C CB  . GLU B 1 234 ? 13.779 10.556 34.282 1.00 10.30 ? 534 GLU C CB  1 
ATOM   4023 C CG  . GLU B 1 234 ? 13.651 9.036  34.196 1.00 12.36 ? 534 GLU C CG  1 
ATOM   4024 C CD  . GLU B 1 234 ? 14.439 8.284  35.260 1.00 16.64 ? 534 GLU C CD  1 
ATOM   4025 O OE1 . GLU B 1 234 ? 14.669 8.853  36.352 1.00 12.57 ? 534 GLU C OE1 1 
ATOM   4026 O OE2 . GLU B 1 234 ? 14.816 7.112  34.998 1.00 16.30 ? 534 GLU C OE2 1 
ATOM   4027 N N   . ALA B 1 235 ? 13.665 13.564 33.028 1.00 7.25  ? 535 ALA C N   1 
ATOM   4028 C CA  . ALA B 1 235 ? 13.631 15.009 33.237 1.00 7.30  ? 535 ALA C CA  1 
ATOM   4029 C C   . ALA B 1 235 ? 12.401 15.554 32.501 1.00 8.38  ? 535 ALA C C   1 
ATOM   4030 O O   . ALA B 1 235 ? 11.725 16.451 32.988 1.00 5.98  ? 535 ALA C O   1 
ATOM   4031 C CB  . ALA B 1 235 ? 14.908 15.659 32.697 1.00 9.39  ? 535 ALA C CB  1 
ATOM   4032 N N   . VAL B 1 236 ? 12.126 15.017 31.316 1.00 8.05  ? 536 VAL C N   1 
ATOM   4033 C CA  . VAL B 1 236 ? 10.944 15.430 30.568 1.00 8.28  ? 536 VAL C CA  1 
ATOM   4034 C C   . VAL B 1 236 ? 9.708  15.050 31.379 1.00 5.88  ? 536 VAL C C   1 
ATOM   4035 O O   . VAL B 1 236 ? 8.760  15.830 31.494 1.00 7.25  ? 536 VAL C O   1 
ATOM   4036 C CB  . VAL B 1 236 ? 10.867 14.734 29.190 1.00 6.77  ? 536 VAL C CB  1 
ATOM   4037 C CG1 . VAL B 1 236 ? 9.433  14.786 28.652 1.00 5.88  ? 536 VAL C CG1 1 
ATOM   4038 C CG2 . VAL B 1 236 ? 11.801 15.446 28.203 1.00 5.97  ? 536 VAL C CG2 1 
ATOM   4039 N N   . GLU B 1 237 ? 9.719  13.851 31.947 1.00 7.92  ? 537 GLU C N   1 
ATOM   4040 C CA  . GLU B 1 237 ? 8.578  13.376 32.732 1.00 6.87  ? 537 GLU C CA  1 
ATOM   4041 C C   . GLU B 1 237 ? 8.354  14.203 34.004 1.00 9.27  ? 537 GLU C C   1 
ATOM   4042 O O   . GLU B 1 237 ? 7.222  14.342 34.477 1.00 4.91  ? 537 GLU C O   1 
ATOM   4043 C CB  . GLU B 1 237 ? 8.749  11.876 33.050 1.00 9.39  ? 537 GLU C CB  1 
ATOM   4044 C CG  . GLU B 1 237 ? 8.437  10.986 31.835 1.00 12.41 ? 537 GLU C CG  1 
ATOM   4045 C CD  . GLU B 1 237 ? 8.947  9.555  31.960 1.00 14.11 ? 537 GLU C CD  1 
ATOM   4046 O OE1 . GLU B 1 237 ? 8.659  8.751  31.046 1.00 14.43 ? 537 GLU C OE1 1 
ATOM   4047 O OE2 . GLU B 1 237 ? 9.642  9.237  32.951 1.00 14.92 ? 537 GLU C OE2 1 
ATOM   4048 N N   . ARG B 1 238 ? 9.423  14.772 34.547 1.00 8.42  ? 538 ARG C N   1 
ATOM   4049 C CA  . ARG B 1 238 ? 9.297  15.599 35.738 1.00 8.94  ? 538 ARG C CA  1 
ATOM   4050 C C   . ARG B 1 238 ? 8.592  16.897 35.341 1.00 7.80  ? 538 ARG C C   1 
ATOM   4051 O O   . ARG B 1 238 ? 7.787  17.433 36.104 1.00 5.33  ? 538 ARG C O   1 
ATOM   4052 C CB  . ARG B 1 238 ? 10.676 15.894 36.330 1.00 12.84 ? 538 ARG C CB  1 
ATOM   4053 C CG  . ARG B 1 238 ? 10.650 16.338 37.778 1.00 21.51 ? 538 ARG C CG  1 
ATOM   4054 C CD  . ARG B 1 238 ? 11.628 15.500 38.605 1.00 27.58 ? 538 ARG C CD  1 
ATOM   4055 N NE  . ARG B 1 238 ? 12.504 16.347 39.406 1.00 30.47 ? 538 ARG C NE  1 
ATOM   4056 C CZ  . ARG B 1 238 ? 13.489 15.903 40.180 1.00 29.56 ? 538 ARG C CZ  1 
ATOM   4057 N NH1 . ARG B 1 238 ? 13.739 14.599 40.272 1.00 27.44 ? 538 ARG C NH1 1 
ATOM   4058 N NH2 . ARG B 1 238 ? 14.230 16.772 40.855 1.00 27.03 ? 538 ARG C NH2 1 
ATOM   4059 N N   . ILE B 1 239 ? 8.879  17.400 34.146 1.00 7.93  ? 539 ILE C N   1 
ATOM   4060 C CA  . ILE B 1 239 ? 8.213  18.623 33.684 1.00 7.76  ? 539 ILE C CA  1 
ATOM   4061 C C   . ILE B 1 239 ? 6.726  18.314 33.419 1.00 7.45  ? 539 ILE C C   1 
ATOM   4062 O O   . ILE B 1 239 ? 5.839  19.108 33.751 1.00 5.27  ? 539 ILE C O   1 
ATOM   4063 C CB  . ILE B 1 239 ? 8.876  19.173 32.395 1.00 8.03  ? 539 ILE C CB  1 
ATOM   4064 C CG1 . ILE B 1 239 ? 10.269 19.734 32.725 1.00 9.94  ? 539 ILE C CG1 1 
ATOM   4065 C CG2 . ILE B 1 239 ? 7.976  20.244 31.758 1.00 8.33  ? 539 ILE C CG2 1 
ATOM   4066 C CD1 . ILE B 1 239 ? 11.056 20.225 31.506 1.00 8.40  ? 539 ILE C CD1 1 
ATOM   4067 N N   . VAL B 1 240 ? 6.460  17.149 32.835 1.00 6.91  ? 540 VAL C N   1 
ATOM   4068 C CA  . VAL B 1 240 ? 5.088  16.738 32.549 1.00 6.75  ? 540 VAL C CA  1 
ATOM   4069 C C   . VAL B 1 240 ? 4.294  16.733 33.864 1.00 7.44  ? 540 VAL C C   1 
ATOM   4070 O O   . VAL B 1 240 ? 3.183  17.266 33.931 1.00 5.90  ? 540 VAL C O   1 
ATOM   4071 C CB  . VAL B 1 240 ? 5.054  15.327 31.894 1.00 5.96  ? 540 VAL C CB  1 
ATOM   4072 C CG1 . VAL B 1 240 ? 3.620  14.788 31.858 1.00 6.41  ? 540 VAL C CG1 1 
ATOM   4073 C CG2 . VAL B 1 240 ? 5.619  15.412 30.456 1.00 6.95  ? 540 VAL C CG2 1 
ATOM   4074 N N   . LYS B 1 241 ? 4.875  16.155 34.915 1.00 8.04  ? 541 LYS C N   1 
ATOM   4075 C CA  . LYS B 1 241 ? 4.204  16.119 36.215 1.00 11.19 ? 541 LYS C CA  1 
ATOM   4076 C C   . LYS B 1 241 ? 3.940  17.517 36.768 1.00 9.54  ? 541 LYS C C   1 
ATOM   4077 O O   . LYS B 1 241 ? 2.850  17.795 37.258 1.00 10.64 ? 541 LYS C O   1 
ATOM   4078 C CB  . LYS B 1 241 ? 5.026  15.327 37.238 1.00 11.99 ? 541 LYS C CB  1 
ATOM   4079 C CG  . LYS B 1 241 ? 4.593  15.587 38.681 1.00 22.51 ? 541 LYS C CG  1 
ATOM   4080 C CD  . LYS B 1 241 ? 5.222  14.620 39.694 1.00 28.10 ? 541 LYS C CD  1 
ATOM   4081 C CE  . LYS B 1 241 ? 6.743  14.648 39.687 1.00 33.45 ? 541 LYS C CE  1 
ATOM   4082 N NZ  . LYS B 1 241 ? 7.307  13.745 40.750 1.00 33.71 ? 541 LYS C NZ  1 
ATOM   4083 N N   . ILE B 1 242 ? 4.939  18.390 36.699 1.00 7.61  ? 542 ILE C N   1 
ATOM   4084 C CA  . ILE B 1 242 ? 4.797  19.753 37.202 1.00 10.18 ? 542 ILE C CA  1 
ATOM   4085 C C   . ILE B 1 242 ? 3.773  20.574 36.410 1.00 8.38  ? 542 ILE C C   1 
ATOM   4086 O O   . ILE B 1 242 ? 3.013  21.345 36.987 1.00 9.70  ? 542 ILE C O   1 
ATOM   4087 C CB  . ILE B 1 242 ? 6.168  20.457 37.226 1.00 13.09 ? 542 ILE C CB  1 
ATOM   4088 C CG1 . ILE B 1 242 ? 7.035  19.809 38.313 1.00 16.58 ? 542 ILE C CG1 1 
ATOM   4089 C CG2 . ILE B 1 242 ? 6.001  21.941 37.503 1.00 11.74 ? 542 ILE C CG2 1 
ATOM   4090 C CD1 . ILE B 1 242 ? 8.478  20.259 38.320 1.00 22.06 ? 542 ILE C CD1 1 
ATOM   4091 N N   . VAL B 1 243 ? 3.748  20.406 35.094 1.00 6.44  ? 543 VAL C N   1 
ATOM   4092 C CA  . VAL B 1 243 ? 2.775  21.103 34.260 1.00 6.78  ? 543 VAL C CA  1 
ATOM   4093 C C   . VAL B 1 243 ? 1.368  20.730 34.752 1.00 8.85  ? 543 VAL C C   1 
ATOM   4094 O O   . VAL B 1 243 ? 0.498  21.600 34.920 1.00 9.09  ? 543 VAL C O   1 
ATOM   4095 C CB  . VAL B 1 243 ? 2.958  20.710 32.773 1.00 7.27  ? 543 VAL C CB  1 
ATOM   4096 C CG1 . VAL B 1 243 ? 1.732  21.119 31.949 1.00 5.79  ? 543 VAL C CG1 1 
ATOM   4097 C CG2 . VAL B 1 243 ? 4.206  21.401 32.220 1.00 7.31  ? 543 VAL C CG2 1 
ATOM   4098 N N   . ASN B 1 244 ? 1.152  19.439 34.996 1.00 7.04  ? 544 ASN C N   1 
ATOM   4099 C CA  . ASN B 1 244 ? -0.139 18.972 35.505 1.00 9.74  ? 544 ASN C CA  1 
ATOM   4100 C C   . ASN B 1 244 ? -0.425 19.566 36.887 1.00 9.55  ? 544 ASN C C   1 
ATOM   4101 O O   . ASN B 1 244 ? -1.524 20.060 37.139 1.00 8.63  ? 544 ASN C O   1 
ATOM   4102 C CB  . ASN B 1 244 ? -0.169 17.439 35.607 1.00 11.76 ? 544 ASN C CB  1 
ATOM   4103 C CG  . ASN B 1 244 ? -1.454 16.927 36.256 1.00 14.86 ? 544 ASN C CG  1 
ATOM   4104 O OD1 . ASN B 1 244 ? -1.435 16.376 37.358 1.00 21.71 ? 544 ASN C OD1 1 
ATOM   4105 N ND2 . ASN B 1 244 ? -2.574 17.128 35.578 1.00 20.93 ? 544 ASN C ND2 1 
ATOM   4106 N N   . ARG B 1 245 ? 0.559  19.525 37.783 1.00 10.38 ? 545 ARG C N   1 
ATOM   4107 C CA  . ARG B 1 245 ? 0.355  20.066 39.129 1.00 10.39 ? 545 ARG C CA  1 
ATOM   4108 C C   . ARG B 1 245 ? 0.033  21.548 39.134 1.00 9.70  ? 545 ARG C C   1 
ATOM   4109 O O   . ARG B 1 245 ? -0.628 22.032 40.046 1.00 8.57  ? 545 ARG C O   1 
ATOM   4110 C CB  . ARG B 1 245 ? 1.584  19.821 40.015 1.00 15.88 ? 545 ARG C CB  1 
ATOM   4111 C CG  . ARG B 1 245 ? 1.739  18.374 40.438 1.00 21.58 ? 545 ARG C CG  1 
ATOM   4112 C CD  . ARG B 1 245 ? 2.839  18.198 41.471 1.00 28.53 ? 545 ARG C CD  1 
ATOM   4113 N NE  . ARG B 1 245 ? 2.632  19.041 42.647 1.00 35.16 ? 545 ARG C NE  1 
ATOM   4114 C CZ  . ARG B 1 245 ? 3.188  18.820 43.834 0.00 35.19 ? 545 ARG C CZ  1 
ATOM   4115 N NH1 . ARG B 1 245 ? 3.985  17.776 44.012 0.00 36.66 ? 545 ARG C NH1 1 
ATOM   4116 N NH2 . ARG B 1 245 ? 2.946  19.643 44.845 0.00 36.66 ? 545 ARG C NH2 1 
ATOM   4117 N N   . ARG B 1 246 ? 0.517  22.278 38.136 1.00 7.03  ? 546 ARG C N   1 
ATOM   4118 C CA  . ARG B 1 246 ? 0.244  23.713 38.055 1.00 7.93  ? 546 ARG C CA  1 
ATOM   4119 C C   . ARG B 1 246 ? -1.052 24.006 37.281 1.00 9.74  ? 546 ARG C C   1 
ATOM   4120 O O   . ARG B 1 246 ? -1.381 25.159 37.023 1.00 7.02  ? 546 ARG C O   1 
ATOM   4121 C CB  . ARG B 1 246 ? 1.428  24.456 37.408 1.00 8.13  ? 546 ARG C CB  1 
ATOM   4122 C CG  . ARG B 1 246 ? 2.744  24.349 38.222 1.00 6.61  ? 546 ARG C CG  1 
ATOM   4123 C CD  . ARG B 1 246 ? 3.883  25.146 37.577 1.00 6.96  ? 546 ARG C CD  1 
ATOM   4124 N NE  . ARG B 1 246 ? 3.636  26.588 37.631 1.00 8.54  ? 546 ARG C NE  1 
ATOM   4125 C CZ  . ARG B 1 246 ? 3.441  27.368 36.568 1.00 8.71  ? 546 ARG C CZ  1 
ATOM   4126 N NH1 . ARG B 1 246 ? 3.469  26.856 35.343 1.00 7.63  ? 546 ARG C NH1 1 
ATOM   4127 N NH2 . ARG B 1 246 ? 3.198  28.664 36.735 1.00 9.85  ? 546 ARG C NH2 1 
ATOM   4128 N N   . GLY B 1 247 ? -1.791 22.958 36.930 1.00 9.78  ? 547 GLY C N   1 
ATOM   4129 C CA  . GLY B 1 247 ? -3.048 23.146 36.208 1.00 11.55 ? 547 GLY C CA  1 
ATOM   4130 C C   . GLY B 1 247 ? -2.892 23.673 34.792 1.00 10.35 ? 547 GLY C C   1 
ATOM   4131 O O   . GLY B 1 247 ? -3.770 24.365 34.258 1.00 11.65 ? 547 GLY C O   1 
ATOM   4132 N N   . LYS B 1 248 ? -1.770 23.354 34.163 1.00 8.42  ? 548 LYS C N   1 
ATOM   4133 C CA  . LYS B 1 248 ? -1.534 23.819 32.808 1.00 9.12  ? 548 LYS C CA  1 
ATOM   4134 C C   . LYS B 1 248 ? -1.751 22.675 31.826 1.00 9.91  ? 548 LYS C C   1 
ATOM   4135 O O   . LYS B 1 248 ? -1.847 21.523 32.231 1.00 6.82  ? 548 LYS C O   1 
ATOM   4136 C CB  . LYS B 1 248 ? -0.115 24.359 32.698 1.00 9.55  ? 548 LYS C CB  1 
ATOM   4137 C CG  . LYS B 1 248 ? 0.185  25.445 33.725 1.00 13.66 ? 548 LYS C CG  1 
ATOM   4138 C CD  . LYS B 1 248 ? -0.801 26.596 33.623 1.00 16.67 ? 548 LYS C CD  1 
ATOM   4139 C CE  . LYS B 1 248 ? -0.391 27.761 34.528 1.00 20.96 ? 548 LYS C CE  1 
ATOM   4140 N NZ  . LYS B 1 248 ? -1.291 28.930 34.329 1.00 24.52 ? 548 LYS C NZ  1 
ATOM   4141 N N   . ASN B 1 249 ? -1.817 23.007 30.541 1.00 9.01  ? 549 ASN C N   1 
ATOM   4142 C CA  . ASN B 1 249 ? -2.042 22.016 29.488 1.00 7.33  ? 549 ASN C CA  1 
ATOM   4143 C C   . ASN B 1 249 ? -0.739 21.707 28.750 1.00 9.91  ? 549 ASN C C   1 
ATOM   4144 O O   . ASN B 1 249 ? -0.139 22.586 28.133 1.00 9.43  ? 549 ASN C O   1 
ATOM   4145 C CB  . ASN B 1 249 ? -3.083 22.554 28.502 1.00 10.59 ? 549 ASN C CB  1 
ATOM   4146 C CG  . ASN B 1 249 ? -3.596 21.481 27.565 1.00 9.86  ? 549 ASN C CG  1 
ATOM   4147 O OD1 . ASN B 1 249 ? -2.819 20.817 26.898 1.00 9.33  ? 549 ASN C OD1 1 
ATOM   4148 N ND2 . ASN B 1 249 ? -4.912 21.304 27.521 1.00 7.07  ? 549 ASN C ND2 1 
ATOM   4149 N N   . LEU B 1 250 ? -0.316 20.446 28.805 1.00 12.01 ? 550 LEU C N   1 
ATOM   4150 C CA  . LEU B 1 250 ? 0.929  20.020 28.175 1.00 10.80 ? 550 LEU C CA  1 
ATOM   4151 C C   . LEU B 1 250 ? 1.044  20.360 26.699 1.00 12.10 ? 550 LEU C C   1 
ATOM   4152 O O   . LEU B 1 250 ? 2.153  20.465 26.174 1.00 11.61 ? 550 LEU C O   1 
ATOM   4153 C CB  . LEU B 1 250 ? 1.124  18.509 28.358 1.00 8.08  ? 550 LEU C CB  1 
ATOM   4154 C CG  . LEU B 1 250 ? 2.521  17.935 28.094 1.00 8.15  ? 550 LEU C CG  1 
ATOM   4155 C CD1 . LEU B 1 250 ? 3.517  18.520 29.098 1.00 7.87  ? 550 LEU C CD1 1 
ATOM   4156 C CD2 . LEU B 1 250 ? 2.484  16.398 28.220 1.00 7.05  ? 550 LEU C CD2 1 
ATOM   4157 N N   . LYS B 1 251 ? -0.089 20.531 26.020 1.00 10.58 ? 551 LYS C N   1 
ATOM   4158 C CA  . LYS B 1 251 ? -0.045 20.845 24.596 1.00 11.95 ? 551 LYS C CA  1 
ATOM   4159 C C   . LYS B 1 251 ? 0.599  22.206 24.333 1.00 11.09 ? 551 LYS C C   1 
ATOM   4160 O O   . LYS B 1 251 ? 1.122  22.457 23.249 1.00 11.25 ? 551 LYS C O   1 
ATOM   4161 C CB  . LYS B 1 251 ? -1.459 20.833 23.998 1.00 9.75  ? 551 LYS C CB  1 
ATOM   4162 C CG  . LYS B 1 251 ? -1.476 20.766 22.470 1.00 14.99 ? 551 LYS C CG  1 
ATOM   4163 C CD  . LYS B 1 251 ? -0.918 19.420 22.004 1.00 13.41 ? 551 LYS C CD  1 
ATOM   4164 C CE  . LYS B 1 251 ? -1.080 19.206 20.510 1.00 19.95 ? 551 LYS C CE  1 
ATOM   4165 N NZ  . LYS B 1 251 ? -0.886 17.762 20.119 1.00 11.06 ? 551 LYS C NZ  1 
ATOM   4166 N N   . ASP B 1 252 ? 0.561  23.088 25.325 1.00 9.99  ? 552 ASP C N   1 
ATOM   4167 C CA  . ASP B 1 252 ? 1.129  24.425 25.165 1.00 10.99 ? 552 ASP C CA  1 
ATOM   4168 C C   . ASP B 1 252 ? 2.619  24.481 25.495 1.00 11.11 ? 552 ASP C C   1 
ATOM   4169 O O   . ASP B 1 252 ? 3.227  25.544 25.422 1.00 12.46 ? 552 ASP C O   1 
ATOM   4170 C CB  . ASP B 1 252 ? 0.407  25.424 26.073 1.00 12.94 ? 552 ASP C CB  1 
ATOM   4171 C CG  . ASP B 1 252 ? -1.105 25.398 25.898 1.00 15.09 ? 552 ASP C CG  1 
ATOM   4172 O OD1 . ASP B 1 252 ? -1.575 25.299 24.743 1.00 13.83 ? 552 ASP C OD1 1 
ATOM   4173 O OD2 . ASP B 1 252 ? -1.816 25.485 26.922 1.00 14.24 ? 552 ASP C OD2 1 
ATOM   4174 N N   . ILE B 1 253 ? 3.211  23.338 25.832 1.00 8.74  ? 553 ILE C N   1 
ATOM   4175 C CA  . ILE B 1 253 ? 4.617  23.311 26.235 1.00 9.70  ? 553 ILE C CA  1 
ATOM   4176 C C   . ILE B 1 253 ? 5.511  22.383 25.411 1.00 10.10 ? 553 ILE C C   1 
ATOM   4177 O O   . ILE B 1 253 ? 5.131  21.257 25.122 1.00 8.19  ? 553 ILE C O   1 
ATOM   4178 C CB  . ILE B 1 253 ? 4.743  22.843 27.721 1.00 12.37 ? 553 ILE C CB  1 
ATOM   4179 C CG1 . ILE B 1 253 ? 3.723  23.571 28.602 1.00 14.75 ? 553 ILE C CG1 1 
ATOM   4180 C CG2 . ILE B 1 253 ? 6.161  23.072 28.226 1.00 14.97 ? 553 ILE C CG2 1 
ATOM   4181 C CD1 . ILE B 1 253 ? 3.903  25.074 28.673 1.00 17.71 ? 553 ILE C CD1 1 
ATOM   4182 N N   . GLN B 1 254 ? 6.690  22.868 25.028 1.00 6.74  ? 554 GLN C N   1 
ATOM   4183 C CA  . GLN B 1 254 ? 7.650  22.031 24.321 1.00 7.80  ? 554 GLN C CA  1 
ATOM   4184 C C   . GLN B 1 254 ? 9.032  22.210 24.943 1.00 8.37  ? 554 GLN C C   1 
ATOM   4185 O O   . GLN B 1 254 ? 9.506  23.327 25.119 1.00 7.45  ? 554 GLN C O   1 
ATOM   4186 C CB  . GLN B 1 254 ? 7.710  22.363 22.827 1.00 8.83  ? 554 GLN C CB  1 
ATOM   4187 C CG  . GLN B 1 254 ? 8.837  21.633 22.067 1.00 8.75  ? 554 GLN C CG  1 
ATOM   4188 C CD  . GLN B 1 254 ? 8.705  20.111 22.061 1.00 9.97  ? 554 GLN C CD  1 
ATOM   4189 O OE1 . GLN B 1 254 ? 8.576  19.475 23.115 1.00 8.53  ? 554 GLN C OE1 1 
ATOM   4190 N NE2 . GLN B 1 254 ? 8.754  19.516 20.864 1.00 7.45  ? 554 GLN C NE2 1 
ATOM   4191 N N   . VAL B 1 255 ? 9.659  21.095 25.302 1.00 9.73  ? 555 VAL C N   1 
ATOM   4192 C CA  . VAL B 1 255 ? 11.012 21.124 25.865 1.00 7.59  ? 555 VAL C CA  1 
ATOM   4193 C C   . VAL B 1 255 ? 11.733 19.900 25.334 1.00 9.84  ? 555 VAL C C   1 
ATOM   4194 O O   . VAL B 1 255 ? 11.167 18.796 25.298 1.00 6.35  ? 555 VAL C O   1 
ATOM   4195 C CB  . VAL B 1 255 ? 11.039 21.019 27.406 1.00 9.02  ? 555 VAL C CB  1 
ATOM   4196 C CG1 . VAL B 1 255 ? 12.489 20.897 27.880 1.00 4.17  ? 555 VAL C CG1 1 
ATOM   4197 C CG2 . VAL B 1 255 ? 10.357 22.243 28.041 1.00 8.91  ? 555 VAL C CG2 1 
ATOM   4198 N N   . GLY B 1 256 ? 12.968 20.103 24.897 1.00 8.19  ? 556 GLY C N   1 
ATOM   4199 C CA  . GLY B 1 256 ? 13.762 18.988 24.417 1.00 7.87  ? 556 GLY C CA  1 
ATOM   4200 C C   . GLY B 1 256 ? 15.078 18.986 25.186 1.00 10.38 ? 556 GLY C C   1 
ATOM   4201 O O   . GLY B 1 256 ? 15.622 20.059 25.459 1.00 9.07  ? 556 GLY C O   1 
ATOM   4202 N N   . PHE B 1 257 ? 15.557 17.809 25.589 1.00 8.48  ? 557 PHE C N   1 
ATOM   4203 C CA  . PHE B 1 257 ? 16.853 17.691 26.270 1.00 7.45  ? 557 PHE C CA  1 
ATOM   4204 C C   . PHE B 1 257 ? 17.712 16.752 25.422 1.00 7.29  ? 557 PHE C C   1 
ATOM   4205 O O   . PHE B 1 257 ? 17.197 15.795 24.847 1.00 5.12  ? 557 PHE C O   1 
ATOM   4206 C CB  . PHE B 1 257 ? 16.739 17.020 27.650 1.00 6.32  ? 557 PHE C CB  1 
ATOM   4207 C CG  . PHE B 1 257 ? 16.093 17.868 28.716 1.00 6.99  ? 557 PHE C CG  1 
ATOM   4208 C CD1 . PHE B 1 257 ? 14.816 17.555 29.182 1.00 9.43  ? 557 PHE C CD1 1 
ATOM   4209 C CD2 . PHE B 1 257 ? 16.778 18.936 29.301 1.00 9.22  ? 557 PHE C CD2 1 
ATOM   4210 C CE1 . PHE B 1 257 ? 14.225 18.292 30.223 1.00 9.13  ? 557 PHE C CE1 1 
ATOM   4211 C CE2 . PHE B 1 257 ? 16.198 19.675 30.339 1.00 6.47  ? 557 PHE C CE2 1 
ATOM   4212 C CZ  . PHE B 1 257 ? 14.914 19.346 30.797 1.00 7.63  ? 557 PHE C CZ  1 
ATOM   4213 N N   . ILE B 1 258 ? 19.005 17.032 25.325 1.00 5.66  ? 558 ILE C N   1 
ATOM   4214 C CA  . ILE B 1 258 ? 19.915 16.123 24.630 1.00 6.89  ? 558 ILE C CA  1 
ATOM   4215 C C   . ILE B 1 258 ? 21.036 15.950 25.651 1.00 6.55  ? 558 ILE C C   1 
ATOM   4216 O O   . ILE B 1 258 ? 21.324 16.875 26.426 1.00 5.97  ? 558 ILE C O   1 
ATOM   4217 C CB  . ILE B 1 258 ? 20.473 16.696 23.296 1.00 8.10  ? 558 ILE C CB  1 
ATOM   4218 C CG1 . ILE B 1 258 ? 21.196 18.019 23.542 1.00 7.42  ? 558 ILE C CG1 1 
ATOM   4219 C CG2 . ILE B 1 258 ? 19.330 16.847 22.285 1.00 5.69  ? 558 ILE C CG2 1 
ATOM   4220 C CD1 . ILE B 1 258 ? 21.811 18.621 22.264 1.00 8.81  ? 558 ILE C CD1 1 
ATOM   4221 N N   . ALA B 1 259 ? 21.656 14.776 25.667 1.00 6.18  ? 559 ALA C N   1 
ATOM   4222 C CA  . ALA B 1 259 ? 22.690 14.500 26.650 1.00 5.04  ? 559 ALA C CA  1 
ATOM   4223 C C   . ALA B 1 259 ? 23.767 13.575 26.133 1.00 5.87  ? 559 ALA C C   1 
ATOM   4224 O O   . ALA B 1 259 ? 23.570 12.824 25.165 1.00 5.28  ? 559 ALA C O   1 
ATOM   4225 C CB  . ALA B 1 259 ? 22.068 13.915 27.913 1.00 7.74  ? 559 ALA C CB  1 
ATOM   4226 N N   . LEU B 1 260 ? 24.905 13.625 26.813 1.00 3.83  ? 560 LEU C N   1 
ATOM   4227 C CA  . LEU B 1 260 ? 26.068 12.849 26.428 1.00 8.30  ? 560 LEU C CA  1 
ATOM   4228 C C   . LEU B 1 260 ? 26.799 12.441 27.709 1.00 8.68  ? 560 LEU C C   1 
ATOM   4229 O O   . LEU B 1 260 ? 26.877 13.237 28.642 1.00 8.73  ? 560 LEU C O   1 
ATOM   4230 C CB  . LEU B 1 260 ? 26.938 13.769 25.562 1.00 12.22 ? 560 LEU C CB  1 
ATOM   4231 C CG  . LEU B 1 260 ? 28.178 13.418 24.745 1.00 16.83 ? 560 LEU C CG  1 
ATOM   4232 C CD1 . LEU B 1 260 ? 27.876 12.312 23.743 1.00 10.92 ? 560 LEU C CD1 1 
ATOM   4233 C CD2 . LEU B 1 260 ? 28.633 14.709 24.021 1.00 12.91 ? 560 LEU C CD2 1 
ATOM   4234 N N   . ASN B 1 261 ? 27.278 11.200 27.807 1.00 8.17  ? 561 ASN C N   1 
ATOM   4235 C CA  . ASN B 1 261 ? 28.037 10.848 29.007 1.00 7.17  ? 561 ASN C CA  1 
ATOM   4236 C C   . ASN B 1 261 ? 29.509 10.766 28.633 1.00 9.93  ? 561 ASN C C   1 
ATOM   4237 O O   . ASN B 1 261 ? 29.869 10.945 27.463 1.00 10.69 ? 561 ASN C O   1 
ATOM   4238 C CB  . ASN B 1 261 ? 27.559 9.538  29.678 1.00 11.07 ? 561 ASN C CB  1 
ATOM   4239 C CG  . ASN B 1 261 ? 27.696 8.305  28.787 1.00 9.95  ? 561 ASN C CG  1 
ATOM   4240 O OD1 . ASN B 1 261 ? 28.506 8.265  27.869 1.00 10.17 ? 561 ASN C OD1 1 
ATOM   4241 N ND2 . ASN B 1 261 ? 26.902 7.280  29.084 1.00 10.12 ? 561 ASN C ND2 1 
ATOM   4242 N N   . LYS B 1 262 ? 30.351 10.505 29.629 1.00 10.37 ? 562 LYS C N   1 
ATOM   4243 C CA  . LYS B 1 262 ? 31.791 10.423 29.445 1.00 13.38 ? 562 LYS C CA  1 
ATOM   4244 C C   . LYS B 1 262 ? 32.243 9.366  28.432 1.00 11.38 ? 562 LYS C C   1 
ATOM   4245 O O   . LYS B 1 262 ? 33.354 9.441  27.909 1.00 10.66 ? 562 LYS C O   1 
ATOM   4246 C CB  . LYS B 1 262 ? 32.450 10.158 30.803 1.00 17.87 ? 562 LYS C CB  1 
ATOM   4247 C CG  . LYS B 1 262 ? 33.942 10.364 30.834 1.00 23.65 ? 562 LYS C CG  1 
ATOM   4248 C CD  . LYS B 1 262 ? 34.288 11.840 30.748 1.00 26.94 ? 562 LYS C CD  1 
ATOM   4249 C CE  . LYS B 1 262 ? 35.753 12.059 31.070 1.00 26.97 ? 562 LYS C CE  1 
ATOM   4250 N NZ  . LYS B 1 262 ? 36.077 13.504 31.050 1.00 27.93 ? 562 LYS C NZ  1 
ATOM   4251 N N   . LYS B 1 263 ? 31.404 8.370  28.166 1.00 12.35 ? 563 LYS C N   1 
ATOM   4252 C CA  . LYS B 1 263 ? 31.773 7.336  27.196 1.00 11.56 ? 563 LYS C CA  1 
ATOM   4253 C C   . LYS B 1 263 ? 31.347 7.700  25.776 1.00 12.25 ? 563 LYS C C   1 
ATOM   4254 O O   . LYS B 1 263 ? 31.606 6.957  24.827 1.00 11.56 ? 563 LYS C O   1 
ATOM   4255 C CB  . LYS B 1 263 ? 31.152 5.986  27.572 1.00 15.68 ? 563 LYS C CB  1 
ATOM   4256 C CG  . LYS B 1 263 ? 31.678 5.383  28.866 1.00 18.65 ? 563 LYS C CG  1 
ATOM   4257 C CD  . LYS B 1 263 ? 31.418 3.876  28.916 1.00 25.29 ? 563 LYS C CD  1 
ATOM   4258 C CE  . LYS B 1 263 ? 29.940 3.549  28.692 1.00 26.87 ? 563 LYS C CE  1 
ATOM   4259 N NZ  . LYS B 1 263 ? 29.672 2.068  28.703 1.00 32.54 ? 563 LYS C NZ  1 
ATOM   4260 N N   . GLY B 1 264 ? 30.682 8.838  25.620 1.00 10.08 ? 564 GLY C N   1 
ATOM   4261 C CA  . GLY B 1 264 ? 30.249 9.212  24.287 1.00 7.37  ? 564 GLY C CA  1 
ATOM   4262 C C   . GLY B 1 264 ? 28.899 8.629  23.929 1.00 7.50  ? 564 GLY C C   1 
ATOM   4263 O O   . GLY B 1 264 ? 28.468 8.707  22.771 1.00 5.90  ? 564 GLY C O   1 
ATOM   4264 N N   . GLU B 1 265 ? 28.236 8.018  24.905 1.00 5.05  ? 565 GLU C N   1 
ATOM   4265 C CA  . GLU B 1 265 ? 26.903 7.477  24.667 1.00 7.22  ? 565 GLU C CA  1 
ATOM   4266 C C   . GLU B 1 265 ? 26.033 8.726  24.688 1.00 6.09  ? 565 GLU C C   1 
ATOM   4267 O O   . GLU B 1 265 ? 26.347 9.669  25.407 1.00 6.65  ? 565 GLU C O   1 
ATOM   4268 C CB  . GLU B 1 265 ? 26.487 6.524  25.787 1.00 9.84  ? 565 GLU C CB  1 
ATOM   4269 C CG  . GLU B 1 265 ? 27.337 5.266  25.863 1.00 17.28 ? 565 GLU C CG  1 
ATOM   4270 C CD  . GLU B 1 265 ? 26.862 4.301  26.935 1.00 20.91 ? 565 GLU C CD  1 
ATOM   4271 O OE1 . GLU B 1 265 ? 27.076 4.571  28.137 1.00 17.89 ? 565 GLU C OE1 1 
ATOM   4272 O OE2 . GLU B 1 265 ? 26.260 3.267  26.571 1.00 27.47 ? 565 GLU C OE2 1 
ATOM   4273 N N   . TYR B 1 266 ? 24.946 8.742  23.921 1.00 5.28  ? 566 TYR C N   1 
ATOM   4274 C CA  . TYR B 1 266 ? 24.108 9.937  23.885 1.00 5.12  ? 566 TYR C CA  1 
ATOM   4275 C C   . TYR B 1 266 ? 22.631 9.620  23.835 1.00 6.94  ? 566 TYR C C   1 
ATOM   4276 O O   . TYR B 1 266 ? 22.231 8.477  23.617 1.00 8.99  ? 566 TYR C O   1 
ATOM   4277 C CB  . TYR B 1 266 ? 24.484 10.796 22.669 1.00 4.88  ? 566 TYR C CB  1 
ATOM   4278 C CG  . TYR B 1 266 ? 24.185 10.154 21.323 1.00 5.26  ? 566 TYR C CG  1 
ATOM   4279 C CD1 . TYR B 1 266 ? 22.937 10.305 20.711 1.00 9.13  ? 566 TYR C CD1 1 
ATOM   4280 C CD2 . TYR B 1 266 ? 25.147 9.388  20.669 1.00 8.49  ? 566 TYR C CD2 1 
ATOM   4281 C CE1 . TYR B 1 266 ? 22.659 9.696  19.462 1.00 8.04  ? 566 TYR C CE1 1 
ATOM   4282 C CE2 . TYR B 1 266 ? 24.880 8.777  19.434 1.00 9.42  ? 566 TYR C CE2 1 
ATOM   4283 C CZ  . TYR B 1 266 ? 23.638 8.937  18.841 1.00 9.54  ? 566 TYR C CZ  1 
ATOM   4284 O OH  . TYR B 1 266 ? 23.400 8.331  17.624 1.00 12.32 ? 566 TYR C OH  1 
ATOM   4285 N N   . GLY B 1 267 ? 21.809 10.645 24.012 1.00 7.51  ? 567 GLY C N   1 
ATOM   4286 C CA  . GLY B 1 267 ? 20.379 10.416 23.966 1.00 6.60  ? 567 GLY C CA  1 
ATOM   4287 C C   . GLY B 1 267 ? 19.619 11.714 24.061 1.00 7.20  ? 567 GLY C C   1 
ATOM   4288 O O   . GLY B 1 267 ? 20.198 12.785 24.279 1.00 7.28  ? 567 GLY C O   1 
ATOM   4289 N N   . ALA B 1 268 ? 18.313 11.616 23.896 1.00 5.91  ? 568 ALA C N   1 
ATOM   4290 C CA  . ALA B 1 268 ? 17.468 12.782 23.946 1.00 6.75  ? 568 ALA C CA  1 
ATOM   4291 C C   . ALA B 1 268 ? 16.037 12.357 24.227 1.00 6.80  ? 568 ALA C C   1 
ATOM   4292 O O   . ALA B 1 268 ? 15.688 11.170 24.157 1.00 4.78  ? 568 ALA C O   1 
ATOM   4293 C CB  . ALA B 1 268 ? 17.531 13.512 22.603 1.00 3.32  ? 568 ALA C CB  1 
ATOM   4294 N N   . TYR B 1 269 ? 15.209 13.347 24.535 1.00 7.37  ? 569 TYR C N   1 
ATOM   4295 C CA  . TYR B 1 269 ? 13.801 13.111 24.778 1.00 7.64  ? 569 TYR C CA  1 
ATOM   4296 C C   . TYR B 1 269 ? 13.123 14.473 24.784 1.00 9.25  ? 569 TYR C C   1 
ATOM   4297 O O   . TYR B 1 269 ? 13.750 15.484 25.087 1.00 8.84  ? 569 TYR C O   1 
ATOM   4298 C CB  . TYR B 1 269 ? 13.582 12.409 26.120 1.00 7.18  ? 569 TYR C CB  1 
ATOM   4299 C CG  . TYR B 1 269 ? 12.335 11.559 26.135 1.00 9.11  ? 569 TYR C CG  1 
ATOM   4300 C CD1 . TYR B 1 269 ? 12.333 10.284 25.568 1.00 8.07  ? 569 TYR C CD1 1 
ATOM   4301 C CD2 . TYR B 1 269 ? 11.149 12.028 26.701 1.00 7.15  ? 569 TYR C CD2 1 
ATOM   4302 C CE1 . TYR B 1 269 ? 11.182 9.492  25.567 1.00 8.98  ? 569 TYR C CE1 1 
ATOM   4303 C CE2 . TYR B 1 269 ? 9.994  11.242 26.697 1.00 12.41 ? 569 TYR C CE2 1 
ATOM   4304 C CZ  . TYR B 1 269 ? 10.028 9.975  26.131 1.00 9.73  ? 569 TYR C CZ  1 
ATOM   4305 O OH  . TYR B 1 269 ? 8.905  9.182  26.159 1.00 14.17 ? 569 TYR C OH  1 
ATOM   4306 N N   . CYS B 1 270 ? 11.847 14.512 24.431 1.00 8.29  ? 570 CYS C N   1 
ATOM   4307 C CA  . CYS B 1 270 ? 11.135 15.779 24.414 1.00 6.94  ? 570 CYS C CA  1 
ATOM   4308 C C   . CYS B 1 270 ? 9.675  15.604 24.807 1.00 5.50  ? 570 CYS C C   1 
ATOM   4309 O O   . CYS B 1 270 ? 9.198  14.479 24.967 1.00 5.72  ? 570 CYS C O   1 
ATOM   4310 C CB  . CYS B 1 270 ? 11.261 16.422 23.034 1.00 6.38  ? 570 CYS C CB  1 
ATOM   4311 S SG  . CYS B 1 270 ? 10.664 15.391 21.661 1.00 9.96  ? 570 CYS C SG  1 
ATOM   4312 N N   . ILE B 1 271 ? 8.984  16.721 25.001 1.00 5.32  ? 571 ILE C N   1 
ATOM   4313 C CA  . ILE B 1 271 ? 7.584  16.689 25.382 1.00 7.51  ? 571 ILE C CA  1 
ATOM   4314 C C   . ILE B 1 271 ? 6.709  16.336 24.189 1.00 7.97  ? 571 ILE C C   1 
ATOM   4315 O O   . ILE B 1 271 ? 5.903  15.390 24.249 1.00 8.52  ? 571 ILE C O   1 
ATOM   4316 C CB  . ILE B 1 271 ? 7.101  18.058 25.934 1.00 7.97  ? 571 ILE C CB  1 
ATOM   4317 C CG1 . ILE B 1 271 ? 7.807  18.380 27.250 1.00 7.73  ? 571 ILE C CG1 1 
ATOM   4318 C CG2 . ILE B 1 271 ? 5.576  18.016 26.156 1.00 10.66 ? 571 ILE C CG2 1 
ATOM   4319 C CD1 . ILE B 1 271 ? 7.379  19.722 27.896 1.00 9.46  ? 571 ILE C CD1 1 
ATOM   4320 N N   . GLN B 1 272 ? 6.860  17.098 23.106 1.00 10.48 ? 572 GLN C N   1 
ATOM   4321 C CA  . GLN B 1 272 ? 6.050  16.865 21.914 1.00 9.34  ? 572 GLN C CA  1 
ATOM   4322 C C   . GLN B 1 272 ? 6.837  16.417 20.693 1.00 12.63 ? 572 GLN C C   1 
ATOM   4323 O O   . GLN B 1 272 ? 7.995  16.775 20.528 1.00 9.79  ? 572 GLN C O   1 
ATOM   4324 C CB  . GLN B 1 272 ? 5.253  18.130 21.583 1.00 10.83 ? 572 GLN C CB  1 
ATOM   4325 C CG  . GLN B 1 272 ? 4.336  18.560 22.728 1.00 10.95 ? 572 GLN C CG  1 
ATOM   4326 C CD  . GLN B 1 272 ? 3.374  19.664 22.339 1.00 10.08 ? 572 GLN C CD  1 
ATOM   4327 O OE1 . GLN B 1 272 ? 2.734  19.594 21.300 1.00 12.54 ? 572 GLN C OE1 1 
ATOM   4328 N NE2 . GLN B 1 272 ? 3.259  20.686 23.184 1.00 7.54  ? 572 GLN C NE2 1 
ATOM   4329 N N   . ASP B 1 273 ? 6.190  15.615 19.849 1.00 13.36 ? 573 ASP C N   1 
ATOM   4330 C CA  . ASP B 1 273 ? 6.796  15.117 18.623 1.00 16.53 ? 573 ASP C CA  1 
ATOM   4331 C C   . ASP B 1 273 ? 7.198  16.319 17.783 1.00 17.38 ? 573 ASP C C   1 
ATOM   4332 O O   . ASP B 1 273 ? 6.646  17.410 17.952 1.00 17.56 ? 573 ASP C O   1 
ATOM   4333 C CB  . ASP B 1 273 ? 5.783  14.268 17.852 1.00 23.91 ? 573 ASP C CB  1 
ATOM   4334 C CG  . ASP B 1 273 ? 6.404  13.547 16.664 1.00 29.59 ? 573 ASP C CG  1 
ATOM   4335 O OD1 . ASP B 1 273 ? 7.310  12.715 16.878 1.00 31.01 ? 573 ASP C OD1 1 
ATOM   4336 O OD2 . ASP B 1 273 ? 5.985  13.811 15.517 1.00 36.89 ? 573 ASP C OD2 1 
ATOM   4337 N N   . GLY B 1 274 ? 8.165  16.129 16.892 1.00 15.77 ? 574 GLY C N   1 
ATOM   4338 C CA  . GLY B 1 274 ? 8.592  17.229 16.042 1.00 18.12 ? 574 GLY C CA  1 
ATOM   4339 C C   . GLY B 1 274 ? 9.972  17.778 16.351 1.00 16.25 ? 574 GLY C C   1 
ATOM   4340 O O   . GLY B 1 274 ? 10.562 18.496 15.545 1.00 17.76 ? 574 GLY C O   1 
ATOM   4341 N N   . PHE B 1 275 ? 10.489 17.459 17.526 1.00 11.18 ? 575 PHE C N   1 
ATOM   4342 C CA  . PHE B 1 275 ? 11.821 17.920 17.899 1.00 9.88  ? 575 PHE C CA  1 
ATOM   4343 C C   . PHE B 1 275 ? 12.831 16.877 17.456 1.00 8.24  ? 575 PHE C C   1 
ATOM   4344 O O   . PHE B 1 275 ? 12.667 15.700 17.769 1.00 9.93  ? 575 PHE C O   1 
ATOM   4345 C CB  . PHE B 1 275 ? 11.928 18.097 19.426 1.00 7.45  ? 575 PHE C CB  1 
ATOM   4346 C CG  . PHE B 1 275 ? 13.340 18.282 19.917 1.00 8.22  ? 575 PHE C CG  1 
ATOM   4347 C CD1 . PHE B 1 275 ? 14.000 19.494 19.740 1.00 7.06  ? 575 PHE C CD1 1 
ATOM   4348 C CD2 . PHE B 1 275 ? 14.014 17.238 20.536 1.00 9.80  ? 575 PHE C CD2 1 
ATOM   4349 C CE1 . PHE B 1 275 ? 15.319 19.669 20.173 1.00 9.06  ? 575 PHE C CE1 1 
ATOM   4350 C CE2 . PHE B 1 275 ? 15.329 17.394 20.971 1.00 11.15 ? 575 PHE C CE2 1 
ATOM   4351 C CZ  . PHE B 1 275 ? 15.987 18.618 20.791 1.00 9.09  ? 575 PHE C CZ  1 
ATOM   4352 N N   . ASN B 1 276 ? 13.857 17.297 16.714 1.00 7.03  ? 576 ASN C N   1 
ATOM   4353 C CA  . ASN B 1 276 ? 14.923 16.383 16.294 1.00 6.92  ? 576 ASN C CA  1 
ATOM   4354 C C   . ASN B 1 276 ? 16.207 16.981 16.842 1.00 5.60  ? 576 ASN C C   1 
ATOM   4355 O O   . ASN B 1 276 ? 16.207 18.112 17.306 1.00 4.52  ? 576 ASN C O   1 
ATOM   4356 C CB  . ASN B 1 276 ? 15.088 16.344 14.767 1.00 8.45  ? 576 ASN C CB  1 
ATOM   4357 C CG  . ASN B 1 276 ? 13.823 15.943 14.040 1.00 8.30  ? 576 ASN C CG  1 
ATOM   4358 O OD1 . ASN B 1 276 ? 13.445 16.576 13.052 1.00 12.03 ? 576 ASN C OD1 1 
ATOM   4359 N ND2 . ASN B 1 276 ? 13.177 14.890 14.504 1.00 2.39  ? 576 ASN C ND2 1 
ATOM   4360 N N   . PHE B 1 277 ? 17.291 16.214 16.790 1.00 6.16  ? 577 PHE C N   1 
ATOM   4361 C CA  . PHE B 1 277 ? 18.600 16.717 17.187 1.00 7.12  ? 577 PHE C CA  1 
ATOM   4362 C C   . PHE B 1 277 ? 19.611 16.143 16.197 1.00 7.24  ? 577 PHE C C   1 
ATOM   4363 O O   . PHE B 1 277 ? 19.327 15.159 15.501 1.00 8.46  ? 577 PHE C O   1 
ATOM   4364 C CB  . PHE B 1 277 ? 18.960 16.343 18.633 1.00 5.98  ? 577 PHE C CB  1 
ATOM   4365 C CG  . PHE B 1 277 ? 19.156 14.890 18.853 1.00 10.28 ? 577 PHE C CG  1 
ATOM   4366 C CD1 . PHE B 1 277 ? 20.431 14.333 18.836 1.00 7.20  ? 577 PHE C CD1 1 
ATOM   4367 C CD2 . PHE B 1 277 ? 18.056 14.058 19.054 1.00 7.24  ? 577 PHE C CD2 1 
ATOM   4368 C CE1 . PHE B 1 277 ? 20.607 12.956 19.012 1.00 10.99 ? 577 PHE C CE1 1 
ATOM   4369 C CE2 . PHE B 1 277 ? 18.220 12.688 19.230 1.00 11.05 ? 577 PHE C CE2 1 
ATOM   4370 C CZ  . PHE B 1 277 ? 19.495 12.135 19.208 1.00 11.30 ? 577 PHE C CZ  1 
ATOM   4371 N N   . ALA B 1 278 ? 20.778 16.771 16.112 1.00 7.62  ? 578 ALA C N   1 
ATOM   4372 C CA  . ALA B 1 278 ? 21.810 16.328 15.192 1.00 4.73  ? 578 ALA C CA  1 
ATOM   4373 C C   . ALA B 1 278 ? 22.989 15.789 15.972 1.00 6.72  ? 578 ALA C C   1 
ATOM   4374 O O   . ALA B 1 278 ? 23.402 16.390 16.959 1.00 5.52  ? 578 ALA C O   1 
ATOM   4375 C CB  . ALA B 1 278 ? 22.254 17.504 14.310 1.00 5.38  ? 578 ALA C CB  1 
ATOM   4376 N N   . VAL B 1 279 ? 23.538 14.662 15.528 1.00 5.43  ? 579 VAL C N   1 
ATOM   4377 C CA  . VAL B 1 279 ? 24.680 14.069 16.205 1.00 6.56  ? 579 VAL C CA  1 
ATOM   4378 C C   . VAL B 1 279 ? 25.765 13.763 15.182 1.00 5.82  ? 579 VAL C C   1 
ATOM   4379 O O   . VAL B 1 279 ? 25.499 13.162 14.138 1.00 6.80  ? 579 VAL C O   1 
ATOM   4380 C CB  . VAL B 1 279 ? 24.285 12.771 16.998 1.00 5.25  ? 579 VAL C CB  1 
ATOM   4381 C CG1 . VAL B 1 279 ? 23.519 11.786 16.101 1.00 5.95  ? 579 VAL C CG1 1 
ATOM   4382 C CG2 . VAL B 1 279 ? 25.547 12.100 17.566 1.00 9.88  ? 579 VAL C CG2 1 
ATOM   4383 N N   . HIS B 1 280 ? 26.980 14.222 15.469 1.00 6.56  ? 580 HIS C N   1 
ATOM   4384 C CA  . HIS B 1 280 ? 28.106 13.992 14.573 1.00 6.01  ? 580 HIS C CA  1 
ATOM   4385 C C   . HIS B 1 280 ? 29.211 13.245 15.310 1.00 9.74  ? 580 HIS C C   1 
ATOM   4386 O O   . HIS B 1 280 ? 29.697 13.685 16.352 1.00 7.20  ? 580 HIS C O   1 
ATOM   4387 C CB  . HIS B 1 280 ? 28.661 15.320 14.055 1.00 7.06  ? 580 HIS C CB  1 
ATOM   4388 C CG  . HIS B 1 280 ? 29.495 15.193 12.813 1.00 5.24  ? 580 HIS C CG  1 
ATOM   4389 N ND1 . HIS B 1 280 ? 30.314 14.110 12.571 1.00 7.49  ? 580 HIS C ND1 1 
ATOM   4390 C CD2 . HIS B 1 280 ? 29.645 16.024 11.753 1.00 6.42  ? 580 HIS C CD2 1 
ATOM   4391 C CE1 . HIS B 1 280 ? 30.935 14.280 11.414 1.00 7.88  ? 580 HIS C CE1 1 
ATOM   4392 N NE2 . HIS B 1 280 ? 30.546 15.434 10.898 1.00 8.66  ? 580 HIS C NE2 1 
ATOM   4393 N N   . ASP B 1 281 ? 29.595 12.093 14.779 1.00 8.17  ? 581 ASP C N   1 
ATOM   4394 C CA  . ASP B 1 281 ? 30.680 11.338 15.378 1.00 9.03  ? 581 ASP C CA  1 
ATOM   4395 C C   . ASP B 1 281 ? 31.541 10.825 14.228 1.00 10.23 ? 581 ASP C C   1 
ATOM   4396 O O   . ASP B 1 281 ? 31.361 11.238 13.083 1.00 11.22 ? 581 ASP C O   1 
ATOM   4397 C CB  . ASP B 1 281 ? 30.152 10.202 16.290 1.00 10.15 ? 581 ASP C CB  1 
ATOM   4398 C CG  . ASP B 1 281 ? 29.242 9.208  15.568 1.00 13.40 ? 581 ASP C CG  1 
ATOM   4399 O OD1 . ASP B 1 281 ? 28.478 8.510  16.283 1.00 10.82 ? 581 ASP C OD1 1 
ATOM   4400 O OD2 . ASP B 1 281 ? 29.287 9.107  14.320 1.00 12.32 ? 581 ASP C OD2 1 
ATOM   4401 N N   . GLN B 1 282 ? 32.493 9.956  14.511 1.00 11.54 ? 582 GLN C N   1 
ATOM   4402 C CA  . GLN B 1 282 ? 33.350 9.478  13.444 1.00 13.87 ? 582 GLN C CA  1 
ATOM   4403 C C   . GLN B 1 282 ? 32.637 8.722  12.328 1.00 15.78 ? 582 GLN C C   1 
ATOM   4404 O O   . GLN B 1 282 ? 33.197 8.554  11.242 1.00 15.78 ? 582 GLN C O   1 
ATOM   4405 C CB  . GLN B 1 282 ? 34.478 8.648  14.025 1.00 14.44 ? 582 GLN C CB  1 
ATOM   4406 C CG  . GLN B 1 282 ? 35.674 9.523  14.409 1.00 18.14 ? 582 GLN C CG  1 
ATOM   4407 C CD  . GLN B 1 282 ? 36.787 8.727  15.037 1.00 21.45 ? 582 GLN C CD  1 
ATOM   4408 O OE1 . GLN B 1 282 ? 36.741 8.396  16.227 1.00 22.33 ? 582 GLN C OE1 1 
ATOM   4409 N NE2 . GLN B 1 282 ? 37.793 8.397  14.238 1.00 21.92 ? 582 GLN C NE2 1 
ATOM   4410 N N   . LYS B 1 283 ? 31.407 8.281  12.579 1.00 13.22 ? 583 LYS C N   1 
ATOM   4411 C CA  . LYS B 1 283 ? 30.661 7.574  11.541 1.00 15.33 ? 583 LYS C CA  1 
ATOM   4412 C C   . LYS B 1 283 ? 29.921 8.562  10.647 1.00 13.59 ? 583 LYS C C   1 
ATOM   4413 O O   . LYS B 1 283 ? 29.504 8.225  9.548  1.00 12.32 ? 583 LYS C O   1 
ATOM   4414 C CB  . LYS B 1 283 ? 29.648 6.597  12.144 1.00 21.01 ? 583 LYS C CB  1 
ATOM   4415 C CG  . LYS B 1 283 ? 29.044 5.678  11.083 1.00 29.59 ? 583 LYS C CG  1 
ATOM   4416 C CD  . LYS B 1 283 ? 28.030 4.683  11.633 1.00 32.20 ? 583 LYS C CD  1 
ATOM   4417 C CE  . LYS B 1 283 ? 27.717 3.612  10.588 1.00 34.03 ? 583 LYS C CE  1 
ATOM   4418 N NZ  . LYS B 1 283 ? 27.466 4.191  9.229  1.00 33.16 ? 583 LYS C NZ  1 
ATOM   4419 N N   . GLY B 1 284 ? 29.751 9.791  11.112 1.00 13.07 ? 584 GLY C N   1 
ATOM   4420 C CA  . GLY B 1 284 ? 29.047 10.753 10.287 1.00 10.08 ? 584 GLY C CA  1 
ATOM   4421 C C   . GLY B 1 284 ? 28.137 11.661 11.084 1.00 9.01  ? 584 GLY C C   1 
ATOM   4422 O O   . GLY B 1 284 ? 28.113 11.594 12.306 1.00 9.85  ? 584 GLY C O   1 
ATOM   4423 N N   . ASN B 1 285 ? 27.402 12.513 10.372 1.00 8.91  ? 585 ASN C N   1 
ATOM   4424 C CA  . ASN B 1 285 ? 26.475 13.482 10.964 1.00 9.88  ? 585 ASN C CA  1 
ATOM   4425 C C   . ASN B 1 285 ? 25.059 12.962 10.688 1.00 10.88 ? 585 ASN C C   1 
ATOM   4426 O O   . ASN B 1 285 ? 24.712 12.685 9.538  1.00 10.97 ? 585 ASN C O   1 
ATOM   4427 C CB  . ASN B 1 285 ? 26.694 14.833 10.278 1.00 8.13  ? 585 ASN C CB  1 
ATOM   4428 C CG  . ASN B 1 285 ? 26.260 16.017 11.119 1.00 7.67  ? 585 ASN C CG  1 
ATOM   4429 O OD1 . ASN B 1 285 ? 26.000 15.896 12.315 1.00 9.47  ? 585 ASN C OD1 1 
ATOM   4430 N ND2 . ASN B 1 285 ? 26.204 17.188 10.488 1.00 8.99  ? 585 ASN C ND2 1 
ATOM   4431 N N   . ARG B 1 286 ? 24.238 12.849 11.728 1.00 6.74  ? 586 ARG C N   1 
ATOM   4432 C CA  . ARG B 1 286 ? 22.885 12.322 11.572 1.00 7.86  ? 586 ARG C CA  1 
ATOM   4433 C C   . ARG B 1 286 ? 21.805 13.161 12.246 1.00 8.17  ? 586 ARG C C   1 
ATOM   4434 O O   . ARG B 1 286 ? 22.006 13.700 13.338 1.00 5.46  ? 586 ARG C O   1 
ATOM   4435 C CB  . ARG B 1 286 ? 22.808 10.909 12.167 1.00 10.43 ? 586 ARG C CB  1 
ATOM   4436 C CG  . ARG B 1 286 ? 23.916 9.959  11.715 1.00 9.75  ? 586 ARG C CG  1 
ATOM   4437 C CD  . ARG B 1 286 ? 23.819 8.625  12.455 1.00 9.51  ? 586 ARG C CD  1 
ATOM   4438 N NE  . ARG B 1 286 ? 24.183 8.722  13.873 1.00 4.61  ? 586 ARG C NE  1 
ATOM   4439 C CZ  . ARG B 1 286 ? 25.432 8.824  14.319 1.00 6.92  ? 586 ARG C CZ  1 
ATOM   4440 N NH1 . ARG B 1 286 ? 26.448 8.850  13.466 1.00 7.48  ? 586 ARG C NH1 1 
ATOM   4441 N NH2 . ARG B 1 286 ? 25.673 8.879  15.624 1.00 9.43  ? 586 ARG C NH2 1 
ATOM   4442 N N   . LEU B 1 287 ? 20.656 13.266 11.589 1.00 6.92  ? 587 LEU C N   1 
ATOM   4443 C CA  . LEU B 1 287 ? 19.522 13.980 12.160 1.00 8.44  ? 587 LEU C CA  1 
ATOM   4444 C C   . LEU B 1 287 ? 18.707 12.864 12.803 1.00 8.48  ? 587 LEU C C   1 
ATOM   4445 O O   . LEU B 1 287 ? 18.218 11.953 12.108 1.00 7.11  ? 587 LEU C O   1 
ATOM   4446 C CB  . LEU B 1 287 ? 18.698 14.669 11.068 1.00 9.41  ? 587 LEU C CB  1 
ATOM   4447 C CG  . LEU B 1 287 ? 17.520 15.499 11.593 1.00 8.29  ? 587 LEU C CG  1 
ATOM   4448 C CD1 . LEU B 1 287 ? 18.029 16.620 12.488 1.00 9.43  ? 587 LEU C CD1 1 
ATOM   4449 C CD2 . LEU B 1 287 ? 16.731 16.068 10.419 1.00 11.16 ? 587 LEU C CD2 1 
ATOM   4450 N N   . GLU B 1 288 ? 18.581 12.903 14.124 1.00 8.89  ? 588 GLU C N   1 
ATOM   4451 C CA  . GLU B 1 288 ? 17.843 11.862 14.823 1.00 8.73  ? 588 GLU C CA  1 
ATOM   4452 C C   . GLU B 1 288 ? 16.599 12.376 15.545 1.00 9.55  ? 588 GLU C C   1 
ATOM   4453 O O   . GLU B 1 288 ? 16.525 13.537 15.937 1.00 9.17  ? 588 GLU C O   1 
ATOM   4454 C CB  . GLU B 1 288 ? 18.802 11.096 15.751 1.00 9.48  ? 588 GLU C CB  1 
ATOM   4455 C CG  . GLU B 1 288 ? 19.899 10.378 14.934 1.00 13.72 ? 588 GLU C CG  1 
ATOM   4456 C CD  . GLU B 1 288 ? 20.809 9.445  15.737 1.00 15.53 ? 588 GLU C CD  1 
ATOM   4457 O OE1 . GLU B 1 288 ? 21.714 8.838  15.124 1.00 18.02 ? 588 GLU C OE1 1 
ATOM   4458 O OE2 . GLU B 1 288 ? 20.629 9.304  16.958 1.00 13.82 ? 588 GLU C OE2 1 
ATOM   4459 N N   . THR B 1 289 ? 15.608 11.500 15.699 1.00 10.79 ? 589 THR C N   1 
ATOM   4460 C CA  . THR B 1 289 ? 14.338 11.871 16.316 1.00 11.32 ? 589 THR C CA  1 
ATOM   4461 C C   . THR B 1 289 ? 14.106 11.065 17.583 1.00 12.73 ? 589 THR C C   1 
ATOM   4462 O O   . THR B 1 289 ? 13.889 9.848  17.525 1.00 11.70 ? 589 THR C O   1 
ATOM   4463 C CB  . THR B 1 289 ? 13.180 11.602 15.332 1.00 14.59 ? 589 THR C CB  1 
ATOM   4464 O OG1 . THR B 1 289 ? 13.480 12.219 14.075 1.00 13.59 ? 589 THR C OG1 1 
ATOM   4465 C CG2 . THR B 1 289 ? 11.861 12.145 15.870 1.00 10.89 ? 589 THR C CG2 1 
ATOM   4466 N N   . PRO B 1 290 ? 14.135 11.733 18.744 1.00 9.12  ? 590 PRO C N   1 
ATOM   4467 C CA  . PRO B 1 290 ? 13.927 11.052 20.021 1.00 8.97  ? 590 PRO C CA  1 
ATOM   4468 C C   . PRO B 1 290 ? 12.464 10.779 20.334 1.00 8.97  ? 590 PRO C C   1 
ATOM   4469 O O   . PRO B 1 290 ? 11.567 11.204 19.598 1.00 6.89  ? 590 PRO C O   1 
ATOM   4470 C CB  . PRO B 1 290 ? 14.566 12.009 21.017 1.00 8.08  ? 590 PRO C CB  1 
ATOM   4471 C CG  . PRO B 1 290 ? 14.234 13.356 20.434 1.00 9.63  ? 590 PRO C CG  1 
ATOM   4472 C CD  . PRO B 1 290 ? 14.497 13.148 18.945 1.00 9.87  ? 590 PRO C CD  1 
ATOM   4473 N N   . GLY B 1 291 ? 12.238 10.064 21.433 1.00 8.67  ? 591 GLY C N   1 
ATOM   4474 C CA  . GLY B 1 291 ? 10.888 9.750  21.851 1.00 10.48 ? 591 GLY C CA  1 
ATOM   4475 C C   . GLY B 1 291 ? 10.287 10.976 22.504 1.00 9.03  ? 591 GLY C C   1 
ATOM   4476 O O   . GLY B 1 291 ? 11.020 11.856 22.961 1.00 7.55  ? 591 GLY C O   1 
ATOM   4477 N N   . PHE B 1 292 ? 8.960  11.043 22.546 1.00 8.75  ? 592 PHE C N   1 
ATOM   4478 C CA  . PHE B 1 292 ? 8.269  12.182 23.155 1.00 9.34  ? 592 PHE C CA  1 
ATOM   4479 C C   . PHE B 1 292 ? 7.200  11.713 24.142 1.00 8.40  ? 592 PHE C C   1 
ATOM   4480 O O   . PHE B 1 292 ? 6.630  10.620 24.000 1.00 10.46 ? 592 PHE C O   1 
ATOM   4481 C CB  . PHE B 1 292 ? 7.656  13.066 22.062 1.00 9.75  ? 592 PHE C CB  1 
ATOM   4482 C CG  . PHE B 1 292 ? 6.810  12.314 21.073 1.00 12.72 ? 592 PHE C CG  1 
ATOM   4483 C CD1 . PHE B 1 292 ? 5.441  12.156 21.284 1.00 13.63 ? 592 PHE C CD1 1 
ATOM   4484 C CD2 . PHE B 1 292 ? 7.385  11.736 19.944 1.00 14.13 ? 592 PHE C CD2 1 
ATOM   4485 C CE1 . PHE B 1 292 ? 4.650  11.432 20.382 1.00 18.82 ? 592 PHE C CE1 1 
ATOM   4486 C CE2 . PHE B 1 292 ? 6.604  11.005 19.031 1.00 17.52 ? 592 PHE C CE2 1 
ATOM   4487 C CZ  . PHE B 1 292 ? 5.234  10.854 19.253 1.00 19.02 ? 592 PHE C CZ  1 
ATOM   4488 N N   . ALA B 1 293 ? 6.931  12.539 25.145 1.00 6.85  ? 593 ALA C N   1 
ATOM   4489 C CA  . ALA B 1 293 ? 5.955  12.202 26.185 1.00 9.84  ? 593 ALA C CA  1 
ATOM   4490 C C   . ALA B 1 293 ? 4.486  12.388 25.803 1.00 11.08 ? 593 ALA C C   1 
ATOM   4491 O O   . ALA B 1 293 ? 3.621  11.611 26.230 1.00 10.68 ? 593 ALA C O   1 
ATOM   4492 C CB  . ALA B 1 293 ? 6.251  13.020 27.452 1.00 8.18  ? 593 ALA C CB  1 
ATOM   4493 N N   . LEU B 1 294 ? 4.196  13.410 25.011 1.00 11.76 ? 594 LEU C N   1 
ATOM   4494 C CA  . LEU B 1 294 ? 2.813  13.688 24.647 1.00 14.25 ? 594 LEU C CA  1 
ATOM   4495 C C   . LEU B 1 294 ? 2.250  12.802 23.544 1.00 15.32 ? 594 LEU C C   1 
ATOM   4496 O O   . LEU B 1 294 ? 2.417  13.069 22.357 1.00 16.37 ? 594 LEU C O   1 
ATOM   4497 C CB  . LEU B 1 294 ? 2.649  15.161 24.268 1.00 11.41 ? 594 LEU C CB  1 
ATOM   4498 C CG  . LEU B 1 294 ? 1.246  15.742 24.518 1.00 14.58 ? 594 LEU C CG  1 
ATOM   4499 C CD1 . LEU B 1 294 ? 1.301  17.262 24.458 1.00 9.74  ? 594 LEU C CD1 1 
ATOM   4500 C CD2 . LEU B 1 294 ? 0.251  15.175 23.506 1.00 12.90 ? 594 LEU C CD2 1 
ATOM   4501 N N   . LYS B 1 295 ? 1.570  11.746 23.965 1.00 21.40 ? 595 LYS C N   1 
ATOM   4502 C CA  . LYS B 1 295 ? 0.947  10.804 23.049 1.00 27.32 ? 595 LYS C CA  1 
ATOM   4503 C C   . LYS B 1 295 ? -0.489 11.229 22.762 1.00 30.19 ? 595 LYS C C   1 
ATOM   4504 O O   . LYS B 1 295 ? -0.855 11.293 21.569 1.00 34.78 ? 595 LYS C O   1 
ATOM   4505 C CB  . LYS B 1 295 ? 0.953  9.402  23.656 1.00 30.15 ? 595 LYS C CB  1 
ATOM   4506 C CG  . LYS B 1 295 ? 2.097  8.525  23.174 1.00 31.98 ? 595 LYS C CG  1 
ATOM   4507 C CD  . LYS B 1 295 ? 3.449  8.989  23.678 1.00 30.30 ? 595 LYS C CD  1 
ATOM   4508 C CE  . LYS B 1 295 ? 4.550  8.123  23.083 1.00 30.75 ? 595 LYS C CE  1 
ATOM   4509 N NZ  . LYS B 1 295 ? 5.831  8.201  23.837 1.00 33.37 ? 595 LYS C NZ  1 
ATOM   4510 O OXT . LYS B 1 295 ? -1.237 11.484 23.732 1.00 31.41 ? 595 LYS C OXT 1 
HETATM 4511 C C1  . GOL C 2 .   ? 24.682 35.942 45.065 0.50 12.78 ? 296 GOL A C1  1 
HETATM 4512 O O1  . GOL C 2 .   ? 23.600 36.826 45.324 0.50 14.72 ? 296 GOL A O1  1 
HETATM 4513 C C2  . GOL C 2 .   ? 25.870 36.342 45.920 0.50 11.66 ? 296 GOL A C2  1 
HETATM 4514 O O2  . GOL C 2 .   ? 25.474 36.365 47.294 0.50 12.30 ? 296 GOL A O2  1 
HETATM 4515 C C3  . GOL C 2 .   ? 26.356 37.724 45.506 0.50 17.09 ? 296 GOL A C3  1 
HETATM 4516 O O3  . GOL C 2 .   ? 25.273 38.651 45.585 0.50 21.48 ? 296 GOL A O3  1 
HETATM 4517 C C1  . GOL D 2 .   ? 24.086 36.424 45.757 0.50 17.09 ? 297 GOL A C1  1 
HETATM 4518 O O1  . GOL D 2 .   ? 24.165 35.954 44.416 0.50 23.38 ? 297 GOL A O1  1 
HETATM 4519 C C2  . GOL D 2 .   ? 25.411 37.051 46.159 0.50 13.18 ? 297 GOL A C2  1 
HETATM 4520 O O2  . GOL D 2 .   ? 25.687 38.159 45.305 0.50 18.74 ? 297 GOL A O2  1 
HETATM 4521 C C3  . GOL D 2 .   ? 26.528 36.022 46.029 0.50 18.69 ? 297 GOL A C3  1 
HETATM 4522 O O3  . GOL D 2 .   ? 26.642 35.638 44.662 0.50 11.48 ? 297 GOL A O3  1 
HETATM 4523 C C1  . GOL E 2 .   ? 15.594 30.251 27.089 0.50 12.76 ? 2   GOL C C1  1 
HETATM 4524 O O1  . GOL E 2 .   ? 16.726 30.834 26.457 0.50 16.64 ? 2   GOL C O1  1 
HETATM 4525 C C2  . GOL E 2 .   ? 14.461 30.126 26.088 0.50 11.82 ? 2   GOL C C2  1 
HETATM 4526 O O2  . GOL E 2 .   ? 14.930 29.430 24.928 0.50 10.98 ? 2   GOL C O2  1 
HETATM 4527 C C3  . GOL E 2 .   ? 13.966 31.511 25.687 0.50 16.01 ? 2   GOL C C3  1 
HETATM 4528 O O3  . GOL E 2 .   ? 15.037 32.266 25.133 0.50 18.16 ? 2   GOL C O3  1 
HETATM 4529 C C1  . GOL F 2 .   ? 16.173 30.532 26.320 0.50 16.00 ? 4   GOL C C1  1 
HETATM 4530 O O1  . GOL F 2 .   ? 15.887 31.402 27.413 0.50 24.11 ? 4   GOL C O1  1 
HETATM 4531 C C2  . GOL F 2 .   ? 14.901 30.308 25.525 0.50 11.78 ? 4   GOL C C2  1 
HETATM 4532 O O2  . GOL F 2 .   ? 14.393 31.570 25.092 0.50 16.09 ? 4   GOL C O2  1 
HETATM 4533 C C3  . GOL F 2 .   ? 13.869 29.635 26.420 0.50 16.45 ? 4   GOL C C3  1 
HETATM 4534 O O3  . GOL F 2 .   ? 13.619 30.478 27.539 0.50 13.44 ? 4   GOL C O3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   1   1   THR THR A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  HIS 16  16  16  HIS HIS A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  TRP 22  22  22  TRP TRP A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 MET 103 103 103 MET MET A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 TRP 132 132 132 TRP TRP A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 HIS 178 178 178 HIS HIS A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 GLN 229 229 229 GLN GLN A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 CYS 232 232 232 CYS CYS A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ASN 244 244 244 ASN ASN A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 VAL 279 279 279 VAL VAL A . n 
A 1 280 HIS 280 280 280 HIS HIS A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 ALA 293 293 293 ALA ALA A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
B 1 1   THR 1   301 301 THR THR C . n 
B 1 2   THR 2   302 302 THR THR C . n 
B 1 3   ASN 3   303 303 ASN ASN C . n 
B 1 4   LYS 4   304 304 LYS LYS C . n 
B 1 5   PRO 5   305 305 PRO PRO C . n 
B 1 6   ILE 6   306 306 ILE ILE C . n 
B 1 7   VAL 7   307 307 VAL VAL C . n 
B 1 8   LEU 8   308 308 LEU LEU C . n 
B 1 9   SER 9   309 309 SER SER C . n 
B 1 10  THR 10  310 310 THR THR C . n 
B 1 11  TRP 11  311 311 TRP TRP C . n 
B 1 12  ASN 12  312 312 ASN ASN C . n 
B 1 13  PHE 13  313 313 PHE PHE C . n 
B 1 14  GLY 14  314 314 GLY GLY C . n 
B 1 15  LEU 15  315 315 LEU LEU C . n 
B 1 16  HIS 16  316 316 HIS HIS C . n 
B 1 17  ALA 17  317 317 ALA ALA C . n 
B 1 18  ASN 18  318 318 ASN ASN C . n 
B 1 19  VAL 19  319 319 VAL VAL C . n 
B 1 20  GLU 20  320 320 GLU GLU C . n 
B 1 21  ALA 21  321 321 ALA ALA C . n 
B 1 22  TRP 22  322 322 TRP TRP C . n 
B 1 23  LYS 23  323 323 LYS LYS C . n 
B 1 24  VAL 24  324 324 VAL VAL C . n 
B 1 25  LEU 25  325 325 LEU LEU C . n 
B 1 26  SER 26  326 326 SER SER C . n 
B 1 27  LYS 27  327 327 LYS LYS C . n 
B 1 28  GLY 28  328 328 GLY GLY C . n 
B 1 29  GLY 29  329 329 GLY GLY C . n 
B 1 30  LYS 30  330 330 LYS LYS C . n 
B 1 31  ALA 31  331 331 ALA ALA C . n 
B 1 32  LEU 32  332 332 LEU LEU C . n 
B 1 33  ASP 33  333 333 ASP ASP C . n 
B 1 34  ALA 34  334 334 ALA ALA C . n 
B 1 35  VAL 35  335 335 VAL VAL C . n 
B 1 36  GLU 36  336 336 GLU GLU C . n 
B 1 37  LYS 37  337 337 LYS LYS C . n 
B 1 38  GLY 38  338 338 GLY GLY C . n 
B 1 39  VAL 39  339 339 VAL VAL C . n 
B 1 40  ARG 40  340 340 ARG ARG C . n 
B 1 41  LEU 41  341 341 LEU LEU C . n 
B 1 42  VAL 42  342 342 VAL VAL C . n 
B 1 43  GLU 43  343 343 GLU GLU C . n 
B 1 44  ASP 44  344 344 ASP ASP C . n 
B 1 45  ASP 45  345 345 ASP ASP C . n 
B 1 46  PRO 46  346 346 PRO PRO C . n 
B 1 47  THR 47  347 347 THR THR C . n 
B 1 48  GLU 48  348 348 GLU GLU C . n 
B 1 49  ARG 49  349 349 ARG ARG C . n 
B 1 50  SER 50  350 350 SER SER C . n 
B 1 51  VAL 51  351 351 VAL VAL C . n 
B 1 52  GLY 52  352 352 GLY GLY C . n 
B 1 53  TYR 53  353 353 TYR TYR C . n 
B 1 54  GLY 54  354 354 GLY GLY C . n 
B 1 55  GLY 55  355 355 GLY GLY C . n 
B 1 56  ARG 56  356 356 ARG ARG C . n 
B 1 57  PRO 57  357 357 PRO PRO C . n 
B 1 58  ASP 58  358 358 ASP ASP C . n 
B 1 59  ARG 59  359 359 ARG ARG C . n 
B 1 60  ASP 60  360 360 ASP ASP C . n 
B 1 61  GLY 61  361 361 GLY GLY C . n 
B 1 62  ARG 62  362 362 ARG ARG C . n 
B 1 63  VAL 63  363 363 VAL VAL C . n 
B 1 64  THR 64  364 364 THR THR C . n 
B 1 65  LEU 65  365 365 LEU LEU C . n 
B 1 66  ASP 66  366 366 ASP ASP C . n 
B 1 67  ALA 67  367 367 ALA ALA C . n 
B 1 68  CYS 68  368 368 CYS CYS C . n 
B 1 69  ILE 69  369 369 ILE ILE C . n 
B 1 70  MET 70  370 370 MET MET C . n 
B 1 71  ASP 71  371 371 ASP ASP C . n 
B 1 72  GLU 72  372 372 GLU GLU C . n 
B 1 73  ASN 73  373 373 ASN ASN C . n 
B 1 74  TYR 74  374 374 TYR TYR C . n 
B 1 75  ASN 75  375 375 ASN ASN C . n 
B 1 76  ILE 76  376 376 ILE ILE C . n 
B 1 77  GLY 77  377 377 GLY GLY C . n 
B 1 78  SER 78  378 378 SER SER C . n 
B 1 79  VAL 79  379 379 VAL VAL C . n 
B 1 80  ALA 80  380 380 ALA ALA C . n 
B 1 81  CYS 81  381 381 CYS CYS C . n 
B 1 82  MET 82  382 382 MET MET C . n 
B 1 83  GLU 83  383 383 GLU GLU C . n 
B 1 84  HIS 84  384 384 HIS HIS C . n 
B 1 85  ILE 85  385 385 ILE ILE C . n 
B 1 86  LYS 86  386 386 LYS LYS C . n 
B 1 87  ASN 87  387 387 ASN ASN C . n 
B 1 88  PRO 88  388 388 PRO PRO C . n 
B 1 89  ILE 89  389 389 ILE ILE C . n 
B 1 90  SER 90  390 390 SER SER C . n 
B 1 91  VAL 91  391 391 VAL VAL C . n 
B 1 92  ALA 92  392 392 ALA ALA C . n 
B 1 93  ARG 93  393 393 ARG ARG C . n 
B 1 94  ALA 94  394 394 ALA ALA C . n 
B 1 95  VAL 95  395 395 VAL VAL C . n 
B 1 96  MET 96  396 396 MET MET C . n 
B 1 97  GLU 97  397 397 GLU GLU C . n 
B 1 98  LYS 98  398 398 LYS LYS C . n 
B 1 99  THR 99  399 399 THR THR C . n 
B 1 100 PRO 100 400 400 PRO PRO C . n 
B 1 101 HIS 101 401 401 HIS HIS C . n 
B 1 102 VAL 102 402 402 VAL VAL C . n 
B 1 103 MET 103 403 403 MET MET C . n 
B 1 104 LEU 104 404 404 LEU LEU C . n 
B 1 105 VAL 105 405 405 VAL VAL C . n 
B 1 106 GLY 106 406 406 GLY GLY C . n 
B 1 107 ASP 107 407 407 ASP ASP C . n 
B 1 108 GLY 108 408 408 GLY GLY C . n 
B 1 109 ALA 109 409 409 ALA ALA C . n 
B 1 110 LEU 110 410 410 LEU LEU C . n 
B 1 111 GLU 111 411 411 GLU GLU C . n 
B 1 112 PHE 112 412 412 PHE PHE C . n 
B 1 113 ALA 113 413 413 ALA ALA C . n 
B 1 114 LEU 114 414 414 LEU LEU C . n 
B 1 115 SER 115 415 415 SER SER C . n 
B 1 116 GLN 116 416 416 GLN GLN C . n 
B 1 117 GLY 117 417 417 GLY GLY C . n 
B 1 118 PHE 118 418 418 PHE PHE C . n 
B 1 119 LYS 119 419 419 LYS LYS C . n 
B 1 120 LYS 120 420 420 LYS LYS C . n 
B 1 121 GLU 121 421 421 GLU GLU C . n 
B 1 122 ASN 122 422 422 ASN ASN C . n 
B 1 123 LEU 123 423 423 LEU LEU C . n 
B 1 124 LEU 124 424 424 LEU LEU C . n 
B 1 125 THR 125 425 425 THR THR C . n 
B 1 126 ALA 126 426 426 ALA ALA C . n 
B 1 127 GLU 127 427 427 GLU GLU C . n 
B 1 128 SER 128 428 428 SER SER C . n 
B 1 129 GLU 129 429 429 GLU GLU C . n 
B 1 130 LYS 130 430 430 LYS LYS C . n 
B 1 131 GLU 131 431 431 GLU GLU C . n 
B 1 132 TRP 132 432 432 TRP TRP C . n 
B 1 133 LYS 133 433 433 LYS LYS C . n 
B 1 134 GLU 134 434 434 GLU GLU C . n 
B 1 135 TRP 135 435 435 TRP TRP C . n 
B 1 136 LEU 136 436 436 LEU LEU C . n 
B 1 137 LYS 137 437 437 LYS LYS C . n 
B 1 138 THR 138 438 438 THR THR C . n 
B 1 139 SER 139 439 439 SER SER C . n 
B 1 140 GLN 140 440 440 GLN GLN C . n 
B 1 141 TYR 141 441 441 TYR TYR C . n 
B 1 142 LYS 142 442 442 LYS LYS C . n 
B 1 143 PRO 143 443 443 PRO PRO C . n 
B 1 144 ILE 144 444 444 ILE ILE C . n 
B 1 145 VAL 145 445 445 VAL VAL C . n 
B 1 146 ASN 146 446 446 ASN ASN C . n 
B 1 147 ILE 147 447 447 ILE ILE C . n 
B 1 148 GLU 148 448 448 GLU GLU C . n 
B 1 149 ASN 149 449 449 ASN ASN C . n 
B 1 150 HIS 150 450 450 HIS HIS C . n 
B 1 151 ASN 151 451 451 ASN ASN C . n 
B 1 152 THR 152 452 452 THR THR C . n 
B 1 153 ILE 153 453 453 ILE ILE C . n 
B 1 154 GLY 154 454 454 GLY GLY C . n 
B 1 155 MET 155 455 455 MET MET C . n 
B 1 156 ILE 156 456 456 ILE ILE C . n 
B 1 157 ALA 157 457 457 ALA ALA C . n 
B 1 158 LEU 158 458 458 LEU LEU C . n 
B 1 159 ASP 159 459 459 ASP ASP C . n 
B 1 160 ALA 160 460 460 ALA ALA C . n 
B 1 161 GLN 161 461 461 GLN GLN C . n 
B 1 162 GLY 162 462 462 GLY GLY C . n 
B 1 163 ASN 163 463 463 ASN ASN C . n 
B 1 164 LEU 164 464 464 LEU LEU C . n 
B 1 165 SER 165 465 465 SER SER C . n 
B 1 166 GLY 166 466 466 GLY GLY C . n 
B 1 167 ALA 167 467 467 ALA ALA C . n 
B 1 168 CYS 168 468 468 CYS CYS C . n 
B 1 169 THR 169 469 469 THR THR C . n 
B 1 170 THR 170 470 470 THR THR C . n 
B 1 171 SER 171 471 471 SER SER C . n 
B 1 172 GLY 172 472 472 GLY GLY C . n 
B 1 173 MET 173 473 473 MET MET C . n 
B 1 174 ALA 174 474 474 ALA ALA C . n 
B 1 175 TYR 175 475 475 TYR TYR C . n 
B 1 176 LYS 176 476 476 LYS LYS C . n 
B 1 177 MET 177 477 477 MET MET C . n 
B 1 178 HIS 178 478 478 HIS HIS C . n 
B 1 179 GLY 179 479 479 GLY GLY C . n 
B 1 180 ARG 180 480 480 ARG ARG C . n 
B 1 181 VAL 181 481 481 VAL VAL C . n 
B 1 182 GLY 182 482 482 GLY GLY C . n 
B 1 183 ASP 183 483 483 ASP ASP C . n 
B 1 184 SER 184 484 484 SER SER C . n 
B 1 185 PRO 185 485 485 PRO PRO C . n 
B 1 186 ILE 186 486 486 ILE ILE C . n 
B 1 187 ILE 187 487 487 ILE ILE C . n 
B 1 188 GLY 188 488 488 GLY GLY C . n 
B 1 189 ALA 189 489 489 ALA ALA C . n 
B 1 190 GLY 190 490 490 GLY GLY C . n 
B 1 191 LEU 191 491 491 LEU LEU C . n 
B 1 192 PHE 192 492 492 PHE PHE C . n 
B 1 193 VAL 193 493 493 VAL VAL C . n 
B 1 194 ASP 194 494 494 ASP ASP C . n 
B 1 195 ASN 195 495 495 ASN ASN C . n 
B 1 196 GLU 196 496 496 GLU GLU C . n 
B 1 197 ILE 197 497 497 ILE ILE C . n 
B 1 198 GLY 198 498 498 GLY GLY C . n 
B 1 199 ALA 199 499 499 ALA ALA C . n 
B 1 200 ALA 200 500 500 ALA ALA C . n 
B 1 201 THR 201 501 501 THR THR C . n 
B 1 202 ALA 202 502 502 ALA ALA C . n 
B 1 203 THR 203 503 503 THR THR C . n 
B 1 204 GLY 204 504 504 GLY GLY C . n 
B 1 205 HIS 205 505 505 HIS HIS C . n 
B 1 206 GLY 206 506 506 GLY GLY C . n 
B 1 207 GLU 207 507 507 GLU GLU C . n 
B 1 208 GLU 208 508 508 GLU GLU C . n 
B 1 209 VAL 209 509 509 VAL VAL C . n 
B 1 210 ILE 210 510 510 ILE ILE C . n 
B 1 211 ARG 211 511 511 ARG ARG C . n 
B 1 212 THR 212 512 512 THR THR C . n 
B 1 213 VAL 213 513 513 VAL VAL C . n 
B 1 214 GLY 214 514 514 GLY GLY C . n 
B 1 215 THR 215 515 515 THR THR C . n 
B 1 216 HIS 216 516 516 HIS HIS C . n 
B 1 217 LEU 217 517 517 LEU LEU C . n 
B 1 218 VAL 218 518 518 VAL VAL C . n 
B 1 219 VAL 219 519 519 VAL VAL C . n 
B 1 220 GLU 220 520 520 GLU GLU C . n 
B 1 221 LEU 221 521 521 LEU LEU C . n 
B 1 222 MET 222 522 522 MET MET C . n 
B 1 223 ASN 223 523 523 ASN ASN C . n 
B 1 224 GLN 224 524 524 GLN GLN C . n 
B 1 225 GLY 225 525 525 GLY GLY C . n 
B 1 226 ARG 226 526 526 ARG ARG C . n 
B 1 227 THR 227 527 527 THR THR C . n 
B 1 228 PRO 228 528 528 PRO PRO C . n 
B 1 229 GLN 229 529 529 GLN GLN C . n 
B 1 230 GLN 230 530 530 GLN GLN C . n 
B 1 231 ALA 231 531 531 ALA ALA C . n 
B 1 232 CYS 232 532 532 CYS CYS C . n 
B 1 233 LYS 233 533 533 LYS LYS C . n 
B 1 234 GLU 234 534 534 GLU GLU C . n 
B 1 235 ALA 235 535 535 ALA ALA C . n 
B 1 236 VAL 236 536 536 VAL VAL C . n 
B 1 237 GLU 237 537 537 GLU GLU C . n 
B 1 238 ARG 238 538 538 ARG ARG C . n 
B 1 239 ILE 239 539 539 ILE ILE C . n 
B 1 240 VAL 240 540 540 VAL VAL C . n 
B 1 241 LYS 241 541 541 LYS LYS C . n 
B 1 242 ILE 242 542 542 ILE ILE C . n 
B 1 243 VAL 243 543 543 VAL VAL C . n 
B 1 244 ASN 244 544 544 ASN ASN C . n 
B 1 245 ARG 245 545 545 ARG ARG C . n 
B 1 246 ARG 246 546 546 ARG ARG C . n 
B 1 247 GLY 247 547 547 GLY GLY C . n 
B 1 248 LYS 248 548 548 LYS LYS C . n 
B 1 249 ASN 249 549 549 ASN ASN C . n 
B 1 250 LEU 250 550 550 LEU LEU C . n 
B 1 251 LYS 251 551 551 LYS LYS C . n 
B 1 252 ASP 252 552 552 ASP ASP C . n 
B 1 253 ILE 253 553 553 ILE ILE C . n 
B 1 254 GLN 254 554 554 GLN GLN C . n 
B 1 255 VAL 255 555 555 VAL VAL C . n 
B 1 256 GLY 256 556 556 GLY GLY C . n 
B 1 257 PHE 257 557 557 PHE PHE C . n 
B 1 258 ILE 258 558 558 ILE ILE C . n 
B 1 259 ALA 259 559 559 ALA ALA C . n 
B 1 260 LEU 260 560 560 LEU LEU C . n 
B 1 261 ASN 261 561 561 ASN ASN C . n 
B 1 262 LYS 262 562 562 LYS LYS C . n 
B 1 263 LYS 263 563 563 LYS LYS C . n 
B 1 264 GLY 264 564 564 GLY GLY C . n 
B 1 265 GLU 265 565 565 GLU GLU C . n 
B 1 266 TYR 266 566 566 TYR TYR C . n 
B 1 267 GLY 267 567 567 GLY GLY C . n 
B 1 268 ALA 268 568 568 ALA ALA C . n 
B 1 269 TYR 269 569 569 TYR TYR C . n 
B 1 270 CYS 270 570 570 CYS CYS C . n 
B 1 271 ILE 271 571 571 ILE ILE C . n 
B 1 272 GLN 272 572 572 GLN GLN C . n 
B 1 273 ASP 273 573 573 ASP ASP C . n 
B 1 274 GLY 274 574 574 GLY GLY C . n 
B 1 275 PHE 275 575 575 PHE PHE C . n 
B 1 276 ASN 276 576 576 ASN ASN C . n 
B 1 277 PHE 277 577 577 PHE PHE C . n 
B 1 278 ALA 278 578 578 ALA ALA C . n 
B 1 279 VAL 279 579 579 VAL VAL C . n 
B 1 280 HIS 280 580 580 HIS HIS C . n 
B 1 281 ASP 281 581 581 ASP ASP C . n 
B 1 282 GLN 282 582 582 GLN GLN C . n 
B 1 283 LYS 283 583 583 LYS LYS C . n 
B 1 284 GLY 284 584 584 GLY GLY C . n 
B 1 285 ASN 285 585 585 ASN ASN C . n 
B 1 286 ARG 286 586 586 ARG ARG C . n 
B 1 287 LEU 287 587 587 LEU LEU C . n 
B 1 288 GLU 288 588 588 GLU GLU C . n 
B 1 289 THR 289 589 589 THR THR C . n 
B 1 290 PRO 290 590 590 PRO PRO C . n 
B 1 291 GLY 291 591 591 GLY GLY C . n 
B 1 292 PHE 292 592 592 PHE PHE C . n 
B 1 293 ALA 293 593 593 ALA ALA C . n 
B 1 294 LEU 294 594 594 LEU LEU C . n 
B 1 295 LYS 295 595 595 LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1 296 1 GOL GLE A . 
D 2 GOL 1 297 1 GOL GLE A . 
E 2 GOL 1 2   2 GOL GLE C . 
F 2 GOL 1 4   2 GOL GLE C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5010  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  20010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-05-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
4 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
5 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 11  ? ? 62.19   173.56  
2  1 HIS A 84  ? ? 68.11   -0.21   
3  1 ASN A 87  ? ? -116.56 76.48   
4  1 ASN A 146 ? ? 174.46  175.28  
5  1 ASN A 149 ? ? 63.30   -140.11 
6  1 ALA A 189 ? ? -103.94 -83.45  
7  1 ILE A 197 ? ? -127.36 -61.69  
8  1 ASP A 281 ? ? -143.01 -158.98 
9  1 TRP C 311 ? ? 69.41   170.48  
10 1 ASN C 387 ? ? -116.95 76.10   
11 1 PRO C 443 ? ? -56.87  95.57   
12 1 ASN C 446 ? ? -171.60 -177.84 
13 1 HIS C 450 ? ? 35.65   69.39   
14 1 ALA C 489 ? ? -104.09 -80.53  
15 1 ILE C 497 ? ? -132.59 -64.37  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A THR 1   ? CB  ? A THR 1   CB  
2  1 Y 0 A THR 1   ? OG1 ? A THR 1   OG1 
3  1 Y 0 A THR 1   ? CG2 ? A THR 1   CG2 
4  1 Y 0 A LYS 119 ? CE  ? A LYS 119 CE  
5  1 Y 0 A LYS 119 ? NZ  ? A LYS 119 NZ  
6  1 Y 0 A LYS 130 ? CE  ? A LYS 130 CE  
7  1 Y 0 A LYS 130 ? NZ  ? A LYS 130 NZ  
8  1 Y 0 A LYS 142 ? CG  ? A LYS 142 CG  
9  1 Y 0 A LYS 142 ? CD  ? A LYS 142 CD  
10 1 Y 0 A LYS 142 ? CE  ? A LYS 142 CE  
11 1 Y 0 A LYS 142 ? NZ  ? A LYS 142 NZ  
12 1 Y 0 A GLU 148 ? CD  ? A GLU 148 CD  
13 1 Y 0 A GLU 148 ? OE1 ? A GLU 148 OE1 
14 1 Y 0 A GLU 148 ? OE2 ? A GLU 148 OE2 
15 1 Y 0 A GLN 282 ? CG  ? A GLN 282 CG  
16 1 Y 0 A GLN 282 ? CD  ? A GLN 282 CD  
17 1 Y 0 A GLN 282 ? OE1 ? A GLN 282 OE1 
18 1 Y 0 A GLN 282 ? NE2 ? A GLN 282 NE2 
19 1 Y 0 C LYS 430 ? CD  ? B LYS 130 CD  
20 1 Y 0 C LYS 430 ? CE  ? B LYS 130 CE  
21 1 Y 0 C LYS 430 ? NZ  ? B LYS 130 NZ  
22 1 Y 0 C LYS 442 ? CG  ? B LYS 142 CG  
23 1 Y 0 C LYS 442 ? CD  ? B LYS 142 CD  
24 1 Y 0 C LYS 442 ? CE  ? B LYS 142 CE  
25 1 Y 0 C LYS 442 ? NZ  ? B LYS 142 NZ  
26 1 Y 0 C ARG 545 ? CZ  ? B ARG 245 CZ  
27 1 Y 0 C ARG 545 ? NH1 ? B ARG 245 NH1 
28 1 Y 0 C ARG 545 ? NH2 ? B ARG 245 NH2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        GLYCEROL 
_pdbx_entity_nonpoly.comp_id     GOL 
#