data_1P4V
# 
_entry.id   1P4V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1P4V         pdb_00001p4v 10.2210/pdb1p4v/pdb 
RCSB  RCSB019009   ?            ?                   
WWPDB D_1000019009 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1P4K 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF THE GLYCOSYLASPARAGINASE PRECURSOR D151N MUTANT' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P4V 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qian, X.'  1 
'Guan, C.'  2 
'Guo, H.C.' 3 
# 
_citation.id                        primary 
_citation.title                     'A dual role for an aspartic acid in glycosylasparaginase autoproteolysis.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                997 
_citation.page_last                 1003 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12906830 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00150-3' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Qian, X.'  1 ? 
primary 'Guan, C.'  2 ? 
primary 'Guo, H.C.' 3 ? 
# 
_cell.entry_id           1P4V 
_cell.length_a           45.877 
_cell.length_b           52.369 
_cell.length_c           61.741 
_cell.angle_alpha        80.92 
_cell.angle_beta         90.41 
_cell.angle_gamma        105.10 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P4V 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase precursor' 32178.645 2   3.5.1.26 D151N 
'Glycosylasparaginase, alpha and beta chains' ? 
2 non-polymer syn GLYCINE                                                     75.067    2   ?        ?     ? ? 
3 water       nat water                                                       18.015    212 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Glycosylasparaginase, Aspartylglucosaminidase, N4-N- acetyl-beta-glucosaminyl, -L-asparagine amidase, AGA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_entity_poly.pdbx_strand_id                 A,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   THR n 
1 3   ASN n 
1 4   LYS n 
1 5   PRO n 
1 6   ILE n 
1 7   VAL n 
1 8   LEU n 
1 9   SER n 
1 10  THR n 
1 11  TRP n 
1 12  ASN n 
1 13  PHE n 
1 14  GLY n 
1 15  LEU n 
1 16  HIS n 
1 17  ALA n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  ALA n 
1 22  TRP n 
1 23  LYS n 
1 24  VAL n 
1 25  LEU n 
1 26  SER n 
1 27  LYS n 
1 28  GLY n 
1 29  GLY n 
1 30  LYS n 
1 31  ALA n 
1 32  LEU n 
1 33  ASP n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  GLY n 
1 39  VAL n 
1 40  ARG n 
1 41  LEU n 
1 42  VAL n 
1 43  GLU n 
1 44  ASP n 
1 45  ASP n 
1 46  PRO n 
1 47  THR n 
1 48  GLU n 
1 49  ARG n 
1 50  SER n 
1 51  VAL n 
1 52  GLY n 
1 53  TYR n 
1 54  GLY n 
1 55  GLY n 
1 56  ARG n 
1 57  PRO n 
1 58  ASP n 
1 59  ARG n 
1 60  ASP n 
1 61  GLY n 
1 62  ARG n 
1 63  VAL n 
1 64  THR n 
1 65  LEU n 
1 66  ASP n 
1 67  ALA n 
1 68  CYS n 
1 69  ILE n 
1 70  MET n 
1 71  ASP n 
1 72  GLU n 
1 73  ASN n 
1 74  TYR n 
1 75  ASN n 
1 76  ILE n 
1 77  GLY n 
1 78  SER n 
1 79  VAL n 
1 80  ALA n 
1 81  CYS n 
1 82  MET n 
1 83  GLU n 
1 84  HIS n 
1 85  ILE n 
1 86  LYS n 
1 87  ASN n 
1 88  PRO n 
1 89  ILE n 
1 90  SER n 
1 91  VAL n 
1 92  ALA n 
1 93  ARG n 
1 94  ALA n 
1 95  VAL n 
1 96  MET n 
1 97  GLU n 
1 98  LYS n 
1 99  THR n 
1 100 PRO n 
1 101 HIS n 
1 102 VAL n 
1 103 MET n 
1 104 LEU n 
1 105 VAL n 
1 106 GLY n 
1 107 ASP n 
1 108 GLY n 
1 109 ALA n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 ALA n 
1 114 LEU n 
1 115 SER n 
1 116 GLN n 
1 117 GLY n 
1 118 PHE n 
1 119 LYS n 
1 120 LYS n 
1 121 GLU n 
1 122 ASN n 
1 123 LEU n 
1 124 LEU n 
1 125 THR n 
1 126 ALA n 
1 127 GLU n 
1 128 SER n 
1 129 GLU n 
1 130 LYS n 
1 131 GLU n 
1 132 TRP n 
1 133 LYS n 
1 134 GLU n 
1 135 TRP n 
1 136 LEU n 
1 137 LYS n 
1 138 THR n 
1 139 SER n 
1 140 GLN n 
1 141 TYR n 
1 142 LYS n 
1 143 PRO n 
1 144 ILE n 
1 145 VAL n 
1 146 ASN n 
1 147 ILE n 
1 148 GLU n 
1 149 ASN n 
1 150 HIS n 
1 151 ASN n 
1 152 THR n 
1 153 ILE n 
1 154 GLY n 
1 155 MET n 
1 156 ILE n 
1 157 ALA n 
1 158 LEU n 
1 159 ASP n 
1 160 ALA n 
1 161 GLN n 
1 162 GLY n 
1 163 ASN n 
1 164 LEU n 
1 165 SER n 
1 166 GLY n 
1 167 ALA n 
1 168 CYS n 
1 169 THR n 
1 170 THR n 
1 171 SER n 
1 172 GLY n 
1 173 MET n 
1 174 ALA n 
1 175 TYR n 
1 176 LYS n 
1 177 MET n 
1 178 HIS n 
1 179 GLY n 
1 180 ARG n 
1 181 VAL n 
1 182 GLY n 
1 183 ASP n 
1 184 SER n 
1 185 PRO n 
1 186 ILE n 
1 187 ILE n 
1 188 GLY n 
1 189 ALA n 
1 190 GLY n 
1 191 LEU n 
1 192 PHE n 
1 193 VAL n 
1 194 ASP n 
1 195 ASN n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 ALA n 
1 200 ALA n 
1 201 THR n 
1 202 ALA n 
1 203 THR n 
1 204 GLY n 
1 205 HIS n 
1 206 GLY n 
1 207 GLU n 
1 208 GLU n 
1 209 VAL n 
1 210 ILE n 
1 211 ARG n 
1 212 THR n 
1 213 VAL n 
1 214 GLY n 
1 215 THR n 
1 216 HIS n 
1 217 LEU n 
1 218 VAL n 
1 219 VAL n 
1 220 GLU n 
1 221 LEU n 
1 222 MET n 
1 223 ASN n 
1 224 GLN n 
1 225 GLY n 
1 226 ARG n 
1 227 THR n 
1 228 PRO n 
1 229 GLN n 
1 230 GLN n 
1 231 ALA n 
1 232 CYS n 
1 233 LYS n 
1 234 GLU n 
1 235 ALA n 
1 236 VAL n 
1 237 GLU n 
1 238 ARG n 
1 239 ILE n 
1 240 VAL n 
1 241 LYS n 
1 242 ILE n 
1 243 VAL n 
1 244 ASN n 
1 245 ARG n 
1 246 ARG n 
1 247 GLY n 
1 248 LYS n 
1 249 ASN n 
1 250 LEU n 
1 251 LYS n 
1 252 ASP n 
1 253 ILE n 
1 254 GLN n 
1 255 VAL n 
1 256 GLY n 
1 257 PHE n 
1 258 ILE n 
1 259 ALA n 
1 260 LEU n 
1 261 ASN n 
1 262 LYS n 
1 263 LYS n 
1 264 GLY n 
1 265 GLU n 
1 266 TYR n 
1 267 GLY n 
1 268 ALA n 
1 269 TYR n 
1 270 CYS n 
1 271 ILE n 
1 272 GLN n 
1 273 ASP n 
1 274 GLY n 
1 275 PHE n 
1 276 ASN n 
1 277 PHE n 
1 278 ALA n 
1 279 VAL n 
1 280 HIS n 
1 281 ASP n 
1 282 GLN n 
1 283 LYS n 
1 284 GLY n 
1 285 ASN n 
1 286 ARG n 
1 287 LEU n 
1 288 GLU n 
1 289 THR n 
1 290 PRO n 
1 291 GLY n 
1 292 PHE n 
1 293 ALA n 
1 294 LEU n 
1 295 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Elizabethkingia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Elizabethkingia meningoseptica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     238 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMAL-c2x 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ASPG_FLAME 
_struct_ref.pdbx_db_accession          Q47898 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHDTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1P4V A 1 ? 295 ? Q47898 46 ? 340 ? 1   295 
2 1 1P4V C 1 ? 295 ? Q47898 46 ? 340 ? 301 595 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P4V ASN A 151 ? UNP Q47898 ASP 196 'engineered mutation' 151 1 
2 1P4V ASN C 151 ? UNP Q47898 ASP 196 'engineered mutation' 451 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1P4V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   41.89 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'15% PEG 3300, 0.1M Tris, pH 7.5, 0.2M lithium sulfate, 0.1% sodium azide, 0.05M glycine, EVAPORATION' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1001 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1001 
# 
_reflns.entry_id                     1P4V 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             20.00 
_reflns.number_all                   43152 
_reflns.number_obs                   43152 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.03 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.08 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P4V 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             20.00 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     43125 
_refine.ls_number_reflns_obs                     41025 
_refine.ls_number_reflns_R_free                  4080 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.225 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               13.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4510 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             212 
_refine_hist.number_atoms_total               4732 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d 1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d  0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1P4V 
_struct.title                     'CRYSTAL STRUCTURE OF THE GLYCOSYLASPARAGINASE PRECURSOR D151N MUTANT WITH GLYCINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P4V 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ALPHA BETA, BETA ALPHA, SANDWICH, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 13  ? SER A 26  ? PHE A 13  SER A 26  1 ? 14 
HELX_P HELX_P2  2  LYS A 30  ? ASP A 45  ? LYS A 30  ASP A 45  1 ? 16 
HELX_P HELX_P3  3  ASN A 87  ? THR A 99  ? ASN A 87  THR A 99  1 ? 13 
HELX_P HELX_P4  4  GLY A 106 ? GLN A 116 ? GLY A 106 GLN A 116 1 ? 11 
HELX_P HELX_P5  5  THR A 125 ? LYS A 137 ? THR A 125 LYS A 137 1 ? 13 
HELX_P HELX_P6  6  HIS A 205 ? VAL A 213 ? HIS A 205 VAL A 213 1 ? 9  
HELX_P HELX_P7  7  VAL A 213 ? GLN A 224 ? VAL A 213 GLN A 224 1 ? 12 
HELX_P HELX_P8  8  THR A 227 ? ARG A 246 ? THR A 227 ARG A 246 1 ? 20 
HELX_P HELX_P9  9  ASN A 249 ? ILE A 253 ? ASN A 249 ILE A 253 5 ? 5  
HELX_P HELX_P10 10 PHE B 13  ? SER B 26  ? PHE C 313 SER C 326 1 ? 14 
HELX_P HELX_P11 11 LYS B 30  ? ASP B 45  ? LYS C 330 ASP C 345 1 ? 16 
HELX_P HELX_P12 12 ASN B 87  ? THR B 99  ? ASN C 387 THR C 399 1 ? 13 
HELX_P HELX_P13 13 GLY B 106 ? GLN B 116 ? GLY C 406 GLN C 416 1 ? 11 
HELX_P HELX_P14 14 THR B 125 ? LYS B 137 ? THR C 425 LYS C 437 1 ? 13 
HELX_P HELX_P15 15 HIS B 205 ? VAL B 213 ? HIS C 505 VAL C 513 1 ? 9  
HELX_P HELX_P16 16 VAL B 213 ? GLN B 224 ? VAL C 513 GLN C 524 1 ? 12 
HELX_P HELX_P17 17 THR B 227 ? ARG B 246 ? THR C 527 ARG C 546 1 ? 20 
HELX_P HELX_P18 18 ASN B 249 ? ILE B 253 ? ASN C 549 ILE C 553 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 4 A . ? LYS 4   A PRO 5 A ? PRO 5   A 1 0.58  
2 LYS 4 B . ? LYS 304 C PRO 5 B ? PRO 305 C 1 -0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 5 ? 
C ? 8 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 103 ? VAL A 105 ? MET A 103 VAL A 105 
A 2 ILE A 76  ? MET A 82  ? ILE A 76  MET A 82  
A 3 LEU A 65  ? MET A 70  ? LEU A 65  MET A 70  
A 4 LEU A 164 ? THR A 170 ? LEU A 164 THR A 170 
A 5 ILE A 153 ? LEU A 158 ? ILE A 153 LEU A 158 
A 6 ILE A 6   ? THR A 10  ? ILE A 6   THR A 10  
A 7 PHE A 277 ? ASP A 281 ? PHE A 277 ASP A 281 
A 8 GLY A 284 ? GLU A 288 ? GLY A 284 GLU A 288 
B 1 LEU A 191 ? ASP A 194 ? LEU A 191 ASP A 194 
B 2 GLY A 198 ? GLY A 204 ? GLY A 198 GLY A 204 
B 3 VAL A 255 ? ASN A 261 ? VAL A 255 ASN A 261 
B 4 TYR A 266 ? CYS A 270 ? TYR A 266 CYS A 270 
B 5 GLY A 291 ? PHE A 292 ? GLY A 291 PHE A 292 
C 1 MET B 103 ? VAL B 105 ? MET C 403 VAL C 405 
C 2 ILE B 76  ? MET B 82  ? ILE C 376 MET C 382 
C 3 LEU B 65  ? MET B 70  ? LEU C 365 MET C 370 
C 4 LEU B 164 ? THR B 170 ? LEU C 464 THR C 470 
C 5 ILE B 153 ? LEU B 158 ? ILE C 453 LEU C 458 
C 6 ILE B 6   ? THR B 10  ? ILE C 306 THR C 310 
C 7 PHE B 277 ? ASP B 281 ? PHE C 577 ASP C 581 
C 8 GLY B 284 ? GLU B 288 ? GLY C 584 GLU C 588 
D 1 LEU B 191 ? ASP B 194 ? LEU C 491 ASP C 494 
D 2 GLY B 198 ? GLY B 204 ? GLY C 498 GLY C 504 
D 3 VAL B 255 ? ASN B 261 ? VAL C 555 ASN C 561 
D 4 TYR B 266 ? CYS B 270 ? TYR C 566 CYS C 570 
D 5 GLY B 291 ? PHE B 292 ? GLY C 591 PHE C 592 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 104 ? O LEU A 104 N SER A 78  ? N SER A 78  
A 2 3 O VAL A 79  ? O VAL A 79  N ALA A 67  ? N ALA A 67  
A 3 4 N ASP A 66  ? N ASP A 66  O THR A 170 ? O THR A 170 
A 4 5 O ALA A 167 ? O ALA A 167 N MET A 155 ? N MET A 155 
A 5 6 O ILE A 156 ? O ILE A 156 N LEU A 8   ? N LEU A 8   
A 6 7 N SER A 9   ? N SER A 9   O ALA A 278 ? O ALA A 278 
A 7 8 N PHE A 277 ? N PHE A 277 O GLU A 288 ? O GLU A 288 
B 1 2 N ASP A 194 ? N ASP A 194 O GLY A 198 ? O GLY A 198 
B 2 3 N ALA A 199 ? N ALA A 199 O LEU A 260 ? O LEU A 260 
B 3 4 N ALA A 259 ? N ALA A 259 O GLY A 267 ? O GLY A 267 
B 4 5 N CYS A 270 ? N CYS A 270 O GLY A 291 ? O GLY A 291 
C 1 2 O LEU B 104 ? O LEU C 404 N SER B 78  ? N SER C 378 
C 2 3 O MET B 82  ? O MET C 382 N LEU B 65  ? N LEU C 365 
C 3 4 N MET B 70  ? N MET C 370 O GLY B 166 ? O GLY C 466 
C 4 5 O ALA B 167 ? O ALA C 467 N MET B 155 ? N MET C 455 
C 5 6 O ILE B 156 ? O ILE C 456 N LEU B 8   ? N LEU C 308 
C 6 7 N VAL B 7   ? N VAL C 307 O HIS B 280 ? O HIS C 580 
C 7 8 N PHE B 277 ? N PHE C 577 O GLU B 288 ? O GLU C 588 
D 1 2 N ASP B 194 ? N ASP C 494 O GLY B 198 ? O GLY C 498 
D 2 3 N ALA B 199 ? N ALA C 499 O LEU B 260 ? O LEU C 560 
D 3 4 N ALA B 259 ? N ALA C 559 O GLY B 267 ? O GLY C 567 
D 4 5 N CYS B 270 ? N CYS C 570 O GLY B 291 ? O GLY C 591 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GLY 296 ? 9  'BINDING SITE FOR RESIDUE GLY A 296' 
AC2 Software C GLY 596 ? 10 'BINDING SITE FOR RESIDUE GLY C 596' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  THR A 152 ? THR A 152 . ? 1_555 ? 
2  AC1 9  GLY A 172 ? GLY A 172 . ? 1_555 ? 
3  AC1 9  MET A 173 ? MET A 173 . ? 1_555 ? 
4  AC1 9  ARG A 180 ? ARG A 180 . ? 1_555 ? 
5  AC1 9  ASP A 183 ? ASP A 183 . ? 1_555 ? 
6  AC1 9  SER A 184 ? SER A 184 . ? 1_555 ? 
7  AC1 9  GLY A 204 ? GLY A 204 . ? 1_555 ? 
8  AC1 9  GLY A 206 ? GLY A 206 . ? 1_555 ? 
9  AC1 9  HOH E .   ? HOH A 301 . ? 1_555 ? 
10 AC2 10 HOH F .   ? HOH C 7   . ? 1_555 ? 
11 AC2 10 HOH F .   ? HOH C 10  . ? 1_555 ? 
12 AC2 10 THR B 152 ? THR C 452 . ? 1_555 ? 
13 AC2 10 GLY B 172 ? GLY C 472 . ? 1_555 ? 
14 AC2 10 MET B 173 ? MET C 473 . ? 1_555 ? 
15 AC2 10 ARG B 180 ? ARG C 480 . ? 1_555 ? 
16 AC2 10 ASP B 183 ? ASP C 483 . ? 1_555 ? 
17 AC2 10 SER B 184 ? SER C 484 . ? 1_555 ? 
18 AC2 10 GLY B 204 ? GLY C 504 . ? 1_555 ? 
19 AC2 10 GLY B 206 ? GLY C 506 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1P4V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P4V 
_atom_sites.fract_transf_matrix[1][1]   0.021797 
_atom_sites.fract_transf_matrix[1][2]   0.005881 
_atom_sites.fract_transf_matrix[1][3]   -0.000805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019778 
_atom_sites.fract_transf_matrix[2][3]   -0.003237 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016413 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? 6.251  11.559 62.221 1.00 52.59 ? 1   THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? 5.898  12.852 62.872 1.00 51.88 ? 1   THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? 6.567  14.018 62.152 1.00 47.83 ? 1   THR A C   1 
ATOM   4    O O   . THR A 1 1   ? 7.794  14.129 62.136 1.00 49.49 ? 1   THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? 6.339  12.878 64.354 1.00 54.39 ? 1   THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? 7.766  12.779 64.432 1.00 58.18 ? 1   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? 5.718  11.715 65.115 1.00 58.79 ? 1   THR A CG2 1 
ATOM   8    N N   . THR A 1 2   ? 5.756  14.882 61.551 1.00 39.40 ? 2   THR A N   1 
ATOM   9    C CA  . THR A 1 2   ? 6.273  16.040 60.838 1.00 32.30 ? 2   THR A CA  1 
ATOM   10   C C   . THR A 1 2   ? 6.310  17.236 61.783 1.00 29.91 ? 2   THR A C   1 
ATOM   11   O O   . THR A 1 2   ? 5.376  17.454 62.556 1.00 32.92 ? 2   THR A O   1 
ATOM   12   C CB  . THR A 1 2   ? 5.386  16.398 59.618 1.00 32.59 ? 2   THR A CB  1 
ATOM   13   O OG1 . THR A 1 2   ? 4.061  16.705 60.063 1.00 38.95 ? 2   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 2   ? 5.318  15.236 58.641 1.00 20.35 ? 2   THR A CG2 1 
ATOM   15   N N   . ASN A 1 3   ? 7.397  18.001 61.730 1.00 20.63 ? 3   ASN A N   1 
ATOM   16   C CA  . ASN A 1 3   ? 7.548  19.184 62.570 1.00 17.72 ? 3   ASN A CA  1 
ATOM   17   C C   . ASN A 1 3   ? 7.185  20.402 61.722 1.00 14.63 ? 3   ASN A C   1 
ATOM   18   O O   . ASN A 1 3   ? 7.962  20.821 60.873 1.00 16.22 ? 3   ASN A O   1 
ATOM   19   C CB  . ASN A 1 3   ? 8.994  19.296 63.080 1.00 16.94 ? 3   ASN A CB  1 
ATOM   20   C CG  . ASN A 1 3   ? 9.228  20.545 63.923 1.00 16.16 ? 3   ASN A CG  1 
ATOM   21   O OD1 . ASN A 1 3   ? 8.348  20.982 64.658 1.00 20.58 ? 3   ASN A OD1 1 
ATOM   22   N ND2 . ASN A 1 3   ? 10.425 21.112 63.825 1.00 13.55 ? 3   ASN A ND2 1 
ATOM   23   N N   . LYS A 1 4   ? 5.994  20.953 61.938 1.00 10.81 ? 4   LYS A N   1 
ATOM   24   C CA  . LYS A 1 4   ? 5.555  22.119 61.174 1.00 10.11 ? 4   LYS A CA  1 
ATOM   25   C C   . LYS A 1 4   ? 4.624  22.973 62.031 1.00 14.12 ? 4   LYS A C   1 
ATOM   26   O O   . LYS A 1 4   ? 3.933  22.452 62.914 1.00 10.95 ? 4   LYS A O   1 
ATOM   27   C CB  . LYS A 1 4   ? 4.821  21.666 59.905 1.00 15.56 ? 4   LYS A CB  1 
ATOM   28   C CG  . LYS A 1 4   ? 3.572  20.827 60.181 1.00 19.34 ? 4   LYS A CG  1 
ATOM   29   C CD  . LYS A 1 4   ? 2.757  20.587 58.922 1.00 23.86 ? 4   LYS A CD  1 
ATOM   30   C CE  . LYS A 1 4   ? 1.515  19.762 59.232 1.00 30.60 ? 4   LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 4   ? 0.604  19.636 58.062 1.00 36.61 ? 4   LYS A NZ  1 
ATOM   32   N N   . PRO A 1 5   ? 4.603  24.298 61.796 1.00 8.35  ? 5   PRO A N   1 
ATOM   33   C CA  . PRO A 1 5   ? 5.389  25.002 60.777 1.00 9.11  ? 5   PRO A CA  1 
ATOM   34   C C   . PRO A 1 5   ? 6.829  25.184 61.255 1.00 10.05 ? 5   PRO A C   1 
ATOM   35   O O   . PRO A 1 5   ? 7.120  25.069 62.447 1.00 8.62  ? 5   PRO A O   1 
ATOM   36   C CB  . PRO A 1 5   ? 4.694  26.360 60.652 1.00 8.65  ? 5   PRO A CB  1 
ATOM   37   C CG  . PRO A 1 5   ? 3.453  26.263 61.546 1.00 18.79 ? 5   PRO A CG  1 
ATOM   38   C CD  . PRO A 1 5   ? 3.794  25.248 62.574 1.00 9.47  ? 5   PRO A CD  1 
ATOM   39   N N   . ILE A 1 6   ? 7.714  25.497 60.318 1.00 8.63  ? 6   ILE A N   1 
ATOM   40   C CA  . ILE A 1 6   ? 9.114  25.728 60.628 1.00 5.74  ? 6   ILE A CA  1 
ATOM   41   C C   . ILE A 1 6   ? 9.721  26.576 59.514 1.00 5.18  ? 6   ILE A C   1 
ATOM   42   O O   . ILE A 1 6   ? 9.376  26.422 58.336 1.00 6.44  ? 6   ILE A O   1 
ATOM   43   C CB  . ILE A 1 6   ? 9.889  24.396 60.770 1.00 8.53  ? 6   ILE A CB  1 
ATOM   44   C CG1 . ILE A 1 6   ? 11.373 24.676 61.012 1.00 11.73 ? 6   ILE A CG1 1 
ATOM   45   C CG2 . ILE A 1 6   ? 9.716  23.538 59.527 1.00 7.12  ? 6   ILE A CG2 1 
ATOM   46   C CD1 . ILE A 1 6   ? 12.165 23.439 61.414 1.00 6.99  ? 6   ILE A CD1 1 
ATOM   47   N N   . VAL A 1 7   ? 10.604 27.490 59.894 1.00 5.73  ? 7   VAL A N   1 
ATOM   48   C CA  . VAL A 1 7   ? 11.258 28.360 58.926 1.00 6.39  ? 7   VAL A CA  1 
ATOM   49   C C   . VAL A 1 7   ? 12.738 28.491 59.258 1.00 11.10 ? 7   VAL A C   1 
ATOM   50   O O   . VAL A 1 7   ? 13.121 28.575 60.426 1.00 9.97  ? 7   VAL A O   1 
ATOM   51   C CB  . VAL A 1 7   ? 10.609 29.772 58.895 1.00 8.19  ? 7   VAL A CB  1 
ATOM   52   C CG1 . VAL A 1 7   ? 10.669 30.417 60.270 1.00 4.07  ? 7   VAL A CG1 1 
ATOM   53   C CG2 . VAL A 1 7   ? 11.326 30.651 57.871 1.00 6.90  ? 7   VAL A CG2 1 
ATOM   54   N N   . LEU A 1 8   ? 13.565 28.455 58.218 1.00 6.21  ? 8   LEU A N   1 
ATOM   55   C CA  . LEU A 1 8   ? 15.006 28.606 58.361 1.00 8.19  ? 8   LEU A CA  1 
ATOM   56   C C   . LEU A 1 8   ? 15.425 29.766 57.477 1.00 9.16  ? 8   LEU A C   1 
ATOM   57   O O   . LEU A 1 8   ? 14.837 29.996 56.417 1.00 4.53  ? 8   LEU A O   1 
ATOM   58   C CB  . LEU A 1 8   ? 15.753 27.349 57.898 1.00 7.42  ? 8   LEU A CB  1 
ATOM   59   C CG  . LEU A 1 8   ? 15.871 26.157 58.848 1.00 14.30 ? 8   LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 8   ? 14.553 25.416 58.934 1.00 15.72 ? 8   LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 8   ? 16.968 25.235 58.335 1.00 15.84 ? 8   LEU A CD2 1 
ATOM   62   N N   . SER A 1 9   ? 16.423 30.518 57.924 1.00 7.08  ? 9   SER A N   1 
ATOM   63   C CA  . SER A 1 9   ? 16.931 31.624 57.131 1.00 9.73  ? 9   SER A CA  1 
ATOM   64   C C   . SER A 1 9   ? 18.422 31.777 57.423 1.00 8.44  ? 9   SER A C   1 
ATOM   65   O O   . SER A 1 9   ? 18.900 31.438 58.503 1.00 6.99  ? 9   SER A O   1 
ATOM   66   C CB  . SER A 1 9   ? 16.156 32.922 57.420 1.00 5.49  ? 9   SER A CB  1 
ATOM   67   O OG  . SER A 1 9   ? 16.199 33.281 58.786 1.00 11.77 ? 9   SER A OG  1 
ATOM   68   N N   . THR A 1 10  ? 19.151 32.292 56.444 1.00 9.83  ? 10  THR A N   1 
ATOM   69   C CA  . THR A 1 10  ? 20.592 32.433 56.553 1.00 7.10  ? 10  THR A CA  1 
ATOM   70   C C   . THR A 1 10  ? 21.073 33.612 57.392 1.00 9.58  ? 10  THR A C   1 
ATOM   71   O O   . THR A 1 10  ? 20.449 34.670 57.415 1.00 8.66  ? 10  THR A O   1 
ATOM   72   C CB  . THR A 1 10  ? 21.204 32.545 55.152 1.00 5.88  ? 10  THR A CB  1 
ATOM   73   O OG1 . THR A 1 10  ? 20.693 33.712 54.510 1.00 10.19 ? 10  THR A OG1 1 
ATOM   74   C CG2 . THR A 1 10  ? 20.826 31.325 54.306 1.00 6.16  ? 10  THR A CG2 1 
ATOM   75   N N   . TRP A 1 11  ? 22.191 33.402 58.080 1.00 10.77 ? 11  TRP A N   1 
ATOM   76   C CA  . TRP A 1 11  ? 22.847 34.413 58.907 1.00 8.24  ? 11  TRP A CA  1 
ATOM   77   C C   . TRP A 1 11  ? 22.083 34.970 60.115 1.00 11.47 ? 11  TRP A C   1 
ATOM   78   O O   . TRP A 1 11  ? 20.911 34.675 60.330 1.00 8.25  ? 11  TRP A O   1 
ATOM   79   C CB  . TRP A 1 11  ? 23.317 35.575 58.023 1.00 9.80  ? 11  TRP A CB  1 
ATOM   80   C CG  . TRP A 1 11  ? 24.247 35.161 56.902 1.00 8.81  ? 11  TRP A CG  1 
ATOM   81   C CD1 . TRP A 1 11  ? 23.950 35.111 55.564 1.00 11.59 ? 11  TRP A CD1 1 
ATOM   82   C CD2 . TRP A 1 11  ? 25.614 34.745 57.024 1.00 12.60 ? 11  TRP A CD2 1 
ATOM   83   N NE1 . TRP A 1 11  ? 25.049 34.691 54.849 1.00 15.32 ? 11  TRP A NE1 1 
ATOM   84   C CE2 . TRP A 1 11  ? 26.082 34.459 55.717 1.00 15.01 ? 11  TRP A CE2 1 
ATOM   85   C CE3 . TRP A 1 11  ? 26.489 34.584 58.107 1.00 13.06 ? 11  TRP A CE3 1 
ATOM   86   C CZ2 . TRP A 1 11  ? 27.389 34.019 55.464 1.00 15.71 ? 11  TRP A CZ2 1 
ATOM   87   C CZ3 . TRP A 1 11  ? 27.792 34.145 57.855 1.00 18.62 ? 11  TRP A CZ3 1 
ATOM   88   C CH2 . TRP A 1 11  ? 28.225 33.869 56.539 1.00 17.49 ? 11  TRP A CH2 1 
ATOM   89   N N   . ASN A 1 12  ? 22.777 35.797 60.895 1.00 11.65 ? 12  ASN A N   1 
ATOM   90   C CA  . ASN A 1 12  ? 22.242 36.408 62.108 1.00 14.55 ? 12  ASN A CA  1 
ATOM   91   C C   . ASN A 1 12  ? 20.926 37.140 61.923 1.00 9.81  ? 12  ASN A C   1 
ATOM   92   O O   . ASN A 1 12  ? 20.005 36.997 62.724 1.00 6.91  ? 12  ASN A O   1 
ATOM   93   C CB  . ASN A 1 12  ? 23.267 37.381 62.679 1.00 15.93 ? 12  ASN A CB  1 
ATOM   94   C CG  . ASN A 1 12  ? 24.580 36.711 63.002 1.00 27.94 ? 12  ASN A CG  1 
ATOM   95   O OD1 . ASN A 1 12  ? 24.749 36.134 64.073 1.00 31.40 ? 12  ASN A OD1 1 
ATOM   96   N ND2 . ASN A 1 12  ? 25.515 36.766 62.065 1.00 33.65 ? 12  ASN A ND2 1 
ATOM   97   N N   . PHE A 1 13  ? 20.832 37.944 60.870 1.00 11.93 ? 13  PHE A N   1 
ATOM   98   C CA  . PHE A 1 13  ? 19.599 38.685 60.656 1.00 14.28 ? 13  PHE A CA  1 
ATOM   99   C C   . PHE A 1 13  ? 18.426 37.763 60.357 1.00 12.20 ? 13  PHE A C   1 
ATOM   100  O O   . PHE A 1 13  ? 17.273 38.183 60.416 1.00 15.23 ? 13  PHE A O   1 
ATOM   101  C CB  . PHE A 1 13  ? 19.767 39.712 59.531 1.00 15.46 ? 13  PHE A CB  1 
ATOM   102  C CG  . PHE A 1 13  ? 20.340 39.146 58.261 1.00 24.95 ? 13  PHE A CG  1 
ATOM   103  C CD1 . PHE A 1 13  ? 19.905 37.923 57.757 1.00 23.93 ? 13  PHE A CD1 1 
ATOM   104  C CD2 . PHE A 1 13  ? 21.290 39.861 57.544 1.00 28.04 ? 13  PHE A CD2 1 
ATOM   105  C CE1 . PHE A 1 13  ? 20.401 37.435 56.562 1.00 25.87 ? 13  PHE A CE1 1 
ATOM   106  C CE2 . PHE A 1 13  ? 21.789 39.376 56.346 1.00 28.07 ? 13  PHE A CE2 1 
ATOM   107  C CZ  . PHE A 1 13  ? 21.345 38.160 55.855 1.00 26.28 ? 13  PHE A CZ  1 
ATOM   108  N N   . GLY A 1 14  ? 18.724 36.507 60.038 1.00 11.33 ? 14  GLY A N   1 
ATOM   109  C CA  . GLY A 1 14  ? 17.667 35.556 59.757 1.00 9.59  ? 14  GLY A CA  1 
ATOM   110  C C   . GLY A 1 14  ? 16.800 35.357 60.978 1.00 13.46 ? 14  GLY A C   1 
ATOM   111  O O   . GLY A 1 14  ? 15.654 34.919 60.890 1.00 8.91  ? 14  GLY A O   1 
ATOM   112  N N   . LEU A 1 15  ? 17.357 35.686 62.136 1.00 11.02 ? 15  LEU A N   1 
ATOM   113  C CA  . LEU A 1 15  ? 16.627 35.525 63.383 1.00 12.41 ? 15  LEU A CA  1 
ATOM   114  C C   . LEU A 1 15  ? 15.437 36.505 63.352 1.00 9.73  ? 15  LEU A C   1 
ATOM   115  O O   . LEU A 1 15  ? 14.300 36.118 63.640 1.00 7.89  ? 15  LEU A O   1 
ATOM   116  C CB  . LEU A 1 15  ? 17.536 35.819 64.584 1.00 14.30 ? 15  LEU A CB  1 
ATOM   117  C CG  . LEU A 1 15  ? 17.209 35.213 65.957 1.00 22.85 ? 15  LEU A CG  1 
ATOM   118  C CD1 . LEU A 1 15  ? 17.167 33.690 65.868 1.00 19.11 ? 15  LEU A CD1 1 
ATOM   119  C CD2 . LEU A 1 15  ? 18.270 35.646 66.962 1.00 26.57 ? 15  LEU A CD2 1 
ATOM   120  N N   . HIS A 1 16  ? 15.688 37.754 62.941 1.00 10.48 ? 16  HIS A N   1 
ATOM   121  C CA  . HIS A 1 16  ? 14.630 38.778 62.859 1.00 10.32 ? 16  HIS A CA  1 
ATOM   122  C C   . HIS A 1 16  ? 13.705 38.525 61.693 1.00 8.89  ? 16  HIS A C   1 
ATOM   123  O O   . HIS A 1 16  ? 12.514 38.788 61.757 1.00 9.67  ? 16  HIS A O   1 
ATOM   124  C CB  . HIS A 1 16  ? 15.243 40.163 62.698 1.00 14.34 ? 16  HIS A CB  1 
ATOM   125  C CG  . HIS A 1 16  ? 16.481 40.373 63.525 1.00 17.24 ? 16  HIS A CG  1 
ATOM   126  N ND1 . HIS A 1 16  ? 16.526 40.114 64.879 1.00 22.23 ? 16  HIS A ND1 1 
ATOM   127  C CD2 . HIS A 1 16  ? 17.730 40.782 63.182 1.00 19.67 ? 16  HIS A CD2 1 
ATOM   128  C CE1 . HIS A 1 16  ? 17.747 40.350 65.334 1.00 19.23 ? 16  HIS A CE1 1 
ATOM   129  N NE2 . HIS A 1 16  ? 18.497 40.756 64.325 1.00 24.58 ? 16  HIS A NE2 1 
ATOM   130  N N   . ALA A 1 17  ? 14.276 38.020 60.613 1.00 4.64  ? 17  ALA A N   1 
ATOM   131  C CA  . ALA A 1 17  ? 13.484 37.723 59.442 1.00 6.87  ? 17  ALA A CA  1 
ATOM   132  C C   . ALA A 1 17  ? 12.520 36.619 59.825 1.00 7.96  ? 17  ALA A C   1 
ATOM   133  O O   . ALA A 1 17  ? 11.344 36.650 59.456 1.00 7.45  ? 17  ALA A O   1 
ATOM   134  C CB  . ALA A 1 17  ? 14.374 37.282 58.297 1.00 7.78  ? 17  ALA A CB  1 
ATOM   135  N N   . ASN A 1 18  ? 13.010 35.663 60.606 1.00 8.22  ? 18  ASN A N   1 
ATOM   136  C CA  . ASN A 1 18  ? 12.194 34.532 61.066 1.00 9.53  ? 18  ASN A CA  1 
ATOM   137  C C   . ASN A 1 18  ? 11.001 34.987 61.889 1.00 6.44  ? 18  ASN A C   1 
ATOM   138  O O   . ASN A 1 18  ? 9.916  34.426 61.761 1.00 8.12  ? 18  ASN A O   1 
ATOM   139  C CB  . ASN A 1 18  ? 13.027 33.565 61.914 1.00 9.04  ? 18  ASN A CB  1 
ATOM   140  C CG  . ASN A 1 18  ? 13.806 32.572 61.078 1.00 12.26 ? 18  ASN A CG  1 
ATOM   141  O OD1 . ASN A 1 18  ? 13.878 32.676 59.843 1.00 8.74  ? 18  ASN A OD1 1 
ATOM   142  N ND2 . ASN A 1 18  ? 14.408 31.606 61.748 1.00 5.96  ? 18  ASN A ND2 1 
ATOM   143  N N   . VAL A 1 19  ? 11.202 35.995 62.736 1.00 6.81  ? 19  VAL A N   1 
ATOM   144  C CA  . VAL A 1 19  ? 10.117 36.500 63.563 1.00 9.01  ? 19  VAL A CA  1 
ATOM   145  C C   . VAL A 1 19  ? 8.975  36.972 62.671 1.00 8.90  ? 19  VAL A C   1 
ATOM   146  O O   . VAL A 1 19  ? 7.805  36.707 62.947 1.00 7.75  ? 19  VAL A O   1 
ATOM   147  C CB  . VAL A 1 19  ? 10.574 37.686 64.471 1.00 7.92  ? 19  VAL A CB  1 
ATOM   148  C CG1 . VAL A 1 19  ? 9.370  38.288 65.189 1.00 11.63 ? 19  VAL A CG1 1 
ATOM   149  C CG2 . VAL A 1 19  ? 11.589 37.205 65.505 1.00 11.26 ? 19  VAL A CG2 1 
ATOM   150  N N   . GLU A 1 20  ? 9.311  37.666 61.591 1.00 8.43  ? 20  GLU A N   1 
ATOM   151  C CA  . GLU A 1 20  ? 8.278  38.153 60.685 1.00 8.05  ? 20  GLU A CA  1 
ATOM   152  C C   . GLU A 1 20  ? 7.584  37.002 59.961 1.00 8.62  ? 20  GLU A C   1 
ATOM   153  O O   . GLU A 1 20  ? 6.367  37.011 59.794 1.00 10.28 ? 20  GLU A O   1 
ATOM   154  C CB  . GLU A 1 20  ? 8.866  39.133 59.672 1.00 11.99 ? 20  GLU A CB  1 
ATOM   155  C CG  . GLU A 1 20  ? 9.454  40.378 60.296 1.00 15.47 ? 20  GLU A CG  1 
ATOM   156  C CD  . GLU A 1 20  ? 8.490  41.073 61.240 1.00 22.32 ? 20  GLU A CD  1 
ATOM   157  O OE1 . GLU A 1 20  ? 7.338  41.336 60.834 1.00 16.07 ? 20  GLU A OE1 1 
ATOM   158  O OE2 . GLU A 1 20  ? 8.886  41.365 62.392 1.00 20.32 ? 20  GLU A OE2 1 
ATOM   159  N N   . ALA A 1 21  ? 8.352  36.006 59.538 1.00 7.17  ? 21  ALA A N   1 
ATOM   160  C CA  . ALA A 1 21  ? 7.761  34.861 58.850 1.00 11.00 ? 21  ALA A CA  1 
ATOM   161  C C   . ALA A 1 21  ? 6.852  34.099 59.801 1.00 9.55  ? 21  ALA A C   1 
ATOM   162  O O   . ALA A 1 21  ? 5.817  33.570 59.403 1.00 5.94  ? 21  ALA A O   1 
ATOM   163  C CB  . ALA A 1 21  ? 8.856  33.938 58.335 1.00 9.07  ? 21  ALA A CB  1 
ATOM   164  N N   . TRP A 1 22  ? 7.243  34.039 61.069 1.00 13.94 ? 22  TRP A N   1 
ATOM   165  C CA  . TRP A 1 22  ? 6.451  33.310 62.052 1.00 14.61 ? 22  TRP A CA  1 
ATOM   166  C C   . TRP A 1 22  ? 5.096  33.978 62.274 1.00 11.92 ? 22  TRP A C   1 
ATOM   167  O O   . TRP A 1 22  ? 4.119  33.305 62.587 1.00 9.89  ? 22  TRP A O   1 
ATOM   168  C CB  . TRP A 1 22  ? 7.219  33.199 63.371 1.00 10.61 ? 22  TRP A CB  1 
ATOM   169  C CG  . TRP A 1 22  ? 6.696  32.117 64.269 1.00 10.53 ? 22  TRP A CG  1 
ATOM   170  C CD1 . TRP A 1 22  ? 6.027  32.283 65.448 1.00 11.64 ? 22  TRP A CD1 1 
ATOM   171  C CD2 . TRP A 1 22  ? 6.766  30.704 64.042 1.00 8.33  ? 22  TRP A CD2 1 
ATOM   172  N NE1 . TRP A 1 22  ? 5.674  31.064 65.969 1.00 9.11  ? 22  TRP A NE1 1 
ATOM   173  C CE2 . TRP A 1 22  ? 6.113  30.074 65.128 1.00 12.48 ? 22  TRP A CE2 1 
ATOM   174  C CE3 . TRP A 1 22  ? 7.316  29.906 63.029 1.00 7.42  ? 22  TRP A CE3 1 
ATOM   175  C CZ2 . TRP A 1 22  ? 5.992  28.680 65.228 1.00 13.21 ? 22  TRP A CZ2 1 
ATOM   176  C CZ3 . TRP A 1 22  ? 7.196  28.517 63.127 1.00 7.57  ? 22  TRP A CZ3 1 
ATOM   177  C CH2 . TRP A 1 22  ? 6.537  27.921 64.221 1.00 14.60 ? 22  TRP A CH2 1 
ATOM   178  N N   . LYS A 1 23  ? 5.035  35.298 62.111 1.00 12.42 ? 23  LYS A N   1 
ATOM   179  C CA  . LYS A 1 23  ? 3.774  36.013 62.285 1.00 12.24 ? 23  LYS A CA  1 
ATOM   180  C C   . LYS A 1 23  ? 2.752  35.441 61.316 1.00 12.87 ? 23  LYS A C   1 
ATOM   181  O O   . LYS A 1 23  ? 1.547  35.426 61.589 1.00 12.84 ? 23  LYS A O   1 
ATOM   182  C CB  . LYS A 1 23  ? 3.958  37.503 62.020 1.00 12.69 ? 23  LYS A CB  1 
ATOM   183  C CG  . LYS A 1 23  ? 4.707  38.236 63.106 1.00 18.49 ? 23  LYS A CG  1 
ATOM   184  C CD  . LYS A 1 23  ? 4.907  39.687 62.726 1.00 18.90 ? 23  LYS A CD  1 
ATOM   185  C CE  . LYS A 1 23  ? 5.699  40.429 63.788 1.00 24.04 ? 23  LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 23  ? 5.954  41.834 63.375 1.00 19.52 ? 23  LYS A NZ  1 
ATOM   187  N N   . VAL A 1 24  ? 3.239  34.984 60.169 1.00 10.42 ? 24  VAL A N   1 
ATOM   188  C CA  . VAL A 1 24  ? 2.375  34.375 59.160 1.00 7.86  ? 24  VAL A CA  1 
ATOM   189  C C   . VAL A 1 24  ? 2.203  32.881 59.463 1.00 6.16  ? 24  VAL A C   1 
ATOM   190  O O   . VAL A 1 24  ? 1.082  32.382 59.579 1.00 8.55  ? 24  VAL A O   1 
ATOM   191  C CB  . VAL A 1 24  ? 2.978  34.521 57.729 1.00 9.75  ? 24  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 24  ? 2.175  33.686 56.735 1.00 12.86 ? 24  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 24  ? 2.968  35.976 57.303 1.00 10.37 ? 24  VAL A CG2 1 
ATOM   194  N N   . LEU A 1 25  ? 3.317  32.168 59.598 1.00 7.11  ? 25  LEU A N   1 
ATOM   195  C CA  . LEU A 1 25  ? 3.265  30.732 59.857 1.00 2.79  ? 25  LEU A CA  1 
ATOM   196  C C   . LEU A 1 25  ? 2.505  30.319 61.118 1.00 9.65  ? 25  LEU A C   1 
ATOM   197  O O   . LEU A 1 25  ? 1.747  29.347 61.090 1.00 9.66  ? 25  LEU A O   1 
ATOM   198  C CB  . LEU A 1 25  ? 4.685  30.154 59.912 1.00 6.51  ? 25  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 25  ? 5.545  30.330 58.653 1.00 5.17  ? 25  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 25  ? 6.939  29.805 58.930 1.00 6.87  ? 25  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 25  ? 4.913  29.595 57.462 1.00 7.39  ? 25  LEU A CD2 1 
ATOM   202  N N   . SER A 1 26  ? 2.689  31.043 62.221 1.00 6.80  ? 26  SER A N   1 
ATOM   203  C CA  . SER A 1 26  ? 2.013  30.660 63.470 1.00 11.42 ? 26  SER A CA  1 
ATOM   204  C C   . SER A 1 26  ? 0.507  30.864 63.403 1.00 16.32 ? 26  SER A C   1 
ATOM   205  O O   . SER A 1 26  ? -0.226 30.361 64.253 1.00 15.83 ? 26  SER A O   1 
ATOM   206  C CB  . SER A 1 26  ? 2.574  31.446 64.658 1.00 8.44  ? 26  SER A CB  1 
ATOM   207  O OG  . SER A 1 26  ? 2.210  32.804 64.573 1.00 6.46  ? 26  SER A OG  1 
ATOM   208  N N   . LYS A 1 27  ? 0.052  31.592 62.387 1.00 14.30 ? 27  LYS A N   1 
ATOM   209  C CA  . LYS A 1 27  ? -1.374 31.856 62.215 1.00 18.94 ? 27  LYS A CA  1 
ATOM   210  C C   . LYS A 1 27  ? -1.950 30.949 61.137 1.00 18.62 ? 27  LYS A C   1 
ATOM   211  O O   . LYS A 1 27  ? -3.067 31.163 60.680 1.00 16.93 ? 27  LYS A O   1 
ATOM   212  C CB  . LYS A 1 27  ? -1.607 33.315 61.814 1.00 15.57 ? 27  LYS A CB  1 
ATOM   213  C CG  . LYS A 1 27  ? -0.992 34.336 62.757 1.00 24.87 ? 27  LYS A CG  1 
ATOM   214  C CD  . LYS A 1 27  ? -1.624 34.286 64.132 1.00 31.23 ? 27  LYS A CD  1 
ATOM   215  C CE  . LYS A 1 27  ? -0.983 35.311 65.055 1.00 37.32 ? 27  LYS A CE  1 
ATOM   216  N NZ  . LYS A 1 27  ? -1.611 35.317 66.399 1.00 40.14 ? 27  LYS A NZ  1 
ATOM   217  N N   . GLY A 1 28  ? -1.178 29.947 60.726 1.00 13.10 ? 28  GLY A N   1 
ATOM   218  C CA  . GLY A 1 28  ? -1.646 29.042 59.696 1.00 11.12 ? 28  GLY A CA  1 
ATOM   219  C C   . GLY A 1 28  ? -1.558 29.639 58.300 1.00 12.19 ? 28  GLY A C   1 
ATOM   220  O O   . GLY A 1 28  ? -2.179 29.140 57.361 1.00 12.02 ? 28  GLY A O   1 
ATOM   221  N N   . GLY A 1 29  ? -0.789 30.713 58.157 1.00 10.76 ? 29  GLY A N   1 
ATOM   222  C CA  . GLY A 1 29  ? -0.634 31.336 56.857 1.00 11.55 ? 29  GLY A CA  1 
ATOM   223  C C   . GLY A 1 29  ? 0.214  30.507 55.901 1.00 11.57 ? 29  GLY A C   1 
ATOM   224  O O   . GLY A 1 29  ? 0.856  29.531 56.305 1.00 8.29  ? 29  GLY A O   1 
ATOM   225  N N   . LYS A 1 30  ? 0.221  30.916 54.632 1.00 10.41 ? 30  LYS A N   1 
ATOM   226  C CA  . LYS A 1 30  ? 0.965  30.237 53.568 1.00 13.67 ? 30  LYS A CA  1 
ATOM   227  C C   . LYS A 1 30  ? 2.474  30.412 53.666 1.00 8.21  ? 30  LYS A C   1 
ATOM   228  O O   . LYS A 1 30  ? 2.963  31.493 53.995 1.00 5.17  ? 30  LYS A O   1 
ATOM   229  C CB  . LYS A 1 30  ? 0.518  30.767 52.199 1.00 16.07 ? 30  LYS A CB  1 
ATOM   230  C CG  . LYS A 1 30  ? -0.962 30.612 51.914 1.00 15.12 ? 30  LYS A CG  1 
ATOM   231  C CD  . LYS A 1 30  ? -1.425 31.604 50.853 1.00 17.06 ? 30  LYS A CD  1 
ATOM   232  C CE  . LYS A 1 30  ? -0.892 31.271 49.472 1.00 14.09 ? 30  LYS A CE  1 
ATOM   233  N NZ  . LYS A 1 30  ? -1.413 32.234 48.441 1.00 9.47  ? 30  LYS A NZ  1 
ATOM   234  N N   . ALA A 1 31  ? 3.212  29.354 53.358 1.00 7.04  ? 31  ALA A N   1 
ATOM   235  C CA  . ALA A 1 31  ? 4.669  29.426 53.394 1.00 7.78  ? 31  ALA A CA  1 
ATOM   236  C C   . ALA A 1 31  ? 5.151  30.537 52.457 1.00 6.65  ? 31  ALA A C   1 
ATOM   237  O O   . ALA A 1 31  ? 6.118  31.241 52.761 1.00 6.39  ? 31  ALA A O   1 
ATOM   238  C CB  . ALA A 1 31  ? 5.278  28.089 52.971 1.00 11.72 ? 31  ALA A CB  1 
ATOM   239  N N   . LEU A 1 32  ? 4.468  30.697 51.326 1.00 3.91  ? 32  LEU A N   1 
ATOM   240  C CA  . LEU A 1 32  ? 4.847  31.717 50.344 1.00 5.83  ? 32  LEU A CA  1 
ATOM   241  C C   . LEU A 1 32  ? 4.790  33.124 50.925 1.00 6.18  ? 32  LEU A C   1 
ATOM   242  O O   . LEU A 1 32  ? 5.685  33.946 50.703 1.00 6.57  ? 32  LEU A O   1 
ATOM   243  C CB  . LEU A 1 32  ? 3.930  31.652 49.115 1.00 6.67  ? 32  LEU A CB  1 
ATOM   244  C CG  . LEU A 1 32  ? 4.235  32.657 47.988 1.00 5.79  ? 32  LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 32  ? 5.607  32.380 47.394 1.00 4.49  ? 32  LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 32  ? 3.159  32.542 46.912 1.00 6.85  ? 32  LEU A CD2 1 
ATOM   247  N N   . ASP A 1 33  ? 3.724  33.410 51.659 1.00 7.74  ? 33  ASP A N   1 
ATOM   248  C CA  . ASP A 1 33  ? 3.577  34.720 52.258 1.00 7.54  ? 33  ASP A CA  1 
ATOM   249  C C   . ASP A 1 33  ? 4.601  34.894 53.369 1.00 6.97  ? 33  ASP A C   1 
ATOM   250  O O   . ASP A 1 33  ? 5.175  35.967 53.523 1.00 8.93  ? 33  ASP A O   1 
ATOM   251  C CB  . ASP A 1 33  ? 2.165  34.895 52.814 1.00 8.15  ? 33  ASP A CB  1 
ATOM   252  C CG  . ASP A 1 33  ? 1.123  35.006 51.716 1.00 11.84 ? 33  ASP A CG  1 
ATOM   253  O OD1 . ASP A 1 33  ? 1.312  35.829 50.805 1.00 10.75 ? 33  ASP A OD1 1 
ATOM   254  O OD2 . ASP A 1 33  ? 0.117  34.279 51.764 1.00 16.79 ? 33  ASP A OD2 1 
ATOM   255  N N   . ALA A 1 34  ? 4.835  33.827 54.129 1.00 7.33  ? 34  ALA A N   1 
ATOM   256  C CA  . ALA A 1 34  ? 5.792  33.874 55.228 1.00 8.56  ? 34  ALA A CA  1 
ATOM   257  C C   . ALA A 1 34  ? 7.208  34.207 54.763 1.00 8.11  ? 34  ALA A C   1 
ATOM   258  O O   . ALA A 1 34  ? 7.855  35.085 55.334 1.00 4.54  ? 34  ALA A O   1 
ATOM   259  C CB  . ALA A 1 34  ? 5.791  32.546 55.984 1.00 10.06 ? 34  ALA A CB  1 
ATOM   260  N N   . VAL A 1 35  ? 7.697  33.517 53.734 1.00 4.67  ? 35  VAL A N   1 
ATOM   261  C CA  . VAL A 1 35  ? 9.043  33.795 53.257 1.00 5.78  ? 35  VAL A CA  1 
ATOM   262  C C   . VAL A 1 35  ? 9.174  35.171 52.608 1.00 6.40  ? 35  VAL A C   1 
ATOM   263  O O   . VAL A 1 35  ? 10.200 35.814 52.763 1.00 7.57  ? 35  VAL A O   1 
ATOM   264  C CB  . VAL A 1 35  ? 9.569  32.709 52.287 1.00 8.69  ? 35  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 35  ? 9.646  31.371 53.024 1.00 6.21  ? 35  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 35  ? 8.686  32.605 51.048 1.00 6.56  ? 35  VAL A CG2 1 
ATOM   267  N N   . GLU A 1 36  ? 8.144  35.628 51.895 1.00 7.61  ? 36  GLU A N   1 
ATOM   268  C CA  . GLU A 1 36  ? 8.208  36.949 51.274 1.00 7.24  ? 36  GLU A CA  1 
ATOM   269  C C   . GLU A 1 36  ? 8.303  38.007 52.375 1.00 7.11  ? 36  GLU A C   1 
ATOM   270  O O   . GLU A 1 36  ? 9.173  38.880 52.343 1.00 8.32  ? 36  GLU A O   1 
ATOM   271  C CB  . GLU A 1 36  ? 6.969  37.231 50.415 1.00 7.50  ? 36  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 36  ? 6.906  38.679 49.932 1.00 7.57  ? 36  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 36  ? 5.691  38.983 49.056 1.00 10.80 ? 36  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 36  ? 4.644  38.330 49.229 1.00 9.17  ? 36  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 36  ? 5.777  39.892 48.202 1.00 14.07 ? 36  GLU A OE2 1 
ATOM   276  N N   . LYS A 1 37  ? 7.406  37.918 53.350 1.00 3.42  ? 37  LYS A N   1 
ATOM   277  C CA  . LYS A 1 37  ? 7.390  38.854 54.460 1.00 7.65  ? 37  LYS A CA  1 
ATOM   278  C C   . LYS A 1 37  ? 8.717  38.807 55.213 1.00 5.85  ? 37  LYS A C   1 
ATOM   279  O O   . LYS A 1 37  ? 9.272  39.844 55.592 1.00 10.58 ? 37  LYS A O   1 
ATOM   280  C CB  . LYS A 1 37  ? 6.240  38.511 55.408 1.00 10.60 ? 37  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 37  ? 6.183  39.382 56.645 1.00 24.14 ? 37  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 37  ? 5.025  38.965 57.548 1.00 30.04 ? 37  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 37  ? 5.042  39.741 58.843 1.00 29.27 ? 37  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 37  ? 3.954  39.314 59.749 1.00 40.84 ? 37  LYS A NZ  1 
ATOM   285  N N   . GLY A 1 38  ? 9.222  37.598 55.426 1.00 5.68  ? 38  GLY A N   1 
ATOM   286  C CA  . GLY A 1 38  ? 10.472 37.438 56.142 1.00 2.97  ? 38  GLY A CA  1 
ATOM   287  C C   . GLY A 1 38  ? 11.656 38.144 55.505 1.00 7.99  ? 38  GLY A C   1 
ATOM   288  O O   . GLY A 1 38  ? 12.376 38.897 56.170 1.00 6.29  ? 38  GLY A O   1 
ATOM   289  N N   . VAL A 1 39  ? 11.881 37.912 54.217 1.00 7.69  ? 39  VAL A N   1 
ATOM   290  C CA  . VAL A 1 39  ? 13.022 38.541 53.568 1.00 5.16  ? 39  VAL A CA  1 
ATOM   291  C C   . VAL A 1 39  ? 12.812 40.030 53.301 1.00 9.71  ? 39  VAL A C   1 
ATOM   292  O O   . VAL A 1 39  ? 13.777 40.793 53.293 1.00 9.61  ? 39  VAL A O   1 
ATOM   293  C CB  . VAL A 1 39  ? 13.417 37.794 52.264 1.00 9.22  ? 39  VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 39  ? 13.704 36.336 52.592 1.00 13.18 ? 39  VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 39  ? 12.324 37.909 51.220 1.00 6.95  ? 39  VAL A CG2 1 
ATOM   296  N N   . ARG A 1 40  ? 11.564 40.456 53.114 1.00 7.70  ? 40  ARG A N   1 
ATOM   297  C CA  . ARG A 1 40  ? 11.294 41.876 52.882 1.00 8.22  ? 40  ARG A CA  1 
ATOM   298  C C   . ARG A 1 40  ? 11.808 42.713 54.057 1.00 11.01 ? 40  ARG A C   1 
ATOM   299  O O   . ARG A 1 40  ? 12.189 43.871 53.890 1.00 8.32  ? 40  ARG A O   1 
ATOM   300  C CB  . ARG A 1 40  ? 9.792  42.132 52.701 1.00 9.27  ? 40  ARG A CB  1 
ATOM   301  C CG  . ARG A 1 40  ? 9.240  41.795 51.319 1.00 8.41  ? 40  ARG A CG  1 
ATOM   302  C CD  . ARG A 1 40  ? 7.747  42.113 51.270 1.00 7.67  ? 40  ARG A CD  1 
ATOM   303  N NE  . ARG A 1 40  ? 7.495  43.517 51.591 1.00 12.61 ? 40  ARG A NE  1 
ATOM   304  C CZ  . ARG A 1 40  ? 7.277  44.477 50.693 1.00 15.79 ? 40  ARG A CZ  1 
ATOM   305  N NH1 . ARG A 1 40  ? 7.272  44.197 49.396 1.00 8.33  ? 40  ARG A NH1 1 
ATOM   306  N NH2 . ARG A 1 40  ? 7.059  45.725 51.091 1.00 14.34 ? 40  ARG A NH2 1 
ATOM   307  N N   . LEU A 1 41  ? 11.805 42.121 55.249 1.00 10.68 ? 41  LEU A N   1 
ATOM   308  C CA  . LEU A 1 41  ? 12.287 42.813 56.440 1.00 12.54 ? 41  LEU A CA  1 
ATOM   309  C C   . LEU A 1 41  ? 13.737 43.230 56.244 1.00 12.76 ? 41  LEU A C   1 
ATOM   310  O O   . LEU A 1 41  ? 14.140 44.334 56.613 1.00 11.08 ? 41  LEU A O   1 
ATOM   311  C CB  . LEU A 1 41  ? 12.194 41.907 57.668 1.00 11.51 ? 41  LEU A CB  1 
ATOM   312  C CG  . LEU A 1 41  ? 12.715 42.532 58.969 1.00 13.33 ? 41  LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 41  ? 11.740 43.595 59.444 1.00 16.80 ? 41  LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 41  ? 12.882 41.459 60.034 1.00 15.76 ? 41  LEU A CD2 1 
ATOM   315  N N   . VAL A 1 42  ? 14.518 42.337 55.651 1.00 12.11 ? 42  VAL A N   1 
ATOM   316  C CA  . VAL A 1 42  ? 15.930 42.593 55.419 1.00 11.05 ? 42  VAL A CA  1 
ATOM   317  C C   . VAL A 1 42  ? 16.121 43.554 54.258 1.00 12.59 ? 42  VAL A C   1 
ATOM   318  O O   . VAL A 1 42  ? 17.022 44.389 54.282 1.00 14.42 ? 42  VAL A O   1 
ATOM   319  C CB  . VAL A 1 42  ? 16.673 41.274 55.144 1.00 13.01 ? 42  VAL A CB  1 
ATOM   320  C CG1 . VAL A 1 42  ? 18.182 41.514 55.084 1.00 12.88 ? 42  VAL A CG1 1 
ATOM   321  C CG2 . VAL A 1 42  ? 16.330 40.264 56.245 1.00 12.79 ? 42  VAL A CG2 1 
ATOM   322  N N   . GLU A 1 43  ? 15.281 43.428 53.235 1.00 8.24  ? 43  GLU A N   1 
ATOM   323  C CA  . GLU A 1 43  ? 15.372 44.322 52.087 1.00 6.41  ? 43  GLU A CA  1 
ATOM   324  C C   . GLU A 1 43  ? 15.142 45.759 52.556 1.00 9.13  ? 43  GLU A C   1 
ATOM   325  O O   . GLU A 1 43  ? 15.834 46.676 52.121 1.00 12.61 ? 43  GLU A O   1 
ATOM   326  C CB  . GLU A 1 43  ? 14.319 43.959 51.041 1.00 4.21  ? 43  GLU A CB  1 
ATOM   327  C CG  . GLU A 1 43  ? 14.495 42.570 50.432 1.00 7.07  ? 43  GLU A CG  1 
ATOM   328  C CD  . GLU A 1 43  ? 13.443 42.257 49.386 1.00 7.82  ? 43  GLU A CD  1 
ATOM   329  O OE1 . GLU A 1 43  ? 12.305 42.736 49.534 1.00 8.38  ? 43  GLU A OE1 1 
ATOM   330  O OE2 . GLU A 1 43  ? 13.745 41.519 48.430 1.00 7.91  ? 43  GLU A OE2 1 
ATOM   331  N N   . ASP A 1 44  ? 14.173 45.939 53.449 1.00 10.04 ? 44  ASP A N   1 
ATOM   332  C CA  . ASP A 1 44  ? 13.827 47.263 53.970 1.00 17.26 ? 44  ASP A CA  1 
ATOM   333  C C   . ASP A 1 44  ? 14.884 47.909 54.855 1.00 19.79 ? 44  ASP A C   1 
ATOM   334  O O   . ASP A 1 44  ? 14.966 49.134 54.938 1.00 15.17 ? 44  ASP A O   1 
ATOM   335  C CB  . ASP A 1 44  ? 12.533 47.208 54.784 1.00 12.71 ? 44  ASP A CB  1 
ATOM   336  C CG  . ASP A 1 44  ? 11.308 46.975 53.933 1.00 17.53 ? 44  ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 44  ? 11.368 47.205 52.710 1.00 12.86 ? 44  ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 44  ? 10.271 46.573 54.495 1.00 16.20 ? 44  ASP A OD2 1 
ATOM   339  N N   . ASP A 1 45  ? 15.682 47.085 55.520 1.00 16.21 ? 45  ASP A N   1 
ATOM   340  C CA  . ASP A 1 45  ? 16.693 47.583 56.444 1.00 18.16 ? 45  ASP A CA  1 
ATOM   341  C C   . ASP A 1 45  ? 17.973 48.103 55.784 1.00 15.94 ? 45  ASP A C   1 
ATOM   342  O O   . ASP A 1 45  ? 18.782 47.325 55.280 1.00 15.51 ? 45  ASP A O   1 
ATOM   343  C CB  . ASP A 1 45  ? 17.047 46.471 57.433 1.00 14.98 ? 45  ASP A CB  1 
ATOM   344  C CG  . ASP A 1 45  ? 17.698 46.999 58.688 1.00 20.45 ? 45  ASP A CG  1 
ATOM   345  O OD1 . ASP A 1 45  ? 18.468 47.978 58.593 1.00 18.31 ? 45  ASP A OD1 1 
ATOM   346  O OD2 . ASP A 1 45  ? 17.442 46.422 59.760 1.00 19.83 ? 45  ASP A OD2 1 
ATOM   347  N N   . PRO A 1 46  ? 18.183 49.430 55.795 1.00 16.86 ? 46  PRO A N   1 
ATOM   348  C CA  . PRO A 1 46  ? 19.393 49.989 55.180 1.00 18.60 ? 46  PRO A CA  1 
ATOM   349  C C   . PRO A 1 46  ? 20.686 49.560 55.879 1.00 19.96 ? 46  PRO A C   1 
ATOM   350  O O   . PRO A 1 46  ? 21.769 49.677 55.304 1.00 20.20 ? 46  PRO A O   1 
ATOM   351  C CB  . PRO A 1 46  ? 19.156 51.501 55.256 1.00 20.57 ? 46  PRO A CB  1 
ATOM   352  C CG  . PRO A 1 46  ? 18.317 51.648 56.492 1.00 18.26 ? 46  PRO A CG  1 
ATOM   353  C CD  . PRO A 1 46  ? 17.335 50.497 56.356 1.00 17.60 ? 46  PRO A CD  1 
ATOM   354  N N   . THR A 1 47  ? 20.575 49.063 57.111 1.00 17.06 ? 47  THR A N   1 
ATOM   355  C CA  . THR A 1 47  ? 21.757 48.616 57.846 1.00 17.16 ? 47  THR A CA  1 
ATOM   356  C C   . THR A 1 47  ? 22.217 47.258 57.337 1.00 21.42 ? 47  THR A C   1 
ATOM   357  O O   . THR A 1 47  ? 23.347 46.844 57.590 1.00 14.99 ? 47  THR A O   1 
ATOM   358  C CB  . THR A 1 47  ? 21.498 48.511 59.365 1.00 22.78 ? 47  THR A CB  1 
ATOM   359  O OG1 . THR A 1 47  ? 20.540 47.478 59.623 1.00 24.52 ? 47  THR A OG1 1 
ATOM   360  C CG2 . THR A 1 47  ? 20.979 49.839 59.909 1.00 23.34 ? 47  THR A CG2 1 
ATOM   361  N N   . GLU A 1 48  ? 21.335 46.561 56.627 1.00 18.66 ? 48  GLU A N   1 
ATOM   362  C CA  . GLU A 1 48  ? 21.684 45.269 56.056 1.00 18.52 ? 48  GLU A CA  1 
ATOM   363  C C   . GLU A 1 48  ? 22.274 45.574 54.692 1.00 18.53 ? 48  GLU A C   1 
ATOM   364  O O   . GLU A 1 48  ? 21.557 45.772 53.712 1.00 21.32 ? 48  GLU A O   1 
ATOM   365  C CB  . GLU A 1 48  ? 20.446 44.378 55.948 1.00 16.88 ? 48  GLU A CB  1 
ATOM   366  C CG  . GLU A 1 48  ? 20.170 43.619 57.231 1.00 23.13 ? 48  GLU A CG  1 
ATOM   367  C CD  . GLU A 1 48  ? 21.420 42.927 57.741 1.00 24.25 ? 48  GLU A CD  1 
ATOM   368  O OE1 . GLU A 1 48  ? 22.152 42.357 56.908 1.00 37.65 ? 48  GLU A OE1 1 
ATOM   369  O OE2 . GLU A 1 48  ? 21.675 42.949 58.962 1.00 21.18 ? 48  GLU A OE2 1 
ATOM   370  N N   . ARG A 1 49  ? 23.600 45.601 54.654 1.00 17.39 ? 49  ARG A N   1 
ATOM   371  C CA  . ARG A 1 49  ? 24.362 45.967 53.471 1.00 18.23 ? 49  ARG A CA  1 
ATOM   372  C C   . ARG A 1 49  ? 24.448 45.002 52.298 1.00 15.33 ? 49  ARG A C   1 
ATOM   373  O O   . ARG A 1 49  ? 25.105 45.314 51.305 1.00 14.64 ? 49  ARG A O   1 
ATOM   374  C CB  . ARG A 1 49  ? 25.780 46.344 53.913 1.00 17.31 ? 49  ARG A CB  1 
ATOM   375  C CG  . ARG A 1 49  ? 25.811 47.256 55.137 1.00 21.18 ? 49  ARG A CG  1 
ATOM   376  C CD  . ARG A 1 49  ? 25.067 48.553 54.864 1.00 19.05 ? 49  ARG A CD  1 
ATOM   377  N NE  . ARG A 1 49  ? 25.669 49.263 53.741 1.00 21.24 ? 49  ARG A NE  1 
ATOM   378  C CZ  . ARG A 1 49  ? 26.915 49.723 53.735 1.00 19.22 ? 49  ARG A CZ  1 
ATOM   379  N NH1 . ARG A 1 49  ? 27.693 49.555 54.799 1.00 19.95 ? 49  ARG A NH1 1 
ATOM   380  N NH2 . ARG A 1 49  ? 27.390 50.328 52.659 1.00 15.77 ? 49  ARG A NH2 1 
ATOM   381  N N   . SER A 1 50  ? 23.806 43.842 52.383 1.00 15.23 ? 50  SER A N   1 
ATOM   382  C CA  . SER A 1 50  ? 23.889 42.896 51.268 1.00 16.63 ? 50  SER A CA  1 
ATOM   383  C C   . SER A 1 50  ? 22.530 42.507 50.719 1.00 15.88 ? 50  SER A C   1 
ATOM   384  O O   . SER A 1 50  ? 22.422 41.587 49.908 1.00 13.34 ? 50  SER A O   1 
ATOM   385  C CB  . SER A 1 50  ? 24.638 41.632 51.691 1.00 21.88 ? 50  SER A CB  1 
ATOM   386  O OG  . SER A 1 50  ? 23.903 40.932 52.675 1.00 37.70 ? 50  SER A OG  1 
ATOM   387  N N   . VAL A 1 51  ? 21.496 43.214 51.157 1.00 14.64 ? 51  VAL A N   1 
ATOM   388  C CA  . VAL A 1 51  ? 20.145 42.935 50.702 1.00 15.15 ? 51  VAL A CA  1 
ATOM   389  C C   . VAL A 1 51  ? 19.359 44.221 50.498 1.00 17.21 ? 51  VAL A C   1 
ATOM   390  O O   . VAL A 1 51  ? 19.226 45.029 51.413 1.00 15.57 ? 51  VAL A O   1 
ATOM   391  C CB  . VAL A 1 51  ? 19.383 42.063 51.724 1.00 13.41 ? 51  VAL A CB  1 
ATOM   392  C CG1 . VAL A 1 51  ? 17.960 41.821 51.243 1.00 13.09 ? 51  VAL A CG1 1 
ATOM   393  C CG2 . VAL A 1 51  ? 20.118 40.742 51.924 1.00 13.72 ? 51  VAL A CG2 1 
ATOM   394  N N   . GLY A 1 52  ? 18.845 44.398 49.288 1.00 16.50 ? 52  GLY A N   1 
ATOM   395  C CA  . GLY A 1 52  ? 18.053 45.570 48.968 1.00 13.13 ? 52  GLY A CA  1 
ATOM   396  C C   . GLY A 1 52  ? 18.596 46.916 49.407 1.00 12.09 ? 52  GLY A C   1 
ATOM   397  O O   . GLY A 1 52  ? 19.770 47.229 49.209 1.00 14.19 ? 52  GLY A O   1 
ATOM   398  N N   . TYR A 1 53  ? 17.716 47.719 49.997 1.00 12.27 ? 53  TYR A N   1 
ATOM   399  C CA  . TYR A 1 53  ? 18.062 49.052 50.465 1.00 10.97 ? 53  TYR A CA  1 
ATOM   400  C C   . TYR A 1 53  ? 19.317 49.042 51.343 1.00 15.15 ? 53  TYR A C   1 
ATOM   401  O O   . TYR A 1 53  ? 19.413 48.286 52.310 1.00 14.15 ? 53  TYR A O   1 
ATOM   402  C CB  . TYR A 1 53  ? 16.865 49.639 51.223 1.00 12.75 ? 53  TYR A CB  1 
ATOM   403  C CG  . TYR A 1 53  ? 17.036 51.071 51.668 1.00 13.54 ? 53  TYR A CG  1 
ATOM   404  C CD1 . TYR A 1 53  ? 17.642 52.016 50.837 1.00 20.06 ? 53  TYR A CD1 1 
ATOM   405  C CD2 . TYR A 1 53  ? 16.563 51.490 52.909 1.00 19.00 ? 53  TYR A CD2 1 
ATOM   406  C CE1 . TYR A 1 53  ? 17.774 53.347 51.234 1.00 19.82 ? 53  TYR A CE1 1 
ATOM   407  C CE2 . TYR A 1 53  ? 16.687 52.815 53.316 1.00 22.95 ? 53  TYR A CE2 1 
ATOM   408  C CZ  . TYR A 1 53  ? 17.294 53.738 52.473 1.00 25.31 ? 53  TYR A CZ  1 
ATOM   409  O OH  . TYR A 1 53  ? 17.426 55.047 52.878 1.00 21.69 ? 53  TYR A OH  1 
ATOM   410  N N   . GLY A 1 54  ? 20.281 49.881 50.984 1.00 14.76 ? 54  GLY A N   1 
ATOM   411  C CA  . GLY A 1 54  ? 21.519 49.949 51.736 1.00 15.67 ? 54  GLY A CA  1 
ATOM   412  C C   . GLY A 1 54  ? 22.546 48.949 51.233 1.00 12.36 ? 54  GLY A C   1 
ATOM   413  O O   . GLY A 1 54  ? 23.654 48.886 51.752 1.00 10.89 ? 54  GLY A O   1 
ATOM   414  N N   . GLY A 1 55  ? 22.181 48.163 50.223 1.00 17.20 ? 55  GLY A N   1 
ATOM   415  C CA  . GLY A 1 55  ? 23.113 47.183 49.686 1.00 17.99 ? 55  GLY A CA  1 
ATOM   416  C C   . GLY A 1 55  ? 24.282 47.844 48.976 1.00 14.29 ? 55  GLY A C   1 
ATOM   417  O O   . GLY A 1 55  ? 24.112 48.876 48.331 1.00 14.45 ? 55  GLY A O   1 
ATOM   418  N N   . ARG A 1 56  ? 25.472 47.265 49.089 1.00 13.46 ? 56  ARG A N   1 
ATOM   419  C CA  . ARG A 1 56  ? 26.638 47.847 48.432 1.00 10.64 ? 56  ARG A CA  1 
ATOM   420  C C   . ARG A 1 56  ? 26.472 47.766 46.924 1.00 10.60 ? 56  ARG A C   1 
ATOM   421  O O   . ARG A 1 56  ? 26.129 46.713 46.377 1.00 12.90 ? 56  ARG A O   1 
ATOM   422  C CB  . ARG A 1 56  ? 27.916 47.127 48.869 1.00 12.97 ? 56  ARG A CB  1 
ATOM   423  C CG  . ARG A 1 56  ? 28.185 47.262 50.357 1.00 21.62 ? 56  ARG A CG  1 
ATOM   424  C CD  . ARG A 1 56  ? 29.626 46.938 50.708 1.00 23.25 ? 56  ARG A CD  1 
ATOM   425  N NE  . ARG A 1 56  ? 29.927 47.304 52.089 1.00 30.24 ? 56  ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 56  ? 29.503 46.628 53.152 1.00 30.35 ? 56  ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 56  ? 28.761 45.537 52.997 1.00 28.25 ? 56  ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 56  ? 29.815 47.050 54.368 1.00 29.78 ? 56  ARG A NH2 1 
ATOM   429  N N   . PRO A 1 57  ? 26.714 48.882 46.226 1.00 11.47 ? 57  PRO A N   1 
ATOM   430  C CA  . PRO A 1 57  ? 26.576 48.913 44.769 1.00 10.48 ? 57  PRO A CA  1 
ATOM   431  C C   . PRO A 1 57  ? 27.673 48.176 44.022 1.00 9.87  ? 57  PRO A C   1 
ATOM   432  O O   . PRO A 1 57  ? 28.652 47.725 44.621 1.00 11.06 ? 57  PRO A O   1 
ATOM   433  C CB  . PRO A 1 57  ? 26.590 50.406 44.462 1.00 8.91  ? 57  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 57  ? 27.601 50.915 45.471 1.00 11.20 ? 57  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 57  ? 27.164 50.190 46.742 1.00 12.66 ? 57  PRO A CD  1 
ATOM   436  N N   . ASP A 1 58  ? 27.491 48.049 42.709 1.00 8.70  ? 58  ASP A N   1 
ATOM   437  C CA  . ASP A 1 58  ? 28.487 47.412 41.870 1.00 9.69  ? 58  ASP A CA  1 
ATOM   438  C C   . ASP A 1 58  ? 29.585 48.462 41.716 1.00 10.08 ? 58  ASP A C   1 
ATOM   439  O O   . ASP A 1 58  ? 29.453 49.577 42.231 1.00 8.21  ? 58  ASP A O   1 
ATOM   440  C CB  . ASP A 1 58  ? 27.901 47.028 40.500 1.00 11.23 ? 58  ASP A CB  1 
ATOM   441  C CG  . ASP A 1 58  ? 27.314 48.211 39.750 1.00 13.99 ? 58  ASP A CG  1 
ATOM   442  O OD1 . ASP A 1 58  ? 27.831 49.342 39.892 1.00 12.71 ? 58  ASP A OD1 1 
ATOM   443  O OD2 . ASP A 1 58  ? 26.340 48.001 38.998 1.00 10.06 ? 58  ASP A OD2 1 
ATOM   444  N N   . ARG A 1 59  ? 30.654 48.131 41.005 1.00 10.46 ? 59  ARG A N   1 
ATOM   445  C CA  . ARG A 1 59  ? 31.760 49.078 40.862 1.00 12.95 ? 59  ARG A CA  1 
ATOM   446  C C   . ARG A 1 59  ? 31.410 50.405 40.191 1.00 13.44 ? 59  ARG A C   1 
ATOM   447  O O   . ARG A 1 59  ? 32.208 51.345 40.220 1.00 11.56 ? 59  ARG A O   1 
ATOM   448  C CB  . ARG A 1 59  ? 32.929 48.421 40.126 1.00 14.52 ? 59  ARG A CB  1 
ATOM   449  C CG  . ARG A 1 59  ? 32.661 48.096 38.676 1.00 19.27 ? 59  ARG A CG  1 
ATOM   450  C CD  . ARG A 1 59  ? 33.856 47.385 38.077 1.00 18.96 ? 59  ARG A CD  1 
ATOM   451  N NE  . ARG A 1 59  ? 33.675 47.138 36.654 1.00 18.12 ? 59  ARG A NE  1 
ATOM   452  C CZ  . ARG A 1 59  ? 34.556 46.504 35.888 1.00 29.68 ? 59  ARG A CZ  1 
ATOM   453  N NH1 . ARG A 1 59  ? 35.687 46.047 36.413 1.00 24.26 ? 59  ARG A NH1 1 
ATOM   454  N NH2 . ARG A 1 59  ? 34.307 46.333 34.594 1.00 28.57 ? 59  ARG A NH2 1 
ATOM   455  N N   . ASP A 1 60  ? 30.231 50.498 39.585 1.00 13.56 ? 60  ASP A N   1 
ATOM   456  C CA  . ASP A 1 60  ? 29.846 51.750 38.946 1.00 14.58 ? 60  ASP A CA  1 
ATOM   457  C C   . ASP A 1 60  ? 28.919 52.565 39.839 1.00 10.46 ? 60  ASP A C   1 
ATOM   458  O O   . ASP A 1 60  ? 28.334 53.546 39.399 1.00 12.89 ? 60  ASP A O   1 
ATOM   459  C CB  . ASP A 1 60  ? 29.180 51.496 37.589 1.00 12.74 ? 60  ASP A CB  1 
ATOM   460  C CG  . ASP A 1 60  ? 30.126 50.886 36.588 1.00 14.27 ? 60  ASP A CG  1 
ATOM   461  O OD1 . ASP A 1 60  ? 31.288 51.346 36.507 1.00 17.37 ? 60  ASP A OD1 1 
ATOM   462  O OD2 . ASP A 1 60  ? 29.712 49.953 35.872 1.00 14.46 ? 60  ASP A OD2 1 
ATOM   463  N N   . GLY A 1 61  ? 28.798 52.153 41.097 1.00 14.99 ? 61  GLY A N   1 
ATOM   464  C CA  . GLY A 1 61  ? 27.956 52.873 42.042 1.00 11.21 ? 61  GLY A CA  1 
ATOM   465  C C   . GLY A 1 61  ? 26.474 52.591 41.916 1.00 13.89 ? 61  GLY A C   1 
ATOM   466  O O   . GLY A 1 61  ? 25.647 53.308 42.478 1.00 13.21 ? 61  GLY A O   1 
ATOM   467  N N   . ARG A 1 62  ? 26.134 51.542 41.180 1.00 9.88  ? 62  ARG A N   1 
ATOM   468  C CA  . ARG A 1 62  ? 24.740 51.181 40.985 1.00 14.07 ? 62  ARG A CA  1 
ATOM   469  C C   . ARG A 1 62  ? 24.298 50.026 41.880 1.00 10.04 ? 62  ARG A C   1 
ATOM   470  O O   . ARG A 1 62  ? 24.954 48.991 41.943 1.00 8.43  ? 62  ARG A O   1 
ATOM   471  C CB  . ARG A 1 62  ? 24.505 50.786 39.530 1.00 17.36 ? 62  ARG A CB  1 
ATOM   472  C CG  . ARG A 1 62  ? 24.616 51.908 38.522 1.00 21.74 ? 62  ARG A CG  1 
ATOM   473  C CD  . ARG A 1 62  ? 23.978 51.428 37.234 1.00 34.78 ? 62  ARG A CD  1 
ATOM   474  N NE  . ARG A 1 62  ? 23.900 52.449 36.203 1.00 39.28 ? 62  ARG A NE  1 
ATOM   475  C CZ  . ARG A 1 62  ? 23.191 52.313 35.089 1.00 40.68 ? 62  ARG A CZ  1 
ATOM   476  N NH1 . ARG A 1 62  ? 22.504 51.198 34.872 1.00 33.31 ? 62  ARG A NH1 1 
ATOM   477  N NH2 . ARG A 1 62  ? 23.166 53.291 34.191 1.00 49.13 ? 62  ARG A NH2 1 
ATOM   478  N N   . VAL A 1 63  ? 23.182 50.206 42.574 1.00 10.81 ? 63  VAL A N   1 
ATOM   479  C CA  . VAL A 1 63  ? 22.673 49.144 43.422 1.00 11.70 ? 63  VAL A CA  1 
ATOM   480  C C   . VAL A 1 63  ? 21.736 48.304 42.568 1.00 7.12  ? 63  VAL A C   1 
ATOM   481  O O   . VAL A 1 63  ? 20.659 48.757 42.185 1.00 9.22  ? 63  VAL A O   1 
ATOM   482  C CB  . VAL A 1 63  ? 21.917 49.708 44.637 1.00 9.72  ? 63  VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 63  ? 21.293 48.578 45.429 1.00 8.85  ? 63  VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 63  ? 22.889 50.509 45.520 1.00 13.94 ? 63  VAL A CG2 1 
ATOM   485  N N   . THR A 1 64  ? 22.172 47.094 42.230 1.00 10.71 ? 64  THR A N   1 
ATOM   486  C CA  . THR A 1 64  ? 21.355 46.208 41.420 1.00 8.45  ? 64  THR A CA  1 
ATOM   487  C C   . THR A 1 64  ? 21.111 44.970 42.252 1.00 7.00  ? 64  THR A C   1 
ATOM   488  O O   . THR A 1 64  ? 22.049 44.359 42.775 1.00 7.20  ? 64  THR A O   1 
ATOM   489  C CB  . THR A 1 64  ? 22.043 45.864 40.078 1.00 8.03  ? 64  THR A CB  1 
ATOM   490  O OG1 . THR A 1 64  ? 23.134 44.959 40.288 1.00 10.06 ? 64  THR A OG1 1 
ATOM   491  C CG2 . THR A 1 64  ? 22.589 47.148 39.435 1.00 11.85 ? 64  THR A CG2 1 
ATOM   492  N N   . LEU A 1 65  ? 19.835 44.623 42.377 1.00 3.11  ? 65  LEU A N   1 
ATOM   493  C CA  . LEU A 1 65  ? 19.406 43.493 43.193 1.00 4.76  ? 65  LEU A CA  1 
ATOM   494  C C   . LEU A 1 65  ? 18.954 42.279 42.400 1.00 1.76  ? 65  LEU A C   1 
ATOM   495  O O   . LEU A 1 65  ? 18.483 42.402 41.274 1.00 4.95  ? 65  LEU A O   1 
ATOM   496  C CB  . LEU A 1 65  ? 18.259 43.939 44.098 1.00 4.61  ? 65  LEU A CB  1 
ATOM   497  C CG  . LEU A 1 65  ? 18.479 45.281 44.806 1.00 9.35  ? 65  LEU A CG  1 
ATOM   498  C CD1 . LEU A 1 65  ? 17.271 45.594 45.685 1.00 8.58  ? 65  LEU A CD1 1 
ATOM   499  C CD2 . LEU A 1 65  ? 19.761 45.219 45.638 1.00 7.55  ? 65  LEU A CD2 1 
ATOM   500  N N   . ASP A 1 66  ? 19.084 41.112 43.023 1.00 4.36  ? 66  ASP A N   1 
ATOM   501  C CA  . ASP A 1 66  ? 18.692 39.836 42.428 1.00 4.23  ? 66  ASP A CA  1 
ATOM   502  C C   . ASP A 1 66  ? 17.800 39.144 43.452 1.00 6.14  ? 66  ASP A C   1 
ATOM   503  O O   . ASP A 1 66  ? 18.051 39.229 44.651 1.00 5.79  ? 66  ASP A O   1 
ATOM   504  C CB  . ASP A 1 66  ? 19.903 38.926 42.212 1.00 2.89  ? 66  ASP A CB  1 
ATOM   505  C CG  . ASP A 1 66  ? 21.045 39.601 41.461 1.00 2.88  ? 66  ASP A CG  1 
ATOM   506  O OD1 . ASP A 1 66  ? 22.187 39.170 41.681 1.00 11.00 ? 66  ASP A OD1 1 
ATOM   507  O OD2 . ASP A 1 66  ? 20.816 40.525 40.655 1.00 5.98  ? 66  ASP A OD2 1 
ATOM   508  N N   . ALA A 1 67  ? 16.765 38.457 42.986 1.00 7.02  ? 67  ALA A N   1 
ATOM   509  C CA  . ALA A 1 67  ? 15.899 37.733 43.894 1.00 4.88  ? 67  ALA A CA  1 
ATOM   510  C C   . ALA A 1 67  ? 15.033 36.739 43.155 1.00 7.67  ? 67  ALA A C   1 
ATOM   511  O O   . ALA A 1 67  ? 14.726 36.913 41.973 1.00 3.09  ? 67  ALA A O   1 
ATOM   512  C CB  . ALA A 1 67  ? 15.011 38.691 44.671 1.00 4.91  ? 67  ALA A CB  1 
ATOM   513  N N   . CYS A 1 68  ? 14.665 35.673 43.853 1.00 3.95  ? 68  CYS A N   1 
ATOM   514  C CA  . CYS A 1 68  ? 13.754 34.704 43.279 1.00 5.55  ? 68  CYS A CA  1 
ATOM   515  C C   . CYS A 1 68  ? 12.934 34.109 44.410 1.00 6.81  ? 68  CYS A C   1 
ATOM   516  O O   . CYS A 1 68  ? 13.326 34.131 45.590 1.00 6.52  ? 68  CYS A O   1 
ATOM   517  C CB  . CYS A 1 68  ? 14.488 33.629 42.460 1.00 2.93  ? 68  CYS A CB  1 
ATOM   518  S SG  . CYS A 1 68  ? 15.368 32.380 43.368 1.00 11.51 ? 68  CYS A SG  1 
ATOM   519  N N   . ILE A 1 69  ? 11.776 33.598 44.041 1.00 5.35  ? 69  ILE A N   1 
ATOM   520  C CA  . ILE A 1 69  ? 10.852 33.032 44.998 1.00 3.22  ? 69  ILE A CA  1 
ATOM   521  C C   . ILE A 1 69  ? 10.282 31.778 44.340 1.00 4.37  ? 69  ILE A C   1 
ATOM   522  O O   . ILE A 1 69  ? 10.203 31.690 43.111 1.00 5.28  ? 69  ILE A O   1 
ATOM   523  C CB  . ILE A 1 69  ? 9.744  34.073 45.304 1.00 1.12  ? 69  ILE A CB  1 
ATOM   524  C CG1 . ILE A 1 69  ? 8.903  33.631 46.502 1.00 1.12  ? 69  ILE A CG1 1 
ATOM   525  C CG2 . ILE A 1 69  ? 8.867  34.285 44.056 1.00 5.86  ? 69  ILE A CG2 1 
ATOM   526  C CD1 . ILE A 1 69  ? 8.095  34.760 47.125 1.00 4.87  ? 69  ILE A CD1 1 
ATOM   527  N N   . MET A 1 70  ? 9.920  30.795 45.153 1.00 1.12  ? 70  MET A N   1 
ATOM   528  C CA  . MET A 1 70  ? 9.378  29.553 44.627 1.00 3.76  ? 70  MET A CA  1 
ATOM   529  C C   . MET A 1 70  ? 8.355  29.059 45.617 1.00 6.08  ? 70  MET A C   1 
ATOM   530  O O   . MET A 1 70  ? 8.620  28.994 46.822 1.00 3.39  ? 70  MET A O   1 
ATOM   531  C CB  . MET A 1 70  ? 10.498 28.523 44.438 1.00 8.75  ? 70  MET A CB  1 
ATOM   532  C CG  . MET A 1 70  ? 10.081 27.236 43.717 1.00 11.70 ? 70  MET A CG  1 
ATOM   533  S SD  . MET A 1 70  ? 11.493 26.341 42.994 1.00 12.13 ? 70  MET A SD  1 
ATOM   534  C CE  . MET A 1 70  ? 12.857 27.471 43.398 1.00 9.01  ? 70  MET A CE  1 
ATOM   535  N N   . ASP A 1 71  ? 7.172  28.727 45.125 1.00 4.48  ? 71  ASP A N   1 
ATOM   536  C CA  . ASP A 1 71  ? 6.137  28.269 46.030 1.00 5.49  ? 71  ASP A CA  1 
ATOM   537  C C   . ASP A 1 71  ? 6.033  26.757 46.100 1.00 5.65  ? 71  ASP A C   1 
ATOM   538  O O   . ASP A 1 71  ? 6.906  26.031 45.604 1.00 7.59  ? 71  ASP A O   1 
ATOM   539  C CB  . ASP A 1 71  ? 4.793  28.895 45.645 1.00 6.99  ? 71  ASP A CB  1 
ATOM   540  C CG  . ASP A 1 71  ? 4.191  28.286 44.391 1.00 7.83  ? 71  ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 71  ? 4.756  27.307 43.863 1.00 7.60  ? 71  ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 71  ? 3.138  28.799 43.961 1.00 6.87  ? 71  ASP A OD2 1 
ATOM   543  N N   . GLU A 1 72  ? 4.948  26.296 46.718 1.00 7.68  ? 72  GLU A N   1 
ATOM   544  C CA  . GLU A 1 72  ? 4.709  24.877 46.941 1.00 8.00  ? 72  GLU A CA  1 
ATOM   545  C C   . GLU A 1 72  ? 4.225  24.089 45.729 1.00 13.87 ? 72  GLU A C   1 
ATOM   546  O O   . GLU A 1 72  ? 4.072  22.870 45.810 1.00 11.97 ? 72  GLU A O   1 
ATOM   547  C CB  . GLU A 1 72  ? 3.698  24.692 48.086 1.00 6.73  ? 72  GLU A CB  1 
ATOM   548  C CG  . GLU A 1 72  ? 2.226  24.897 47.690 1.00 11.82 ? 72  GLU A CG  1 
ATOM   549  C CD  . GLU A 1 72  ? 1.860  26.336 47.360 1.00 17.43 ? 72  GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 72  ? 0.710  26.563 46.930 1.00 18.34 ? 72  GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 72  ? 2.702  27.244 47.532 1.00 17.39 ? 72  GLU A OE2 1 
ATOM   552  N N   . ASN A 1 73  ? 3.989  24.763 44.608 1.00 10.32 ? 73  ASN A N   1 
ATOM   553  C CA  . ASN A 1 73  ? 3.511  24.055 43.429 1.00 9.17  ? 73  ASN A CA  1 
ATOM   554  C C   . ASN A 1 73  ? 4.278  24.382 42.160 1.00 8.10  ? 73  ASN A C   1 
ATOM   555  O O   . ASN A 1 73  ? 3.682  24.640 41.113 1.00 10.33 ? 73  ASN A O   1 
ATOM   556  C CB  . ASN A 1 73  ? 2.016  24.322 43.220 1.00 8.98  ? 73  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 73  ? 1.365  23.293 42.308 1.00 13.30 ? 73  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 73  ? 1.604  22.093 42.449 1.00 13.01 ? 73  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 73  ? 0.530  23.756 41.375 1.00 8.63  ? 73  ASN A ND2 1 
ATOM   560  N N   . TYR A 1 74  ? 5.603  24.360 42.270 1.00 7.85  ? 74  TYR A N   1 
ATOM   561  C CA  . TYR A 1 74  ? 6.503  24.613 41.153 1.00 6.36  ? 74  TYR A CA  1 
ATOM   562  C C   . TYR A 1 74  ? 6.338  25.967 40.464 1.00 8.47  ? 74  TYR A C   1 
ATOM   563  O O   . TYR A 1 74  ? 6.746  26.136 39.315 1.00 12.06 ? 74  TYR A O   1 
ATOM   564  C CB  . TYR A 1 74  ? 6.365  23.483 40.132 1.00 6.05  ? 74  TYR A CB  1 
ATOM   565  C CG  . TYR A 1 74  ? 6.252  22.120 40.780 1.00 12.05 ? 74  TYR A CG  1 
ATOM   566  C CD1 . TYR A 1 74  ? 5.002  21.572 41.081 1.00 17.40 ? 74  TYR A CD1 1 
ATOM   567  C CD2 . TYR A 1 74  ? 7.391  21.394 41.123 1.00 8.08  ? 74  TYR A CD2 1 
ATOM   568  C CE1 . TYR A 1 74  ? 4.889  20.331 41.710 1.00 22.71 ? 74  TYR A CE1 1 
ATOM   569  C CE2 . TYR A 1 74  ? 7.292  20.152 41.754 1.00 17.91 ? 74  TYR A CE2 1 
ATOM   570  C CZ  . TYR A 1 74  ? 6.038  19.626 42.043 1.00 22.74 ? 74  TYR A CZ  1 
ATOM   571  O OH  . TYR A 1 74  ? 5.928  18.392 42.652 1.00 31.05 ? 74  TYR A OH  1 
ATOM   572  N N   . ASN A 1 75  ? 5.725  26.932 41.144 1.00 4.19  ? 75  ASN A N   1 
ATOM   573  C CA  . ASN A 1 75  ? 5.602  28.256 40.547 1.00 6.35  ? 75  ASN A CA  1 
ATOM   574  C C   . ASN A 1 75  ? 6.869  29.000 40.975 1.00 5.62  ? 75  ASN A C   1 
ATOM   575  O O   . ASN A 1 75  ? 7.315  28.866 42.119 1.00 2.07  ? 75  ASN A O   1 
ATOM   576  C CB  . ASN A 1 75  ? 4.342  28.964 41.047 1.00 7.28  ? 75  ASN A CB  1 
ATOM   577  C CG  . ASN A 1 75  ? 3.070  28.279 40.580 1.00 10.75 ? 75  ASN A CG  1 
ATOM   578  O OD1 . ASN A 1 75  ? 2.188  27.971 41.383 1.00 13.27 ? 75  ASN A OD1 1 
ATOM   579  N ND2 . ASN A 1 75  ? 2.971  28.032 39.277 1.00 1.12  ? 75  ASN A ND2 1 
ATOM   580  N N   . ILE A 1 76  ? 7.454  29.759 40.054 1.00 4.52  ? 76  ILE A N   1 
ATOM   581  C CA  . ILE A 1 76  ? 8.690  30.489 40.337 1.00 4.16  ? 76  ILE A CA  1 
ATOM   582  C C   . ILE A 1 76  ? 8.706  31.889 39.745 1.00 5.57  ? 76  ILE A C   1 
ATOM   583  O O   . ILE A 1 76  ? 8.073  32.160 38.726 1.00 5.18  ? 76  ILE A O   1 
ATOM   584  C CB  . ILE A 1 76  ? 9.917  29.754 39.771 1.00 8.41  ? 76  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 76  ? 9.696  29.467 38.283 1.00 11.19 ? 76  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 76  ? 10.163 28.463 40.532 1.00 10.19 ? 76  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 76  ? 10.961 29.022 37.555 1.00 6.94  ? 76  ILE A CD1 1 
ATOM   588  N N   . GLY A 1 77  ? 9.455  32.771 40.393 1.00 3.03  ? 77  GLY A N   1 
ATOM   589  C CA  . GLY A 1 77  ? 9.565  34.138 39.932 1.00 2.58  ? 77  GLY A CA  1 
ATOM   590  C C   . GLY A 1 77  ? 10.954 34.633 40.266 1.00 5.49  ? 77  GLY A C   1 
ATOM   591  O O   . GLY A 1 77  ? 11.488 34.354 41.341 1.00 4.98  ? 77  GLY A O   1 
ATOM   592  N N   . SER A 1 78  ? 11.542 35.393 39.357 1.00 7.39  ? 78  SER A N   1 
ATOM   593  C CA  . SER A 1 78  ? 12.888 35.874 39.579 1.00 6.80  ? 78  SER A CA  1 
ATOM   594  C C   . SER A 1 78  ? 13.172 37.207 38.906 1.00 4.91  ? 78  SER A C   1 
ATOM   595  O O   . SER A 1 78  ? 12.640 37.507 37.834 1.00 4.54  ? 78  SER A O   1 
ATOM   596  C CB  . SER A 1 78  ? 13.881 34.822 39.054 1.00 5.12  ? 78  SER A CB  1 
ATOM   597  O OG  . SER A 1 78  ? 15.165 35.387 38.844 1.00 12.94 ? 78  SER A OG  1 
ATOM   598  N N   . VAL A 1 79  ? 13.997 38.017 39.557 1.00 4.69  ? 79  VAL A N   1 
ATOM   599  C CA  . VAL A 1 79  ? 14.425 39.281 38.976 1.00 3.45  ? 79  VAL A CA  1 
ATOM   600  C C   . VAL A 1 79  ? 15.923 39.359 39.222 1.00 4.89  ? 79  VAL A C   1 
ATOM   601  O O   . VAL A 1 79  ? 16.414 38.909 40.254 1.00 5.67  ? 79  VAL A O   1 
ATOM   602  C CB  . VAL A 1 79  ? 13.718 40.516 39.600 1.00 5.72  ? 79  VAL A CB  1 
ATOM   603  C CG1 . VAL A 1 79  ? 12.256 40.508 39.219 1.00 9.44  ? 79  VAL A CG1 1 
ATOM   604  C CG2 . VAL A 1 79  ? 13.883 40.527 41.126 1.00 3.34  ? 79  VAL A CG2 1 
ATOM   605  N N   . ALA A 1 80  ? 16.662 39.887 38.256 1.00 3.68  ? 80  ALA A N   1 
ATOM   606  C CA  . ALA A 1 80  ? 18.095 40.006 38.443 1.00 5.77  ? 80  ALA A CA  1 
ATOM   607  C C   . ALA A 1 80  ? 18.568 41.341 37.904 1.00 4.43  ? 80  ALA A C   1 
ATOM   608  O O   . ALA A 1 80  ? 18.039 41.848 36.916 1.00 7.81  ? 80  ALA A O   1 
ATOM   609  C CB  . ALA A 1 80  ? 18.830 38.855 37.755 1.00 3.28  ? 80  ALA A CB  1 
ATOM   610  N N   . CYS A 1 81  ? 19.558 41.903 38.586 1.00 6.39  ? 81  CYS A N   1 
ATOM   611  C CA  . CYS A 1 81  ? 20.144 43.184 38.216 1.00 9.58  ? 81  CYS A CA  1 
ATOM   612  C C   . CYS A 1 81  ? 19.060 44.239 38.026 1.00 9.79  ? 81  CYS A C   1 
ATOM   613  O O   . CYS A 1 81  ? 19.000 44.922 36.999 1.00 5.53  ? 81  CYS A O   1 
ATOM   614  C CB  . CYS A 1 81  ? 20.980 43.039 36.938 1.00 10.76 ? 81  CYS A CB  1 
ATOM   615  S SG  . CYS A 1 81  ? 22.126 44.424 36.645 1.00 13.21 ? 81  CYS A SG  1 
ATOM   616  N N   . MET A 1 82  ? 18.196 44.363 39.030 1.00 7.72  ? 82  MET A N   1 
ATOM   617  C CA  . MET A 1 82  ? 17.124 45.352 38.991 1.00 6.91  ? 82  MET A CA  1 
ATOM   618  C C   . MET A 1 82  ? 17.492 46.500 39.912 1.00 3.65  ? 82  MET A C   1 
ATOM   619  O O   . MET A 1 82  ? 17.941 46.285 41.033 1.00 5.41  ? 82  MET A O   1 
ATOM   620  C CB  . MET A 1 82  ? 15.795 44.732 39.439 1.00 6.39  ? 82  MET A CB  1 
ATOM   621  C CG  . MET A 1 82  ? 14.629 45.724 39.458 1.00 3.40  ? 82  MET A CG  1 
ATOM   622  S SD  . MET A 1 82  ? 13.031 44.928 39.778 1.00 8.65  ? 82  MET A SD  1 
ATOM   623  C CE  . MET A 1 82  ? 13.240 44.402 41.517 1.00 7.30  ? 82  MET A CE  1 
ATOM   624  N N   . GLU A 1 83  ? 17.309 47.722 39.435 1.00 5.79  ? 83  GLU A N   1 
ATOM   625  C CA  . GLU A 1 83  ? 17.638 48.891 40.231 1.00 8.57  ? 83  GLU A CA  1 
ATOM   626  C C   . GLU A 1 83  ? 16.397 49.649 40.666 1.00 8.93  ? 83  GLU A C   1 
ATOM   627  O O   . GLU A 1 83  ? 15.313 49.474 40.104 1.00 9.74  ? 83  GLU A O   1 
ATOM   628  C CB  . GLU A 1 83  ? 18.503 49.876 39.433 1.00 8.35  ? 83  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 83  ? 19.821 49.356 38.929 1.00 15.40 ? 83  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 83  ? 20.476 50.344 37.980 1.00 20.51 ? 83  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 83  ? 20.985 51.383 38.450 1.00 15.21 ? 83  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 83  ? 20.459 50.087 36.757 1.00 22.14 ? 83  GLU A OE2 1 
ATOM   633  N N   . HIS A 1 84  ? 16.586 50.483 41.685 1.00 8.73  ? 84  HIS A N   1 
ATOM   634  C CA  . HIS A 1 84  ? 15.561 51.373 42.204 1.00 10.58 ? 84  HIS A CA  1 
ATOM   635  C C   . HIS A 1 84  ? 14.322 50.802 42.892 1.00 8.75  ? 84  HIS A C   1 
ATOM   636  O O   . HIS A 1 84  ? 13.438 51.563 43.280 1.00 12.21 ? 84  HIS A O   1 
ATOM   637  C CB  . HIS A 1 84  ? 15.141 52.333 41.082 1.00 9.00  ? 84  HIS A CB  1 
ATOM   638  C CG  . HIS A 1 84  ? 16.298 52.958 40.359 1.00 8.50  ? 84  HIS A CG  1 
ATOM   639  N ND1 . HIS A 1 84  ? 17.329 53.598 41.015 1.00 13.84 ? 84  HIS A ND1 1 
ATOM   640  C CD2 . HIS A 1 84  ? 16.576 53.058 39.036 1.00 8.78  ? 84  HIS A CD2 1 
ATOM   641  C CE1 . HIS A 1 84  ? 18.191 54.065 40.128 1.00 10.55 ? 84  HIS A CE1 1 
ATOM   642  N NE2 . HIS A 1 84  ? 17.757 53.752 38.920 1.00 6.33  ? 84  HIS A NE2 1 
ATOM   643  N N   . ILE A 1 85  ? 14.243 49.485 43.047 1.00 8.58  ? 85  ILE A N   1 
ATOM   644  C CA  . ILE A 1 85  ? 13.101 48.875 43.716 1.00 8.29  ? 85  ILE A CA  1 
ATOM   645  C C   . ILE A 1 85  ? 13.595 48.207 44.993 1.00 8.90  ? 85  ILE A C   1 
ATOM   646  O O   . ILE A 1 85  ? 14.379 47.258 44.951 1.00 8.26  ? 85  ILE A O   1 
ATOM   647  C CB  . ILE A 1 85  ? 12.421 47.818 42.824 1.00 10.87 ? 85  ILE A CB  1 
ATOM   648  C CG1 . ILE A 1 85  ? 11.982 48.463 41.509 1.00 14.69 ? 85  ILE A CG1 1 
ATOM   649  C CG2 . ILE A 1 85  ? 11.212 47.224 43.545 1.00 9.24  ? 85  ILE A CG2 1 
ATOM   650  C CD1 . ILE A 1 85  ? 11.019 49.614 41.674 1.00 9.90  ? 85  ILE A CD1 1 
ATOM   651  N N   . LYS A 1 86  ? 13.136 48.710 46.128 1.00 4.95  ? 86  LYS A N   1 
ATOM   652  C CA  . LYS A 1 86  ? 13.569 48.184 47.409 1.00 7.04  ? 86  LYS A CA  1 
ATOM   653  C C   . LYS A 1 86  ? 13.190 46.737 47.705 1.00 7.80  ? 86  LYS A C   1 
ATOM   654  O O   . LYS A 1 86  ? 13.910 46.046 48.422 1.00 7.01  ? 86  LYS A O   1 
ATOM   655  C CB  . LYS A 1 86  ? 13.060 49.087 48.532 1.00 8.79  ? 86  LYS A CB  1 
ATOM   656  C CG  . LYS A 1 86  ? 13.626 48.736 49.896 1.00 13.67 ? 86  LYS A CG  1 
ATOM   657  C CD  . LYS A 1 86  ? 13.576 49.924 50.839 1.00 23.06 ? 86  LYS A CD  1 
ATOM   658  C CE  . LYS A 1 86  ? 12.158 50.366 51.122 1.00 26.80 ? 86  LYS A CE  1 
ATOM   659  N NZ  . LYS A 1 86  ? 12.165 51.585 51.978 1.00 33.99 ? 86  LYS A NZ  1 
ATOM   660  N N   . ASN A 1 87  ? 12.076 46.263 47.157 1.00 6.43  ? 87  ASN A N   1 
ATOM   661  C CA  . ASN A 1 87  ? 11.655 44.891 47.444 1.00 5.95  ? 87  ASN A CA  1 
ATOM   662  C C   . ASN A 1 87  ? 11.654 43.966 46.232 1.00 6.94  ? 87  ASN A C   1 
ATOM   663  O O   . ASN A 1 87  ? 10.596 43.574 45.738 1.00 6.04  ? 87  ASN A O   1 
ATOM   664  C CB  . ASN A 1 87  ? 10.269 44.911 48.091 1.00 4.67  ? 87  ASN A CB  1 
ATOM   665  C CG  . ASN A 1 87  ? 10.237 45.757 49.355 1.00 11.71 ? 87  ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 87  ? 10.793 45.372 50.389 1.00 8.64  ? 87  ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 87  ? 9.607  46.923 49.271 1.00 4.42  ? 87  ASN A ND2 1 
ATOM   668  N N   . PRO A 1 88  ? 12.847 43.573 45.757 1.00 8.23  ? 88  PRO A N   1 
ATOM   669  C CA  . PRO A 1 88  ? 12.892 42.683 44.591 1.00 8.77  ? 88  PRO A CA  1 
ATOM   670  C C   . PRO A 1 88  ? 12.166 41.350 44.777 1.00 8.99  ? 88  PRO A C   1 
ATOM   671  O O   . PRO A 1 88  ? 11.622 40.802 43.816 1.00 7.70  ? 88  PRO A O   1 
ATOM   672  C CB  . PRO A 1 88  ? 14.394 42.506 44.340 1.00 4.76  ? 88  PRO A CB  1 
ATOM   673  C CG  . PRO A 1 88  ? 15.014 42.708 45.712 1.00 4.14  ? 88  PRO A CG  1 
ATOM   674  C CD  . PRO A 1 88  ? 14.206 43.869 46.258 1.00 9.67  ? 88  PRO A CD  1 
ATOM   675  N N   . ILE A 1 89  ? 12.142 40.830 46.002 1.00 7.13  ? 89  ILE A N   1 
ATOM   676  C CA  . ILE A 1 89  ? 11.466 39.549 46.227 1.00 8.42  ? 89  ILE A CA  1 
ATOM   677  C C   . ILE A 1 89  ? 9.984  39.648 45.849 1.00 8.90  ? 89  ILE A C   1 
ATOM   678  O O   . ILE A 1 89  ? 9.391  38.694 45.339 1.00 5.31  ? 89  ILE A O   1 
ATOM   679  C CB  . ILE A 1 89  ? 11.608 39.058 47.705 1.00 8.73  ? 89  ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 89  ? 11.175 37.586 47.799 1.00 4.39  ? 89  ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 89  ? 10.773 39.914 48.648 1.00 3.73  ? 89  ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 89  ? 12.034 36.644 46.924 1.00 3.15  ? 89  ILE A CD1 1 
ATOM   683  N N   . SER A 1 90  ? 9.389  40.813 46.084 1.00 6.84  ? 90  SER A N   1 
ATOM   684  C CA  . SER A 1 90  ? 7.985  41.009 45.763 1.00 2.06  ? 90  SER A CA  1 
ATOM   685  C C   . SER A 1 90  ? 7.791  41.206 44.264 1.00 5.81  ? 90  SER A C   1 
ATOM   686  O O   . SER A 1 90  ? 6.746  40.856 43.715 1.00 6.81  ? 90  SER A O   1 
ATOM   687  C CB  . SER A 1 90  ? 7.425  42.202 46.532 1.00 6.67  ? 90  SER A CB  1 
ATOM   688  O OG  . SER A 1 90  ? 7.466  41.943 47.927 1.00 12.89 ? 90  SER A OG  1 
ATOM   689  N N   . VAL A 1 91  ? 8.785  41.778 43.598 1.00 6.09  ? 91  VAL A N   1 
ATOM   690  C CA  . VAL A 1 91  ? 8.668  41.958 42.158 1.00 6.14  ? 91  VAL A CA  1 
ATOM   691  C C   . VAL A 1 91  ? 8.790  40.562 41.566 1.00 3.93  ? 91  VAL A C   1 
ATOM   692  O O   . VAL A 1 91  ? 8.091  40.228 40.622 1.00 3.84  ? 91  VAL A O   1 
ATOM   693  C CB  . VAL A 1 91  ? 9.778  42.863 41.601 1.00 5.53  ? 91  VAL A CB  1 
ATOM   694  C CG1 . VAL A 1 91  ? 9.614  43.004 40.098 1.00 5.68  ? 91  VAL A CG1 1 
ATOM   695  C CG2 . VAL A 1 91  ? 9.700  44.236 42.265 1.00 2.91  ? 91  VAL A CG2 1 
ATOM   696  N N   . ALA A 1 92  ? 9.674  39.749 42.145 1.00 3.96  ? 92  ALA A N   1 
ATOM   697  C CA  . ALA A 1 92  ? 9.864  38.376 41.683 1.00 4.89  ? 92  ALA A CA  1 
ATOM   698  C C   . ALA A 1 92  ? 8.539  37.627 41.804 1.00 7.68  ? 92  ALA A C   1 
ATOM   699  O O   . ALA A 1 92  ? 8.151  36.873 40.908 1.00 5.25  ? 92  ALA A O   1 
ATOM   700  C CB  . ALA A 1 92  ? 10.940 37.678 42.521 1.00 5.71  ? 92  ALA A CB  1 
ATOM   701  N N   . ARG A 1 93  ? 7.849  37.832 42.921 1.00 6.62  ? 93  ARG A N   1 
ATOM   702  C CA  . ARG A 1 93  ? 6.567  37.170 43.128 1.00 6.24  ? 93  ARG A CA  1 
ATOM   703  C C   . ARG A 1 93  ? 5.580  37.628 42.050 1.00 5.54  ? 93  ARG A C   1 
ATOM   704  O O   . ARG A 1 93  ? 4.773  36.838 41.555 1.00 7.21  ? 93  ARG A O   1 
ATOM   705  C CB  . ARG A 1 93  ? 6.021  37.479 44.526 1.00 3.92  ? 93  ARG A CB  1 
ATOM   706  C CG  . ARG A 1 93  ? 4.635  36.906 44.746 1.00 5.25  ? 93  ARG A CG  1 
ATOM   707  C CD  . ARG A 1 93  ? 4.231  36.898 46.209 1.00 8.71  ? 93  ARG A CD  1 
ATOM   708  N NE  . ARG A 1 93  ? 2.946  36.226 46.339 1.00 7.44  ? 93  ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 93  ? 2.357  35.924 47.488 1.00 11.70 ? 93  ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 93  ? 2.933  36.231 48.645 1.00 8.59  ? 93  ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 93  ? 1.190  35.301 47.465 1.00 10.10 ? 93  ARG A NH2 1 
ATOM   712  N N   . ALA A 1 94  ? 5.653  38.903 41.680 1.00 7.06  ? 94  ALA A N   1 
ATOM   713  C CA  . ALA A 1 94  ? 4.774  39.428 40.642 1.00 7.91  ? 94  ALA A CA  1 
ATOM   714  C C   . ALA A 1 94  ? 5.128  38.777 39.300 1.00 7.93  ? 94  ALA A C   1 
ATOM   715  O O   . ALA A 1 94  ? 4.242  38.441 38.524 1.00 10.50 ? 94  ALA A O   1 
ATOM   716  C CB  . ALA A 1 94  ? 4.897  40.953 40.553 1.00 6.45  ? 94  ALA A CB  1 
ATOM   717  N N   . VAL A 1 95  ? 6.419  38.602 39.028 1.00 4.65  ? 95  VAL A N   1 
ATOM   718  C CA  . VAL A 1 95  ? 6.847  37.954 37.783 1.00 6.45  ? 95  VAL A CA  1 
ATOM   719  C C   . VAL A 1 95  ? 6.196  36.567 37.742 1.00 5.92  ? 95  VAL A C   1 
ATOM   720  O O   . VAL A 1 95  ? 5.647  36.136 36.725 1.00 7.86  ? 95  VAL A O   1 
ATOM   721  C CB  . VAL A 1 95  ? 8.396  37.800 37.730 1.00 8.48  ? 95  VAL A CB  1 
ATOM   722  C CG1 . VAL A 1 95  ? 8.804  36.905 36.565 1.00 4.76  ? 95  VAL A CG1 1 
ATOM   723  C CG2 . VAL A 1 95  ? 9.051  39.174 37.579 1.00 4.75  ? 95  VAL A CG2 1 
ATOM   724  N N   . MET A 1 96  ? 6.258  35.875 38.868 1.00 4.63  ? 96  MET A N   1 
ATOM   725  C CA  . MET A 1 96  ? 5.668  34.547 38.982 1.00 3.40  ? 96  MET A CA  1 
ATOM   726  C C   . MET A 1 96  ? 4.160  34.532 38.747 1.00 6.49  ? 96  MET A C   1 
ATOM   727  O O   . MET A 1 96  ? 3.665  33.785 37.913 1.00 7.95  ? 96  MET A O   1 
ATOM   728  C CB  . MET A 1 96  ? 5.951  33.988 40.377 1.00 1.34  ? 96  MET A CB  1 
ATOM   729  C CG  . MET A 1 96  ? 5.261  32.666 40.694 1.00 3.61  ? 96  MET A CG  1 
ATOM   730  S SD  . MET A 1 96  ? 5.895  31.978 42.250 1.00 7.56  ? 96  MET A SD  1 
ATOM   731  C CE  . MET A 1 96  ? 4.992  32.995 43.419 1.00 4.44  ? 96  MET A CE  1 
ATOM   732  N N   . GLU A 1 97  ? 3.436  35.359 39.491 1.00 7.49  ? 97  GLU A N   1 
ATOM   733  C CA  . GLU A 1 97  ? 1.976  35.382 39.409 1.00 9.84  ? 97  GLU A CA  1 
ATOM   734  C C   . GLU A 1 97  ? 1.332  36.174 38.280 1.00 11.13 ? 97  GLU A C   1 
ATOM   735  O O   . GLU A 1 97  ? 0.211  35.866 37.881 1.00 7.68  ? 97  GLU A O   1 
ATOM   736  C CB  . GLU A 1 97  ? 1.395  35.914 40.721 1.00 7.74  ? 97  GLU A CB  1 
ATOM   737  C CG  . GLU A 1 97  ? 2.029  35.334 41.966 1.00 11.56 ? 97  GLU A CG  1 
ATOM   738  C CD  . GLU A 1 97  ? 1.465  35.921 43.245 1.00 14.20 ? 97  GLU A CD  1 
ATOM   739  O OE1 . GLU A 1 97  ? 1.125  37.123 43.256 1.00 13.90 ? 97  GLU A OE1 1 
ATOM   740  O OE2 . GLU A 1 97  ? 1.382  35.183 44.236 1.00 14.59 ? 97  GLU A OE2 1 
ATOM   741  N N   . LYS A 1 98  ? 2.030  37.176 37.763 1.00 5.86  ? 98  LYS A N   1 
ATOM   742  C CA  . LYS A 1 98  ? 1.433  38.053 36.759 1.00 7.68  ? 98  LYS A CA  1 
ATOM   743  C C   . LYS A 1 98  ? 1.930  37.966 35.328 1.00 8.96  ? 98  LYS A C   1 
ATOM   744  O O   . LYS A 1 98  ? 1.420  38.670 34.463 1.00 9.57  ? 98  LYS A O   1 
ATOM   745  C CB  . LYS A 1 98  ? 1.571  39.504 37.226 1.00 4.84  ? 98  LYS A CB  1 
ATOM   746  C CG  . LYS A 1 98  ? 1.094  39.767 38.641 1.00 11.60 ? 98  LYS A CG  1 
ATOM   747  C CD  . LYS A 1 98  ? -0.401 39.577 38.773 1.00 18.05 ? 98  LYS A CD  1 
ATOM   748  C CE  . LYS A 1 98  ? -0.883 40.013 40.152 1.00 29.36 ? 98  LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 98  ? -2.361 39.858 40.301 1.00 37.35 ? 98  LYS A NZ  1 
ATOM   750  N N   . THR A 1 99  ? 2.911  37.117 35.068 1.00 9.55  ? 99  THR A N   1 
ATOM   751  C CA  . THR A 1 99  ? 3.452  37.021 33.718 1.00 7.90  ? 99  THR A CA  1 
ATOM   752  C C   . THR A 1 99  ? 3.609  35.582 33.283 1.00 7.87  ? 99  THR A C   1 
ATOM   753  O O   . THR A 1 99  ? 3.547  34.666 34.096 1.00 9.09  ? 99  THR A O   1 
ATOM   754  C CB  . THR A 1 99  ? 4.866  37.630 33.617 1.00 7.75  ? 99  THR A CB  1 
ATOM   755  O OG1 . THR A 1 99  ? 5.810  36.705 34.173 1.00 6.41  ? 99  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 99  ? 4.955  38.950 34.364 1.00 10.19 ? 99  THR A CG2 1 
ATOM   757  N N   . PRO A 1 100 ? 3.837  35.375 31.981 1.00 14.39 ? 100 PRO A N   1 
ATOM   758  C CA  . PRO A 1 100 ? 4.029  34.053 31.380 1.00 14.23 ? 100 PRO A CA  1 
ATOM   759  C C   . PRO A 1 100 ? 5.510  33.669 31.488 1.00 14.10 ? 100 PRO A C   1 
ATOM   760  O O   . PRO A 1 100 ? 5.929  32.619 30.991 1.00 8.95  ? 100 PRO A O   1 
ATOM   761  C CB  . PRO A 1 100 ? 3.625  34.267 29.917 1.00 12.62 ? 100 PRO A CB  1 
ATOM   762  C CG  . PRO A 1 100 ? 2.814  35.523 29.933 1.00 25.71 ? 100 PRO A CG  1 
ATOM   763  C CD  . PRO A 1 100 ? 3.534  36.367 30.939 1.00 13.56 ? 100 PRO A CD  1 
ATOM   764  N N   . HIS A 1 101 ? 6.296  34.530 32.130 1.00 6.34  ? 101 HIS A N   1 
ATOM   765  C CA  . HIS A 1 101 ? 7.736  34.294 32.287 1.00 8.14  ? 101 HIS A CA  1 
ATOM   766  C C   . HIS A 1 101 ? 8.126  33.996 33.727 1.00 7.39  ? 101 HIS A C   1 
ATOM   767  O O   . HIS A 1 101 ? 7.310  34.147 34.630 1.00 8.66  ? 101 HIS A O   1 
ATOM   768  C CB  . HIS A 1 101 ? 8.521  35.518 31.805 1.00 6.11  ? 101 HIS A CB  1 
ATOM   769  C CG  . HIS A 1 101 ? 8.155  35.956 30.422 1.00 11.01 ? 101 HIS A CG  1 
ATOM   770  N ND1 . HIS A 1 101 ? 8.071  35.076 29.364 1.00 9.15  ? 101 HIS A ND1 1 
ATOM   771  C CD2 . HIS A 1 101 ? 7.853  37.177 29.925 1.00 8.19  ? 101 HIS A CD2 1 
ATOM   772  C CE1 . HIS A 1 101 ? 7.733  35.740 28.273 1.00 8.67  ? 101 HIS A CE1 1 
ATOM   773  N NE2 . HIS A 1 101 ? 7.594  37.016 28.586 1.00 6.92  ? 101 HIS A NE2 1 
ATOM   774  N N   . VAL A 1 102 ? 9.364  33.551 33.945 1.00 2.24  ? 102 VAL A N   1 
ATOM   775  C CA  . VAL A 1 102 ? 9.803  33.284 35.313 1.00 1.69  ? 102 VAL A CA  1 
ATOM   776  C C   . VAL A 1 102 ? 10.994 34.137 35.700 1.00 5.20  ? 102 VAL A C   1 
ATOM   777  O O   . VAL A 1 102 ? 11.388 34.156 36.862 1.00 4.87  ? 102 VAL A O   1 
ATOM   778  C CB  . VAL A 1 102 ? 10.173 31.798 35.562 1.00 2.56  ? 102 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 102 ? 8.975  30.905 35.268 1.00 1.12  ? 102 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 102 ? 11.389 31.407 34.749 1.00 6.76  ? 102 VAL A CG2 1 
ATOM   781  N N   . MET A 1 103 ? 11.564 34.854 34.734 1.00 2.89  ? 103 MET A N   1 
ATOM   782  C CA  . MET A 1 103 ? 12.711 35.687 35.041 1.00 6.66  ? 103 MET A CA  1 
ATOM   783  C C   . MET A 1 103 ? 12.809 36.918 34.150 1.00 4.84  ? 103 MET A C   1 
ATOM   784  O O   . MET A 1 103 ? 12.744 36.820 32.932 1.00 4.83  ? 103 MET A O   1 
ATOM   785  C CB  . MET A 1 103 ? 13.997 34.868 34.923 1.00 3.79  ? 103 MET A CB  1 
ATOM   786  C CG  . MET A 1 103 ? 15.261 35.640 35.263 1.00 7.91  ? 103 MET A CG  1 
ATOM   787  S SD  . MET A 1 103 ? 16.724 34.581 35.178 1.00 10.35 ? 103 MET A SD  1 
ATOM   788  C CE  . MET A 1 103 ? 17.846 35.413 36.267 1.00 8.28  ? 103 MET A CE  1 
ATOM   789  N N   . LEU A 1 104 ? 12.948 38.074 34.788 1.00 7.05  ? 104 LEU A N   1 
ATOM   790  C CA  . LEU A 1 104 ? 13.102 39.348 34.094 1.00 5.98  ? 104 LEU A CA  1 
ATOM   791  C C   . LEU A 1 104 ? 14.356 39.986 34.676 1.00 5.82  ? 104 LEU A C   1 
ATOM   792  O O   . LEU A 1 104 ? 14.604 39.893 35.878 1.00 4.77  ? 104 LEU A O   1 
ATOM   793  C CB  . LEU A 1 104 ? 11.909 40.266 34.362 1.00 9.95  ? 104 LEU A CB  1 
ATOM   794  C CG  . LEU A 1 104 ? 10.540 39.809 33.850 1.00 7.59  ? 104 LEU A CG  1 
ATOM   795  C CD1 . LEU A 1 104 ? 9.495  40.853 34.209 1.00 9.26  ? 104 LEU A CD1 1 
ATOM   796  C CD2 . LEU A 1 104 ? 10.593 39.618 32.336 1.00 12.55 ? 104 LEU A CD2 1 
ATOM   797  N N   . VAL A 1 105 ? 15.148 40.640 33.835 1.00 4.99  ? 105 VAL A N   1 
ATOM   798  C CA  . VAL A 1 105 ? 16.364 41.275 34.327 1.00 8.74  ? 105 VAL A CA  1 
ATOM   799  C C   . VAL A 1 105 ? 16.519 42.704 33.819 1.00 11.26 ? 105 VAL A C   1 
ATOM   800  O O   . VAL A 1 105 ? 15.854 43.116 32.862 1.00 5.22  ? 105 VAL A O   1 
ATOM   801  C CB  . VAL A 1 105 ? 17.619 40.473 33.908 1.00 6.24  ? 105 VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 105 ? 17.414 38.981 34.221 1.00 7.06  ? 105 VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 105 ? 17.904 40.670 32.418 1.00 9.32  ? 105 VAL A CG2 1 
ATOM   804  N N   . GLY A 1 106 ? 17.401 43.445 34.481 1.00 8.36  ? 106 GLY A N   1 
ATOM   805  C CA  . GLY A 1 106 ? 17.704 44.816 34.101 1.00 10.22 ? 106 GLY A CA  1 
ATOM   806  C C   . GLY A 1 106 ? 16.538 45.775 33.959 1.00 6.84  ? 106 GLY A C   1 
ATOM   807  O O   . GLY A 1 106 ? 15.587 45.720 34.728 1.00 6.76  ? 106 GLY A O   1 
ATOM   808  N N   . ASP A 1 107 ? 16.619 46.657 32.962 1.00 8.91  ? 107 ASP A N   1 
ATOM   809  C CA  . ASP A 1 107 ? 15.574 47.644 32.717 1.00 12.24 ? 107 ASP A CA  1 
ATOM   810  C C   . ASP A 1 107 ? 14.184 47.013 32.650 1.00 8.01  ? 107 ASP A C   1 
ATOM   811  O O   . ASP A 1 107 ? 13.229 47.561 33.191 1.00 10.33 ? 107 ASP A O   1 
ATOM   812  C CB  . ASP A 1 107 ? 15.850 48.395 31.410 1.00 13.80 ? 107 ASP A CB  1 
ATOM   813  C CG  . ASP A 1 107 ? 17.148 49.175 31.442 1.00 17.46 ? 107 ASP A CG  1 
ATOM   814  O OD1 . ASP A 1 107 ? 17.558 49.680 30.380 1.00 19.17 ? 107 ASP A OD1 1 
ATOM   815  O OD2 . ASP A 1 107 ? 17.756 49.289 32.524 1.00 23.22 ? 107 ASP A OD2 1 
ATOM   816  N N   . GLY A 1 108 ? 14.083 45.865 31.982 1.00 6.01  ? 108 GLY A N   1 
ATOM   817  C CA  . GLY A 1 108 ? 12.802 45.184 31.846 1.00 6.99  ? 108 GLY A CA  1 
ATOM   818  C C   . GLY A 1 108 ? 12.178 44.803 33.177 1.00 8.72  ? 108 GLY A C   1 
ATOM   819  O O   . GLY A 1 108 ? 10.959 44.850 33.344 1.00 5.85  ? 108 GLY A O   1 
ATOM   820  N N   . ALA A 1 109 ? 13.014 44.422 34.134 1.00 10.44 ? 109 ALA A N   1 
ATOM   821  C CA  . ALA A 1 109 ? 12.522 44.052 35.447 1.00 10.43 ? 109 ALA A CA  1 
ATOM   822  C C   . ALA A 1 109 ? 11.974 45.304 36.129 1.00 9.02  ? 109 ALA A C   1 
ATOM   823  O O   . ALA A 1 109 ? 10.905 45.270 36.735 1.00 5.40  ? 109 ALA A O   1 
ATOM   824  C CB  . ALA A 1 109 ? 13.647 43.435 36.281 1.00 10.11 ? 109 ALA A CB  1 
ATOM   825  N N   . LEU A 1 110 ? 12.702 46.413 36.016 1.00 8.94  ? 110 LEU A N   1 
ATOM   826  C CA  . LEU A 1 110 ? 12.258 47.670 36.624 1.00 6.81  ? 110 LEU A CA  1 
ATOM   827  C C   . LEU A 1 110 ? 10.956 48.140 35.984 1.00 5.62  ? 110 LEU A C   1 
ATOM   828  O O   . LEU A 1 110 ? 10.023 48.540 36.674 1.00 6.35  ? 110 LEU A O   1 
ATOM   829  C CB  . LEU A 1 110 ? 13.326 48.766 36.462 1.00 6.46  ? 110 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 110 ? 12.919 50.183 36.903 1.00 9.08  ? 110 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 110 ? 12.508 50.187 38.369 1.00 8.32  ? 110 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 110 ? 14.075 51.135 36.678 1.00 11.07 ? 110 LEU A CD2 1 
ATOM   833  N N   . GLU A 1 111 ? 10.896 48.096 34.657 1.00 4.88  ? 111 GLU A N   1 
ATOM   834  C CA  . GLU A 1 111 ? 9.696  48.535 33.955 1.00 10.38 ? 111 GLU A CA  1 
ATOM   835  C C   . GLU A 1 111 ? 8.492  47.706 34.402 1.00 10.88 ? 111 GLU A C   1 
ATOM   836  O O   . GLU A 1 111 ? 7.402  48.236 34.611 1.00 6.99  ? 111 GLU A O   1 
ATOM   837  C CB  . GLU A 1 111 ? 9.901  48.421 32.441 1.00 13.99 ? 111 GLU A CB  1 
ATOM   838  C CG  . GLU A 1 111 ? 8.638  48.622 31.613 1.00 26.69 ? 111 GLU A CG  1 
ATOM   839  C CD  . GLU A 1 111 ? 8.925  48.692 30.122 1.00 37.58 ? 111 GLU A CD  1 
ATOM   840  O OE1 . GLU A 1 111 ? 9.204  49.802 29.620 1.00 39.56 ? 111 GLU A OE1 1 
ATOM   841  O OE2 . GLU A 1 111 ? 8.886  47.634 29.456 1.00 39.61 ? 111 GLU A OE2 1 
ATOM   842  N N   . PHE A 1 112 ? 8.687  46.404 34.567 1.00 2.79  ? 112 PHE A N   1 
ATOM   843  C CA  . PHE A 1 112 ? 7.584  45.570 35.009 1.00 7.52  ? 112 PHE A CA  1 
ATOM   844  C C   . PHE A 1 112 ? 7.214  45.969 36.439 1.00 6.34  ? 112 PHE A C   1 
ATOM   845  O O   . PHE A 1 112 ? 6.040  46.168 36.757 1.00 6.05  ? 112 PHE A O   1 
ATOM   846  C CB  . PHE A 1 112 ? 7.966  44.089 34.954 1.00 3.99  ? 112 PHE A CB  1 
ATOM   847  C CG  . PHE A 1 112 ? 6.970  43.191 35.612 1.00 7.63  ? 112 PHE A CG  1 
ATOM   848  C CD1 . PHE A 1 112 ? 5.685  43.064 35.104 1.00 5.88  ? 112 PHE A CD1 1 
ATOM   849  C CD2 . PHE A 1 112 ? 7.315  42.475 36.755 1.00 6.59  ? 112 PHE A CD2 1 
ATOM   850  C CE1 . PHE A 1 112 ? 4.756  42.234 35.716 1.00 8.43  ? 112 PHE A CE1 1 
ATOM   851  C CE2 . PHE A 1 112 ? 6.397  41.645 37.373 1.00 7.62  ? 112 PHE A CE2 1 
ATOM   852  C CZ  . PHE A 1 112 ? 5.113  41.521 36.854 1.00 2.39  ? 112 PHE A CZ  1 
ATOM   853  N N   . ALA A 1 113 ? 8.214  46.102 37.302 1.00 8.47  ? 113 ALA A N   1 
ATOM   854  C CA  . ALA A 1 113 ? 7.946  46.484 38.683 1.00 6.24  ? 113 ALA A CA  1 
ATOM   855  C C   . ALA A 1 113 ? 7.097  47.752 38.741 1.00 9.89  ? 113 ALA A C   1 
ATOM   856  O O   . ALA A 1 113 ? 6.108  47.811 39.469 1.00 6.57  ? 113 ALA A O   1 
ATOM   857  C CB  . ALA A 1 113 ? 9.248  46.701 39.432 1.00 12.08 ? 113 ALA A CB  1 
ATOM   858  N N   . LEU A 1 114 ? 7.485  48.767 37.972 1.00 8.10  ? 114 LEU A N   1 
ATOM   859  C CA  . LEU A 1 114 ? 6.743  50.028 37.959 1.00 9.66  ? 114 LEU A CA  1 
ATOM   860  C C   . LEU A 1 114 ? 5.305  49.823 37.476 1.00 9.25  ? 114 LEU A C   1 
ATOM   861  O O   . LEU A 1 114 ? 4.373  50.442 37.992 1.00 8.35  ? 114 LEU A O   1 
ATOM   862  C CB  . LEU A 1 114 ? 7.464  51.051 37.070 1.00 12.67 ? 114 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 114 ? 8.878  51.428 37.542 1.00 11.75 ? 114 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 114 ? 9.550  52.340 36.526 1.00 11.51 ? 114 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 114 ? 8.797  52.113 38.903 1.00 9.39  ? 114 LEU A CD2 1 
ATOM   866  N N   . SER A 1 115 ? 5.127  48.947 36.489 1.00 7.23  ? 115 SER A N   1 
ATOM   867  C CA  . SER A 1 115 ? 3.799  48.665 35.948 1.00 8.44  ? 115 SER A CA  1 
ATOM   868  C C   . SER A 1 115 ? 2.933  47.987 36.996 1.00 10.09 ? 115 SER A C   1 
ATOM   869  O O   . SER A 1 115 ? 1.702  48.005 36.912 1.00 9.49  ? 115 SER A O   1 
ATOM   870  C CB  . SER A 1 115 ? 3.892  47.759 34.717 1.00 9.24  ? 115 SER A CB  1 
ATOM   871  O OG  . SER A 1 115 ? 4.152  46.411 35.095 1.00 12.28 ? 115 SER A OG  1 
ATOM   872  N N   . GLN A 1 116 ? 3.578  47.376 37.982 1.00 7.35  ? 116 GLN A N   1 
ATOM   873  C CA  . GLN A 1 116 ? 2.857  46.693 39.049 1.00 8.81  ? 116 GLN A CA  1 
ATOM   874  C C   . GLN A 1 116 ? 2.637  47.589 40.260 1.00 12.79 ? 116 GLN A C   1 
ATOM   875  O O   . GLN A 1 116 ? 2.131  47.142 41.292 1.00 13.23 ? 116 GLN A O   1 
ATOM   876  C CB  . GLN A 1 116 ? 3.610  45.428 39.467 1.00 11.53 ? 116 GLN A CB  1 
ATOM   877  C CG  . GLN A 1 116 ? 3.580  44.339 38.409 1.00 11.78 ? 116 GLN A CG  1 
ATOM   878  C CD  . GLN A 1 116 ? 2.171  43.891 38.089 1.00 11.84 ? 116 GLN A CD  1 
ATOM   879  O OE1 . GLN A 1 116 ? 1.473  43.358 38.940 1.00 20.95 ? 116 GLN A OE1 1 
ATOM   880  N NE2 . GLN A 1 116 ? 1.747  44.111 36.855 1.00 15.59 ? 116 GLN A NE2 1 
ATOM   881  N N   . GLY A 1 117 ? 3.031  48.851 40.136 1.00 13.70 ? 117 GLY A N   1 
ATOM   882  C CA  . GLY A 1 117 ? 2.834  49.786 41.228 1.00 12.46 ? 117 GLY A CA  1 
ATOM   883  C C   . GLY A 1 117 ? 3.973  49.937 42.217 1.00 14.77 ? 117 GLY A C   1 
ATOM   884  O O   . GLY A 1 117 ? 3.823  50.656 43.214 1.00 7.03  ? 117 GLY A O   1 
ATOM   885  N N   . PHE A 1 118 ? 5.098  49.266 41.969 1.00 11.41 ? 118 PHE A N   1 
ATOM   886  C CA  . PHE A 1 118 ? 6.232  49.393 42.875 1.00 11.16 ? 118 PHE A CA  1 
ATOM   887  C C   . PHE A 1 118 ? 6.788  50.796 42.667 1.00 10.90 ? 118 PHE A C   1 
ATOM   888  O O   . PHE A 1 118 ? 6.691  51.348 41.567 1.00 11.52 ? 118 PHE A O   1 
ATOM   889  C CB  . PHE A 1 118 ? 7.301  48.323 42.593 1.00 6.50  ? 118 PHE A CB  1 
ATOM   890  C CG  . PHE A 1 118 ? 6.893  46.937 43.017 1.00 7.24  ? 118 PHE A CG  1 
ATOM   891  C CD1 . PHE A 1 118 ? 6.136  46.133 42.174 1.00 6.59  ? 118 PHE A CD1 1 
ATOM   892  C CD2 . PHE A 1 118 ? 7.237  46.455 44.276 1.00 11.16 ? 118 PHE A CD2 1 
ATOM   893  C CE1 . PHE A 1 118 ? 5.715  44.852 42.578 1.00 3.50  ? 118 PHE A CE1 1 
ATOM   894  C CE2 . PHE A 1 118 ? 6.828  45.183 44.694 1.00 9.53  ? 118 PHE A CE2 1 
ATOM   895  C CZ  . PHE A 1 118 ? 6.065  44.382 43.844 1.00 6.57  ? 118 PHE A CZ  1 
ATOM   896  N N   . LYS A 1 119 ? 7.333  51.376 43.728 1.00 8.13  ? 119 LYS A N   1 
ATOM   897  C CA  . LYS A 1 119 ? 7.864  52.723 43.666 1.00 8.09  ? 119 LYS A CA  1 
ATOM   898  C C   . LYS A 1 119 ? 9.363  52.779 43.453 1.00 11.64 ? 119 LYS A C   1 
ATOM   899  O O   . LYS A 1 119 ? 10.122 52.070 44.106 1.00 12.37 ? 119 LYS A O   1 
ATOM   900  C CB  . LYS A 1 119 ? 7.512  53.483 44.953 1.00 13.16 ? 119 LYS A CB  1 
ATOM   901  C CG  . LYS A 1 119 ? 6.034  53.662 45.231 0.00 16.39 ? 119 LYS A CG  1 
ATOM   902  C CD  . LYS A 1 119 ? 5.808  54.504 46.476 0.00 19.89 ? 119 LYS A CD  1 
ATOM   903  C CE  . LYS A 1 119 ? 4.332  54.741 46.747 0.00 21.63 ? 119 LYS A CE  1 
ATOM   904  N NZ  . LYS A 1 119 ? 4.123  55.618 47.934 0.00 22.36 ? 119 LYS A NZ  1 
ATOM   905  N N   . LYS A 1 120 ? 9.775  53.650 42.541 1.00 12.19 ? 120 LYS A N   1 
ATOM   906  C CA  . LYS A 1 120 ? 11.181 53.835 42.236 1.00 17.30 ? 120 LYS A CA  1 
ATOM   907  C C   . LYS A 1 120 ? 11.765 54.597 43.423 1.00 15.50 ? 120 LYS A C   1 
ATOM   908  O O   . LYS A 1 120 ? 11.225 55.625 43.835 1.00 20.31 ? 120 LYS A O   1 
ATOM   909  C CB  . LYS A 1 120 ? 11.303 54.641 40.948 1.00 13.20 ? 120 LYS A CB  1 
ATOM   910  C CG  . LYS A 1 120 ? 12.698 54.799 40.404 1.00 25.91 ? 120 LYS A CG  1 
ATOM   911  C CD  . LYS A 1 120 ? 12.627 55.499 39.071 1.00 22.21 ? 120 LYS A CD  1 
ATOM   912  C CE  . LYS A 1 120 ? 14.001 55.755 38.501 1.00 30.00 ? 120 LYS A CE  1 
ATOM   913  N NZ  . LYS A 1 120 ? 13.894 56.528 37.233 1.00 35.97 ? 120 LYS A NZ  1 
ATOM   914  N N   . GLU A 1 121 ? 12.849 54.083 43.991 1.00 13.96 ? 121 GLU A N   1 
ATOM   915  C CA  . GLU A 1 121 ? 13.476 54.717 45.145 1.00 15.82 ? 121 GLU A CA  1 
ATOM   916  C C   . GLU A 1 121 ? 14.993 54.667 45.027 1.00 16.50 ? 121 GLU A C   1 
ATOM   917  O O   . GLU A 1 121 ? 15.546 53.802 44.348 1.00 14.80 ? 121 GLU A O   1 
ATOM   918  C CB  . GLU A 1 121 ? 13.050 54.012 46.434 1.00 15.99 ? 121 GLU A CB  1 
ATOM   919  C CG  . GLU A 1 121 ? 11.559 54.033 46.700 1.00 23.10 ? 121 GLU A CG  1 
ATOM   920  C CD  . GLU A 1 121 ? 11.207 53.493 48.075 1.00 27.57 ? 121 GLU A CD  1 
ATOM   921  O OE1 . GLU A 1 121 ? 11.272 52.261 48.279 1.00 20.83 ? 121 GLU A OE1 1 
ATOM   922  O OE2 . GLU A 1 121 ? 10.868 54.309 48.957 1.00 30.42 ? 121 GLU A OE2 1 
ATOM   923  N N   . ASN A 1 122 ? 15.665 55.605 45.685 1.00 16.11 ? 122 ASN A N   1 
ATOM   924  C CA  . ASN A 1 122 ? 17.118 55.640 45.655 1.00 14.85 ? 122 ASN A CA  1 
ATOM   925  C C   . ASN A 1 122 ? 17.593 54.641 46.701 1.00 13.04 ? 122 ASN A C   1 
ATOM   926  O O   . ASN A 1 122 ? 17.428 54.868 47.896 1.00 12.14 ? 122 ASN A O   1 
ATOM   927  C CB  . ASN A 1 122 ? 17.639 57.028 46.010 1.00 18.83 ? 122 ASN A CB  1 
ATOM   928  C CG  . ASN A 1 122 ? 19.123 57.158 45.766 1.00 20.89 ? 122 ASN A CG  1 
ATOM   929  O OD1 . ASN A 1 122 ? 19.856 56.166 45.815 1.00 17.67 ? 122 ASN A OD1 1 
ATOM   930  N ND2 . ASN A 1 122 ? 19.582 58.381 45.512 1.00 17.70 ? 122 ASN A ND2 1 
ATOM   931  N N   . LEU A 1 123 ? 18.191 53.546 46.247 1.00 9.46  ? 123 LEU A N   1 
ATOM   932  C CA  . LEU A 1 123 ? 18.660 52.500 47.150 1.00 8.98  ? 123 LEU A CA  1 
ATOM   933  C C   . LEU A 1 123 ? 20.082 52.713 47.646 1.00 9.35  ? 123 LEU A C   1 
ATOM   934  O O   . LEU A 1 123 ? 20.547 52.011 48.547 1.00 8.41  ? 123 LEU A O   1 
ATOM   935  C CB  . LEU A 1 123 ? 18.562 51.137 46.457 1.00 11.08 ? 123 LEU A CB  1 
ATOM   936  C CG  . LEU A 1 123 ? 17.184 50.769 45.904 1.00 10.80 ? 123 LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 123 ? 17.235 49.356 45.324 1.00 10.14 ? 123 LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 123 ? 16.148 50.861 46.999 1.00 9.39  ? 123 LEU A CD2 1 
ATOM   939  N N   . LEU A 1 124 ? 20.776 53.677 47.052 1.00 12.25 ? 124 LEU A N   1 
ATOM   940  C CA  . LEU A 1 124 ? 22.147 53.967 47.450 1.00 12.91 ? 124 LEU A CA  1 
ATOM   941  C C   . LEU A 1 124 ? 22.163 54.893 48.659 1.00 14.91 ? 124 LEU A C   1 
ATOM   942  O O   . LEU A 1 124 ? 21.889 56.087 48.537 1.00 13.39 ? 124 LEU A O   1 
ATOM   943  C CB  . LEU A 1 124 ? 22.918 54.624 46.299 1.00 14.94 ? 124 LEU A CB  1 
ATOM   944  C CG  . LEU A 1 124 ? 24.398 54.883 46.593 1.00 14.98 ? 124 LEU A CG  1 
ATOM   945  C CD1 . LEU A 1 124 ? 25.109 53.549 46.770 1.00 15.53 ? 124 LEU A CD1 1 
ATOM   946  C CD2 . LEU A 1 124 ? 25.035 55.678 45.460 1.00 13.99 ? 124 LEU A CD2 1 
ATOM   947  N N   . THR A 1 125 ? 22.485 54.338 49.821 1.00 12.83 ? 125 THR A N   1 
ATOM   948  C CA  . THR A 1 125 ? 22.536 55.122 51.052 1.00 16.32 ? 125 THR A CA  1 
ATOM   949  C C   . THR A 1 125 ? 23.774 56.011 51.050 1.00 16.88 ? 125 THR A C   1 
ATOM   950  O O   . THR A 1 125 ? 24.711 55.776 50.296 1.00 12.34 ? 125 THR A O   1 
ATOM   951  C CB  . THR A 1 125 ? 22.598 54.207 52.283 1.00 16.76 ? 125 THR A CB  1 
ATOM   952  O OG1 . THR A 1 125 ? 23.662 53.262 52.118 1.00 13.02 ? 125 THR A OG1 1 
ATOM   953  C CG2 . THR A 1 125 ? 21.287 53.461 52.465 1.00 17.50 ? 125 THR A CG2 1 
ATOM   954  N N   . ALA A 1 126 ? 23.781 57.038 51.890 1.00 16.53 ? 126 ALA A N   1 
ATOM   955  C CA  . ALA A 1 126 ? 24.939 57.917 51.951 1.00 15.97 ? 126 ALA A CA  1 
ATOM   956  C C   . ALA A 1 126 ? 26.152 57.061 52.309 1.00 14.78 ? 126 ALA A C   1 
ATOM   957  O O   . ALA A 1 126 ? 27.234 57.224 51.753 1.00 16.81 ? 126 ALA A O   1 
ATOM   958  C CB  . ALA A 1 126 ? 24.728 58.994 53.002 1.00 17.19 ? 126 ALA A CB  1 
ATOM   959  N N   . GLU A 1 127 ? 25.947 56.141 53.244 1.00 15.72 ? 127 GLU A N   1 
ATOM   960  C CA  . GLU A 1 127 ? 26.994 55.242 53.704 1.00 17.40 ? 127 GLU A CA  1 
ATOM   961  C C   . GLU A 1 127 ? 27.568 54.393 52.563 1.00 18.58 ? 127 GLU A C   1 
ATOM   962  O O   . GLU A 1 127 ? 28.787 54.256 52.424 1.00 20.69 ? 127 GLU A O   1 
ATOM   963  C CB  . GLU A 1 127 ? 26.428 54.346 54.811 1.00 20.28 ? 127 GLU A CB  1 
ATOM   964  C CG  . GLU A 1 127 ? 27.330 53.211 55.242 1.00 24.68 ? 127 GLU A CG  1 
ATOM   965  C CD  . GLU A 1 127 ? 26.711 52.373 56.347 1.00 30.71 ? 127 GLU A CD  1 
ATOM   966  O OE1 . GLU A 1 127 ? 25.527 51.996 56.217 1.00 23.76 ? 127 GLU A OE1 1 
ATOM   967  O OE2 . GLU A 1 127 ? 27.411 52.082 57.339 1.00 29.28 ? 127 GLU A OE2 1 
ATOM   968  N N   . SER A 1 128 ? 26.693 53.821 51.745 1.00 15.92 ? 128 SER A N   1 
ATOM   969  C CA  . SER A 1 128 ? 27.150 53.006 50.626 1.00 15.53 ? 128 SER A CA  1 
ATOM   970  C C   . SER A 1 128 ? 27.896 53.853 49.602 1.00 14.40 ? 128 SER A C   1 
ATOM   971  O O   . SER A 1 128 ? 28.934 53.445 49.088 1.00 16.19 ? 128 SER A O   1 
ATOM   972  C CB  . SER A 1 128 ? 25.967 52.303 49.957 1.00 14.84 ? 128 SER A CB  1 
ATOM   973  O OG  . SER A 1 128 ? 25.434 51.308 50.813 1.00 19.28 ? 128 SER A OG  1 
ATOM   974  N N   . GLU A 1 129 ? 27.367 55.031 49.303 1.00 13.68 ? 129 GLU A N   1 
ATOM   975  C CA  . GLU A 1 129 ? 28.023 55.904 48.346 1.00 16.66 ? 129 GLU A CA  1 
ATOM   976  C C   . GLU A 1 129 ? 29.432 56.229 48.842 1.00 16.47 ? 129 GLU A C   1 
ATOM   977  O O   . GLU A 1 129 ? 30.401 56.130 48.098 1.00 12.84 ? 129 GLU A O   1 
ATOM   978  C CB  . GLU A 1 129 ? 27.209 57.189 48.154 1.00 18.32 ? 129 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 129 ? 27.800 58.154 47.141 1.00 23.60 ? 129 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 129 ? 26.944 59.388 46.952 1.00 25.13 ? 129 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 129 ? 26.597 60.033 47.964 1.00 33.59 ? 129 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 129 ? 26.618 59.714 45.793 1.00 28.40 ? 129 GLU A OE2 1 
ATOM   983  N N   . LYS A 1 130 ? 29.544 56.579 50.115 1.00 17.60 ? 130 LYS A N   1 
ATOM   984  C CA  . LYS A 1 130 ? 30.837 56.916 50.695 1.00 19.88 ? 130 LYS A CA  1 
ATOM   985  C C   . LYS A 1 130 ? 31.827 55.772 50.585 1.00 20.23 ? 130 LYS A C   1 
ATOM   986  O O   . LYS A 1 130 ? 32.944 55.949 50.107 1.00 18.53 ? 130 LYS A O   1 
ATOM   987  C CB  . LYS A 1 130 ? 30.672 57.296 52.159 1.00 22.27 ? 130 LYS A CB  1 
ATOM   988  C CG  . LYS A 1 130 ? 31.941 57.816 52.761 1.00 28.01 ? 130 LYS A CG  1 
ATOM   989  C CD  . LYS A 1 130 ? 31.669 58.657 53.980 1.00 34.14 ? 130 LYS A CD  1 
ATOM   990  C CE  . LYS A 1 130 ? 32.988 59.197 54.490 0.00 33.94 ? 130 LYS A CE  1 
ATOM   991  N NZ  . LYS A 1 130 ? 32.823 60.242 55.527 0.00 34.65 ? 130 LYS A NZ  1 
ATOM   992  N N   . GLU A 1 131 ? 31.406 54.599 51.038 1.00 19.34 ? 131 GLU A N   1 
ATOM   993  C CA  . GLU A 1 131 ? 32.246 53.415 50.982 1.00 19.64 ? 131 GLU A CA  1 
ATOM   994  C C   . GLU A 1 131 ? 32.651 53.113 49.541 1.00 19.09 ? 131 GLU A C   1 
ATOM   995  O O   . GLU A 1 131 ? 33.788 52.719 49.274 1.00 16.83 ? 131 GLU A O   1 
ATOM   996  C CB  . GLU A 1 131 ? 31.501 52.221 51.579 1.00 20.23 ? 131 GLU A CB  1 
ATOM   997  C CG  . GLU A 1 131 ? 31.419 52.237 53.096 1.00 26.43 ? 131 GLU A CG  1 
ATOM   998  C CD  . GLU A 1 131 ? 30.583 51.096 53.645 1.00 32.14 ? 131 GLU A CD  1 
ATOM   999  O OE1 . GLU A 1 131 ? 30.726 49.956 53.157 1.00 36.02 ? 131 GLU A OE1 1 
ATOM   1000 O OE2 . GLU A 1 131 ? 29.784 51.336 54.571 1.00 36.41 ? 131 GLU A OE2 1 
ATOM   1001 N N   . TRP A 1 132 ? 31.721 53.307 48.610 1.00 15.49 ? 132 TRP A N   1 
ATOM   1002 C CA  . TRP A 1 132 ? 32.007 53.049 47.209 1.00 16.37 ? 132 TRP A CA  1 
ATOM   1003 C C   . TRP A 1 132 ? 33.093 53.983 46.665 1.00 20.05 ? 132 TRP A C   1 
ATOM   1004 O O   . TRP A 1 132 ? 34.096 53.524 46.115 1.00 19.58 ? 132 TRP A O   1 
ATOM   1005 C CB  . TRP A 1 132 ? 30.731 53.176 46.375 1.00 16.43 ? 132 TRP A CB  1 
ATOM   1006 C CG  . TRP A 1 132 ? 30.984 53.132 44.907 1.00 15.17 ? 132 TRP A CG  1 
ATOM   1007 C CD1 . TRP A 1 132 ? 31.618 52.144 44.209 1.00 12.54 ? 132 TRP A CD1 1 
ATOM   1008 C CD2 . TRP A 1 132 ? 30.665 54.152 43.961 1.00 12.86 ? 132 TRP A CD2 1 
ATOM   1009 N NE1 . TRP A 1 132 ? 31.719 52.493 42.883 1.00 17.13 ? 132 TRP A NE1 1 
ATOM   1010 C CE2 . TRP A 1 132 ? 31.141 53.724 42.706 1.00 14.24 ? 132 TRP A CE2 1 
ATOM   1011 C CE3 . TRP A 1 132 ? 30.024 55.395 44.054 1.00 15.03 ? 132 TRP A CE3 1 
ATOM   1012 C CZ2 . TRP A 1 132 ? 30.994 54.494 41.546 1.00 19.57 ? 132 TRP A CZ2 1 
ATOM   1013 C CZ3 . TRP A 1 132 ? 29.879 56.160 42.901 1.00 15.98 ? 132 TRP A CZ3 1 
ATOM   1014 C CH2 . TRP A 1 132 ? 30.364 55.706 41.665 1.00 14.91 ? 132 TRP A CH2 1 
ATOM   1015 N N   . LYS A 1 133 ? 32.899 55.289 46.816 1.00 23.27 ? 133 LYS A N   1 
ATOM   1016 C CA  . LYS A 1 133 ? 33.891 56.245 46.334 1.00 25.59 ? 133 LYS A CA  1 
ATOM   1017 C C   . LYS A 1 133 ? 35.245 55.940 46.972 1.00 26.40 ? 133 LYS A C   1 
ATOM   1018 O O   . LYS A 1 133 ? 36.294 56.091 46.342 1.00 25.68 ? 133 LYS A O   1 
ATOM   1019 C CB  . LYS A 1 133 ? 33.455 57.676 46.664 1.00 27.45 ? 133 LYS A CB  1 
ATOM   1020 C CG  . LYS A 1 133 ? 32.215 58.122 45.904 1.00 31.29 ? 133 LYS A CG  1 
ATOM   1021 C CD  . LYS A 1 133 ? 31.807 59.535 46.267 1.00 30.64 ? 133 LYS A CD  1 
ATOM   1022 C CE  . LYS A 1 133 ? 30.592 59.979 45.467 1.00 34.91 ? 133 LYS A CE  1 
ATOM   1023 N NZ  . LYS A 1 133 ? 30.159 61.356 45.842 1.00 37.67 ? 133 LYS A NZ  1 
ATOM   1024 N N   . GLU A 1 134 ? 35.216 55.495 48.221 1.00 26.66 ? 134 GLU A N   1 
ATOM   1025 C CA  . GLU A 1 134 ? 36.440 55.157 48.935 1.00 29.32 ? 134 GLU A CA  1 
ATOM   1026 C C   . GLU A 1 134 ? 37.077 53.916 48.311 1.00 29.39 ? 134 GLU A C   1 
ATOM   1027 O O   . GLU A 1 134 ? 38.295 53.850 48.139 1.00 23.72 ? 134 GLU A O   1 
ATOM   1028 C CB  . GLU A 1 134 ? 36.126 54.901 50.409 1.00 32.83 ? 134 GLU A CB  1 
ATOM   1029 C CG  . GLU A 1 134 ? 37.342 54.633 51.278 1.00 39.85 ? 134 GLU A CG  1 
ATOM   1030 C CD  . GLU A 1 134 ? 38.388 55.727 51.169 1.00 44.62 ? 134 GLU A CD  1 
ATOM   1031 O OE1 . GLU A 1 134 ? 38.005 56.916 51.101 1.00 46.05 ? 134 GLU A OE1 1 
ATOM   1032 O OE2 . GLU A 1 134 ? 39.595 55.397 51.163 1.00 43.53 ? 134 GLU A OE2 1 
ATOM   1033 N N   . TRP A 1 135 ? 36.247 52.933 47.971 1.00 25.42 ? 135 TRP A N   1 
ATOM   1034 C CA  . TRP A 1 135 ? 36.736 51.702 47.358 1.00 22.24 ? 135 TRP A CA  1 
ATOM   1035 C C   . TRP A 1 135 ? 37.360 51.991 45.992 1.00 20.29 ? 135 TRP A C   1 
ATOM   1036 O O   . TRP A 1 135 ? 38.324 51.341 45.592 1.00 19.32 ? 135 TRP A O   1 
ATOM   1037 C CB  . TRP A 1 135 ? 35.583 50.703 47.190 1.00 18.79 ? 135 TRP A CB  1 
ATOM   1038 C CG  . TRP A 1 135 ? 35.965 49.469 46.431 1.00 17.82 ? 135 TRP A CG  1 
ATOM   1039 C CD1 . TRP A 1 135 ? 36.589 48.359 46.923 1.00 13.31 ? 135 TRP A CD1 1 
ATOM   1040 C CD2 . TRP A 1 135 ? 35.788 49.243 45.030 1.00 14.60 ? 135 TRP A CD2 1 
ATOM   1041 N NE1 . TRP A 1 135 ? 36.809 47.452 45.911 1.00 15.54 ? 135 TRP A NE1 1 
ATOM   1042 C CE2 . TRP A 1 135 ? 36.326 47.971 44.740 1.00 14.43 ? 135 TRP A CE2 1 
ATOM   1043 C CE3 . TRP A 1 135 ? 35.222 49.992 43.988 1.00 19.29 ? 135 TRP A CE3 1 
ATOM   1044 C CZ2 . TRP A 1 135 ? 36.321 47.433 43.448 1.00 15.70 ? 135 TRP A CZ2 1 
ATOM   1045 C CZ3 . TRP A 1 135 ? 35.216 49.458 42.706 1.00 16.68 ? 135 TRP A CZ3 1 
ATOM   1046 C CH2 . TRP A 1 135 ? 35.760 48.189 42.448 1.00 16.06 ? 135 TRP A CH2 1 
ATOM   1047 N N   . LEU A 1 136 ? 36.803 52.971 45.289 1.00 21.39 ? 136 LEU A N   1 
ATOM   1048 C CA  . LEU A 1 136 ? 37.279 53.342 43.964 1.00 24.94 ? 136 LEU A CA  1 
ATOM   1049 C C   . LEU A 1 136 ? 38.750 53.738 43.911 1.00 28.37 ? 136 LEU A C   1 
ATOM   1050 O O   . LEU A 1 136 ? 39.388 53.635 42.871 1.00 29.38 ? 136 LEU A O   1 
ATOM   1051 C CB  . LEU A 1 136 ? 36.425 54.484 43.403 1.00 25.11 ? 136 LEU A CB  1 
ATOM   1052 C CG  . LEU A 1 136 ? 35.022 54.142 42.896 1.00 30.58 ? 136 LEU A CG  1 
ATOM   1053 C CD1 . LEU A 1 136 ? 34.336 55.412 42.409 1.00 29.21 ? 136 LEU A CD1 1 
ATOM   1054 C CD2 . LEU A 1 136 ? 35.122 53.126 41.767 1.00 27.96 ? 136 LEU A CD2 1 
ATOM   1055 N N   . LYS A 1 137 ? 39.290 54.186 45.035 1.00 33.38 ? 137 LYS A N   1 
ATOM   1056 C CA  . LYS A 1 137 ? 40.682 54.608 45.089 1.00 36.98 ? 137 LYS A CA  1 
ATOM   1057 C C   . LYS A 1 137 ? 41.640 53.447 44.834 1.00 43.13 ? 137 LYS A C   1 
ATOM   1058 O O   . LYS A 1 137 ? 42.753 53.640 44.334 1.00 40.76 ? 137 LYS A O   1 
ATOM   1059 C CB  . LYS A 1 137 ? 40.974 55.241 46.447 1.00 37.73 ? 137 LYS A CB  1 
ATOM   1060 C CG  . LYS A 1 137 ? 39.753 55.915 47.045 1.00 38.82 ? 137 LYS A CG  1 
ATOM   1061 C CD  . LYS A 1 137 ? 40.096 56.845 48.190 1.00 41.37 ? 137 LYS A CD  1 
ATOM   1062 C CE  . LYS A 1 137 ? 40.576 58.186 47.662 1.00 41.68 ? 137 LYS A CE  1 
ATOM   1063 N NZ  . LYS A 1 137 ? 40.778 59.178 48.749 1.00 43.33 ? 137 LYS A NZ  1 
ATOM   1064 N N   . THR A 1 138 ? 41.197 52.238 45.170 1.00 44.38 ? 138 THR A N   1 
ATOM   1065 C CA  . THR A 1 138 ? 42.009 51.038 44.992 1.00 45.10 ? 138 THR A CA  1 
ATOM   1066 C C   . THR A 1 138 ? 41.464 50.165 43.861 1.00 44.63 ? 138 THR A C   1 
ATOM   1067 O O   . THR A 1 138 ? 42.218 49.689 43.011 1.00 42.61 ? 138 THR A O   1 
ATOM   1068 C CB  . THR A 1 138 ? 42.026 50.198 46.278 1.00 46.22 ? 138 THR A CB  1 
ATOM   1069 O OG1 . THR A 1 138 ? 40.814 49.436 46.365 1.00 50.90 ? 138 THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 138 ? 42.117 51.107 47.497 1.00 45.17 ? 138 THR A CG2 1 
ATOM   1071 N N   . SER A 1 139 ? 40.151 49.955 43.869 1.00 44.79 ? 139 SER A N   1 
ATOM   1072 C CA  . SER A 1 139 ? 39.483 49.142 42.861 1.00 44.59 ? 139 SER A CA  1 
ATOM   1073 C C   . SER A 1 139 ? 39.959 47.693 42.849 1.00 46.34 ? 139 SER A C   1 
ATOM   1074 O O   . SER A 1 139 ? 40.041 47.069 41.791 1.00 47.33 ? 139 SER A O   1 
ATOM   1075 C CB  . SER A 1 139 ? 39.663 49.756 41.469 1.00 43.29 ? 139 SER A CB  1 
ATOM   1076 O OG  . SER A 1 139 ? 38.969 50.987 41.359 1.00 43.33 ? 139 SER A OG  1 
ATOM   1077 N N   . GLN A 1 140 ? 40.285 47.165 44.025 1.00 46.94 ? 140 GLN A N   1 
ATOM   1078 C CA  . GLN A 1 140 ? 40.718 45.779 44.140 1.00 49.20 ? 140 GLN A CA  1 
ATOM   1079 C C   . GLN A 1 140 ? 39.514 44.921 44.491 1.00 48.29 ? 140 GLN A C   1 
ATOM   1080 O O   . GLN A 1 140 ? 38.928 45.066 45.568 1.00 48.77 ? 140 GLN A O   1 
ATOM   1081 C CB  . GLN A 1 140 ? 41.790 45.622 45.220 1.00 51.45 ? 140 GLN A CB  1 
ATOM   1082 C CG  . GLN A 1 140 ? 43.108 46.296 44.909 1.00 61.86 ? 140 GLN A CG  1 
ATOM   1083 C CD  . GLN A 1 140 ? 44.221 45.807 45.815 1.00 69.88 ? 140 GLN A CD  1 
ATOM   1084 O OE1 . GLN A 1 140 ? 44.101 45.853 47.041 1.00 73.04 ? 140 GLN A OE1 1 
ATOM   1085 N NE2 . GLN A 1 140 ? 45.314 45.338 45.217 1.00 71.52 ? 140 GLN A NE2 1 
ATOM   1086 N N   . TYR A 1 141 ? 39.143 44.032 43.576 1.00 45.86 ? 141 TYR A N   1 
ATOM   1087 C CA  . TYR A 1 141 ? 37.994 43.161 43.788 1.00 41.88 ? 141 TYR A CA  1 
ATOM   1088 C C   . TYR A 1 141 ? 38.363 41.900 44.576 1.00 38.67 ? 141 TYR A C   1 
ATOM   1089 O O   . TYR A 1 141 ? 39.155 41.077 44.105 1.00 35.35 ? 141 TYR A O   1 
ATOM   1090 C CB  . TYR A 1 141 ? 37.387 42.773 42.432 1.00 42.23 ? 141 TYR A CB  1 
ATOM   1091 C CG  . TYR A 1 141 ? 36.054 42.072 42.554 1.00 39.61 ? 141 TYR A CG  1 
ATOM   1092 C CD1 . TYR A 1 141 ? 34.964 42.717 43.140 1.00 41.69 ? 141 TYR A CD1 1 
ATOM   1093 C CD2 . TYR A 1 141 ? 35.896 40.745 42.147 1.00 39.34 ? 141 TYR A CD2 1 
ATOM   1094 C CE1 . TYR A 1 141 ? 33.754 42.062 43.329 1.00 35.69 ? 141 TYR A CE1 1 
ATOM   1095 C CE2 . TYR A 1 141 ? 34.681 40.074 42.331 1.00 33.88 ? 141 TYR A CE2 1 
ATOM   1096 C CZ  . TYR A 1 141 ? 33.617 40.740 42.928 1.00 36.56 ? 141 TYR A CZ  1 
ATOM   1097 O OH  . TYR A 1 141 ? 32.433 40.075 43.173 1.00 14.90 ? 141 TYR A OH  1 
ATOM   1098 N N   . LYS A 1 142 ? 37.792 41.750 45.770 1.00 36.18 ? 142 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 142 ? 38.075 40.580 46.606 1.00 38.45 ? 142 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 142 ? 36.924 40.232 47.564 1.00 43.12 ? 142 LYS A C   1 
ATOM   1101 O O   . LYS A 1 142 ? 36.993 40.525 48.765 1.00 43.12 ? 142 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 142 ? 39.347 40.813 47.432 1.00 33.32 ? 142 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 142 ? 40.622 40.860 46.601 0.00 29.66 ? 142 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 142 ? 41.850 41.017 47.489 0.00 26.81 ? 142 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 142 ? 43.135 40.919 46.676 0.00 25.60 ? 142 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 142 ? 44.329 41.022 47.559 0.00 25.09 ? 142 LYS A NZ  1 
ATOM   1107 N N   . PRO A 1 143 ? 35.855 39.597 47.052 1.00 47.70 ? 143 PRO A N   1 
ATOM   1108 C CA  . PRO A 1 143 ? 34.684 39.200 47.848 1.00 50.71 ? 143 PRO A CA  1 
ATOM   1109 C C   . PRO A 1 143 ? 34.950 38.222 48.998 1.00 51.47 ? 143 PRO A C   1 
ATOM   1110 O O   . PRO A 1 143 ? 35.582 37.176 48.831 1.00 52.17 ? 143 PRO A O   1 
ATOM   1111 C CB  . PRO A 1 143 ? 33.744 38.594 46.810 1.00 51.15 ? 143 PRO A CB  1 
ATOM   1112 C CG  . PRO A 1 143 ? 34.057 39.376 45.600 1.00 53.45 ? 143 PRO A CG  1 
ATOM   1113 C CD  . PRO A 1 143 ? 35.567 39.449 45.617 1.00 50.05 ? 143 PRO A CD  1 
ATOM   1114 N N   . ILE A 1 144 ? 34.429 38.585 50.163 1.00 51.81 ? 144 ILE A N   1 
ATOM   1115 C CA  . ILE A 1 144 ? 34.545 37.805 51.398 1.00 52.20 ? 144 ILE A CA  1 
ATOM   1116 C C   . ILE A 1 144 ? 33.167 37.369 51.985 1.00 51.15 ? 144 ILE A C   1 
ATOM   1117 O O   . ILE A 1 144 ? 32.314 38.220 52.186 1.00 51.53 ? 144 ILE A O   1 
ATOM   1118 C CB  . ILE A 1 144 ? 35.281 38.678 52.407 1.00 53.71 ? 144 ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 144 ? 34.252 39.581 53.062 1.00 52.93 ? 144 ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 144 ? 36.357 39.514 51.731 1.00 55.70 ? 144 ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 144 ? 34.562 39.930 54.500 1.00 52.35 ? 144 ILE A CD1 1 
ATOM   1122 N N   . VAL A 1 145 ? 32.968 36.095 52.296 1.00 48.79 ? 145 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 145 ? 31.674 35.697 52.848 1.00 47.53 ? 145 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 145 ? 31.726 35.329 54.335 1.00 47.64 ? 145 VAL A C   1 
ATOM   1125 O O   . VAL A 1 145 ? 31.909 34.163 54.686 1.00 49.68 ? 145 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 145 ? 31.069 34.508 52.055 1.00 44.13 ? 145 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 145 ? 29.747 34.083 52.678 1.00 39.43 ? 145 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 145 ? 30.856 34.913 50.601 1.00 39.84 ? 145 VAL A CG2 1 
ATOM   1129 N N   . ASN A 1 146 ? 31.565 36.324 55.205 1.00 46.18 ? 146 ASN A N   1 
ATOM   1130 C CA  . ASN A 1 146 ? 31.576 36.075 56.646 1.00 47.01 ? 146 ASN A CA  1 
ATOM   1131 C C   . ASN A 1 146 ? 30.347 36.665 57.339 1.00 46.07 ? 146 ASN A C   1 
ATOM   1132 O O   . ASN A 1 146 ? 29.527 37.323 56.703 1.00 42.23 ? 146 ASN A O   1 
ATOM   1133 C CB  . ASN A 1 146 ? 32.854 36.625 57.293 1.00 46.05 ? 146 ASN A CB  1 
ATOM   1134 C CG  . ASN A 1 146 ? 32.907 38.141 57.306 1.00 44.39 ? 146 ASN A CG  1 
ATOM   1135 O OD1 . ASN A 1 146 ? 31.962 38.811 57.724 1.00 40.16 ? 146 ASN A OD1 1 
ATOM   1136 N ND2 . ASN A 1 146 ? 34.031 38.689 56.870 1.00 42.19 ? 146 ASN A ND2 1 
ATOM   1137 N N   . ILE A 1 147 ? 30.239 36.430 58.646 1.00 46.24 ? 147 ILE A N   1 
ATOM   1138 C CA  . ILE A 1 147 ? 29.109 36.892 59.449 1.00 47.00 ? 147 ILE A CA  1 
ATOM   1139 C C   . ILE A 1 147 ? 28.761 38.377 59.324 1.00 49.99 ? 147 ILE A C   1 
ATOM   1140 O O   . ILE A 1 147 ? 27.679 38.800 59.742 1.00 50.54 ? 147 ILE A O   1 
ATOM   1141 C CB  . ILE A 1 147 ? 29.331 36.590 60.951 1.00 45.07 ? 147 ILE A CB  1 
ATOM   1142 C CG1 . ILE A 1 147 ? 30.558 35.694 61.137 0.00 41.73 ? 147 ILE A CG1 1 
ATOM   1143 C CG2 . ILE A 1 147 ? 28.119 35.885 61.523 0.00 42.61 ? 147 ILE A CG2 1 
ATOM   1144 C CD1 . ILE A 1 147 ? 30.890 35.390 62.585 0.00 38.29 ? 147 ILE A CD1 1 
ATOM   1145 N N   . GLU A 1 148 ? 29.665 39.167 58.749 1.00 51.13 ? 148 GLU A N   1 
ATOM   1146 C CA  . GLU A 1 148 ? 29.427 40.599 58.576 1.00 49.78 ? 148 GLU A CA  1 
ATOM   1147 C C   . GLU A 1 148 ? 29.832 41.061 57.176 1.00 49.88 ? 148 GLU A C   1 
ATOM   1148 O O   . GLU A 1 148 ? 30.282 42.194 56.997 1.00 52.06 ? 148 GLU A O   1 
ATOM   1149 C CB  . GLU A 1 148 ? 30.214 41.400 59.617 1.00 47.53 ? 148 GLU A CB  1 
ATOM   1150 C CG  . GLU A 1 148 ? 30.036 40.923 61.050 0.00 40.70 ? 148 GLU A CG  1 
ATOM   1151 C CD  . GLU A 1 148 ? 30.784 41.791 62.045 0.00 36.69 ? 148 GLU A CD  1 
ATOM   1152 O OE1 . GLU A 1 148 ? 31.719 42.504 61.626 0.00 34.23 ? 148 GLU A OE1 1 
ATOM   1153 O OE2 . GLU A 1 148 ? 30.443 41.749 63.246 0.00 34.23 ? 148 GLU A OE2 1 
ATOM   1154 N N   . ASN A 1 149 ? 29.663 40.188 56.185 1.00 51.41 ? 149 ASN A N   1 
ATOM   1155 C CA  . ASN A 1 149 ? 30.021 40.516 54.806 1.00 51.39 ? 149 ASN A CA  1 
ATOM   1156 C C   . ASN A 1 149 ? 29.322 39.654 53.764 1.00 52.67 ? 149 ASN A C   1 
ATOM   1157 O O   . ASN A 1 149 ? 29.404 38.424 53.799 1.00 53.96 ? 149 ASN A O   1 
ATOM   1158 C CB  . ASN A 1 149 ? 31.528 40.392 54.619 1.00 50.47 ? 149 ASN A CB  1 
ATOM   1159 C CG  . ASN A 1 149 ? 32.266 41.661 54.982 1.00 49.81 ? 149 ASN A CG  1 
ATOM   1160 O OD1 . ASN A 1 149 ? 32.277 42.623 54.215 1.00 50.63 ? 149 ASN A OD1 1 
ATOM   1161 N ND2 . ASN A 1 149 ? 32.886 41.672 56.158 1.00 44.51 ? 149 ASN A ND2 1 
ATOM   1162 N N   . HIS A 1 150 ? 28.660 40.317 52.821 1.00 52.98 ? 150 HIS A N   1 
ATOM   1163 C CA  . HIS A 1 150 ? 27.930 39.635 51.762 1.00 52.00 ? 150 HIS A CA  1 
ATOM   1164 C C   . HIS A 1 150 ? 26.946 38.650 52.375 1.00 49.35 ? 150 HIS A C   1 
ATOM   1165 O O   . HIS A 1 150 ? 26.840 37.497 51.951 1.00 49.58 ? 150 HIS A O   1 
ATOM   1166 C CB  . HIS A 1 150 ? 28.899 38.905 50.823 1.00 55.67 ? 150 HIS A CB  1 
ATOM   1167 C CG  . HIS A 1 150 ? 29.848 39.817 50.104 1.00 58.58 ? 150 HIS A CG  1 
ATOM   1168 N ND1 . HIS A 1 150 ? 29.439 40.987 49.497 1.00 59.22 ? 150 HIS A ND1 1 
ATOM   1169 C CD2 . HIS A 1 150 ? 31.180 39.723 49.879 1.00 58.86 ? 150 HIS A CD2 1 
ATOM   1170 C CE1 . HIS A 1 150 ? 30.479 41.573 48.931 1.00 56.67 ? 150 HIS A CE1 1 
ATOM   1171 N NE2 . HIS A 1 150 ? 31.548 40.828 49.148 1.00 57.84 ? 150 HIS A NE2 1 
ATOM   1172 N N   . ASN A 1 151 ? 26.228 39.122 53.388 1.00 43.81 ? 151 ASN A N   1 
ATOM   1173 C CA  . ASN A 1 151 ? 25.240 38.308 54.083 1.00 38.99 ? 151 ASN A CA  1 
ATOM   1174 C C   . ASN A 1 151 ? 23.907 38.304 53.348 1.00 36.60 ? 151 ASN A C   1 
ATOM   1175 O O   . ASN A 1 151 ? 22.964 38.971 53.768 1.00 40.88 ? 151 ASN A O   1 
ATOM   1176 C CB  . ASN A 1 151 ? 25.017 38.836 55.504 1.00 40.52 ? 151 ASN A CB  1 
ATOM   1177 C CG  . ASN A 1 151 ? 26.202 38.596 56.409 1.00 40.99 ? 151 ASN A CG  1 
ATOM   1178 O OD1 . ASN A 1 151 ? 26.219 39.045 57.553 1.00 43.66 ? 151 ASN A OD1 1 
ATOM   1179 N ND2 . ASN A 1 151 ? 27.200 37.879 55.905 1.00 34.78 ? 151 ASN A ND2 1 
ATOM   1180 N N   . THR A 1 152 ? 23.829 37.569 52.246 1.00 24.06 ? 152 THR A N   1 
ATOM   1181 C CA  . THR A 1 152 ? 22.584 37.485 51.487 1.00 19.54 ? 152 THR A CA  1 
ATOM   1182 C C   . THR A 1 152 ? 21.583 36.715 52.345 1.00 13.31 ? 152 THR A C   1 
ATOM   1183 O O   . THR A 1 152 ? 21.987 35.861 53.127 1.00 18.21 ? 152 THR A O   1 
ATOM   1184 C CB  . THR A 1 152 ? 22.786 36.695 50.182 1.00 14.15 ? 152 THR A CB  1 
ATOM   1185 O OG1 . THR A 1 152 ? 23.587 37.458 49.273 1.00 17.16 ? 152 THR A OG1 1 
ATOM   1186 C CG2 . THR A 1 152 ? 21.446 36.366 49.540 1.00 16.42 ? 152 THR A CG2 1 
ATOM   1187 N N   . ILE A 1 153 ? 20.291 37.007 52.220 1.00 14.35 ? 153 ILE A N   1 
ATOM   1188 C CA  . ILE A 1 153 ? 19.324 36.245 52.994 1.00 10.04 ? 153 ILE A CA  1 
ATOM   1189 C C   . ILE A 1 153 ? 18.512 35.305 52.122 1.00 11.63 ? 153 ILE A C   1 
ATOM   1190 O O   . ILE A 1 153 ? 17.958 35.699 51.093 1.00 7.99  ? 153 ILE A O   1 
ATOM   1191 C CB  . ILE A 1 153 ? 18.339 37.127 53.795 1.00 9.91  ? 153 ILE A CB  1 
ATOM   1192 C CG1 . ILE A 1 153 ? 17.410 36.208 54.598 1.00 12.33 ? 153 ILE A CG1 1 
ATOM   1193 C CG2 . ILE A 1 153 ? 17.519 38.019 52.863 1.00 11.82 ? 153 ILE A CG2 1 
ATOM   1194 C CD1 . ILE A 1 153 ? 16.622 36.886 55.695 1.00 14.86 ? 153 ILE A CD1 1 
ATOM   1195 N N   . GLY A 1 154 ? 18.477 34.048 52.543 1.00 6.13  ? 154 GLY A N   1 
ATOM   1196 C CA  . GLY A 1 154 ? 17.715 33.033 51.851 1.00 5.55  ? 154 GLY A CA  1 
ATOM   1197 C C   . GLY A 1 154 ? 16.819 32.483 52.943 1.00 6.41  ? 154 GLY A C   1 
ATOM   1198 O O   . GLY A 1 154 ? 17.258 32.345 54.083 1.00 4.36  ? 154 GLY A O   1 
ATOM   1199 N N   . MET A 1 155 ? 15.568 32.191 52.618 1.00 5.51  ? 155 MET A N   1 
ATOM   1200 C CA  . MET A 1 155 ? 14.651 31.676 53.614 1.00 2.55  ? 155 MET A CA  1 
ATOM   1201 C C   . MET A 1 155 ? 13.781 30.591 53.006 1.00 8.21  ? 155 MET A C   1 
ATOM   1202 O O   . MET A 1 155 ? 13.333 30.701 51.864 1.00 3.09  ? 155 MET A O   1 
ATOM   1203 C CB  . MET A 1 155 ? 13.781 32.812 54.167 1.00 7.78  ? 155 MET A CB  1 
ATOM   1204 C CG  . MET A 1 155 ? 12.732 32.371 55.178 1.00 11.01 ? 155 MET A CG  1 
ATOM   1205 S SD  . MET A 1 155 ? 11.762 33.750 55.770 1.00 12.04 ? 155 MET A SD  1 
ATOM   1206 C CE  . MET A 1 155 ? 12.868 34.403 57.078 1.00 11.97 ? 155 MET A CE  1 
ATOM   1207 N N   . ILE A 1 156 ? 13.574 29.525 53.774 1.00 4.20  ? 156 ILE A N   1 
ATOM   1208 C CA  . ILE A 1 156 ? 12.740 28.413 53.345 1.00 3.77  ? 156 ILE A CA  1 
ATOM   1209 C C   . ILE A 1 156 ? 11.836 28.051 54.517 1.00 7.00  ? 156 ILE A C   1 
ATOM   1210 O O   . ILE A 1 156 ? 12.249 28.115 55.676 1.00 6.40  ? 156 ILE A O   1 
ATOM   1211 C CB  . ILE A 1 156 ? 13.590 27.191 52.949 1.00 7.81  ? 156 ILE A CB  1 
ATOM   1212 C CG1 . ILE A 1 156 ? 14.578 26.846 54.072 1.00 6.92  ? 156 ILE A CG1 1 
ATOM   1213 C CG2 . ILE A 1 156 ? 14.336 27.474 51.642 1.00 5.72  ? 156 ILE A CG2 1 
ATOM   1214 C CD1 . ILE A 1 156 ? 15.491 25.658 53.726 1.00 4.00  ? 156 ILE A CD1 1 
ATOM   1215 N N   . ALA A 1 157 ? 10.599 27.687 54.222 1.00 5.13  ? 157 ALA A N   1 
ATOM   1216 C CA  . ALA A 1 157 ? 9.677  27.356 55.285 1.00 5.02  ? 157 ALA A CA  1 
ATOM   1217 C C   . ALA A 1 157 ? 8.701  26.273 54.887 1.00 4.37  ? 157 ALA A C   1 
ATOM   1218 O O   . ALA A 1 157 ? 8.440  26.045 53.702 1.00 8.63  ? 157 ALA A O   1 
ATOM   1219 C CB  . ALA A 1 157 ? 8.913  28.594 55.715 1.00 1.90  ? 157 ALA A CB  1 
ATOM   1220 N N   . LEU A 1 158 ? 8.162  25.620 55.908 1.00 7.18  ? 158 LEU A N   1 
ATOM   1221 C CA  . LEU A 1 158 ? 7.171  24.565 55.765 1.00 6.92  ? 158 LEU A CA  1 
ATOM   1222 C C   . LEU A 1 158 ? 6.018  25.107 56.601 1.00 10.78 ? 158 LEU A C   1 
ATOM   1223 O O   . LEU A 1 158 ? 6.190  25.375 57.791 1.00 5.91  ? 158 LEU A O   1 
ATOM   1224 C CB  . LEU A 1 158 ? 7.708  23.268 56.373 1.00 4.78  ? 158 LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 158 ? 6.822  22.020 56.327 1.00 3.58  ? 158 LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 158 ? 6.556  21.611 54.896 1.00 8.19  ? 158 LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 158 ? 7.516  20.912 57.075 1.00 3.79  ? 158 LEU A CD2 1 
ATOM   1228 N N   . ASP A 1 159 ? 4.851  25.289 55.995 1.00 7.49  ? 159 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 159 ? 3.730  25.841 56.747 1.00 9.45  ? 159 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 159 ? 2.813  24.797 57.376 1.00 4.40  ? 159 ASP A C   1 
ATOM   1231 O O   . ASP A 1 159 ? 3.042  23.587 57.252 1.00 5.71  ? 159 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 159 ? 2.909  26.788 55.866 1.00 7.98  ? 159 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 159 ? 2.331  26.098 54.659 1.00 8.76  ? 159 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 159 ? 1.991  24.899 54.765 1.00 8.28  ? 159 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 159 ? 2.203  26.758 53.612 1.00 12.27 ? 159 ASP A OD2 1 
ATOM   1236 N N   . ALA A 1 160 ? 1.768  25.274 58.043 1.00 5.74  ? 160 ALA A N   1 
ATOM   1237 C CA  . ALA A 1 160 ? 0.812  24.387 58.716 1.00 13.67 ? 160 ALA A CA  1 
ATOM   1238 C C   . ALA A 1 160 ? 0.168  23.341 57.804 1.00 11.74 ? 160 ALA A C   1 
ATOM   1239 O O   . ALA A 1 160 ? -0.209 22.266 58.273 1.00 13.25 ? 160 ALA A O   1 
ATOM   1240 C CB  . ALA A 1 160 ? -0.275 25.218 59.406 1.00 10.53 ? 160 ALA A CB  1 
ATOM   1241 N N   . GLN A 1 161 ? 0.048  23.653 56.512 1.00 12.03 ? 161 GLN A N   1 
ATOM   1242 C CA  . GLN A 1 161 ? -0.545 22.725 55.543 1.00 9.35  ? 161 GLN A CA  1 
ATOM   1243 C C   . GLN A 1 161 ? 0.497  21.728 55.051 1.00 9.89  ? 161 GLN A C   1 
ATOM   1244 O O   . GLN A 1 161 ? 0.200  20.849 54.236 1.00 11.62 ? 161 GLN A O   1 
ATOM   1245 C CB  . GLN A 1 161 ? -1.089 23.476 54.322 1.00 13.26 ? 161 GLN A CB  1 
ATOM   1246 C CG  . GLN A 1 161 ? -2.146 24.530 54.597 1.00 11.07 ? 161 GLN A CG  1 
ATOM   1247 C CD  . GLN A 1 161 ? -2.362 25.430 53.388 1.00 17.36 ? 161 GLN A CD  1 
ATOM   1248 O OE1 . GLN A 1 161 ? -2.848 24.988 52.348 1.00 19.29 ? 161 GLN A OE1 1 
ATOM   1249 N NE2 . GLN A 1 161 ? -1.984 26.698 53.519 1.00 18.82 ? 161 GLN A NE2 1 
ATOM   1250 N N   . GLY A 1 162 ? 1.725  21.880 55.526 1.00 9.32  ? 162 GLY A N   1 
ATOM   1251 C CA  . GLY A 1 162 ? 2.782  20.984 55.106 1.00 5.34  ? 162 GLY A CA  1 
ATOM   1252 C C   . GLY A 1 162 ? 3.330  21.374 53.741 1.00 7.53  ? 162 GLY A C   1 
ATOM   1253 O O   . GLY A 1 162 ? 3.915  20.542 53.049 1.00 11.97 ? 162 GLY A O   1 
ATOM   1254 N N   . ASN A 1 163 ? 3.137  22.633 53.352 1.00 6.77  ? 163 ASN A N   1 
ATOM   1255 C CA  . ASN A 1 163 ? 3.631  23.122 52.067 1.00 4.32  ? 163 ASN A CA  1 
ATOM   1256 C C   . ASN A 1 163 ? 4.940  23.883 52.247 1.00 9.27  ? 163 ASN A C   1 
ATOM   1257 O O   . ASN A 1 163 ? 5.140  24.574 53.249 1.00 5.89  ? 163 ASN A O   1 
ATOM   1258 C CB  . ASN A 1 163 ? 2.619  24.046 51.391 1.00 6.30  ? 163 ASN A CB  1 
ATOM   1259 C CG  . ASN A 1 163 ? 1.403  23.311 50.878 1.00 7.27  ? 163 ASN A CG  1 
ATOM   1260 O OD1 . ASN A 1 163 ? 1.492  22.158 50.444 1.00 10.26 ? 163 ASN A OD1 1 
ATOM   1261 N ND2 . ASN A 1 163 ? 0.259  23.979 50.904 1.00 10.74 ? 163 ASN A ND2 1 
ATOM   1262 N N   . LEU A 1 164 ? 5.818  23.758 51.257 1.00 7.42  ? 164 LEU A N   1 
ATOM   1263 C CA  . LEU A 1 164 ? 7.113  24.411 51.284 1.00 7.69  ? 164 LEU A CA  1 
ATOM   1264 C C   . LEU A 1 164 ? 7.162  25.603 50.333 1.00 6.49  ? 164 LEU A C   1 
ATOM   1265 O O   . LEU A 1 164 ? 6.440  25.657 49.343 1.00 7.47  ? 164 LEU A O   1 
ATOM   1266 C CB  . LEU A 1 164 ? 8.199  23.410 50.880 1.00 1.65  ? 164 LEU A CB  1 
ATOM   1267 C CG  . LEU A 1 164 ? 8.428  22.197 51.791 1.00 4.64  ? 164 LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1 164 ? 9.037  21.056 50.994 1.00 7.44  ? 164 LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1 164 ? 9.339  22.597 52.937 1.00 10.29 ? 164 LEU A CD2 1 
ATOM   1270 N N   . SER A 1 165 ? 8.015  26.570 50.658 1.00 6.85  ? 165 SER A N   1 
ATOM   1271 C CA  . SER A 1 165 ? 8.214  27.746 49.822 1.00 5.50  ? 165 SER A CA  1 
ATOM   1272 C C   . SER A 1 165 ? 9.529  28.367 50.235 1.00 5.24  ? 165 SER A C   1 
ATOM   1273 O O   . SER A 1 165 ? 10.019 28.121 51.334 1.00 5.72  ? 165 SER A O   1 
ATOM   1274 C CB  . SER A 1 165 ? 7.080  28.758 49.993 1.00 2.77  ? 165 SER A CB  1 
ATOM   1275 O OG  . SER A 1 165 ? 5.881  28.286 49.421 1.00 4.62  ? 165 SER A OG  1 
ATOM   1276 N N   . GLY A 1 166 ? 10.102 29.178 49.356 1.00 4.05  ? 166 GLY A N   1 
ATOM   1277 C CA  . GLY A 1 166 ? 11.374 29.795 49.681 1.00 4.85  ? 166 GLY A CA  1 
ATOM   1278 C C   . GLY A 1 166 ? 11.554 31.112 48.968 1.00 3.82  ? 166 GLY A C   1 
ATOM   1279 O O   . GLY A 1 166 ? 10.895 31.388 47.970 1.00 1.12  ? 166 GLY A O   1 
ATOM   1280 N N   . ALA A 1 167 ? 12.456 31.926 49.497 1.00 5.31  ? 167 ALA A N   1 
ATOM   1281 C CA  . ALA A 1 167 ? 12.741 33.229 48.926 1.00 5.83  ? 167 ALA A CA  1 
ATOM   1282 C C   . ALA A 1 167 ? 14.221 33.535 49.146 1.00 4.84  ? 167 ALA A C   1 
ATOM   1283 O O   . ALA A 1 167 ? 14.804 33.164 50.173 1.00 4.02  ? 167 ALA A O   1 
ATOM   1284 C CB  . ALA A 1 167 ? 11.877 34.286 49.608 1.00 5.35  ? 167 ALA A CB  1 
ATOM   1285 N N   . CYS A 1 168 ? 14.822 34.208 48.174 1.00 5.41  ? 168 CYS A N   1 
ATOM   1286 C CA  . CYS A 1 168 ? 16.225 34.567 48.240 1.00 6.84  ? 168 CYS A CA  1 
ATOM   1287 C C   . CYS A 1 168 ? 16.348 35.962 47.644 1.00 9.54  ? 168 CYS A C   1 
ATOM   1288 O O   . CYS A 1 168 ? 15.839 36.226 46.556 1.00 9.60  ? 168 CYS A O   1 
ATOM   1289 C CB  . CYS A 1 168 ? 17.056 33.571 47.426 1.00 9.86  ? 168 CYS A CB  1 
ATOM   1290 S SG  . CYS A 1 168 ? 18.813 33.710 47.682 1.00 16.61 ? 168 CYS A SG  1 
ATOM   1291 N N   . THR A 1 169 ? 17.006 36.863 48.363 1.00 5.53  ? 169 THR A N   1 
ATOM   1292 C CA  . THR A 1 169 ? 17.169 38.222 47.872 1.00 6.76  ? 169 THR A CA  1 
ATOM   1293 C C   . THR A 1 169 ? 18.542 38.741 48.297 1.00 8.91  ? 169 THR A C   1 
ATOM   1294 O O   . THR A 1 169 ? 18.983 38.519 49.427 1.00 8.85  ? 169 THR A O   1 
ATOM   1295 C CB  . THR A 1 169 ? 16.028 39.119 48.413 1.00 6.92  ? 169 THR A CB  1 
ATOM   1296 O OG1 . THR A 1 169 ? 16.227 40.472 47.991 1.00 7.16  ? 169 THR A OG1 1 
ATOM   1297 C CG2 . THR A 1 169 ? 15.973 39.046 49.938 1.00 8.06  ? 169 THR A CG2 1 
ATOM   1298 N N   . THR A 1 170 ? 19.209 39.442 47.385 1.00 6.44  ? 170 THR A N   1 
ATOM   1299 C CA  . THR A 1 170 ? 20.553 39.940 47.641 1.00 9.46  ? 170 THR A CA  1 
ATOM   1300 C C   . THR A 1 170 ? 20.850 41.201 46.838 1.00 9.26  ? 170 THR A C   1 
ATOM   1301 O O   . THR A 1 170 ? 20.113 41.554 45.917 1.00 5.90  ? 170 THR A O   1 
ATOM   1302 C CB  . THR A 1 170 ? 21.578 38.876 47.206 1.00 8.52  ? 170 THR A CB  1 
ATOM   1303 O OG1 . THR A 1 170 ? 22.906 39.297 47.530 1.00 9.22  ? 170 THR A OG1 1 
ATOM   1304 C CG2 . THR A 1 170 ? 21.497 38.671 45.699 1.00 9.18  ? 170 THR A CG2 1 
ATOM   1305 N N   . SER A 1 171 ? 21.939 41.871 47.196 1.00 6.97  ? 171 SER A N   1 
ATOM   1306 C CA  . SER A 1 171 ? 22.383 43.044 46.461 1.00 12.18 ? 171 SER A CA  1 
ATOM   1307 C C   . SER A 1 171 ? 23.620 42.572 45.702 1.00 9.57  ? 171 SER A C   1 
ATOM   1308 O O   . SER A 1 171 ? 24.254 43.327 44.965 1.00 8.54  ? 171 SER A O   1 
ATOM   1309 C CB  . SER A 1 171 ? 22.726 44.191 47.418 1.00 14.97 ? 171 SER A CB  1 
ATOM   1310 O OG  . SER A 1 171 ? 23.593 43.752 48.439 1.00 12.82 ? 171 SER A OG  1 
ATOM   1311 N N   . GLY A 1 172 ? 23.954 41.297 45.891 1.00 8.39  ? 172 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 172 ? 25.094 40.710 45.201 1.00 8.75  ? 172 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 172 ? 26.448 41.098 45.759 1.00 6.74  ? 172 GLY A C   1 
ATOM   1314 O O   . GLY A 1 172 ? 26.539 41.795 46.761 1.00 6.04  ? 172 GLY A O   1 
ATOM   1315 N N   . MET A 1 173 ? 27.511 40.640 45.114 1.00 9.54  ? 173 MET A N   1 
ATOM   1316 C CA  . MET A 1 173 ? 28.852 40.960 45.577 1.00 12.51 ? 173 MET A CA  1 
ATOM   1317 C C   . MET A 1 173 ? 29.123 42.454 45.444 1.00 10.61 ? 173 MET A C   1 
ATOM   1318 O O   . MET A 1 173 ? 28.908 43.048 44.391 1.00 9.31  ? 173 MET A O   1 
ATOM   1319 C CB  . MET A 1 173 ? 29.886 40.157 44.785 1.00 11.30 ? 173 MET A CB  1 
ATOM   1320 C CG  . MET A 1 173 ? 30.709 39.213 45.653 1.00 33.35 ? 173 MET A CG  1 
ATOM   1321 S SD  . MET A 1 173 ? 29.710 38.240 46.837 1.00 38.37 ? 173 MET A SD  1 
ATOM   1322 C CE  . MET A 1 173 ? 29.677 36.619 46.051 1.00 39.37 ? 173 MET A CE  1 
ATOM   1323 N N   . ALA A 1 174 ? 29.580 43.060 46.529 1.00 9.00  ? 174 ALA A N   1 
ATOM   1324 C CA  . ALA A 1 174 ? 29.879 44.485 46.520 1.00 13.60 ? 174 ALA A CA  1 
ATOM   1325 C C   . ALA A 1 174 ? 30.934 44.796 45.463 1.00 9.02  ? 174 ALA A C   1 
ATOM   1326 O O   . ALA A 1 174 ? 31.926 44.079 45.331 1.00 7.31  ? 174 ALA A O   1 
ATOM   1327 C CB  . ALA A 1 174 ? 30.374 44.917 47.894 1.00 15.97 ? 174 ALA A CB  1 
ATOM   1328 N N   . TYR A 1 175 ? 30.690 45.855 44.696 1.00 8.95  ? 175 TYR A N   1 
ATOM   1329 C CA  . TYR A 1 175 ? 31.620 46.309 43.670 1.00 10.33 ? 175 TYR A CA  1 
ATOM   1330 C C   . TYR A 1 175 ? 31.823 45.335 42.514 1.00 9.98  ? 175 TYR A C   1 
ATOM   1331 O O   . TYR A 1 175 ? 32.854 45.342 41.840 1.00 12.27 ? 175 TYR A O   1 
ATOM   1332 C CB  . TYR A 1 175 ? 32.950 46.664 44.342 1.00 14.83 ? 175 TYR A CB  1 
ATOM   1333 C CG  . TYR A 1 175 ? 32.732 47.491 45.587 1.00 11.80 ? 175 TYR A CG  1 
ATOM   1334 C CD1 . TYR A 1 175 ? 33.371 47.172 46.780 1.00 13.54 ? 175 TYR A CD1 1 
ATOM   1335 C CD2 . TYR A 1 175 ? 31.828 48.559 45.586 1.00 11.35 ? 175 TYR A CD2 1 
ATOM   1336 C CE1 . TYR A 1 175 ? 33.113 47.891 47.949 1.00 13.12 ? 175 TYR A CE1 1 
ATOM   1337 C CE2 . TYR A 1 175 ? 31.563 49.281 46.747 1.00 8.46  ? 175 TYR A CE2 1 
ATOM   1338 C CZ  . TYR A 1 175 ? 32.214 48.934 47.925 1.00 11.80 ? 175 TYR A CZ  1 
ATOM   1339 O OH  . TYR A 1 175 ? 31.952 49.629 49.082 1.00 15.50 ? 175 TYR A OH  1 
ATOM   1340 N N   . LYS A 1 176 ? 30.814 44.501 42.290 1.00 11.30 ? 176 LYS A N   1 
ATOM   1341 C CA  . LYS A 1 176 ? 30.816 43.534 41.197 1.00 6.31  ? 176 LYS A CA  1 
ATOM   1342 C C   . LYS A 1 176 ? 30.802 44.345 39.893 1.00 10.52 ? 176 LYS A C   1 
ATOM   1343 O O   . LYS A 1 176 ? 30.551 45.551 39.915 1.00 8.45  ? 176 LYS A O   1 
ATOM   1344 C CB  . LYS A 1 176 ? 29.534 42.695 41.273 1.00 7.13  ? 176 LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 176 ? 28.283 43.575 41.216 1.00 3.96  ? 176 LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 176 ? 27.010 42.814 41.507 1.00 7.51  ? 176 LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 176 ? 25.856 43.772 41.688 1.00 2.46  ? 176 LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 176 ? 24.636 43.114 42.251 1.00 8.22  ? 176 LYS A NZ  1 
ATOM   1349 N N   . MET A 1 177 ? 31.079 43.693 38.769 1.00 7.54  ? 177 MET A N   1 
ATOM   1350 C CA  . MET A 1 177 ? 31.036 44.373 37.478 1.00 8.87  ? 177 MET A CA  1 
ATOM   1351 C C   . MET A 1 177 ? 29.566 44.687 37.252 1.00 9.49  ? 177 MET A C   1 
ATOM   1352 O O   . MET A 1 177 ? 28.689 43.946 37.713 1.00 3.03  ? 177 MET A O   1 
ATOM   1353 C CB  . MET A 1 177 ? 31.522 43.449 36.354 1.00 6.58  ? 177 MET A CB  1 
ATOM   1354 C CG  . MET A 1 177 ? 33.007 43.094 36.400 1.00 4.40  ? 177 MET A CG  1 
ATOM   1355 S SD  . MET A 1 177 ? 33.448 41.948 35.082 1.00 10.59 ? 177 MET A SD  1 
ATOM   1356 C CE  . MET A 1 177 ? 33.134 42.980 33.635 1.00 12.43 ? 177 MET A CE  1 
ATOM   1357 N N   . HIS A 1 178 ? 29.282 45.771 36.541 1.00 4.13  ? 178 HIS A N   1 
ATOM   1358 C CA  . HIS A 1 178 ? 27.897 46.116 36.295 1.00 7.59  ? 178 HIS A CA  1 
ATOM   1359 C C   . HIS A 1 178 ? 27.243 44.973 35.529 1.00 8.36  ? 178 HIS A C   1 
ATOM   1360 O O   . HIS A 1 178 ? 27.821 44.449 34.578 1.00 9.19  ? 178 HIS A O   1 
ATOM   1361 C CB  . HIS A 1 178 ? 27.781 47.407 35.484 1.00 9.12  ? 178 HIS A CB  1 
ATOM   1362 C CG  . HIS A 1 178 ? 26.364 47.830 35.259 1.00 11.82 ? 178 HIS A CG  1 
ATOM   1363 N ND1 . HIS A 1 178 ? 25.538 48.230 36.288 1.00 12.31 ? 178 HIS A ND1 1 
ATOM   1364 C CD2 . HIS A 1 178 ? 25.605 47.853 34.136 1.00 11.73 ? 178 HIS A CD2 1 
ATOM   1365 C CE1 . HIS A 1 178 ? 24.331 48.481 35.809 1.00 10.38 ? 178 HIS A CE1 1 
ATOM   1366 N NE2 . HIS A 1 178 ? 24.345 48.258 34.507 1.00 13.87 ? 178 HIS A NE2 1 
ATOM   1367 N N   . GLY A 1 179 ? 26.048 44.581 35.959 1.00 7.46  ? 179 GLY A N   1 
ATOM   1368 C CA  . GLY A 1 179 ? 25.347 43.502 35.294 1.00 4.45  ? 179 GLY A CA  1 
ATOM   1369 C C   . GLY A 1 179 ? 25.672 42.117 35.830 1.00 7.50  ? 179 GLY A C   1 
ATOM   1370 O O   . GLY A 1 179 ? 25.121 41.134 35.357 1.00 5.06  ? 179 GLY A O   1 
ATOM   1371 N N   . ARG A 1 180 ? 26.557 42.020 36.813 1.00 6.35  ? 180 ARG A N   1 
ATOM   1372 C CA  . ARG A 1 180 ? 26.897 40.715 37.361 1.00 7.59  ? 180 ARG A CA  1 
ATOM   1373 C C   . ARG A 1 180 ? 25.714 40.121 38.111 1.00 5.12  ? 180 ARG A C   1 
ATOM   1374 O O   . ARG A 1 180 ? 25.093 40.784 38.942 1.00 9.17  ? 180 ARG A O   1 
ATOM   1375 C CB  . ARG A 1 180 ? 28.105 40.820 38.302 1.00 4.03  ? 180 ARG A CB  1 
ATOM   1376 C CG  . ARG A 1 180 ? 28.447 39.531 39.038 1.00 6.77  ? 180 ARG A CG  1 
ATOM   1377 C CD  . ARG A 1 180 ? 27.652 39.380 40.333 1.00 9.46  ? 180 ARG A CD  1 
ATOM   1378 N NE  . ARG A 1 180 ? 28.138 38.255 41.130 1.00 7.25  ? 180 ARG A NE  1 
ATOM   1379 C CZ  . ARG A 1 180 ? 27.630 37.892 42.305 1.00 2.88  ? 180 ARG A CZ  1 
ATOM   1380 N NH1 . ARG A 1 180 ? 26.613 38.562 42.826 1.00 6.13  ? 180 ARG A NH1 1 
ATOM   1381 N NH2 . ARG A 1 180 ? 28.145 36.865 42.966 1.00 6.97  ? 180 ARG A NH2 1 
ATOM   1382 N N   . VAL A 1 181 ? 25.410 38.870 37.805 1.00 5.21  ? 181 VAL A N   1 
ATOM   1383 C CA  . VAL A 1 181 ? 24.312 38.168 38.455 1.00 8.24  ? 181 VAL A CA  1 
ATOM   1384 C C   . VAL A 1 181 ? 24.869 36.975 39.209 1.00 6.47  ? 181 VAL A C   1 
ATOM   1385 O O   . VAL A 1 181 ? 25.654 36.197 38.663 1.00 6.90  ? 181 VAL A O   1 
ATOM   1386 C CB  . VAL A 1 181 ? 23.264 37.674 37.434 1.00 7.24  ? 181 VAL A CB  1 
ATOM   1387 C CG1 . VAL A 1 181 ? 22.191 36.813 38.146 1.00 3.99  ? 181 VAL A CG1 1 
ATOM   1388 C CG2 . VAL A 1 181 ? 22.592 38.864 36.777 1.00 7.73  ? 181 VAL A CG2 1 
ATOM   1389 N N   . GLY A 1 182 ? 24.466 36.852 40.471 1.00 7.87  ? 182 GLY A N   1 
ATOM   1390 C CA  . GLY A 1 182 ? 24.911 35.754 41.301 1.00 8.70  ? 182 GLY A CA  1 
ATOM   1391 C C   . GLY A 1 182 ? 23.931 34.595 41.289 1.00 8.72  ? 182 GLY A C   1 
ATOM   1392 O O   . GLY A 1 182 ? 23.127 34.449 40.373 1.00 4.79  ? 182 GLY A O   1 
ATOM   1393 N N   . ASP A 1 183 ? 23.999 33.773 42.328 1.00 7.73  ? 183 ASP A N   1 
ATOM   1394 C CA  . ASP A 1 183 ? 23.153 32.599 42.461 1.00 7.14  ? 183 ASP A CA  1 
ATOM   1395 C C   . ASP A 1 183 ? 21.742 32.884 42.966 1.00 6.29  ? 183 ASP A C   1 
ATOM   1396 O O   . ASP A 1 183 ? 20.814 32.120 42.704 1.00 5.93  ? 183 ASP A O   1 
ATOM   1397 C CB  . ASP A 1 183 ? 23.811 31.625 43.438 1.00 4.89  ? 183 ASP A CB  1 
ATOM   1398 C CG  . ASP A 1 183 ? 23.866 32.182 44.838 1.00 5.84  ? 183 ASP A CG  1 
ATOM   1399 O OD1 . ASP A 1 183 ? 24.428 33.287 45.009 1.00 8.24  ? 183 ASP A OD1 1 
ATOM   1400 O OD2 . ASP A 1 183 ? 23.341 31.531 45.767 1.00 12.21 ? 183 ASP A OD2 1 
ATOM   1401 N N   . SER A 1 184 ? 21.588 33.983 43.690 1.00 5.50  ? 184 SER A N   1 
ATOM   1402 C CA  . SER A 1 184 ? 20.311 34.338 44.301 1.00 9.34  ? 184 SER A CA  1 
ATOM   1403 C C   . SER A 1 184 ? 19.033 34.338 43.462 1.00 6.76  ? 184 SER A C   1 
ATOM   1404 O O   . SER A 1 184 ? 17.967 34.003 43.979 1.00 7.99  ? 184 SER A O   1 
ATOM   1405 C CB  . SER A 1 184 ? 20.461 35.677 45.025 1.00 6.53  ? 184 SER A CB  1 
ATOM   1406 O OG  . SER A 1 184 ? 21.478 35.582 46.011 1.00 7.68  ? 184 SER A OG  1 
ATOM   1407 N N   . PRO A 1 185 ? 19.109 34.725 42.174 1.00 4.31  ? 185 PRO A N   1 
ATOM   1408 C CA  . PRO A 1 185 ? 17.881 34.722 41.366 1.00 5.24  ? 185 PRO A CA  1 
ATOM   1409 C C   . PRO A 1 185 ? 17.764 33.478 40.491 1.00 8.50  ? 185 PRO A C   1 
ATOM   1410 O O   . PRO A 1 185 ? 16.800 33.330 39.737 1.00 7.98  ? 185 PRO A O   1 
ATOM   1411 C CB  . PRO A 1 185 ? 18.045 35.963 40.515 1.00 6.50  ? 185 PRO A CB  1 
ATOM   1412 C CG  . PRO A 1 185 ? 19.512 35.855 40.145 1.00 1.90  ? 185 PRO A CG  1 
ATOM   1413 C CD  . PRO A 1 185 ? 20.163 35.512 41.499 1.00 1.12  ? 185 PRO A CD  1 
ATOM   1414 N N   . ILE A 1 186 ? 18.747 32.590 40.591 1.00 6.15  ? 186 ILE A N   1 
ATOM   1415 C CA  . ILE A 1 186 ? 18.767 31.383 39.778 1.00 6.13  ? 186 ILE A CA  1 
ATOM   1416 C C   . ILE A 1 186 ? 18.175 30.152 40.463 1.00 7.76  ? 186 ILE A C   1 
ATOM   1417 O O   . ILE A 1 186 ? 18.696 29.667 41.471 1.00 7.11  ? 186 ILE A O   1 
ATOM   1418 C CB  . ILE A 1 186 ? 20.200 31.080 39.312 1.00 7.33  ? 186 ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 186 ? 20.722 32.265 38.488 1.00 10.63 ? 186 ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 186 ? 20.229 29.795 38.470 1.00 7.95  ? 186 ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 186 ? 22.148 32.084 37.981 1.00 18.29 ? 186 ILE A CD1 1 
ATOM   1422 N N   . ILE A 1 187 ? 17.074 29.663 39.897 1.00 2.39  ? 187 ILE A N   1 
ATOM   1423 C CA  . ILE A 1 187 ? 16.381 28.493 40.418 1.00 4.12  ? 187 ILE A CA  1 
ATOM   1424 C C   . ILE A 1 187 ? 17.299 27.278 40.315 1.00 4.54  ? 187 ILE A C   1 
ATOM   1425 O O   . ILE A 1 187 ? 17.783 26.937 39.236 1.00 7.20  ? 187 ILE A O   1 
ATOM   1426 C CB  . ILE A 1 187 ? 15.073 28.243 39.633 1.00 8.21  ? 187 ILE A CB  1 
ATOM   1427 C CG1 . ILE A 1 187 ? 14.171 29.480 39.740 1.00 8.40  ? 187 ILE A CG1 1 
ATOM   1428 C CG2 . ILE A 1 187 ? 14.350 27.001 40.168 1.00 3.44  ? 187 ILE A CG2 1 
ATOM   1429 C CD1 . ILE A 1 187 ? 13.737 29.815 41.165 1.00 10.11 ? 187 ILE A CD1 1 
ATOM   1430 N N   . GLY A 1 188 ? 17.538 26.631 41.450 1.00 4.30  ? 188 GLY A N   1 
ATOM   1431 C CA  . GLY A 1 188 ? 18.419 25.481 41.467 1.00 3.74  ? 188 GLY A CA  1 
ATOM   1432 C C   . GLY A 1 188 ? 19.794 25.870 41.975 1.00 4.78  ? 188 GLY A C   1 
ATOM   1433 O O   . GLY A 1 188 ? 20.597 25.008 42.347 1.00 5.99  ? 188 GLY A O   1 
ATOM   1434 N N   . ALA A 1 189 ? 20.085 27.169 41.977 1.00 4.41  ? 189 ALA A N   1 
ATOM   1435 C CA  . ALA A 1 189 ? 21.371 27.642 42.472 1.00 6.70  ? 189 ALA A CA  1 
ATOM   1436 C C   . ALA A 1 189 ? 21.147 28.185 43.880 1.00 10.16 ? 189 ALA A C   1 
ATOM   1437 O O   . ALA A 1 189 ? 21.307 27.461 44.858 1.00 7.37  ? 189 ALA A O   1 
ATOM   1438 C CB  . ALA A 1 189 ? 21.941 28.731 41.554 1.00 8.96  ? 189 ALA A CB  1 
ATOM   1439 N N   . GLY A 1 190 ? 20.748 29.447 43.977 1.00 5.31  ? 190 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 190 ? 20.510 30.034 45.279 1.00 5.17  ? 190 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 190 ? 19.304 29.462 46.005 1.00 7.10  ? 190 GLY A C   1 
ATOM   1442 O O   . GLY A 1 190 ? 19.271 29.454 47.237 1.00 6.54  ? 190 GLY A O   1 
ATOM   1443 N N   . LEU A 1 191 ? 18.332 28.955 45.251 1.00 4.12  ? 191 LEU A N   1 
ATOM   1444 C CA  . LEU A 1 191 ? 17.105 28.429 45.848 1.00 4.01  ? 191 LEU A CA  1 
ATOM   1445 C C   . LEU A 1 191 ? 16.413 27.357 45.019 1.00 4.68  ? 191 LEU A C   1 
ATOM   1446 O O   . LEU A 1 191 ? 16.389 27.427 43.793 1.00 6.78  ? 191 LEU A O   1 
ATOM   1447 C CB  . LEU A 1 191 ? 16.116 29.584 46.043 1.00 1.12  ? 191 LEU A CB  1 
ATOM   1448 C CG  . LEU A 1 191 ? 14.689 29.264 46.501 1.00 4.63  ? 191 LEU A CG  1 
ATOM   1449 C CD1 . LEU A 1 191 ? 14.718 28.907 47.979 1.00 3.78  ? 191 LEU A CD1 1 
ATOM   1450 C CD2 . LEU A 1 191 ? 13.764 30.469 46.265 1.00 6.62  ? 191 LEU A CD2 1 
ATOM   1451 N N   . PHE A 1 192 ? 15.856 26.354 45.696 1.00 6.69  ? 192 PHE A N   1 
ATOM   1452 C CA  . PHE A 1 192 ? 15.084 25.327 45.013 1.00 5.36  ? 192 PHE A CA  1 
ATOM   1453 C C   . PHE A 1 192 ? 14.104 24.714 45.996 1.00 7.20  ? 192 PHE A C   1 
ATOM   1454 O O   . PHE A 1 192 ? 14.462 24.412 47.132 1.00 3.16  ? 192 PHE A O   1 
ATOM   1455 C CB  . PHE A 1 192 ? 15.953 24.227 44.397 1.00 6.34  ? 192 PHE A CB  1 
ATOM   1456 C CG  . PHE A 1 192 ? 15.175 23.302 43.494 1.00 7.23  ? 192 PHE A CG  1 
ATOM   1457 C CD1 . PHE A 1 192 ? 14.852 22.012 43.898 1.00 6.56  ? 192 PHE A CD1 1 
ATOM   1458 C CD2 . PHE A 1 192 ? 14.697 23.760 42.260 1.00 5.78  ? 192 PHE A CD2 1 
ATOM   1459 C CE1 . PHE A 1 192 ? 14.057 21.191 43.090 1.00 12.34 ? 192 PHE A CE1 1 
ATOM   1460 C CE2 . PHE A 1 192 ? 13.904 22.948 41.449 1.00 1.12  ? 192 PHE A CE2 1 
ATOM   1461 C CZ  . PHE A 1 192 ? 13.582 21.665 41.861 1.00 11.94 ? 192 PHE A CZ  1 
ATOM   1462 N N   . VAL A 1 193 ? 12.864 24.551 45.550 1.00 9.43  ? 193 VAL A N   1 
ATOM   1463 C CA  . VAL A 1 193 ? 11.802 23.983 46.372 1.00 8.31  ? 193 VAL A CA  1 
ATOM   1464 C C   . VAL A 1 193 ? 11.045 22.921 45.585 1.00 6.96  ? 193 VAL A C   1 
ATOM   1465 O O   . VAL A 1 193 ? 10.666 23.142 44.435 1.00 11.38 ? 193 VAL A O   1 
ATOM   1466 C CB  . VAL A 1 193 ? 10.770 25.072 46.801 1.00 3.59  ? 193 VAL A CB  1 
ATOM   1467 C CG1 . VAL A 1 193 ? 9.647  24.443 47.633 1.00 3.73  ? 193 VAL A CG1 1 
ATOM   1468 C CG2 . VAL A 1 193 ? 11.461 26.168 47.608 1.00 5.06  ? 193 VAL A CG2 1 
ATOM   1469 N N   . ASP A 1 194 ? 10.859 21.759 46.192 1.00 10.54 ? 194 ASP A N   1 
ATOM   1470 C CA  . ASP A 1 194 ? 10.082 20.701 45.568 1.00 6.79  ? 194 ASP A CA  1 
ATOM   1471 C C   . ASP A 1 194 ? 9.165  20.250 46.694 1.00 3.13  ? 194 ASP A C   1 
ATOM   1472 O O   . ASP A 1 194 ? 9.615  19.637 47.655 1.00 7.13  ? 194 ASP A O   1 
ATOM   1473 C CB  . ASP A 1 194 ? 10.961 19.540 45.102 1.00 12.81 ? 194 ASP A CB  1 
ATOM   1474 C CG  . ASP A 1 194 ? 10.164 18.479 44.364 1.00 19.25 ? 194 ASP A CG  1 
ATOM   1475 O OD1 . ASP A 1 194 ? 9.047  18.179 44.817 1.00 10.66 ? 194 ASP A OD1 1 
ATOM   1476 O OD2 . ASP A 1 194 ? 10.651 17.946 43.345 1.00 24.22 ? 194 ASP A OD2 1 
ATOM   1477 N N   . ASN A 1 195 ? 7.878  20.553 46.572 1.00 10.19 ? 195 ASN A N   1 
ATOM   1478 C CA  . ASN A 1 195 ? 6.933  20.227 47.632 1.00 12.44 ? 195 ASN A CA  1 
ATOM   1479 C C   . ASN A 1 195 ? 6.816  18.766 48.028 1.00 11.57 ? 195 ASN A C   1 
ATOM   1480 O O   . ASN A 1 195 ? 6.311  18.456 49.104 1.00 15.36 ? 195 ASN A O   1 
ATOM   1481 C CB  . ASN A 1 195 ? 5.548  20.783 47.302 1.00 14.15 ? 195 ASN A CB  1 
ATOM   1482 C CG  . ASN A 1 195 ? 4.736  21.060 48.551 1.00 16.64 ? 195 ASN A CG  1 
ATOM   1483 O OD1 . ASN A 1 195 ? 5.263  21.606 49.518 1.00 18.59 ? 195 ASN A OD1 1 
ATOM   1484 N ND2 . ASN A 1 195 ? 3.455  20.693 48.540 1.00 15.36 ? 195 ASN A ND2 1 
ATOM   1485 N N   . GLU A 1 196 ? 7.272  17.861 47.174 1.00 10.98 ? 196 GLU A N   1 
ATOM   1486 C CA  . GLU A 1 196 ? 7.206  16.441 47.519 1.00 17.34 ? 196 GLU A CA  1 
ATOM   1487 C C   . GLU A 1 196 ? 8.485  15.994 48.214 1.00 21.03 ? 196 GLU A C   1 
ATOM   1488 O O   . GLU A 1 196 ? 8.547  14.894 48.765 1.00 18.62 ? 196 GLU A O   1 
ATOM   1489 C CB  . GLU A 1 196 ? 7.031  15.584 46.267 1.00 20.79 ? 196 GLU A CB  1 
ATOM   1490 C CG  . GLU A 1 196 ? 5.605  15.287 45.867 1.00 30.51 ? 196 GLU A CG  1 
ATOM   1491 C CD  . GLU A 1 196 ? 5.547  14.323 44.699 1.00 37.41 ? 196 GLU A CD  1 
ATOM   1492 O OE1 . GLU A 1 196 ? 5.917  14.723 43.573 1.00 40.00 ? 196 GLU A OE1 1 
ATOM   1493 O OE2 . GLU A 1 196 ? 5.148  13.160 44.914 1.00 44.04 ? 196 GLU A OE2 1 
ATOM   1494 N N   . ILE A 1 197 ? 9.497  16.856 48.205 1.00 16.66 ? 197 ILE A N   1 
ATOM   1495 C CA  . ILE A 1 197 ? 10.790 16.497 48.768 1.00 12.00 ? 197 ILE A CA  1 
ATOM   1496 C C   . ILE A 1 197 ? 11.314 17.393 49.875 1.00 12.83 ? 197 ILE A C   1 
ATOM   1497 O O   . ILE A 1 197 ? 11.519 16.955 51.010 1.00 6.81  ? 197 ILE A O   1 
ATOM   1498 C CB  . ILE A 1 197 ? 11.842 16.461 47.646 1.00 10.12 ? 197 ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 197 ? 11.375 15.512 46.535 1.00 15.87 ? 197 ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 197 ? 13.187 15.998 48.194 1.00 11.09 ? 197 ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 197 ? 11.206 14.075 46.995 1.00 18.39 ? 197 ILE A CD1 1 
ATOM   1502 N N   . GLY A 1 198 ? 11.556 18.649 49.527 1.00 11.63 ? 198 GLY A N   1 
ATOM   1503 C CA  . GLY A 1 198 ? 12.078 19.588 50.494 1.00 9.07  ? 198 GLY A CA  1 
ATOM   1504 C C   . GLY A 1 198 ? 12.502 20.859 49.794 1.00 11.03 ? 198 GLY A C   1 
ATOM   1505 O O   . GLY A 1 198 ? 12.203 21.065 48.619 1.00 7.50  ? 198 GLY A O   1 
ATOM   1506 N N   . ALA A 1 199 ? 13.215 21.705 50.520 1.00 5.13  ? 199 ALA A N   1 
ATOM   1507 C CA  . ALA A 1 199 ? 13.670 22.971 49.985 1.00 5.64  ? 199 ALA A CA  1 
ATOM   1508 C C   . ALA A 1 199 ? 15.066 23.264 50.503 1.00 2.93  ? 199 ALA A C   1 
ATOM   1509 O O   . ALA A 1 199 ? 15.469 22.773 51.558 1.00 4.87  ? 199 ALA A O   1 
ATOM   1510 C CB  . ALA A 1 199 ? 12.714 24.082 50.420 1.00 6.23  ? 199 ALA A CB  1 
ATOM   1511 N N   . ALA A 1 200 ? 15.805 24.065 49.752 1.00 4.15  ? 200 ALA A N   1 
ATOM   1512 C CA  . ALA A 1 200 ? 17.147 24.431 50.157 1.00 1.93  ? 200 ALA A CA  1 
ATOM   1513 C C   . ALA A 1 200 ? 17.481 25.804 49.604 1.00 5.44  ? 200 ALA A C   1 
ATOM   1514 O O   . ALA A 1 200 ? 17.001 26.190 48.541 1.00 5.82  ? 200 ALA A O   1 
ATOM   1515 C CB  . ALA A 1 200 ? 18.150 23.408 49.640 1.00 3.57  ? 200 ALA A CB  1 
ATOM   1516 N N   . THR A 1 201 ? 18.285 26.556 50.345 1.00 7.80  ? 201 THR A N   1 
ATOM   1517 C CA  . THR A 1 201 ? 18.715 27.857 49.868 1.00 6.60  ? 201 THR A CA  1 
ATOM   1518 C C   . THR A 1 201 ? 20.191 27.959 50.229 1.00 6.68  ? 201 THR A C   1 
ATOM   1519 O O   . THR A 1 201 ? 20.650 27.338 51.193 1.00 5.80  ? 201 THR A O   1 
ATOM   1520 C CB  . THR A 1 201 ? 17.848 29.005 50.444 1.00 4.06  ? 201 THR A CB  1 
ATOM   1521 O OG1 . THR A 1 201 ? 18.144 30.217 49.732 1.00 9.75  ? 201 THR A OG1 1 
ATOM   1522 C CG2 . THR A 1 201 ? 18.101 29.200 51.919 1.00 4.17  ? 201 THR A CG2 1 
ATOM   1523 N N   . ALA A 1 202 ? 20.948 28.724 49.453 1.00 6.89  ? 202 ALA A N   1 
ATOM   1524 C CA  . ALA A 1 202 ? 22.389 28.800 49.659 1.00 7.35  ? 202 ALA A CA  1 
ATOM   1525 C C   . ALA A 1 202 ? 22.985 30.047 50.288 1.00 12.04 ? 202 ALA A C   1 
ATOM   1526 O O   . ALA A 1 202 ? 22.338 31.078 50.425 1.00 18.58 ? 202 ALA A O   1 
ATOM   1527 C CB  . ALA A 1 202 ? 23.086 28.547 48.327 1.00 7.36  ? 202 ALA A CB  1 
ATOM   1528 N N   . THR A 1 203 ? 24.258 29.915 50.641 1.00 17.82 ? 203 THR A N   1 
ATOM   1529 C CA  . THR A 1 203 ? 25.038 30.993 51.225 1.00 18.42 ? 203 THR A CA  1 
ATOM   1530 C C   . THR A 1 203 ? 26.416 30.857 50.604 1.00 14.74 ? 203 THR A C   1 
ATOM   1531 O O   . THR A 1 203 ? 26.840 29.754 50.248 1.00 17.47 ? 203 THR A O   1 
ATOM   1532 C CB  . THR A 1 203 ? 25.169 30.851 52.762 1.00 17.92 ? 203 THR A CB  1 
ATOM   1533 O OG1 . THR A 1 203 ? 25.938 31.944 53.278 1.00 15.75 ? 203 THR A OG1 1 
ATOM   1534 C CG2 . THR A 1 203 ? 25.865 29.539 53.128 1.00 21.06 ? 203 THR A CG2 1 
ATOM   1535 N N   . GLY A 1 204 ? 27.106 31.976 50.443 1.00 17.45 ? 204 GLY A N   1 
ATOM   1536 C CA  . GLY A 1 204 ? 28.435 31.920 49.871 1.00 16.71 ? 204 GLY A CA  1 
ATOM   1537 C C   . GLY A 1 204 ? 28.582 32.579 48.520 1.00 13.10 ? 204 GLY A C   1 
ATOM   1538 O O   . GLY A 1 204 ? 27.651 33.167 47.971 1.00 16.47 ? 204 GLY A O   1 
ATOM   1539 N N   . HIS A 1 205 ? 29.790 32.480 47.990 1.00 12.13 ? 205 HIS A N   1 
ATOM   1540 C CA  . HIS A 1 205 ? 30.121 33.056 46.701 1.00 11.74 ? 205 HIS A CA  1 
ATOM   1541 C C   . HIS A 1 205 ? 29.192 32.550 45.604 1.00 10.15 ? 205 HIS A C   1 
ATOM   1542 O O   . HIS A 1 205 ? 29.251 31.386 45.202 1.00 10.82 ? 205 HIS A O   1 
ATOM   1543 C CB  . HIS A 1 205 ? 31.583 32.754 46.385 1.00 12.39 ? 205 HIS A CB  1 
ATOM   1544 C CG  . HIS A 1 205 ? 32.543 33.481 47.276 1.00 20.50 ? 205 HIS A CG  1 
ATOM   1545 N ND1 . HIS A 1 205 ? 32.967 32.985 48.491 1.00 27.77 ? 205 HIS A ND1 1 
ATOM   1546 C CD2 . HIS A 1 205 ? 33.114 34.704 47.152 1.00 25.57 ? 205 HIS A CD2 1 
ATOM   1547 C CE1 . HIS A 1 205 ? 33.756 33.870 49.076 1.00 28.40 ? 205 HIS A CE1 1 
ATOM   1548 N NE2 . HIS A 1 205 ? 33.860 34.922 48.284 1.00 31.97 ? 205 HIS A NE2 1 
ATOM   1549 N N   . GLY A 1 206 ? 28.346 33.453 45.116 1.00 6.53  ? 206 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 206 ? 27.366 33.114 44.099 1.00 10.04 ? 206 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 206 ? 27.865 32.329 42.911 1.00 6.96  ? 206 GLY A C   1 
ATOM   1552 O O   . GLY A 1 206 ? 27.213 31.382 42.479 1.00 6.03  ? 206 GLY A O   1 
ATOM   1553 N N   . GLU A 1 207 ? 29.008 32.733 42.370 1.00 6.87  ? 207 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 207 ? 29.593 32.059 41.221 1.00 7.07  ? 207 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 207 ? 29.777 30.558 41.455 1.00 9.41  ? 207 GLU A C   1 
ATOM   1556 O O   . GLU A 1 207 ? 29.598 29.751 40.542 1.00 6.44  ? 207 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 207 ? 30.955 32.674 40.887 1.00 7.54  ? 207 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 207 ? 30.913 33.991 40.131 1.00 7.04  ? 207 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 207 ? 30.408 35.171 40.955 1.00 10.26 ? 207 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 207 ? 30.383 35.104 42.205 1.00 4.24  ? 207 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 207 ? 30.044 36.196 40.332 1.00 9.99  ? 207 GLU A OE2 1 
ATOM   1562 N N   . GLU A 1 208 ? 30.139 30.192 42.680 1.00 7.18  ? 208 GLU A N   1 
ATOM   1563 C CA  . GLU A 1 208 ? 30.365 28.792 43.020 1.00 3.25  ? 208 GLU A CA  1 
ATOM   1564 C C   . GLU A 1 208 ? 29.079 28.003 43.180 1.00 1.12  ? 208 GLU A C   1 
ATOM   1565 O O   . GLU A 1 208 ? 29.028 26.818 42.864 1.00 6.45  ? 208 GLU A O   1 
ATOM   1566 C CB  . GLU A 1 208 ? 31.205 28.702 44.290 1.00 3.26  ? 208 GLU A CB  1 
ATOM   1567 C CG  . GLU A 1 208 ? 32.562 29.348 44.152 1.00 1.96  ? 208 GLU A CG  1 
ATOM   1568 C CD  . GLU A 1 208 ? 33.289 28.912 42.888 1.00 8.39  ? 208 GLU A CD  1 
ATOM   1569 O OE1 . GLU A 1 208 ? 33.326 27.704 42.599 1.00 10.93 ? 208 GLU A OE1 1 
ATOM   1570 O OE2 . GLU A 1 208 ? 33.830 29.777 42.180 1.00 6.32  ? 208 GLU A OE2 1 
ATOM   1571 N N   . VAL A 1 209 ? 28.036 28.660 43.670 1.00 5.97  ? 209 VAL A N   1 
ATOM   1572 C CA  . VAL A 1 209 ? 26.751 28.001 43.840 1.00 7.18  ? 209 VAL A CA  1 
ATOM   1573 C C   . VAL A 1 209 ? 26.122 27.782 42.465 1.00 7.41  ? 209 VAL A C   1 
ATOM   1574 O O   . VAL A 1 209 ? 25.485 26.767 42.230 1.00 11.09 ? 209 VAL A O   1 
ATOM   1575 C CB  . VAL A 1 209 ? 25.814 28.843 44.735 1.00 6.14  ? 209 VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 209 ? 24.425 28.219 44.776 1.00 3.47  ? 209 VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 209 ? 26.391 28.908 46.150 1.00 6.55  ? 209 VAL A CG2 1 
ATOM   1578 N N   . ILE A 1 210 ? 26.310 28.740 41.560 1.00 8.23  ? 210 ILE A N   1 
ATOM   1579 C CA  . ILE A 1 210 ? 25.782 28.609 40.205 1.00 6.58  ? 210 ILE A CA  1 
ATOM   1580 C C   . ILE A 1 210 ? 26.493 27.434 39.533 1.00 8.64  ? 210 ILE A C   1 
ATOM   1581 O O   . ILE A 1 210 ? 25.860 26.551 38.962 1.00 6.04  ? 210 ILE A O   1 
ATOM   1582 C CB  . ILE A 1 210 ? 26.051 29.884 39.375 1.00 7.55  ? 210 ILE A CB  1 
ATOM   1583 C CG1 . ILE A 1 210 ? 25.138 31.014 39.852 1.00 7.91  ? 210 ILE A CG1 1 
ATOM   1584 C CG2 . ILE A 1 210 ? 25.844 29.606 37.882 1.00 5.98  ? 210 ILE A CG2 1 
ATOM   1585 C CD1 . ILE A 1 210 ? 25.396 32.344 39.150 1.00 7.20  ? 210 ILE A CD1 1 
ATOM   1586 N N   . ARG A 1 211 ? 27.819 27.445 39.629 1.00 7.73  ? 211 ARG A N   1 
ATOM   1587 C CA  . ARG A 1 211 ? 28.681 26.427 39.043 1.00 10.93 ? 211 ARG A CA  1 
ATOM   1588 C C   . ARG A 1 211 ? 28.256 25.002 39.387 1.00 9.28  ? 211 ARG A C   1 
ATOM   1589 O O   . ARG A 1 211 ? 28.324 24.102 38.548 1.00 8.22  ? 211 ARG A O   1 
ATOM   1590 C CB  . ARG A 1 211 ? 30.117 26.659 39.525 1.00 13.52 ? 211 ARG A CB  1 
ATOM   1591 C CG  . ARG A 1 211 ? 31.182 25.920 38.752 1.00 17.17 ? 211 ARG A CG  1 
ATOM   1592 C CD  . ARG A 1 211 ? 32.541 26.047 39.437 1.00 9.76  ? 211 ARG A CD  1 
ATOM   1593 N NE  . ARG A 1 211 ? 32.880 27.433 39.771 1.00 4.80  ? 211 ARG A NE  1 
ATOM   1594 C CZ  . ARG A 1 211 ? 33.100 28.392 38.873 1.00 11.56 ? 211 ARG A CZ  1 
ATOM   1595 N NH1 . ARG A 1 211 ? 33.018 28.123 37.574 1.00 10.53 ? 211 ARG A NH1 1 
ATOM   1596 N NH2 . ARG A 1 211 ? 33.406 29.617 39.274 1.00 6.29  ? 211 ARG A NH2 1 
ATOM   1597 N N   . THR A 1 212 ? 27.809 24.801 40.619 1.00 7.50  ? 212 THR A N   1 
ATOM   1598 C CA  . THR A 1 212 ? 27.418 23.479 41.071 1.00 7.84  ? 212 THR A CA  1 
ATOM   1599 C C   . THR A 1 212 ? 25.916 23.261 41.181 1.00 7.98  ? 212 THR A C   1 
ATOM   1600 O O   . THR A 1 212 ? 25.480 22.195 41.607 1.00 8.25  ? 212 THR A O   1 
ATOM   1601 C CB  . THR A 1 212 ? 28.073 23.170 42.430 1.00 13.54 ? 212 THR A CB  1 
ATOM   1602 O OG1 . THR A 1 212 ? 27.711 24.182 43.377 1.00 13.08 ? 212 THR A OG1 1 
ATOM   1603 C CG2 . THR A 1 212 ? 29.595 23.142 42.284 1.00 15.90 ? 212 THR A CG2 1 
ATOM   1604 N N   . VAL A 1 213 ? 25.132 24.270 40.800 1.00 5.52  ? 213 VAL A N   1 
ATOM   1605 C CA  . VAL A 1 213 ? 23.678 24.169 40.852 1.00 4.74  ? 213 VAL A CA  1 
ATOM   1606 C C   . VAL A 1 213 ? 23.340 23.612 42.232 1.00 3.44  ? 213 VAL A C   1 
ATOM   1607 O O   . VAL A 1 213 ? 22.536 22.691 42.390 1.00 6.94  ? 213 VAL A O   1 
ATOM   1608 C CB  . VAL A 1 213 ? 23.161 23.225 39.729 1.00 3.95  ? 213 VAL A CB  1 
ATOM   1609 C CG1 . VAL A 1 213 ? 21.664 23.429 39.507 1.00 5.73  ? 213 VAL A CG1 1 
ATOM   1610 C CG2 . VAL A 1 213 ? 23.926 23.494 38.441 1.00 5.17  ? 213 VAL A CG2 1 
ATOM   1611 N N   . GLY A 1 214 ? 23.978 24.227 43.223 1.00 5.44  ? 214 GLY A N   1 
ATOM   1612 C CA  . GLY A 1 214 ? 23.865 23.837 44.615 1.00 7.30  ? 214 GLY A CA  1 
ATOM   1613 C C   . GLY A 1 214 ? 22.558 23.399 45.247 1.00 7.13  ? 214 GLY A C   1 
ATOM   1614 O O   . GLY A 1 214 ? 22.491 22.295 45.777 1.00 4.33  ? 214 GLY A O   1 
ATOM   1615 N N   . THR A 1 215 ? 21.530 24.242 45.225 1.00 7.65  ? 215 THR A N   1 
ATOM   1616 C CA  . THR A 1 215 ? 20.279 23.857 45.868 1.00 8.10  ? 215 THR A CA  1 
ATOM   1617 C C   . THR A 1 215 ? 19.524 22.747 45.153 1.00 4.66  ? 215 THR A C   1 
ATOM   1618 O O   . THR A 1 215 ? 18.876 21.932 45.805 1.00 4.85  ? 215 THR A O   1 
ATOM   1619 C CB  . THR A 1 215 ? 19.362 25.074 46.098 1.00 6.23  ? 215 THR A CB  1 
ATOM   1620 O OG1 . THR A 1 215 ? 19.183 25.793 44.876 1.00 4.84  ? 215 THR A OG1 1 
ATOM   1621 C CG2 . THR A 1 215 ? 19.986 25.991 47.141 1.00 8.27  ? 215 THR A CG2 1 
ATOM   1622 N N   . HIS A 1 216 ? 19.604 22.690 43.828 1.00 5.78  ? 216 HIS A N   1 
ATOM   1623 C CA  . HIS A 1 216 ? 18.909 21.608 43.142 1.00 6.86  ? 216 HIS A CA  1 
ATOM   1624 C C   . HIS A 1 216 ? 19.581 20.308 43.575 1.00 5.24  ? 216 HIS A C   1 
ATOM   1625 O O   . HIS A 1 216 ? 18.918 19.301 43.821 1.00 8.62  ? 216 HIS A O   1 
ATOM   1626 C CB  . HIS A 1 216 ? 18.991 21.735 41.624 1.00 6.54  ? 216 HIS A CB  1 
ATOM   1627 C CG  . HIS A 1 216 ? 18.252 20.649 40.905 1.00 9.64  ? 216 HIS A CG  1 
ATOM   1628 N ND1 . HIS A 1 216 ? 16.890 20.474 41.021 1.00 8.72  ? 216 HIS A ND1 1 
ATOM   1629 C CD2 . HIS A 1 216 ? 18.691 19.650 40.103 1.00 5.94  ? 216 HIS A CD2 1 
ATOM   1630 C CE1 . HIS A 1 216 ? 16.523 19.413 40.324 1.00 8.04  ? 216 HIS A CE1 1 
ATOM   1631 N NE2 . HIS A 1 216 ? 17.597 18.894 39.759 1.00 13.71 ? 216 HIS A NE2 1 
ATOM   1632 N N   . LEU A 1 217 ? 20.903 20.342 43.679 1.00 4.14  ? 217 LEU A N   1 
ATOM   1633 C CA  . LEU A 1 217 ? 21.647 19.166 44.099 1.00 4.49  ? 217 LEU A CA  1 
ATOM   1634 C C   . LEU A 1 217 ? 21.211 18.729 45.494 1.00 4.50  ? 217 LEU A C   1 
ATOM   1635 O O   . LEU A 1 217 ? 20.954 17.547 45.727 1.00 6.57  ? 217 LEU A O   1 
ATOM   1636 C CB  . LEU A 1 217 ? 23.145 19.456 44.097 1.00 6.00  ? 217 LEU A CB  1 
ATOM   1637 C CG  . LEU A 1 217 ? 24.031 18.322 44.624 1.00 8.21  ? 217 LEU A CG  1 
ATOM   1638 C CD1 . LEU A 1 217 ? 23.834 17.070 43.772 1.00 8.15  ? 217 LEU A CD1 1 
ATOM   1639 C CD2 . LEU A 1 217 ? 25.481 18.763 44.601 1.00 7.06  ? 217 LEU A CD2 1 
ATOM   1640 N N   . VAL A 1 218 ? 21.123 19.679 46.420 1.00 4.17  ? 218 VAL A N   1 
ATOM   1641 C CA  . VAL A 1 218 ? 20.721 19.356 47.789 1.00 5.77  ? 218 VAL A CA  1 
ATOM   1642 C C   . VAL A 1 218 ? 19.340 18.711 47.829 1.00 8.60  ? 218 VAL A C   1 
ATOM   1643 O O   . VAL A 1 218 ? 19.143 17.682 48.479 1.00 6.32  ? 218 VAL A O   1 
ATOM   1644 C CB  . VAL A 1 218 ? 20.704 20.617 48.692 1.00 8.88  ? 218 VAL A CB  1 
ATOM   1645 C CG1 . VAL A 1 218 ? 20.084 20.278 50.050 1.00 7.01  ? 218 VAL A CG1 1 
ATOM   1646 C CG2 . VAL A 1 218 ? 22.116 21.142 48.880 1.00 4.23  ? 218 VAL A CG2 1 
ATOM   1647 N N   . VAL A 1 219 ? 18.378 19.317 47.140 1.00 6.89  ? 219 VAL A N   1 
ATOM   1648 C CA  . VAL A 1 219 ? 17.035 18.768 47.123 1.00 7.35  ? 219 VAL A CA  1 
ATOM   1649 C C   . VAL A 1 219 ? 17.002 17.402 46.439 1.00 5.87  ? 219 VAL A C   1 
ATOM   1650 O O   . VAL A 1 219 ? 16.302 16.495 46.894 1.00 7.72  ? 219 VAL A O   1 
ATOM   1651 C CB  . VAL A 1 219 ? 16.053 19.723 46.427 1.00 5.50  ? 219 VAL A CB  1 
ATOM   1652 C CG1 . VAL A 1 219 ? 14.708 19.045 46.247 1.00 5.89  ? 219 VAL A CG1 1 
ATOM   1653 C CG2 . VAL A 1 219 ? 15.894 20.986 47.266 1.00 3.74  ? 219 VAL A CG2 1 
ATOM   1654 N N   . GLU A 1 220 ? 17.764 17.249 45.361 1.00 7.72  ? 220 GLU A N   1 
ATOM   1655 C CA  . GLU A 1 220 ? 17.803 15.974 44.647 1.00 9.36  ? 220 GLU A CA  1 
ATOM   1656 C C   . GLU A 1 220 ? 18.403 14.902 45.546 1.00 9.37  ? 220 GLU A C   1 
ATOM   1657 O O   . GLU A 1 220 ? 17.984 13.737 45.505 1.00 10.10 ? 220 GLU A O   1 
ATOM   1658 C CB  . GLU A 1 220 ? 18.611 16.111 43.350 1.00 6.94  ? 220 GLU A CB  1 
ATOM   1659 C CG  . GLU A 1 220 ? 18.829 14.809 42.577 1.00 16.70 ? 220 GLU A CG  1 
ATOM   1660 C CD  . GLU A 1 220 ? 17.546 14.048 42.303 1.00 20.83 ? 220 GLU A CD  1 
ATOM   1661 O OE1 . GLU A 1 220 ? 16.536 14.686 41.933 1.00 27.80 ? 220 GLU A OE1 1 
ATOM   1662 O OE2 . GLU A 1 220 ? 17.553 12.806 42.453 1.00 26.41 ? 220 GLU A OE2 1 
ATOM   1663 N N   . LEU A 1 221 ? 19.375 15.288 46.366 1.00 7.97  ? 221 LEU A N   1 
ATOM   1664 C CA  . LEU A 1 221 ? 19.999 14.336 47.282 1.00 10.79 ? 221 LEU A CA  1 
ATOM   1665 C C   . LEU A 1 221 ? 18.947 13.930 48.308 1.00 14.90 ? 221 LEU A C   1 
ATOM   1666 O O   . LEU A 1 221 ? 18.823 12.750 48.653 1.00 14.30 ? 221 LEU A O   1 
ATOM   1667 C CB  . LEU A 1 221 ? 21.236 14.954 47.953 1.00 7.55  ? 221 LEU A CB  1 
ATOM   1668 C CG  . LEU A 1 221 ? 22.417 15.161 46.990 1.00 5.42  ? 221 LEU A CG  1 
ATOM   1669 C CD1 . LEU A 1 221 ? 23.590 15.818 47.709 1.00 10.13 ? 221 LEU A CD1 1 
ATOM   1670 C CD2 . LEU A 1 221 ? 22.832 13.828 46.405 1.00 10.15 ? 221 LEU A CD2 1 
ATOM   1671 N N   . MET A 1 222 ? 18.170 14.898 48.786 1.00 9.46  ? 222 MET A N   1 
ATOM   1672 C CA  . MET A 1 222 ? 17.114 14.573 49.731 1.00 13.35 ? 222 MET A CA  1 
ATOM   1673 C C   . MET A 1 222 ? 16.116 13.659 49.032 1.00 12.77 ? 222 MET A C   1 
ATOM   1674 O O   . MET A 1 222 ? 15.526 12.777 49.655 1.00 14.92 ? 222 MET A O   1 
ATOM   1675 C CB  . MET A 1 222 ? 16.392 15.833 50.227 1.00 11.16 ? 222 MET A CB  1 
ATOM   1676 C CG  . MET A 1 222 ? 17.176 16.631 51.259 1.00 8.79  ? 222 MET A CG  1 
ATOM   1677 S SD  . MET A 1 222 ? 16.166 17.888 52.041 1.00 9.89  ? 222 MET A SD  1 
ATOM   1678 C CE  . MET A 1 222 ? 16.183 19.194 50.798 1.00 6.92  ? 222 MET A CE  1 
ATOM   1679 N N   . ASN A 1 223 ? 15.924 13.872 47.734 1.00 14.09 ? 223 ASN A N   1 
ATOM   1680 C CA  . ASN A 1 223 ? 15.000 13.039 46.968 1.00 17.83 ? 223 ASN A CA  1 
ATOM   1681 C C   . ASN A 1 223 ? 15.544 11.615 46.904 1.00 19.56 ? 223 ASN A C   1 
ATOM   1682 O O   . ASN A 1 223 ? 14.781 10.653 46.857 1.00 21.83 ? 223 ASN A O   1 
ATOM   1683 C CB  . ASN A 1 223 ? 14.819 13.601 45.552 1.00 17.47 ? 223 ASN A CB  1 
ATOM   1684 C CG  . ASN A 1 223 ? 13.918 12.728 44.680 1.00 27.47 ? 223 ASN A CG  1 
ATOM   1685 O OD1 . ASN A 1 223 ? 12.800 12.369 45.072 1.00 20.16 ? 223 ASN A OD1 1 
ATOM   1686 N ND2 . ASN A 1 223 ? 14.399 12.390 43.489 1.00 29.56 ? 223 ASN A ND2 1 
ATOM   1687 N N   . GLN A 1 224 ? 16.866 11.482 46.913 1.00 20.80 ? 224 GLN A N   1 
ATOM   1688 C CA  . GLN A 1 224 ? 17.484 10.165 46.859 1.00 25.65 ? 224 GLN A CA  1 
ATOM   1689 C C   . GLN A 1 224 ? 17.566 9.499  48.230 1.00 24.47 ? 224 GLN A C   1 
ATOM   1690 O O   . GLN A 1 224 ? 18.315 8.541  48.411 1.00 32.21 ? 224 GLN A O   1 
ATOM   1691 C CB  . GLN A 1 224 ? 18.880 10.266 46.240 1.00 22.16 ? 224 GLN A CB  1 
ATOM   1692 C CG  . GLN A 1 224 ? 18.855 10.795 44.817 1.00 23.54 ? 224 GLN A CG  1 
ATOM   1693 C CD  . GLN A 1 224 ? 20.238 11.050 44.251 1.00 20.73 ? 224 GLN A CD  1 
ATOM   1694 O OE1 . GLN A 1 224 ? 20.405 11.872 43.348 1.00 27.07 ? 224 GLN A OE1 1 
ATOM   1695 N NE2 . GLN A 1 224 ? 21.234 10.343 44.769 1.00 16.46 ? 224 GLN A NE2 1 
ATOM   1696 N N   . GLY A 1 225 ? 16.812 10.017 49.197 1.00 24.93 ? 225 GLY A N   1 
ATOM   1697 C CA  . GLY A 1 225 ? 16.804 9.419  50.523 1.00 19.62 ? 225 GLY A CA  1 
ATOM   1698 C C   . GLY A 1 225 ? 17.673 10.044 51.596 1.00 22.84 ? 225 GLY A C   1 
ATOM   1699 O O   . GLY A 1 225 ? 17.627 9.612  52.745 1.00 26.13 ? 225 GLY A O   1 
ATOM   1700 N N   . ARG A 1 226 ? 18.471 11.046 51.246 1.00 19.14 ? 226 ARG A N   1 
ATOM   1701 C CA  . ARG A 1 226 ? 19.327 11.691 52.241 1.00 15.21 ? 226 ARG A CA  1 
ATOM   1702 C C   . ARG A 1 226 ? 18.507 12.608 53.138 1.00 17.55 ? 226 ARG A C   1 
ATOM   1703 O O   . ARG A 1 226 ? 17.483 13.145 52.720 1.00 16.14 ? 226 ARG A O   1 
ATOM   1704 C CB  . ARG A 1 226 ? 20.417 12.536 51.567 1.00 17.22 ? 226 ARG A CB  1 
ATOM   1705 C CG  . ARG A 1 226 ? 21.679 11.792 51.146 1.00 23.04 ? 226 ARG A CG  1 
ATOM   1706 C CD  . ARG A 1 226 ? 21.448 10.867 49.965 1.00 27.08 ? 226 ARG A CD  1 
ATOM   1707 N NE  . ARG A 1 226 ? 22.716 10.521 49.317 1.00 29.59 ? 226 ARG A NE  1 
ATOM   1708 C CZ  . ARG A 1 226 ? 22.827 9.710  48.270 1.00 28.96 ? 226 ARG A CZ  1 
ATOM   1709 N NH1 . ARG A 1 226 ? 21.749 9.150  47.743 1.00 32.05 ? 226 ARG A NH1 1 
ATOM   1710 N NH2 . ARG A 1 226 ? 24.015 9.468  47.739 1.00 33.01 ? 226 ARG A NH2 1 
ATOM   1711 N N   . THR A 1 227 ? 18.952 12.782 54.376 1.00 14.20 ? 227 THR A N   1 
ATOM   1712 C CA  . THR A 1 227 ? 18.268 13.685 55.286 1.00 15.71 ? 227 THR A CA  1 
ATOM   1713 C C   . THR A 1 227 ? 18.769 15.076 54.866 1.00 14.27 ? 227 THR A C   1 
ATOM   1714 O O   . THR A 1 227 ? 19.720 15.179 54.085 1.00 8.70  ? 227 THR A O   1 
ATOM   1715 C CB  . THR A 1 227 ? 18.670 13.413 56.743 1.00 15.02 ? 227 THR A CB  1 
ATOM   1716 O OG1 . THR A 1 227 ? 20.075 13.646 56.904 1.00 12.52 ? 227 THR A OG1 1 
ATOM   1717 C CG2 . THR A 1 227 ? 18.346 11.959 57.123 1.00 18.99 ? 227 THR A CG2 1 
ATOM   1718 N N   . PRO A 1 228 ? 18.137 16.156 55.361 1.00 13.01 ? 228 PRO A N   1 
ATOM   1719 C CA  . PRO A 1 228 ? 18.554 17.521 55.010 1.00 13.15 ? 228 PRO A CA  1 
ATOM   1720 C C   . PRO A 1 228 ? 20.015 17.786 55.347 1.00 12.09 ? 228 PRO A C   1 
ATOM   1721 O O   . PRO A 1 228 ? 20.751 18.389 54.561 1.00 7.88  ? 228 PRO A O   1 
ATOM   1722 C CB  . PRO A 1 228 ? 17.612 18.391 55.836 1.00 11.50 ? 228 PRO A CB  1 
ATOM   1723 C CG  . PRO A 1 228 ? 16.372 17.577 55.882 1.00 15.13 ? 228 PRO A CG  1 
ATOM   1724 C CD  . PRO A 1 228 ? 16.902 16.181 56.163 1.00 14.59 ? 228 PRO A CD  1 
ATOM   1725 N N   . GLN A 1 229 ? 20.420 17.331 56.529 1.00 13.65 ? 229 GLN A N   1 
ATOM   1726 C CA  . GLN A 1 229 ? 21.788 17.503 56.995 1.00 14.38 ? 229 GLN A CA  1 
ATOM   1727 C C   . GLN A 1 229 ? 22.790 16.825 56.062 1.00 17.32 ? 229 GLN A C   1 
ATOM   1728 O O   . GLN A 1 229 ? 23.797 17.413 55.675 1.00 17.86 ? 229 GLN A O   1 
ATOM   1729 C CB  . GLN A 1 229 ? 21.944 16.928 58.407 1.00 18.54 ? 229 GLN A CB  1 
ATOM   1730 C CG  . GLN A 1 229 ? 23.374 16.991 58.914 1.00 24.54 ? 229 GLN A CG  1 
ATOM   1731 C CD  . GLN A 1 229 ? 23.863 18.412 59.075 1.00 25.38 ? 229 GLN A CD  1 
ATOM   1732 O OE1 . GLN A 1 229 ? 25.057 18.656 59.247 1.00 38.43 ? 229 GLN A OE1 1 
ATOM   1733 N NE2 . GLN A 1 229 ? 22.937 19.362 59.032 1.00 29.93 ? 229 GLN A NE2 1 
ATOM   1734 N N   . GLN A 1 230 ? 22.496 15.578 55.714 1.00 16.70 ? 230 GLN A N   1 
ATOM   1735 C CA  . GLN A 1 230 ? 23.347 14.781 54.837 1.00 21.47 ? 230 GLN A CA  1 
ATOM   1736 C C   . GLN A 1 230 ? 23.429 15.369 53.434 1.00 17.99 ? 230 GLN A C   1 
ATOM   1737 O O   . GLN A 1 230 ? 24.492 15.390 52.817 1.00 20.34 ? 230 GLN A O   1 
ATOM   1738 C CB  . GLN A 1 230 ? 22.806 13.352 54.741 1.00 23.05 ? 230 GLN A CB  1 
ATOM   1739 C CG  . GLN A 1 230 ? 22.721 12.600 56.049 1.00 35.30 ? 230 GLN A CG  1 
ATOM   1740 C CD  . GLN A 1 230 ? 21.734 11.446 55.966 1.00 34.58 ? 230 GLN A CD  1 
ATOM   1741 O OE1 . GLN A 1 230 ? 21.339 11.022 54.882 1.00 40.27 ? 230 GLN A OE1 1 
ATOM   1742 N NE2 . GLN A 1 230 ? 21.341 10.932 57.107 1.00 46.10 ? 230 GLN A NE2 1 
ATOM   1743 N N   . ALA A 1 231 ? 22.287 15.841 52.945 1.00 16.63 ? 231 ALA A N   1 
ATOM   1744 C CA  . ALA A 1 231 ? 22.195 16.432 51.619 1.00 12.49 ? 231 ALA A CA  1 
ATOM   1745 C C   . ALA A 1 231 ? 23.079 17.671 51.522 1.00 9.34  ? 231 ALA A C   1 
ATOM   1746 O O   . ALA A 1 231 ? 23.836 17.831 50.565 1.00 14.63 ? 231 ALA A O   1 
ATOM   1747 C CB  . ALA A 1 231 ? 20.736 16.789 51.303 1.00 13.21 ? 231 ALA A CB  1 
ATOM   1748 N N   . CYS A 1 232 ? 22.978 18.551 52.513 1.00 9.82  ? 232 CYS A N   1 
ATOM   1749 C CA  . CYS A 1 232 ? 23.791 19.758 52.527 1.00 6.58  ? 232 CYS A CA  1 
ATOM   1750 C C   . CYS A 1 232 ? 25.266 19.375 52.598 1.00 8.72  ? 232 CYS A C   1 
ATOM   1751 O O   . CYS A 1 232 ? 26.104 19.985 51.938 1.00 14.87 ? 232 CYS A O   1 
ATOM   1752 C CB  . CYS A 1 232 ? 23.429 20.634 53.729 1.00 12.81 ? 232 CYS A CB  1 
ATOM   1753 S SG  . CYS A 1 232 ? 21.779 21.326 53.656 1.00 9.99  ? 232 CYS A SG  1 
ATOM   1754 N N   . LYS A 1 233 ? 25.571 18.347 53.393 1.00 13.14 ? 233 LYS A N   1 
ATOM   1755 C CA  . LYS A 1 233 ? 26.955 17.894 53.547 1.00 13.96 ? 233 LYS A CA  1 
ATOM   1756 C C   . LYS A 1 233 ? 27.464 17.156 52.315 1.00 13.80 ? 233 LYS A C   1 
ATOM   1757 O O   . LYS A 1 233 ? 28.545 17.450 51.826 1.00 12.59 ? 233 LYS A O   1 
ATOM   1758 C CB  . LYS A 1 233 ? 27.091 16.993 54.774 1.00 11.71 ? 233 LYS A CB  1 
ATOM   1759 C CG  . LYS A 1 233 ? 28.513 16.502 55.036 1.00 12.74 ? 233 LYS A CG  1 
ATOM   1760 C CD  . LYS A 1 233 ? 28.594 15.861 56.413 1.00 24.24 ? 233 LYS A CD  1 
ATOM   1761 C CE  . LYS A 1 233 ? 30.023 15.595 56.847 1.00 27.97 ? 233 LYS A CE  1 
ATOM   1762 N NZ  . LYS A 1 233 ? 30.624 14.457 56.112 1.00 27.95 ? 233 LYS A NZ  1 
ATOM   1763 N N   . GLU A 1 234 ? 26.692 16.196 51.820 1.00 14.45 ? 234 GLU A N   1 
ATOM   1764 C CA  . GLU A 1 234 ? 27.113 15.445 50.641 1.00 17.48 ? 234 GLU A CA  1 
ATOM   1765 C C   . GLU A 1 234 ? 27.250 16.384 49.451 1.00 15.01 ? 234 GLU A C   1 
ATOM   1766 O O   . GLU A 1 234 ? 28.099 16.177 48.583 1.00 16.54 ? 234 GLU A O   1 
ATOM   1767 C CB  . GLU A 1 234 ? 26.120 14.329 50.319 1.00 20.52 ? 234 GLU A CB  1 
ATOM   1768 C CG  . GLU A 1 234 ? 26.429 13.597 49.020 1.00 33.98 ? 234 GLU A CG  1 
ATOM   1769 C CD  . GLU A 1 234 ? 25.473 12.457 48.751 1.00 43.28 ? 234 GLU A CD  1 
ATOM   1770 O OE1 . GLU A 1 234 ? 24.249 12.695 48.745 1.00 52.92 ? 234 GLU A OE1 1 
ATOM   1771 O OE2 . GLU A 1 234 ? 25.945 11.321 48.541 1.00 49.83 ? 234 GLU A OE2 1 
ATOM   1772 N N   . ALA A 1 235 ? 26.417 17.421 49.411 1.00 14.72 ? 235 ALA A N   1 
ATOM   1773 C CA  . ALA A 1 235 ? 26.487 18.396 48.330 1.00 14.75 ? 235 ALA A CA  1 
ATOM   1774 C C   . ALA A 1 235 ? 27.814 19.132 48.461 1.00 16.30 ? 235 ALA A C   1 
ATOM   1775 O O   . ALA A 1 235 ? 28.603 19.200 47.511 1.00 15.08 ? 235 ALA A O   1 
ATOM   1776 C CB  . ALA A 1 235 ? 25.326 19.384 48.423 1.00 14.50 ? 235 ALA A CB  1 
ATOM   1777 N N   . VAL A 1 236 ? 28.054 19.685 49.648 1.00 15.34 ? 236 VAL A N   1 
ATOM   1778 C CA  . VAL A 1 236 ? 29.286 20.419 49.927 1.00 15.56 ? 236 VAL A CA  1 
ATOM   1779 C C   . VAL A 1 236 ? 30.504 19.541 49.637 1.00 15.71 ? 236 VAL A C   1 
ATOM   1780 O O   . VAL A 1 236 ? 31.485 20.007 49.060 1.00 17.57 ? 236 VAL A O   1 
ATOM   1781 C CB  . VAL A 1 236 ? 29.302 20.927 51.404 1.00 15.01 ? 236 VAL A CB  1 
ATOM   1782 C CG1 . VAL A 1 236 ? 30.689 21.419 51.797 1.00 14.15 ? 236 VAL A CG1 1 
ATOM   1783 C CG2 . VAL A 1 236 ? 28.300 22.062 51.555 1.00 15.85 ? 236 VAL A CG2 1 
ATOM   1784 N N   . GLU A 1 237 ? 30.440 18.267 50.013 1.00 15.62 ? 237 GLU A N   1 
ATOM   1785 C CA  . GLU A 1 237 ? 31.554 17.373 49.749 1.00 14.09 ? 237 GLU A CA  1 
ATOM   1786 C C   . GLU A 1 237 ? 31.789 17.201 48.249 1.00 18.66 ? 237 GLU A C   1 
ATOM   1787 O O   . GLU A 1 237 ? 32.930 17.240 47.787 1.00 16.17 ? 237 GLU A O   1 
ATOM   1788 C CB  . GLU A 1 237 ? 31.319 16.030 50.430 1.00 20.79 ? 237 GLU A CB  1 
ATOM   1789 C CG  . GLU A 1 237 ? 31.474 16.139 51.938 1.00 17.78 ? 237 GLU A CG  1 
ATOM   1790 C CD  . GLU A 1 237 ? 31.231 14.833 52.645 1.00 27.74 ? 237 GLU A CD  1 
ATOM   1791 O OE1 . GLU A 1 237 ? 31.695 14.699 53.793 1.00 30.14 ? 237 GLU A OE1 1 
ATOM   1792 O OE2 . GLU A 1 237 ? 30.570 13.950 52.060 1.00 22.14 ? 237 GLU A OE2 1 
ATOM   1793 N N   . ARG A 1 238 ? 30.719 17.025 47.482 1.00 15.93 ? 238 ARG A N   1 
ATOM   1794 C CA  . ARG A 1 238 ? 30.871 16.898 46.042 1.00 16.23 ? 238 ARG A CA  1 
ATOM   1795 C C   . ARG A 1 238 ? 31.487 18.186 45.520 1.00 12.46 ? 238 ARG A C   1 
ATOM   1796 O O   . ARG A 1 238 ? 32.359 18.160 44.654 1.00 18.96 ? 238 ARG A O   1 
ATOM   1797 C CB  . ARG A 1 238 ? 29.521 16.669 45.370 1.00 14.71 ? 238 ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 238 ? 28.879 15.354 45.738 1.00 24.32 ? 238 ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 238 ? 27.736 15.049 44.802 1.00 25.90 ? 238 ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 238 ? 27.077 13.799 45.155 1.00 30.60 ? 238 ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 238 ? 26.090 13.255 44.451 1.00 33.23 ? 238 ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 238 ? 25.650 13.858 43.349 1.00 24.96 ? 238 ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 238 ? 25.544 12.111 44.850 1.00 27.47 ? 238 ARG A NH2 1 
ATOM   1804 N N   . ILE A 1 239 ? 31.036 19.311 46.062 1.00 12.54 ? 239 ILE A N   1 
ATOM   1805 C CA  . ILE A 1 239 ? 31.545 20.617 45.655 1.00 11.00 ? 239 ILE A CA  1 
ATOM   1806 C C   . ILE A 1 239 ? 33.013 20.853 46.025 1.00 16.68 ? 239 ILE A C   1 
ATOM   1807 O O   . ILE A 1 239 ? 33.752 21.518 45.291 1.00 15.86 ? 239 ILE A O   1 
ATOM   1808 C CB  . ILE A 1 239 ? 30.699 21.750 46.261 1.00 14.40 ? 239 ILE A CB  1 
ATOM   1809 C CG1 . ILE A 1 239 ? 29.309 21.746 45.624 1.00 14.34 ? 239 ILE A CG1 1 
ATOM   1810 C CG2 . ILE A 1 239 ? 31.377 23.103 46.029 1.00 13.19 ? 239 ILE A CG2 1 
ATOM   1811 C CD1 . ILE A 1 239 ? 28.350 22.741 46.250 1.00 15.83 ? 239 ILE A CD1 1 
ATOM   1812 N N   . VAL A 1 240 ? 33.430 20.336 47.173 1.00 13.35 ? 240 VAL A N   1 
ATOM   1813 C CA  . VAL A 1 240 ? 34.819 20.492 47.597 1.00 17.29 ? 240 VAL A CA  1 
ATOM   1814 C C   . VAL A 1 240 ? 35.679 19.778 46.556 1.00 17.34 ? 240 VAL A C   1 
ATOM   1815 O O   . VAL A 1 240 ? 36.732 20.276 46.152 1.00 16.28 ? 240 VAL A O   1 
ATOM   1816 C CB  . VAL A 1 240 ? 35.052 19.859 48.990 1.00 16.21 ? 240 VAL A CB  1 
ATOM   1817 C CG1 . VAL A 1 240 ? 36.535 19.836 49.319 1.00 13.15 ? 240 VAL A CG1 1 
ATOM   1818 C CG2 . VAL A 1 240 ? 34.292 20.652 50.040 1.00 14.18 ? 240 VAL A CG2 1 
ATOM   1819 N N   . LYS A 1 241 ? 35.202 18.608 46.137 1.00 14.61 ? 241 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 241 ? 35.857 17.784 45.132 1.00 17.17 ? 241 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 241 ? 36.024 18.562 43.827 1.00 19.84 ? 241 LYS A C   1 
ATOM   1822 O O   . LYS A 1 241 ? 37.052 18.456 43.151 1.00 19.07 ? 241 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 241 ? 35.016 16.534 44.872 1.00 22.22 ? 241 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 241 ? 35.288 15.870 43.538 1.00 30.64 ? 241 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 241 ? 34.093 15.045 43.081 1.00 41.16 ? 241 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 241 ? 34.316 14.471 41.692 1.00 31.30 ? 241 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 241 ? 35.422 13.478 41.674 1.00 40.10 ? 241 LYS A NZ  1 
ATOM   1828 N N   . ILE A 1 242 ? 34.997 19.332 43.472 1.00 17.43 ? 242 ILE A N   1 
ATOM   1829 C CA  . ILE A 1 242 ? 35.014 20.138 42.256 1.00 16.66 ? 242 ILE A CA  1 
ATOM   1830 C C   . ILE A 1 242 ? 35.997 21.297 42.402 1.00 15.99 ? 242 ILE A C   1 
ATOM   1831 O O   . ILE A 1 242 ? 36.769 21.586 41.486 1.00 12.87 ? 242 ILE A O   1 
ATOM   1832 C CB  . ILE A 1 242 ? 33.592 20.669 41.930 1.00 19.23 ? 242 ILE A CB  1 
ATOM   1833 C CG1 . ILE A 1 242 ? 32.709 19.501 41.477 1.00 16.90 ? 242 ILE A CG1 1 
ATOM   1834 C CG2 . ILE A 1 242 ? 33.659 21.741 40.852 1.00 15.02 ? 242 ILE A CG2 1 
ATOM   1835 C CD1 . ILE A 1 242 ? 31.243 19.847 41.340 1.00 23.71 ? 242 ILE A CD1 1 
ATOM   1836 N N   . VAL A 1 243 ? 35.981 21.956 43.555 1.00 15.47 ? 243 VAL A N   1 
ATOM   1837 C CA  . VAL A 1 243 ? 36.904 23.063 43.802 1.00 12.73 ? 243 VAL A CA  1 
ATOM   1838 C C   . VAL A 1 243 ? 38.356 22.591 43.644 1.00 15.22 ? 243 VAL A C   1 
ATOM   1839 O O   . VAL A 1 243 ? 39.199 23.313 43.106 1.00 17.11 ? 243 VAL A O   1 
ATOM   1840 C CB  . VAL A 1 243 ? 36.734 23.654 45.232 1.00 17.54 ? 243 VAL A CB  1 
ATOM   1841 C CG1 . VAL A 1 243 ? 37.951 24.520 45.598 1.00 8.14  ? 243 VAL A CG1 1 
ATOM   1842 C CG2 . VAL A 1 243 ? 35.474 24.503 45.291 1.00 20.96 ? 243 VAL A CG2 1 
ATOM   1843 N N   . ASN A 1 244 ? 38.647 21.389 44.130 1.00 17.25 ? 244 ASN A N   1 
ATOM   1844 C CA  . ASN A 1 244 ? 39.991 20.834 44.025 1.00 15.07 ? 244 ASN A CA  1 
ATOM   1845 C C   . ASN A 1 244 ? 40.315 20.567 42.553 1.00 18.76 ? 244 ASN A C   1 
ATOM   1846 O O   . ASN A 1 244 ? 41.418 20.842 42.088 1.00 16.28 ? 244 ASN A O   1 
ATOM   1847 C CB  . ASN A 1 244 ? 40.087 19.531 44.822 1.00 17.57 ? 244 ASN A CB  1 
ATOM   1848 C CG  . ASN A 1 244 ? 41.436 18.844 44.667 1.00 30.42 ? 244 ASN A CG  1 
ATOM   1849 O OD1 . ASN A 1 244 ? 41.581 17.657 44.967 1.00 42.18 ? 244 ASN A OD1 1 
ATOM   1850 N ND2 . ASN A 1 244 ? 42.431 19.590 44.207 1.00 37.02 ? 244 ASN A ND2 1 
ATOM   1851 N N   . ARG A 1 245 ? 39.342 20.023 41.831 1.00 16.98 ? 245 ARG A N   1 
ATOM   1852 C CA  . ARG A 1 245 ? 39.499 19.711 40.416 1.00 16.38 ? 245 ARG A CA  1 
ATOM   1853 C C   . ARG A 1 245 ? 39.840 20.958 39.615 1.00 13.41 ? 245 ARG A C   1 
ATOM   1854 O O   . ARG A 1 245 ? 40.511 20.889 38.589 1.00 9.18  ? 245 ARG A O   1 
ATOM   1855 C CB  . ARG A 1 245 ? 38.207 19.078 39.882 1.00 16.08 ? 245 ARG A CB  1 
ATOM   1856 C CG  . ARG A 1 245 ? 38.329 17.608 39.535 1.00 23.94 ? 245 ARG A CG  1 
ATOM   1857 C CD  . ARG A 1 245 ? 36.966 16.920 39.436 1.00 30.53 ? 245 ARG A CD  1 
ATOM   1858 N NE  . ARG A 1 245 ? 36.046 17.589 38.520 1.00 30.18 ? 245 ARG A NE  1 
ATOM   1859 C CZ  . ARG A 1 245 ? 34.830 17.135 38.222 1.00 31.11 ? 245 ARG A CZ  1 
ATOM   1860 N NH1 . ARG A 1 245 ? 34.383 16.009 38.766 1.00 40.15 ? 245 ARG A NH1 1 
ATOM   1861 N NH2 . ARG A 1 245 ? 34.055 17.801 37.377 1.00 33.59 ? 245 ARG A NH2 1 
ATOM   1862 N N   . ARG A 1 246 ? 39.373 22.100 40.096 1.00 10.03 ? 246 ARG A N   1 
ATOM   1863 C CA  . ARG A 1 246 ? 39.616 23.363 39.425 1.00 10.58 ? 246 ARG A CA  1 
ATOM   1864 C C   . ARG A 1 246 ? 40.919 24.027 39.866 1.00 12.26 ? 246 ARG A C   1 
ATOM   1865 O O   . ARG A 1 246 ? 41.241 25.130 39.431 1.00 10.80 ? 246 ARG A O   1 
ATOM   1866 C CB  . ARG A 1 246 ? 38.431 24.308 39.647 1.00 13.52 ? 246 ARG A CB  1 
ATOM   1867 C CG  . ARG A 1 246 ? 37.111 23.781 39.088 1.00 15.78 ? 246 ARG A CG  1 
ATOM   1868 C CD  . ARG A 1 246 ? 35.982 24.771 39.323 1.00 12.97 ? 246 ARG A CD  1 
ATOM   1869 N NE  . ARG A 1 246 ? 36.208 26.016 38.592 1.00 15.52 ? 246 ARG A NE  1 
ATOM   1870 C CZ  . ARG A 1 246 ? 36.244 27.213 39.166 1.00 23.21 ? 246 ARG A CZ  1 
ATOM   1871 N NH1 . ARG A 1 246 ? 36.066 27.330 40.477 1.00 30.70 ? 246 ARG A NH1 1 
ATOM   1872 N NH2 . ARG A 1 246 ? 36.480 28.284 38.435 1.00 11.72 ? 246 ARG A NH2 1 
ATOM   1873 N N   . GLY A 1 247 ? 41.661 23.350 40.735 1.00 14.89 ? 247 GLY A N   1 
ATOM   1874 C CA  . GLY A 1 247 ? 42.925 23.890 41.207 1.00 15.73 ? 247 GLY A CA  1 
ATOM   1875 C C   . GLY A 1 247 ? 42.790 25.153 42.035 1.00 17.09 ? 247 GLY A C   1 
ATOM   1876 O O   . GLY A 1 247 ? 43.676 26.004 42.036 1.00 17.87 ? 247 GLY A O   1 
ATOM   1877 N N   . LYS A 1 248 ? 41.675 25.286 42.741 1.00 12.48 ? 248 LYS A N   1 
ATOM   1878 C CA  . LYS A 1 248 ? 41.455 26.456 43.573 1.00 12.39 ? 248 LYS A CA  1 
ATOM   1879 C C   . LYS A 1 248 ? 41.698 26.092 45.030 1.00 13.47 ? 248 LYS A C   1 
ATOM   1880 O O   . LYS A 1 248 ? 41.655 24.917 45.397 1.00 15.67 ? 248 LYS A O   1 
ATOM   1881 C CB  . LYS A 1 248 ? 40.028 26.974 43.394 1.00 15.72 ? 248 LYS A CB  1 
ATOM   1882 C CG  . LYS A 1 248 ? 39.709 27.398 41.970 1.00 17.08 ? 248 LYS A CG  1 
ATOM   1883 C CD  . LYS A 1 248 ? 40.700 28.439 41.467 1.00 16.32 ? 248 LYS A CD  1 
ATOM   1884 C CE  . LYS A 1 248 ? 40.349 28.900 40.062 1.00 19.01 ? 248 LYS A CE  1 
ATOM   1885 N NZ  . LYS A 1 248 ? 41.351 29.871 39.553 1.00 21.55 ? 248 LYS A NZ  1 
ATOM   1886 N N   . ASN A 1 249 ? 41.959 27.099 45.857 1.00 16.94 ? 249 ASN A N   1 
ATOM   1887 C CA  . ASN A 1 249 ? 42.200 26.855 47.272 1.00 15.61 ? 249 ASN A CA  1 
ATOM   1888 C C   . ASN A 1 249 ? 40.879 26.987 48.009 1.00 16.15 ? 249 ASN A C   1 
ATOM   1889 O O   . ASN A 1 249 ? 40.203 28.009 47.923 1.00 14.17 ? 249 ASN A O   1 
ATOM   1890 C CB  . ASN A 1 249 ? 43.221 27.850 47.827 1.00 16.57 ? 249 ASN A CB  1 
ATOM   1891 C CG  . ASN A 1 249 ? 43.730 27.449 49.197 1.00 19.05 ? 249 ASN A CG  1 
ATOM   1892 O OD1 . ASN A 1 249 ? 44.923 27.191 49.377 1.00 12.55 ? 249 ASN A OD1 1 
ATOM   1893 N ND2 . ASN A 1 249 ? 42.825 27.382 50.170 1.00 10.93 ? 249 ASN A ND2 1 
ATOM   1894 N N   . LEU A 1 250 ? 40.515 25.940 48.734 1.00 17.54 ? 250 LEU A N   1 
ATOM   1895 C CA  . LEU A 1 250 ? 39.262 25.915 49.476 1.00 17.12 ? 250 LEU A CA  1 
ATOM   1896 C C   . LEU A 1 250 ? 39.062 27.112 50.405 1.00 17.92 ? 250 LEU A C   1 
ATOM   1897 O O   . LEU A 1 250 ? 37.937 27.578 50.603 1.00 15.63 ? 250 LEU A O   1 
ATOM   1898 C CB  . LEU A 1 250 ? 39.180 24.618 50.282 1.00 17.41 ? 250 LEU A CB  1 
ATOM   1899 C CG  . LEU A 1 250 ? 37.778 24.207 50.738 1.00 26.77 ? 250 LEU A CG  1 
ATOM   1900 C CD1 . LEU A 1 250 ? 36.898 23.929 49.512 1.00 21.76 ? 250 LEU A CD1 1 
ATOM   1901 C CD2 . LEU A 1 250 ? 37.874 22.962 51.618 1.00 21.61 ? 250 LEU A CD2 1 
ATOM   1902 N N   . LYS A 1 251 ? 40.151 27.618 50.976 1.00 16.65 ? 251 LYS A N   1 
ATOM   1903 C CA  . LYS A 1 251 ? 40.054 28.749 51.894 1.00 16.59 ? 251 LYS A CA  1 
ATOM   1904 C C   . LYS A 1 251 ? 39.448 29.991 51.233 1.00 14.38 ? 251 LYS A C   1 
ATOM   1905 O O   . LYS A 1 251 ? 38.899 30.854 51.912 1.00 15.96 ? 251 LYS A O   1 
ATOM   1906 C CB  . LYS A 1 251 ? 41.441 29.094 52.451 1.00 17.61 ? 251 LYS A CB  1 
ATOM   1907 C CG  . LYS A 1 251 ? 41.421 29.993 53.676 1.00 23.37 ? 251 LYS A CG  1 
ATOM   1908 C CD  . LYS A 1 251 ? 40.861 29.263 54.888 1.00 30.85 ? 251 LYS A CD  1 
ATOM   1909 C CE  . LYS A 1 251 ? 41.709 28.050 55.240 1.00 37.88 ? 251 LYS A CE  1 
ATOM   1910 N NZ  . LYS A 1 251 ? 41.173 27.298 56.403 1.00 44.14 ? 251 LYS A NZ  1 
ATOM   1911 N N   . ASP A 1 252 ? 39.547 30.077 49.911 1.00 13.63 ? 252 ASP A N   1 
ATOM   1912 C CA  . ASP A 1 252 ? 39.035 31.234 49.187 1.00 21.04 ? 252 ASP A CA  1 
ATOM   1913 C C   . ASP A 1 252 ? 37.584 31.087 48.771 1.00 24.67 ? 252 ASP A C   1 
ATOM   1914 O O   . ASP A 1 252 ? 36.967 32.046 48.306 1.00 23.60 ? 252 ASP A O   1 
ATOM   1915 C CB  . ASP A 1 252 ? 39.882 31.480 47.938 1.00 23.99 ? 252 ASP A CB  1 
ATOM   1916 C CG  . ASP A 1 252 ? 41.356 31.574 48.252 1.00 16.90 ? 252 ASP A CG  1 
ATOM   1917 O OD1 . ASP A 1 252 ? 41.716 32.372 49.141 1.00 27.81 ? 252 ASP A OD1 1 
ATOM   1918 O OD2 . ASP A 1 252 ? 42.145 30.851 47.612 1.00 22.01 ? 252 ASP A OD2 1 
ATOM   1919 N N   . ILE A 1 253 ? 37.042 29.889 48.957 1.00 22.94 ? 253 ILE A N   1 
ATOM   1920 C CA  . ILE A 1 253 ? 35.672 29.605 48.558 1.00 21.57 ? 253 ILE A CA  1 
ATOM   1921 C C   . ILE A 1 253 ? 34.756 29.147 49.681 1.00 22.06 ? 253 ILE A C   1 
ATOM   1922 O O   . ILE A 1 253 ? 35.052 28.184 50.387 1.00 21.53 ? 253 ILE A O   1 
ATOM   1923 C CB  . ILE A 1 253 ? 35.665 28.541 47.449 1.00 19.77 ? 253 ILE A CB  1 
ATOM   1924 C CG1 . ILE A 1 253 ? 36.395 29.091 46.220 1.00 23.29 ? 253 ILE A CG1 1 
ATOM   1925 C CG2 . ILE A 1 253 ? 34.232 28.137 47.106 1.00 20.28 ? 253 ILE A CG2 1 
ATOM   1926 C CD1 . ILE A 1 253 ? 36.447 28.140 45.040 1.00 25.61 ? 253 ILE A CD1 1 
ATOM   1927 N N   . GLN A 1 254 ? 33.651 29.864 49.850 1.00 18.80 ? 254 GLN A N   1 
ATOM   1928 C CA  . GLN A 1 254 ? 32.660 29.503 50.849 1.00 23.12 ? 254 GLN A CA  1 
ATOM   1929 C C   . GLN A 1 254 ? 31.384 29.115 50.105 1.00 26.05 ? 254 GLN A C   1 
ATOM   1930 O O   . GLN A 1 254 ? 30.872 29.873 49.275 1.00 23.69 ? 254 GLN A O   1 
ATOM   1931 C CB  . GLN A 1 254 ? 32.370 30.664 51.801 1.00 19.81 ? 254 GLN A CB  1 
ATOM   1932 C CG  . GLN A 1 254 ? 31.195 30.399 52.754 1.00 23.96 ? 254 GLN A CG  1 
ATOM   1933 C CD  . GLN A 1 254 ? 31.414 29.187 53.668 1.00 22.79 ? 254 GLN A CD  1 
ATOM   1934 O OE1 . GLN A 1 254 ? 31.572 28.054 53.202 1.00 17.29 ? 254 GLN A OE1 1 
ATOM   1935 N NE2 . GLN A 1 254 ? 31.424 29.430 54.977 1.00 20.57 ? 254 GLN A NE2 1 
ATOM   1936 N N   . VAL A 1 255 ? 30.905 27.907 50.381 1.00 24.51 ? 255 VAL A N   1 
ATOM   1937 C CA  . VAL A 1 255 ? 29.675 27.390 49.787 1.00 19.75 ? 255 VAL A CA  1 
ATOM   1938 C C   . VAL A 1 255 ? 28.994 26.600 50.884 1.00 20.14 ? 255 VAL A C   1 
ATOM   1939 O O   . VAL A 1 255 ? 29.570 25.656 51.424 1.00 16.83 ? 255 VAL A O   1 
ATOM   1940 C CB  . VAL A 1 255 ? 29.942 26.440 48.592 1.00 18.48 ? 255 VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 255 ? 28.668 25.651 48.262 1.00 17.83 ? 255 VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 255 ? 30.367 27.245 47.365 1.00 15.53 ? 255 VAL A CG2 1 
ATOM   1943 N N   . GLY A 1 256 ? 27.772 27.002 51.214 1.00 19.94 ? 256 GLY A N   1 
ATOM   1944 C CA  . GLY A 1 256 ? 27.014 26.329 52.253 1.00 19.88 ? 256 GLY A CA  1 
ATOM   1945 C C   . GLY A 1 256 ? 25.543 26.295 51.894 1.00 19.73 ? 256 GLY A C   1 
ATOM   1946 O O   . GLY A 1 256 ? 25.122 26.924 50.924 1.00 18.96 ? 256 GLY A O   1 
ATOM   1947 N N   . PHE A 1 257 ? 24.752 25.579 52.683 1.00 15.03 ? 257 PHE A N   1 
ATOM   1948 C CA  . PHE A 1 257 ? 23.330 25.454 52.410 1.00 6.71  ? 257 PHE A CA  1 
ATOM   1949 C C   . PHE A 1 257 ? 22.534 25.149 53.665 1.00 5.52  ? 257 PHE A C   1 
ATOM   1950 O O   . PHE A 1 257 ? 23.070 24.623 54.636 1.00 7.43  ? 257 PHE A O   1 
ATOM   1951 C CB  . PHE A 1 257 ? 23.083 24.292 51.446 1.00 7.12  ? 257 PHE A CB  1 
ATOM   1952 C CG  . PHE A 1 257 ? 23.868 24.366 50.174 1.00 8.62  ? 257 PHE A CG  1 
ATOM   1953 C CD1 . PHE A 1 257 ? 25.129 23.773 50.071 1.00 11.04 ? 257 PHE A CD1 1 
ATOM   1954 C CD2 . PHE A 1 257 ? 23.337 25.005 49.065 1.00 9.10  ? 257 PHE A CD2 1 
ATOM   1955 C CE1 . PHE A 1 257 ? 25.838 23.815 48.870 1.00 19.27 ? 257 PHE A CE1 1 
ATOM   1956 C CE2 . PHE A 1 257 ? 24.038 25.051 47.866 1.00 10.69 ? 257 PHE A CE2 1 
ATOM   1957 C CZ  . PHE A 1 257 ? 25.288 24.455 47.767 1.00 9.93  ? 257 PHE A CZ  1 
ATOM   1958 N N   . ILE A 1 258 ? 21.256 25.500 53.641 1.00 5.17  ? 258 ILE A N   1 
ATOM   1959 C CA  . ILE A 1 258 ? 20.362 25.162 54.732 1.00 8.13  ? 258 ILE A CA  1 
ATOM   1960 C C   . ILE A 1 258 ? 19.255 24.456 53.980 1.00 6.94  ? 258 ILE A C   1 
ATOM   1961 O O   . ILE A 1 258 ? 18.929 24.828 52.847 1.00 4.20  ? 258 ILE A O   1 
ATOM   1962 C CB  . ILE A 1 258 ? 19.829 26.396 55.499 1.00 6.25  ? 258 ILE A CB  1 
ATOM   1963 C CG1 . ILE A 1 258 ? 19.103 27.352 54.560 1.00 6.82  ? 258 ILE A CG1 1 
ATOM   1964 C CG2 . ILE A 1 258 ? 20.993 27.083 56.222 1.00 4.41  ? 258 ILE A CG2 1 
ATOM   1965 C CD1 . ILE A 1 258 ? 18.469 28.545 55.298 1.00 7.74  ? 258 ILE A CD1 1 
ATOM   1966 N N   . ALA A 1 259 ? 18.708 23.411 54.587 1.00 7.19  ? 259 ALA A N   1 
ATOM   1967 C CA  . ALA A 1 259 ? 17.676 22.631 53.927 1.00 3.05  ? 259 ALA A CA  1 
ATOM   1968 C C   . ALA A 1 259 ? 16.583 22.197 54.873 1.00 5.34  ? 259 ALA A C   1 
ATOM   1969 O O   . ALA A 1 259 ? 16.767 22.156 56.083 1.00 5.54  ? 259 ALA A O   1 
ATOM   1970 C CB  . ALA A 1 259 ? 18.298 21.411 53.261 1.00 6.04  ? 259 ALA A CB  1 
ATOM   1971 N N   . LEU A 1 260 ? 15.452 21.844 54.288 1.00 6.43  ? 260 LEU A N   1 
ATOM   1972 C CA  . LEU A 1 260 ? 14.285 21.451 55.039 1.00 11.89 ? 260 LEU A CA  1 
ATOM   1973 C C   . LEU A 1 260 ? 13.559 20.393 54.208 1.00 9.79  ? 260 LEU A C   1 
ATOM   1974 O O   . LEU A 1 260 ? 13.476 20.524 52.991 1.00 11.01 ? 260 LEU A O   1 
ATOM   1975 C CB  . LEU A 1 260 ? 13.413 22.700 55.202 1.00 9.70  ? 260 LEU A CB  1 
ATOM   1976 C CG  . LEU A 1 260 ? 12.202 22.820 56.109 1.00 15.08 ? 260 LEU A CG  1 
ATOM   1977 C CD1 . LEU A 1 260 ? 12.590 22.560 57.556 1.00 4.07  ? 260 LEU A CD1 1 
ATOM   1978 C CD2 . LEU A 1 260 ? 11.643 24.230 55.943 1.00 7.47  ? 260 LEU A CD2 1 
ATOM   1979 N N   . ASN A 1 261 ? 13.068 19.326 54.831 1.00 15.14 ? 261 ASN A N   1 
ATOM   1980 C CA  . ASN A 1 261 ? 12.325 18.359 54.040 1.00 9.11  ? 261 ASN A CA  1 
ATOM   1981 C C   . ASN A 1 261 ? 10.849 18.451 54.386 1.00 13.15 ? 261 ASN A C   1 
ATOM   1982 O O   . ASN A 1 261 ? 10.443 19.243 55.246 1.00 9.90  ? 261 ASN A O   1 
ATOM   1983 C CB  . ASN A 1 261 ? 12.851 16.918 54.207 1.00 10.29 ? 261 ASN A CB  1 
ATOM   1984 C CG  . ASN A 1 261 ? 12.720 16.387 55.617 1.00 9.55  ? 261 ASN A CG  1 
ATOM   1985 O OD1 . ASN A 1 261 ? 11.928 16.881 56.421 1.00 9.65  ? 261 ASN A OD1 1 
ATOM   1986 N ND2 . ASN A 1 261 ? 13.484 15.349 55.915 1.00 10.36 ? 261 ASN A ND2 1 
ATOM   1987 N N   . LYS A 1 262 ? 10.050 17.643 53.704 1.00 10.64 ? 262 LYS A N   1 
ATOM   1988 C CA  . LYS A 1 262 ? 8.606  17.621 53.891 1.00 13.84 ? 262 LYS A CA  1 
ATOM   1989 C C   . LYS A 1 262 ? 8.183  17.318 55.328 1.00 11.44 ? 262 LYS A C   1 
ATOM   1990 O O   . LYS A 1 262 ? 7.084  17.680 55.738 1.00 12.24 ? 262 LYS A O   1 
ATOM   1991 C CB  . LYS A 1 262 ? 8.001  16.593 52.932 1.00 16.06 ? 262 LYS A CB  1 
ATOM   1992 C CG  . LYS A 1 262 ? 6.490  16.657 52.780 1.00 24.46 ? 262 LYS A CG  1 
ATOM   1993 C CD  . LYS A 1 262 ? 6.048  17.865 51.970 1.00 25.81 ? 262 LYS A CD  1 
ATOM   1994 C CE  . LYS A 1 262 ? 4.573  17.749 51.594 1.00 30.24 ? 262 LYS A CE  1 
ATOM   1995 N NZ  . LYS A 1 262 ? 4.116  18.882 50.742 1.00 24.41 ? 262 LYS A NZ  1 
ATOM   1996 N N   . LYS A 1 263 ? 9.055  16.667 56.091 1.00 11.17 ? 263 LYS A N   1 
ATOM   1997 C CA  . LYS A 1 263 ? 8.743  16.317 57.476 1.00 12.96 ? 263 LYS A CA  1 
ATOM   1998 C C   . LYS A 1 263 ? 9.170  17.370 58.496 1.00 16.68 ? 263 LYS A C   1 
ATOM   1999 O O   . LYS A 1 263 ? 9.038  17.168 59.707 1.00 14.60 ? 263 LYS A O   1 
ATOM   2000 C CB  . LYS A 1 263 ? 9.381  14.970 57.831 1.00 16.01 ? 263 LYS A CB  1 
ATOM   2001 C CG  . LYS A 1 263 ? 8.675  13.760 57.221 1.00 28.50 ? 263 LYS A CG  1 
ATOM   2002 C CD  . LYS A 1 263 ? 8.616  13.853 55.702 1.00 37.48 ? 263 LYS A CD  1 
ATOM   2003 C CE  . LYS A 1 263 ? 7.834  12.701 55.087 1.00 39.71 ? 263 LYS A CE  1 
ATOM   2004 N NZ  . LYS A 1 263 ? 7.699  12.856 53.606 1.00 34.13 ? 263 LYS A NZ  1 
ATOM   2005 N N   . GLY A 1 264 ? 9.689  18.495 58.016 1.00 12.52 ? 264 GLY A N   1 
ATOM   2006 C CA  . GLY A 1 264 ? 10.102 19.530 58.940 1.00 10.39 ? 264 GLY A CA  1 
ATOM   2007 C C   . GLY A 1 264 ? 11.479 19.304 59.525 1.00 10.22 ? 264 GLY A C   1 
ATOM   2008 O O   . GLY A 1 264 ? 11.892 20.034 60.421 1.00 11.71 ? 264 GLY A O   1 
ATOM   2009 N N   . GLU A 1 265 ? 12.180 18.281 59.052 1.00 10.82 ? 265 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 265 ? 13.538 18.035 59.520 1.00 9.68  ? 265 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 265 ? 14.366 19.049 58.747 1.00 10.03 ? 265 GLU A C   1 
ATOM   2012 O O   . GLU A 1 265 ? 14.024 19.399 57.618 1.00 6.45  ? 265 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 265 ? 14.002 16.630 59.159 1.00 13.19 ? 265 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 265 ? 13.295 15.529 59.921 1.00 20.28 ? 265 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 265 ? 13.752 14.156 59.486 1.00 22.61 ? 265 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 265 ? 13.612 13.838 58.285 1.00 27.81 ? 265 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 265 ? 14.248 13.393 60.342 1.00 35.26 ? 265 GLU A OE2 1 
ATOM   2018 N N   . TYR A 1 266 ? 15.457 19.512 59.339 1.00 8.51  ? 266 TYR A N   1 
ATOM   2019 C CA  . TYR A 1 266 ? 16.275 20.503 58.671 1.00 8.18  ? 266 TYR A CA  1 
ATOM   2020 C C   . TYR A 1 266 ? 17.755 20.200 58.844 1.00 10.78 ? 266 TYR A C   1 
ATOM   2021 O O   . TYR A 1 266 ? 18.144 19.367 59.663 1.00 7.16  ? 266 TYR A O   1 
ATOM   2022 C CB  . TYR A 1 266 ? 15.928 21.892 59.223 1.00 10.09 ? 266 TYR A CB  1 
ATOM   2023 C CG  . TYR A 1 266 ? 16.259 22.085 60.690 1.00 5.73  ? 266 TYR A CG  1 
ATOM   2024 C CD1 . TYR A 1 266 ? 17.541 22.470 61.088 1.00 7.21  ? 266 TYR A CD1 1 
ATOM   2025 C CD2 . TYR A 1 266 ? 15.295 21.873 61.681 1.00 10.00 ? 266 TYR A CD2 1 
ATOM   2026 C CE1 . TYR A 1 266 ? 17.859 22.641 62.435 1.00 13.85 ? 266 TYR A CE1 1 
ATOM   2027 C CE2 . TYR A 1 266 ? 15.601 22.038 63.033 1.00 11.25 ? 266 TYR A CE2 1 
ATOM   2028 C CZ  . TYR A 1 266 ? 16.889 22.424 63.400 1.00 14.41 ? 266 TYR A CZ  1 
ATOM   2029 O OH  . TYR A 1 266 ? 17.218 22.606 64.719 1.00 13.91 ? 266 TYR A OH  1 
ATOM   2030 N N   . GLY A 1 267 ? 18.577 20.871 58.052 1.00 9.01  ? 267 GLY A N   1 
ATOM   2031 C CA  . GLY A 1 267 ? 20.004 20.659 58.143 1.00 11.33 ? 267 GLY A CA  1 
ATOM   2032 C C   . GLY A 1 267 ? 20.750 21.803 57.495 1.00 2.30  ? 267 GLY A C   1 
ATOM   2033 O O   . GLY A 1 267 ? 20.146 22.653 56.842 1.00 6.93  ? 267 GLY A O   1 
ATOM   2034 N N   . ALA A 1 268 ? 22.064 21.819 57.682 1.00 5.29  ? 268 ALA A N   1 
ATOM   2035 C CA  . ALA A 1 268 ? 22.904 22.858 57.114 1.00 5.46  ? 268 ALA A CA  1 
ATOM   2036 C C   . ALA A 1 268 ? 24.349 22.412 57.116 1.00 10.39 ? 268 ALA A C   1 
ATOM   2037 O O   . ALA A 1 268 ? 24.780 21.624 57.966 1.00 8.28  ? 268 ALA A O   1 
ATOM   2038 C CB  . ALA A 1 268 ? 22.758 24.147 57.903 1.00 8.63  ? 268 ALA A CB  1 
ATOM   2039 N N   . TYR A 1 269 ? 25.105 22.921 56.157 1.00 10.44 ? 269 TYR A N   1 
ATOM   2040 C CA  . TYR A 1 269 ? 26.510 22.576 56.065 1.00 8.36  ? 269 TYR A CA  1 
ATOM   2041 C C   . TYR A 1 269 ? 27.202 23.587 55.189 1.00 13.62 ? 269 TYR A C   1 
ATOM   2042 O O   . TYR A 1 269 ? 26.575 24.173 54.314 1.00 11.42 ? 269 TYR A O   1 
ATOM   2043 C CB  . TYR A 1 269 ? 26.681 21.206 55.441 1.00 6.93  ? 269 TYR A CB  1 
ATOM   2044 C CG  . TYR A 1 269 ? 27.941 20.517 55.885 1.00 7.96  ? 269 TYR A CG  1 
ATOM   2045 C CD1 . TYR A 1 269 ? 27.969 19.794 57.074 1.00 12.91 ? 269 TYR A CD1 1 
ATOM   2046 C CD2 . TYR A 1 269 ? 29.114 20.615 55.140 1.00 14.56 ? 269 TYR A CD2 1 
ATOM   2047 C CE1 . TYR A 1 269 ? 29.133 19.180 57.516 1.00 11.70 ? 269 TYR A CE1 1 
ATOM   2048 C CE2 . TYR A 1 269 ? 30.292 20.002 55.571 1.00 21.67 ? 269 TYR A CE2 1 
ATOM   2049 C CZ  . TYR A 1 269 ? 30.287 19.284 56.762 1.00 19.62 ? 269 TYR A CZ  1 
ATOM   2050 O OH  . TYR A 1 269 ? 31.428 18.644 57.187 1.00 22.19 ? 269 TYR A OH  1 
ATOM   2051 N N   . CYS A 1 270 ? 28.498 23.766 55.418 1.00 10.57 ? 270 CYS A N   1 
ATOM   2052 C CA  . CYS A 1 270 ? 29.290 24.702 54.638 1.00 10.90 ? 270 CYS A CA  1 
ATOM   2053 C C   . CYS A 1 270 ? 30.695 24.190 54.433 1.00 12.13 ? 270 CYS A C   1 
ATOM   2054 O O   . CYS A 1 270 ? 31.141 23.259 55.103 1.00 8.75  ? 270 CYS A O   1 
ATOM   2055 C CB  . CYS A 1 270 ? 29.385 26.043 55.339 1.00 12.52 ? 270 CYS A CB  1 
ATOM   2056 S SG  . CYS A 1 270 ? 27.832 26.736 55.733 1.00 18.81 ? 270 CYS A SG  1 
ATOM   2057 N N   . ILE A 1 271 ? 31.393 24.805 53.489 1.00 14.70 ? 271 ILE A N   1 
ATOM   2058 C CA  . ILE A 1 271 ? 32.766 24.433 53.231 1.00 13.96 ? 271 ILE A CA  1 
ATOM   2059 C C   . ILE A 1 271 ? 33.584 24.931 54.423 1.00 13.55 ? 271 ILE A C   1 
ATOM   2060 O O   . ILE A 1 271 ? 34.421 24.206 54.960 1.00 13.71 ? 271 ILE A O   1 
ATOM   2061 C CB  . ILE A 1 271 ? 33.293 25.110 51.944 1.00 17.36 ? 271 ILE A CB  1 
ATOM   2062 C CG1 . ILE A 1 271 ? 32.641 24.478 50.709 1.00 12.70 ? 271 ILE A CG1 1 
ATOM   2063 C CG2 . ILE A 1 271 ? 34.811 24.984 51.882 1.00 15.67 ? 271 ILE A CG2 1 
ATOM   2064 C CD1 . ILE A 1 271 ? 33.069 25.111 49.375 1.00 19.13 ? 271 ILE A CD1 1 
ATOM   2065 N N   . GLN A 1 272 ? 33.321 26.170 54.832 1.00 15.60 ? 272 GLN A N   1 
ATOM   2066 C CA  . GLN A 1 272 ? 34.039 26.789 55.940 1.00 16.08 ? 272 GLN A CA  1 
ATOM   2067 C C   . GLN A 1 272 ? 33.163 27.096 57.150 1.00 18.40 ? 272 GLN A C   1 
ATOM   2068 O O   . GLN A 1 272 ? 31.943 27.230 57.033 1.00 15.13 ? 272 GLN A O   1 
ATOM   2069 C CB  . GLN A 1 272 ? 34.720 28.084 55.476 1.00 18.06 ? 272 GLN A CB  1 
ATOM   2070 C CG  . GLN A 1 272 ? 35.809 27.874 54.433 1.00 18.39 ? 272 GLN A CG  1 
ATOM   2071 C CD  . GLN A 1 272 ? 36.589 29.140 54.141 1.00 20.36 ? 272 GLN A CD  1 
ATOM   2072 O OE1 . GLN A 1 272 ? 37.181 29.744 55.039 1.00 20.81 ? 272 GLN A OE1 1 
ATOM   2073 N NE2 . GLN A 1 272 ? 36.600 29.546 52.878 1.00 17.66 ? 272 GLN A NE2 1 
ATOM   2074 N N   . ASP A 1 273 ? 33.814 27.210 58.306 1.00 15.10 ? 273 ASP A N   1 
ATOM   2075 C CA  . ASP A 1 273 ? 33.158 27.511 59.574 1.00 14.99 ? 273 ASP A CA  1 
ATOM   2076 C C   . ASP A 1 273 ? 32.837 28.994 59.616 1.00 18.61 ? 273 ASP A C   1 
ATOM   2077 O O   . ASP A 1 273 ? 33.313 29.764 58.780 1.00 19.57 ? 273 ASP A O   1 
ATOM   2078 C CB  . ASP A 1 273 ? 34.090 27.146 60.738 1.00 14.92 ? 273 ASP A CB  1 
ATOM   2079 C CG  . ASP A 1 273 ? 33.432 27.304 62.103 1.00 20.85 ? 273 ASP A CG  1 
ATOM   2080 O OD1 . ASP A 1 273 ? 32.233 26.985 62.234 1.00 22.85 ? 273 ASP A OD1 1 
ATOM   2081 O OD2 . ASP A 1 273 ? 34.126 27.727 63.053 1.00 25.20 ? 273 ASP A OD2 1 
ATOM   2082 N N   . GLY A 1 274 ? 32.023 29.395 60.584 1.00 13.10 ? 274 GLY A N   1 
ATOM   2083 C CA  . GLY A 1 274 ? 31.676 30.800 60.710 1.00 18.23 ? 274 GLY A CA  1 
ATOM   2084 C C   . GLY A 1 274 ? 30.283 31.184 60.236 1.00 14.69 ? 274 GLY A C   1 
ATOM   2085 O O   . GLY A 1 274 ? 29.822 32.290 60.502 1.00 16.29 ? 274 GLY A O   1 
ATOM   2086 N N   . PHE A 1 275 ? 29.614 30.288 59.521 1.00 12.25 ? 275 PHE A N   1 
ATOM   2087 C CA  . PHE A 1 275 ? 28.269 30.586 59.042 1.00 14.54 ? 275 PHE A CA  1 
ATOM   2088 C C   . PHE A 1 275 ? 27.277 30.192 60.123 1.00 13.60 ? 275 PHE A C   1 
ATOM   2089 O O   . PHE A 1 275 ? 27.549 29.316 60.936 1.00 13.72 ? 275 PHE A O   1 
ATOM   2090 C CB  . PHE A 1 275 ? 27.976 29.801 57.754 1.00 9.94  ? 275 PHE A CB  1 
ATOM   2091 C CG  . PHE A 1 275 ? 26.555 29.922 57.267 1.00 13.49 ? 275 PHE A CG  1 
ATOM   2092 C CD1 . PHE A 1 275 ? 26.082 31.116 56.733 1.00 13.90 ? 275 PHE A CD1 1 
ATOM   2093 C CD2 . PHE A 1 275 ? 25.690 28.832 57.336 1.00 15.11 ? 275 PHE A CD2 1 
ATOM   2094 C CE1 . PHE A 1 275 ? 24.770 31.222 56.272 1.00 15.55 ? 275 PHE A CE1 1 
ATOM   2095 C CE2 . PHE A 1 275 ? 24.375 28.927 56.877 1.00 13.29 ? 275 PHE A CE2 1 
ATOM   2096 C CZ  . PHE A 1 275 ? 23.912 30.124 56.344 1.00 9.90  ? 275 PHE A CZ  1 
ATOM   2097 N N   . ASN A 1 276 ? 26.137 30.866 60.154 1.00 14.14 ? 276 ASN A N   1 
ATOM   2098 C CA  . ASN A 1 276 ? 25.103 30.523 61.113 1.00 10.42 ? 276 ASN A CA  1 
ATOM   2099 C C   . ASN A 1 276 ? 23.762 30.733 60.425 1.00 8.84  ? 276 ASN A C   1 
ATOM   2100 O O   . ASN A 1 276 ? 23.656 31.498 59.460 1.00 8.44  ? 276 ASN A O   1 
ATOM   2101 C CB  . ASN A 1 276 ? 25.212 31.391 62.374 1.00 16.90 ? 276 ASN A CB  1 
ATOM   2102 C CG  . ASN A 1 276 ? 24.961 32.867 62.103 1.00 21.55 ? 276 ASN A CG  1 
ATOM   2103 O OD1 . ASN A 1 276 ? 23.863 33.264 61.720 1.00 24.86 ? 276 ASN A OD1 1 
ATOM   2104 N ND2 . ASN A 1 276 ? 25.986 33.689 62.310 1.00 34.54 ? 276 ASN A ND2 1 
ATOM   2105 N N   . PHE A 1 277 ? 22.741 30.039 60.909 1.00 4.13  ? 277 PHE A N   1 
ATOM   2106 C CA  . PHE A 1 277 ? 21.416 30.172 60.332 1.00 6.27  ? 277 PHE A CA  1 
ATOM   2107 C C   . PHE A 1 277 ? 20.394 30.211 61.453 1.00 3.55  ? 277 PHE A C   1 
ATOM   2108 O O   . PHE A 1 277 ? 20.648 29.717 62.552 1.00 10.25 ? 277 PHE A O   1 
ATOM   2109 C CB  . PHE A 1 277 ? 21.136 29.021 59.354 1.00 5.62  ? 277 PHE A CB  1 
ATOM   2110 C CG  . PHE A 1 277 ? 21.067 27.662 59.996 1.00 7.27  ? 277 PHE A CG  1 
ATOM   2111 C CD1 . PHE A 1 277 ? 19.835 27.092 60.303 1.00 7.86  ? 277 PHE A CD1 1 
ATOM   2112 C CD2 . PHE A 1 277 ? 22.225 26.950 60.300 1.00 5.42  ? 277 PHE A CD2 1 
ATOM   2113 C CE1 . PHE A 1 277 ? 19.758 25.839 60.905 1.00 10.23 ? 277 PHE A CE1 1 
ATOM   2114 C CE2 . PHE A 1 277 ? 22.151 25.688 60.907 1.00 2.81  ? 277 PHE A CE2 1 
ATOM   2115 C CZ  . PHE A 1 277 ? 20.912 25.137 61.207 1.00 7.36  ? 277 PHE A CZ  1 
ATOM   2116 N N   . ALA A 1 278 ? 19.251 30.826 61.182 1.00 7.22  ? 278 ALA A N   1 
ATOM   2117 C CA  . ALA A 1 278 ? 18.199 30.925 62.184 1.00 8.97  ? 278 ALA A CA  1 
ATOM   2118 C C   . ALA A 1 278 ? 17.118 29.898 61.899 1.00 10.06 ? 278 ALA A C   1 
ATOM   2119 O O   . ALA A 1 278 ? 16.693 29.727 60.757 1.00 5.99  ? 278 ALA A O   1 
ATOM   2120 C CB  . ALA A 1 278 ? 17.593 32.330 62.182 1.00 4.12  ? 278 ALA A CB  1 
ATOM   2121 N N   . VAL A 1 279 ? 16.679 29.217 62.947 1.00 7.31  ? 279 VAL A N   1 
ATOM   2122 C CA  . VAL A 1 279 ? 15.634 28.210 62.834 1.00 11.33 ? 279 VAL A CA  1 
ATOM   2123 C C   . VAL A 1 279 ? 14.505 28.578 63.790 1.00 6.72  ? 279 VAL A C   1 
ATOM   2124 O O   . VAL A 1 279 ? 14.734 28.831 64.977 1.00 4.25  ? 279 VAL A O   1 
ATOM   2125 C CB  . VAL A 1 279 ? 16.186 26.802 63.201 1.00 13.70 ? 279 VAL A CB  1 
ATOM   2126 C CG1 . VAL A 1 279 ? 15.062 25.904 63.688 1.00 15.78 ? 279 VAL A CG1 1 
ATOM   2127 C CG2 . VAL A 1 279 ? 16.859 26.180 62.007 1.00 15.68 ? 279 VAL A CG2 1 
ATOM   2128 N N   . HIS A 1 280 ? 13.280 28.608 63.276 1.00 4.27  ? 280 HIS A N   1 
ATOM   2129 C CA  . HIS A 1 280 ? 12.130 28.929 64.116 1.00 6.47  ? 280 HIS A CA  1 
ATOM   2130 C C   . HIS A 1 280 ? 11.051 27.876 63.943 1.00 6.15  ? 280 HIS A C   1 
ATOM   2131 O O   . HIS A 1 280 ? 10.584 27.637 62.834 1.00 8.36  ? 280 HIS A O   1 
ATOM   2132 C CB  . HIS A 1 280 ? 11.555 30.306 63.744 1.00 8.95  ? 280 HIS A CB  1 
ATOM   2133 C CG  . HIS A 1 280 ? 10.659 30.904 64.791 1.00 5.49  ? 280 HIS A CG  1 
ATOM   2134 N ND1 . HIS A 1 280 ? 9.875  30.144 65.636 1.00 11.73 ? 280 HIS A ND1 1 
ATOM   2135 C CD2 . HIS A 1 280 ? 10.420 32.195 65.126 1.00 10.01 ? 280 HIS A CD2 1 
ATOM   2136 C CE1 . HIS A 1 280 ? 9.198  30.939 66.446 1.00 5.42  ? 280 HIS A CE1 1 
ATOM   2137 N NE2 . HIS A 1 280 ? 9.510  32.190 66.157 1.00 10.37 ? 280 HIS A NE2 1 
ATOM   2138 N N   . ASP A 1 281 ? 10.682 27.220 65.037 1.00 6.10  ? 281 ASP A N   1 
ATOM   2139 C CA  . ASP A 1 281 ? 9.604  26.241 65.008 1.00 8.14  ? 281 ASP A CA  1 
ATOM   2140 C C   . ASP A 1 281 ? 8.896  26.349 66.355 1.00 8.74  ? 281 ASP A C   1 
ATOM   2141 O O   . ASP A 1 281 ? 9.018  27.373 67.030 1.00 12.40 ? 281 ASP A O   1 
ATOM   2142 C CB  . ASP A 1 281 ? 10.127 24.825 64.726 1.00 7.71  ? 281 ASP A CB  1 
ATOM   2143 C CG  . ASP A 1 281 ? 11.116 24.330 65.765 1.00 17.03 ? 281 ASP A CG  1 
ATOM   2144 O OD1 . ASP A 1 281 ? 11.669 23.229 65.551 1.00 20.05 ? 281 ASP A OD1 1 
ATOM   2145 O OD2 . ASP A 1 281 ? 11.346 25.023 66.780 1.00 15.89 ? 281 ASP A OD2 1 
ATOM   2146 N N   . GLN A 1 282 ? 8.162  25.326 66.761 1.00 10.86 ? 282 GLN A N   1 
ATOM   2147 C CA  . GLN A 1 282 ? 7.446  25.414 68.025 1.00 15.81 ? 282 GLN A CA  1 
ATOM   2148 C C   . GLN A 1 282 ? 8.379  25.522 69.240 1.00 14.33 ? 282 GLN A C   1 
ATOM   2149 O O   . GLN A 1 282 ? 7.933  25.824 70.347 1.00 11.71 ? 282 GLN A O   1 
ATOM   2150 C CB  . GLN A 1 282 ? 6.479  24.231 68.163 1.00 19.53 ? 282 GLN A CB  1 
ATOM   2151 C CG  . GLN A 1 282 ? 4.979  24.589 67.997 1.00 36.54 ? 282 GLN A CG  1 
ATOM   2152 C CD  . GLN A 1 282 ? 4.619  25.095 66.605 1.00 36.35 ? 282 GLN A CD  1 
ATOM   2153 O OE1 . GLN A 1 282 ? 4.829  24.405 65.615 1.00 45.38 ? 282 GLN A OE1 1 
ATOM   2154 N NE2 . GLN A 1 282 ? 4.074  26.304 66.530 1.00 40.47 ? 282 GLN A NE2 1 
ATOM   2155 N N   . LYS A 1 283 ? 9.673  25.282 69.038 1.00 9.94  ? 283 LYS A N   1 
ATOM   2156 C CA  . LYS A 1 283 ? 10.636 25.416 70.136 1.00 15.91 ? 283 LYS A CA  1 
ATOM   2157 C C   . LYS A 1 283 ? 11.106 26.860 70.215 1.00 15.63 ? 283 LYS A C   1 
ATOM   2158 O O   . LYS A 1 283 ? 11.856 27.235 71.111 1.00 16.80 ? 283 LYS A O   1 
ATOM   2159 C CB  . LYS A 1 283 ? 11.836 24.483 69.945 1.00 10.08 ? 283 LYS A CB  1 
ATOM   2160 C CG  . LYS A 1 283 ? 11.572 23.042 70.429 1.00 23.52 ? 283 LYS A CG  1 
ATOM   2161 C CD  . LYS A 1 283 ? 11.253 23.019 71.948 0.00 18.38 ? 283 LYS A CD  1 
ATOM   2162 C CE  . LYS A 1 283 ? 10.983 21.620 72.505 0.00 19.32 ? 283 LYS A CE  1 
ATOM   2163 N NZ  . LYS A 1 283 ? 10.524 21.644 73.920 0.00 18.28 ? 283 LYS A NZ  1 
ATOM   2164 N N   . GLY A 1 284 ? 10.658 27.671 69.267 1.00 13.23 ? 284 GLY A N   1 
ATOM   2165 C CA  . GLY A 1 284 ? 11.067 29.052 69.267 1.00 6.94  ? 284 GLY A CA  1 
ATOM   2166 C C   . GLY A 1 284 ? 12.099 29.307 68.197 1.00 4.72  ? 284 GLY A C   1 
ATOM   2167 O O   . GLY A 1 284 ? 12.415 28.438 67.386 1.00 9.41  ? 284 GLY A O   1 
ATOM   2168 N N   . ASN A 1 285 ? 12.652 30.507 68.241 1.00 9.70  ? 285 ASN A N   1 
ATOM   2169 C CA  . ASN A 1 285 ? 13.622 30.990 67.270 1.00 9.16  ? 285 ASN A CA  1 
ATOM   2170 C C   . ASN A 1 285 ? 15.040 30.976 67.862 1.00 9.58  ? 285 ASN A C   1 
ATOM   2171 O O   . ASN A 1 285 ? 15.249 31.436 68.984 1.00 8.83  ? 285 ASN A O   1 
ATOM   2172 C CB  . ASN A 1 285 ? 13.164 32.406 66.926 1.00 9.71  ? 285 ASN A CB  1 
ATOM   2173 C CG  . ASN A 1 285 ? 13.795 32.959 65.683 1.00 12.26 ? 285 ASN A CG  1 
ATOM   2174 O OD1 . ASN A 1 285 ? 14.173 32.224 64.770 1.00 10.07 ? 285 ASN A OD1 1 
ATOM   2175 N ND2 . ASN A 1 285 ? 13.879 34.281 65.624 1.00 9.97  ? 285 ASN A ND2 1 
ATOM   2176 N N   . ARG A 1 286 ? 16.007 30.436 67.127 1.00 7.32  ? 286 ARG A N   1 
ATOM   2177 C CA  . ARG A 1 286 ? 17.385 30.416 67.615 1.00 11.48 ? 286 ARG A CA  1 
ATOM   2178 C C   . ARG A 1 286 ? 18.389 30.371 66.478 1.00 10.27 ? 286 ARG A C   1 
ATOM   2179 O O   . ARG A 1 286 ? 18.042 30.043 65.341 1.00 9.22  ? 286 ARG A O   1 
ATOM   2180 C CB  . ARG A 1 286 ? 17.639 29.225 68.550 1.00 5.19  ? 286 ARG A CB  1 
ATOM   2181 C CG  . ARG A 1 286 ? 17.624 27.861 67.879 1.00 11.31 ? 286 ARG A CG  1 
ATOM   2182 C CD  . ARG A 1 286 ? 16.206 27.396 67.615 1.00 8.60  ? 286 ARG A CD  1 
ATOM   2183 N NE  . ARG A 1 286 ? 16.172 26.000 67.189 1.00 7.13  ? 286 ARG A NE  1 
ATOM   2184 C CZ  . ARG A 1 286 ? 15.058 25.326 66.932 1.00 7.75  ? 286 ARG A CZ  1 
ATOM   2185 N NH1 . ARG A 1 286 ? 13.880 25.922 67.060 1.00 9.98  ? 286 ARG A NH1 1 
ATOM   2186 N NH2 . ARG A 1 286 ? 15.119 24.060 66.546 1.00 8.51  ? 286 ARG A NH2 1 
ATOM   2187 N N   . LEU A 1 287 ? 19.636 30.710 66.795 1.00 7.19  ? 287 LEU A N   1 
ATOM   2188 C CA  . LEU A 1 287 ? 20.708 30.702 65.807 1.00 6.89  ? 287 LEU A CA  1 
ATOM   2189 C C   . LEU A 1 287 ? 21.516 29.441 66.003 1.00 11.97 ? 287 LEU A C   1 
ATOM   2190 O O   . LEU A 1 287 ? 21.982 29.157 67.108 1.00 10.43 ? 287 LEU A O   1 
ATOM   2191 C CB  . LEU A 1 287 ? 21.623 31.918 65.987 1.00 12.75 ? 287 LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 287 ? 21.019 33.288 65.677 1.00 22.14 ? 287 LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 287 ? 21.884 34.376 66.292 1.00 27.94 ? 287 LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 287 ? 20.905 33.464 64.168 1.00 25.59 ? 287 LEU A CD2 1 
ATOM   2195 N N   . GLU A 1 288 ? 21.673 28.669 64.938 1.00 11.11 ? 288 GLU A N   1 
ATOM   2196 C CA  . GLU A 1 288 ? 22.439 27.434 65.038 1.00 8.28  ? 288 GLU A CA  1 
ATOM   2197 C C   . GLU A 1 288 ? 23.633 27.469 64.096 1.00 14.95 ? 288 GLU A C   1 
ATOM   2198 O O   . GLU A 1 288 ? 23.684 28.275 63.159 1.00 8.27  ? 288 GLU A O   1 
ATOM   2199 C CB  . GLU A 1 288 ? 21.529 26.227 64.758 1.00 4.82  ? 288 GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 288 ? 20.402 26.109 65.793 1.00 12.39 ? 288 GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 288 ? 19.543 24.854 65.658 1.00 14.33 ? 288 GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 288 ? 18.597 24.713 66.459 1.00 18.70 ? 288 GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 288 ? 19.812 24.021 64.767 1.00 14.16 ? 288 GLU A OE2 1 
ATOM   2204 N N   . THR A 1 289 ? 24.612 26.616 64.367 1.00 14.47 ? 289 THR A N   1 
ATOM   2205 C CA  . THR A 1 289 ? 25.818 26.560 63.549 1.00 21.76 ? 289 THR A CA  1 
ATOM   2206 C C   . THR A 1 289 ? 25.971 25.177 62.921 1.00 21.48 ? 289 THR A C   1 
ATOM   2207 O O   . THR A 1 289 ? 25.989 24.163 63.621 1.00 27.36 ? 289 THR A O   1 
ATOM   2208 C CB  . THR A 1 289 ? 27.082 26.878 64.379 1.00 23.26 ? 289 THR A CB  1 
ATOM   2209 O OG1 . THR A 1 289 ? 26.744 26.917 65.771 1.00 41.65 ? 289 THR A OG1 1 
ATOM   2210 C CG2 . THR A 1 289 ? 27.666 28.225 63.972 1.00 33.57 ? 289 THR A CG2 1 
ATOM   2211 N N   . PRO A 1 290 ? 26.091 25.131 61.585 1.00 16.42 ? 290 PRO A N   1 
ATOM   2212 C CA  . PRO A 1 290 ? 26.244 23.945 60.732 1.00 15.59 ? 290 PRO A CA  1 
ATOM   2213 C C   . PRO A 1 290 ? 27.616 23.297 60.834 1.00 11.51 ? 290 PRO A C   1 
ATOM   2214 O O   . PRO A 1 290 ? 28.557 23.892 61.347 1.00 11.35 ? 290 PRO A O   1 
ATOM   2215 C CB  . PRO A 1 290 ? 26.026 24.494 59.320 1.00 12.52 ? 290 PRO A CB  1 
ATOM   2216 C CG  . PRO A 1 290 ? 25.391 25.832 59.514 1.00 23.76 ? 290 PRO A CG  1 
ATOM   2217 C CD  . PRO A 1 290 ? 26.033 26.345 60.760 1.00 18.59 ? 290 PRO A CD  1 
ATOM   2218 N N   . GLY A 1 291 ? 27.723 22.072 60.329 1.00 15.01 ? 291 GLY A N   1 
ATOM   2219 C CA  . GLY A 1 291 ? 29.012 21.406 60.313 1.00 10.69 ? 291 GLY A CA  1 
ATOM   2220 C C   . GLY A 1 291 ? 29.735 22.051 59.143 1.00 12.33 ? 291 GLY A C   1 
ATOM   2221 O O   . GLY A 1 291 ? 29.114 22.770 58.350 1.00 9.27  ? 291 GLY A O   1 
ATOM   2222 N N   . PHE A 1 292 ? 31.032 21.818 59.020 1.00 8.06  ? 292 PHE A N   1 
ATOM   2223 C CA  . PHE A 1 292 ? 31.785 22.407 57.919 1.00 10.89 ? 292 PHE A CA  1 
ATOM   2224 C C   . PHE A 1 292 ? 32.899 21.465 57.474 1.00 13.11 ? 292 PHE A C   1 
ATOM   2225 O O   . PHE A 1 292 ? 33.437 20.708 58.282 1.00 15.38 ? 292 PHE A O   1 
ATOM   2226 C CB  . PHE A 1 292 ? 32.333 23.776 58.339 1.00 9.75  ? 292 PHE A CB  1 
ATOM   2227 C CG  . PHE A 1 292 ? 33.144 23.752 59.604 1.00 14.96 ? 292 PHE A CG  1 
ATOM   2228 C CD1 . PHE A 1 292 ? 34.504 23.444 59.570 1.00 19.41 ? 292 PHE A CD1 1 
ATOM   2229 C CD2 . PHE A 1 292 ? 32.549 24.030 60.830 1.00 18.79 ? 292 PHE A CD2 1 
ATOM   2230 C CE1 . PHE A 1 292 ? 35.264 23.415 60.747 1.00 24.74 ? 292 PHE A CE1 1 
ATOM   2231 C CE2 . PHE A 1 292 ? 33.292 24.006 62.014 1.00 20.54 ? 292 PHE A CE2 1 
ATOM   2232 C CZ  . PHE A 1 292 ? 34.654 23.696 61.972 1.00 23.79 ? 292 PHE A CZ  1 
ATOM   2233 N N   . ALA A 1 293 ? 33.227 21.502 56.185 1.00 11.58 ? 293 ALA A N   1 
ATOM   2234 C CA  . ALA A 1 293 ? 34.248 20.617 55.621 1.00 14.01 ? 293 ALA A CA  1 
ATOM   2235 C C   . ALA A 1 293 ? 35.701 21.003 55.911 1.00 16.86 ? 293 ALA A C   1 
ATOM   2236 O O   . ALA A 1 293 ? 36.505 20.163 56.319 1.00 16.73 ? 293 ALA A O   1 
ATOM   2237 C CB  . ALA A 1 293 ? 34.039 20.502 54.117 1.00 18.27 ? 293 ALA A CB  1 
ATOM   2238 N N   . LEU A 1 294 ? 36.031 22.271 55.697 1.00 17.83 ? 294 LEU A N   1 
ATOM   2239 C CA  . LEU A 1 294 ? 37.387 22.755 55.908 1.00 18.88 ? 294 LEU A CA  1 
ATOM   2240 C C   . LEU A 1 294 ? 37.763 22.746 57.381 1.00 18.67 ? 294 LEU A C   1 
ATOM   2241 O O   . LEU A 1 294 ? 37.458 23.688 58.114 1.00 17.89 ? 294 LEU A O   1 
ATOM   2242 C CB  . LEU A 1 294 ? 37.526 24.165 55.337 1.00 15.68 ? 294 LEU A CB  1 
ATOM   2243 C CG  . LEU A 1 294 ? 38.958 24.705 55.233 1.00 20.23 ? 294 LEU A CG  1 
ATOM   2244 C CD1 . LEU A 1 294 ? 39.851 23.674 54.567 1.00 26.69 ? 294 LEU A CD1 1 
ATOM   2245 C CD2 . LEU A 1 294 ? 38.953 25.998 54.436 1.00 13.60 ? 294 LEU A CD2 1 
ATOM   2246 N N   . LYS A 1 295 ? 38.424 21.673 57.808 1.00 22.68 ? 295 LYS A N   1 
ATOM   2247 C CA  . LYS A 1 295 ? 38.842 21.520 59.198 1.00 32.17 ? 295 LYS A CA  1 
ATOM   2248 C C   . LYS A 1 295 ? 40.224 22.115 59.414 1.00 37.37 ? 295 LYS A C   1 
ATOM   2249 O O   . LYS A 1 295 ? 40.341 23.047 60.239 1.00 41.95 ? 295 LYS A O   1 
ATOM   2250 C CB  . LYS A 1 295 ? 38.867 20.039 59.585 1.00 32.66 ? 295 LYS A CB  1 
ATOM   2251 C CG  . LYS A 1 295 ? 37.545 19.320 59.417 1.00 41.10 ? 295 LYS A CG  1 
ATOM   2252 C CD  . LYS A 1 295 ? 36.472 19.913 60.305 1.00 40.12 ? 295 LYS A CD  1 
ATOM   2253 C CE  . LYS A 1 295 ? 35.168 19.144 60.161 1.00 43.20 ? 295 LYS A CE  1 
ATOM   2254 N NZ  . LYS A 1 295 ? 34.084 19.738 60.989 1.00 43.70 ? 295 LYS A NZ  1 
ATOM   2255 O OXT . LYS A 1 295 ? 41.171 21.634 58.756 1.00 40.66 ? 295 LYS A OXT 1 
ATOM   2256 N N   . THR B 1 1   ? 35.004 0.557  24.595 1.00 19.06 ? 301 THR C N   1 
ATOM   2257 C CA  . THR B 1 1   ? 34.358 1.318  23.489 1.00 17.92 ? 301 THR C CA  1 
ATOM   2258 C C   . THR B 1 1   ? 33.934 2.719  23.902 1.00 15.32 ? 301 THR C C   1 
ATOM   2259 O O   . THR B 1 1   ? 33.095 2.893  24.787 1.00 19.28 ? 301 THR C O   1 
ATOM   2260 C CB  . THR B 1 1   ? 33.100 0.593  22.960 1.00 22.29 ? 301 THR C CB  1 
ATOM   2261 O OG1 . THR B 1 1   ? 33.457 -0.708 22.482 1.00 26.83 ? 301 THR C OG1 1 
ATOM   2262 C CG2 . THR B 1 1   ? 32.466 1.391  21.823 1.00 21.45 ? 301 THR C CG2 1 
ATOM   2263 N N   . THR B 1 2   ? 34.524 3.718  23.260 1.00 15.33 ? 302 THR C N   1 
ATOM   2264 C CA  . THR B 1 2   ? 34.176 5.106  23.521 1.00 20.06 ? 302 THR C CA  1 
ATOM   2265 C C   . THR B 1 2   ? 33.988 5.773  22.163 1.00 20.85 ? 302 THR C C   1 
ATOM   2266 O O   . THR B 1 2   ? 34.916 5.824  21.350 1.00 22.51 ? 302 THR C O   1 
ATOM   2267 C CB  . THR B 1 2   ? 35.283 5.856  24.301 1.00 20.24 ? 302 THR C CB  1 
ATOM   2268 O OG1 . THR B 1 2   ? 35.396 5.312  25.618 1.00 20.21 ? 302 THR C OG1 1 
ATOM   2269 C CG2 . THR B 1 2   ? 34.949 7.339  24.410 1.00 18.41 ? 302 THR C CG2 1 
ATOM   2270 N N   . ASN B 1 3   ? 32.783 6.275  21.915 1.00 14.38 ? 303 ASN C N   1 
ATOM   2271 C CA  . ASN B 1 3   ? 32.490 6.936  20.655 1.00 10.22 ? 303 ASN C CA  1 
ATOM   2272 C C   . ASN B 1 3   ? 32.922 8.390  20.758 1.00 11.37 ? 303 ASN C C   1 
ATOM   2273 O O   . ASN B 1 3   ? 32.186 9.229  21.270 1.00 10.75 ? 303 ASN C O   1 
ATOM   2274 C CB  . ASN B 1 3   ? 30.990 6.847  20.355 1.00 11.74 ? 303 ASN C CB  1 
ATOM   2275 C CG  . ASN B 1 3   ? 30.640 7.310  18.947 1.00 11.95 ? 303 ASN C CG  1 
ATOM   2276 O OD1 . ASN B 1 3   ? 31.524 7.555  18.118 1.00 11.34 ? 303 ASN C OD1 1 
ATOM   2277 N ND2 . ASN B 1 3   ? 29.347 7.418  18.667 1.00 10.74 ? 303 ASN C ND2 1 
ATOM   2278 N N   . LYS B 1 4   ? 34.136 8.682  20.309 1.00 9.24  ? 304 LYS C N   1 
ATOM   2279 C CA  . LYS B 1 4   ? 34.637 10.057 20.337 1.00 5.98  ? 304 LYS C CA  1 
ATOM   2280 C C   . LYS B 1 4   ? 35.607 10.252 19.187 1.00 8.45  ? 304 LYS C C   1 
ATOM   2281 O O   . LYS B 1 4   ? 36.265 9.307  18.760 1.00 9.69  ? 304 LYS C O   1 
ATOM   2282 C CB  . LYS B 1 4   ? 35.339 10.369 21.675 1.00 6.56  ? 304 LYS C CB  1 
ATOM   2283 C CG  . LYS B 1 4   ? 36.646 9.612  21.924 1.00 13.06 ? 304 LYS C CG  1 
ATOM   2284 C CD  . LYS B 1 4   ? 37.182 9.871  23.326 1.00 13.04 ? 304 LYS C CD  1 
ATOM   2285 C CE  . LYS B 1 4   ? 38.319 8.918  23.694 1.00 20.24 ? 304 LYS C CE  1 
ATOM   2286 N NZ  . LYS B 1 4   ? 39.564 9.182  22.932 1.00 28.85 ? 304 LYS C NZ  1 
ATOM   2287 N N   . PRO B 1 5   ? 35.673 11.473 18.638 1.00 5.59  ? 305 PRO C N   1 
ATOM   2288 C CA  . PRO B 1 5   ? 34.859 12.599 19.099 1.00 5.26  ? 305 PRO C CA  1 
ATOM   2289 C C   . PRO B 1 5   ? 33.406 12.467 18.611 1.00 5.18  ? 305 PRO C C   1 
ATOM   2290 O O   . PRO B 1 5   ? 33.116 11.696 17.698 1.00 5.14  ? 305 PRO C O   1 
ATOM   2291 C CB  . PRO B 1 5   ? 35.583 13.816 18.512 1.00 6.58  ? 305 PRO C CB  1 
ATOM   2292 C CG  . PRO B 1 5   ? 36.235 13.273 17.287 1.00 11.83 ? 305 PRO C CG  1 
ATOM   2293 C CD  . PRO B 1 5   ? 36.738 11.925 17.725 1.00 7.90  ? 305 PRO C CD  1 
ATOM   2294 N N   . ILE B 1 6   ? 32.499 13.203 19.242 1.00 8.22  ? 306 ILE C N   1 
ATOM   2295 C CA  . ILE B 1 6   ? 31.092 13.169 18.871 1.00 4.30  ? 306 ILE C CA  1 
ATOM   2296 C C   . ILE B 1 6   ? 30.446 14.478 19.296 1.00 7.71  ? 306 ILE C C   1 
ATOM   2297 O O   . ILE B 1 6   ? 30.795 15.042 20.334 1.00 8.16  ? 306 ILE C O   1 
ATOM   2298 C CB  . ILE B 1 6   ? 30.361 11.969 19.541 1.00 6.31  ? 306 ILE C CB  1 
ATOM   2299 C CG1 . ILE B 1 6   ? 28.874 11.990 19.199 1.00 8.98  ? 306 ILE C CG1 1 
ATOM   2300 C CG2 . ILE B 1 6   ? 30.554 12.004 21.067 1.00 3.10  ? 306 ILE C CG2 1 
ATOM   2301 C CD1 . ILE B 1 6   ? 28.143 10.703 19.608 1.00 7.84  ? 306 ILE C CD1 1 
ATOM   2302 N N   . VAL B 1 7   ? 29.527 14.976 18.474 1.00 6.55  ? 307 VAL C N   1 
ATOM   2303 C CA  . VAL B 1 7   ? 28.828 16.210 18.792 1.00 2.96  ? 307 VAL C CA  1 
ATOM   2304 C C   . VAL B 1 7   ? 27.349 16.081 18.477 1.00 6.57  ? 307 VAL C C   1 
ATOM   2305 O O   . VAL B 1 7   ? 26.963 15.484 17.469 1.00 4.05  ? 307 VAL C O   1 
ATOM   2306 C CB  . VAL B 1 7   ? 29.413 17.427 18.014 1.00 6.38  ? 307 VAL C CB  1 
ATOM   2307 C CG1 . VAL B 1 7   ? 29.331 17.192 16.495 1.00 6.22  ? 307 VAL C CG1 1 
ATOM   2308 C CG2 . VAL B 1 7   ? 28.638 18.689 18.384 1.00 7.92  ? 307 VAL C CG2 1 
ATOM   2309 N N   . LEU B 1 8   ? 26.522 16.619 19.367 1.00 6.30  ? 308 LEU C N   1 
ATOM   2310 C CA  . LEU B 1 8   ? 25.077 16.612 19.185 1.00 5.82  ? 308 LEU C CA  1 
ATOM   2311 C C   . LEU B 1 8   ? 24.591 18.044 19.289 1.00 2.86  ? 308 LEU C C   1 
ATOM   2312 O O   . LEU B 1 8   ? 25.127 18.827 20.064 1.00 3.46  ? 308 LEU C O   1 
ATOM   2313 C CB  . LEU B 1 8   ? 24.367 15.817 20.285 1.00 2.42  ? 308 LEU C CB  1 
ATOM   2314 C CG  . LEU B 1 8   ? 24.252 14.296 20.222 1.00 11.60 ? 308 LEU C CG  1 
ATOM   2315 C CD1 . LEU B 1 8   ? 25.570 13.657 20.649 1.00 11.33 ? 308 LEU C CD1 1 
ATOM   2316 C CD2 . LEU B 1 8   ? 23.139 13.855 21.164 1.00 15.98 ? 308 LEU C CD2 1 
ATOM   2317 N N   . SER B 1 9   ? 23.580 18.385 18.506 1.00 2.82  ? 309 SER C N   1 
ATOM   2318 C CA  . SER B 1 9   ? 23.010 19.716 18.587 1.00 7.84  ? 309 SER C CA  1 
ATOM   2319 C C   . SER B 1 9   ? 21.513 19.610 18.340 1.00 7.05  ? 309 SER C C   1 
ATOM   2320 O O   . SER B 1 9   ? 21.026 18.672 17.695 1.00 7.61  ? 309 SER C O   1 
ATOM   2321 C CB  . SER B 1 9   ? 23.684 20.687 17.595 1.00 4.89  ? 309 SER C CB  1 
ATOM   2322 O OG  . SER B 1 9   ? 23.725 20.170 16.284 1.00 11.51 ? 309 SER C OG  1 
ATOM   2323 N N   . THR B 1 10  ? 20.785 20.581 18.873 1.00 4.59  ? 310 THR C N   1 
ATOM   2324 C CA  . THR B 1 10  ? 19.333 20.604 18.776 1.00 4.42  ? 310 THR C CA  1 
ATOM   2325 C C   . THR B 1 10  ? 18.771 21.091 17.450 1.00 6.67  ? 310 THR C C   1 
ATOM   2326 O O   . THR B 1 10  ? 19.306 22.010 16.838 1.00 6.48  ? 310 THR C O   1 
ATOM   2327 C CB  . THR B 1 10  ? 18.765 21.491 19.865 1.00 6.88  ? 310 THR C CB  1 
ATOM   2328 O OG1 . THR B 1 10  ? 19.311 22.806 19.722 1.00 7.33  ? 310 THR C OG1 1 
ATOM   2329 C CG2 . THR B 1 10  ? 19.122 20.935 21.243 1.00 6.73  ? 310 THR C CG2 1 
ATOM   2330 N N   . TRP B 1 11  ? 17.680 20.463 17.032 1.00 4.50  ? 311 TRP C N   1 
ATOM   2331 C CA  . TRP B 1 11  ? 16.981 20.808 15.791 1.00 4.11  ? 311 TRP C CA  1 
ATOM   2332 C C   . TRP B 1 11  ? 17.709 20.546 14.473 1.00 3.65  ? 311 TRP C C   1 
ATOM   2333 O O   . TRP B 1 11  ? 18.892 20.214 14.444 1.00 6.26  ? 311 TRP C O   1 
ATOM   2334 C CB  . TRP B 1 11  ? 16.515 22.266 15.837 1.00 4.52  ? 311 TRP C CB  1 
ATOM   2335 C CG  . TRP B 1 11  ? 15.587 22.555 16.991 1.00 2.41  ? 311 TRP C CG  1 
ATOM   2336 C CD1 . TRP B 1 11  ? 15.886 23.254 18.129 1.00 6.81  ? 311 TRP C CD1 1 
ATOM   2337 C CD2 . TRP B 1 11  ? 14.225 22.128 17.132 1.00 6.76  ? 311 TRP C CD2 1 
ATOM   2338 N NE1 . TRP B 1 11  ? 14.795 23.288 18.967 1.00 10.18 ? 311 TRP C NE1 1 
ATOM   2339 C CE2 . TRP B 1 11  ? 13.763 22.605 18.381 1.00 10.70 ? 311 TRP C CE2 1 
ATOM   2340 C CE3 . TRP B 1 11  ? 13.351 21.389 16.327 1.00 9.36  ? 311 TRP C CE3 1 
ATOM   2341 C CZ2 . TRP B 1 11  ? 12.464 22.366 18.842 1.00 12.17 ? 311 TRP C CZ2 1 
ATOM   2342 C CZ3 . TRP B 1 11  ? 12.059 21.151 16.786 1.00 10.93 ? 311 TRP C CZ3 1 
ATOM   2343 C CH2 . TRP B 1 11  ? 11.631 21.639 18.032 1.00 11.00 ? 311 TRP C CH2 1 
ATOM   2344 N N   . ASN B 1 12  ? 16.973 20.706 13.373 1.00 6.06  ? 312 ASN C N   1 
ATOM   2345 C CA  . ASN B 1 12  ? 17.518 20.465 12.046 1.00 7.09  ? 312 ASN C CA  1 
ATOM   2346 C C   . ASN B 1 12  ? 18.768 21.277 11.683 1.00 7.58  ? 312 ASN C C   1 
ATOM   2347 O O   . ASN B 1 12  ? 19.670 20.739 11.035 1.00 7.82  ? 312 ASN C O   1 
ATOM   2348 C CB  . ASN B 1 12  ? 16.430 20.666 10.984 1.00 5.03  ? 312 ASN C CB  1 
ATOM   2349 C CG  . ASN B 1 12  ? 15.363 19.556 11.000 1.00 9.24  ? 312 ASN C CG  1 
ATOM   2350 O OD1 . ASN B 1 12  ? 14.601 19.397 10.040 1.00 10.90 ? 312 ASN C OD1 1 
ATOM   2351 N ND2 . ASN B 1 12  ? 15.301 18.800 12.088 1.00 4.95  ? 312 ASN C ND2 1 
ATOM   2352 N N   . PHE B 1 13  ? 18.837 22.552 12.071 1.00 10.31 ? 313 PHE C N   1 
ATOM   2353 C CA  . PHE B 1 13  ? 20.027 23.351 11.745 1.00 10.61 ? 313 PHE C CA  1 
ATOM   2354 C C   . PHE B 1 13  ? 21.267 22.850 12.477 1.00 6.31  ? 313 PHE C C   1 
ATOM   2355 O O   . PHE B 1 13  ? 22.387 23.284 12.193 1.00 13.03 ? 313 PHE C O   1 
ATOM   2356 C CB  . PHE B 1 13  ? 19.819 24.852 12.042 1.00 12.44 ? 313 PHE C CB  1 
ATOM   2357 C CG  . PHE B 1 13  ? 19.324 25.162 13.439 1.00 18.96 ? 313 PHE C CG  1 
ATOM   2358 C CD1 . PHE B 1 13  ? 19.773 24.449 14.541 1.00 22.23 ? 313 PHE C CD1 1 
ATOM   2359 C CD2 . PHE B 1 13  ? 18.425 26.201 13.644 1.00 24.26 ? 313 PHE C CD2 1 
ATOM   2360 C CE1 . PHE B 1 13  ? 19.338 24.764 15.823 1.00 18.48 ? 313 PHE C CE1 1 
ATOM   2361 C CE2 . PHE B 1 13  ? 17.986 26.525 14.924 1.00 25.79 ? 313 PHE C CE2 1 
ATOM   2362 C CZ  . PHE B 1 13  ? 18.445 25.800 16.011 1.00 19.21 ? 313 PHE C CZ  1 
ATOM   2363 N N   . GLY B 1 14  ? 21.056 21.935 13.419 1.00 8.54  ? 314 GLY C N   1 
ATOM   2364 C CA  . GLY B 1 14  ? 22.163 21.376 14.167 1.00 8.56  ? 314 GLY C CA  1 
ATOM   2365 C C   . GLY B 1 14  ? 23.000 20.511 13.251 1.00 5.74  ? 314 GLY C C   1 
ATOM   2366 O O   . GLY B 1 14  ? 24.138 20.171 13.550 1.00 7.54  ? 314 GLY C O   1 
ATOM   2367 N N   . LEU B 1 15  ? 22.424 20.150 12.112 1.00 12.95 ? 315 LEU C N   1 
ATOM   2368 C CA  . LEU B 1 15  ? 23.133 19.320 11.162 1.00 12.14 ? 315 LEU C CA  1 
ATOM   2369 C C   . LEU B 1 15  ? 24.316 20.092 10.575 1.00 12.82 ? 315 LEU C C   1 
ATOM   2370 O O   . LEU B 1 15  ? 25.450 19.610 10.634 1.00 9.82  ? 315 LEU C O   1 
ATOM   2371 C CB  . LEU B 1 15  ? 22.183 18.855 10.061 1.00 16.16 ? 315 LEU C CB  1 
ATOM   2372 C CG  . LEU B 1 15  ? 22.581 17.596 9.293  1.00 19.29 ? 315 LEU C CG  1 
ATOM   2373 C CD1 . LEU B 1 15  ? 22.774 16.408 10.249 1.00 18.12 ? 315 LEU C CD1 1 
ATOM   2374 C CD2 . LEU B 1 15  ? 21.488 17.284 8.284  1.00 18.31 ? 315 LEU C CD2 1 
ATOM   2375 N N   . HIS B 1 16  ? 24.089 21.279 10.014 1.00 10.86 ? 316 HIS C N   1 
ATOM   2376 C CA  . HIS B 1 16  ? 25.231 22.009 9.476  1.00 13.53 ? 316 HIS C CA  1 
ATOM   2377 C C   . HIS B 1 16  ? 26.052 22.662 10.592 1.00 7.77  ? 316 HIS C C   1 
ATOM   2378 O O   . HIS B 1 16  ? 27.235 22.917 10.410 1.00 10.59 ? 316 HIS C O   1 
ATOM   2379 C CB  . HIS B 1 16  ? 24.815 23.046 8.418  1.00 19.91 ? 316 HIS C CB  1 
ATOM   2380 C CG  . HIS B 1 16  ? 23.776 24.019 8.877  1.00 27.35 ? 316 HIS C CG  1 
ATOM   2381 N ND1 . HIS B 1 16  ? 22.455 23.667 9.053  1.00 33.95 ? 316 HIS C ND1 1 
ATOM   2382 C CD2 . HIS B 1 16  ? 23.851 25.344 9.153  1.00 34.72 ? 316 HIS C CD2 1 
ATOM   2383 C CE1 . HIS B 1 16  ? 21.761 24.732 9.413  1.00 34.66 ? 316 HIS C CE1 1 
ATOM   2384 N NE2 . HIS B 1 16  ? 22.584 25.763 9.482  1.00 31.68 ? 316 HIS C NE2 1 
ATOM   2385 N N   . ALA B 1 17  ? 25.441 22.914 11.751 1.00 6.29  ? 317 ALA C N   1 
ATOM   2386 C CA  . ALA B 1 17  ? 26.195 23.469 12.868 1.00 7.08  ? 317 ALA C CA  1 
ATOM   2387 C C   . ALA B 1 17  ? 27.213 22.387 13.238 1.00 5.62  ? 317 ALA C C   1 
ATOM   2388 O O   . ALA B 1 17  ? 28.369 22.685 13.520 1.00 8.45  ? 317 ALA C O   1 
ATOM   2389 C CB  . ALA B 1 17  ? 25.276 23.757 14.053 1.00 9.50  ? 317 ALA C CB  1 
ATOM   2390 N N   . ASN B 1 18  ? 26.778 21.126 13.222 1.00 4.79  ? 318 ASN C N   1 
ATOM   2391 C CA  . ASN B 1 18  ? 27.669 20.008 13.546 1.00 4.21  ? 318 ASN C CA  1 
ATOM   2392 C C   . ASN B 1 18  ? 28.863 19.944 12.600 1.00 3.91  ? 318 ASN C C   1 
ATOM   2393 O O   . ASN B 1 18  ? 29.972 19.617 13.016 1.00 5.96  ? 318 ASN C O   1 
ATOM   2394 C CB  . ASN B 1 18  ? 26.938 18.674 13.473 1.00 1.12  ? 318 ASN C CB  1 
ATOM   2395 C CG  . ASN B 1 18  ? 26.134 18.372 14.719 1.00 5.28  ? 318 ASN C CG  1 
ATOM   2396 O OD1 . ASN B 1 18  ? 26.057 19.181 15.640 1.00 4.82  ? 318 ASN C OD1 1 
ATOM   2397 N ND2 . ASN B 1 18  ? 25.522 17.191 14.748 1.00 5.78  ? 318 ASN C ND2 1 
ATOM   2398 N N   . VAL B 1 19  ? 28.627 20.221 11.324 1.00 4.03  ? 319 VAL C N   1 
ATOM   2399 C CA  . VAL B 1 19  ? 29.713 20.201 10.346 1.00 9.41  ? 319 VAL C CA  1 
ATOM   2400 C C   . VAL B 1 19  ? 30.834 21.139 10.794 1.00 7.50  ? 319 VAL C C   1 
ATOM   2401 O O   . VAL B 1 19  ? 32.016 20.792 10.711 1.00 6.87  ? 319 VAL C O   1 
ATOM   2402 C CB  . VAL B 1 19  ? 29.221 20.632 8.943  1.00 7.73  ? 319 VAL C CB  1 
ATOM   2403 C CG1 . VAL B 1 19  ? 30.402 20.732 7.980  1.00 11.45 ? 319 VAL C CG1 1 
ATOM   2404 C CG2 . VAL B 1 19  ? 28.212 19.630 8.421  1.00 12.95 ? 319 VAL C CG2 1 
ATOM   2405 N N   . GLU B 1 20  ? 30.460 22.319 11.280 1.00 11.64 ? 320 GLU C N   1 
ATOM   2406 C CA  . GLU B 1 20  ? 31.444 23.292 11.745 1.00 8.41  ? 320 GLU C CA  1 
ATOM   2407 C C   . GLU B 1 20  ? 32.183 22.790 12.972 1.00 6.16  ? 320 GLU C C   1 
ATOM   2408 O O   . GLU B 1 20  ? 33.402 22.922 13.069 1.00 9.13  ? 320 GLU C O   1 
ATOM   2409 C CB  . GLU B 1 20  ? 30.771 24.626 12.071 1.00 13.68 ? 320 GLU C CB  1 
ATOM   2410 C CG  . GLU B 1 20  ? 30.191 25.326 10.866 1.00 24.35 ? 320 GLU C CG  1 
ATOM   2411 C CD  . GLU B 1 20  ? 31.187 25.428 9.724  1.00 29.61 ? 320 GLU C CD  1 
ATOM   2412 O OE1 . GLU B 1 20  ? 32.285 25.980 9.944  1.00 21.15 ? 320 GLU C OE1 1 
ATOM   2413 O OE2 . GLU B 1 20  ? 30.865 24.952 8.609  1.00 31.24 ? 320 GLU C OE2 1 
ATOM   2414 N N   . ALA B 1 21  ? 31.441 22.210 13.910 1.00 8.63  ? 321 ALA C N   1 
ATOM   2415 C CA  . ALA B 1 21  ? 32.031 21.685 15.135 1.00 5.79  ? 321 ALA C CA  1 
ATOM   2416 C C   . ALA B 1 21  ? 32.988 20.545 14.806 1.00 7.84  ? 321 ALA C C   1 
ATOM   2417 O O   . ALA B 1 21  ? 34.029 20.386 15.445 1.00 4.74  ? 321 ALA C O   1 
ATOM   2418 C CB  . ALA B 1 21  ? 30.926 21.192 16.068 1.00 4.55  ? 321 ALA C CB  1 
ATOM   2419 N N   . TRP B 1 22  ? 32.636 19.765 13.790 1.00 7.58  ? 322 TRP C N   1 
ATOM   2420 C CA  . TRP B 1 22  ? 33.454 18.626 13.393 1.00 8.60  ? 322 TRP C CA  1 
ATOM   2421 C C   . TRP B 1 22  ? 34.788 19.074 12.804 1.00 7.04  ? 322 TRP C C   1 
ATOM   2422 O O   . TRP B 1 22  ? 35.775 18.347 12.883 1.00 6.18  ? 322 TRP C O   1 
ATOM   2423 C CB  . TRP B 1 22  ? 32.691 17.757 12.385 1.00 9.82  ? 322 TRP C CB  1 
ATOM   2424 C CG  . TRP B 1 22  ? 33.266 16.369 12.249 1.00 8.85  ? 322 TRP C CG  1 
ATOM   2425 C CD1 . TRP B 1 22  ? 33.913 15.853 11.169 1.00 10.38 ? 322 TRP C CD1 1 
ATOM   2426 C CD2 . TRP B 1 22  ? 33.271 15.341 13.250 1.00 10.82 ? 322 TRP C CD2 1 
ATOM   2427 N NE1 . TRP B 1 22  ? 34.326 14.566 11.431 1.00 7.58  ? 322 TRP C NE1 1 
ATOM   2428 C CE2 . TRP B 1 22  ? 33.945 14.228 12.702 1.00 11.09 ? 322 TRP C CE2 1 
ATOM   2429 C CE3 . TRP B 1 22  ? 32.775 15.253 14.556 1.00 7.38  ? 322 TRP C CE3 1 
ATOM   2430 C CZ2 . TRP B 1 22  ? 34.134 13.038 13.417 1.00 8.84  ? 322 TRP C CZ2 1 
ATOM   2431 C CZ3 . TRP B 1 22  ? 32.963 14.069 15.268 1.00 10.11 ? 322 TRP C CZ3 1 
ATOM   2432 C CH2 . TRP B 1 22  ? 33.640 12.977 14.693 1.00 8.18  ? 322 TRP C CH2 1 
ATOM   2433 N N   . LYS B 1 23  ? 34.822 20.263 12.209 1.00 6.50  ? 323 LYS C N   1 
ATOM   2434 C CA  . LYS B 1 23  ? 36.077 20.771 11.644 1.00 7.61  ? 323 LYS C CA  1 
ATOM   2435 C C   . LYS B 1 23  ? 37.103 20.878 12.767 1.00 10.77 ? 323 LYS C C   1 
ATOM   2436 O O   . LYS B 1 23  ? 38.306 20.707 12.556 1.00 7.39  ? 323 LYS C O   1 
ATOM   2437 C CB  . LYS B 1 23  ? 35.867 22.145 11.004 1.00 6.50  ? 323 LYS C CB  1 
ATOM   2438 C CG  . LYS B 1 23  ? 35.093 22.109 9.701  1.00 14.01 ? 323 LYS C CG  1 
ATOM   2439 C CD  . LYS B 1 23  ? 34.829 23.515 9.186  1.00 15.75 ? 323 LYS C CD  1 
ATOM   2440 C CE  . LYS B 1 23  ? 34.031 23.492 7.895  1.00 22.55 ? 323 LYS C CE  1 
ATOM   2441 N NZ  . LYS B 1 23  ? 33.704 24.874 7.432  1.00 26.94 ? 323 LYS C NZ  1 
ATOM   2442 N N   . VAL B 1 24  ? 36.618 21.173 13.967 1.00 8.22  ? 324 VAL C N   1 
ATOM   2443 C CA  . VAL B 1 24  ? 37.489 21.278 15.124 1.00 9.80  ? 324 VAL C CA  1 
ATOM   2444 C C   . VAL B 1 24  ? 37.718 19.893 15.725 1.00 9.22  ? 324 VAL C C   1 
ATOM   2445 O O   . VAL B 1 24  ? 38.854 19.475 15.929 1.00 9.58  ? 324 VAL C O   1 
ATOM   2446 C CB  . VAL B 1 24  ? 36.875 22.196 16.213 1.00 7.59  ? 324 VAL C CB  1 
ATOM   2447 C CG1 . VAL B 1 24  ? 37.677 22.098 17.505 1.00 12.76 ? 324 VAL C CG1 1 
ATOM   2448 C CG2 . VAL B 1 24  ? 36.857 23.632 15.735 1.00 9.20  ? 324 VAL C CG2 1 
ATOM   2449 N N   . LEU B 1 25  ? 36.631 19.179 15.999 1.00 11.31 ? 325 LEU C N   1 
ATOM   2450 C CA  . LEU B 1 25  ? 36.732 17.856 16.610 1.00 7.90  ? 325 LEU C CA  1 
ATOM   2451 C C   . LEU B 1 25  ? 37.528 16.839 15.802 1.00 7.40  ? 325 LEU C C   1 
ATOM   2452 O O   . LEU B 1 25  ? 38.301 16.070 16.371 1.00 3.98  ? 325 LEU C O   1 
ATOM   2453 C CB  . LEU B 1 25  ? 35.336 17.296 16.873 1.00 5.39  ? 325 LEU C CB  1 
ATOM   2454 C CG  . LEU B 1 25  ? 34.472 18.114 17.835 1.00 7.61  ? 325 LEU C CG  1 
ATOM   2455 C CD1 . LEU B 1 25  ? 33.077 17.536 17.865 1.00 3.40  ? 325 LEU C CD1 1 
ATOM   2456 C CD2 . LEU B 1 25  ? 35.102 18.117 19.231 1.00 9.76  ? 325 LEU C CD2 1 
ATOM   2457 N N   . SER B 1 26  ? 37.345 16.832 14.483 1.00 5.96  ? 326 SER C N   1 
ATOM   2458 C CA  . SER B 1 26  ? 38.043 15.859 13.643 1.00 6.71  ? 326 SER C CA  1 
ATOM   2459 C C   . SER B 1 26  ? 39.548 16.088 13.598 1.00 11.23 ? 326 SER C C   1 
ATOM   2460 O O   . SER B 1 26  ? 40.309 15.175 13.265 1.00 14.51 ? 326 SER C O   1 
ATOM   2461 C CB  . SER B 1 26  ? 37.481 15.872 12.208 1.00 7.45  ? 326 SER C CB  1 
ATOM   2462 O OG  . SER B 1 26  ? 37.752 17.107 11.569 1.00 10.55 ? 326 SER C OG  1 
ATOM   2463 N N   . LYS B 1 27  ? 39.977 17.300 13.942 1.00 10.26 ? 327 LYS C N   1 
ATOM   2464 C CA  . LYS B 1 27  ? 41.395 17.644 13.928 1.00 13.04 ? 327 LYS C CA  1 
ATOM   2465 C C   . LYS B 1 27  ? 41.975 17.512 15.333 1.00 15.05 ? 327 LYS C C   1 
ATOM   2466 O O   . LYS B 1 27  ? 43.078 17.976 15.604 1.00 15.12 ? 327 LYS C O   1 
ATOM   2467 C CB  . LYS B 1 27  ? 41.588 19.080 13.415 1.00 15.83 ? 327 LYS C CB  1 
ATOM   2468 C CG  . LYS B 1 27  ? 41.018 19.325 12.026 1.00 20.80 ? 327 LYS C CG  1 
ATOM   2469 C CD  . LYS B 1 27  ? 41.642 18.388 10.999 1.00 27.05 ? 327 LYS C CD  1 
ATOM   2470 C CE  . LYS B 1 27  ? 41.033 18.580 9.620  1.00 31.15 ? 327 LYS C CE  1 
ATOM   2471 N NZ  . LYS B 1 27  ? 41.282 19.945 9.081  1.00 35.50 ? 327 LYS C NZ  1 
ATOM   2472 N N   . GLY B 1 28  ? 41.221 16.869 16.216 1.00 10.95 ? 328 GLY C N   1 
ATOM   2473 C CA  . GLY B 1 28  ? 41.673 16.686 17.581 1.00 12.83 ? 328 GLY C CA  1 
ATOM   2474 C C   . GLY B 1 28  ? 41.530 17.932 18.438 1.00 10.63 ? 328 GLY C C   1 
ATOM   2475 O O   . GLY B 1 28  ? 42.094 18.000 19.524 1.00 8.93  ? 328 GLY C O   1 
ATOM   2476 N N   . GLY B 1 29  ? 40.776 18.919 17.956 1.00 8.80  ? 329 GLY C N   1 
ATOM   2477 C CA  . GLY B 1 29  ? 40.589 20.150 18.710 1.00 10.25 ? 329 GLY C CA  1 
ATOM   2478 C C   . GLY B 1 29  ? 39.784 19.985 19.991 1.00 11.76 ? 329 GLY C C   1 
ATOM   2479 O O   . GLY B 1 29  ? 39.194 18.932 20.231 1.00 10.14 ? 329 GLY C O   1 
ATOM   2480 N N   . LYS B 1 30  ? 39.752 21.032 20.814 1.00 10.28 ? 330 LYS C N   1 
ATOM   2481 C CA  . LYS B 1 30  ? 39.025 20.998 22.083 1.00 5.76  ? 330 LYS C CA  1 
ATOM   2482 C C   . LYS B 1 30  ? 37.521 21.071 21.917 1.00 7.67  ? 330 LYS C C   1 
ATOM   2483 O O   . LYS B 1 30  ? 37.014 21.765 21.033 1.00 6.77  ? 330 LYS C O   1 
ATOM   2484 C CB  . LYS B 1 30  ? 39.476 22.153 22.989 1.00 14.73 ? 330 LYS C CB  1 
ATOM   2485 C CG  . LYS B 1 30  ? 40.954 22.103 23.366 1.00 11.18 ? 330 LYS C CG  1 
ATOM   2486 C CD  . LYS B 1 30  ? 41.306 23.083 24.474 1.00 17.44 ? 330 LYS C CD  1 
ATOM   2487 C CE  . LYS B 1 30  ? 41.113 24.534 24.073 1.00 21.93 ? 330 LYS C CE  1 
ATOM   2488 N NZ  . LYS B 1 30  ? 41.481 25.456 25.204 1.00 9.25  ? 330 LYS C NZ  1 
ATOM   2489 N N   . ALA B 1 31  ? 36.804 20.361 22.779 1.00 8.54  ? 331 ALA C N   1 
ATOM   2490 C CA  . ALA B 1 31  ? 35.349 20.366 22.719 1.00 5.39  ? 331 ALA C CA  1 
ATOM   2491 C C   . ALA B 1 31  ? 34.834 21.789 22.891 1.00 3.22  ? 331 ALA C C   1 
ATOM   2492 O O   . ALA B 1 31  ? 33.869 22.192 22.241 1.00 5.54  ? 331 ALA C O   1 
ATOM   2493 C CB  . ALA B 1 31  ? 34.781 19.466 23.813 1.00 7.99  ? 331 ALA C CB  1 
ATOM   2494 N N   . LEU B 1 32  ? 35.486 22.559 23.758 1.00 3.23  ? 332 LEU C N   1 
ATOM   2495 C CA  . LEU B 1 32  ? 35.060 23.934 24.009 1.00 5.38  ? 332 LEU C CA  1 
ATOM   2496 C C   . LEU B 1 32  ? 35.087 24.765 22.731 1.00 6.10  ? 332 LEU C C   1 
ATOM   2497 O O   . LEU B 1 32  ? 34.161 25.534 22.455 1.00 6.52  ? 332 LEU C O   1 
ATOM   2498 C CB  . LEU B 1 32  ? 35.959 24.588 25.064 1.00 7.45  ? 332 LEU C CB  1 
ATOM   2499 C CG  . LEU B 1 32  ? 35.620 26.044 25.408 1.00 13.09 ? 332 LEU C CG  1 
ATOM   2500 C CD1 . LEU B 1 32  ? 34.241 26.115 26.044 1.00 7.47  ? 332 LEU C CD1 1 
ATOM   2501 C CD2 . LEU B 1 32  ? 36.670 26.598 26.365 1.00 14.86 ? 332 LEU C CD2 1 
ATOM   2502 N N   . ASP B 1 33  ? 36.152 24.624 21.953 1.00 6.01  ? 333 ASP C N   1 
ATOM   2503 C CA  . ASP B 1 33  ? 36.252 25.367 20.707 1.00 2.87  ? 333 ASP C CA  1 
ATOM   2504 C C   . ASP B 1 33  ? 35.245 24.856 19.697 1.00 4.05  ? 333 ASP C C   1 
ATOM   2505 O O   . ASP B 1 33  ? 34.686 25.629 18.909 1.00 6.00  ? 333 ASP C O   1 
ATOM   2506 C CB  . ASP B 1 33  ? 37.657 25.249 20.119 1.00 6.15  ? 333 ASP C CB  1 
ATOM   2507 C CG  . ASP B 1 33  ? 38.693 25.963 20.957 1.00 9.85  ? 333 ASP C CG  1 
ATOM   2508 O OD1 . ASP B 1 33  ? 38.425 27.109 21.359 1.00 13.93 ? 333 ASP C OD1 1 
ATOM   2509 O OD2 . ASP B 1 33  ? 39.767 25.385 21.208 1.00 9.99  ? 333 ASP C OD2 1 
ATOM   2510 N N   . ALA B 1 34  ? 35.013 23.549 19.713 1.00 5.25  ? 334 ALA C N   1 
ATOM   2511 C CA  . ALA B 1 34  ? 34.068 22.947 18.774 1.00 4.00  ? 334 ALA C CA  1 
ATOM   2512 C C   . ALA B 1 34  ? 32.638 23.453 18.974 1.00 7.18  ? 334 ALA C C   1 
ATOM   2513 O O   . ALA B 1 34  ? 31.983 23.860 18.013 1.00 6.55  ? 334 ALA C O   1 
ATOM   2514 C CB  . ALA B 1 34  ? 34.114 21.420 18.900 1.00 6.28  ? 334 ALA C CB  1 
ATOM   2515 N N   . VAL B 1 35  ? 32.141 23.424 20.208 1.00 5.88  ? 335 VAL C N   1 
ATOM   2516 C CA  . VAL B 1 35  ? 30.776 23.889 20.436 1.00 7.68  ? 335 VAL C CA  1 
ATOM   2517 C C   . VAL B 1 35  ? 30.625 25.383 20.195 1.00 6.19  ? 335 VAL C C   1 
ATOM   2518 O O   . VAL B 1 35  ? 29.601 25.823 19.686 1.00 5.79  ? 335 VAL C O   1 
ATOM   2519 C CB  . VAL B 1 35  ? 30.270 23.515 21.854 1.00 7.56  ? 335 VAL C CB  1 
ATOM   2520 C CG1 . VAL B 1 35  ? 30.339 22.001 22.016 1.00 5.98  ? 335 VAL C CG1 1 
ATOM   2521 C CG2 . VAL B 1 35  ? 31.087 24.213 22.933 1.00 5.64  ? 335 VAL C CG2 1 
ATOM   2522 N N   . GLU B 1 36  ? 31.646 26.168 20.530 1.00 5.75  ? 336 GLU C N   1 
ATOM   2523 C CA  . GLU B 1 36  ? 31.557 27.601 20.287 1.00 8.94  ? 336 GLU C CA  1 
ATOM   2524 C C   . GLU B 1 36  ? 31.456 27.863 18.785 1.00 5.65  ? 336 GLU C C   1 
ATOM   2525 O O   . GLU B 1 36  ? 30.560 28.577 18.318 1.00 8.22  ? 336 GLU C O   1 
ATOM   2526 C CB  . GLU B 1 36  ? 32.776 28.337 20.837 1.00 5.18  ? 336 GLU C CB  1 
ATOM   2527 C CG  . GLU B 1 36  ? 32.795 29.805 20.426 1.00 6.49  ? 336 GLU C CG  1 
ATOM   2528 C CD  . GLU B 1 36  ? 34.008 30.549 20.954 1.00 11.13 ? 336 GLU C CD  1 
ATOM   2529 O OE1 . GLU B 1 36  ? 35.064 29.909 21.103 1.00 7.49  ? 336 GLU C OE1 1 
ATOM   2530 O OE2 . GLU B 1 36  ? 33.896 31.769 21.198 1.00 9.92  ? 336 GLU C OE2 1 
ATOM   2531 N N   . LYS B 1 37  ? 32.375 27.279 18.027 1.00 6.21  ? 337 LYS C N   1 
ATOM   2532 C CA  . LYS B 1 37  ? 32.372 27.452 16.577 1.00 4.61  ? 337 LYS C CA  1 
ATOM   2533 C C   . LYS B 1 37  ? 31.057 26.964 15.981 1.00 5.30  ? 337 LYS C C   1 
ATOM   2534 O O   . LYS B 1 37  ? 30.478 27.605 15.092 1.00 6.63  ? 337 LYS C O   1 
ATOM   2535 C CB  . LYS B 1 37  ? 33.542 26.683 15.953 1.00 8.55  ? 337 LYS C CB  1 
ATOM   2536 C CG  . LYS B 1 37  ? 33.572 26.729 14.434 1.00 23.03 ? 337 LYS C CG  1 
ATOM   2537 C CD  . LYS B 1 37  ? 34.724 25.895 13.884 1.00 31.70 ? 337 LYS C CD  1 
ATOM   2538 C CE  . LYS B 1 37  ? 34.661 25.802 12.376 1.00 31.90 ? 337 LYS C CE  1 
ATOM   2539 N NZ  . LYS B 1 37  ? 35.758 24.972 11.826 1.00 44.52 ? 337 LYS C NZ  1 
ATOM   2540 N N   . GLY B 1 38  ? 30.585 25.825 16.481 1.00 6.94  ? 338 GLY C N   1 
ATOM   2541 C CA  . GLY B 1 38  ? 29.350 25.249 15.987 1.00 6.80  ? 338 GLY C CA  1 
ATOM   2542 C C   . GLY B 1 38  ? 28.129 26.138 16.135 1.00 10.40 ? 338 GLY C C   1 
ATOM   2543 O O   . GLY B 1 38  ? 27.379 26.347 15.176 1.00 7.80  ? 338 GLY C O   1 
ATOM   2544 N N   . VAL B 1 39  ? 27.922 26.684 17.325 1.00 6.89  ? 339 VAL C N   1 
ATOM   2545 C CA  . VAL B 1 39  ? 26.752 27.522 17.529 1.00 5.79  ? 339 VAL C CA  1 
ATOM   2546 C C   . VAL B 1 39  ? 26.923 28.914 16.938 1.00 6.98  ? 339 VAL C C   1 
ATOM   2547 O O   . VAL B 1 39  ? 25.938 29.571 16.605 1.00 6.89  ? 339 VAL C O   1 
ATOM   2548 C CB  . VAL B 1 39  ? 26.375 27.598 19.028 1.00 9.39  ? 339 VAL C CB  1 
ATOM   2549 C CG1 . VAL B 1 39  ? 26.194 26.181 19.572 1.00 7.58  ? 339 VAL C CG1 1 
ATOM   2550 C CG2 . VAL B 1 39  ? 27.441 28.355 19.820 1.00 8.60  ? 339 VAL C CG2 1 
ATOM   2551 N N   . ARG B 1 40  ? 28.164 29.366 16.790 1.00 7.30  ? 340 ARG C N   1 
ATOM   2552 C CA  . ARG B 1 40  ? 28.405 30.687 16.197 1.00 7.09  ? 340 ARG C CA  1 
ATOM   2553 C C   . ARG B 1 40  ? 27.879 30.723 14.761 1.00 9.25  ? 340 ARG C C   1 
ATOM   2554 O O   . ARG B 1 40  ? 27.457 31.774 14.264 1.00 8.79  ? 340 ARG C O   1 
ATOM   2555 C CB  . ARG B 1 40  ? 29.900 31.015 16.190 1.00 7.96  ? 340 ARG C CB  1 
ATOM   2556 C CG  . ARG B 1 40  ? 30.449 31.562 17.496 1.00 5.84  ? 340 ARG C CG  1 
ATOM   2557 C CD  . ARG B 1 40  ? 31.926 31.896 17.324 1.00 10.05 ? 340 ARG C CD  1 
ATOM   2558 N NE  . ARG B 1 40  ? 32.132 32.864 16.245 1.00 12.50 ? 340 ARG C NE  1 
ATOM   2559 C CZ  . ARG B 1 40  ? 32.325 34.168 16.435 1.00 17.47 ? 340 ARG C CZ  1 
ATOM   2560 N NH1 . ARG B 1 40  ? 32.346 34.660 17.665 1.00 12.34 ? 340 ARG C NH1 1 
ATOM   2561 N NH2 . ARG B 1 40  ? 32.492 34.980 15.394 1.00 13.11 ? 340 ARG C NH2 1 
ATOM   2562 N N   . LEU B 1 41  ? 27.914 29.572 14.094 1.00 10.25 ? 341 LEU C N   1 
ATOM   2563 C CA  . LEU B 1 41  ? 27.426 29.466 12.717 1.00 11.85 ? 341 LEU C CA  1 
ATOM   2564 C C   . LEU B 1 41  ? 25.961 29.887 12.654 1.00 12.96 ? 341 LEU C C   1 
ATOM   2565 O O   . LEU B 1 41  ? 25.536 30.586 11.735 1.00 11.74 ? 341 LEU C O   1 
ATOM   2566 C CB  . LEU B 1 41  ? 27.554 28.024 12.209 1.00 11.67 ? 341 LEU C CB  1 
ATOM   2567 C CG  . LEU B 1 41  ? 27.033 27.783 10.789 1.00 6.08  ? 341 LEU C CG  1 
ATOM   2568 C CD1 . LEU B 1 41  ? 27.984 28.414 9.788  1.00 13.30 ? 341 LEU C CD1 1 
ATOM   2569 C CD2 . LEU B 1 41  ? 26.892 26.294 10.526 1.00 11.15 ? 341 LEU C CD2 1 
ATOM   2570 N N   . VAL B 1 42  ? 25.188 29.453 13.642 1.00 8.81  ? 342 VAL C N   1 
ATOM   2571 C CA  . VAL B 1 42  ? 23.774 29.776 13.686 1.00 7.58  ? 342 VAL C CA  1 
ATOM   2572 C C   . VAL B 1 42  ? 23.550 31.220 14.131 1.00 6.78  ? 342 VAL C C   1 
ATOM   2573 O O   . VAL B 1 42  ? 22.656 31.903 13.627 1.00 10.68 ? 342 VAL C O   1 
ATOM   2574 C CB  . VAL B 1 42  ? 23.034 28.808 14.627 1.00 10.37 ? 342 VAL C CB  1 
ATOM   2575 C CG1 . VAL B 1 42  ? 21.536 29.044 14.557 1.00 11.60 ? 342 VAL C CG1 1 
ATOM   2576 C CG2 . VAL B 1 42  ? 23.372 27.372 14.241 1.00 14.62 ? 342 VAL C CG2 1 
ATOM   2577 N N   . GLU B 1 43  ? 24.354 31.682 15.082 1.00 8.62  ? 343 GLU C N   1 
ATOM   2578 C CA  . GLU B 1 43  ? 24.243 33.056 15.554 1.00 6.88  ? 343 GLU C CA  1 
ATOM   2579 C C   . GLU B 1 43  ? 24.428 34.016 14.380 1.00 9.68  ? 343 GLU C C   1 
ATOM   2580 O O   . GLU B 1 43  ? 23.735 35.024 14.292 1.00 8.83  ? 343 GLU C O   1 
ATOM   2581 C CB  . GLU B 1 43  ? 25.313 33.349 16.601 1.00 5.29  ? 343 GLU C CB  1 
ATOM   2582 C CG  . GLU B 1 43  ? 25.184 32.533 17.881 1.00 2.77  ? 343 GLU C CG  1 
ATOM   2583 C CD  . GLU B 1 43  ? 26.218 32.928 18.908 1.00 9.61  ? 343 GLU C CD  1 
ATOM   2584 O OE1 . GLU B 1 43  ? 27.323 33.346 18.497 1.00 10.21 ? 343 GLU C OE1 1 
ATOM   2585 O OE2 . GLU B 1 43  ? 25.927 32.809 20.122 1.00 7.85  ? 343 GLU C OE2 1 
ATOM   2586 N N   . ASP B 1 44  ? 25.366 33.686 13.493 1.00 12.46 ? 344 ASP C N   1 
ATOM   2587 C CA  . ASP B 1 44  ? 25.681 34.508 12.320 1.00 14.56 ? 344 ASP C CA  1 
ATOM   2588 C C   . ASP B 1 44  ? 24.621 34.485 11.230 1.00 16.40 ? 344 ASP C C   1 
ATOM   2589 O O   . ASP B 1 44  ? 24.572 35.388 10.401 1.00 13.62 ? 344 ASP C O   1 
ATOM   2590 C CB  . ASP B 1 44  ? 26.982 34.048 11.659 1.00 13.77 ? 344 ASP C CB  1 
ATOM   2591 C CG  . ASP B 1 44  ? 28.201 34.307 12.501 1.00 17.92 ? 344 ASP C CG  1 
ATOM   2592 O OD1 . ASP B 1 44  ? 28.145 35.166 13.402 1.00 13.18 ? 344 ASP C OD1 1 
ATOM   2593 O OD2 . ASP B 1 44  ? 29.230 33.652 12.241 1.00 13.74 ? 344 ASP C OD2 1 
ATOM   2594 N N   . ASP B 1 45  ? 23.789 33.450 11.223 1.00 14.73 ? 345 ASP C N   1 
ATOM   2595 C CA  . ASP B 1 45  ? 22.773 33.290 10.180 1.00 14.84 ? 345 ASP C CA  1 
ATOM   2596 C C   . ASP B 1 45  ? 21.509 34.127 10.360 1.00 14.95 ? 345 ASP C C   1 
ATOM   2597 O O   . ASP B 1 45  ? 20.673 33.829 11.210 1.00 14.91 ? 345 ASP C O   1 
ATOM   2598 C CB  . ASP B 1 45  ? 22.390 31.817 10.074 1.00 21.15 ? 345 ASP C CB  1 
ATOM   2599 C CG  . ASP B 1 45  ? 21.684 31.494 8.777  1.00 23.12 ? 345 ASP C CG  1 
ATOM   2600 O OD1 . ASP B 1 45  ? 21.030 32.400 8.218  1.00 16.47 ? 345 ASP C OD1 1 
ATOM   2601 O OD2 . ASP B 1 45  ? 21.783 30.335 8.329  1.00 27.24 ? 345 ASP C OD2 1 
ATOM   2602 N N   . PRO B 1 46  ? 21.334 35.164 9.525  1.00 17.92 ? 346 PRO C N   1 
ATOM   2603 C CA  . PRO B 1 46  ? 20.160 36.049 9.596  1.00 18.42 ? 346 PRO C CA  1 
ATOM   2604 C C   . PRO B 1 46  ? 18.835 35.312 9.410  1.00 12.32 ? 346 PRO C C   1 
ATOM   2605 O O   . PRO B 1 46  ? 17.792 35.779 9.874  1.00 13.12 ? 346 PRO C O   1 
ATOM   2606 C CB  . PRO B 1 46  ? 20.399 37.048 8.456  1.00 18.02 ? 346 PRO C CB  1 
ATOM   2607 C CG  . PRO B 1 46  ? 21.873 36.977 8.209  1.00 23.84 ? 346 PRO C CG  1 
ATOM   2608 C CD  . PRO B 1 46  ? 22.196 35.530 8.386  1.00 15.68 ? 346 PRO C CD  1 
ATOM   2609 N N   . THR B 1 47  ? 18.880 34.161 8.740  1.00 10.24 ? 347 THR C N   1 
ATOM   2610 C CA  . THR B 1 47  ? 17.671 33.389 8.468  1.00 11.47 ? 347 THR C CA  1 
ATOM   2611 C C   . THR B 1 47  ? 17.230 32.482 9.611  1.00 15.59 ? 347 THR C C   1 
ATOM   2612 O O   . THR B 1 47  ? 16.146 31.899 9.562  1.00 12.66 ? 347 THR C O   1 
ATOM   2613 C CB  . THR B 1 47  ? 17.819 32.545 7.184  1.00 11.73 ? 347 THR C CB  1 
ATOM   2614 O OG1 . THR B 1 47  ? 18.850 31.567 7.360  1.00 15.80 ? 347 THR C OG1 1 
ATOM   2615 C CG2 . THR B 1 47  ? 18.173 33.444 5.998  1.00 13.46 ? 347 THR C CG2 1 
ATOM   2616 N N   . GLU B 1 48  ? 18.082 32.352 10.625 1.00 11.75 ? 348 GLU C N   1 
ATOM   2617 C CA  . GLU B 1 48  ? 17.756 31.561 11.807 1.00 13.35 ? 348 GLU C CA  1 
ATOM   2618 C C   . GLU B 1 48  ? 17.221 32.598 12.782 1.00 13.03 ? 348 GLU C C   1 
ATOM   2619 O O   . GLU B 1 48  ? 17.980 33.251 13.493 1.00 13.24 ? 348 GLU C O   1 
ATOM   2620 C CB  . GLU B 1 48  ? 19.005 30.885 12.369 1.00 14.76 ? 348 GLU C CB  1 
ATOM   2621 C CG  . GLU B 1 48  ? 19.431 29.656 11.592 1.00 19.93 ? 348 GLU C CG  1 
ATOM   2622 C CD  . GLU B 1 48  ? 18.315 28.628 11.502 1.00 28.49 ? 348 GLU C CD  1 
ATOM   2623 O OE1 . GLU B 1 48  ? 17.488 28.568 12.441 1.00 31.00 ? 348 GLU C OE1 1 
ATOM   2624 O OE2 . GLU B 1 48  ? 18.271 27.875 10.503 1.00 23.03 ? 348 GLU C OE2 1 
ATOM   2625 N N   . ARG B 1 49  ? 15.903 32.734 12.790 1.00 12.08 ? 349 ARG C N   1 
ATOM   2626 C CA  . ARG B 1 49  ? 15.191 33.722 13.589 1.00 11.27 ? 349 ARG C CA  1 
ATOM   2627 C C   . ARG B 1 49  ? 15.088 33.467 15.084 1.00 13.31 ? 349 ARG C C   1 
ATOM   2628 O O   . ARG B 1 49  ? 14.392 34.198 15.789 1.00 13.43 ? 349 ARG C O   1 
ATOM   2629 C CB  . ARG B 1 49  ? 13.784 33.870 13.015 1.00 14.25 ? 349 ARG C CB  1 
ATOM   2630 C CG  . ARG B 1 49  ? 13.752 33.924 11.490 1.00 15.81 ? 349 ARG C CG  1 
ATOM   2631 C CD  . ARG B 1 49  ? 14.409 35.197 10.982 1.00 11.54 ? 349 ARG C CD  1 
ATOM   2632 N NE  . ARG B 1 49  ? 13.737 36.376 11.525 1.00 18.88 ? 349 ARG C NE  1 
ATOM   2633 C CZ  . ARG B 1 49  ? 12.461 36.673 11.300 1.00 20.70 ? 349 ARG C CZ  1 
ATOM   2634 N NH1 . ARG B 1 49  ? 11.721 35.882 10.531 1.00 17.97 ? 349 ARG C NH1 1 
ATOM   2635 N NH2 . ARG B 1 49  ? 11.915 37.736 11.872 1.00 20.86 ? 349 ARG C NH2 1 
ATOM   2636 N N   . SER B 1 50  ? 15.775 32.449 15.578 1.00 14.67 ? 350 SER C N   1 
ATOM   2637 C CA  . SER B 1 50  ? 15.684 32.132 16.996 1.00 16.99 ? 350 SER C CA  1 
ATOM   2638 C C   . SER B 1 50  ? 17.031 32.122 17.694 1.00 12.44 ? 350 SER C C   1 
ATOM   2639 O O   . SER B 1 50  ? 17.134 31.732 18.861 1.00 12.27 ? 350 SER C O   1 
ATOM   2640 C CB  . SER B 1 50  ? 15.007 30.769 17.162 1.00 22.12 ? 350 SER C CB  1 
ATOM   2641 O OG  . SER B 1 50  ? 14.944 30.378 18.519 1.00 32.18 ? 350 SER C OG  1 
ATOM   2642 N N   . VAL B 1 51  ? 18.061 32.557 16.979 1.00 12.36 ? 351 VAL C N   1 
ATOM   2643 C CA  . VAL B 1 51  ? 19.411 32.579 17.521 1.00 7.19  ? 351 VAL C CA  1 
ATOM   2644 C C   . VAL B 1 51  ? 20.193 33.747 16.940 1.00 10.69 ? 351 VAL C C   1 
ATOM   2645 O O   . VAL B 1 51  ? 20.182 33.959 15.735 1.00 13.46 ? 351 VAL C O   1 
ATOM   2646 C CB  . VAL B 1 51  ? 20.146 31.265 17.180 1.00 9.46  ? 351 VAL C CB  1 
ATOM   2647 C CG1 . VAL B 1 51  ? 21.588 31.330 17.637 1.00 7.05  ? 351 VAL C CG1 1 
ATOM   2648 C CG2 . VAL B 1 51  ? 19.427 30.085 17.831 1.00 10.22 ? 351 VAL C CG2 1 
ATOM   2649 N N   . GLY B 1 52  ? 20.860 34.504 17.803 1.00 6.92  ? 352 GLY C N   1 
ATOM   2650 C CA  . GLY B 1 52  ? 21.663 35.636 17.354 1.00 7.28  ? 352 GLY C CA  1 
ATOM   2651 C C   . GLY B 1 52  ? 21.041 36.568 16.329 1.00 9.17  ? 352 GLY C C   1 
ATOM   2652 O O   . GLY B 1 52  ? 19.873 36.930 16.426 1.00 9.92  ? 352 GLY C O   1 
ATOM   2653 N N   . TYR B 1 53  ? 21.847 36.966 15.348 1.00 11.41 ? 353 TYR C N   1 
ATOM   2654 C CA  . TYR B 1 53  ? 21.429 37.862 14.274 1.00 7.84  ? 353 TYR C CA  1 
ATOM   2655 C C   . TYR B 1 53  ? 20.163 37.372 13.567 1.00 7.32  ? 353 TYR C C   1 
ATOM   2656 O O   . TYR B 1 53  ? 20.076 36.217 13.157 1.00 11.69 ? 353 TYR C O   1 
ATOM   2657 C CB  . TYR B 1 53  ? 22.587 37.996 13.280 1.00 13.85 ? 353 TYR C CB  1 
ATOM   2658 C CG  . TYR B 1 53  ? 22.401 38.979 12.149 1.00 15.21 ? 353 TYR C CG  1 
ATOM   2659 C CD1 . TYR B 1 53  ? 21.729 40.189 12.341 1.00 13.98 ? 353 TYR C CD1 1 
ATOM   2660 C CD2 . TYR B 1 53  ? 22.992 38.743 10.904 1.00 20.82 ? 353 TYR C CD2 1 
ATOM   2661 C CE1 . TYR B 1 53  ? 21.658 41.141 11.326 1.00 14.25 ? 353 TYR C CE1 1 
ATOM   2662 C CE2 . TYR B 1 53  ? 22.926 39.688 9.886  1.00 18.87 ? 353 TYR C CE2 1 
ATOM   2663 C CZ  . TYR B 1 53  ? 22.261 40.883 10.105 1.00 22.09 ? 353 TYR C CZ  1 
ATOM   2664 O OH  . TYR B 1 53  ? 22.213 41.820 9.105  1.00 22.49 ? 353 TYR C OH  1 
ATOM   2665 N N   . GLY B 1 54  ? 19.183 38.261 13.424 1.00 7.53  ? 354 GLY C N   1 
ATOM   2666 C CA  . GLY B 1 54  ? 17.936 37.886 12.783 1.00 8.35  ? 354 GLY C CA  1 
ATOM   2667 C C   . GLY B 1 54  ? 16.928 37.353 13.785 1.00 8.88  ? 354 GLY C C   1 
ATOM   2668 O O   . GLY B 1 54  ? 15.776 37.096 13.442 1.00 6.32  ? 354 GLY C O   1 
ATOM   2669 N N   . GLY B 1 55  ? 17.355 37.197 15.035 1.00 8.94  ? 355 GLY C N   1 
ATOM   2670 C CA  . GLY B 1 55  ? 16.455 36.689 16.054 1.00 7.68  ? 355 GLY C CA  1 
ATOM   2671 C C   . GLY B 1 55  ? 15.293 37.631 16.289 1.00 10.74 ? 355 GLY C C   1 
ATOM   2672 O O   . GLY B 1 55  ? 15.471 38.854 16.299 1.00 6.18  ? 355 GLY C O   1 
ATOM   2673 N N   . ARG B 1 56  ? 14.100 37.074 16.472 1.00 7.53  ? 356 ARG C N   1 
ATOM   2674 C CA  . ARG B 1 56  ? 12.930 37.912 16.713 1.00 10.06 ? 356 ARG C CA  1 
ATOM   2675 C C   . ARG B 1 56  ? 13.112 38.651 18.024 1.00 12.25 ? 356 ARG C C   1 
ATOM   2676 O O   . ARG B 1 56  ? 13.542 38.076 19.029 1.00 11.39 ? 356 ARG C O   1 
ATOM   2677 C CB  . ARG B 1 56  ? 11.654 37.073 16.722 1.00 11.07 ? 356 ARG C CB  1 
ATOM   2678 C CG  . ARG B 1 56  ? 11.398 36.409 15.389 1.00 16.11 ? 356 ARG C CG  1 
ATOM   2679 C CD  . ARG B 1 56  ? 9.937  36.027 15.228 1.00 23.98 ? 356 ARG C CD  1 
ATOM   2680 N NE  . ARG B 1 56  ? 9.691  35.411 13.930 1.00 26.66 ? 356 ARG C NE  1 
ATOM   2681 C CZ  . ARG B 1 56  ? 10.072 34.180 13.606 1.00 32.08 ? 356 ARG C CZ  1 
ATOM   2682 N NH1 . ARG B 1 56  ? 10.714 33.425 14.489 1.00 30.29 ? 356 ARG C NH1 1 
ATOM   2683 N NH2 . ARG B 1 56  ? 9.819  33.706 12.395 1.00 36.37 ? 356 ARG C NH2 1 
ATOM   2684 N N   . PRO B 1 57  ? 12.796 39.951 18.029 1.00 11.29 ? 357 PRO C N   1 
ATOM   2685 C CA  . PRO B 1 57  ? 12.931 40.804 19.208 1.00 11.94 ? 357 PRO C CA  1 
ATOM   2686 C C   . PRO B 1 57  ? 11.878 40.604 20.272 1.00 11.57 ? 357 PRO C C   1 
ATOM   2687 O O   . PRO B 1 57  ? 10.907 39.859 20.086 1.00 10.62 ? 357 PRO C O   1 
ATOM   2688 C CB  . PRO B 1 57  ? 12.852 42.199 18.613 1.00 11.63 ? 357 PRO C CB  1 
ATOM   2689 C CG  . PRO B 1 57  ? 11.783 42.009 17.571 1.00 10.99 ? 357 PRO C CG  1 
ATOM   2690 C CD  . PRO B 1 57  ? 12.215 40.710 16.904 1.00 13.04 ? 357 PRO C CD  1 
ATOM   2691 N N   . ASP B 1 58  ? 12.088 41.261 21.407 1.00 8.30  ? 358 ASP C N   1 
ATOM   2692 C CA  . ASP B 1 58  ? 11.105 41.198 22.463 1.00 8.64  ? 358 ASP C CA  1 
ATOM   2693 C C   . ASP B 1 58  ? 9.963  42.065 21.936 1.00 12.40 ? 358 ASP C C   1 
ATOM   2694 O O   . ASP B 1 58  ? 10.085 42.677 20.866 1.00 9.86  ? 358 ASP C O   1 
ATOM   2695 C CB  . ASP B 1 58  ? 11.667 41.725 23.796 1.00 6.76  ? 358 ASP C CB  1 
ATOM   2696 C CG  . ASP B 1 58  ? 12.145 43.166 23.728 1.00 13.94 ? 358 ASP C CG  1 
ATOM   2697 O OD1 . ASP B 1 58  ? 12.933 43.545 24.628 1.00 13.20 ? 358 ASP C OD1 1 
ATOM   2698 O OD2 . ASP B 1 58  ? 11.737 43.914 22.809 1.00 9.88  ? 358 ASP C OD2 1 
ATOM   2699 N N   . ARG B 1 59  ? 8.863  42.116 22.671 1.00 9.87  ? 359 ARG C N   1 
ATOM   2700 C CA  . ARG B 1 59  ? 7.694  42.865 22.237 1.00 9.21  ? 359 ARG C CA  1 
ATOM   2701 C C   . ARG B 1 59  ? 7.940  44.353 22.017 1.00 10.61 ? 359 ARG C C   1 
ATOM   2702 O O   . ARG B 1 59  ? 7.096  45.048 21.450 1.00 14.99 ? 359 ARG C O   1 
ATOM   2703 C CB  . ARG B 1 59  ? 6.549  42.657 23.233 1.00 7.30  ? 359 ARG C CB  1 
ATOM   2704 C CG  . ARG B 1 59  ? 6.838  43.134 24.646 1.00 9.23  ? 359 ARG C CG  1 
ATOM   2705 C CD  . ARG B 1 59  ? 5.706  42.736 25.587 1.00 18.22 ? 359 ARG C CD  1 
ATOM   2706 N NE  . ARG B 1 59  ? 5.728  41.301 25.898 1.00 32.10 ? 359 ARG C NE  1 
ATOM   2707 C CZ  . ARG B 1 59  ? 4.778  40.429 25.558 1.00 35.06 ? 359 ARG C CZ  1 
ATOM   2708 N NH1 . ARG B 1 59  ? 3.708  40.832 24.883 1.00 39.92 ? 359 ARG C NH1 1 
ATOM   2709 N NH2 . ARG B 1 59  ? 4.887  39.153 25.909 1.00 31.98 ? 359 ARG C NH2 1 
ATOM   2710 N N   . ASP B 1 60  ? 9.095  44.843 22.454 1.00 11.46 ? 360 ASP C N   1 
ATOM   2711 C CA  . ASP B 1 60  ? 9.422  46.254 22.283 1.00 10.47 ? 360 ASP C CA  1 
ATOM   2712 C C   . ASP B 1 60  ? 10.339 46.509 21.094 1.00 9.99  ? 360 ASP C C   1 
ATOM   2713 O O   . ASP B 1 60  ? 10.777 47.635 20.884 1.00 11.10 ? 360 ASP C O   1 
ATOM   2714 C CB  . ASP B 1 60  ? 10.078 46.810 23.544 1.00 8.37  ? 360 ASP C CB  1 
ATOM   2715 C CG  . ASP B 1 60  ? 9.141  46.825 24.733 1.00 11.10 ? 360 ASP C CG  1 
ATOM   2716 O OD1 . ASP B 1 60  ? 7.929  47.059 24.538 1.00 21.81 ? 360 ASP C OD1 1 
ATOM   2717 O OD2 . ASP B 1 60  ? 9.615  46.620 25.864 1.00 17.58 ? 360 ASP C OD2 1 
ATOM   2718 N N   . GLY B 1 61  ? 10.643 45.465 20.328 1.00 9.70  ? 361 GLY C N   1 
ATOM   2719 C CA  . GLY B 1 61  ? 11.504 45.634 19.172 1.00 10.78 ? 361 GLY C CA  1 
ATOM   2720 C C   . GLY B 1 61  ? 12.987 45.480 19.448 1.00 12.99 ? 361 GLY C C   1 
ATOM   2721 O O   . GLY B 1 61  ? 13.811 45.751 18.570 1.00 11.38 ? 361 GLY C O   1 
ATOM   2722 N N   . ARG B 1 62  ? 13.336 45.049 20.659 1.00 8.34  ? 362 ARG C N   1 
ATOM   2723 C CA  . ARG B 1 62  ? 14.736 44.860 21.018 1.00 8.68  ? 362 ARG C CA  1 
ATOM   2724 C C   . ARG B 1 62  ? 15.146 43.408 20.869 1.00 11.07 ? 362 ARG C C   1 
ATOM   2725 O O   . ARG B 1 62  ? 14.473 42.519 21.375 1.00 10.76 ? 362 ARG C O   1 
ATOM   2726 C CB  . ARG B 1 62  ? 15.006 45.261 22.474 1.00 10.75 ? 362 ARG C CB  1 
ATOM   2727 C CG  . ARG B 1 62  ? 14.709 46.706 22.828 1.00 21.75 ? 362 ARG C CG  1 
ATOM   2728 C CD  . ARG B 1 62  ? 15.266 47.019 24.209 1.00 30.05 ? 362 ARG C CD  1 
ATOM   2729 N NE  . ARG B 1 62  ? 15.054 48.410 24.597 1.00 44.82 ? 362 ARG C NE  1 
ATOM   2730 C CZ  . ARG B 1 62  ? 15.624 48.988 25.649 1.00 47.18 ? 362 ARG C CZ  1 
ATOM   2731 N NH1 . ARG B 1 62  ? 16.449 48.297 26.427 1.00 51.39 ? 362 ARG C NH1 1 
ATOM   2732 N NH2 . ARG B 1 62  ? 15.368 50.260 25.925 1.00 48.21 ? 362 ARG C NH2 1 
ATOM   2733 N N   . VAL B 1 63  ? 16.252 43.160 20.179 1.00 8.90  ? 363 VAL C N   1 
ATOM   2734 C CA  . VAL B 1 63  ? 16.717 41.789 20.039 1.00 12.14 ? 363 VAL C CA  1 
ATOM   2735 C C   . VAL B 1 63  ? 17.673 41.567 21.202 1.00 8.89  ? 363 VAL C C   1 
ATOM   2736 O O   . VAL B 1 63  ? 18.758 42.134 21.230 1.00 11.27 ? 363 VAL C O   1 
ATOM   2737 C CB  . VAL B 1 63  ? 17.455 41.569 18.692 1.00 14.57 ? 363 VAL C CB  1 
ATOM   2738 C CG1 . VAL B 1 63  ? 18.021 40.155 18.632 1.00 14.51 ? 363 VAL C CG1 1 
ATOM   2739 C CG2 . VAL B 1 63  ? 16.484 41.778 17.523 1.00 12.95 ? 363 VAL C CG2 1 
ATOM   2740 N N   . THR B 1 64  ? 17.261 40.774 22.187 1.00 8.23  ? 364 THR C N   1 
ATOM   2741 C CA  . THR B 1 64  ? 18.141 40.517 23.314 1.00 7.91  ? 364 THR C CA  1 
ATOM   2742 C C   . THR B 1 64  ? 18.478 39.032 23.337 1.00 8.84  ? 364 THR C C   1 
ATOM   2743 O O   . THR B 1 64  ? 17.588 38.173 23.287 1.00 7.74  ? 364 THR C O   1 
ATOM   2744 C CB  . THR B 1 64  ? 17.513 40.993 24.660 1.00 6.67  ? 364 THR C CB  1 
ATOM   2745 O OG1 . THR B 1 64  ? 16.389 40.174 25.006 1.00 7.35  ? 364 THR C OG1 1 
ATOM   2746 C CG2 . THR B 1 64  ? 17.044 42.442 24.525 1.00 11.01 ? 364 THR C CG2 1 
ATOM   2747 N N   . LEU B 1 65  ? 19.775 38.742 23.393 1.00 4.16  ? 365 LEU C N   1 
ATOM   2748 C CA  . LEU B 1 65  ? 20.251 37.364 23.362 1.00 4.27  ? 365 LEU C CA  1 
ATOM   2749 C C   . LEU B 1 65  ? 20.749 36.815 24.683 1.00 3.62  ? 365 LEU C C   1 
ATOM   2750 O O   . LEU B 1 65  ? 21.268 37.548 25.521 1.00 5.12  ? 365 LEU C O   1 
ATOM   2751 C CB  . LEU B 1 65  ? 21.369 37.232 22.329 1.00 3.84  ? 365 LEU C CB  1 
ATOM   2752 C CG  . LEU B 1 65  ? 21.077 37.935 20.998 1.00 9.20  ? 365 LEU C CG  1 
ATOM   2753 C CD1 . LEU B 1 65  ? 22.283 37.759 20.071 1.00 6.31  ? 365 LEU C CD1 1 
ATOM   2754 C CD2 . LEU B 1 65  ? 19.802 37.350 20.366 1.00 3.15  ? 365 LEU C CD2 1 
ATOM   2755 N N   . ASP B 1 66  ? 20.588 35.505 24.848 1.00 7.87  ? 366 ASP C N   1 
ATOM   2756 C CA  . ASP B 1 66  ? 21.025 34.798 26.048 1.00 6.89  ? 366 ASP C CA  1 
ATOM   2757 C C   . ASP B 1 66  ? 21.905 33.654 25.565 1.00 7.45  ? 366 ASP C C   1 
ATOM   2758 O O   . ASP B 1 66  ? 21.605 33.013 24.552 1.00 5.99  ? 366 ASP C O   1 
ATOM   2759 C CB  . ASP B 1 66  ? 19.843 34.158 26.780 1.00 6.37  ? 366 ASP C CB  1 
ATOM   2760 C CG  . ASP B 1 66  ? 18.677 35.105 26.998 1.00 6.89  ? 366 ASP C CG  1 
ATOM   2761 O OD1 . ASP B 1 66  ? 17.549 34.590 27.031 1.00 5.32  ? 366 ASP C OD1 1 
ATOM   2762 O OD2 . ASP B 1 66  ? 18.871 36.328 27.156 1.00 2.92  ? 366 ASP C OD2 1 
ATOM   2763 N N   . ALA B 1 67  ? 22.981 33.380 26.290 1.00 3.23  ? 367 ALA C N   1 
ATOM   2764 C CA  . ALA B 1 67  ? 23.860 32.279 25.935 1.00 3.33  ? 367 ALA C CA  1 
ATOM   2765 C C   . ALA B 1 67  ? 24.740 31.926 27.112 1.00 4.42  ? 367 ALA C C   1 
ATOM   2766 O O   . ALA B 1 67  ? 25.020 32.769 27.963 1.00 3.13  ? 367 ALA C O   1 
ATOM   2767 C CB  . ALA B 1 67  ? 24.744 32.658 24.741 1.00 1.39  ? 367 ALA C CB  1 
ATOM   2768 N N   . CYS B 1 68  ? 25.142 30.663 27.175 1.00 3.80  ? 368 CYS C N   1 
ATOM   2769 C CA  . CYS B 1 68  ? 26.069 30.243 28.202 1.00 5.19  ? 368 CYS C CA  1 
ATOM   2770 C C   . CYS B 1 68  ? 26.922 29.134 27.630 1.00 5.58  ? 368 CYS C C   1 
ATOM   2771 O O   . CYS B 1 68  ? 26.547 28.464 26.662 1.00 5.73  ? 368 CYS C O   1 
ATOM   2772 C CB  . CYS B 1 68  ? 25.368 29.823 29.503 1.00 1.80  ? 368 CYS C CB  1 
ATOM   2773 S SG  . CYS B 1 68  ? 24.501 28.257 29.554 1.00 7.73  ? 368 CYS C SG  1 
ATOM   2774 N N   . ILE B 1 69  ? 28.092 28.962 28.221 1.00 3.14  ? 369 ILE C N   1 
ATOM   2775 C CA  . ILE B 1 69  ? 29.030 27.971 27.753 1.00 5.22  ? 369 ILE C CA  1 
ATOM   2776 C C   . ILE B 1 69  ? 29.628 27.320 28.988 1.00 3.46  ? 369 ILE C C   1 
ATOM   2777 O O   . ILE B 1 69  ? 29.718 27.944 30.042 1.00 4.74  ? 369 ILE C O   1 
ATOM   2778 C CB  . ILE B 1 69  ? 30.116 28.660 26.897 1.00 5.53  ? 369 ILE C CB  1 
ATOM   2779 C CG1 . ILE B 1 69  ? 30.911 27.619 26.106 1.00 3.44  ? 369 ILE C CG1 1 
ATOM   2780 C CG2 . ILE B 1 69  ? 31.051 29.500 27.804 1.00 2.60  ? 369 ILE C CG2 1 
ATOM   2781 C CD1 . ILE B 1 69  ? 31.790 28.230 25.021 1.00 5.63  ? 369 ILE C CD1 1 
ATOM   2782 N N   . MET B 1 70  ? 30.002 26.054 28.866 1.00 3.82  ? 370 MET C N   1 
ATOM   2783 C CA  . MET B 1 70  ? 30.582 25.335 29.989 1.00 2.69  ? 370 MET C CA  1 
ATOM   2784 C C   . MET B 1 70  ? 31.616 24.396 29.427 1.00 6.02  ? 370 MET C C   1 
ATOM   2785 O O   . MET B 1 70  ? 31.366 23.713 28.435 1.00 6.59  ? 370 MET C O   1 
ATOM   2786 C CB  . MET B 1 70  ? 29.499 24.551 30.739 1.00 3.95  ? 370 MET C CB  1 
ATOM   2787 C CG  . MET B 1 70  ? 29.963 23.990 32.077 1.00 1.12  ? 370 MET C CG  1 
ATOM   2788 S SD  . MET B 1 70  ? 28.575 23.568 33.153 1.00 6.01  ? 370 MET C SD  1 
ATOM   2789 C CE  . MET B 1 70  ? 27.181 24.299 32.292 1.00 25.95 ? 370 MET C CE  1 
ATOM   2790 N N   . ASP B 1 71  ? 32.792 24.366 30.039 1.00 4.48  ? 371 ASP C N   1 
ATOM   2791 C CA  . ASP B 1 71  ? 33.835 23.495 29.535 1.00 4.68  ? 371 ASP C CA  1 
ATOM   2792 C C   . ASP B 1 71  ? 33.931 22.213 30.346 1.00 3.75  ? 371 ASP C C   1 
ATOM   2793 O O   . ASP B 1 71  ? 33.034 21.889 31.135 1.00 4.56  ? 371 ASP C O   1 
ATOM   2794 C CB  . ASP B 1 71  ? 35.183 24.239 29.504 1.00 6.59  ? 371 ASP C CB  1 
ATOM   2795 C CG  . ASP B 1 71  ? 35.792 24.424 30.881 1.00 11.89 ? 371 ASP C CG  1 
ATOM   2796 O OD1 . ASP B 1 71  ? 35.171 24.008 31.892 1.00 6.64  ? 371 ASP C OD1 1 
ATOM   2797 O OD2 . ASP B 1 71  ? 36.902 24.992 30.941 1.00 7.47  ? 371 ASP C OD2 1 
ATOM   2798 N N   . GLU B 1 72  ? 35.039 21.506 30.191 1.00 5.54  ? 372 GLU C N   1 
ATOM   2799 C CA  . GLU B 1 72  ? 35.215 20.221 30.863 1.00 6.20  ? 372 GLU C CA  1 
ATOM   2800 C C   . GLU B 1 72  ? 35.666 20.262 32.326 1.00 7.35  ? 372 GLU C C   1 
ATOM   2801 O O   . GLU B 1 72  ? 35.910 19.212 32.917 1.00 7.56  ? 372 GLU C O   1 
ATOM   2802 C CB  . GLU B 1 72  ? 36.199 19.364 30.059 1.00 6.99  ? 372 GLU C CB  1 
ATOM   2803 C CG  . GLU B 1 72  ? 37.666 19.774 30.220 1.00 11.93 ? 372 GLU C CG  1 
ATOM   2804 C CD  . GLU B 1 72  ? 38.053 21.029 29.438 1.00 11.12 ? 372 GLU C CD  1 
ATOM   2805 O OE1 . GLU B 1 72  ? 39.199 21.487 29.619 1.00 8.21  ? 372 GLU C OE1 1 
ATOM   2806 O OE2 . GLU B 1 72  ? 37.229 21.545 28.648 1.00 11.79 ? 372 GLU C OE2 1 
ATOM   2807 N N   . ASN B 1 73  ? 35.779 21.451 32.914 1.00 5.61  ? 373 ASN C N   1 
ATOM   2808 C CA  . ASN B 1 73  ? 36.231 21.551 34.303 1.00 4.30  ? 373 ASN C CA  1 
ATOM   2809 C C   . ASN B 1 73  ? 35.433 22.586 35.103 1.00 6.53  ? 373 ASN C C   1 
ATOM   2810 O O   . ASN B 1 73  ? 35.990 23.405 35.838 1.00 7.70  ? 373 ASN C O   1 
ATOM   2811 C CB  . ASN B 1 73  ? 37.732 21.883 34.325 1.00 6.70  ? 373 ASN C CB  1 
ATOM   2812 C CG  . ASN B 1 73  ? 38.426 21.393 35.588 1.00 14.05 ? 373 ASN C CG  1 
ATOM   2813 O OD1 . ASN B 1 73  ? 38.004 20.410 36.196 1.00 12.19 ? 373 ASN C OD1 1 
ATOM   2814 N ND2 . ASN B 1 73  ? 39.510 22.065 35.974 1.00 7.54  ? 373 ASN C ND2 1 
ATOM   2815 N N   . TYR B 1 74  ? 34.116 22.534 34.946 1.00 7.45  ? 374 TYR C N   1 
ATOM   2816 C CA  . TYR B 1 74  ? 33.201 23.435 35.633 1.00 7.48  ? 374 TYR C CA  1 
ATOM   2817 C C   . TYR B 1 74  ? 33.441 24.928 35.436 1.00 5.75  ? 374 TYR C C   1 
ATOM   2818 O O   . TYR B 1 74  ? 33.034 25.737 36.265 1.00 5.16  ? 374 TYR C O   1 
ATOM   2819 C CB  . TYR B 1 74  ? 33.159 23.110 37.128 1.00 8.89  ? 374 TYR C CB  1 
ATOM   2820 C CG  . TYR B 1 74  ? 32.185 21.993 37.458 1.00 8.85  ? 374 TYR C CG  1 
ATOM   2821 C CD1 . TYR B 1 74  ? 32.519 20.655 37.242 1.00 9.41  ? 374 TYR C CD1 1 
ATOM   2822 C CD2 . TYR B 1 74  ? 30.913 22.284 37.953 1.00 9.66  ? 374 TYR C CD2 1 
ATOM   2823 C CE1 . TYR B 1 74  ? 31.603 19.630 37.515 1.00 13.72 ? 374 TYR C CE1 1 
ATOM   2824 C CE2 . TYR B 1 74  ? 29.988 21.271 38.227 1.00 14.13 ? 374 TYR C CE2 1 
ATOM   2825 C CZ  . TYR B 1 74  ? 30.341 19.950 38.008 1.00 12.03 ? 374 TYR C CZ  1 
ATOM   2826 O OH  . TYR B 1 74  ? 29.438 18.954 38.298 1.00 14.57 ? 374 TYR C OH  1 
ATOM   2827 N N   . ASN B 1 75  ? 34.112 25.300 34.354 1.00 4.48  ? 375 ASN C N   1 
ATOM   2828 C CA  . ASN B 1 75  ? 34.302 26.711 34.094 1.00 6.37  ? 375 ASN C CA  1 
ATOM   2829 C C   . ASN B 1 75  ? 33.042 27.056 33.325 1.00 8.51  ? 375 ASN C C   1 
ATOM   2830 O O   . ASN B 1 75  ? 32.583 26.282 32.481 1.00 2.80  ? 375 ASN C O   1 
ATOM   2831 C CB  . ASN B 1 75  ? 35.559 26.968 33.265 1.00 4.02  ? 375 ASN C CB  1 
ATOM   2832 C CG  . ASN B 1 75  ? 36.822 26.599 34.015 1.00 10.52 ? 375 ASN C CG  1 
ATOM   2833 O OD1 . ASN B 1 75  ? 37.658 25.841 33.521 1.00 10.40 ? 375 ASN C OD1 1 
ATOM   2834 N ND2 . ASN B 1 75  ? 36.967 27.141 35.217 1.00 5.70  ? 375 ASN C ND2 1 
ATOM   2835 N N   . ILE B 1 76  ? 32.466 28.206 33.636 1.00 1.12  ? 376 ILE C N   1 
ATOM   2836 C CA  . ILE B 1 76  ? 31.234 28.600 33.000 1.00 2.56  ? 376 ILE C CA  1 
ATOM   2837 C C   . ILE B 1 76  ? 31.195 30.076 32.682 1.00 3.98  ? 376 ILE C C   1 
ATOM   2838 O O   . ILE B 1 76  ? 31.801 30.901 33.377 1.00 3.09  ? 376 ILE C O   1 
ATOM   2839 C CB  . ILE B 1 76  ? 30.021 28.282 33.898 1.00 6.13  ? 376 ILE C CB  1 
ATOM   2840 C CG1 . ILE B 1 76  ? 30.270 28.827 35.307 1.00 5.69  ? 376 ILE C CG1 1 
ATOM   2841 C CG2 . ILE B 1 76  ? 29.773 26.774 33.938 1.00 7.30  ? 376 ILE C CG2 1 
ATOM   2842 C CD1 . ILE B 1 76  ? 29.011 28.923 36.160 1.00 5.35  ? 376 ILE C CD1 1 
ATOM   2843 N N   . GLY B 1 77  ? 30.452 30.398 31.631 1.00 4.35  ? 377 GLY C N   1 
ATOM   2844 C CA  . GLY B 1 77  ? 30.303 31.774 31.216 1.00 5.34  ? 377 GLY C CA  1 
ATOM   2845 C C   . GLY B 1 77  ? 28.894 31.957 30.706 1.00 6.48  ? 377 GLY C C   1 
ATOM   2846 O O   . GLY B 1 77  ? 28.356 31.087 30.019 1.00 4.56  ? 377 GLY C O   1 
ATOM   2847 N N   . SER B 1 78  ? 28.299 33.101 31.023 1.00 4.45  ? 378 SER C N   1 
ATOM   2848 C CA  . SER B 1 78  ? 26.940 33.356 30.611 1.00 4.93  ? 378 SER C CA  1 
ATOM   2849 C C   . SER B 1 78  ? 26.623 34.826 30.414 1.00 7.14  ? 378 SER C C   1 
ATOM   2850 O O   . SER B 1 78  ? 27.142 35.693 31.120 1.00 7.34  ? 378 SER C O   1 
ATOM   2851 C CB  . SER B 1 78  ? 25.982 32.764 31.658 1.00 5.36  ? 378 SER C CB  1 
ATOM   2852 O OG  . SER B 1 78  ? 24.682 33.319 31.534 1.00 13.24 ? 378 SER C OG  1 
ATOM   2853 N N   . VAL B 1 79  ? 25.800 35.102 29.412 1.00 5.44  ? 379 VAL C N   1 
ATOM   2854 C CA  . VAL B 1 79  ? 25.334 36.456 29.161 1.00 6.85  ? 379 VAL C CA  1 
ATOM   2855 C C   . VAL B 1 79  ? 23.838 36.318 28.923 1.00 7.90  ? 379 VAL C C   1 
ATOM   2856 O O   . VAL B 1 79  ? 23.381 35.356 28.300 1.00 6.65  ? 379 VAL C O   1 
ATOM   2857 C CB  . VAL B 1 79  ? 26.000 37.107 27.916 1.00 8.42  ? 379 VAL C CB  1 
ATOM   2858 C CG1 . VAL B 1 79  ? 27.482 37.315 28.175 1.00 10.37 ? 379 VAL C CG1 1 
ATOM   2859 C CG2 . VAL B 1 79  ? 25.781 36.251 26.680 1.00 5.46  ? 379 VAL C CG2 1 
ATOM   2860 N N   . ALA B 1 80  ? 23.064 37.260 29.439 1.00 2.39  ? 380 ALA C N   1 
ATOM   2861 C CA  . ALA B 1 80  ? 21.630 37.194 29.243 1.00 7.84  ? 380 ALA C CA  1 
ATOM   2862 C C   . ALA B 1 80  ? 21.085 38.574 28.948 1.00 4.91  ? 380 ALA C C   1 
ATOM   2863 O O   . ALA B 1 80  ? 21.561 39.571 29.490 1.00 7.91  ? 380 ALA C O   1 
ATOM   2864 C CB  . ALA B 1 80  ? 20.954 36.605 30.483 1.00 3.55  ? 380 ALA C CB  1 
ATOM   2865 N N   . CYS B 1 81  ? 20.091 38.617 28.067 1.00 3.55  ? 381 CYS C N   1 
ATOM   2866 C CA  . CYS B 1 81  ? 19.456 39.868 27.678 1.00 4.76  ? 381 CYS C CA  1 
ATOM   2867 C C   . CYS B 1 81  ? 20.510 40.878 27.226 1.00 6.95  ? 381 CYS C C   1 
ATOM   2868 O O   . CYS B 1 81  ? 20.552 42.011 27.705 1.00 7.35  ? 381 CYS C O   1 
ATOM   2869 C CB  . CYS B 1 81  ? 18.654 40.436 28.856 1.00 7.51  ? 381 CYS C CB  1 
ATOM   2870 S SG  . CYS B 1 81  ? 17.415 41.673 28.372 1.00 10.54 ? 381 CYS C SG  1 
ATOM   2871 N N   . MET B 1 82  ? 21.375 40.451 26.316 1.00 7.35  ? 382 MET C N   1 
ATOM   2872 C CA  . MET B 1 82  ? 22.407 41.332 25.789 1.00 7.83  ? 382 MET C CA  1 
ATOM   2873 C C   . MET B 1 82  ? 22.014 41.735 24.365 1.00 7.21  ? 382 MET C C   1 
ATOM   2874 O O   . MET B 1 82  ? 21.541 40.908 23.578 1.00 3.18  ? 382 MET C O   1 
ATOM   2875 C CB  . MET B 1 82  ? 23.771 40.629 25.794 1.00 7.52  ? 382 MET C CB  1 
ATOM   2876 C CG  . MET B 1 82  ? 24.884 41.444 25.144 1.00 7.90  ? 382 MET C CG  1 
ATOM   2877 S SD  . MET B 1 82  ? 26.513 40.685 25.295 1.00 10.14 ? 382 MET C SD  1 
ATOM   2878 C CE  . MET B 1 82  ? 26.346 39.244 24.212 1.00 5.71  ? 382 MET C CE  1 
ATOM   2879 N N   . GLU B 1 83  ? 22.195 43.009 24.040 1.00 9.08  ? 383 GLU C N   1 
ATOM   2880 C CA  . GLU B 1 83  ? 21.846 43.512 22.712 1.00 8.99  ? 383 GLU C CA  1 
ATOM   2881 C C   . GLU B 1 83  ? 23.079 43.925 21.910 1.00 10.21 ? 383 GLU C C   1 
ATOM   2882 O O   . GLU B 1 83  ? 24.158 44.132 22.464 1.00 8.55  ? 383 GLU C O   1 
ATOM   2883 C CB  . GLU B 1 83  ? 20.957 44.752 22.821 1.00 13.19 ? 383 GLU C CB  1 
ATOM   2884 C CG  . GLU B 1 83  ? 19.666 44.605 23.587 1.00 18.98 ? 383 GLU C CG  1 
ATOM   2885 C CD  . GLU B 1 83  ? 18.958 45.944 23.748 1.00 23.59 ? 383 GLU C CD  1 
ATOM   2886 O OE1 . GLU B 1 83  ? 18.430 46.475 22.746 1.00 21.11 ? 383 GLU C OE1 1 
ATOM   2887 O OE2 . GLU B 1 83  ? 18.945 46.474 24.877 1.00 26.17 ? 383 GLU C OE2 1 
ATOM   2888 N N   . HIS B 1 84  ? 22.897 44.040 20.596 1.00 9.36  ? 384 HIS C N   1 
ATOM   2889 C CA  . HIS B 1 84  ? 23.934 44.513 19.684 1.00 6.23  ? 384 HIS C CA  1 
ATOM   2890 C C   . HIS B 1 84  ? 25.201 43.701 19.452 1.00 10.68 ? 384 HIS C C   1 
ATOM   2891 O O   . HIS B 1 84  ? 26.108 44.179 18.772 1.00 9.73  ? 384 HIS C O   1 
ATOM   2892 C CB  . HIS B 1 84  ? 24.322 45.935 20.096 1.00 4.49  ? 384 HIS C CB  1 
ATOM   2893 C CG  . HIS B 1 84  ? 23.146 46.837 20.300 1.00 2.26  ? 384 HIS C CG  1 
ATOM   2894 N ND1 . HIS B 1 84  ? 23.046 47.698 21.373 1.00 12.05 ? 384 HIS C ND1 1 
ATOM   2895 C CD2 . HIS B 1 84  ? 22.019 47.012 19.570 1.00 1.66  ? 384 HIS C CD2 1 
ATOM   2896 C CE1 . HIS B 1 84  ? 21.906 48.362 21.295 1.00 5.03  ? 384 HIS C CE1 1 
ATOM   2897 N NE2 . HIS B 1 84  ? 21.264 47.963 20.211 1.00 15.27 ? 384 HIS C NE2 1 
ATOM   2898 N N   . ILE B 1 85  ? 25.278 42.495 20.013 1.00 8.47  ? 385 ILE C N   1 
ATOM   2899 C CA  . ILE B 1 85  ? 26.441 41.641 19.816 1.00 7.07  ? 385 ILE C CA  1 
ATOM   2900 C C   . ILE B 1 85  ? 25.914 40.388 19.138 1.00 11.56 ? 385 ILE C C   1 
ATOM   2901 O O   . ILE B 1 85  ? 25.058 39.690 19.679 1.00 6.49  ? 385 ILE C O   1 
ATOM   2902 C CB  . ILE B 1 85  ? 27.129 41.267 21.155 1.00 4.35  ? 385 ILE C CB  1 
ATOM   2903 C CG1 . ILE B 1 85  ? 27.513 42.541 21.916 1.00 5.39  ? 385 ILE C CG1 1 
ATOM   2904 C CG2 . ILE B 1 85  ? 28.385 40.440 20.879 1.00 4.81  ? 385 ILE C CG2 1 
ATOM   2905 C CD1 . ILE B 1 85  ? 28.387 43.504 21.091 1.00 7.66  ? 385 ILE C CD1 1 
ATOM   2906 N N   . LYS B 1 86  ? 26.423 40.113 17.943 1.00 10.49 ? 386 LYS C N   1 
ATOM   2907 C CA  . LYS B 1 86  ? 25.965 38.968 17.159 1.00 10.26 ? 386 LYS C CA  1 
ATOM   2908 C C   . LYS B 1 86  ? 26.332 37.610 17.744 1.00 5.80  ? 386 LYS C C   1 
ATOM   2909 O O   . LYS B 1 86  ? 25.641 36.619 17.509 1.00 5.38  ? 386 LYS C O   1 
ATOM   2910 C CB  . LYS B 1 86  ? 26.514 39.082 15.734 1.00 6.34  ? 386 LYS C CB  1 
ATOM   2911 C CG  . LYS B 1 86  ? 25.960 38.066 14.756 1.00 21.38 ? 386 LYS C CG  1 
ATOM   2912 C CD  . LYS B 1 86  ? 25.884 38.644 13.341 1.00 26.11 ? 386 LYS C CD  1 
ATOM   2913 C CE  . LYS B 1 86  ? 27.240 39.077 12.807 1.00 31.40 ? 386 LYS C CE  1 
ATOM   2914 N NZ  . LYS B 1 86  ? 27.126 39.594 11.405 1.00 35.64 ? 386 LYS C NZ  1 
ATOM   2915 N N   . ASN B 1 87  ? 27.415 37.557 18.506 1.00 7.12  ? 387 ASN C N   1 
ATOM   2916 C CA  . ASN B 1 87  ? 27.844 36.278 19.049 1.00 10.08 ? 387 ASN C CA  1 
ATOM   2917 C C   . ASN B 1 87  ? 27.890 36.202 20.553 1.00 7.85  ? 387 ASN C C   1 
ATOM   2918 O O   . ASN B 1 87  ? 28.961 36.230 21.162 1.00 8.93  ? 387 ASN C O   1 
ATOM   2919 C CB  . ASN B 1 87  ? 29.203 35.905 18.460 1.00 8.38  ? 387 ASN C CB  1 
ATOM   2920 C CG  . ASN B 1 87  ? 29.167 35.855 16.961 1.00 9.97  ? 387 ASN C CG  1 
ATOM   2921 O OD1 . ASN B 1 87  ? 28.518 34.984 16.380 1.00 10.36 ? 387 ASN C OD1 1 
ATOM   2922 N ND2 . ASN B 1 87  ? 29.834 36.806 16.318 1.00 3.65  ? 387 ASN C ND2 1 
ATOM   2923 N N   . PRO B 1 88  ? 26.715 36.095 21.180 1.00 7.41  ? 388 PRO C N   1 
ATOM   2924 C CA  . PRO B 1 88  ? 26.697 36.011 22.638 1.00 8.41  ? 388 PRO C CA  1 
ATOM   2925 C C   . PRO B 1 88  ? 27.458 34.803 23.207 1.00 7.65  ? 388 PRO C C   1 
ATOM   2926 O O   . PRO B 1 88  ? 28.002 34.888 24.301 1.00 5.94  ? 388 PRO C O   1 
ATOM   2927 C CB  . PRO B 1 88  ? 25.199 35.990 22.972 1.00 7.52  ? 388 PRO C CB  1 
ATOM   2928 C CG  . PRO B 1 88  ? 24.548 35.431 21.717 1.00 4.25  ? 388 PRO C CG  1 
ATOM   2929 C CD  . PRO B 1 88  ? 25.351 36.107 20.620 1.00 7.31  ? 388 PRO C CD  1 
ATOM   2930 N N   . ILE B 1 89  ? 27.516 33.692 22.475 1.00 6.30  ? 389 ILE C N   1 
ATOM   2931 C CA  . ILE B 1 89  ? 28.224 32.528 23.004 1.00 7.12  ? 389 ILE C CA  1 
ATOM   2932 C C   . ILE B 1 89  ? 29.687 32.889 23.234 1.00 7.01  ? 389 ILE C C   1 
ATOM   2933 O O   . ILE B 1 89  ? 30.301 32.432 24.195 1.00 5.10  ? 389 ILE C O   1 
ATOM   2934 C CB  . ILE B 1 89  ? 28.131 31.281 22.062 1.00 7.39  ? 389 ILE C CB  1 
ATOM   2935 C CG1 . ILE B 1 89  ? 28.610 30.029 22.808 1.00 4.22  ? 389 ILE C CG1 1 
ATOM   2936 C CG2 . ILE B 1 89  ? 28.991 31.464 20.817 1.00 1.12  ? 389 ILE C CG2 1 
ATOM   2937 C CD1 . ILE B 1 89  ? 27.798 29.734 24.101 1.00 1.12  ? 389 ILE C CD1 1 
ATOM   2938 N N   . SER B 1 90  ? 30.242 33.730 22.365 1.00 5.12  ? 390 SER C N   1 
ATOM   2939 C CA  . SER B 1 90  ? 31.639 34.122 22.504 1.00 2.06  ? 390 SER C CA  1 
ATOM   2940 C C   . SER B 1 90  ? 31.856 35.123 23.628 1.00 3.15  ? 390 SER C C   1 
ATOM   2941 O O   . SER B 1 90  ? 32.916 35.132 24.254 1.00 7.14  ? 390 SER C O   1 
ATOM   2942 C CB  . SER B 1 90  ? 32.169 34.670 21.178 1.00 2.64  ? 390 SER C CB  1 
ATOM   2943 O OG  . SER B 1 90  ? 32.227 33.618 20.226 1.00 4.18  ? 390 SER C OG  1 
ATOM   2944 N N   . VAL B 1 91  ? 30.863 35.975 23.881 1.00 4.71  ? 391 VAL C N   1 
ATOM   2945 C CA  . VAL B 1 91  ? 30.987 36.931 24.975 1.00 6.69  ? 391 VAL C CA  1 
ATOM   2946 C C   . VAL B 1 91  ? 30.877 36.101 26.249 1.00 3.30  ? 391 VAL C C   1 
ATOM   2947 O O   . VAL B 1 91  ? 31.578 36.348 27.235 1.00 6.78  ? 391 VAL C O   1 
ATOM   2948 C CB  . VAL B 1 91  ? 29.869 37.992 24.953 1.00 5.02  ? 391 VAL C CB  1 
ATOM   2949 C CG1 . VAL B 1 91  ? 30.074 38.979 26.103 1.00 5.59  ? 391 VAL C CG1 1 
ATOM   2950 C CG2 . VAL B 1 91  ? 29.884 38.729 23.626 1.00 2.97  ? 391 VAL C CG2 1 
ATOM   2951 N N   . ALA B 1 92  ? 30.005 35.093 26.219 1.00 4.98  ? 392 ALA C N   1 
ATOM   2952 C CA  . ALA B 1 92  ? 29.849 34.207 27.372 1.00 6.15  ? 392 ALA C CA  1 
ATOM   2953 C C   . ALA B 1 92  ? 31.200 33.576 27.684 1.00 5.34  ? 392 ALA C C   1 
ATOM   2954 O O   . ALA B 1 92  ? 31.619 33.523 28.841 1.00 4.68  ? 392 ALA C O   1 
ATOM   2955 C CB  . ALA B 1 92  ? 28.820 33.112 27.077 1.00 6.03  ? 392 ALA C CB  1 
ATOM   2956 N N   . ARG B 1 93  ? 31.882 33.089 26.652 1.00 8.13  ? 393 ARG C N   1 
ATOM   2957 C CA  . ARG B 1 93  ? 33.188 32.477 26.858 1.00 5.38  ? 393 ARG C CA  1 
ATOM   2958 C C   . ARG B 1 93  ? 34.167 33.491 27.451 1.00 6.57  ? 393 ARG C C   1 
ATOM   2959 O O   . ARG B 1 93  ? 35.026 33.135 28.254 1.00 9.08  ? 393 ARG C O   1 
ATOM   2960 C CB  . ARG B 1 93  ? 33.733 31.923 25.548 1.00 5.33  ? 393 ARG C CB  1 
ATOM   2961 C CG  . ARG B 1 93  ? 35.115 31.337 25.697 1.00 5.67  ? 393 ARG C CG  1 
ATOM   2962 C CD  . ARG B 1 93  ? 35.518 30.522 24.488 1.00 2.18  ? 393 ARG C CD  1 
ATOM   2963 N NE  . ARG B 1 93  ? 36.824 29.928 24.711 1.00 4.65  ? 393 ARG C NE  1 
ATOM   2964 C CZ  . ARG B 1 93  ? 37.408 29.068 23.894 1.00 8.68  ? 393 ARG C CZ  1 
ATOM   2965 N NH1 . ARG B 1 93  ? 36.795 28.694 22.777 1.00 9.72  ? 393 ARG C NH1 1 
ATOM   2966 N NH2 . ARG B 1 93  ? 38.602 28.574 24.211 1.00 10.82 ? 393 ARG C NH2 1 
ATOM   2967 N N   . ALA B 1 94  ? 34.035 34.754 27.056 1.00 5.49  ? 394 ALA C N   1 
ATOM   2968 C CA  . ALA B 1 94  ? 34.903 35.800 27.593 1.00 7.44  ? 394 ALA C CA  1 
ATOM   2969 C C   . ALA B 1 94  ? 34.560 36.049 29.067 1.00 5.80  ? 394 ALA C C   1 
ATOM   2970 O O   . ALA B 1 94  ? 35.441 36.317 29.888 1.00 5.25  ? 394 ALA C O   1 
ATOM   2971 C CB  . ALA B 1 94  ? 34.746 37.083 26.785 1.00 6.13  ? 394 ALA C CB  1 
ATOM   2972 N N   . VAL B 1 95  ? 33.276 35.973 29.406 1.00 3.84  ? 395 VAL C N   1 
ATOM   2973 C CA  . VAL B 1 95  ? 32.865 36.171 30.791 1.00 4.76  ? 395 VAL C CA  1 
ATOM   2974 C C   . VAL B 1 95  ? 33.562 35.090 31.615 1.00 7.05  ? 395 VAL C C   1 
ATOM   2975 O O   . VAL B 1 95  ? 34.128 35.360 32.670 1.00 5.58  ? 395 VAL C O   1 
ATOM   2976 C CB  . VAL B 1 95  ? 31.325 36.042 30.952 1.00 7.98  ? 395 VAL C CB  1 
ATOM   2977 C CG1 . VAL B 1 95  ? 30.953 35.923 32.430 1.00 7.46  ? 395 VAL C CG1 1 
ATOM   2978 C CG2 . VAL B 1 95  ? 30.640 37.267 30.351 1.00 7.19  ? 395 VAL C CG2 1 
ATOM   2979 N N   . MET B 1 96  ? 33.523 33.866 31.106 1.00 5.23  ? 396 MET C N   1 
ATOM   2980 C CA  . MET B 1 96  ? 34.143 32.727 31.764 1.00 5.25  ? 396 MET C CA  1 
ATOM   2981 C C   . MET B 1 96  ? 35.658 32.855 31.915 1.00 10.16 ? 396 MET C C   1 
ATOM   2982 O O   . MET B 1 96  ? 36.197 32.643 32.996 1.00 9.29  ? 396 MET C O   1 
ATOM   2983 C CB  . MET B 1 96  ? 33.836 31.455 30.967 1.00 1.48  ? 396 MET C CB  1 
ATOM   2984 C CG  . MET B 1 96  ? 34.542 30.206 31.458 1.00 5.96  ? 396 MET C CG  1 
ATOM   2985 S SD  . MET B 1 96  ? 34.007 28.764 30.511 1.00 8.60  ? 396 MET C SD  1 
ATOM   2986 C CE  . MET B 1 96  ? 34.983 28.972 29.021 1.00 7.03  ? 396 MET C CE  1 
ATOM   2987 N N   . GLU B 1 97  ? 36.341 33.204 30.827 1.00 8.20  ? 397 GLU C N   1 
ATOM   2988 C CA  . GLU B 1 97  ? 37.801 33.287 30.853 1.00 11.25 ? 397 GLU C CA  1 
ATOM   2989 C C   . GLU B 1 97  ? 38.427 34.591 31.322 1.00 10.66 ? 397 GLU C C   1 
ATOM   2990 O O   . GLU B 1 97  ? 39.562 34.589 31.795 1.00 10.90 ? 397 GLU C O   1 
ATOM   2991 C CB  . GLU B 1 97  ? 38.362 32.969 29.465 1.00 10.02 ? 397 GLU C CB  1 
ATOM   2992 C CG  . GLU B 1 97  ? 37.783 31.712 28.835 1.00 7.24  ? 397 GLU C CG  1 
ATOM   2993 C CD  . GLU B 1 97  ? 38.297 31.482 27.434 1.00 6.86  ? 397 GLU C CD  1 
ATOM   2994 O OE1 . GLU B 1 97  ? 38.628 32.470 26.756 1.00 10.08 ? 397 GLU C OE1 1 
ATOM   2995 O OE2 . GLU B 1 97  ? 38.351 30.313 27.000 1.00 12.87 ? 397 GLU C OE2 1 
ATOM   2996 N N   . LYS B 1 98  ? 37.697 35.692 31.227 1.00 10.30 ? 398 LYS C N   1 
ATOM   2997 C CA  . LYS B 1 98  ? 38.284 36.983 31.572 1.00 9.24  ? 398 LYS C CA  1 
ATOM   2998 C C   . LYS B 1 98  ? 37.763 37.738 32.789 1.00 9.88  ? 398 LYS C C   1 
ATOM   2999 O O   . LYS B 1 98  ? 38.264 38.821 33.098 1.00 11.87 ? 398 LYS C O   1 
ATOM   3000 C CB  . LYS B 1 98  ? 38.184 37.899 30.355 1.00 8.75  ? 398 LYS C CB  1 
ATOM   3001 C CG  . LYS B 1 98  ? 38.616 37.260 29.052 1.00 15.81 ? 398 LYS C CG  1 
ATOM   3002 C CD  . LYS B 1 98  ? 40.114 37.037 29.009 1.00 23.52 ? 398 LYS C CD  1 
ATOM   3003 C CE  . LYS B 1 98  ? 40.565 36.627 27.610 1.00 27.92 ? 398 LYS C CE  1 
ATOM   3004 N NZ  . LYS B 1 98  ? 42.043 36.477 27.525 1.00 34.82 ? 398 LYS C NZ  1 
ATOM   3005 N N   . THR B 1 99  ? 36.779 37.189 33.489 1.00 8.65  ? 399 THR C N   1 
ATOM   3006 C CA  . THR B 1 99  ? 36.233 37.891 34.637 1.00 7.33  ? 399 THR C CA  1 
ATOM   3007 C C   . THR B 1 99  ? 36.102 37.007 35.857 1.00 8.57  ? 399 THR C C   1 
ATOM   3008 O O   . THR B 1 99  ? 36.193 35.788 35.769 1.00 11.60 ? 399 THR C O   1 
ATOM   3009 C CB  . THR B 1 99  ? 34.829 38.450 34.352 1.00 7.22  ? 399 THR C CB  1 
ATOM   3010 O OG1 . THR B 1 99  ? 33.857 37.412 34.539 1.00 11.68 ? 399 THR C OG1 1 
ATOM   3011 C CG2 . THR B 1 99  ? 34.730 38.960 32.927 1.00 6.90  ? 399 THR C CG2 1 
ATOM   3012 N N   . PRO B 1 100 ? 35.883 37.628 37.023 1.00 14.54 ? 400 PRO C N   1 
ATOM   3013 C CA  . PRO B 1 100 ? 35.719 36.930 38.301 1.00 15.45 ? 400 PRO C CA  1 
ATOM   3014 C C   . PRO B 1 100 ? 34.275 36.431 38.408 1.00 14.43 ? 400 PRO C C   1 
ATOM   3015 O O   . PRO B 1 100 ? 33.905 35.766 39.374 1.00 15.74 ? 400 PRO C O   1 
ATOM   3016 C CB  . PRO B 1 100 ? 36.000 38.024 39.337 1.00 14.60 ? 400 PRO C CB  1 
ATOM   3017 C CG  . PRO B 1 100 ? 36.749 39.081 38.578 1.00 21.66 ? 400 PRO C CG  1 
ATOM   3018 C CD  . PRO B 1 100 ? 36.079 39.072 37.244 1.00 15.24 ? 400 PRO C CD  1 
ATOM   3019 N N   . HIS B 1 101 ? 33.464 36.754 37.409 1.00 6.00  ? 401 HIS C N   1 
ATOM   3020 C CA  . HIS B 1 101 ? 32.053 36.370 37.421 1.00 7.59  ? 401 HIS C CA  1 
ATOM   3021 C C   . HIS B 1 101 ? 31.710 35.296 36.399 1.00 6.12  ? 401 HIS C C   1 
ATOM   3022 O O   . HIS B 1 101 ? 32.540 34.938 35.577 1.00 5.43  ? 401 HIS C O   1 
ATOM   3023 C CB  . HIS B 1 101 ? 31.211 37.615 37.172 1.00 8.59  ? 401 HIS C CB  1 
ATOM   3024 C CG  . HIS B 1 101 ? 31.545 38.744 38.090 1.00 6.73  ? 401 HIS C CG  1 
ATOM   3025 N ND1 . HIS B 1 101 ? 31.731 40.037 37.651 1.00 9.88  ? 401 HIS C ND1 1 
ATOM   3026 C CD2 . HIS B 1 101 ? 31.754 38.767 39.428 1.00 3.21  ? 401 HIS C CD2 1 
ATOM   3027 C CE1 . HIS B 1 101 ? 32.043 40.808 38.677 1.00 5.17  ? 401 HIS C CE1 1 
ATOM   3028 N NE2 . HIS B 1 101 ? 32.064 40.060 39.767 1.00 10.79 ? 401 HIS C NE2 1 
ATOM   3029 N N   . VAL B 1 102 ? 30.486 34.774 36.456 1.00 5.65  ? 402 VAL C N   1 
ATOM   3030 C CA  . VAL B 1 102 ? 30.091 33.751 35.493 1.00 4.81  ? 402 VAL C CA  1 
ATOM   3031 C C   . VAL B 1 102 ? 28.860 34.172 34.710 1.00 3.56  ? 402 VAL C C   1 
ATOM   3032 O O   . VAL B 1 102 ? 28.466 33.511 33.749 1.00 4.88  ? 402 VAL C O   1 
ATOM   3033 C CB  . VAL B 1 102 ? 29.812 32.383 36.170 1.00 4.11  ? 402 VAL C CB  1 
ATOM   3034 C CG1 . VAL B 1 102 ? 31.071 31.898 36.866 1.00 3.71  ? 402 VAL C CG1 1 
ATOM   3035 C CG2 . VAL B 1 102 ? 28.647 32.502 37.168 1.00 6.63  ? 402 VAL C CG2 1 
ATOM   3036 N N   . MET B 1 103 ? 28.250 35.276 35.118 1.00 3.47  ? 403 MET C N   1 
ATOM   3037 C CA  . MET B 1 103 ? 27.063 35.746 34.426 1.00 6.34  ? 403 MET C CA  1 
ATOM   3038 C C   . MET B 1 103 ? 26.917 37.262 34.440 1.00 7.56  ? 403 MET C C   1 
ATOM   3039 O O   . MET B 1 103 ? 26.954 37.891 35.495 1.00 5.27  ? 403 MET C O   1 
ATOM   3040 C CB  . MET B 1 103 ? 25.814 35.102 35.042 1.00 9.09  ? 403 MET C CB  1 
ATOM   3041 C CG  . MET B 1 103 ? 24.510 35.472 34.352 1.00 7.20  ? 403 MET C CG  1 
ATOM   3042 S SD  . MET B 1 103 ? 23.110 34.507 34.986 1.00 11.10 ? 403 MET C SD  1 
ATOM   3043 C CE  . MET B 1 103 ? 21.994 34.549 33.577 1.00 14.41 ? 403 MET C CE  1 
ATOM   3044 N N   . LEU B 1 104 ? 26.762 37.838 33.251 1.00 5.27  ? 404 LEU C N   1 
ATOM   3045 C CA  . LEU B 1 104 ? 26.574 39.276 33.097 1.00 7.65  ? 404 LEU C CA  1 
ATOM   3046 C C   . LEU B 1 104 ? 25.313 39.446 32.271 1.00 6.18  ? 404 LEU C C   1 
ATOM   3047 O O   . LEU B 1 104 ? 25.071 38.684 31.336 1.00 5.41  ? 404 LEU C O   1 
ATOM   3048 C CB  . LEU B 1 104 ? 27.751 39.912 32.351 1.00 8.64  ? 404 LEU C CB  1 
ATOM   3049 C CG  . LEU B 1 104 ? 29.110 39.822 33.038 1.00 5.80  ? 404 LEU C CG  1 
ATOM   3050 C CD1 . LEU B 1 104 ? 30.147 40.494 32.152 1.00 11.64 ? 404 LEU C CD1 1 
ATOM   3051 C CD2 . LEU B 1 104 ? 29.053 40.507 34.419 1.00 1.60  ? 404 LEU C CD2 1 
ATOM   3052 N N   . VAL B 1 105 ? 24.503 40.435 32.619 1.00 6.25  ? 405 VAL C N   1 
ATOM   3053 C CA  . VAL B 1 105 ? 23.270 40.664 31.883 1.00 6.74  ? 405 VAL C CA  1 
ATOM   3054 C C   . VAL B 1 105 ? 23.104 42.125 31.468 1.00 9.72  ? 405 VAL C C   1 
ATOM   3055 O O   . VAL B 1 105 ? 23.739 43.019 32.030 1.00 11.23 ? 405 VAL C O   1 
ATOM   3056 C CB  . VAL B 1 105 ? 22.048 40.239 32.720 1.00 8.93  ? 405 VAL C CB  1 
ATOM   3057 C CG1 . VAL B 1 105 ? 22.273 38.852 33.278 1.00 4.11  ? 405 VAL C CG1 1 
ATOM   3058 C CG2 . VAL B 1 105 ? 21.799 41.236 33.847 1.00 9.12  ? 405 VAL C CG2 1 
ATOM   3059 N N   . GLY B 1 106 ? 22.271 42.339 30.456 1.00 8.34  ? 406 GLY C N   1 
ATOM   3060 C CA  . GLY B 1 106 ? 21.958 43.676 29.978 1.00 10.70 ? 406 GLY C CA  1 
ATOM   3061 C C   . GLY B 1 106 ? 23.095 44.590 29.577 1.00 7.05  ? 406 GLY C C   1 
ATOM   3062 O O   . GLY B 1 106 ? 24.068 44.164 28.957 1.00 4.93  ? 406 GLY C O   1 
ATOM   3063 N N   . ASP B 1 107 ? 22.957 45.862 29.934 1.00 11.52 ? 407 ASP C N   1 
ATOM   3064 C CA  . ASP B 1 107 ? 23.960 46.873 29.614 1.00 13.36 ? 407 ASP C CA  1 
ATOM   3065 C C   . ASP B 1 107 ? 25.357 46.440 30.032 1.00 11.36 ? 407 ASP C C   1 
ATOM   3066 O O   . ASP B 1 107 ? 26.322 46.652 29.297 1.00 10.53 ? 407 ASP C O   1 
ATOM   3067 C CB  . ASP B 1 107 ? 23.610 48.200 30.295 1.00 11.44 ? 407 ASP C CB  1 
ATOM   3068 C CG  . ASP B 1 107 ? 22.288 48.785 29.807 1.00 15.87 ? 407 ASP C CG  1 
ATOM   3069 O OD1 . ASP B 1 107 ? 21.799 49.758 30.422 1.00 16.73 ? 407 ASP C OD1 1 
ATOM   3070 O OD2 . ASP B 1 107 ? 21.736 48.278 28.810 1.00 11.90 ? 407 ASP C OD2 1 
ATOM   3071 N N   . GLY B 1 108 ? 25.462 45.846 31.217 1.00 6.58  ? 408 GLY C N   1 
ATOM   3072 C CA  . GLY B 1 108 ? 26.754 45.394 31.703 1.00 9.53  ? 408 GLY C CA  1 
ATOM   3073 C C   . GLY B 1 108 ? 27.400 44.347 30.807 1.00 7.73  ? 408 GLY C C   1 
ATOM   3074 O O   . GLY B 1 108 ? 28.617 44.350 30.616 1.00 7.87  ? 408 GLY C O   1 
ATOM   3075 N N   . ALA B 1 109 ? 26.594 43.438 30.265 1.00 5.28  ? 409 ALA C N   1 
ATOM   3076 C CA  . ALA B 1 109 ? 27.122 42.412 29.384 1.00 5.84  ? 409 ALA C CA  1 
ATOM   3077 C C   . ALA B 1 109 ? 27.642 43.077 28.107 1.00 10.33 ? 409 ALA C C   1 
ATOM   3078 O O   . ALA B 1 109 ? 28.729 42.747 27.617 1.00 10.60 ? 409 ALA C O   1 
ATOM   3079 C CB  . ALA B 1 109 ? 26.042 41.394 29.046 1.00 8.08  ? 409 ALA C CB  1 
ATOM   3080 N N   . LEU B 1 110 ? 26.869 44.017 27.574 1.00 9.30  ? 410 LEU C N   1 
ATOM   3081 C CA  . LEU B 1 110 ? 27.273 44.723 26.352 1.00 9.23  ? 410 LEU C CA  1 
ATOM   3082 C C   . LEU B 1 110 ? 28.560 45.503 26.581 1.00 12.33 ? 410 LEU C C   1 
ATOM   3083 O O   . LEU B 1 110 ? 29.491 45.419 25.782 1.00 12.10 ? 410 LEU C O   1 
ATOM   3084 C CB  . LEU B 1 110 ? 26.177 45.689 25.890 1.00 5.83  ? 410 LEU C CB  1 
ATOM   3085 C CG  . LEU B 1 110 ? 26.540 46.613 24.713 1.00 10.40 ? 410 LEU C CG  1 
ATOM   3086 C CD1 . LEU B 1 110 ? 26.926 45.792 23.485 1.00 8.90  ? 410 LEU C CD1 1 
ATOM   3087 C CD2 . LEU B 1 110 ? 25.347 47.498 24.399 1.00 9.72  ? 410 LEU C CD2 1 
ATOM   3088 N N   . GLU B 1 111 ? 28.612 46.268 27.667 1.00 9.39  ? 411 GLU C N   1 
ATOM   3089 C CA  . GLU B 1 111 ? 29.804 47.048 27.963 1.00 7.93  ? 411 GLU C CA  1 
ATOM   3090 C C   . GLU B 1 111 ? 31.023 46.132 28.043 1.00 11.56 ? 411 GLU C C   1 
ATOM   3091 O O   . GLU B 1 111 ? 32.102 46.467 27.542 1.00 8.76  ? 411 GLU C O   1 
ATOM   3092 C CB  . GLU B 1 111 ? 29.614 47.823 29.274 1.00 11.34 ? 411 GLU C CB  1 
ATOM   3093 C CG  . GLU B 1 111 ? 30.875 48.484 29.814 1.00 19.32 ? 411 GLU C CG  1 
ATOM   3094 C CD  . GLU B 1 111 ? 30.586 49.353 31.027 1.00 30.95 ? 411 GLU C CD  1 
ATOM   3095 O OE1 . GLU B 1 111 ? 30.259 50.542 30.838 1.00 39.79 ? 411 GLU C OE1 1 
ATOM   3096 O OE2 . GLU B 1 111 ? 30.668 48.845 32.165 1.00 30.76 ? 411 GLU C OE2 1 
ATOM   3097 N N   . PHE B 1 112 ? 30.857 44.965 28.657 1.00 6.91  ? 412 PHE C N   1 
ATOM   3098 C CA  . PHE B 1 112 ? 31.965 44.022 28.761 1.00 6.05  ? 412 PHE C CA  1 
ATOM   3099 C C   . PHE B 1 112 ? 32.353 43.517 27.371 1.00 6.97  ? 412 PHE C C   1 
ATOM   3100 O O   . PHE B 1 112 ? 33.531 43.454 27.031 1.00 6.58  ? 412 PHE C O   1 
ATOM   3101 C CB  . PHE B 1 112 ? 31.585 42.829 29.646 1.00 2.19  ? 412 PHE C CB  1 
ATOM   3102 C CG  . PHE B 1 112 ? 32.602 41.720 29.630 1.00 8.87  ? 412 PHE C CG  1 
ATOM   3103 C CD1 . PHE B 1 112 ? 33.886 41.929 30.123 1.00 4.53  ? 412 PHE C CD1 1 
ATOM   3104 C CD2 . PHE B 1 112 ? 32.277 40.472 29.105 1.00 8.69  ? 412 PHE C CD2 1 
ATOM   3105 C CE1 . PHE B 1 112 ? 34.836 40.911 30.095 1.00 8.90  ? 412 PHE C CE1 1 
ATOM   3106 C CE2 . PHE B 1 112 ? 33.217 39.447 29.071 1.00 8.09  ? 412 PHE C CE2 1 
ATOM   3107 C CZ  . PHE B 1 112 ? 34.502 39.666 29.567 1.00 7.42  ? 412 PHE C CZ  1 
ATOM   3108 N N   . ALA B 1 113 ? 31.351 43.160 26.575 1.00 5.53  ? 413 ALA C N   1 
ATOM   3109 C CA  . ALA B 1 113 ? 31.580 42.664 25.234 1.00 9.21  ? 413 ALA C CA  1 
ATOM   3110 C C   . ALA B 1 113 ? 32.411 43.664 24.442 1.00 13.01 ? 413 ALA C C   1 
ATOM   3111 O O   . ALA B 1 113 ? 33.406 43.295 23.815 1.00 9.83  ? 413 ALA C O   1 
ATOM   3112 C CB  . ALA B 1 113 ? 30.245 42.423 24.528 1.00 6.51  ? 413 ALA C CB  1 
ATOM   3113 N N   . LEU B 1 114 ? 32.005 44.931 24.484 1.00 12.86 ? 414 LEU C N   1 
ATOM   3114 C CA  . LEU B 1 114 ? 32.715 45.988 23.758 1.00 10.87 ? 414 LEU C CA  1 
ATOM   3115 C C   . LEU B 1 114 ? 34.142 46.146 24.262 1.00 13.11 ? 414 LEU C C   1 
ATOM   3116 O O   . LEU B 1 114 ? 35.058 46.409 23.477 1.00 13.85 ? 414 LEU C O   1 
ATOM   3117 C CB  . LEU B 1 114 ? 31.959 47.317 23.881 1.00 12.89 ? 414 LEU C CB  1 
ATOM   3118 C CG  . LEU B 1 114 ? 30.527 47.328 23.330 1.00 12.96 ? 414 LEU C CG  1 
ATOM   3119 C CD1 . LEU B 1 114 ? 29.865 48.665 23.642 1.00 12.56 ? 414 LEU C CD1 1 
ATOM   3120 C CD2 . LEU B 1 114 ? 30.546 47.083 21.830 1.00 9.41  ? 414 LEU C CD2 1 
ATOM   3121 N N   . SER B 1 115 ? 34.340 45.966 25.566 1.00 9.09  ? 415 SER C N   1 
ATOM   3122 C CA  . SER B 1 115 ? 35.673 46.089 26.147 1.00 11.61 ? 415 SER C CA  1 
ATOM   3123 C C   . SER B 1 115 ? 36.563 44.938 25.684 1.00 13.66 ? 415 SER C C   1 
ATOM   3124 O O   . SER B 1 115 ? 37.790 45.036 25.722 1.00 11.69 ? 415 SER C O   1 
ATOM   3125 C CB  . SER B 1 115 ? 35.600 46.075 27.675 1.00 14.08 ? 415 SER C CB  1 
ATOM   3126 O OG  . SER B 1 115 ? 35.406 44.755 28.140 1.00 13.62 ? 415 SER C OG  1 
ATOM   3127 N N   . GLN B 1 116 ? 35.941 43.846 25.249 1.00 10.68 ? 416 GLN C N   1 
ATOM   3128 C CA  . GLN B 1 116 ? 36.682 42.680 24.790 1.00 10.46 ? 416 GLN C CA  1 
ATOM   3129 C C   . GLN B 1 116 ? 36.856 42.650 23.277 1.00 14.38 ? 416 GLN C C   1 
ATOM   3130 O O   . GLN B 1 116 ? 37.277 41.639 22.720 1.00 13.62 ? 416 GLN C O   1 
ATOM   3131 C CB  . GLN B 1 116 ? 35.982 41.400 25.253 1.00 14.70 ? 416 GLN C CB  1 
ATOM   3132 C CG  . GLN B 1 116 ? 36.061 41.167 26.752 1.00 13.37 ? 416 GLN C CG  1 
ATOM   3133 C CD  . GLN B 1 116 ? 37.480 40.922 27.216 1.00 15.31 ? 416 GLN C CD  1 
ATOM   3134 O OE1 . GLN B 1 116 ? 38.127 39.976 26.783 1.00 19.38 ? 416 GLN C OE1 1 
ATOM   3135 N NE2 . GLN B 1 116 ? 37.974 41.780 28.099 1.00 19.00 ? 416 GLN C NE2 1 
ATOM   3136 N N   . GLY B 1 117 ? 36.518 43.754 22.614 1.00 13.98 ? 417 GLY C N   1 
ATOM   3137 C CA  . GLY B 1 117 ? 36.690 43.830 21.174 1.00 14.08 ? 417 GLY C CA  1 
ATOM   3138 C C   . GLY B 1 117 ? 35.507 43.435 20.310 1.00 16.19 ? 417 GLY C C   1 
ATOM   3139 O O   . GLY B 1 117 ? 35.589 43.499 19.087 1.00 9.08  ? 417 GLY C O   1 
ATOM   3140 N N   . PHE B 1 118 ? 34.404 43.020 20.917 1.00 13.00 ? 418 PHE C N   1 
ATOM   3141 C CA  . PHE B 1 118 ? 33.251 42.639 20.121 1.00 14.04 ? 418 PHE C CA  1 
ATOM   3142 C C   . PHE B 1 118 ? 32.668 43.893 19.492 1.00 15.04 ? 418 PHE C C   1 
ATOM   3143 O O   . PHE B 1 118 ? 32.705 44.972 20.084 1.00 15.06 ? 418 PHE C O   1 
ATOM   3144 C CB  . PHE B 1 118 ? 32.209 41.930 20.987 1.00 14.65 ? 418 PHE C CB  1 
ATOM   3145 C CG  . PHE B 1 118 ? 32.628 40.551 21.415 1.00 11.64 ? 418 PHE C CG  1 
ATOM   3146 C CD1 . PHE B 1 118 ? 33.363 40.357 22.585 1.00 10.76 ? 418 PHE C CD1 1 
ATOM   3147 C CD2 . PHE B 1 118 ? 32.338 39.451 20.612 1.00 17.13 ? 418 PHE C CD2 1 
ATOM   3148 C CE1 . PHE B 1 118 ? 33.808 39.086 22.949 1.00 7.34  ? 418 PHE C CE1 1 
ATOM   3149 C CE2 . PHE B 1 118 ? 32.776 38.178 20.963 1.00 12.75 ? 418 PHE C CE2 1 
ATOM   3150 C CZ  . PHE B 1 118 ? 33.516 37.993 22.135 1.00 9.06  ? 418 PHE C CZ  1 
ATOM   3151 N N   . LYS B 1 119 ? 32.129 43.752 18.288 1.00 11.56 ? 419 LYS C N   1 
ATOM   3152 C CA  . LYS B 1 119 ? 31.569 44.901 17.587 1.00 13.55 ? 419 LYS C CA  1 
ATOM   3153 C C   . LYS B 1 119 ? 30.062 45.029 17.717 1.00 14.92 ? 419 LYS C C   1 
ATOM   3154 O O   . LYS B 1 119 ? 29.316 44.057 17.551 1.00 15.77 ? 419 LYS C O   1 
ATOM   3155 C CB  . LYS B 1 119 ? 31.952 44.858 16.106 1.00 14.76 ? 419 LYS C CB  1 
ATOM   3156 C CG  . LYS B 1 119 ? 33.436 45.173 15.875 1.00 25.84 ? 419 LYS C CG  1 
ATOM   3157 C CD  . LYS B 1 119 ? 33.740 45.316 14.391 0.00 23.90 ? 419 LYS C CD  1 
ATOM   3158 C CE  . LYS B 1 119 ? 35.195 45.703 14.168 0.00 25.44 ? 419 LYS C CE  1 
ATOM   3159 N NZ  . LYS B 1 119 ? 35.515 45.882 12.723 0.00 25.22 ? 419 LYS C NZ  1 
ATOM   3160 N N   . LYS B 1 120 ? 29.625 46.245 18.024 1.00 11.98 ? 420 LYS C N   1 
ATOM   3161 C CA  . LYS B 1 120 ? 28.216 46.564 18.169 1.00 18.55 ? 420 LYS C CA  1 
ATOM   3162 C C   . LYS B 1 120 ? 27.628 46.564 16.768 1.00 20.32 ? 420 LYS C C   1 
ATOM   3163 O O   . LYS B 1 120 ? 28.178 47.190 15.863 1.00 23.48 ? 420 LYS C O   1 
ATOM   3164 C CB  . LYS B 1 120 ? 28.064 47.946 18.817 1.00 21.10 ? 420 LYS C CB  1 
ATOM   3165 C CG  . LYS B 1 120 ? 26.667 48.258 19.320 1.00 30.63 ? 420 LYS C CG  1 
ATOM   3166 C CD  . LYS B 1 120 ? 26.657 49.516 20.182 1.00 32.90 ? 420 LYS C CD  1 
ATOM   3167 C CE  . LYS B 1 120 ? 25.310 49.687 20.870 1.00 41.84 ? 420 LYS C CE  1 
ATOM   3168 N NZ  . LYS B 1 120 ? 25.294 50.855 21.793 1.00 46.95 ? 420 LYS C NZ  1 
ATOM   3169 N N   . GLU B 1 121 ? 26.531 45.838 16.585 1.00 17.32 ? 421 GLU C N   1 
ATOM   3170 C CA  . GLU B 1 121 ? 25.875 45.750 15.286 1.00 16.65 ? 421 GLU C CA  1 
ATOM   3171 C C   . GLU B 1 121 ? 24.375 45.743 15.489 1.00 14.24 ? 421 GLU C C   1 
ATOM   3172 O O   . GLU B 1 121 ? 23.903 45.465 16.585 1.00 13.93 ? 421 GLU C O   1 
ATOM   3173 C CB  . GLU B 1 121 ? 26.268 44.460 14.564 1.00 20.29 ? 421 GLU C CB  1 
ATOM   3174 C CG  . GLU B 1 121 ? 27.745 44.150 14.581 1.00 27.17 ? 421 GLU C CG  1 
ATOM   3175 C CD  . GLU B 1 121 ? 28.083 42.947 13.726 1.00 27.99 ? 421 GLU C CD  1 
ATOM   3176 O OE1 . GLU B 1 121 ? 28.045 43.073 12.485 1.00 26.43 ? 421 GLU C OE1 1 
ATOM   3177 O OE2 . GLU B 1 121 ? 28.370 41.872 14.291 1.00 23.73 ? 421 GLU C OE2 1 
ATOM   3178 N N   . ASN B 1 122 ? 23.627 46.043 14.433 1.00 14.22 ? 422 ASN C N   1 
ATOM   3179 C CA  . ASN B 1 122 ? 22.176 46.048 14.518 1.00 14.94 ? 422 ASN C CA  1 
ATOM   3180 C C   . ASN B 1 122 ? 21.693 44.630 14.240 1.00 15.66 ? 422 ASN C C   1 
ATOM   3181 O O   . ASN B 1 122 ? 21.788 44.153 13.113 1.00 13.12 ? 422 ASN C O   1 
ATOM   3182 C CB  . ASN B 1 122 ? 21.577 47.000 13.484 1.00 19.59 ? 422 ASN C CB  1 
ATOM   3183 C CG  . ASN B 1 122 ? 20.088 47.205 13.681 1.00 21.69 ? 422 ASN C CG  1 
ATOM   3184 O OD1 . ASN B 1 122 ? 19.361 46.272 14.008 1.00 17.89 ? 422 ASN C OD1 1 
ATOM   3185 N ND2 . ASN B 1 122 ? 19.626 48.434 13.473 1.00 24.37 ? 422 ASN C ND2 1 
ATOM   3186 N N   . LEU B 1 123 ? 21.160 43.965 15.259 1.00 9.54  ? 423 LEU C N   1 
ATOM   3187 C CA  . LEU B 1 123 ? 20.697 42.591 15.096 1.00 11.37 ? 423 LEU C CA  1 
ATOM   3188 C C   . LEU B 1 123 ? 19.260 42.477 14.610 1.00 6.20  ? 423 LEU C C   1 
ATOM   3189 O O   . LEU B 1 123 ? 18.809 41.392 14.270 1.00 8.49  ? 423 LEU C O   1 
ATOM   3190 C CB  . LEU B 1 123 ? 20.859 41.830 16.415 1.00 12.40 ? 423 LEU C CB  1 
ATOM   3191 C CG  . LEU B 1 123 ? 22.273 41.863 17.016 1.00 14.72 ? 423 LEU C CG  1 
ATOM   3192 C CD1 . LEU B 1 123 ? 22.278 41.117 18.336 1.00 14.56 ? 423 LEU C CD1 1 
ATOM   3193 C CD2 . LEU B 1 123 ? 23.264 41.244 16.043 1.00 13.33 ? 423 LEU C CD2 1 
ATOM   3194 N N   . LEU B 1 124 ? 18.536 43.592 14.581 1.00 11.21 ? 424 LEU C N   1 
ATOM   3195 C CA  . LEU B 1 124 ? 17.155 43.567 14.112 1.00 8.33  ? 424 LEU C CA  1 
ATOM   3196 C C   . LEU B 1 124 ? 17.162 43.691 12.592 1.00 14.89 ? 424 LEU C C   1 
ATOM   3197 O O   . LEU B 1 124 ? 17.421 44.765 12.045 1.00 13.76 ? 424 LEU C O   1 
ATOM   3198 C CB  . LEU B 1 124 ? 16.358 44.725 14.729 1.00 9.01  ? 424 LEU C CB  1 
ATOM   3199 C CG  . LEU B 1 124 ? 14.874 44.790 14.364 1.00 9.31  ? 424 LEU C CG  1 
ATOM   3200 C CD1 . LEU B 1 124 ? 14.144 43.581 14.932 1.00 10.66 ? 424 LEU C CD1 1 
ATOM   3201 C CD2 . LEU B 1 124 ? 14.263 46.073 14.917 1.00 11.04 ? 424 LEU C CD2 1 
ATOM   3202 N N   . THR B 1 125 ? 16.894 42.588 11.907 1.00 14.52 ? 425 THR C N   1 
ATOM   3203 C CA  . THR B 1 125 ? 16.876 42.609 10.449 1.00 19.58 ? 425 THR C CA  1 
ATOM   3204 C C   . THR B 1 125 ? 15.608 43.285 9.962  1.00 18.38 ? 425 THR C C   1 
ATOM   3205 O O   . THR B 1 125 ? 14.699 43.549 10.745 1.00 12.40 ? 425 THR C O   1 
ATOM   3206 C CB  . THR B 1 125 ? 16.919 41.193 9.881  1.00 19.38 ? 425 THR C CB  1 
ATOM   3207 O OG1 . THR B 1 125 ? 15.832 40.435 10.425 1.00 18.27 ? 425 THR C OG1 1 
ATOM   3208 C CG2 . THR B 1 125 ? 18.239 40.522 10.227 1.00 14.10 ? 425 THR C CG2 1 
ATOM   3209 N N   . ALA B 1 126 ? 15.541 43.572 8.668  1.00 18.38 ? 426 ALA C N   1 
ATOM   3210 C CA  . ALA B 1 126 ? 14.351 44.215 8.121  1.00 17.31 ? 426 ALA C CA  1 
ATOM   3211 C C   . ALA B 1 126 ? 13.161 43.288 8.313  1.00 13.60 ? 426 ALA C C   1 
ATOM   3212 O O   . ALA B 1 126 ? 12.067 43.722 8.676  1.00 15.71 ? 426 ALA C O   1 
ATOM   3213 C CB  . ALA B 1 126 ? 14.554 44.517 6.635  1.00 18.74 ? 426 ALA C CB  1 
ATOM   3214 N N   . GLU B 1 127 ? 13.385 42.004 8.062  1.00 13.64 ? 427 GLU C N   1 
ATOM   3215 C CA  . GLU B 1 127 ? 12.344 40.993 8.196  1.00 16.10 ? 427 GLU C CA  1 
ATOM   3216 C C   . GLU B 1 127 ? 11.793 40.930 9.622  1.00 14.40 ? 427 GLU C C   1 
ATOM   3217 O O   . GLU B 1 127 ? 10.581 40.923 9.823  1.00 18.41 ? 427 GLU C O   1 
ATOM   3218 C CB  . GLU B 1 127 ? 12.912 39.637 7.783  1.00 15.98 ? 427 GLU C CB  1 
ATOM   3219 C CG  . GLU B 1 127 ? 12.035 38.449 8.073  1.00 21.69 ? 427 GLU C CG  1 
ATOM   3220 C CD  . GLU B 1 127 ? 12.675 37.157 7.608  1.00 27.35 ? 427 GLU C CD  1 
ATOM   3221 O OE1 . GLU B 1 127 ? 13.875 36.949 7.916  1.00 29.96 ? 427 GLU C OE1 1 
ATOM   3222 O OE2 . GLU B 1 127 ? 11.984 36.354 6.941  1.00 28.59 ? 427 GLU C OE2 1 
ATOM   3223 N N   . SER B 1 128 ? 12.684 40.884 10.608 1.00 16.53 ? 428 SER C N   1 
ATOM   3224 C CA  . SER B 1 128 ? 12.261 40.829 12.004 1.00 12.75 ? 428 SER C CA  1 
ATOM   3225 C C   . SER B 1 128 ? 11.520 42.099 12.400 1.00 11.81 ? 428 SER C C   1 
ATOM   3226 O O   . SER B 1 128 ? 10.543 42.044 13.139 1.00 13.35 ? 428 SER C O   1 
ATOM   3227 C CB  . SER B 1 128 ? 13.470 40.630 12.926 1.00 10.71 ? 428 SER C CB  1 
ATOM   3228 O OG  . SER B 1 128 ? 14.000 39.319 12.797 1.00 15.75 ? 428 SER C OG  1 
ATOM   3229 N N   . GLU B 1 129 ? 11.982 43.245 11.913 1.00 13.78 ? 429 GLU C N   1 
ATOM   3230 C CA  . GLU B 1 129 ? 11.317 44.501 12.248 1.00 14.34 ? 429 GLU C CA  1 
ATOM   3231 C C   . GLU B 1 129 ? 9.912  44.507 11.657 1.00 11.22 ? 429 GLU C C   1 
ATOM   3232 O O   . GLU B 1 129 ? 8.945  44.910 12.307 1.00 14.81 ? 429 GLU C O   1 
ATOM   3233 C CB  . GLU B 1 129 ? 12.112 45.687 11.704 1.00 16.69 ? 429 GLU C CB  1 
ATOM   3234 C CG  . GLU B 1 129 ? 11.458 47.034 11.966 1.00 19.46 ? 429 GLU C CG  1 
ATOM   3235 C CD  . GLU B 1 129 ? 12.271 48.182 11.416 1.00 27.33 ? 429 GLU C CD  1 
ATOM   3236 O OE1 . GLU B 1 129 ? 12.589 48.155 10.208 1.00 34.70 ? 429 GLU C OE1 1 
ATOM   3237 O OE2 . GLU B 1 129 ? 12.592 49.106 12.189 1.00 24.53 ? 429 GLU C OE2 1 
ATOM   3238 N N   . LYS B 1 130 ? 9.818  44.057 10.414 1.00 19.24 ? 430 LYS C N   1 
ATOM   3239 C CA  . LYS B 1 130 ? 8.552  43.979 9.700  1.00 19.63 ? 430 LYS C CA  1 
ATOM   3240 C C   . LYS B 1 130 ? 7.560  43.093 10.466 1.00 17.65 ? 430 LYS C C   1 
ATOM   3241 O O   . LYS B 1 130 ? 6.447  43.519 10.790 1.00 16.04 ? 430 LYS C O   1 
ATOM   3242 C CB  . LYS B 1 130 ? 8.812  43.405 8.308  1.00 21.40 ? 430 LYS C CB  1 
ATOM   3243 C CG  . LYS B 1 130 ? 7.603  43.326 7.425  1.00 27.00 ? 430 LYS C CG  1 
ATOM   3244 C CD  . LYS B 1 130 ? 7.277  44.663 6.822  0.00 26.16 ? 430 LYS C CD  1 
ATOM   3245 C CE  . LYS B 1 130 ? 6.248  44.471 5.733  0.00 26.93 ? 430 LYS C CE  1 
ATOM   3246 N NZ  . LYS B 1 130 ? 5.943  45.734 5.025  0.00 26.85 ? 430 LYS C NZ  1 
ATOM   3247 N N   . GLU B 1 131 ? 7.972  41.863 10.759 1.00 17.71 ? 431 GLU C N   1 
ATOM   3248 C CA  . GLU B 1 131 ? 7.129  40.917 11.487 1.00 17.90 ? 431 GLU C CA  1 
ATOM   3249 C C   . GLU B 1 131 ? 6.734  41.466 12.854 1.00 17.89 ? 431 GLU C C   1 
ATOM   3250 O O   . GLU B 1 131 ? 5.601  41.288 13.294 1.00 23.71 ? 431 GLU C O   1 
ATOM   3251 C CB  . GLU B 1 131 ? 7.860  39.581 11.663 1.00 16.01 ? 431 GLU C CB  1 
ATOM   3252 C CG  . GLU B 1 131 ? 7.978  38.759 10.390 1.00 27.46 ? 431 GLU C CG  1 
ATOM   3253 C CD  . GLU B 1 131 ? 8.837  37.522 10.574 1.00 33.23 ? 431 GLU C CD  1 
ATOM   3254 O OE1 . GLU B 1 131 ? 8.705  36.849 11.619 1.00 35.32 ? 431 GLU C OE1 1 
ATOM   3255 O OE2 . GLU B 1 131 ? 9.636  37.218 9.666  1.00 38.97 ? 431 GLU C OE2 1 
ATOM   3256 N N   . TRP B 1 132 ? 7.669  42.133 13.524 1.00 17.05 ? 432 TRP C N   1 
ATOM   3257 C CA  . TRP B 1 132 ? 7.391  42.704 14.836 1.00 15.34 ? 432 TRP C CA  1 
ATOM   3258 C C   . TRP B 1 132 ? 6.283  43.756 14.780 1.00 19.13 ? 432 TRP C C   1 
ATOM   3259 O O   . TRP B 1 132 ? 5.297  43.667 15.512 1.00 15.08 ? 432 TRP C O   1 
ATOM   3260 C CB  . TRP B 1 132 ? 8.663  43.319 15.428 1.00 14.32 ? 432 TRP C CB  1 
ATOM   3261 C CG  . TRP B 1 132 ? 8.404  44.117 16.667 1.00 8.40  ? 432 TRP C CG  1 
ATOM   3262 C CD1 . TRP B 1 132 ? 7.828  43.676 17.822 1.00 10.52 ? 432 TRP C CD1 1 
ATOM   3263 C CD2 . TRP B 1 132 ? 8.670  45.507 16.852 1.00 10.94 ? 432 TRP C CD2 1 
ATOM   3264 N NE1 . TRP B 1 132 ? 7.715  44.713 18.719 1.00 15.64 ? 432 TRP C NE1 1 
ATOM   3265 C CE2 . TRP B 1 132 ? 8.232  45.847 18.148 1.00 11.56 ? 432 TRP C CE2 1 
ATOM   3266 C CE3 . TRP B 1 132 ? 9.249  46.499 16.051 1.00 13.80 ? 432 TRP C CE3 1 
ATOM   3267 C CZ2 . TRP B 1 132 ? 8.338  47.142 18.657 1.00 12.41 ? 432 TRP C CZ2 1 
ATOM   3268 C CZ3 . TRP B 1 132 ? 9.356  47.786 16.555 1.00 15.35 ? 432 TRP C CZ3 1 
ATOM   3269 C CH2 . TRP B 1 132 ? 8.908  48.094 17.850 1.00 17.43 ? 432 TRP C CH2 1 
ATOM   3270 N N   . LYS B 1 133 ? 6.439  44.749 13.912 1.00 21.50 ? 433 LYS C N   1 
ATOM   3271 C CA  . LYS B 1 133 ? 5.426  45.788 13.786 1.00 25.18 ? 433 LYS C CA  1 
ATOM   3272 C C   . LYS B 1 133 ? 4.080  45.155 13.440 1.00 25.35 ? 433 LYS C C   1 
ATOM   3273 O O   . LYS B 1 133 ? 3.030  45.627 13.872 1.00 28.16 ? 433 LYS C O   1 
ATOM   3274 C CB  . LYS B 1 133 ? 5.833  46.794 12.705 1.00 23.94 ? 433 LYS C CB  1 
ATOM   3275 C CG  . LYS B 1 133 ? 7.087  47.585 13.051 1.00 27.28 ? 433 LYS C CG  1 
ATOM   3276 C CD  . LYS B 1 133 ? 7.424  48.589 11.967 1.00 31.96 ? 433 LYS C CD  1 
ATOM   3277 C CE  . LYS B 1 133 ? 8.643  49.416 12.337 1.00 35.75 ? 433 LYS C CE  1 
ATOM   3278 N NZ  . LYS B 1 133 ? 8.987  50.393 11.263 1.00 37.08 ? 433 LYS C NZ  1 
ATOM   3279 N N   . GLU B 1 134 ? 4.116  44.078 12.664 1.00 27.95 ? 434 GLU C N   1 
ATOM   3280 C CA  . GLU B 1 134 ? 2.895  43.380 12.279 1.00 28.17 ? 434 GLU C CA  1 
ATOM   3281 C C   . GLU B 1 134 ? 2.284  42.695 13.501 1.00 27.48 ? 434 GLU C C   1 
ATOM   3282 O O   . GLU B 1 134 ? 1.068  42.715 13.694 1.00 25.11 ? 434 GLU C O   1 
ATOM   3283 C CB  . GLU B 1 134 ? 3.206  42.345 11.196 1.00 31.13 ? 434 GLU C CB  1 
ATOM   3284 C CG  . GLU B 1 134 ? 1.995  41.596 10.666 1.00 38.15 ? 434 GLU C CG  1 
ATOM   3285 C CD  . GLU B 1 134 ? 0.898  42.529 10.178 1.00 42.76 ? 434 GLU C CD  1 
ATOM   3286 O OE1 . GLU B 1 134 ? 1.223  43.564 9.560  1.00 44.38 ? 434 GLU C OE1 1 
ATOM   3287 O OE2 . GLU B 1 134 ? -0.290 42.216 10.403 1.00 41.57 ? 434 GLU C OE2 1 
ATOM   3288 N N   . TRP B 1 135 ? 3.134  42.083 14.321 1.00 22.27 ? 435 TRP C N   1 
ATOM   3289 C CA  . TRP B 1 135 ? 2.677  41.403 15.531 1.00 18.53 ? 435 TRP C CA  1 
ATOM   3290 C C   . TRP B 1 135 ? 2.066  42.408 16.509 1.00 15.86 ? 435 TRP C C   1 
ATOM   3291 O O   . TRP B 1 135 ? 1.124  42.093 17.237 1.00 17.48 ? 435 TRP C O   1 
ATOM   3292 C CB  . TRP B 1 135 ? 3.858  40.693 16.207 1.00 15.80 ? 435 TRP C CB  1 
ATOM   3293 C CG  . TRP B 1 135 ? 3.516  40.100 17.540 1.00 13.94 ? 435 TRP C CG  1 
ATOM   3294 C CD1 . TRP B 1 135 ? 2.944  38.876 17.781 1.00 9.47  ? 435 TRP C CD1 1 
ATOM   3295 C CD2 . TRP B 1 135 ? 3.696  40.717 18.817 1.00 12.60 ? 435 TRP C CD2 1 
ATOM   3296 N NE1 . TRP B 1 135 ? 2.760  38.698 19.131 1.00 13.97 ? 435 TRP C NE1 1 
ATOM   3297 C CE2 . TRP B 1 135 ? 3.207  39.815 19.791 1.00 9.61  ? 435 TRP C CE2 1 
ATOM   3298 C CE3 . TRP B 1 135 ? 4.216  41.952 19.238 1.00 13.01 ? 435 TRP C CE3 1 
ATOM   3299 C CZ2 . TRP B 1 135 ? 3.230  40.105 21.155 1.00 11.85 ? 435 TRP C CZ2 1 
ATOM   3300 C CZ3 . TRP B 1 135 ? 4.238  42.239 20.601 1.00 13.16 ? 435 TRP C CZ3 1 
ATOM   3301 C CH2 . TRP B 1 135 ? 3.745  41.318 21.540 1.00 12.90 ? 435 TRP C CH2 1 
ATOM   3302 N N   . LEU B 1 136 ? 2.612  43.621 16.522 1.00 17.61 ? 436 LEU C N   1 
ATOM   3303 C CA  . LEU B 1 136 ? 2.135  44.671 17.412 1.00 20.13 ? 436 LEU C CA  1 
ATOM   3304 C C   . LEU B 1 136 ? 0.659  44.999 17.237 1.00 25.44 ? 436 LEU C C   1 
ATOM   3305 O O   . LEU B 1 136 ? 0.014  45.458 18.177 1.00 26.02 ? 436 LEU C O   1 
ATOM   3306 C CB  . LEU B 1 136 ? 2.955  45.944 17.211 1.00 24.33 ? 436 LEU C CB  1 
ATOM   3307 C CG  . LEU B 1 136 ? 4.334  45.994 17.864 1.00 22.44 ? 436 LEU C CG  1 
ATOM   3308 C CD1 . LEU B 1 136 ? 4.982  47.336 17.572 1.00 26.47 ? 436 LEU C CD1 1 
ATOM   3309 C CD2 . LEU B 1 136 ? 4.194  45.786 19.367 1.00 26.43 ? 436 LEU C CD2 1 
ATOM   3310 N N   . LYS B 1 137 ? 0.136  44.766 16.036 1.00 21.02 ? 437 LYS C N   1 
ATOM   3311 C CA  . LYS B 1 137 ? -1.263 45.043 15.739 1.00 29.23 ? 437 LYS C CA  1 
ATOM   3312 C C   . LYS B 1 137 ? -2.200 44.504 16.817 1.00 29.56 ? 437 LYS C C   1 
ATOM   3313 O O   . LYS B 1 137 ? -3.127 45.196 17.247 1.00 34.05 ? 437 LYS C O   1 
ATOM   3314 C CB  . LYS B 1 137 ? -1.655 44.438 14.388 1.00 27.59 ? 437 LYS C CB  1 
ATOM   3315 C CG  . LYS B 1 137 ? -0.827 44.926 13.200 1.00 31.89 ? 437 LYS C CG  1 
ATOM   3316 C CD  . LYS B 1 137 ? -0.987 46.418 12.957 1.00 30.56 ? 437 LYS C CD  1 
ATOM   3317 C CE  . LYS B 1 137 ? -0.225 46.850 11.711 1.00 36.54 ? 437 LYS C CE  1 
ATOM   3318 N NZ  . LYS B 1 137 ? -0.466 48.280 11.369 1.00 40.67 ? 437 LYS C NZ  1 
ATOM   3319 N N   . THR B 1 138 ? -1.959 43.274 17.257 1.00 30.09 ? 438 THR C N   1 
ATOM   3320 C CA  . THR B 1 138 ? -2.800 42.655 18.275 1.00 28.98 ? 438 THR C CA  1 
ATOM   3321 C C   . THR B 1 138 ? -2.024 42.224 19.516 1.00 29.00 ? 438 THR C C   1 
ATOM   3322 O O   . THR B 1 138 ? -2.624 41.812 20.511 1.00 24.91 ? 438 THR C O   1 
ATOM   3323 C CB  . THR B 1 138 ? -3.526 41.435 17.707 1.00 27.33 ? 438 THR C CB  1 
ATOM   3324 O OG1 . THR B 1 138 ? -2.563 40.501 17.211 1.00 29.24 ? 438 THR C OG1 1 
ATOM   3325 C CG2 . THR B 1 138 ? -4.454 41.851 16.576 1.00 35.69 ? 438 THR C CG2 1 
ATOM   3326 N N   . SER B 1 139 ? -0.697 42.315 19.444 1.00 30.34 ? 439 SER C N   1 
ATOM   3327 C CA  . SER B 1 139 ? 0.186  41.947 20.552 1.00 28.67 ? 439 SER C CA  1 
ATOM   3328 C C   . SER B 1 139 ? -0.223 40.679 21.287 1.00 27.19 ? 439 SER C C   1 
ATOM   3329 O O   . SER B 1 139 ? -0.227 40.647 22.515 1.00 27.77 ? 439 SER C O   1 
ATOM   3330 C CB  . SER B 1 139 ? 0.281  43.095 21.559 1.00 29.89 ? 439 SER C CB  1 
ATOM   3331 O OG  . SER B 1 139 ? 0.801  44.262 20.953 1.00 38.50 ? 439 SER C OG  1 
ATOM   3332 N N   . GLN B 1 140 ? -0.567 39.637 20.539 1.00 27.55 ? 440 GLN C N   1 
ATOM   3333 C CA  . GLN B 1 140 ? -0.963 38.374 21.147 1.00 25.78 ? 440 GLN C CA  1 
ATOM   3334 C C   . GLN B 1 140 ? 0.254  37.482 21.377 1.00 25.58 ? 440 GLN C C   1 
ATOM   3335 O O   . GLN B 1 140 ? 0.765  36.863 20.444 1.00 20.70 ? 440 GLN C O   1 
ATOM   3336 C CB  . GLN B 1 140 ? -1.977 37.649 20.259 1.00 30.45 ? 440 GLN C CB  1 
ATOM   3337 C CG  . GLN B 1 140 ? -3.270 38.426 20.031 1.00 41.20 ? 440 GLN C CG  1 
ATOM   3338 C CD  . GLN B 1 140 ? -4.021 38.701 21.325 1.00 47.05 ? 440 GLN C CD  1 
ATOM   3339 O OE1 . GLN B 1 140 ? -4.318 37.783 22.086 1.00 49.68 ? 440 GLN C OE1 1 
ATOM   3340 N NE2 . GLN B 1 140 ? -4.335 39.972 21.578 1.00 48.66 ? 440 GLN C NE2 1 
ATOM   3341 N N   . TYR B 1 141 ? 0.714  37.415 22.623 1.00 23.31 ? 441 TYR C N   1 
ATOM   3342 C CA  . TYR B 1 141 ? 1.879  36.600 22.954 1.00 23.63 ? 441 TYR C CA  1 
ATOM   3343 C C   . TYR B 1 141 ? 1.511  35.123 23.066 1.00 25.80 ? 441 TYR C C   1 
ATOM   3344 O O   . TYR B 1 141 ? 0.813  34.720 23.997 1.00 20.99 ? 441 TYR C O   1 
ATOM   3345 C CB  . TYR B 1 141 ? 2.497  37.077 24.270 1.00 21.97 ? 441 TYR C CB  1 
ATOM   3346 C CG  . TYR B 1 141 ? 3.786  36.369 24.619 1.00 23.71 ? 441 TYR C CG  1 
ATOM   3347 C CD1 . TYR B 1 141 ? 4.898  36.453 23.778 1.00 24.43 ? 441 TYR C CD1 1 
ATOM   3348 C CD2 . TYR B 1 141 ? 3.891  35.598 25.780 1.00 21.97 ? 441 TYR C CD2 1 
ATOM   3349 C CE1 . TYR B 1 141 ? 6.083  35.788 24.081 1.00 22.81 ? 441 TYR C CE1 1 
ATOM   3350 C CE2 . TYR B 1 141 ? 5.074  34.925 26.092 1.00 26.12 ? 441 TYR C CE2 1 
ATOM   3351 C CZ  . TYR B 1 141 ? 6.164  35.025 25.233 1.00 23.52 ? 441 TYR C CZ  1 
ATOM   3352 O OH  . TYR B 1 141 ? 7.321  34.322 25.500 1.00 18.07 ? 441 TYR C OH  1 
ATOM   3353 N N   . LYS B 1 142 ? 1.990  34.321 22.115 1.00 26.12 ? 442 LYS C N   1 
ATOM   3354 C CA  . LYS B 1 142 ? 1.709  32.886 22.094 1.00 30.48 ? 442 LYS C CA  1 
ATOM   3355 C C   . LYS B 1 142 ? 2.892  32.108 21.525 1.00 29.76 ? 442 LYS C C   1 
ATOM   3356 O O   . LYS B 1 142 ? 2.823  31.585 20.415 1.00 30.02 ? 442 LYS C O   1 
ATOM   3357 C CB  . LYS B 1 142 ? 0.470  32.605 21.242 1.00 31.16 ? 442 LYS C CB  1 
ATOM   3358 C CG  . LYS B 1 142 ? -0.781 33.339 21.705 1.00 41.57 ? 442 LYS C CG  1 
ATOM   3359 C CD  . LYS B 1 142 ? -1.977 33.016 20.821 1.00 45.35 ? 442 LYS C CD  1 
ATOM   3360 C CE  . LYS B 1 142 ? -3.206 33.796 21.253 1.00 45.10 ? 442 LYS C CE  1 
ATOM   3361 N NZ  . LYS B 1 142 ? -4.390 33.427 20.435 1.00 50.71 ? 442 LYS C NZ  1 
ATOM   3362 N N   . PRO B 1 143 ? 3.994  32.019 22.288 1.00 31.17 ? 443 PRO C N   1 
ATOM   3363 C CA  . PRO B 1 143 ? 5.202  31.306 21.864 1.00 29.39 ? 443 PRO C CA  1 
ATOM   3364 C C   . PRO B 1 143 ? 4.959  29.864 21.473 1.00 26.30 ? 443 PRO C C   1 
ATOM   3365 O O   . PRO B 1 143 ? 4.504  29.053 22.284 1.00 20.90 ? 443 PRO C O   1 
ATOM   3366 C CB  . PRO B 1 143 ? 6.102  31.389 23.089 1.00 27.90 ? 443 PRO C CB  1 
ATOM   3367 C CG  . PRO B 1 143 ? 5.730  32.653 23.670 1.00 33.30 ? 443 PRO C CG  1 
ATOM   3368 C CD  . PRO B 1 143 ? 4.221  32.657 23.595 1.00 32.07 ? 443 PRO C CD  1 
ATOM   3369 N N   . ILE B 1 144 ? 5.275  29.552 20.226 1.00 26.12 ? 444 ILE C N   1 
ATOM   3370 C CA  . ILE B 1 144 ? 5.124  28.200 19.725 1.00 28.04 ? 444 ILE C CA  1 
ATOM   3371 C C   . ILE B 1 144 ? 6.520  27.635 19.482 1.00 22.11 ? 444 ILE C C   1 
ATOM   3372 O O   . ILE B 1 144 ? 7.401  28.333 18.983 1.00 18.45 ? 444 ILE C O   1 
ATOM   3373 C CB  . ILE B 1 144 ? 4.330  28.173 18.393 1.00 30.52 ? 444 ILE C CB  1 
ATOM   3374 C CG1 . ILE B 1 144 ? 5.005  29.082 17.358 1.00 36.43 ? 444 ILE C CG1 1 
ATOM   3375 C CG2 . ILE B 1 144 ? 2.897  28.607 18.638 1.00 30.80 ? 444 ILE C CG2 1 
ATOM   3376 C CD1 . ILE B 1 144 ? 4.258  29.162 16.031 1.00 41.37 ? 444 ILE C CD1 1 
ATOM   3377 N N   . VAL B 1 145 ? 6.723  26.381 19.869 1.00 18.26 ? 445 VAL C N   1 
ATOM   3378 C CA  . VAL B 1 145 ? 8.000  25.715 19.657 1.00 16.94 ? 445 VAL C CA  1 
ATOM   3379 C C   . VAL B 1 145 ? 7.729  24.439 18.877 1.00 20.71 ? 445 VAL C C   1 
ATOM   3380 O O   . VAL B 1 145 ? 7.168  23.480 19.405 1.00 24.28 ? 445 VAL C O   1 
ATOM   3381 C CB  . VAL B 1 145 ? 8.707  25.354 20.990 1.00 13.66 ? 445 VAL C CB  1 
ATOM   3382 C CG1 . VAL B 1 145 ? 9.988  24.583 20.700 1.00 13.95 ? 445 VAL C CG1 1 
ATOM   3383 C CG2 . VAL B 1 145 ? 9.032  26.626 21.780 1.00 19.50 ? 445 VAL C CG2 1 
ATOM   3384 N N   . ASN B 1 146 ? 8.101  24.451 17.604 1.00 21.45 ? 446 ASN C N   1 
ATOM   3385 C CA  . ASN B 1 146 ? 7.918  23.297 16.746 1.00 25.12 ? 446 ASN C CA  1 
ATOM   3386 C C   . ASN B 1 146 ? 9.044  23.260 15.731 1.00 25.83 ? 446 ASN C C   1 
ATOM   3387 O O   . ASN B 1 146 ? 9.965  24.072 15.788 1.00 22.31 ? 446 ASN C O   1 
ATOM   3388 C CB  . ASN B 1 146 ? 6.551  23.349 16.041 1.00 30.90 ? 446 ASN C CB  1 
ATOM   3389 C CG  . ASN B 1 146 ? 6.324  24.646 15.289 1.00 31.31 ? 446 ASN C CG  1 
ATOM   3390 O OD1 . ASN B 1 146 ? 7.229  25.172 14.639 1.00 28.34 ? 446 ASN C OD1 1 
ATOM   3391 N ND2 . ASN B 1 146 ? 5.103  25.165 15.371 1.00 31.30 ? 446 ASN C ND2 1 
ATOM   3392 N N   . ILE B 1 147 ? 8.964  22.317 14.799 1.00 27.18 ? 447 ILE C N   1 
ATOM   3393 C CA  . ILE B 1 147 ? 9.994  22.171 13.774 1.00 30.24 ? 447 ILE C CA  1 
ATOM   3394 C C   . ILE B 1 147 ? 10.331 23.511 13.117 1.00 28.98 ? 447 ILE C C   1 
ATOM   3395 O O   . ILE B 1 147 ? 11.483 23.760 12.769 1.00 30.80 ? 447 ILE C O   1 
ATOM   3396 C CB  . ILE B 1 147 ? 9.573  21.181 12.656 1.00 30.89 ? 447 ILE C CB  1 
ATOM   3397 C CG1 . ILE B 1 147 ? 8.667  20.093 13.228 1.00 36.79 ? 447 ILE C CG1 1 
ATOM   3398 C CG2 . ILE B 1 147 ? 10.817 20.542 12.051 1.00 31.96 ? 447 ILE C CG2 1 
ATOM   3399 C CD1 . ILE B 1 147 ? 7.214  20.262 12.851 1.00 41.10 ? 447 ILE C CD1 1 
ATOM   3400 N N   . GLU B 1 148 ? 9.328  24.371 12.943 1.00 26.98 ? 448 GLU C N   1 
ATOM   3401 C CA  . GLU B 1 148 ? 9.542  25.668 12.297 1.00 30.20 ? 448 GLU C CA  1 
ATOM   3402 C C   . GLU B 1 148 ? 9.496  26.893 13.207 1.00 28.71 ? 448 GLU C C   1 
ATOM   3403 O O   . GLU B 1 148 ? 9.459  28.015 12.711 1.00 27.69 ? 448 GLU C O   1 
ATOM   3404 C CB  . GLU B 1 148 ? 8.517  25.859 11.169 1.00 27.43 ? 448 GLU C CB  1 
ATOM   3405 C CG  . GLU B 1 148 ? 8.558  24.790 10.085 1.00 29.89 ? 448 GLU C CG  1 
ATOM   3406 C CD  . GLU B 1 148 ? 7.456  24.962 9.056  0.00 29.49 ? 448 GLU C CD  1 
ATOM   3407 O OE1 . GLU B 1 148 ? 6.728  25.973 9.128  0.00 29.77 ? 448 GLU C OE1 1 
ATOM   3408 O OE2 . GLU B 1 148 ? 7.315  24.090 8.169  0.00 29.77 ? 448 GLU C OE2 1 
ATOM   3409 N N   . ASN B 1 149 ? 9.497  26.691 14.522 1.00 24.63 ? 449 ASN C N   1 
ATOM   3410 C CA  . ASN B 1 149 ? 9.435  27.823 15.445 1.00 25.51 ? 449 ASN C CA  1 
ATOM   3411 C C   . ASN B 1 149 ? 10.287 27.722 16.712 1.00 27.78 ? 449 ASN C C   1 
ATOM   3412 O O   . ASN B 1 149 ? 10.415 26.650 17.307 1.00 25.27 ? 449 ASN C O   1 
ATOM   3413 C CB  . ASN B 1 149 ? 7.976  28.088 15.835 1.00 27.23 ? 449 ASN C CB  1 
ATOM   3414 C CG  . ASN B 1 149 ? 7.152  28.618 14.678 1.00 27.96 ? 449 ASN C CG  1 
ATOM   3415 O OD1 . ASN B 1 149 ? 7.300  29.770 14.276 1.00 33.09 ? 449 ASN C OD1 1 
ATOM   3416 N ND2 . ASN B 1 149 ? 6.287  27.775 14.130 1.00 29.30 ? 449 ASN C ND2 1 
ATOM   3417 N N   . HIS B 1 150 ? 10.855 28.860 17.114 1.00 30.59 ? 450 HIS C N   1 
ATOM   3418 C CA  . HIS B 1 150 ? 11.696 28.968 18.308 1.00 32.42 ? 450 HIS C CA  1 
ATOM   3419 C C   . HIS B 1 150 ? 12.728 27.867 18.474 1.00 34.84 ? 450 HIS C C   1 
ATOM   3420 O O   . HIS B 1 150 ? 12.829 27.230 19.529 1.00 30.43 ? 450 HIS C O   1 
ATOM   3421 C CB  . HIS B 1 150 ? 10.824 29.053 19.560 1.00 35.04 ? 450 HIS C CB  1 
ATOM   3422 C CG  . HIS B 1 150 ? 10.080 30.344 19.676 1.00 38.97 ? 450 HIS C CG  1 
ATOM   3423 N ND1 . HIS B 1 150 ? 10.700 31.567 19.537 1.00 39.94 ? 450 HIS C ND1 1 
ATOM   3424 C CD2 . HIS B 1 150 ? 8.770  30.606 19.895 1.00 40.24 ? 450 HIS C CD2 1 
ATOM   3425 C CE1 . HIS B 1 150 ? 9.802  32.527 19.661 1.00 35.93 ? 450 HIS C CE1 1 
ATOM   3426 N NE2 . HIS B 1 150 ? 8.624  31.973 19.880 1.00 39.87 ? 450 HIS C NE2 1 
ATOM   3427 N N   . ASN B 1 151 ? 13.510 27.663 17.423 1.00 30.18 ? 451 ASN C N   1 
ATOM   3428 C CA  . ASN B 1 151 ? 14.542 26.649 17.439 1.00 28.54 ? 451 ASN C CA  1 
ATOM   3429 C C   . ASN B 1 151 ? 15.852 27.199 18.013 1.00 27.73 ? 451 ASN C C   1 
ATOM   3430 O O   . ASN B 1 151 ? 16.706 27.692 17.279 1.00 27.16 ? 451 ASN C O   1 
ATOM   3431 C CB  . ASN B 1 151 ? 14.754 26.114 16.018 1.00 30.46 ? 451 ASN C CB  1 
ATOM   3432 C CG  . ASN B 1 151 ? 13.598 25.244 15.540 1.00 30.82 ? 451 ASN C CG  1 
ATOM   3433 O OD1 . ASN B 1 151 ? 12.495 25.298 16.088 1.00 29.94 ? 451 ASN C OD1 1 
ATOM   3434 N ND2 . ASN B 1 151 ? 13.845 24.445 14.505 1.00 30.24 ? 451 ASN C ND2 1 
ATOM   3435 N N   . THR B 1 152 ? 15.991 27.135 19.335 1.00 19.80 ? 452 THR C N   1 
ATOM   3436 C CA  . THR B 1 152 ? 17.214 27.586 20.006 1.00 15.72 ? 452 THR C CA  1 
ATOM   3437 C C   . THR B 1 152 ? 18.258 26.509 19.754 1.00 13.26 ? 452 THR C C   1 
ATOM   3438 O O   . THR B 1 152 ? 17.906 25.337 19.658 1.00 19.02 ? 452 THR C O   1 
ATOM   3439 C CB  . THR B 1 152 ? 17.010 27.678 21.534 1.00 16.00 ? 452 THR C CB  1 
ATOM   3440 O OG1 . THR B 1 152 ? 16.181 28.804 21.842 1.00 14.90 ? 452 THR C OG1 1 
ATOM   3441 C CG2 . THR B 1 152 ? 18.352 27.804 22.248 1.00 17.92 ? 452 THR C CG2 1 
ATOM   3442 N N   . ILE B 1 153 ? 19.531 26.872 19.644 1.00 11.37 ? 453 ILE C N   1 
ATOM   3443 C CA  . ILE B 1 153 ? 20.525 25.825 19.449 1.00 10.33 ? 453 ILE C CA  1 
ATOM   3444 C C   . ILE B 1 153 ? 21.380 25.555 20.681 1.00 11.08 ? 453 ILE C C   1 
ATOM   3445 O O   . ILE B 1 153 ? 22.004 26.452 21.253 1.00 8.82  ? 453 ILE C O   1 
ATOM   3446 C CB  . ILE B 1 153 ? 21.472 26.085 18.252 1.00 10.37 ? 453 ILE C CB  1 
ATOM   3447 C CG1 . ILE B 1 153 ? 22.389 24.864 18.071 1.00 8.14  ? 453 ILE C CG1 1 
ATOM   3448 C CG2 . ILE B 1 153 ? 22.321 27.331 18.492 1.00 9.81  ? 453 ILE C CG2 1 
ATOM   3449 C CD1 . ILE B 1 153 ? 23.172 24.830 16.765 1.00 7.68  ? 453 ILE C CD1 1 
ATOM   3450 N N   . GLY B 1 154 ? 21.372 24.294 21.092 1.00 7.31  ? 454 GLY C N   1 
ATOM   3451 C CA  . GLY B 1 154 ? 22.180 23.851 22.210 1.00 7.31  ? 454 GLY C CA  1 
ATOM   3452 C C   . GLY B 1 154 ? 23.095 22.823 21.572 1.00 6.05  ? 454 GLY C C   1 
ATOM   3453 O O   . GLY B 1 154 ? 22.652 22.061 20.714 1.00 2.83  ? 454 GLY C O   1 
ATOM   3454 N N   . MET B 1 155 ? 24.364 22.803 21.959 1.00 6.02  ? 455 MET C N   1 
ATOM   3455 C CA  . MET B 1 155 ? 25.307 21.850 21.378 1.00 1.26  ? 455 MET C CA  1 
ATOM   3456 C C   . MET B 1 155 ? 26.240 21.328 22.454 1.00 3.56  ? 455 MET C C   1 
ATOM   3457 O O   . MET B 1 155 ? 26.735 22.085 23.292 1.00 8.24  ? 455 MET C O   1 
ATOM   3458 C CB  . MET B 1 155 ? 26.110 22.530 20.262 1.00 4.29  ? 455 MET C CB  1 
ATOM   3459 C CG  . MET B 1 155 ? 27.167 21.662 19.613 1.00 2.48  ? 455 MET C CG  1 
ATOM   3460 S SD  . MET B 1 155 ? 28.063 22.533 18.291 1.00 8.31  ? 455 MET C SD  1 
ATOM   3461 C CE  . MET B 1 155 ? 26.931 22.315 16.912 1.00 6.87  ? 455 MET C CE  1 
ATOM   3462 N N   . ILE B 1 156 ? 26.461 20.023 22.439 1.00 3.45  ? 456 ILE C N   1 
ATOM   3463 C CA  . ILE B 1 156 ? 27.337 19.389 23.399 1.00 3.41  ? 456 ILE C CA  1 
ATOM   3464 C C   . ILE B 1 156 ? 28.262 18.455 22.635 1.00 7.48  ? 456 ILE C C   1 
ATOM   3465 O O   . ILE B 1 156 ? 27.865 17.842 21.643 1.00 5.22  ? 456 ILE C O   1 
ATOM   3466 C CB  . ILE B 1 156 ? 26.530 18.608 24.445 1.00 6.55  ? 456 ILE C CB  1 
ATOM   3467 C CG1 . ILE B 1 156 ? 25.538 17.669 23.753 1.00 7.53  ? 456 ILE C CG1 1 
ATOM   3468 C CG2 . ILE B 1 156 ? 25.792 19.599 25.370 1.00 4.71  ? 456 ILE C CG2 1 
ATOM   3469 C CD1 . ILE B 1 156 ? 24.699 16.832 24.735 1.00 5.02  ? 456 ILE C CD1 1 
ATOM   3470 N N   . ALA B 1 157 ? 29.503 18.356 23.087 1.00 4.35  ? 457 ALA C N   1 
ATOM   3471 C CA  . ALA B 1 157 ? 30.457 17.511 22.399 1.00 5.99  ? 457 ALA C CA  1 
ATOM   3472 C C   . ALA B 1 157 ? 31.463 16.863 23.331 1.00 6.22  ? 457 ALA C C   1 
ATOM   3473 O O   . ALA B 1 157 ? 31.764 17.379 24.409 1.00 4.16  ? 457 ALA C O   1 
ATOM   3474 C CB  . ALA B 1 157 ? 31.189 18.331 21.331 1.00 3.48  ? 457 ALA C CB  1 
ATOM   3475 N N   . LEU B 1 158 ? 31.973 15.720 22.887 1.00 7.22  ? 458 LEU C N   1 
ATOM   3476 C CA  . LEU B 1 158 ? 32.977 14.945 23.610 1.00 3.83  ? 458 LEU C CA  1 
ATOM   3477 C C   . LEU B 1 158 ? 34.128 14.922 22.611 1.00 4.46  ? 458 LEU C C   1 
ATOM   3478 O O   . LEU B 1 158 ? 33.958 14.409 21.512 1.00 7.27  ? 458 LEU C O   1 
ATOM   3479 C CB  . LEU B 1 158 ? 32.464 13.520 23.843 1.00 4.66  ? 458 LEU C CB  1 
ATOM   3480 C CG  . LEU B 1 158 ? 33.441 12.539 24.502 1.00 6.70  ? 458 LEU C CG  1 
ATOM   3481 C CD1 . LEU B 1 158 ? 33.747 12.995 25.922 1.00 8.29  ? 458 LEU C CD1 1 
ATOM   3482 C CD2 . LEU B 1 158 ? 32.822 11.141 24.524 1.00 10.78 ? 458 LEU C CD2 1 
ATOM   3483 N N   . ASP B 1 159 ? 35.279 15.495 22.962 1.00 6.66  ? 459 ASP C N   1 
ATOM   3484 C CA  . ASP B 1 159 ? 36.388 15.521 22.014 1.00 5.12  ? 459 ASP C CA  1 
ATOM   3485 C C   . ASP B 1 159 ? 37.307 14.295 22.047 1.00 6.94  ? 459 ASP C C   1 
ATOM   3486 O O   . ASP B 1 159 ? 37.076 13.344 22.805 1.00 6.89  ? 459 ASP C O   1 
ATOM   3487 C CB  . ASP B 1 159 ? 37.208 16.804 22.176 1.00 6.94  ? 459 ASP C CB  1 
ATOM   3488 C CG  . ASP B 1 159 ? 37.770 16.970 23.572 1.00 2.81  ? 459 ASP C CG  1 
ATOM   3489 O OD1 . ASP B 1 159 ? 38.165 15.953 24.172 1.00 4.46  ? 459 ASP C OD1 1 
ATOM   3490 O OD2 . ASP B 1 159 ? 37.830 18.126 24.053 1.00 9.52  ? 459 ASP C OD2 1 
ATOM   3491 N N   . ALA B 1 160 ? 38.339 14.318 21.210 1.00 5.28  ? 460 ALA C N   1 
ATOM   3492 C CA  . ALA B 1 160 ? 39.283 13.206 21.125 1.00 8.51  ? 460 ALA C CA  1 
ATOM   3493 C C   . ALA B 1 160 ? 39.991 12.925 22.448 1.00 10.75 ? 460 ALA C C   1 
ATOM   3494 O O   . ALA B 1 160 ? 40.399 11.795 22.711 1.00 7.61  ? 460 ALA C O   1 
ATOM   3495 C CB  . ALA B 1 160 ? 40.314 13.471 20.028 1.00 8.64  ? 460 ALA C CB  1 
ATOM   3496 N N   . GLN B 1 161 ? 40.141 13.952 23.276 1.00 8.70  ? 461 GLN C N   1 
ATOM   3497 C CA  . GLN B 1 161 ? 40.790 13.791 24.576 1.00 8.10  ? 461 GLN C CA  1 
ATOM   3498 C C   . GLN B 1 161 ? 39.807 13.213 25.581 1.00 9.84  ? 461 GLN C C   1 
ATOM   3499 O O   . GLN B 1 161 ? 40.167 12.914 26.723 1.00 6.57  ? 461 GLN C O   1 
ATOM   3500 C CB  . GLN B 1 161 ? 41.253 15.132 25.121 1.00 13.89 ? 461 GLN C CB  1 
ATOM   3501 C CG  . GLN B 1 161 ? 42.476 15.711 24.493 1.00 11.52 ? 461 GLN C CG  1 
ATOM   3502 C CD  . GLN B 1 161 ? 42.590 17.180 24.816 1.00 15.39 ? 461 GLN C CD  1 
ATOM   3503 O OE1 . GLN B 1 161 ? 42.085 18.021 24.074 1.00 14.55 ? 461 GLN C OE1 1 
ATOM   3504 N NE2 . GLN B 1 161 ? 43.230 17.501 25.942 1.00 15.27 ? 461 GLN C NE2 1 
ATOM   3505 N N   . GLY B 1 162 ? 38.558 13.083 25.164 1.00 4.86  ? 462 GLY C N   1 
ATOM   3506 C CA  . GLY B 1 162 ? 37.553 12.562 26.060 1.00 7.17  ? 462 GLY C CA  1 
ATOM   3507 C C   . GLY B 1 162 ? 37.002 13.629 26.984 1.00 6.23  ? 462 GLY C C   1 
ATOM   3508 O O   . GLY B 1 162 ? 36.517 13.317 28.072 1.00 6.74  ? 462 GLY C O   1 
ATOM   3509 N N   . ASN B 1 163 ? 37.083 14.890 26.569 1.00 3.95  ? 463 ASN C N   1 
ATOM   3510 C CA  . ASN B 1 163 ? 36.549 15.977 27.391 1.00 4.57  ? 463 ASN C CA  1 
ATOM   3511 C C   . ASN B 1 163 ? 35.244 16.490 26.815 1.00 6.18  ? 463 ASN C C   1 
ATOM   3512 O O   . ASN B 1 163 ? 35.067 16.577 25.598 1.00 6.40  ? 463 ASN C O   1 
ATOM   3513 C CB  . ASN B 1 163 ? 37.538 17.141 27.501 1.00 4.78  ? 463 ASN C CB  1 
ATOM   3514 C CG  . ASN B 1 163 ? 38.770 16.786 28.312 1.00 6.86  ? 463 ASN C CG  1 
ATOM   3515 O OD1 . ASN B 1 163 ? 38.667 16.141 29.348 1.00 7.94  ? 463 ASN C OD1 1 
ATOM   3516 N ND2 . ASN B 1 163 ? 39.941 17.220 27.848 1.00 10.39 ? 463 ASN C ND2 1 
ATOM   3517 N N   . LEU B 1 164 ? 34.341 16.858 27.709 1.00 3.55  ? 464 LEU C N   1 
ATOM   3518 C CA  . LEU B 1 164 ? 33.033 17.368 27.328 1.00 5.96  ? 464 LEU C CA  1 
ATOM   3519 C C   . LEU B 1 164 ? 32.951 18.880 27.452 1.00 8.29  ? 464 LEU C C   1 
ATOM   3520 O O   . LEU B 1 164 ? 33.636 19.486 28.274 1.00 6.98  ? 464 LEU C O   1 
ATOM   3521 C CB  . LEU B 1 164 ? 31.965 16.757 28.237 1.00 4.02  ? 464 LEU C CB  1 
ATOM   3522 C CG  . LEU B 1 164 ? 31.742 15.240 28.139 1.00 7.73  ? 464 LEU C CG  1 
ATOM   3523 C CD1 . LEU B 1 164 ? 31.176 14.697 29.454 1.00 5.31  ? 464 LEU C CD1 1 
ATOM   3524 C CD2 . LEU B 1 164 ? 30.775 14.964 26.989 1.00 5.88  ? 464 LEU C CD2 1 
ATOM   3525 N N   . SER B 1 165 ? 32.111 19.485 26.623 1.00 6.23  ? 465 SER C N   1 
ATOM   3526 C CA  . SER B 1 165 ? 31.871 20.915 26.686 1.00 4.59  ? 465 SER C CA  1 
ATOM   3527 C C   . SER B 1 165 ? 30.529 21.156 26.027 1.00 6.21  ? 465 SER C C   1 
ATOM   3528 O O   . SER B 1 165 ? 30.046 20.321 25.264 1.00 6.52  ? 465 SER C O   1 
ATOM   3529 C CB  . SER B 1 165 ? 32.969 21.709 25.984 1.00 6.74  ? 465 SER C CB  1 
ATOM   3530 O OG  . SER B 1 165 ? 34.174 21.662 26.737 1.00 5.68  ? 465 SER C OG  1 
ATOM   3531 N N   . GLY B 1 166 ? 29.914 22.286 26.339 1.00 3.12  ? 466 GLY C N   1 
ATOM   3532 C CA  . GLY B 1 166 ? 28.623 22.582 25.753 1.00 2.77  ? 466 GLY C CA  1 
ATOM   3533 C C   . GLY B 1 166 ? 28.395 24.062 25.593 1.00 3.19  ? 466 GLY C C   1 
ATOM   3534 O O   . GLY B 1 166 ? 29.040 24.880 26.254 1.00 3.22  ? 466 GLY C O   1 
ATOM   3535 N N   . ALA B 1 167 ? 27.471 24.404 24.703 1.00 4.33  ? 467 ALA C N   1 
ATOM   3536 C CA  . ALA B 1 167 ? 27.136 25.787 24.443 1.00 6.13  ? 467 ALA C CA  1 
ATOM   3537 C C   . ALA B 1 167 ? 25.647 25.872 24.117 1.00 6.02  ? 467 ALA C C   1 
ATOM   3538 O O   . ALA B 1 167 ? 25.073 24.958 23.516 1.00 5.69  ? 467 ALA C O   1 
ATOM   3539 C CB  . ALA B 1 167 ? 27.977 26.318 23.271 1.00 8.43  ? 467 ALA C CB  1 
ATOM   3540 N N   . CYS B 1 168 ? 25.018 26.961 24.538 1.00 3.87  ? 468 CYS C N   1 
ATOM   3541 C CA  . CYS B 1 168 ? 23.596 27.161 24.282 1.00 2.15  ? 468 CYS C CA  1 
ATOM   3542 C C   . CYS B 1 168 ? 23.417 28.637 23.970 1.00 4.01  ? 468 CYS C C   1 
ATOM   3543 O O   . CYS B 1 168 ? 23.879 29.484 24.721 1.00 5.73  ? 468 CYS C O   1 
ATOM   3544 C CB  . CYS B 1 168 ? 22.783 26.779 25.521 1.00 3.77  ? 468 CYS C CB  1 
ATOM   3545 S SG  . CYS B 1 168 ? 21.001 26.665 25.258 1.00 9.65  ? 468 CYS C SG  1 
ATOM   3546 N N   . THR B 1 169 ? 22.752 28.945 22.864 1.00 4.56  ? 469 THR C N   1 
ATOM   3547 C CA  . THR B 1 169 ? 22.554 30.337 22.485 1.00 4.99  ? 469 THR C CA  1 
ATOM   3548 C C   . THR B 1 169 ? 21.175 30.513 21.862 1.00 2.33  ? 469 THR C C   1 
ATOM   3549 O O   . THR B 1 169 ? 20.729 29.673 21.084 1.00 5.91  ? 469 THR C O   1 
ATOM   3550 C CB  . THR B 1 169 ? 23.685 30.790 21.523 1.00 8.39  ? 469 THR C CB  1 
ATOM   3551 O OG1 . THR B 1 169 ? 23.496 32.161 21.167 1.00 6.65  ? 469 THR C OG1 1 
ATOM   3552 C CG2 . THR B 1 169 ? 23.706 29.929 20.274 1.00 11.97 ? 469 THR C CG2 1 
ATOM   3553 N N   . THR B 1 170 ? 20.507 31.612 22.200 1.00 3.72  ? 470 THR C N   1 
ATOM   3554 C CA  . THR B 1 170 ? 19.152 31.859 21.711 1.00 4.67  ? 470 THR C CA  1 
ATOM   3555 C C   . THR B 1 170 ? 18.817 33.345 21.670 1.00 6.02  ? 470 THR C C   1 
ATOM   3556 O O   . THR B 1 170 ? 19.529 34.170 22.235 1.00 1.97  ? 470 THR C O   1 
ATOM   3557 C CB  . THR B 1 170 ? 18.120 31.201 22.651 1.00 5.45  ? 470 THR C CB  1 
ATOM   3558 O OG1 . THR B 1 170 ? 16.796 31.388 22.139 1.00 7.31  ? 470 THR C OG1 1 
ATOM   3559 C CG2 . THR B 1 170 ? 18.192 31.846 24.043 1.00 12.59 ? 470 THR C CG2 1 
ATOM   3560 N N   . SER B 1 171 ? 17.720 33.679 21.001 1.00 6.81  ? 471 SER C N   1 
ATOM   3561 C CA  . SER B 1 171 ? 17.265 35.058 20.955 1.00 10.36 ? 471 SER C CA  1 
ATOM   3562 C C   . SER B 1 171 ? 16.038 35.078 21.856 1.00 8.31  ? 471 SER C C   1 
ATOM   3563 O O   . SER B 1 171 ? 15.371 36.098 22.020 1.00 9.18  ? 471 SER C O   1 
ATOM   3564 C CB  . SER B 1 171 ? 16.906 35.475 19.524 1.00 8.37  ? 471 SER C CB  1 
ATOM   3565 O OG  . SER B 1 171 ? 15.965 34.591 18.955 1.00 10.75 ? 471 SER C OG  1 
ATOM   3566 N N   . GLY B 1 172 ? 15.743 33.920 22.438 1.00 6.76  ? 472 GLY C N   1 
ATOM   3567 C CA  . GLY B 1 172 ? 14.616 33.818 23.348 1.00 3.35  ? 472 GLY C CA  1 
ATOM   3568 C C   . GLY B 1 172 ? 13.268 33.789 22.658 1.00 6.91  ? 472 GLY C C   1 
ATOM   3569 O O   . GLY B 1 172 ? 13.181 33.808 21.435 1.00 7.23  ? 472 GLY C O   1 
ATOM   3570 N N   . MET B 1 173 ? 12.213 33.742 23.456 1.00 8.39  ? 473 MET C N   1 
ATOM   3571 C CA  . MET B 1 173 ? 10.858 33.703 22.932 1.00 11.62 ? 473 MET C CA  1 
ATOM   3572 C C   . MET B 1 173 ? 10.532 34.998 22.184 1.00 11.19 ? 473 MET C C   1 
ATOM   3573 O O   . MET B 1 173 ? 10.756 36.094 22.688 1.00 8.87  ? 473 MET C O   1 
ATOM   3574 C CB  . MET B 1 173 ? 9.878  33.480 24.085 1.00 11.80 ? 473 MET C CB  1 
ATOM   3575 C CG  . MET B 1 173 ? 9.024  32.237 23.929 1.00 27.49 ? 473 MET C CG  1 
ATOM   3576 S SD  . MET B 1 173 ? 9.895  30.804 23.215 1.00 23.83 ? 473 MET C SD  1 
ATOM   3577 C CE  . MET B 1 173 ? 10.171 29.794 24.666 1.00 26.52 ? 473 MET C CE  1 
ATOM   3578 N N   . ALA B 1 174 ? 10.019 34.869 20.968 1.00 13.53 ? 474 ALA C N   1 
ATOM   3579 C CA  . ALA B 1 174 ? 9.685  36.038 20.175 1.00 13.11 ? 474 ALA C CA  1 
ATOM   3580 C C   . ALA B 1 174 ? 8.625  36.859 20.896 1.00 10.34 ? 474 ALA C C   1 
ATOM   3581 O O   . ALA B 1 174 ? 7.655  36.309 21.422 1.00 8.66  ? 474 ALA C O   1 
ATOM   3582 C CB  . ALA B 1 174 ? 9.169  35.611 18.802 1.00 12.15 ? 474 ALA C CB  1 
ATOM   3583 N N   . TYR B 1 175 ? 8.829  38.170 20.936 1.00 8.75  ? 475 TYR C N   1 
ATOM   3584 C CA  . TYR B 1 175 ? 7.872  39.086 21.558 1.00 9.15  ? 475 TYR C CA  1 
ATOM   3585 C C   . TYR B 1 175 ? 7.689  38.857 23.050 1.00 12.64 ? 475 TYR C C   1 
ATOM   3586 O O   . TYR B 1 175 ? 6.615  39.087 23.611 1.00 12.44 ? 475 TYR C O   1 
ATOM   3587 C CB  . TYR B 1 175 ? 6.536  38.988 20.824 1.00 9.42  ? 475 TYR C CB  1 
ATOM   3588 C CG  . TYR B 1 175 ? 6.737  39.003 19.329 1.00 8.60  ? 475 TYR C CG  1 
ATOM   3589 C CD1 . TYR B 1 175 ? 6.093  38.083 18.509 1.00 6.55  ? 475 TYR C CD1 1 
ATOM   3590 C CD2 . TYR B 1 175 ? 7.638  39.897 18.743 1.00 10.18 ? 475 TYR C CD2 1 
ATOM   3591 C CE1 . TYR B 1 175 ? 6.342  38.042 17.139 1.00 13.29 ? 475 TYR C CE1 1 
ATOM   3592 C CE2 . TYR B 1 175 ? 7.897  39.865 17.373 1.00 9.37  ? 475 TYR C CE2 1 
ATOM   3593 C CZ  . TYR B 1 175 ? 7.248  38.932 16.579 1.00 12.97 ? 475 TYR C CZ  1 
ATOM   3594 O OH  . TYR B 1 175 ? 7.527  38.865 15.227 1.00 12.06 ? 475 TYR C OH  1 
ATOM   3595 N N   . LYS B 1 176 ? 8.763  38.401 23.682 1.00 6.86  ? 476 LYS C N   1 
ATOM   3596 C CA  . LYS B 1 176 ? 8.795  38.173 25.112 1.00 5.25  ? 476 LYS C CA  1 
ATOM   3597 C C   . LYS B 1 176 ? 8.771  39.557 25.770 1.00 6.71  ? 476 LYS C C   1 
ATOM   3598 O O   . LYS B 1 176 ? 9.013  40.567 25.103 1.00 6.52  ? 476 LYS C O   1 
ATOM   3599 C CB  . LYS B 1 176 ? 10.101 37.464 25.470 1.00 2.47  ? 476 LYS C CB  1 
ATOM   3600 C CG  . LYS B 1 176 ? 11.322 38.284 25.036 1.00 5.70  ? 476 LYS C CG  1 
ATOM   3601 C CD  . LYS B 1 176 ? 12.611 37.501 25.015 1.00 6.47  ? 476 LYS C CD  1 
ATOM   3602 C CE  . LYS B 1 176 ? 13.754 38.383 24.488 1.00 2.32  ? 476 LYS C CE  1 
ATOM   3603 N NZ  . LYS B 1 176 ? 15.037 37.635 24.337 1.00 4.96  ? 476 LYS C NZ  1 
ATOM   3604 N N   . MET B 1 177 ? 8.468  39.617 27.063 1.00 7.86  ? 477 MET C N   1 
ATOM   3605 C CA  . MET B 1 177 ? 8.485  40.897 27.758 1.00 8.42  ? 477 MET C CA  1 
ATOM   3606 C C   . MET B 1 177 ? 9.926  41.367 27.748 1.00 10.17 ? 477 MET C C   1 
ATOM   3607 O O   . MET B 1 177 ? 10.857 40.558 27.795 1.00 6.17  ? 477 MET C O   1 
ATOM   3608 C CB  . MET B 1 177 ? 8.036  40.751 29.213 1.00 4.40  ? 477 MET C CB  1 
ATOM   3609 C CG  . MET B 1 177 ? 6.569  40.399 29.379 1.00 6.74  ? 477 MET C CG  1 
ATOM   3610 S SD  . MET B 1 177 ? 6.129  40.191 31.094 1.00 11.37 ? 477 MET C SD  1 
ATOM   3611 C CE  . MET B 1 177 ? 6.205  41.871 31.702 1.00 12.37 ? 477 MET C CE  1 
ATOM   3612 N N   . HIS B 1 178 ? 10.102 42.677 27.683 1.00 2.90  ? 478 HIS C N   1 
ATOM   3613 C CA  . HIS B 1 178 ? 11.428 43.256 27.707 1.00 8.61  ? 478 HIS C CA  1 
ATOM   3614 C C   . HIS B 1 178 ? 12.157 42.714 28.938 1.00 8.50  ? 478 HIS C C   1 
ATOM   3615 O O   . HIS B 1 178 ? 11.596 42.675 30.040 1.00 8.94  ? 478 HIS C O   1 
ATOM   3616 C CB  . HIS B 1 178 ? 11.304 44.780 27.777 1.00 16.41 ? 478 HIS C CB  1 
ATOM   3617 C CG  . HIS B 1 178 ? 12.602 45.486 27.990 1.00 20.69 ? 478 HIS C CG  1 
ATOM   3618 N ND1 . HIS B 1 178 ? 13.747 45.162 27.295 1.00 27.19 ? 478 HIS C ND1 1 
ATOM   3619 C CD2 . HIS B 1 178 ? 12.933 46.510 28.809 1.00 24.67 ? 478 HIS C CD2 1 
ATOM   3620 C CE1 . HIS B 1 178 ? 14.730 45.956 27.680 1.00 29.71 ? 478 HIS C CE1 1 
ATOM   3621 N NE2 . HIS B 1 178 ? 14.262 46.782 28.598 1.00 25.48 ? 478 HIS C NE2 1 
ATOM   3622 N N   . GLY B 1 179 ? 13.391 42.254 28.752 1.00 5.94  ? 479 GLY C N   1 
ATOM   3623 C CA  . GLY B 1 179 ? 14.154 41.740 29.883 1.00 6.84  ? 479 GLY C CA  1 
ATOM   3624 C C   . GLY B 1 179 ? 13.885 40.291 30.255 1.00 8.13  ? 479 GLY C C   1 
ATOM   3625 O O   . GLY B 1 179 ? 14.491 39.770 31.185 1.00 4.90  ? 479 GLY C O   1 
ATOM   3626 N N   . ARG B 1 180 ? 12.976 39.629 29.548 1.00 6.37  ? 480 ARG C N   1 
ATOM   3627 C CA  . ARG B 1 180 ? 12.698 38.226 29.857 1.00 6.88  ? 480 ARG C CA  1 
ATOM   3628 C C   . ARG B 1 180 ? 13.919 37.370 29.524 1.00 6.15  ? 480 ARG C C   1 
ATOM   3629 O O   . ARG B 1 180 ? 14.543 37.528 28.471 1.00 6.29  ? 480 ARG C O   1 
ATOM   3630 C CB  . ARG B 1 180 ? 11.479 37.735 29.063 1.00 1.99  ? 480 ARG C CB  1 
ATOM   3631 C CG  . ARG B 1 180 ? 11.176 36.238 29.190 1.00 4.61  ? 480 ARG C CG  1 
ATOM   3632 C CD  . ARG B 1 180 ? 12.086 35.379 28.299 1.00 7.01  ? 480 ARG C CD  1 
ATOM   3633 N NE  . ARG B 1 180 ? 11.638 33.980 28.252 1.00 5.45  ? 480 ARG C NE  1 
ATOM   3634 C CZ  . ARG B 1 180 ? 12.170 33.042 27.469 1.00 6.55  ? 480 ARG C CZ  1 
ATOM   3635 N NH1 . ARG B 1 180 ? 13.179 33.337 26.658 1.00 3.82  ? 480 ARG C NH1 1 
ATOM   3636 N NH2 . ARG B 1 180 ? 11.681 31.809 27.488 1.00 6.77  ? 480 ARG C NH2 1 
ATOM   3637 N N   . VAL B 1 181 ? 14.256 36.470 30.439 1.00 1.70  ? 481 VAL C N   1 
ATOM   3638 C CA  . VAL B 1 181 ? 15.374 35.562 30.255 1.00 3.50  ? 481 VAL C CA  1 
ATOM   3639 C C   . VAL B 1 181 ? 14.853 34.139 30.396 1.00 3.00  ? 481 VAL C C   1 
ATOM   3640 O O   . VAL B 1 181 ? 14.075 33.852 31.301 1.00 5.51  ? 481 VAL C O   1 
ATOM   3641 C CB  . VAL B 1 181 ? 16.478 35.796 31.311 1.00 2.84  ? 481 VAL C CB  1 
ATOM   3642 C CG1 . VAL B 1 181 ? 17.596 34.760 31.145 1.00 5.31  ? 481 VAL C CG1 1 
ATOM   3643 C CG2 . VAL B 1 181 ? 17.048 37.203 31.158 1.00 2.36  ? 481 VAL C CG2 1 
ATOM   3644 N N   . GLY B 1 182 ? 15.274 33.263 29.486 1.00 3.66  ? 482 GLY C N   1 
ATOM   3645 C CA  . GLY B 1 182 ? 14.857 31.874 29.531 1.00 6.62  ? 482 GLY C CA  1 
ATOM   3646 C C   . GLY B 1 182 ? 15.941 30.993 30.143 1.00 4.89  ? 482 GLY C C   1 
ATOM   3647 O O   . GLY B 1 182 ? 16.771 31.464 30.909 1.00 5.78  ? 482 GLY C O   1 
ATOM   3648 N N   . ASP B 1 183 ? 15.933 29.714 29.782 1.00 2.49  ? 483 ASP C N   1 
ATOM   3649 C CA  . ASP B 1 183 ? 16.883 28.735 30.299 1.00 5.52  ? 483 ASP C CA  1 
ATOM   3650 C C   . ASP B 1 183 ? 18.255 28.733 29.629 1.00 1.68  ? 483 ASP C C   1 
ATOM   3651 O O   . ASP B 1 183 ? 19.238 28.308 30.222 1.00 2.19  ? 483 ASP C O   1 
ATOM   3652 C CB  . ASP B 1 183 ? 16.298 27.336 30.132 1.00 4.97  ? 483 ASP C CB  1 
ATOM   3653 C CG  . ASP B 1 183 ? 16.168 26.941 28.666 1.00 4.09  ? 483 ASP C CG  1 
ATOM   3654 O OD1 . ASP B 1 183 ? 15.610 27.747 27.880 1.00 6.66  ? 483 ASP C OD1 1 
ATOM   3655 O OD2 . ASP B 1 183 ? 16.613 25.837 28.299 1.00 7.49  ? 483 ASP C OD2 1 
ATOM   3656 N N   . SER B 1 184 ? 18.315 29.195 28.392 1.00 4.75  ? 484 SER C N   1 
ATOM   3657 C CA  . SER B 1 184 ? 19.555 29.152 27.635 1.00 4.80  ? 484 SER C CA  1 
ATOM   3658 C C   . SER B 1 184 ? 20.843 29.672 28.248 1.00 4.28  ? 484 SER C C   1 
ATOM   3659 O O   . SER B 1 184 ? 21.916 29.125 27.967 1.00 6.23  ? 484 SER C O   1 
ATOM   3660 C CB  . SER B 1 184 ? 19.336 29.801 26.272 1.00 5.95  ? 484 SER C CB  1 
ATOM   3661 O OG  . SER B 1 184 ? 18.301 29.126 25.591 1.00 2.69  ? 484 SER C OG  1 
ATOM   3662 N N   . PRO B 1 185 ? 20.775 30.723 29.088 1.00 2.64  ? 485 PRO C N   1 
ATOM   3663 C CA  . PRO B 1 185 ? 22.020 31.223 29.672 1.00 1.89  ? 485 PRO C CA  1 
ATOM   3664 C C   . PRO B 1 185 ? 22.207 30.788 31.122 1.00 5.20  ? 485 PRO C C   1 
ATOM   3665 O O   . PRO B 1 185 ? 23.135 31.234 31.793 1.00 3.89  ? 485 PRO C O   1 
ATOM   3666 C CB  . PRO B 1 185 ? 21.840 32.725 29.574 1.00 1.12  ? 485 PRO C CB  1 
ATOM   3667 C CG  . PRO B 1 185 ? 20.397 32.861 30.017 1.00 3.85  ? 485 PRO C CG  1 
ATOM   3668 C CD  . PRO B 1 185 ? 19.694 31.716 29.260 1.00 1.12  ? 485 PRO C CD  1 
ATOM   3669 N N   . ILE B 1 186 ? 21.319 29.925 31.604 1.00 5.96  ? 486 ILE C N   1 
ATOM   3670 C CA  . ILE B 1 186 ? 21.392 29.479 32.983 1.00 4.45  ? 486 ILE C CA  1 
ATOM   3671 C C   . ILE B 1 186 ? 21.999 28.089 33.115 1.00 5.33  ? 486 ILE C C   1 
ATOM   3672 O O   . ILE B 1 186 ? 21.455 27.106 32.609 1.00 3.37  ? 486 ILE C O   1 
ATOM   3673 C CB  . ILE B 1 186 ? 19.991 29.507 33.630 1.00 6.13  ? 486 ILE C CB  1 
ATOM   3674 C CG1 . ILE B 1 186 ? 19.447 30.944 33.588 1.00 11.43 ? 486 ILE C CG1 1 
ATOM   3675 C CG2 . ILE B 1 186 ? 20.063 28.999 35.067 1.00 5.35  ? 486 ILE C CG2 1 
ATOM   3676 C CD1 . ILE B 1 186 ? 18.039 31.094 34.120 1.00 10.55 ? 486 ILE C CD1 1 
ATOM   3677 N N   . ILE B 1 187 ? 23.142 28.019 33.787 1.00 6.03  ? 487 ILE C N   1 
ATOM   3678 C CA  . ILE B 1 187 ? 23.831 26.749 33.991 1.00 3.44  ? 487 ILE C CA  1 
ATOM   3679 C C   . ILE B 1 187 ? 22.949 25.850 34.855 1.00 6.34  ? 487 ILE C C   1 
ATOM   3680 O O   . ILE B 1 187 ? 22.481 26.259 35.911 1.00 4.03  ? 487 ILE C O   1 
ATOM   3681 C CB  . ILE B 1 187 ? 25.205 26.971 34.668 1.00 6.96  ? 487 ILE C CB  1 
ATOM   3682 C CG1 . ILE B 1 187 ? 26.178 27.600 33.668 1.00 8.60  ? 487 ILE C CG1 1 
ATOM   3683 C CG2 . ILE B 1 187 ? 25.776 25.654 35.167 1.00 2.53  ? 487 ILE C CG2 1 
ATOM   3684 C CD1 . ILE B 1 187 ? 25.858 29.024 33.319 1.00 22.76 ? 487 ILE C CD1 1 
ATOM   3685 N N   . GLY B 1 188 ? 22.716 24.627 34.393 1.00 6.24  ? 488 GLY C N   1 
ATOM   3686 C CA  . GLY B 1 188 ? 21.866 23.717 35.138 1.00 5.52  ? 488 GLY C CA  1 
ATOM   3687 C C   . GLY B 1 188 ? 20.477 23.703 34.532 1.00 5.59  ? 488 GLY C C   1 
ATOM   3688 O O   . GLY B 1 188 ? 19.707 22.764 34.735 1.00 4.33  ? 488 GLY C O   1 
ATOM   3689 N N   . ALA B 1 189 ? 20.143 24.759 33.796 1.00 4.69  ? 489 ALA C N   1 
ATOM   3690 C CA  . ALA B 1 189 ? 18.844 24.835 33.146 1.00 3.13  ? 489 ALA C CA  1 
ATOM   3691 C C   . ALA B 1 189 ? 19.048 24.486 31.678 1.00 7.04  ? 489 ALA C C   1 
ATOM   3692 O O   . ALA B 1 189 ? 18.896 23.333 31.289 1.00 5.36  ? 489 ALA C O   1 
ATOM   3693 C CB  . ALA B 1 189 ? 18.238 26.233 33.294 1.00 8.41  ? 489 ALA C CB  1 
ATOM   3694 N N   . GLY B 1 190 ? 19.421 25.472 30.870 1.00 5.34  ? 490 GLY C N   1 
ATOM   3695 C CA  . GLY B 1 190 ? 19.630 25.212 29.454 1.00 4.02  ? 490 GLY C CA  1 
ATOM   3696 C C   . GLY B 1 190 ? 20.860 24.378 29.136 1.00 8.48  ? 490 GLY C C   1 
ATOM   3697 O O   . GLY B 1 190 ? 20.954 23.766 28.070 1.00 5.80  ? 490 GLY C O   1 
ATOM   3698 N N   . LEU B 1 191 ? 21.803 24.319 30.066 1.00 5.88  ? 491 LEU C N   1 
ATOM   3699 C CA  . LEU B 1 191 ? 23.029 23.579 29.806 1.00 2.52  ? 491 LEU C CA  1 
ATOM   3700 C C   . LEU B 1 191 ? 23.765 23.160 31.062 1.00 4.26  ? 491 LEU C C   1 
ATOM   3701 O O   . LEU B 1 191 ? 23.819 23.902 32.040 1.00 5.12  ? 491 LEU C O   1 
ATOM   3702 C CB  . LEU B 1 191 ? 23.973 24.449 28.963 1.00 5.00  ? 491 LEU C CB  1 
ATOM   3703 C CG  . LEU B 1 191 ? 25.395 23.934 28.727 1.00 7.07  ? 491 LEU C CG  1 
ATOM   3704 C CD1 . LEU B 1 191 ? 25.358 22.807 27.719 1.00 7.81  ? 491 LEU C CD1 1 
ATOM   3705 C CD2 . LEU B 1 191 ? 26.291 25.072 28.235 1.00 9.10  ? 491 LEU C CD2 1 
ATOM   3706 N N   . PHE B 1 192 ? 24.321 21.955 31.041 1.00 1.18  ? 492 PHE C N   1 
ATOM   3707 C CA  . PHE B 1 192 ? 25.118 21.494 32.157 1.00 2.89  ? 492 PHE C CA  1 
ATOM   3708 C C   . PHE B 1 192 ? 26.108 20.461 31.669 1.00 3.52  ? 492 PHE C C   1 
ATOM   3709 O O   . PHE B 1 192 ? 25.776 19.593 30.863 1.00 3.01  ? 492 PHE C O   1 
ATOM   3710 C CB  . PHE B 1 192 ? 24.277 20.922 33.292 1.00 2.74  ? 492 PHE C CB  1 
ATOM   3711 C CG  . PHE B 1 192 ? 25.074 20.697 34.546 1.00 5.12  ? 492 PHE C CG  1 
ATOM   3712 C CD1 . PHE B 1 192 ? 25.442 19.417 34.933 1.00 3.45  ? 492 PHE C CD1 1 
ATOM   3713 C CD2 . PHE B 1 192 ? 25.521 21.787 35.301 1.00 5.81  ? 492 PHE C CD2 1 
ATOM   3714 C CE1 . PHE B 1 192 ? 26.252 19.213 36.052 1.00 6.71  ? 492 PHE C CE1 1 
ATOM   3715 C CE2 . PHE B 1 192 ? 26.332 21.597 36.423 1.00 5.68  ? 492 PHE C CE2 1 
ATOM   3716 C CZ  . PHE B 1 192 ? 26.698 20.305 36.797 1.00 8.38  ? 492 PHE C CZ  1 
ATOM   3717 N N   . VAL B 1 193 ? 27.339 20.586 32.146 1.00 4.74  ? 493 VAL C N   1 
ATOM   3718 C CA  . VAL B 1 193 ? 28.407 19.680 31.757 1.00 2.57  ? 493 VAL C CA  1 
ATOM   3719 C C   . VAL B 1 193 ? 29.229 19.255 32.966 1.00 5.63  ? 493 VAL C C   1 
ATOM   3720 O O   . VAL B 1 193 ? 29.695 20.097 33.731 1.00 7.34  ? 493 VAL C O   1 
ATOM   3721 C CB  . VAL B 1 193 ? 29.391 20.347 30.743 1.00 3.90  ? 493 VAL C CB  1 
ATOM   3722 C CG1 . VAL B 1 193 ? 30.521 19.383 30.393 1.00 1.12  ? 493 VAL C CG1 1 
ATOM   3723 C CG2 . VAL B 1 193 ? 28.654 20.772 29.474 1.00 5.26  ? 493 VAL C CG2 1 
ATOM   3724 N N   . ASP B 1 194 ? 29.382 17.948 33.155 1.00 6.20  ? 494 ASP C N   1 
ATOM   3725 C CA  . ASP B 1 194 ? 30.221 17.436 34.234 1.00 6.09  ? 494 ASP C CA  1 
ATOM   3726 C C   . ASP B 1 194 ? 31.096 16.409 33.532 1.00 7.75  ? 494 ASP C C   1 
ATOM   3727 O O   . ASP B 1 194 ? 30.614 15.367 33.097 1.00 6.47  ? 494 ASP C O   1 
ATOM   3728 C CB  . ASP B 1 194 ? 29.405 16.763 35.337 1.00 8.06  ? 494 ASP C CB  1 
ATOM   3729 C CG  . ASP B 1 194 ? 30.279 16.303 36.496 1.00 8.84  ? 494 ASP C CG  1 
ATOM   3730 O OD1 . ASP B 1 194 ? 31.354 15.725 36.240 1.00 10.97 ? 494 ASP C OD1 1 
ATOM   3731 O OD2 . ASP B 1 194 ? 29.903 16.516 37.665 1.00 9.89  ? 494 ASP C OD2 1 
ATOM   3732 N N   . ASN B 1 195 ? 32.385 16.710 33.423 1.00 6.46  ? 495 ASN C N   1 
ATOM   3733 C CA  . ASN B 1 195 ? 33.314 15.839 32.714 1.00 5.32  ? 495 ASN C CA  1 
ATOM   3734 C C   . ASN B 1 195 ? 33.438 14.408 33.237 1.00 8.54  ? 495 ASN C C   1 
ATOM   3735 O O   . ASN B 1 195 ? 33.938 13.538 32.531 1.00 6.19  ? 495 ASN C O   1 
ATOM   3736 C CB  . ASN B 1 195 ? 34.693 16.493 32.661 1.00 6.02  ? 495 ASN C CB  1 
ATOM   3737 C CG  . ASN B 1 195 ? 35.486 16.069 31.445 1.00 5.98  ? 495 ASN C CG  1 
ATOM   3738 O OD1 . ASN B 1 195 ? 34.933 15.934 30.360 1.00 7.93  ? 495 ASN C OD1 1 
ATOM   3739 N ND2 . ASN B 1 195 ? 36.788 15.864 31.618 1.00 7.40  ? 495 ASN C ND2 1 
ATOM   3740 N N   . GLU B 1 196 ? 32.996 14.160 34.466 1.00 6.97  ? 496 GLU C N   1 
ATOM   3741 C CA  . GLU B 1 196 ? 33.076 12.812 35.026 1.00 11.13 ? 496 GLU C CA  1 
ATOM   3742 C C   . GLU B 1 196 ? 31.764 12.058 34.834 1.00 13.26 ? 496 GLU C C   1 
ATOM   3743 O O   . GLU B 1 196 ? 31.636 10.905 35.246 1.00 12.48 ? 496 GLU C O   1 
ATOM   3744 C CB  . GLU B 1 196 ? 33.399 12.879 36.523 1.00 11.47 ? 496 GLU C CB  1 
ATOM   3745 C CG  . GLU B 1 196 ? 34.730 13.530 36.827 1.00 19.31 ? 496 GLU C CG  1 
ATOM   3746 C CD  . GLU B 1 196 ? 35.871 12.819 36.141 1.00 31.55 ? 496 GLU C CD  1 
ATOM   3747 O OE1 . GLU B 1 196 ? 36.080 11.621 36.435 1.00 38.47 ? 496 GLU C OE1 1 
ATOM   3748 O OE2 . GLU B 1 196 ? 36.555 13.451 35.305 1.00 40.26 ? 496 GLU C OE2 1 
ATOM   3749 N N   . ILE B 1 197 ? 30.788 12.710 34.209 1.00 7.94  ? 497 ILE C N   1 
ATOM   3750 C CA  . ILE B 1 197 ? 29.478 12.087 34.009 1.00 8.54  ? 497 ILE C CA  1 
ATOM   3751 C C   . ILE B 1 197 ? 28.927 12.194 32.593 1.00 11.12 ? 497 ILE C C   1 
ATOM   3752 O O   . ILE B 1 197 ? 28.719 11.193 31.912 1.00 6.17  ? 497 ILE C O   1 
ATOM   3753 C CB  . ILE B 1 197 ? 28.434 12.719 34.943 1.00 5.24  ? 497 ILE C CB  1 
ATOM   3754 C CG1 . ILE B 1 197 ? 28.865 12.544 36.400 1.00 8.89  ? 497 ILE C CG1 1 
ATOM   3755 C CG2 . ILE B 1 197 ? 27.076 12.110 34.682 1.00 5.60  ? 497 ILE C CG2 1 
ATOM   3756 C CD1 . ILE B 1 197 ? 28.061 13.390 37.380 1.00 18.78 ? 497 ILE C CD1 1 
ATOM   3757 N N   . GLY B 1 198 ? 28.656 13.426 32.178 1.00 7.71  ? 498 GLY C N   1 
ATOM   3758 C CA  . GLY B 1 198 ? 28.105 13.652 30.861 1.00 4.74  ? 498 GLY C CA  1 
ATOM   3759 C C   . GLY B 1 198 ? 27.688 15.097 30.729 1.00 7.35  ? 498 GLY C C   1 
ATOM   3760 O O   . GLY B 1 198 ? 27.961 15.918 31.601 1.00 3.84  ? 498 GLY C O   1 
ATOM   3761 N N   . ALA B 1 199 ? 27.013 15.407 29.637 1.00 3.99  ? 499 ALA C N   1 
ATOM   3762 C CA  . ALA B 1 199 ? 26.555 16.764 29.390 1.00 3.35  ? 499 ALA C CA  1 
ATOM   3763 C C   . ALA B 1 199 ? 25.165 16.686 28.809 1.00 3.97  ? 499 ALA C C   1 
ATOM   3764 O O   . ALA B 1 199 ? 24.778 15.673 28.224 1.00 1.12  ? 499 ALA C O   1 
ATOM   3765 C CB  . ALA B 1 199 ? 27.484 17.453 28.387 1.00 5.87  ? 499 ALA C CB  1 
ATOM   3766 N N   . ALA B 1 200 ? 24.431 17.776 28.945 1.00 4.48  ? 500 ALA C N   1 
ATOM   3767 C CA  . ALA B 1 200 ? 23.080 17.838 28.427 1.00 1.61  ? 500 ALA C CA  1 
ATOM   3768 C C   . ALA B 1 200 ? 22.752 19.289 28.137 1.00 3.57  ? 500 ALA C C   1 
ATOM   3769 O O   . ALA B 1 200 ? 23.258 20.192 28.803 1.00 6.85  ? 500 ALA C O   1 
ATOM   3770 C CB  . ALA B 1 200 ? 22.095 17.284 29.457 1.00 2.75  ? 500 ALA C CB  1 
ATOM   3771 N N   . THR B 1 201 ? 21.913 19.509 27.137 1.00 5.27  ? 501 THR C N   1 
ATOM   3772 C CA  . THR B 1 201 ? 21.496 20.851 26.814 1.00 1.17  ? 501 THR C CA  1 
ATOM   3773 C C   . THR B 1 201 ? 20.029 20.750 26.441 1.00 4.05  ? 501 THR C C   1 
ATOM   3774 O O   . THR B 1 201 ? 19.540 19.677 26.067 1.00 5.89  ? 501 THR C O   1 
ATOM   3775 C CB  . THR B 1 201 ? 22.338 21.470 25.689 1.00 1.59  ? 501 THR C CB  1 
ATOM   3776 O OG1 . THR B 1 201 ? 22.054 22.873 25.611 1.00 7.02  ? 501 THR C OG1 1 
ATOM   3777 C CG2 . THR B 1 201 ? 22.043 20.832 24.354 1.00 2.33  ? 501 THR C CG2 1 
ATOM   3778 N N   . ALA B 1 202 ? 19.330 21.869 26.555 1.00 2.27  ? 502 ALA C N   1 
ATOM   3779 C CA  . ALA B 1 202 ? 17.907 21.890 26.300 1.00 6.87  ? 502 ALA C CA  1 
ATOM   3780 C C   . ALA B 1 202 ? 17.471 22.921 25.277 1.00 10.47 ? 502 ALA C C   1 
ATOM   3781 O O   . ALA B 1 202 ? 18.236 23.808 24.887 1.00 9.52  ? 502 ALA C O   1 
ATOM   3782 C CB  . ALA B 1 202 ? 17.175 22.143 27.615 1.00 2.37  ? 502 ALA C CB  1 
ATOM   3783 N N   . THR B 1 203 ? 16.217 22.792 24.860 1.00 9.27  ? 503 THR C N   1 
ATOM   3784 C CA  . THR B 1 203 ? 15.618 23.707 23.906 1.00 5.27  ? 503 THR C CA  1 
ATOM   3785 C C   . THR B 1 203 ? 14.111 23.684 24.139 1.00 9.84  ? 503 THR C C   1 
ATOM   3786 O O   . THR B 1 203 ? 13.601 22.771 24.785 1.00 6.66  ? 503 THR C O   1 
ATOM   3787 C CB  . THR B 1 203 ? 15.958 23.294 22.444 1.00 11.70 ? 503 THR C CB  1 
ATOM   3788 O OG1 . THR B 1 203 ? 15.531 24.329 21.554 1.00 10.26 ? 503 THR C OG1 1 
ATOM   3789 C CG2 . THR B 1 203 ? 15.253 21.990 22.057 1.00 6.09  ? 503 THR C CG2 1 
ATOM   3790 N N   . GLY B 1 204 ? 13.402 24.699 23.649 1.00 6.55  ? 504 GLY C N   1 
ATOM   3791 C CA  . GLY B 1 204 ? 11.957 24.740 23.830 1.00 8.40  ? 504 GLY C CA  1 
ATOM   3792 C C   . GLY B 1 204 ? 11.477 25.847 24.754 1.00 7.21  ? 504 GLY C C   1 
ATOM   3793 O O   . GLY B 1 204 ? 12.092 26.922 24.804 1.00 7.96  ? 504 GLY C O   1 
ATOM   3794 N N   . HIS B 1 205 ? 10.383 25.604 25.481 1.00 3.96  ? 505 HIS C N   1 
ATOM   3795 C CA  . HIS B 1 205 ? 9.864  26.621 26.393 1.00 8.30  ? 505 HIS C CA  1 
ATOM   3796 C C   . HIS B 1 205 ? 10.760 26.728 27.619 1.00 9.64  ? 505 HIS C C   1 
ATOM   3797 O O   . HIS B 1 205 ? 10.642 25.949 28.566 1.00 10.30 ? 505 HIS C O   1 
ATOM   3798 C CB  . HIS B 1 205 ? 8.414  26.330 26.799 1.00 9.09  ? 505 HIS C CB  1 
ATOM   3799 C CG  . HIS B 1 205 ? 7.439  26.508 25.679 1.00 16.16 ? 505 HIS C CG  1 
ATOM   3800 N ND1 . HIS B 1 205 ? 7.006  25.460 24.899 1.00 18.46 ? 505 HIS C ND1 1 
ATOM   3801 C CD2 . HIS B 1 205 ? 6.865  27.622 25.162 1.00 22.56 ? 505 HIS C CD2 1 
ATOM   3802 C CE1 . HIS B 1 205 ? 6.208  25.915 23.950 1.00 20.45 ? 505 HIS C CE1 1 
ATOM   3803 N NE2 . HIS B 1 205 ? 6.106  27.225 24.087 1.00 24.39 ? 505 HIS C NE2 1 
ATOM   3804 N N   . GLY B 1 206 ? 11.654 27.715 27.576 1.00 6.68  ? 506 GLY C N   1 
ATOM   3805 C CA  . GLY B 1 206 ? 12.620 27.931 28.638 1.00 8.35  ? 506 GLY C CA  1 
ATOM   3806 C C   . GLY B 1 206 ? 12.107 27.967 30.056 1.00 7.15  ? 506 GLY C C   1 
ATOM   3807 O O   . GLY B 1 206 ? 12.747 27.432 30.969 1.00 6.68  ? 506 GLY C O   1 
ATOM   3808 N N   . GLU B 1 207 ? 10.966 28.613 30.260 1.00 5.71  ? 507 GLU C N   1 
ATOM   3809 C CA  . GLU B 1 207 ? 10.381 28.705 31.595 1.00 7.56  ? 507 GLU C CA  1 
ATOM   3810 C C   . GLU B 1 207 ? 10.274 27.338 32.264 1.00 5.20  ? 507 GLU C C   1 
ATOM   3811 O O   . GLU B 1 207 ? 10.528 27.200 33.466 1.00 4.16  ? 507 GLU C O   1 
ATOM   3812 C CB  . GLU B 1 207 ? 8.983  29.340 31.524 1.00 6.59  ? 507 GLU C CB  1 
ATOM   3813 C CG  . GLU B 1 207 ? 8.971  30.864 31.404 1.00 8.14  ? 507 GLU C CG  1 
ATOM   3814 C CD  . GLU B 1 207 ? 9.484  31.383 30.074 1.00 9.62  ? 507 GLU C CD  1 
ATOM   3815 O OE1 . GLU B 1 207 ? 9.588  30.592 29.104 1.00 1.51  ? 507 GLU C OE1 1 
ATOM   3816 O OE2 . GLU B 1 207 ? 9.775  32.601 30.000 1.00 5.58  ? 507 GLU C OE2 1 
ATOM   3817 N N   . GLU B 1 208 ? 9.898  26.334 31.480 1.00 3.99  ? 508 GLU C N   1 
ATOM   3818 C CA  . GLU B 1 208 ? 9.727  24.975 31.993 1.00 4.56  ? 508 GLU C CA  1 
ATOM   3819 C C   . GLU B 1 208 ? 11.038 24.263 32.298 1.00 4.21  ? 508 GLU C C   1 
ATOM   3820 O O   . GLU B 1 208 ? 11.091 23.394 33.164 1.00 7.07  ? 508 GLU C O   1 
ATOM   3821 C CB  . GLU B 1 208 ? 8.897  24.152 31.001 1.00 2.70  ? 508 GLU C CB  1 
ATOM   3822 C CG  . GLU B 1 208 ? 7.496  24.724 30.766 1.00 6.00  ? 508 GLU C CG  1 
ATOM   3823 C CD  . GLU B 1 208 ? 6.813  25.151 32.066 1.00 5.12  ? 508 GLU C CD  1 
ATOM   3824 O OE1 . GLU B 1 208 ? 6.768  24.343 33.018 1.00 4.75  ? 508 GLU C OE1 1 
ATOM   3825 O OE2 . GLU B 1 208 ? 6.326  26.293 32.131 1.00 7.75  ? 508 GLU C OE2 1 
ATOM   3826 N N   . VAL B 1 209 ? 12.091 24.621 31.572 1.00 6.45  ? 509 VAL C N   1 
ATOM   3827 C CA  . VAL B 1 209 ? 13.399 24.028 31.795 1.00 4.66  ? 509 VAL C CA  1 
ATOM   3828 C C   . VAL B 1 209 ? 14.018 24.670 33.039 1.00 5.95  ? 509 VAL C C   1 
ATOM   3829 O O   . VAL B 1 209 ? 14.713 24.009 33.809 1.00 7.80  ? 509 VAL C O   1 
ATOM   3830 C CB  . VAL B 1 209 ? 14.316 24.234 30.551 1.00 6.21  ? 509 VAL C CB  1 
ATOM   3831 C CG1 . VAL B 1 209 ? 15.728 23.753 30.842 1.00 5.12  ? 509 VAL C CG1 1 
ATOM   3832 C CG2 . VAL B 1 209 ? 13.747 23.446 29.360 1.00 3.20  ? 509 VAL C CG2 1 
ATOM   3833 N N   . ILE B 1 210 ? 13.756 25.958 33.239 1.00 4.11  ? 510 ILE C N   1 
ATOM   3834 C CA  . ILE B 1 210 ? 14.258 26.655 34.420 1.00 3.47  ? 510 ILE C CA  1 
ATOM   3835 C C   . ILE B 1 210 ? 13.573 26.066 35.655 1.00 6.45  ? 510 ILE C C   1 
ATOM   3836 O O   . ILE B 1 210 ? 14.216 25.764 36.665 1.00 4.39  ? 510 ILE C O   1 
ATOM   3837 C CB  . ILE B 1 210 ? 13.933 28.161 34.369 1.00 7.17  ? 510 ILE C CB  1 
ATOM   3838 C CG1 . ILE B 1 210 ? 14.787 28.841 33.302 1.00 6.27  ? 510 ILE C CG1 1 
ATOM   3839 C CG2 . ILE B 1 210 ? 14.186 28.798 35.748 1.00 4.76  ? 510 ILE C CG2 1 
ATOM   3840 C CD1 . ILE B 1 210 ? 14.459 30.312 33.114 1.00 12.02 ? 510 ILE C CD1 1 
ATOM   3841 N N   . ARG B 1 211 ? 12.260 25.899 35.541 1.00 6.29  ? 511 ARG C N   1 
ATOM   3842 C CA  . ARG B 1 211 ? 11.416 25.374 36.605 1.00 6.11  ? 511 ARG C CA  1 
ATOM   3843 C C   . ARG B 1 211 ? 11.881 24.015 37.120 1.00 9.25  ? 511 ARG C C   1 
ATOM   3844 O O   . ARG B 1 211 ? 11.770 23.712 38.311 1.00 10.00 ? 511 ARG C O   1 
ATOM   3845 C CB  . ARG B 1 211 ? 9.976  25.262 36.084 1.00 11.29 ? 511 ARG C CB  1 
ATOM   3846 C CG  . ARG B 1 211 ? 8.908  25.103 37.148 1.00 12.74 ? 511 ARG C CG  1 
ATOM   3847 C CD  . ARG B 1 211 ? 7.549  24.781 36.514 1.00 15.06 ? 511 ARG C CD  1 
ATOM   3848 N NE  . ARG B 1 211 ? 7.155  25.733 35.477 1.00 7.97  ? 511 ARG C NE  1 
ATOM   3849 C CZ  . ARG B 1 211 ? 6.890  27.018 35.690 1.00 8.54  ? 511 ARG C CZ  1 
ATOM   3850 N NH1 . ARG B 1 211 ? 6.974  27.525 36.916 1.00 7.34  ? 511 ARG C NH1 1 
ATOM   3851 N NH2 . ARG B 1 211 ? 6.525  27.798 34.674 1.00 6.98  ? 511 ARG C NH2 1 
ATOM   3852 N N   . THR B 1 212 ? 12.409 23.191 36.223 1.00 5.68  ? 512 THR C N   1 
ATOM   3853 C CA  . THR B 1 212 ? 12.860 21.864 36.611 1.00 6.80  ? 512 THR C CA  1 
ATOM   3854 C C   . THR B 1 212 ? 14.378 21.706 36.643 1.00 5.07  ? 512 THR C C   1 
ATOM   3855 O O   . THR B 1 212 ? 14.879 20.606 36.876 1.00 5.12  ? 512 THR C O   1 
ATOM   3856 C CB  . THR B 1 212 ? 12.254 20.802 35.668 1.00 11.29 ? 512 THR C CB  1 
ATOM   3857 O OG1 . THR B 1 212 ? 12.658 21.062 34.318 1.00 8.88  ? 512 THR C OG1 1 
ATOM   3858 C CG2 . THR B 1 212 ? 10.725 20.850 35.741 1.00 15.31 ? 512 THR C CG2 1 
ATOM   3859 N N   . VAL B 1 213 ? 15.104 22.804 36.418 1.00 2.39  ? 513 VAL C N   1 
ATOM   3860 C CA  . VAL B 1 213 ? 16.571 22.784 36.403 1.00 3.13  ? 513 VAL C CA  1 
ATOM   3861 C C   . VAL B 1 213 ? 16.956 21.581 35.521 1.00 5.41  ? 513 VAL C C   1 
ATOM   3862 O O   . VAL B 1 213 ? 17.813 20.772 35.869 1.00 3.49  ? 513 VAL C O   1 
ATOM   3863 C CB  . VAL B 1 213 ? 17.138 22.621 37.850 1.00 4.50  ? 513 VAL C CB  1 
ATOM   3864 C CG1 . VAL B 1 213 ? 18.594 23.116 37.915 1.00 4.11  ? 513 VAL C CG1 1 
ATOM   3865 C CG2 . VAL B 1 213 ? 16.290 23.422 38.844 1.00 4.51  ? 513 VAL C CG2 1 
ATOM   3866 N N   . GLY B 1 214 ? 16.280 21.500 34.376 1.00 5.87  ? 514 GLY C N   1 
ATOM   3867 C CA  . GLY B 1 214 ? 16.428 20.417 33.413 1.00 4.51  ? 514 GLY C CA  1 
ATOM   3868 C C   . GLY B 1 214 ? 17.745 19.699 33.156 1.00 5.58  ? 514 GLY C C   1 
ATOM   3869 O O   . GLY B 1 214 ? 17.863 18.507 33.413 1.00 4.42  ? 514 GLY C O   1 
ATOM   3870 N N   . THR B 1 215 ? 18.743 20.406 32.647 1.00 5.33  ? 515 THR C N   1 
ATOM   3871 C CA  . THR B 1 215 ? 19.994 19.746 32.324 1.00 3.48  ? 515 THR C CA  1 
ATOM   3872 C C   . THR B 1 215 ? 20.776 19.256 33.525 1.00 6.04  ? 515 THR C C   1 
ATOM   3873 O O   . THR B 1 215 ? 21.483 18.257 33.435 1.00 2.56  ? 515 THR C O   1 
ATOM   3874 C CB  . THR B 1 215 ? 20.862 20.633 31.424 1.00 2.79  ? 515 THR C CB  1 
ATOM   3875 O OG1 . THR B 1 215 ? 21.018 21.929 32.015 1.00 6.59  ? 515 THR C OG1 1 
ATOM   3876 C CG2 . THR B 1 215 ? 20.189 20.784 30.081 1.00 1.93  ? 515 THR C CG2 1 
ATOM   3877 N N   . HIS B 1 216 ? 20.667 19.948 34.654 1.00 5.24  ? 516 HIS C N   1 
ATOM   3878 C CA  . HIS B 1 216 ? 21.365 19.458 35.828 1.00 2.39  ? 516 HIS C CA  1 
ATOM   3879 C C   . HIS B 1 216 ? 20.703 18.124 36.206 1.00 4.26  ? 516 HIS C C   1 
ATOM   3880 O O   . HIS B 1 216 ? 21.377 17.168 36.578 1.00 4.87  ? 516 HIS C O   1 
ATOM   3881 C CB  . HIS B 1 216 ? 21.260 20.423 37.007 1.00 1.92  ? 516 HIS C CB  1 
ATOM   3882 C CG  . HIS B 1 216 ? 21.986 19.938 38.222 1.00 2.11  ? 516 HIS C CG  1 
ATOM   3883 N ND1 . HIS B 1 216 ? 23.354 19.781 38.252 1.00 7.26  ? 516 HIS C ND1 1 
ATOM   3884 C CD2 . HIS B 1 216 ? 21.533 19.489 39.416 1.00 4.30  ? 516 HIS C CD2 1 
ATOM   3885 C CE1 . HIS B 1 216 ? 23.711 19.253 39.410 1.00 5.43  ? 516 HIS C CE1 1 
ATOM   3886 N NE2 . HIS B 1 216 ? 22.626 19.065 40.135 1.00 9.24  ? 516 HIS C NE2 1 
ATOM   3887 N N   . LEU B 1 217 ? 19.377 18.069 36.103 1.00 6.34  ? 517 LEU C N   1 
ATOM   3888 C CA  . LEU B 1 217 ? 18.654 16.844 36.424 1.00 5.26  ? 517 LEU C CA  1 
ATOM   3889 C C   . LEU B 1 217 ? 19.080 15.708 35.495 1.00 7.28  ? 517 LEU C C   1 
ATOM   3890 O O   . LEU B 1 217 ? 19.314 14.580 35.943 1.00 6.96  ? 517 LEU C O   1 
ATOM   3891 C CB  . LEU B 1 217 ? 17.149 17.061 36.304 1.00 7.58  ? 517 LEU C CB  1 
ATOM   3892 C CG  . LEU B 1 217 ? 16.277 15.804 36.501 1.00 5.54  ? 517 LEU C CG  1 
ATOM   3893 C CD1 . LEU B 1 217 ? 16.465 15.251 37.923 1.00 9.39  ? 517 LEU C CD1 1 
ATOM   3894 C CD2 . LEU B 1 217 ? 14.815 16.167 36.269 1.00 10.11 ? 517 LEU C CD2 1 
ATOM   3895 N N   . VAL B 1 218 ? 19.176 15.998 34.200 1.00 4.84  ? 518 VAL C N   1 
ATOM   3896 C CA  . VAL B 1 218 ? 19.578 14.973 33.233 1.00 2.01  ? 518 VAL C CA  1 
ATOM   3897 C C   . VAL B 1 218 ? 20.956 14.415 33.557 1.00 5.11  ? 518 VAL C C   1 
ATOM   3898 O O   . VAL B 1 218 ? 21.161 13.200 33.553 1.00 3.24  ? 518 VAL C O   1 
ATOM   3899 C CB  . VAL B 1 218 ? 19.593 15.514 31.783 1.00 4.07  ? 518 VAL C CB  1 
ATOM   3900 C CG1 . VAL B 1 218 ? 20.165 14.446 30.842 1.00 1.12  ? 518 VAL C CG1 1 
ATOM   3901 C CG2 . VAL B 1 218 ? 18.174 15.883 31.352 1.00 5.50  ? 518 VAL C CG2 1 
ATOM   3902 N N   . VAL B 1 219 ? 21.902 15.303 33.835 1.00 3.47  ? 519 VAL C N   1 
ATOM   3903 C CA  . VAL B 1 219 ? 23.245 14.865 34.147 1.00 3.28  ? 519 VAL C CA  1 
ATOM   3904 C C   . VAL B 1 219 ? 23.275 14.110 35.481 1.00 4.04  ? 519 VAL C C   1 
ATOM   3905 O O   . VAL B 1 219 ? 23.988 13.119 35.621 1.00 6.04  ? 519 VAL C O   1 
ATOM   3906 C CB  . VAL B 1 219 ? 24.214 16.062 34.166 1.00 3.23  ? 519 VAL C CB  1 
ATOM   3907 C CG1 . VAL B 1 219 ? 25.574 15.640 34.692 1.00 2.56  ? 519 VAL C CG1 1 
ATOM   3908 C CG2 . VAL B 1 219 ? 24.344 16.625 32.748 1.00 5.51  ? 519 VAL C CG2 1 
ATOM   3909 N N   . GLU B 1 220 ? 22.488 14.562 36.451 1.00 4.77  ? 520 GLU C N   1 
ATOM   3910 C CA  . GLU B 1 220 ? 22.445 13.878 37.745 1.00 6.66  ? 520 GLU C CA  1 
ATOM   3911 C C   . GLU B 1 220 ? 21.824 12.485 37.565 1.00 3.81  ? 520 GLU C C   1 
ATOM   3912 O O   . GLU B 1 220 ? 22.219 11.535 38.238 1.00 5.60  ? 520 GLU C O   1 
ATOM   3913 C CB  . GLU B 1 220 ? 21.642 14.705 38.761 1.00 7.27  ? 520 GLU C CB  1 
ATOM   3914 C CG  . GLU B 1 220 ? 21.511 14.096 40.162 1.00 10.07 ? 520 GLU C CG  1 
ATOM   3915 C CD  . GLU B 1 220 ? 22.826 13.602 40.748 1.00 18.14 ? 520 GLU C CD  1 
ATOM   3916 O OE1 . GLU B 1 220 ? 23.868 14.256 40.551 1.00 19.04 ? 520 GLU C OE1 1 
ATOM   3917 O OE2 . GLU B 1 220 ? 22.809 12.553 41.425 1.00 25.96 ? 520 GLU C OE2 1 
ATOM   3918 N N   . LEU B 1 221 ? 20.863 12.356 36.651 1.00 5.01  ? 521 LEU C N   1 
ATOM   3919 C CA  . LEU B 1 221 ? 20.256 11.050 36.414 1.00 7.45  ? 521 LEU C CA  1 
ATOM   3920 C C   . LEU B 1 221 ? 21.293 10.143 35.771 1.00 7.04  ? 521 LEU C C   1 
ATOM   3921 O O   . LEU B 1 221 ? 21.362 8.949  36.081 1.00 6.76  ? 521 LEU C O   1 
ATOM   3922 C CB  . LEU B 1 221 ? 19.013 11.166 35.528 1.00 4.64  ? 521 LEU C CB  1 
ATOM   3923 C CG  . LEU B 1 221 ? 17.859 11.892 36.226 1.00 5.09  ? 521 LEU C CG  1 
ATOM   3924 C CD1 . LEU B 1 221 ? 16.689 12.024 35.266 1.00 8.55  ? 521 LEU C CD1 1 
ATOM   3925 C CD2 . LEU B 1 221 ? 17.438 11.121 37.490 1.00 11.43 ? 521 LEU C CD2 1 
ATOM   3926 N N   . MET B 1 222 ? 22.096 10.696 34.864 1.00 4.59  ? 522 MET C N   1 
ATOM   3927 C CA  . MET B 1 222 ? 23.160 9.901  34.262 1.00 6.39  ? 522 MET C CA  1 
ATOM   3928 C C   . MET B 1 222 ? 24.166 9.545  35.359 1.00 5.87  ? 522 MET C C   1 
ATOM   3929 O O   . MET B 1 222 ? 24.747 8.458  35.348 1.00 4.72  ? 522 MET C O   1 
ATOM   3930 C CB  . MET B 1 222 ? 23.870 10.673 33.144 1.00 6.83  ? 522 MET C CB  1 
ATOM   3931 C CG  . MET B 1 222 ? 23.040 10.831 31.884 1.00 8.27  ? 522 MET C CG  1 
ATOM   3932 S SD  . MET B 1 222 ? 24.015 11.381 30.472 1.00 8.28  ? 522 MET C SD  1 
ATOM   3933 C CE  . MET B 1 222 ? 24.191 13.117 30.822 1.00 5.16  ? 522 MET C CE  1 
ATOM   3934 N N   . ASN B 1 223 ? 24.365 10.459 36.307 1.00 4.67  ? 523 ASN C N   1 
ATOM   3935 C CA  . ASN B 1 223 ? 25.294 10.204 37.406 1.00 7.74  ? 523 ASN C CA  1 
ATOM   3936 C C   . ASN B 1 223 ? 24.766 9.008  38.201 1.00 9.79  ? 523 ASN C C   1 
ATOM   3937 O O   . ASN B 1 223 ? 25.543 8.209  38.713 1.00 7.12  ? 523 ASN C O   1 
ATOM   3938 C CB  . ASN B 1 223 ? 25.410 11.436 38.311 1.00 9.48  ? 523 ASN C CB  1 
ATOM   3939 C CG  . ASN B 1 223 ? 26.423 11.249 39.433 1.00 15.10 ? 523 ASN C CG  1 
ATOM   3940 O OD1 . ASN B 1 223 ? 27.483 10.650 39.239 1.00 9.77  ? 523 ASN C OD1 1 
ATOM   3941 N ND2 . ASN B 1 223 ? 26.107 11.778 40.606 1.00 19.44 ? 523 ASN C ND2 1 
ATOM   3942 N N   . GLN B 1 224 ? 23.441 8.889  38.268 1.00 9.58  ? 524 GLN C N   1 
ATOM   3943 C CA  . GLN B 1 224 ? 22.784 7.790  38.981 1.00 8.39  ? 524 GLN C CA  1 
ATOM   3944 C C   . GLN B 1 224 ? 22.712 6.493  38.175 1.00 8.99  ? 524 GLN C C   1 
ATOM   3945 O O   . GLN B 1 224 ? 22.163 5.495  38.649 1.00 10.50 ? 524 GLN C O   1 
ATOM   3946 C CB  . GLN B 1 224 ? 21.370 8.195  39.397 1.00 9.69  ? 524 GLN C CB  1 
ATOM   3947 C CG  . GLN B 1 224 ? 21.305 9.185  40.542 1.00 12.54 ? 524 GLN C CG  1 
ATOM   3948 C CD  . GLN B 1 224 ? 19.891 9.670  40.794 1.00 20.49 ? 524 GLN C CD  1 
ATOM   3949 O OE1 . GLN B 1 224 ? 18.983 8.873  41.009 1.00 23.50 ? 524 GLN C OE1 1 
ATOM   3950 N NE2 . GLN B 1 224 ? 19.697 10.987 40.766 1.00 22.77 ? 524 GLN C NE2 1 
ATOM   3951 N N   . GLY B 1 225 ? 23.240 6.511  36.953 1.00 8.55  ? 525 GLY C N   1 
ATOM   3952 C CA  . GLY B 1 225 ? 23.241 5.309  36.130 1.00 6.01  ? 525 GLY C CA  1 
ATOM   3953 C C   . GLY B 1 225 ? 22.303 5.266  34.935 1.00 5.57  ? 525 GLY C C   1 
ATOM   3954 O O   . GLY B 1 225 ? 22.319 4.307  34.167 1.00 4.81  ? 525 GLY C O   1 
ATOM   3955 N N   . ARG B 1 226 ? 21.468 6.283  34.773 1.00 6.20  ? 526 ARG C N   1 
ATOM   3956 C CA  . ARG B 1 226 ? 20.558 6.307  33.639 1.00 8.29  ? 526 ARG C CA  1 
ATOM   3957 C C   . ARG B 1 226 ? 21.353 6.493  32.352 1.00 9.57  ? 526 ARG C C   1 
ATOM   3958 O O   . ARG B 1 226 ? 22.394 7.161  32.346 1.00 8.43  ? 526 ARG C O   1 
ATOM   3959 C CB  . ARG B 1 226 ? 19.561 7.456  33.794 1.00 13.85 ? 526 ARG C CB  1 
ATOM   3960 C CG  . ARG B 1 226 ? 18.124 7.008  33.979 1.00 24.22 ? 526 ARG C CG  1 
ATOM   3961 C CD  . ARG B 1 226 ? 17.500 7.515  35.262 1.00 28.82 ? 526 ARG C CD  1 
ATOM   3962 N NE  . ARG B 1 226 ? 18.004 6.813  36.435 1.00 29.90 ? 526 ARG C NE  1 
ATOM   3963 C CZ  . ARG B 1 226 ? 17.402 6.803  37.623 1.00 22.84 ? 526 ARG C CZ  1 
ATOM   3964 N NH1 . ARG B 1 226 ? 16.263 7.454  37.814 1.00 20.86 ? 526 ARG C NH1 1 
ATOM   3965 N NH2 . ARG B 1 226 ? 17.942 6.131  38.626 1.00 14.40 ? 526 ARG C NH2 1 
ATOM   3966 N N   . THR B 1 227 ? 20.888 5.879  31.266 1.00 5.49  ? 527 THR C N   1 
ATOM   3967 C CA  . THR B 1 227 ? 21.559 6.051  29.987 1.00 6.37  ? 527 THR C CA  1 
ATOM   3968 C C   . THR B 1 227 ? 21.233 7.482  29.576 1.00 4.94  ? 527 THR C C   1 
ATOM   3969 O O   . THR B 1 227 ? 20.317 8.104  30.124 1.00 6.02  ? 527 THR C O   1 
ATOM   3970 C CB  . THR B 1 227 ? 20.988 5.122  28.902 1.00 8.06  ? 527 THR C CB  1 
ATOM   3971 O OG1 . THR B 1 227 ? 19.585 5.385  28.749 1.00 7.14  ? 527 THR C OG1 1 
ATOM   3972 C CG2 . THR B 1 227 ? 21.194 3.659  29.269 1.00 12.60 ? 527 THR C CG2 1 
ATOM   3973 N N   . PRO B 1 228 ? 21.990 8.039  28.628 1.00 4.46  ? 528 PRO C N   1 
ATOM   3974 C CA  . PRO B 1 228 ? 21.663 9.408  28.232 1.00 5.80  ? 528 PRO C CA  1 
ATOM   3975 C C   . PRO B 1 228 ? 20.198 9.543  27.793 1.00 5.80  ? 528 PRO C C   1 
ATOM   3976 O O   . PRO B 1 228 ? 19.507 10.486 28.176 1.00 2.86  ? 528 PRO C O   1 
ATOM   3977 C CB  . PRO B 1 228 ? 22.639 9.668  27.092 1.00 5.88  ? 528 PRO C CB  1 
ATOM   3978 C CG  . PRO B 1 228 ? 23.862 8.961  27.562 1.00 9.25  ? 528 PRO C CG  1 
ATOM   3979 C CD  . PRO B 1 228 ? 23.299 7.631  28.090 1.00 6.78  ? 528 PRO C CD  1 
ATOM   3980 N N   . GLN B 1 229 ? 19.723 8.593  26.995 1.00 7.25  ? 529 GLN C N   1 
ATOM   3981 C CA  . GLN B 1 229 ? 18.343 8.617  26.508 1.00 8.40  ? 529 GLN C CA  1 
ATOM   3982 C C   . GLN B 1 229 ? 17.344 8.566  27.660 1.00 8.57  ? 529 GLN C C   1 
ATOM   3983 O O   . GLN B 1 229 ? 16.382 9.336  27.717 1.00 4.66  ? 529 GLN C O   1 
ATOM   3984 C CB  . GLN B 1 229 ? 18.102 7.424  25.571 1.00 7.14  ? 529 GLN C CB  1 
ATOM   3985 C CG  . GLN B 1 229 ? 16.726 7.409  24.912 1.00 15.04 ? 529 GLN C CG  1 
ATOM   3986 C CD  . GLN B 1 229 ? 15.658 6.723  25.754 1.00 28.57 ? 529 GLN C CD  1 
ATOM   3987 O OE1 . GLN B 1 229 ? 14.477 6.733  25.397 1.00 35.13 ? 529 GLN C OE1 1 
ATOM   3988 N NE2 . GLN B 1 229 ? 16.066 6.117  26.869 1.00 26.24 ? 529 GLN C NE2 1 
ATOM   3989 N N   . GLN B 1 230 ? 17.586 7.640  28.581 1.00 8.41  ? 530 GLN C N   1 
ATOM   3990 C CA  . GLN B 1 230 ? 16.709 7.455  29.733 1.00 12.38 ? 530 GLN C CA  1 
ATOM   3991 C C   . GLN B 1 230 ? 16.713 8.688  30.641 1.00 9.48  ? 530 GLN C C   1 
ATOM   3992 O O   . GLN B 1 230 ? 15.678 9.075  31.179 1.00 6.13  ? 530 GLN C O   1 
ATOM   3993 C CB  . GLN B 1 230 ? 17.120 6.196  30.515 1.00 16.07 ? 530 GLN C CB  1 
ATOM   3994 C CG  . GLN B 1 230 ? 16.232 5.905  31.708 1.00 21.60 ? 530 GLN C CG  1 
ATOM   3995 C CD  . GLN B 1 230 ? 14.758 5.923  31.341 1.00 31.80 ? 530 GLN C CD  1 
ATOM   3996 O OE1 . GLN B 1 230 ? 14.297 5.199  30.449 1.00 22.44 ? 530 GLN C OE1 1 
ATOM   3997 N NE2 . GLN B 1 230 ? 14.019 6.767  32.004 1.00 33.18 ? 530 GLN C NE2 1 
ATOM   3998 N N   . ALA B 1 231 ? 17.883 9.291  30.810 1.00 7.64  ? 531 ALA C N   1 
ATOM   3999 C CA  . ALA B 1 231 ? 18.020 10.482 31.639 1.00 6.59  ? 531 ALA C CA  1 
ATOM   4000 C C   . ALA B 1 231 ? 17.166 11.601 31.047 1.00 6.00  ? 531 ALA C C   1 
ATOM   4001 O O   . ALA B 1 231 ? 16.443 12.295 31.761 1.00 5.75  ? 531 ALA C O   1 
ATOM   4002 C CB  . ALA B 1 231 ? 19.477 10.906 31.712 1.00 4.47  ? 531 ALA C CB  1 
ATOM   4003 N N   . CYS B 1 232 ? 17.244 11.773 29.734 1.00 5.05  ? 532 CYS C N   1 
ATOM   4004 C CA  . CYS B 1 232 ? 16.447 12.790 29.063 1.00 4.18  ? 532 CYS C CA  1 
ATOM   4005 C C   . CYS B 1 232 ? 14.963 12.473 29.197 1.00 5.69  ? 532 CYS C C   1 
ATOM   4006 O O   . CYS B 1 232 ? 14.153 13.354 29.472 1.00 7.94  ? 532 CYS C O   1 
ATOM   4007 C CB  . CYS B 1 232 ? 16.795 12.861 27.578 1.00 6.29  ? 532 CYS C CB  1 
ATOM   4008 S SG  . CYS B 1 232 ? 18.441 13.502 27.252 1.00 3.86  ? 532 CYS C SG  1 
ATOM   4009 N N   . LYS B 1 233 ? 14.612 11.210 29.000 1.00 8.58  ? 533 LYS C N   1 
ATOM   4010 C CA  . LYS B 1 233 ? 13.224 10.796 29.093 1.00 4.97  ? 533 LYS C CA  1 
ATOM   4011 C C   . LYS B 1 233 ? 12.620 11.171 30.449 1.00 10.94 ? 533 LYS C C   1 
ATOM   4012 O O   . LYS B 1 233 ? 11.571 11.808 30.519 1.00 6.85  ? 533 LYS C O   1 
ATOM   4013 C CB  . LYS B 1 233 ? 13.114 9.282  28.865 1.00 2.43  ? 533 LYS C CB  1 
ATOM   4014 C CG  . LYS B 1 233 ? 11.670 8.751  28.862 1.00 7.24  ? 533 LYS C CG  1 
ATOM   4015 C CD  . LYS B 1 233 ? 11.609 7.297  28.399 1.00 5.60  ? 533 LYS C CD  1 
ATOM   4016 C CE  . LYS B 1 233 ? 10.201 6.710  28.482 1.00 10.88 ? 533 LYS C CE  1 
ATOM   4017 N NZ  . LYS B 1 233 ? 9.721  6.560  29.882 1.00 23.19 ? 533 LYS C NZ  1 
ATOM   4018 N N   . GLU B 1 234 ? 13.290 10.775 31.524 1.00 9.96  ? 534 GLU C N   1 
ATOM   4019 C CA  . GLU B 1 234 ? 12.798 11.071 32.863 1.00 9.08  ? 534 GLU C CA  1 
ATOM   4020 C C   . GLU B 1 234 ? 12.677 12.568 33.155 1.00 8.94  ? 534 GLU C C   1 
ATOM   4021 O O   . GLU B 1 234 ? 11.754 12.992 33.852 1.00 8.40  ? 534 GLU C O   1 
ATOM   4022 C CB  . GLU B 1 234 ? 13.682 10.385 33.905 1.00 7.87  ? 534 GLU C CB  1 
ATOM   4023 C CG  . GLU B 1 234 ? 13.517 8.879  33.868 1.00 11.52 ? 534 GLU C CG  1 
ATOM   4024 C CD  . GLU B 1 234 ? 14.291 8.160  34.946 1.00 16.41 ? 534 GLU C CD  1 
ATOM   4025 O OE1 . GLU B 1 234 ? 14.470 8.742  36.037 1.00 13.21 ? 534 GLU C OE1 1 
ATOM   4026 O OE2 . GLU B 1 234 ? 14.705 7.002  34.704 1.00 12.34 ? 534 GLU C OE2 1 
ATOM   4027 N N   . ALA B 1 235 ? 13.601 13.364 32.627 1.00 9.29  ? 535 ALA C N   1 
ATOM   4028 C CA  . ALA B 1 235 ? 13.549 14.808 32.832 1.00 10.11 ? 535 ALA C CA  1 
ATOM   4029 C C   . ALA B 1 235 ? 12.318 15.373 32.124 1.00 9.10  ? 535 ALA C C   1 
ATOM   4030 O O   . ALA B 1 235 ? 11.670 16.298 32.618 1.00 7.29  ? 535 ALA C O   1 
ATOM   4031 C CB  . ALA B 1 235 ? 14.806 15.468 32.299 1.00 6.35  ? 535 ALA C CB  1 
ATOM   4032 N N   . VAL B 1 236 ? 12.007 14.826 30.953 1.00 6.78  ? 536 VAL C N   1 
ATOM   4033 C CA  . VAL B 1 236 ? 10.827 15.264 30.214 1.00 11.42 ? 536 VAL C CA  1 
ATOM   4034 C C   . VAL B 1 236 ? 9.585  14.886 31.006 1.00 6.39  ? 536 VAL C C   1 
ATOM   4035 O O   . VAL B 1 236 ? 8.638  15.670 31.136 1.00 7.59  ? 536 VAL C O   1 
ATOM   4036 C CB  . VAL B 1 236 ? 10.729 14.589 28.831 1.00 6.19  ? 536 VAL C CB  1 
ATOM   4037 C CG1 . VAL B 1 236 ? 9.309  14.721 28.280 1.00 7.89  ? 536 VAL C CG1 1 
ATOM   4038 C CG2 . VAL B 1 236 ? 11.712 15.240 27.872 1.00 10.80 ? 536 VAL C CG2 1 
ATOM   4039 N N   . GLU B 1 237 ? 9.596  13.676 31.539 1.00 7.67  ? 537 GLU C N   1 
ATOM   4040 C CA  . GLU B 1 237 ? 8.463  13.191 32.307 1.00 7.26  ? 537 GLU C CA  1 
ATOM   4041 C C   . GLU B 1 237 ? 8.247  14.018 33.572 1.00 7.96  ? 537 GLU C C   1 
ATOM   4042 O O   . GLU B 1 237 ? 7.115  14.204 34.012 1.00 4.23  ? 537 GLU C O   1 
ATOM   4043 C CB  . GLU B 1 237 ? 8.667  11.708 32.621 1.00 7.96  ? 537 GLU C CB  1 
ATOM   4044 C CG  . GLU B 1 237 ? 8.494  10.848 31.371 1.00 12.29 ? 537 GLU C CG  1 
ATOM   4045 C CD  . GLU B 1 237 ? 8.933  9.411  31.545 1.00 15.70 ? 537 GLU C CD  1 
ATOM   4046 O OE1 . GLU B 1 237 ? 8.639  8.604  30.635 1.00 11.54 ? 537 GLU C OE1 1 
ATOM   4047 O OE2 . GLU B 1 237 ? 9.577  9.090  32.570 1.00 15.59 ? 537 GLU C OE2 1 
ATOM   4048 N N   . ARG B 1 238 ? 9.334  14.523 34.143 1.00 8.31  ? 538 ARG C N   1 
ATOM   4049 C CA  . ARG B 1 238 ? 9.240  15.348 35.338 1.00 10.17 ? 538 ARG C CA  1 
ATOM   4050 C C   . ARG B 1 238 ? 8.522  16.637 34.946 1.00 9.86  ? 538 ARG C C   1 
ATOM   4051 O O   . ARG B 1 238 ? 7.704  17.162 35.705 1.00 8.10  ? 538 ARG C O   1 
ATOM   4052 C CB  . ARG B 1 238 ? 10.640 15.660 35.873 1.00 17.32 ? 538 ARG C CB  1 
ATOM   4053 C CG  . ARG B 1 238 ? 10.690 16.085 37.333 1.00 28.63 ? 538 ARG C CG  1 
ATOM   4054 C CD  . ARG B 1 238 ? 11.649 15.192 38.114 1.00 32.70 ? 538 ARG C CD  1 
ATOM   4055 N NE  . ARG B 1 238 ? 12.382 15.943 39.131 1.00 40.55 ? 538 ARG C NE  1 
ATOM   4056 C CZ  . ARG B 1 238 ? 13.289 15.418 39.945 1.00 39.10 ? 538 ARG C CZ  1 
ATOM   4057 N NH1 . ARG B 1 238 ? 13.585 14.126 39.874 1.00 31.68 ? 538 ARG C NH1 1 
ATOM   4058 N NH2 . ARG B 1 238 ? 13.909 16.198 40.819 1.00 41.99 ? 538 ARG C NH2 1 
ATOM   4059 N N   . ILE B 1 239 ? 8.828  17.148 33.760 1.00 7.36  ? 539 ILE C N   1 
ATOM   4060 C CA  . ILE B 1 239 ? 8.163  18.359 33.289 1.00 7.67  ? 539 ILE C CA  1 
ATOM   4061 C C   . ILE B 1 239 ? 6.687  18.044 33.029 1.00 9.29  ? 539 ILE C C   1 
ATOM   4062 O O   . ILE B 1 239 ? 5.802  18.837 33.367 1.00 6.50  ? 539 ILE C O   1 
ATOM   4063 C CB  . ILE B 1 239 ? 8.811  18.900 31.990 1.00 9.69  ? 539 ILE C CB  1 
ATOM   4064 C CG1 . ILE B 1 239 ? 10.180 19.509 32.312 1.00 11.39 ? 539 ILE C CG1 1 
ATOM   4065 C CG2 . ILE B 1 239 ? 7.894  19.931 31.343 1.00 7.87  ? 539 ILE C CG2 1 
ATOM   4066 C CD1 . ILE B 1 239 ? 10.917 20.050 31.104 1.00 13.71 ? 539 ILE C CD1 1 
ATOM   4067 N N   . VAL B 1 240 ? 6.416  16.887 32.433 1.00 8.01  ? 540 VAL C N   1 
ATOM   4068 C CA  . VAL B 1 240 ? 5.035  16.494 32.154 1.00 6.77  ? 540 VAL C CA  1 
ATOM   4069 C C   . VAL B 1 240 ? 4.242  16.480 33.465 1.00 6.92  ? 540 VAL C C   1 
ATOM   4070 O O   . VAL B 1 240 ? 3.138  17.026 33.539 1.00 5.45  ? 540 VAL C O   1 
ATOM   4071 C CB  . VAL B 1 240 ? 4.964  15.095 31.481 1.00 10.21 ? 540 VAL C CB  1 
ATOM   4072 C CG1 . VAL B 1 240 ? 3.506  14.664 31.333 1.00 7.78  ? 540 VAL C CG1 1 
ATOM   4073 C CG2 . VAL B 1 240 ? 5.624  15.150 30.102 1.00 4.78  ? 540 VAL C CG2 1 
ATOM   4074 N N   . LYS B 1 241 ? 4.820  15.880 34.504 1.00 6.04  ? 541 LYS C N   1 
ATOM   4075 C CA  . LYS B 1 241 ? 4.160  15.812 35.808 1.00 8.34  ? 541 LYS C CA  1 
ATOM   4076 C C   . LYS B 1 241 ? 3.865  17.198 36.373 1.00 4.04  ? 541 LYS C C   1 
ATOM   4077 O O   . LYS B 1 241 ? 2.757  17.469 36.836 1.00 8.34  ? 541 LYS C O   1 
ATOM   4078 C CB  . LYS B 1 241 ? 5.027  15.044 36.811 1.00 10.20 ? 541 LYS C CB  1 
ATOM   4079 C CG  . LYS B 1 241 ? 4.335  14.833 38.139 1.00 18.92 ? 541 LYS C CG  1 
ATOM   4080 C CD  . LYS B 1 241 ? 5.167  13.994 39.109 1.00 31.15 ? 541 LYS C CD  1 
ATOM   4081 C CE  . LYS B 1 241 ? 6.096  14.850 39.953 1.00 32.78 ? 541 LYS C CE  1 
ATOM   4082 N NZ  . LYS B 1 241 ? 6.712  14.063 41.064 1.00 33.78 ? 541 LYS C NZ  1 
ATOM   4083 N N   . ILE B 1 242 ? 4.862  18.072 36.331 1.00 4.57  ? 542 ILE C N   1 
ATOM   4084 C CA  . ILE B 1 242 ? 4.729  19.428 36.847 1.00 7.18  ? 542 ILE C CA  1 
ATOM   4085 C C   . ILE B 1 242 ? 3.724  20.256 36.053 1.00 8.19  ? 542 ILE C C   1 
ATOM   4086 O O   . ILE B 1 242 ? 2.960  21.036 36.622 1.00 9.02  ? 542 ILE C O   1 
ATOM   4087 C CB  . ILE B 1 242 ? 6.111  20.120 36.872 1.00 12.43 ? 542 ILE C CB  1 
ATOM   4088 C CG1 . ILE B 1 242 ? 6.994  19.418 37.909 1.00 17.42 ? 542 ILE C CG1 1 
ATOM   4089 C CG2 . ILE B 1 242 ? 5.963  21.612 37.191 1.00 9.75  ? 542 ILE C CG2 1 
ATOM   4090 C CD1 . ILE B 1 242 ? 8.439  19.890 37.937 1.00 18.19 ? 542 ILE C CD1 1 
ATOM   4091 N N   . VAL B 1 243 ? 3.720  20.081 34.738 1.00 8.13  ? 543 VAL C N   1 
ATOM   4092 C CA  . VAL B 1 243 ? 2.774  20.789 33.895 1.00 4.82  ? 543 VAL C CA  1 
ATOM   4093 C C   . VAL B 1 243 ? 1.370  20.391 34.376 1.00 13.60 ? 543 VAL C C   1 
ATOM   4094 O O   . VAL B 1 243 ? 0.489  21.238 34.561 1.00 10.13 ? 543 VAL C O   1 
ATOM   4095 C CB  . VAL B 1 243 ? 3.000  20.409 32.413 1.00 5.62  ? 543 VAL C CB  1 
ATOM   4096 C CG1 . VAL B 1 243 ? 1.777  20.758 31.569 1.00 7.79  ? 543 VAL C CG1 1 
ATOM   4097 C CG2 . VAL B 1 243 ? 4.224  21.171 31.885 1.00 5.90  ? 543 VAL C CG2 1 
ATOM   4098 N N   . ASN B 1 244 ? 1.181  19.096 34.611 1.00 7.22  ? 544 ASN C N   1 
ATOM   4099 C CA  . ASN B 1 244 ? -0.096 18.589 35.090 1.00 8.07  ? 544 ASN C CA  1 
ATOM   4100 C C   . ASN B 1 244 ? -0.433 19.169 36.462 1.00 11.38 ? 544 ASN C C   1 
ATOM   4101 O O   . ASN B 1 244 ? -1.543 19.649 36.689 1.00 9.34  ? 544 ASN C O   1 
ATOM   4102 C CB  . ASN B 1 244 ? -0.062 17.060 35.184 1.00 12.23 ? 544 ASN C CB  1 
ATOM   4103 C CG  . ASN B 1 244 ? -1.233 16.501 35.974 1.00 19.54 ? 544 ASN C CG  1 
ATOM   4104 O OD1 . ASN B 1 244 ? -1.138 16.258 37.182 1.00 26.74 ? 544 ASN C OD1 1 
ATOM   4105 N ND2 . ASN B 1 244 ? -2.349 16.313 35.298 1.00 17.72 ? 544 ASN C ND2 1 
ATOM   4106 N N   . ARG B 1 245 ? 0.533  19.132 37.373 1.00 8.39  ? 545 ARG C N   1 
ATOM   4107 C CA  . ARG B 1 245 ? 0.303  19.645 38.719 1.00 10.64 ? 545 ARG C CA  1 
ATOM   4108 C C   . ARG B 1 245 ? 0.004  21.131 38.746 1.00 6.76  ? 545 ARG C C   1 
ATOM   4109 O O   . ARG B 1 245 ? -0.675 21.607 39.650 1.00 7.13  ? 545 ARG C O   1 
ATOM   4110 C CB  . ARG B 1 245 ? 1.498  19.307 39.613 1.00 14.94 ? 545 ARG C CB  1 
ATOM   4111 C CG  . ARG B 1 245 ? 1.482  17.840 40.037 1.00 27.17 ? 545 ARG C CG  1 
ATOM   4112 C CD  . ARG B 1 245 ? 2.792  17.375 40.655 1.00 38.19 ? 545 ARG C CD  1 
ATOM   4113 N NE  . ARG B 1 245 ? 2.682  16.035 41.241 1.00 44.55 ? 545 ARG C NE  1 
ATOM   4114 C CZ  . ARG B 1 245 ? 2.181  14.967 40.620 1.00 50.39 ? 545 ARG C CZ  1 
ATOM   4115 N NH1 . ARG B 1 245 ? 1.726  15.057 39.376 1.00 50.21 ? 545 ARG C NH1 1 
ATOM   4116 N NH2 . ARG B 1 245 ? 2.141  13.798 41.244 1.00 49.62 ? 545 ARG C NH2 1 
ATOM   4117 N N   . ARG B 1 246 ? 0.489  21.859 37.743 1.00 4.08  ? 546 ARG C N   1 
ATOM   4118 C CA  . ARG B 1 246 ? 0.244  23.297 37.672 1.00 7.59  ? 546 ARG C CA  1 
ATOM   4119 C C   . ARG B 1 246 ? -1.051 23.610 36.924 1.00 9.07  ? 546 ARG C C   1 
ATOM   4120 O O   . ARG B 1 246 ? -1.398 24.771 36.715 1.00 6.55  ? 546 ARG C O   1 
ATOM   4121 C CB  . ARG B 1 246 ? 1.429  23.998 36.999 1.00 8.56  ? 546 ARG C CB  1 
ATOM   4122 C CG  . ARG B 1 246 ? 2.738  23.851 37.775 1.00 8.56  ? 546 ARG C CG  1 
ATOM   4123 C CD  . ARG B 1 246 ? 3.862  24.706 37.188 1.00 5.47  ? 546 ARG C CD  1 
ATOM   4124 N NE  . ARG B 1 246 ? 3.557  26.131 37.280 1.00 3.78  ? 546 ARG C NE  1 
ATOM   4125 C CZ  . ARG B 1 246 ? 3.376  26.930 36.235 1.00 7.24  ? 546 ARG C CZ  1 
ATOM   4126 N NH1 . ARG B 1 246 ? 3.471  26.446 35.002 1.00 8.87  ? 546 ARG C NH1 1 
ATOM   4127 N NH2 . ARG B 1 246 ? 3.091  28.217 36.423 1.00 9.16  ? 546 ARG C NH2 1 
ATOM   4128 N N   . GLY B 1 247 ? -1.770 22.565 36.530 1.00 10.52 ? 547 GLY C N   1 
ATOM   4129 C CA  . GLY B 1 247 ? -3.027 22.760 35.816 1.00 12.02 ? 547 GLY C CA  1 
ATOM   4130 C C   . GLY B 1 247 ? -2.883 23.352 34.426 1.00 10.70 ? 547 GLY C C   1 
ATOM   4131 O O   . GLY B 1 247 ? -3.768 24.067 33.943 1.00 10.52 ? 547 GLY C O   1 
ATOM   4132 N N   . LYS B 1 248 ? -1.764 23.067 33.771 1.00 7.19  ? 548 LYS C N   1 
ATOM   4133 C CA  . LYS B 1 248 ? -1.539 23.575 32.428 1.00 6.40  ? 548 LYS C CA  1 
ATOM   4134 C C   . LYS B 1 248 ? -1.759 22.443 31.433 1.00 9.57  ? 548 LYS C C   1 
ATOM   4135 O O   . LYS B 1 248 ? -1.874 21.286 31.824 1.00 8.94  ? 548 LYS C O   1 
ATOM   4136 C CB  . LYS B 1 248 ? -0.116 24.122 32.294 1.00 6.57  ? 548 LYS C CB  1 
ATOM   4137 C CG  . LYS B 1 248 ? 0.219  25.222 33.289 1.00 13.94 ? 548 LYS C CG  1 
ATOM   4138 C CD  . LYS B 1 248 ? -0.761 26.384 33.199 1.00 20.62 ? 548 LYS C CD  1 
ATOM   4139 C CE  . LYS B 1 248 ? -0.353 27.515 34.145 1.00 22.42 ? 548 LYS C CE  1 
ATOM   4140 N NZ  . LYS B 1 248 ? -1.260 28.688 34.013 1.00 27.77 ? 548 LYS C NZ  1 
ATOM   4141 N N   . ASN B 1 249 ? -1.817 22.784 30.150 1.00 9.62  ? 549 ASN C N   1 
ATOM   4142 C CA  . ASN B 1 249 ? -2.031 21.785 29.110 1.00 9.60  ? 549 ASN C CA  1 
ATOM   4143 C C   . ASN B 1 249 ? -0.719 21.490 28.388 1.00 8.82  ? 549 ASN C C   1 
ATOM   4144 O O   . ASN B 1 249 ? -0.110 22.382 27.794 1.00 8.44  ? 549 ASN C O   1 
ATOM   4145 C CB  . ASN B 1 249 ? -3.071 22.281 28.103 1.00 8.26  ? 549 ASN C CB  1 
ATOM   4146 C CG  . ASN B 1 249 ? -3.544 21.184 27.173 1.00 10.73 ? 549 ASN C CG  1 
ATOM   4147 O OD1 . ASN B 1 249 ? -2.741 20.447 26.612 1.00 5.50  ? 549 ASN C OD1 1 
ATOM   4148 N ND2 . ASN B 1 249 ? -4.854 21.074 27.006 1.00 7.55  ? 549 ASN C ND2 1 
ATOM   4149 N N   . LEU B 1 250 ? -0.302 20.231 28.427 1.00 11.85 ? 550 LEU C N   1 
ATOM   4150 C CA  . LEU B 1 250 ? 0.947  19.802 27.810 1.00 11.31 ? 550 LEU C CA  1 
ATOM   4151 C C   . LEU B 1 250 ? 1.078  20.141 26.326 1.00 12.14 ? 550 LEU C C   1 
ATOM   4152 O O   . LEU B 1 250 ? 2.189  20.254 25.812 1.00 10.48 ? 550 LEU C O   1 
ATOM   4153 C CB  . LEU B 1 250 ? 1.122  18.292 28.001 1.00 11.29 ? 550 LEU C CB  1 
ATOM   4154 C CG  . LEU B 1 250 ? 2.537  17.734 27.788 1.00 10.61 ? 550 LEU C CG  1 
ATOM   4155 C CD1 . LEU B 1 250 ? 3.488  18.340 28.809 1.00 7.65  ? 550 LEU C CD1 1 
ATOM   4156 C CD2 . LEU B 1 250 ? 2.513  16.208 27.922 1.00 11.99 ? 550 LEU C CD2 1 
ATOM   4157 N N   . LYS B 1 251 ? -0.047 20.297 25.634 1.00 11.06 ? 551 LYS C N   1 
ATOM   4158 C CA  . LYS B 1 251 ? -0.004 20.617 24.212 1.00 9.90  ? 551 LYS C CA  1 
ATOM   4159 C C   . LYS B 1 251 ? 0.644  21.978 23.963 1.00 8.10  ? 551 LYS C C   1 
ATOM   4160 O O   . LYS B 1 251 ? 1.188  22.230 22.891 1.00 8.53  ? 551 LYS C O   1 
ATOM   4161 C CB  . LYS B 1 251 ? -1.419 20.609 23.617 1.00 10.80 ? 551 LYS C CB  1 
ATOM   4162 C CG  . LYS B 1 251 ? -1.454 20.507 22.095 1.00 12.26 ? 551 LYS C CG  1 
ATOM   4163 C CD  . LYS B 1 251 ? -0.910 19.157 21.643 1.00 12.43 ? 551 LYS C CD  1 
ATOM   4164 C CE  . LYS B 1 251 ? -1.052 18.951 20.143 1.00 21.40 ? 551 LYS C CE  1 
ATOM   4165 N NZ  . LYS B 1 251 ? -0.778 17.523 19.761 1.00 20.12 ? 551 LYS C NZ  1 
ATOM   4166 N N   . ASP B 1 252 ? 0.594  22.856 24.958 1.00 8.90  ? 552 ASP C N   1 
ATOM   4167 C CA  . ASP B 1 252 ? 1.167  24.193 24.808 1.00 8.98  ? 552 ASP C CA  1 
ATOM   4168 C C   . ASP B 1 252 ? 2.653  24.229 25.117 1.00 8.61  ? 552 ASP C C   1 
ATOM   4169 O O   . ASP B 1 252 ? 3.291  25.276 24.994 1.00 10.65 ? 552 ASP C O   1 
ATOM   4170 C CB  . ASP B 1 252 ? 0.450  25.181 25.730 1.00 12.18 ? 552 ASP C CB  1 
ATOM   4171 C CG  . ASP B 1 252 ? -1.060 25.175 25.536 1.00 13.75 ? 552 ASP C CG  1 
ATOM   4172 O OD1 . ASP B 1 252 ? -1.510 25.181 24.371 1.00 13.87 ? 552 ASP C OD1 1 
ATOM   4173 O OD2 . ASP B 1 252 ? -1.791 25.173 26.548 1.00 12.74 ? 552 ASP C OD2 1 
ATOM   4174 N N   . ILE B 1 253 ? 3.208  23.086 25.503 1.00 8.64  ? 553 ILE C N   1 
ATOM   4175 C CA  . ILE B 1 253 ? 4.615  23.030 25.882 1.00 7.53  ? 553 ILE C CA  1 
ATOM   4176 C C   . ILE B 1 253 ? 5.488  22.097 25.061 1.00 7.96  ? 553 ILE C C   1 
ATOM   4177 O O   . ILE B 1 253 ? 5.089  20.980 24.763 1.00 7.71  ? 553 ILE C O   1 
ATOM   4178 C CB  . ILE B 1 253 ? 4.733  22.612 27.366 1.00 10.50 ? 553 ILE C CB  1 
ATOM   4179 C CG1 . ILE B 1 253 ? 3.815  23.508 28.209 1.00 13.54 ? 553 ILE C CG1 1 
ATOM   4180 C CG2 . ILE B 1 253 ? 6.187  22.674 27.813 1.00 14.20 ? 553 ILE C CG2 1 
ATOM   4181 C CD1 . ILE B 1 253 ? 4.423  24.050 29.477 1.00 29.51 ? 553 ILE C CD1 1 
ATOM   4182 N N   . GLN B 1 254 ? 6.671  22.575 24.674 1.00 7.44  ? 554 GLN C N   1 
ATOM   4183 C CA  . GLN B 1 254 ? 7.631  21.742 23.953 1.00 8.67  ? 554 GLN C CA  1 
ATOM   4184 C C   . GLN B 1 254 ? 9.013  21.952 24.547 1.00 10.64 ? 554 GLN C C   1 
ATOM   4185 O O   . GLN B 1 254 ? 9.492  23.076 24.687 1.00 10.96 ? 554 GLN C O   1 
ATOM   4186 C CB  . GLN B 1 254 ? 7.674  22.059 22.460 1.00 8.30  ? 554 GLN C CB  1 
ATOM   4187 C CG  . GLN B 1 254 ? 8.804  21.332 21.701 1.00 8.62  ? 554 GLN C CG  1 
ATOM   4188 C CD  . GLN B 1 254 ? 8.674  19.806 21.691 1.00 11.46 ? 554 GLN C CD  1 
ATOM   4189 O OE1 . GLN B 1 254 ? 8.576  19.170 22.742 1.00 9.60  ? 554 GLN C OE1 1 
ATOM   4190 N NE2 . GLN B 1 254 ? 8.692  19.213 20.494 1.00 6.25  ? 554 GLN C NE2 1 
ATOM   4191 N N   . VAL B 1 255 ? 9.634  20.848 24.922 1.00 7.80  ? 555 VAL C N   1 
ATOM   4192 C CA  . VAL B 1 255 ? 10.970 20.880 25.473 1.00 5.96  ? 555 VAL C CA  1 
ATOM   4193 C C   . VAL B 1 255 ? 11.654 19.631 24.981 1.00 10.35 ? 555 VAL C C   1 
ATOM   4194 O O   . VAL B 1 255 ? 11.044 18.556 24.896 1.00 5.48  ? 555 VAL C O   1 
ATOM   4195 C CB  . VAL B 1 255 ? 10.991 20.846 27.008 1.00 6.64  ? 555 VAL C CB  1 
ATOM   4196 C CG1 . VAL B 1 255 ? 12.435 20.696 27.486 1.00 7.85  ? 555 VAL C CG1 1 
ATOM   4197 C CG2 . VAL B 1 255 ? 10.381 22.121 27.579 1.00 12.24 ? 555 VAL C CG2 1 
ATOM   4198 N N   . GLY B 1 256 ? 12.916 19.787 24.624 1.00 8.13  ? 556 GLY C N   1 
ATOM   4199 C CA  . GLY B 1 256 ? 13.689 18.650 24.184 1.00 8.88  ? 556 GLY C CA  1 
ATOM   4200 C C   . GLY B 1 256 ? 15.024 18.685 24.902 1.00 11.95 ? 556 GLY C C   1 
ATOM   4201 O O   . GLY B 1 256 ? 15.557 19.767 25.155 1.00 7.74  ? 556 GLY C O   1 
ATOM   4202 N N   . PHE B 1 257 ? 15.528 17.518 25.294 1.00 7.11  ? 557 PHE C N   1 
ATOM   4203 C CA  . PHE B 1 257 ? 16.845 17.431 25.917 1.00 6.20  ? 557 PHE C CA  1 
ATOM   4204 C C   . PHE B 1 257 ? 17.663 16.476 25.061 1.00 5.99  ? 557 PHE C C   1 
ATOM   4205 O O   . PHE B 1 257 ? 17.131 15.518 24.497 1.00 4.26  ? 557 PHE C O   1 
ATOM   4206 C CB  . PHE B 1 257 ? 16.808 16.825 27.328 1.00 5.05  ? 557 PHE C CB  1 
ATOM   4207 C CG  . PHE B 1 257 ? 16.104 17.666 28.355 1.00 6.92  ? 557 PHE C CG  1 
ATOM   4208 C CD1 . PHE B 1 257 ? 14.837 17.308 28.797 1.00 10.30 ? 557 PHE C CD1 1 
ATOM   4209 C CD2 . PHE B 1 257 ? 16.725 18.780 28.920 1.00 7.88  ? 557 PHE C CD2 1 
ATOM   4210 C CE1 . PHE B 1 257 ? 14.189 18.042 29.789 1.00 12.08 ? 557 PHE C CE1 1 
ATOM   4211 C CE2 . PHE B 1 257 ? 16.085 19.522 29.914 1.00 6.56  ? 557 PHE C CE2 1 
ATOM   4212 C CZ  . PHE B 1 257 ? 14.814 19.147 30.350 1.00 9.94  ? 557 PHE C CZ  1 
ATOM   4213 N N   . ILE B 1 258 ? 18.950 16.761 24.931 1.00 2.70  ? 558 ILE C N   1 
ATOM   4214 C CA  . ILE B 1 258 ? 19.841 15.853 24.228 1.00 5.33  ? 558 ILE C CA  1 
ATOM   4215 C C   . ILE B 1 258 ? 20.945 15.678 25.261 1.00 5.54  ? 558 ILE C C   1 
ATOM   4216 O O   . ILE B 1 258 ? 21.258 16.615 26.002 1.00 5.24  ? 558 ILE C O   1 
ATOM   4217 C CB  . ILE B 1 258 ? 20.409 16.439 22.920 1.00 7.17  ? 558 ILE C CB  1 
ATOM   4218 C CG1 . ILE B 1 258 ? 21.079 17.786 23.181 1.00 7.42  ? 558 ILE C CG1 1 
ATOM   4219 C CG2 . ILE B 1 258 ? 19.303 16.575 21.892 1.00 3.57  ? 558 ILE C CG2 1 
ATOM   4220 C CD1 . ILE B 1 258 ? 21.710 18.381 21.932 1.00 8.00  ? 558 ILE C CD1 1 
ATOM   4221 N N   . ALA B 1 259 ? 21.512 14.482 25.335 1.00 3.32  ? 559 ALA C N   1 
ATOM   4222 C CA  . ALA B 1 259 ? 22.541 14.218 26.320 1.00 3.41  ? 559 ALA C CA  1 
ATOM   4223 C C   . ALA B 1 259 ? 23.625 13.324 25.791 1.00 3.50  ? 559 ALA C C   1 
ATOM   4224 O O   . ALA B 1 259 ? 23.428 12.553 24.841 1.00 4.60  ? 559 ALA C O   1 
ATOM   4225 C CB  . ALA B 1 259 ? 21.934 13.616 27.571 1.00 6.06  ? 559 ALA C CB  1 
ATOM   4226 N N   . LEU B 1 260 ? 24.773 13.414 26.443 1.00 3.49  ? 560 LEU C N   1 
ATOM   4227 C CA  . LEU B 1 260 ? 25.947 12.659 26.044 1.00 7.08  ? 560 LEU C CA  1 
ATOM   4228 C C   . LEU B 1 260 ? 26.681 12.262 27.321 1.00 10.40 ? 560 LEU C C   1 
ATOM   4229 O O   . LEU B 1 260 ? 26.776 13.067 28.239 1.00 9.65  ? 560 LEU C O   1 
ATOM   4230 C CB  . LEU B 1 260 ? 26.805 13.591 25.188 1.00 8.97  ? 560 LEU C CB  1 
ATOM   4231 C CG  . LEU B 1 260 ? 28.021 13.175 24.376 1.00 13.35 ? 560 LEU C CG  1 
ATOM   4232 C CD1 . LEU B 1 260 ? 27.634 12.146 23.322 1.00 4.13  ? 560 LEU C CD1 1 
ATOM   4233 C CD2 . LEU B 1 260 ? 28.580 14.431 23.714 1.00 14.02 ? 560 LEU C CD2 1 
ATOM   4234 N N   . ASN B 1 261 ? 27.168 11.027 27.416 1.00 7.65  ? 561 ASN C N   1 
ATOM   4235 C CA  . ASN B 1 261 ? 27.922 10.669 28.609 1.00 5.35  ? 561 ASN C CA  1 
ATOM   4236 C C   . ASN B 1 261 ? 29.404 10.560 28.255 1.00 10.89 ? 561 ASN C C   1 
ATOM   4237 O O   . ASN B 1 261 ? 29.782 10.757 27.102 1.00 10.75 ? 561 ASN C O   1 
ATOM   4238 C CB  . ASN B 1 261 ? 27.403 9.379  29.277 1.00 6.36  ? 561 ASN C CB  1 
ATOM   4239 C CG  . ASN B 1 261 ? 27.585 8.143  28.420 1.00 4.75  ? 561 ASN C CG  1 
ATOM   4240 O OD1 . ASN B 1 261 ? 28.444 8.099  27.534 1.00 5.63  ? 561 ASN C OD1 1 
ATOM   4241 N ND2 . ASN B 1 261 ? 26.784 7.112  28.701 1.00 7.99  ? 561 ASN C ND2 1 
ATOM   4242 N N   . LYS B 1 262 ? 30.234 10.262 29.251 1.00 7.70  ? 562 LYS C N   1 
ATOM   4243 C CA  . LYS B 1 262 ? 31.679 10.181 29.065 1.00 13.70 ? 562 LYS C CA  1 
ATOM   4244 C C   . LYS B 1 262 ? 32.143 9.121  28.058 1.00 10.78 ? 562 LYS C C   1 
ATOM   4245 O O   . LYS B 1 262 ? 33.249 9.217  27.518 1.00 11.46 ? 562 LYS C O   1 
ATOM   4246 C CB  . LYS B 1 262 ? 32.341 9.948  30.429 1.00 14.03 ? 562 LYS C CB  1 
ATOM   4247 C CG  . LYS B 1 262 ? 33.851 10.112 30.465 1.00 29.25 ? 562 LYS C CG  1 
ATOM   4248 C CD  . LYS B 1 262 ? 34.265 11.578 30.441 1.00 36.90 ? 562 LYS C CD  1 
ATOM   4249 C CE  . LYS B 1 262 ? 35.738 11.732 30.787 1.00 40.66 ? 562 LYS C CE  1 
ATOM   4250 N NZ  . LYS B 1 262 ? 36.136 13.163 30.869 1.00 43.84 ? 562 LYS C NZ  1 
ATOM   4251 N N   . LYS B 1 263 ? 31.316 8.109  27.806 1.00 11.04 ? 563 LYS C N   1 
ATOM   4252 C CA  . LYS B 1 263 ? 31.683 7.063  26.847 1.00 7.87  ? 563 LYS C CA  1 
ATOM   4253 C C   . LYS B 1 263 ? 31.236 7.407  25.434 1.00 11.07 ? 563 LYS C C   1 
ATOM   4254 O O   . LYS B 1 263 ? 31.418 6.627  24.492 1.00 10.13 ? 563 LYS C O   1 
ATOM   4255 C CB  . LYS B 1 263 ? 31.076 5.712  27.254 1.00 7.02  ? 563 LYS C CB  1 
ATOM   4256 C CG  . LYS B 1 263 ? 31.571 5.182  28.593 1.00 14.64 ? 563 LYS C CG  1 
ATOM   4257 C CD  . LYS B 1 263 ? 30.846 3.901  28.993 1.00 19.96 ? 563 LYS C CD  1 
ATOM   4258 C CE  . LYS B 1 263 ? 31.046 2.794  27.970 0.00 17.62 ? 563 LYS C CE  1 
ATOM   4259 N NZ  . LYS B 1 263 ? 30.316 1.554  28.353 0.00 17.54 ? 563 LYS C NZ  1 
ATOM   4260 N N   . GLY B 1 264 ? 30.644 8.580  25.275 1.00 8.73  ? 564 GLY C N   1 
ATOM   4261 C CA  . GLY B 1 264 ? 30.198 8.973  23.952 1.00 3.78  ? 564 GLY C CA  1 
ATOM   4262 C C   . GLY B 1 264 ? 28.827 8.451  23.582 1.00 5.46  ? 564 GLY C C   1 
ATOM   4263 O O   . GLY B 1 264 ? 28.408 8.571  22.430 1.00 3.92  ? 564 GLY C O   1 
ATOM   4264 N N   . GLU B 1 265 ? 28.132 7.850  24.543 1.00 3.56  ? 565 GLU C N   1 
ATOM   4265 C CA  . GLU B 1 265 ? 26.785 7.356  24.289 1.00 7.31  ? 565 GLU C CA  1 
ATOM   4266 C C   . GLU B 1 265 ? 25.919 8.599  24.321 1.00 5.83  ? 565 GLU C C   1 
ATOM   4267 O O   . GLU B 1 265 ? 26.233 9.556  25.024 1.00 6.72  ? 565 GLU C O   1 
ATOM   4268 C CB  . GLU B 1 265 ? 26.358 6.376  25.380 1.00 5.32  ? 565 GLU C CB  1 
ATOM   4269 C CG  . GLU B 1 265 ? 27.307 5.196  25.457 1.00 12.43 ? 565 GLU C CG  1 
ATOM   4270 C CD  . GLU B 1 265 ? 26.963 4.215  26.546 1.00 20.38 ? 565 GLU C CD  1 
ATOM   4271 O OE1 . GLU B 1 265 ? 26.764 4.647  27.692 1.00 15.73 ? 565 GLU C OE1 1 
ATOM   4272 O OE2 . GLU B 1 265 ? 26.914 3.007  26.251 1.00 23.33 ? 565 GLU C OE2 1 
ATOM   4273 N N   . TYR B 1 266 ? 24.823 8.591  23.576 1.00 5.35  ? 566 TYR C N   1 
ATOM   4274 C CA  . TYR B 1 266 ? 23.989 9.774  23.543 1.00 5.56  ? 566 TYR C CA  1 
ATOM   4275 C C   . TYR B 1 266 ? 22.520 9.434  23.514 1.00 8.45  ? 566 TYR C C   1 
ATOM   4276 O O   . TYR B 1 266 ? 22.129 8.289  23.292 1.00 6.84  ? 566 TYR C O   1 
ATOM   4277 C CB  . TYR B 1 266 ? 24.354 10.616 22.322 1.00 5.61  ? 566 TYR C CB  1 
ATOM   4278 C CG  . TYR B 1 266 ? 24.059 9.934  20.997 1.00 3.83  ? 566 TYR C CG  1 
ATOM   4279 C CD1 . TYR B 1 266 ? 22.802 10.044 20.393 1.00 6.77  ? 566 TYR C CD1 1 
ATOM   4280 C CD2 . TYR B 1 266 ? 25.038 9.191  20.343 1.00 6.01  ? 566 TYR C CD2 1 
ATOM   4281 C CE1 . TYR B 1 266 ? 22.529 9.428  19.155 1.00 7.80  ? 566 TYR C CE1 1 
ATOM   4282 C CE2 . TYR B 1 266 ? 24.778 8.570  19.110 1.00 9.59  ? 566 TYR C CE2 1 
ATOM   4283 C CZ  . TYR B 1 266 ? 23.525 8.696  18.526 1.00 11.65 ? 566 TYR C CZ  1 
ATOM   4284 O OH  . TYR B 1 266 ? 23.279 8.088  17.310 1.00 11.55 ? 566 TYR C OH  1 
ATOM   4285 N N   . GLY B 1 267 ? 21.696 10.446 23.730 1.00 6.76  ? 567 GLY C N   1 
ATOM   4286 C CA  . GLY B 1 267 ? 20.273 10.212 23.724 1.00 9.86  ? 567 GLY C CA  1 
ATOM   4287 C C   . GLY B 1 267 ? 19.529 11.520 23.729 1.00 10.12 ? 567 GLY C C   1 
ATOM   4288 O O   . GLY B 1 267 ? 20.119 12.598 23.827 1.00 5.98  ? 567 GLY C O   1 
ATOM   4289 N N   . ALA B 1 268 ? 18.217 11.415 23.637 1.00 6.46  ? 568 ALA C N   1 
ATOM   4290 C CA  . ALA B 1 268 ? 17.374 12.583 23.621 1.00 4.62  ? 568 ALA C CA  1 
ATOM   4291 C C   . ALA B 1 268 ? 15.937 12.158 23.871 1.00 6.14  ? 568 ALA C C   1 
ATOM   4292 O O   . ALA B 1 268 ? 15.582 10.987 23.732 1.00 5.43  ? 568 ALA C O   1 
ATOM   4293 C CB  . ALA B 1 268 ? 17.480 13.271 22.267 1.00 1.59  ? 568 ALA C CB  1 
ATOM   4294 N N   . TYR B 1 269 ? 15.114 13.127 24.236 1.00 4.31  ? 569 TYR C N   1 
ATOM   4295 C CA  . TYR B 1 269 ? 13.703 12.877 24.470 1.00 6.54  ? 569 TYR C CA  1 
ATOM   4296 C C   . TYR B 1 269 ? 13.059 14.256 24.471 1.00 9.58  ? 569 TYR C C   1 
ATOM   4297 O O   . TYR B 1 269 ? 13.721 15.251 24.763 1.00 10.32 ? 569 TYR C O   1 
ATOM   4298 C CB  . TYR B 1 269 ? 13.489 12.172 25.811 1.00 8.53  ? 569 TYR C CB  1 
ATOM   4299 C CG  . TYR B 1 269 ? 12.265 11.277 25.834 1.00 8.11  ? 569 TYR C CG  1 
ATOM   4300 C CD1 . TYR B 1 269 ? 12.291 10.006 25.250 1.00 7.76  ? 569 TYR C CD1 1 
ATOM   4301 C CD2 . TYR B 1 269 ? 11.074 11.709 26.420 1.00 10.06 ? 569 TYR C CD2 1 
ATOM   4302 C CE1 . TYR B 1 269 ? 11.153 9.184  25.250 1.00 9.80  ? 569 TYR C CE1 1 
ATOM   4303 C CE2 . TYR B 1 269 ? 9.932  10.897 26.422 1.00 13.90 ? 569 TYR C CE2 1 
ATOM   4304 C CZ  . TYR B 1 269 ? 9.984  9.640  25.836 1.00 14.52 ? 569 TYR C CZ  1 
ATOM   4305 O OH  . TYR B 1 269 ? 8.863  8.840  25.838 1.00 17.67 ? 569 TYR C OH  1 
ATOM   4306 N N   . CYS B 1 270 ? 11.783 14.323 24.124 1.00 6.77  ? 570 CYS C N   1 
ATOM   4307 C CA  . CYS B 1 270 ? 11.086 15.596 24.085 1.00 8.12  ? 570 CYS C CA  1 
ATOM   4308 C C   . CYS B 1 270 ? 9.623  15.415 24.481 1.00 6.13  ? 570 CYS C C   1 
ATOM   4309 O O   . CYS B 1 270 ? 9.141  14.291 24.613 1.00 6.48  ? 570 CYS C O   1 
ATOM   4310 C CB  . CYS B 1 270 ? 11.191 16.189 22.679 1.00 6.55  ? 570 CYS C CB  1 
ATOM   4311 S SG  . CYS B 1 270 ? 10.591 15.089 21.351 1.00 9.28  ? 570 CYS C SG  1 
ATOM   4312 N N   . ILE B 1 271 ? 8.916  16.521 24.664 1.00 7.81  ? 571 ILE C N   1 
ATOM   4313 C CA  . ILE B 1 271 ? 7.516  16.450 25.049 1.00 8.60  ? 571 ILE C CA  1 
ATOM   4314 C C   . ILE B 1 271 ? 6.630  16.101 23.866 1.00 9.09  ? 571 ILE C C   1 
ATOM   4315 O O   . ILE B 1 271 ? 5.786  15.198 23.952 1.00 8.92  ? 571 ILE C O   1 
ATOM   4316 C CB  . ILE B 1 271 ? 7.028  17.788 25.637 1.00 8.70  ? 571 ILE C CB  1 
ATOM   4317 C CG1 . ILE B 1 271 ? 7.753  18.072 26.948 1.00 5.10  ? 571 ILE C CG1 1 
ATOM   4318 C CG2 . ILE B 1 271 ? 5.505  17.736 25.858 1.00 11.71 ? 571 ILE C CG2 1 
ATOM   4319 C CD1 . ILE B 1 271 ? 7.386  19.422 27.582 1.00 7.91  ? 571 ILE C CD1 1 
ATOM   4320 N N   . GLN B 1 272 ? 6.828  16.815 22.762 1.00 6.93  ? 572 GLN C N   1 
ATOM   4321 C CA  . GLN B 1 272 ? 6.022  16.604 21.568 1.00 10.53 ? 572 GLN C CA  1 
ATOM   4322 C C   . GLN B 1 272 ? 6.809  16.155 20.349 1.00 13.11 ? 572 GLN C C   1 
ATOM   4323 O O   . GLN B 1 272 ? 7.949  16.560 20.149 1.00 9.61  ? 572 GLN C O   1 
ATOM   4324 C CB  . GLN B 1 272 ? 5.245  17.878 21.235 1.00 9.36  ? 572 GLN C CB  1 
ATOM   4325 C CG  . GLN B 1 272 ? 4.382  18.355 22.384 1.00 11.77 ? 572 GLN C CG  1 
ATOM   4326 C CD  . GLN B 1 272 ? 3.369  19.390 21.956 1.00 8.31  ? 572 GLN C CD  1 
ATOM   4327 O OE1 . GLN B 1 272 ? 2.653  19.191 20.984 1.00 10.72 ? 572 GLN C OE1 1 
ATOM   4328 N NE2 . GLN B 1 272 ? 3.295  20.495 22.688 1.00 12.62 ? 572 GLN C NE2 1 
ATOM   4329 N N   . ASP B 1 273 ? 6.188  15.303 19.539 1.00 14.51 ? 573 ASP C N   1 
ATOM   4330 C CA  . ASP B 1 273 ? 6.820  14.794 18.330 1.00 21.49 ? 573 ASP C CA  1 
ATOM   4331 C C   . ASP B 1 273 ? 7.222  15.984 17.466 1.00 18.58 ? 573 ASP C C   1 
ATOM   4332 O O   . ASP B 1 273 ? 6.751  17.103 17.681 1.00 20.24 ? 573 ASP C O   1 
ATOM   4333 C CB  . ASP B 1 273 ? 5.842  13.881 17.578 1.00 31.00 ? 573 ASP C CB  1 
ATOM   4334 C CG  . ASP B 1 273 ? 6.518  13.068 16.486 1.00 46.43 ? 573 ASP C CG  1 
ATOM   4335 O OD1 . ASP B 1 273 ? 7.577  12.463 16.757 1.00 55.54 ? 573 ASP C OD1 1 
ATOM   4336 O OD2 . ASP B 1 273 ? 5.984  13.023 15.358 1.00 56.25 ? 573 ASP C OD2 1 
ATOM   4337 N N   . GLY B 1 274 ? 8.109  15.754 16.507 1.00 14.18 ? 574 GLY C N   1 
ATOM   4338 C CA  . GLY B 1 274 ? 8.538  16.837 15.641 1.00 15.13 ? 574 GLY C CA  1 
ATOM   4339 C C   . GLY B 1 274 ? 9.904  17.402 15.979 1.00 15.63 ? 574 GLY C C   1 
ATOM   4340 O O   . GLY B 1 274 ? 10.443 18.216 15.230 1.00 17.11 ? 574 GLY C O   1 
ATOM   4341 N N   . PHE B 1 275 ? 10.468 16.986 17.109 1.00 9.22  ? 575 PHE C N   1 
ATOM   4342 C CA  . PHE B 1 275 ? 11.791 17.454 17.505 1.00 6.34  ? 575 PHE C CA  1 
ATOM   4343 C C   . PHE B 1 275 ? 12.854 16.476 17.030 1.00 7.23  ? 575 PHE C C   1 
ATOM   4344 O O   . PHE B 1 275 ? 12.725 15.269 17.229 1.00 8.76  ? 575 PHE C O   1 
ATOM   4345 C CB  . PHE B 1 275 ? 11.896 17.578 19.035 1.00 4.33  ? 575 PHE C CB  1 
ATOM   4346 C CG  . PHE B 1 275 ? 13.300 17.800 19.524 1.00 7.73  ? 575 PHE C CG  1 
ATOM   4347 C CD1 . PHE B 1 275 ? 13.935 19.018 19.320 1.00 6.25  ? 575 PHE C CD1 1 
ATOM   4348 C CD2 . PHE B 1 275 ? 13.998 16.781 20.169 1.00 9.19  ? 575 PHE C CD2 1 
ATOM   4349 C CE1 . PHE B 1 275 ? 15.242 19.223 19.748 1.00 10.20 ? 575 PHE C CE1 1 
ATOM   4350 C CE2 . PHE B 1 275 ? 15.306 16.973 20.599 1.00 8.72  ? 575 PHE C CE2 1 
ATOM   4351 C CZ  . PHE B 1 275 ? 15.932 18.201 20.390 1.00 11.60 ? 575 PHE C CZ  1 
ATOM   4352 N N   . ASN B 1 276 ? 13.891 16.989 16.376 1.00 5.63  ? 576 ASN C N   1 
ATOM   4353 C CA  . ASN B 1 276 ? 14.995 16.140 15.937 1.00 5.35  ? 576 ASN C CA  1 
ATOM   4354 C C   . ASN B 1 276 ? 16.254 16.775 16.496 1.00 1.12  ? 576 ASN C C   1 
ATOM   4355 O O   . ASN B 1 276 ? 16.231 17.916 16.937 1.00 7.96  ? 576 ASN C O   1 
ATOM   4356 C CB  . ASN B 1 276 ? 15.161 16.125 14.410 1.00 5.50  ? 576 ASN C CB  1 
ATOM   4357 C CG  . ASN B 1 276 ? 13.902 15.741 13.678 1.00 9.82  ? 576 ASN C CG  1 
ATOM   4358 O OD1 . ASN B 1 276 ? 13.319 14.693 13.945 1.00 8.01  ? 576 ASN C OD1 1 
ATOM   4359 N ND2 . ASN B 1 276 ? 13.480 16.583 12.735 1.00 12.19 ? 576 ASN C ND2 1 
ATOM   4360 N N   . PHE B 1 277 ? 17.344 16.025 16.468 1.00 5.30  ? 577 PHE C N   1 
ATOM   4361 C CA  . PHE B 1 277 ? 18.633 16.542 16.883 1.00 3.22  ? 577 PHE C CA  1 
ATOM   4362 C C   . PHE B 1 277 ? 19.626 15.948 15.895 1.00 8.43  ? 577 PHE C C   1 
ATOM   4363 O O   . PHE B 1 277 ? 19.359 14.915 15.264 1.00 6.52  ? 577 PHE C O   1 
ATOM   4364 C CB  . PHE B 1 277 ? 18.965 16.162 18.336 1.00 2.67  ? 577 PHE C CB  1 
ATOM   4365 C CG  . PHE B 1 277 ? 19.132 14.692 18.552 1.00 5.24  ? 577 PHE C CG  1 
ATOM   4366 C CD1 . PHE B 1 277 ? 20.393 14.106 18.534 1.00 10.03 ? 577 PHE C CD1 1 
ATOM   4367 C CD2 . PHE B 1 277 ? 18.016 13.882 18.740 1.00 3.30  ? 577 PHE C CD2 1 
ATOM   4368 C CE1 . PHE B 1 277 ? 20.542 12.721 18.698 1.00 6.23  ? 577 PHE C CE1 1 
ATOM   4369 C CE2 . PHE B 1 277 ? 18.149 12.505 18.903 1.00 6.95  ? 577 PHE C CE2 1 
ATOM   4370 C CZ  . PHE B 1 277 ? 19.414 11.922 18.885 1.00 9.29  ? 577 PHE C CZ  1 
ATOM   4371 N N   . ALA B 1 278 ? 20.752 16.626 15.725 1.00 9.53  ? 578 ALA C N   1 
ATOM   4372 C CA  . ALA B 1 278 ? 21.774 16.169 14.803 1.00 8.49  ? 578 ALA C CA  1 
ATOM   4373 C C   . ALA B 1 278 ? 22.915 15.581 15.605 1.00 8.32  ? 578 ALA C C   1 
ATOM   4374 O O   . ALA B 1 278 ? 23.325 16.143 16.617 1.00 4.23  ? 578 ALA C O   1 
ATOM   4375 C CB  . ALA B 1 278 ? 22.271 17.335 13.954 1.00 5.00  ? 578 ALA C CB  1 
ATOM   4376 N N   . VAL B 1 279 ? 23.435 14.451 15.147 1.00 7.33  ? 579 VAL C N   1 
ATOM   4377 C CA  . VAL B 1 279 ? 24.521 13.797 15.852 1.00 6.17  ? 579 VAL C CA  1 
ATOM   4378 C C   . VAL B 1 279 ? 25.637 13.509 14.857 1.00 6.80  ? 579 VAL C C   1 
ATOM   4379 O O   . VAL B 1 279 ? 25.405 12.928 13.795 1.00 4.93  ? 579 VAL C O   1 
ATOM   4380 C CB  . VAL B 1 279 ? 24.003 12.482 16.528 1.00 11.04 ? 579 VAL C CB  1 
ATOM   4381 C CG1 . VAL B 1 279 ? 24.114 11.301 15.588 1.00 10.61 ? 579 VAL C CG1 1 
ATOM   4382 C CG2 . VAL B 1 279 ? 24.744 12.227 17.798 1.00 12.62 ? 579 VAL C CG2 1 
ATOM   4383 N N   . HIS B 1 280 ? 26.849 13.938 15.190 1.00 6.98  ? 580 HIS C N   1 
ATOM   4384 C CA  . HIS B 1 280 ? 27.983 13.723 14.302 1.00 6.04  ? 580 HIS C CA  1 
ATOM   4385 C C   . HIS B 1 280 ? 29.103 12.995 15.041 1.00 8.27  ? 580 HIS C C   1 
ATOM   4386 O O   . HIS B 1 280 ? 29.591 13.477 16.055 1.00 5.90  ? 580 HIS C O   1 
ATOM   4387 C CB  . HIS B 1 280 ? 28.510 15.072 13.794 1.00 4.81  ? 580 HIS C CB  1 
ATOM   4388 C CG  . HIS B 1 280 ? 29.369 14.975 12.569 1.00 3.39  ? 580 HIS C CG  1 
ATOM   4389 N ND1 . HIS B 1 280 ? 30.205 13.904 12.322 1.00 5.02  ? 580 HIS C ND1 1 
ATOM   4390 C CD2 . HIS B 1 280 ? 29.534 15.829 11.532 1.00 7.65  ? 580 HIS C CD2 1 
ATOM   4391 C CE1 . HIS B 1 280 ? 30.844 14.105 11.182 1.00 10.68 ? 580 HIS C CE1 1 
ATOM   4392 N NE2 . HIS B 1 280 ? 30.457 15.265 10.682 1.00 6.86  ? 580 HIS C NE2 1 
ATOM   4393 N N   . ASP B 1 281 ? 29.489 11.825 14.549 1.00 5.16  ? 581 ASP C N   1 
ATOM   4394 C CA  . ASP B 1 281 ? 30.592 11.087 15.142 1.00 6.75  ? 581 ASP C CA  1 
ATOM   4395 C C   . ASP B 1 281 ? 31.460 10.579 13.985 1.00 11.63 ? 581 ASP C C   1 
ATOM   4396 O O   . ASP B 1 281 ? 31.257 10.982 12.837 1.00 11.79 ? 581 ASP C O   1 
ATOM   4397 C CB  . ASP B 1 281 ? 30.082 9.941  16.048 1.00 9.75  ? 581 ASP C CB  1 
ATOM   4398 C CG  . ASP B 1 281 ? 29.158 8.969  15.331 1.00 11.98 ? 581 ASP C CG  1 
ATOM   4399 O OD1 . ASP B 1 281 ? 28.399 8.262  16.044 1.00 7.36  ? 581 ASP C OD1 1 
ATOM   4400 O OD2 . ASP B 1 281 ? 29.192 8.899  14.080 1.00 13.52 ? 581 ASP C OD2 1 
ATOM   4401 N N   . GLN B 1 282 ? 32.425 9.714  14.261 1.00 9.85  ? 582 GLN C N   1 
ATOM   4402 C CA  . GLN B 1 282 ? 33.286 9.238  13.184 1.00 13.05 ? 582 GLN C CA  1 
ATOM   4403 C C   . GLN B 1 282 ? 32.565 8.492  12.065 1.00 12.53 ? 582 GLN C C   1 
ATOM   4404 O O   . GLN B 1 282 ? 33.120 8.311  10.983 1.00 13.62 ? 582 GLN C O   1 
ATOM   4405 C CB  . GLN B 1 282 ? 34.410 8.389  13.758 1.00 10.84 ? 582 GLN C CB  1 
ATOM   4406 C CG  . GLN B 1 282 ? 35.369 9.208  14.603 1.00 20.16 ? 582 GLN C CG  1 
ATOM   4407 C CD  . GLN B 1 282 ? 36.606 8.437  14.997 1.00 23.53 ? 582 GLN C CD  1 
ATOM   4408 O OE1 . GLN B 1 282 ? 37.345 7.949  14.142 1.00 24.73 ? 582 GLN C OE1 1 
ATOM   4409 N NE2 . GLN B 1 282 ? 36.844 8.327  16.298 1.00 24.39 ? 582 GLN C NE2 1 
ATOM   4410 N N   . LYS B 1 283 ? 31.328 8.078  12.319 1.00 10.29 ? 583 LYS C N   1 
ATOM   4411 C CA  . LYS B 1 283 ? 30.531 7.368  11.320 1.00 13.28 ? 583 LYS C CA  1 
ATOM   4412 C C   . LYS B 1 283 ? 29.818 8.345  10.398 1.00 15.35 ? 583 LYS C C   1 
ATOM   4413 O O   . LYS B 1 283 ? 29.352 7.978  9.318  1.00 14.58 ? 583 LYS C O   1 
ATOM   4414 C CB  . LYS B 1 283 ? 29.479 6.487  11.997 1.00 16.17 ? 583 LYS C CB  1 
ATOM   4415 C CG  . LYS B 1 283 ? 30.014 5.218  12.667 1.00 22.76 ? 583 LYS C CG  1 
ATOM   4416 C CD  . LYS B 1 283 ? 28.931 4.552  13.525 1.00 31.92 ? 583 LYS C CD  1 
ATOM   4417 C CE  . LYS B 1 283 ? 27.631 4.336  12.745 1.00 41.59 ? 583 LYS C CE  1 
ATOM   4418 N NZ  . LYS B 1 283 ? 26.512 3.875  13.619 1.00 42.25 ? 583 LYS C NZ  1 
ATOM   4419 N N   . GLY B 1 284 ? 29.704 9.591  10.831 1.00 10.38 ? 584 GLY C N   1 
ATOM   4420 C CA  . GLY B 1 284 ? 29.040 10.564 9.994  1.00 10.58 ? 584 GLY C CA  1 
ATOM   4421 C C   . GLY B 1 284 ? 28.100 11.452 10.769 1.00 6.46  ? 584 GLY C C   1 
ATOM   4422 O O   . GLY B 1 284 ? 28.003 11.373 11.988 1.00 7.86  ? 584 GLY C O   1 
ATOM   4423 N N   . ASN B 1 285 ? 27.398 12.301 10.035 1.00 5.59  ? 585 ASN C N   1 
ATOM   4424 C CA  . ASN B 1 285 ? 26.467 13.242 10.624 1.00 6.00  ? 585 ASN C CA  1 
ATOM   4425 C C   . ASN B 1 285 ? 25.056 12.779 10.284 1.00 9.25  ? 585 ASN C C   1 
ATOM   4426 O O   . ASN B 1 285 ? 24.756 12.487 9.131  1.00 10.02 ? 585 ASN C O   1 
ATOM   4427 C CB  . ASN B 1 285 ? 26.741 14.622 10.031 1.00 8.85  ? 585 ASN C CB  1 
ATOM   4428 C CG  . ASN B 1 285 ? 26.132 15.742 10.840 1.00 8.89  ? 585 ASN C CG  1 
ATOM   4429 O OD1 . ASN B 1 285 ? 25.899 15.601 12.040 1.00 10.14 ? 585 ASN C OD1 1 
ATOM   4430 N ND2 . ASN B 1 285 ? 25.893 16.880 10.188 1.00 5.98  ? 585 ASN C ND2 1 
ATOM   4431 N N   . ARG B 1 286 ? 24.186 12.716 11.280 1.00 6.31  ? 586 ARG C N   1 
ATOM   4432 C CA  . ARG B 1 286 ? 22.834 12.277 11.014 1.00 8.26  ? 586 ARG C CA  1 
ATOM   4433 C C   . ARG B 1 286 ? 21.775 12.981 11.829 1.00 8.49  ? 586 ARG C C   1 
ATOM   4434 O O   . ARG B 1 286 ? 22.000 13.426 12.962 1.00 5.77  ? 586 ARG C O   1 
ATOM   4435 C CB  . ARG B 1 286 ? 22.729 10.765 11.207 1.00 13.88 ? 586 ARG C CB  1 
ATOM   4436 C CG  . ARG B 1 286 ? 23.496 10.296 12.386 1.00 22.94 ? 586 ARG C CG  1 
ATOM   4437 C CD  . ARG B 1 286 ? 23.641 8.788  12.442 1.00 15.78 ? 586 ARG C CD  1 
ATOM   4438 N NE  . ARG B 1 286 ? 24.178 8.456  13.747 1.00 8.24  ? 586 ARG C NE  1 
ATOM   4439 C CZ  . ARG B 1 286 ? 25.471 8.464  14.055 1.00 7.80  ? 586 ARG C CZ  1 
ATOM   4440 N NH1 . ARG B 1 286 ? 26.382 8.765  13.140 1.00 6.04  ? 586 ARG C NH1 1 
ATOM   4441 N NH2 . ARG B 1 286 ? 25.851 8.225  15.302 1.00 19.93 ? 586 ARG C NH2 1 
ATOM   4442 N N   . LEU B 1 287 ? 20.611 13.091 11.209 1.00 6.14  ? 587 LEU C N   1 
ATOM   4443 C CA  . LEU B 1 287 ? 19.465 13.717 11.824 1.00 11.82 ? 587 LEU C CA  1 
ATOM   4444 C C   . LEU B 1 287 ? 18.675 12.575 12.451 1.00 11.94 ? 587 LEU C C   1 
ATOM   4445 O O   . LEU B 1 287 ? 18.297 11.627 11.759 1.00 9.91  ? 587 LEU C O   1 
ATOM   4446 C CB  . LEU B 1 287 ? 18.635 14.414 10.747 1.00 11.34 ? 587 LEU C CB  1 
ATOM   4447 C CG  . LEU B 1 287 ? 17.496 15.295 11.258 1.00 9.60  ? 587 LEU C CG  1 
ATOM   4448 C CD1 . LEU B 1 287 ? 18.064 16.406 12.126 1.00 9.22  ? 587 LEU C CD1 1 
ATOM   4449 C CD2 . LEU B 1 287 ? 16.732 15.858 10.077 1.00 9.92  ? 587 LEU C CD2 1 
ATOM   4450 N N   . GLU B 1 288 ? 18.449 12.652 13.757 1.00 7.28  ? 588 GLU C N   1 
ATOM   4451 C CA  . GLU B 1 288 ? 17.711 11.609 14.461 1.00 8.92  ? 588 GLU C CA  1 
ATOM   4452 C C   . GLU B 1 288 ? 16.504 12.171 15.221 1.00 11.10 ? 588 GLU C C   1 
ATOM   4453 O O   . GLU B 1 288 ? 16.479 13.350 15.569 1.00 9.98  ? 588 GLU C O   1 
ATOM   4454 C CB  . GLU B 1 288 ? 18.678 10.824 15.377 1.00 5.75  ? 588 GLU C CB  1 
ATOM   4455 C CG  . GLU B 1 288 ? 19.751 10.090 14.558 1.00 13.19 ? 588 GLU C CG  1 
ATOM   4456 C CD  . GLU B 1 288 ? 20.707 9.212  15.366 1.00 16.46 ? 588 GLU C CD  1 
ATOM   4457 O OE1 . GLU B 1 288 ? 21.551 8.547  14.729 1.00 18.11 ? 588 GLU C OE1 1 
ATOM   4458 O OE2 . GLU B 1 288 ? 20.630 9.174  16.607 1.00 14.21 ? 588 GLU C OE2 1 
ATOM   4459 N N   . THR B 1 289 ? 15.504 11.321 15.461 1.00 9.84  ? 589 THR C N   1 
ATOM   4460 C CA  . THR B 1 289 ? 14.260 11.726 16.122 1.00 12.39 ? 589 THR C CA  1 
ATOM   4461 C C   . THR B 1 289 ? 14.070 10.906 17.383 1.00 14.37 ? 589 THR C C   1 
ATOM   4462 O O   . THR B 1 289 ? 13.916 9.690  17.314 1.00 17.07 ? 589 THR C O   1 
ATOM   4463 C CB  . THR B 1 289 ? 13.027 11.457 15.206 1.00 21.45 ? 589 THR C CB  1 
ATOM   4464 O OG1 . THR B 1 289 ? 13.473 11.142 13.884 1.00 28.98 ? 589 THR C OG1 1 
ATOM   4465 C CG2 . THR B 1 289 ? 12.127 12.660 15.123 1.00 29.19 ? 589 THR C CG2 1 
ATOM   4466 N N   . PRO B 1 290 ? 14.082 11.554 18.551 1.00 9.31  ? 590 PRO C N   1 
ATOM   4467 C CA  . PRO B 1 290 ? 13.901 10.814 19.800 1.00 9.76  ? 590 PRO C CA  1 
ATOM   4468 C C   . PRO B 1 290 ? 12.428 10.526 20.061 1.00 6.20  ? 590 PRO C C   1 
ATOM   4469 O O   . PRO B 1 290 ? 11.552 10.948 19.297 1.00 1.40  ? 590 PRO C O   1 
ATOM   4470 C CB  . PRO B 1 290 ? 14.501 11.757 20.836 1.00 6.69  ? 590 PRO C CB  1 
ATOM   4471 C CG  . PRO B 1 290 ? 14.146 13.117 20.277 1.00 5.64  ? 590 PRO C CG  1 
ATOM   4472 C CD  . PRO B 1 290 ? 14.477 12.949 18.811 1.00 9.84  ? 590 PRO C CD  1 
ATOM   4473 N N   . GLY B 1 291 ? 12.164 9.805  21.142 1.00 6.81  ? 591 GLY C N   1 
ATOM   4474 C CA  . GLY B 1 291 ? 10.796 9.497  21.501 1.00 7.88  ? 591 GLY C CA  1 
ATOM   4475 C C   . GLY B 1 291 ? 10.201 10.750 22.108 1.00 9.64  ? 591 GLY C C   1 
ATOM   4476 O O   . GLY B 1 291 ? 10.926 11.695 22.418 1.00 8.84  ? 591 GLY C O   1 
ATOM   4477 N N   . PHE B 1 292 ? 8.886  10.773 22.273 1.00 8.40  ? 592 PHE C N   1 
ATOM   4478 C CA  . PHE B 1 292 ? 8.222  11.933 22.851 1.00 10.69 ? 592 PHE C CA  1 
ATOM   4479 C C   . PHE B 1 292 ? 7.154  11.467 23.819 1.00 12.35 ? 592 PHE C C   1 
ATOM   4480 O O   . PHE B 1 292 ? 6.578  10.386 23.651 1.00 12.34 ? 592 PHE C O   1 
ATOM   4481 C CB  . PHE B 1 292 ? 7.615  12.797 21.745 1.00 11.57 ? 592 PHE C CB  1 
ATOM   4482 C CG  . PHE B 1 292 ? 6.782  12.025 20.769 1.00 14.03 ? 592 PHE C CG  1 
ATOM   4483 C CD1 . PHE B 1 292 ? 5.402  11.931 20.934 1.00 13.75 ? 592 PHE C CD1 1 
ATOM   4484 C CD2 . PHE B 1 292 ? 7.379  11.381 19.688 1.00 14.10 ? 592 PHE C CD2 1 
ATOM   4485 C CE1 . PHE B 1 292 ? 4.624  11.204 20.036 1.00 20.00 ? 592 PHE C CE1 1 
ATOM   4486 C CE2 . PHE B 1 292 ? 6.616  10.648 18.781 1.00 17.34 ? 592 PHE C CE2 1 
ATOM   4487 C CZ  . PHE B 1 292 ? 5.232  10.562 18.954 1.00 18.92 ? 592 PHE C CZ  1 
ATOM   4488 N N   . ALA B 1 293 ? 6.895  12.291 24.830 1.00 10.95 ? 593 ALA C N   1 
ATOM   4489 C CA  . ALA B 1 293 ? 5.922  11.979 25.875 1.00 11.51 ? 593 ALA C CA  1 
ATOM   4490 C C   . ALA B 1 293 ? 4.457  12.147 25.483 1.00 12.49 ? 593 ALA C C   1 
ATOM   4491 O O   . ALA B 1 293 ? 3.618  11.313 25.829 1.00 14.46 ? 593 ALA C O   1 
ATOM   4492 C CB  . ALA B 1 293 ? 6.215  12.833 27.113 1.00 7.95  ? 593 ALA C CB  1 
ATOM   4493 N N   . LEU B 1 294 ? 4.147  13.228 24.779 1.00 10.85 ? 594 LEU C N   1 
ATOM   4494 C CA  . LEU B 1 294 ? 2.773  13.515 24.387 1.00 13.72 ? 594 LEU C CA  1 
ATOM   4495 C C   . LEU B 1 294 ? 2.307  12.629 23.239 1.00 15.01 ? 594 LEU C C   1 
ATOM   4496 O O   . LEU B 1 294 ? 2.550  12.920 22.073 1.00 18.50 ? 594 LEU C O   1 
ATOM   4497 C CB  . LEU B 1 294 ? 2.645  14.997 24.020 1.00 10.54 ? 594 LEU C CB  1 
ATOM   4498 C CG  . LEU B 1 294 ? 1.231  15.579 23.836 1.00 19.81 ? 594 LEU C CG  1 
ATOM   4499 C CD1 . LEU B 1 294 ? 0.330  15.096 24.958 1.00 26.14 ? 594 LEU C CD1 1 
ATOM   4500 C CD2 . LEU B 1 294 ? 1.302  17.102 23.831 1.00 11.74 ? 594 LEU C CD2 1 
ATOM   4501 N N   . LYS B 1 295 ? 1.637  11.537 23.583 1.00 23.97 ? 595 LYS C N   1 
ATOM   4502 C CA  . LYS B 1 295 ? 1.148  10.597 22.585 1.00 31.94 ? 595 LYS C CA  1 
ATOM   4503 C C   . LYS B 1 295 ? -0.373 10.632 22.489 1.00 36.98 ? 595 LYS C C   1 
ATOM   4504 O O   . LYS B 1 295 ? -0.883 10.639 21.351 1.00 39.82 ? 595 LYS C O   1 
ATOM   4505 C CB  . LYS B 1 295 ? 1.619  9.188  22.934 1.00 35.25 ? 595 LYS C CB  1 
ATOM   4506 C CG  . LYS B 1 295 ? 3.120  9.089  23.092 1.00 34.07 ? 595 LYS C CG  1 
ATOM   4507 C CD  . LYS B 1 295 ? 3.550  7.682  23.445 1.00 40.11 ? 595 LYS C CD  1 
ATOM   4508 C CE  . LYS B 1 295 ? 5.050  7.621  23.651 1.00 35.63 ? 595 LYS C CE  1 
ATOM   4509 N NZ  . LYS B 1 295 ? 5.762  8.124  22.452 1.00 36.91 ? 595 LYS C NZ  1 
ATOM   4510 O OXT . LYS B 1 295 ? -1.035 10.642 23.548 1.00 41.26 ? 595 LYS C OXT 1 
HETATM 4511 N N   . GLY C 2 .   ? 25.050 34.808 47.034 1.00 13.98 ? 296 GLY A N   1 
HETATM 4512 C CA  . GLY C 2 .   ? 24.726 36.177 46.583 1.00 15.67 ? 296 GLY A CA  1 
HETATM 4513 C C   . GLY C 2 .   ? 25.559 36.567 45.378 1.00 18.04 ? 296 GLY A C   1 
HETATM 4514 O O   . GLY C 2 .   ? 25.136 37.472 44.633 1.00 16.07 ? 296 GLY A O   1 
HETATM 4515 O OXT . GLY C 2 .   ? 26.639 35.963 45.186 1.00 15.64 ? 296 GLY A OXT 1 
HETATM 4516 N N   . GLY D 2 .   ? 14.809 27.785 25.251 1.00 8.50  ? 596 GLY C N   1 
HETATM 4517 C CA  . GLY D 2 .   ? 15.119 29.189 24.842 1.00 5.16  ? 596 GLY C CA  1 
HETATM 4518 C C   . GLY D 2 .   ? 14.283 30.165 25.642 1.00 10.24 ? 596 GLY C C   1 
HETATM 4519 O O   . GLY D 2 .   ? 14.689 31.339 25.746 1.00 8.75  ? 596 GLY C O   1 
HETATM 4520 O OXT . GLY D 2 .   ? 13.226 29.747 26.169 1.00 6.78  ? 596 GLY C OXT 1 
HETATM 4521 O O   . HOH E 3 .   ? 18.974 46.133 53.365 1.00 9.61  ? 297 HOH A O   1 
HETATM 4522 O O   . HOH E 3 .   ? 24.580 40.323 41.521 1.00 4.09  ? 298 HOH A O   1 
HETATM 4523 O O   . HOH E 3 .   ? 16.655 47.774 36.674 1.00 6.58  ? 299 HOH A O   1 
HETATM 4524 O O   . HOH E 3 .   ? 1.374  28.102 58.642 1.00 11.45 ? 300 HOH A O   1 
HETATM 4525 O O   . HOH E 3 .   ? 22.937 36.913 43.054 1.00 7.13  ? 301 HOH A O   1 
HETATM 4526 O O   . HOH E 3 .   ? 2.123  39.693 42.640 1.00 7.15  ? 302 HOH A O   1 
HETATM 4527 O O   . HOH E 3 .   ? 5.319  32.585 36.034 1.00 8.97  ? 303 HOH A O   1 
HETATM 4528 O O   . HOH E 3 .   ? 25.355 45.519 38.323 1.00 7.94  ? 304 HOH A O   1 
HETATM 4529 O O   . HOH E 3 .   ? 15.975 44.358 30.428 1.00 6.73  ? 305 HOH A O   1 
HETATM 4530 O O   . HOH E 3 .   ? 22.921 42.236 39.871 1.00 11.68 ? 306 HOH A O   1 
HETATM 4531 O O   . HOH E 3 .   ? 3.150  30.828 38.188 1.00 10.17 ? 307 HOH A O   1 
HETATM 4532 O O   . HOH E 3 .   ? 34.836 32.030 38.001 1.00 10.20 ? 308 HOH A O   1 
HETATM 4533 O O   . HOH E 3 .   ? 24.291 46.055 44.073 1.00 7.54  ? 309 HOH A O   1 
HETATM 4534 O O   . HOH E 3 .   ? 4.092  40.868 44.182 1.00 11.03 ? 310 HOH A O   1 
HETATM 4535 O O   . HOH E 3 .   ? 15.696 47.066 42.524 1.00 9.88  ? 311 HOH A O   1 
HETATM 4536 O O   . HOH E 3 .   ? 9.358  43.860 31.322 1.00 10.17 ? 312 HOH A O   1 
HETATM 4537 O O   . HOH E 3 .   ? 26.073 44.295 47.570 1.00 14.02 ? 313 HOH A O   1 
HETATM 4538 O O   . HOH E 3 .   ? 28.452 35.933 38.274 1.00 7.88  ? 314 HOH A O   1 
HETATM 4539 O O   . HOH E 3 .   ? 23.065 51.324 49.187 1.00 10.65 ? 315 HOH A O   1 
HETATM 4540 O O   . HOH E 3 .   ? 0.661  32.737 44.165 1.00 11.06 ? 316 HOH A O   1 
HETATM 4541 O O   . HOH E 3 .   ? 6.681  36.185 65.246 1.00 8.79  ? 317 HOH A O   1 
HETATM 4542 O O   . HOH E 3 .   ? 33.771 18.816 34.868 1.00 9.55  ? 318 HOH A O   1 
HETATM 4543 O O   . HOH E 3 .   ? 9.554  48.071 46.892 1.00 11.31 ? 319 HOH A O   1 
HETATM 4544 O O   . HOH E 3 .   ? 7.528  23.734 44.391 1.00 9.61  ? 320 HOH A O   1 
HETATM 4545 O O   . HOH E 3 .   ? 7.314  49.753 46.180 1.00 12.64 ? 321 HOH A O   1 
HETATM 4546 O O   . HOH E 3 .   ? 23.194 27.048 38.577 1.00 13.77 ? 322 HOH A O   1 
HETATM 4547 O O   . HOH E 3 .   ? 0.799  26.937 51.509 1.00 15.56 ? 323 HOH A O   1 
HETATM 4548 O O   . HOH E 3 .   ? -1.013 33.299 53.939 1.00 11.61 ? 324 HOH A O   1 
HETATM 4549 O O   . HOH E 3 .   ? 31.321 47.604 35.545 1.00 17.05 ? 325 HOH A O   1 
HETATM 4550 O O   . HOH E 3 .   ? 36.533 26.203 58.422 1.00 11.17 ? 326 HOH A O   1 
HETATM 4551 O O   . HOH E 3 .   ? 24.043 24.954 66.802 1.00 12.87 ? 327 HOH A O   1 
HETATM 4552 O O   . HOH E 3 .   ? 24.506 29.390 67.956 1.00 14.33 ? 328 HOH A O   1 
HETATM 4553 O O   . HOH E 3 .   ? 23.507 51.859 54.436 1.00 16.51 ? 329 HOH A O   1 
HETATM 4554 O O   . HOH E 3 .   ? -0.980 34.729 49.426 1.00 17.12 ? 330 HOH A O   1 
HETATM 4555 O O   . HOH E 3 .   ? 18.683 53.214 43.580 1.00 14.76 ? 331 HOH A O   1 
HETATM 4556 O O   . HOH E 3 .   ? 15.783 32.118 37.360 1.00 13.86 ? 332 HOH A O   1 
HETATM 4557 O O   . HOH E 3 .   ? 8.341  34.635 66.880 1.00 14.67 ? 333 HOH A O   1 
HETATM 4558 O O   . HOH E 3 .   ? 10.849 50.526 46.237 1.00 10.19 ? 334 HOH A O   1 
HETATM 4559 O O   . HOH E 3 .   ? 17.926 42.573 47.468 1.00 12.16 ? 335 HOH A O   1 
HETATM 4560 O O   . HOH E 3 .   ? 18.978 56.881 51.902 1.00 19.56 ? 336 HOH A O   1 
HETATM 4561 O O   . HOH E 3 .   ? 23.119 42.199 54.669 1.00 13.63 ? 337 HOH A O   1 
HETATM 4562 O O   . HOH E 3 .   ? 3.650  40.706 46.974 1.00 10.78 ? 338 HOH A O   1 
HETATM 4563 O O   . HOH E 3 .   ? 25.100 31.863 48.118 1.00 13.27 ? 339 HOH A O   1 
HETATM 4564 O O   . HOH E 3 .   ? 13.636 35.605 67.987 1.00 13.35 ? 340 HOH A O   1 
HETATM 4565 O O   . HOH E 3 .   ? 3.975  35.388 65.669 1.00 13.60 ? 341 HOH A O   1 
HETATM 4566 O O   . HOH E 3 .   ? 19.352 50.905 42.642 1.00 15.85 ? 342 HOH A O   1 
HETATM 4567 O O   . HOH E 3 .   ? 18.404 16.402 58.827 1.00 14.26 ? 343 HOH A O   1 
HETATM 4568 O O   . HOH E 3 .   ? 16.951 26.775 36.560 1.00 10.17 ? 344 HOH A O   1 
HETATM 4569 O O   . HOH E 3 .   ? 8.154  41.948 56.308 1.00 14.52 ? 345 HOH A O   1 
HETATM 4570 O O   . HOH E 3 .   ? 15.296 14.207 53.647 1.00 15.67 ? 346 HOH A O   1 
HETATM 4571 O O   . HOH E 3 .   ? 15.929 18.384 62.183 1.00 18.34 ? 347 HOH A O   1 
HETATM 4572 O O   . HOH E 3 .   ? 18.021 22.481 67.962 1.00 16.28 ? 348 HOH A O   1 
HETATM 4573 O O   . HOH E 3 .   ? 9.250  57.141 42.886 1.00 16.22 ? 349 HOH A O   1 
HETATM 4574 O O   . HOH E 3 .   ? 21.929 33.370 47.470 1.00 13.66 ? 350 HOH A O   1 
HETATM 4575 O O   . HOH E 3 .   ? 27.653 43.796 50.160 1.00 23.29 ? 351 HOH A O   1 
HETATM 4576 O O   . HOH E 3 .   ? 10.069 15.769 61.912 1.00 21.43 ? 352 HOH A O   1 
HETATM 4577 O O   . HOH E 3 .   ? 21.627 47.928 33.846 1.00 16.35 ? 353 HOH A O   1 
HETATM 4578 O O   . HOH E 3 .   ? 41.921 29.697 45.103 1.00 26.97 ? 354 HOH A O   1 
HETATM 4579 O O   . HOH E 3 .   ? 6.890  23.536 64.577 1.00 21.12 ? 355 HOH A O   1 
HETATM 4580 O O   . HOH E 3 .   ? 11.479 40.878 63.100 1.00 18.48 ? 356 HOH A O   1 
HETATM 4581 O O   . HOH E 3 .   ? 0.024  26.268 40.652 1.00 16.27 ? 357 HOH A O   1 
HETATM 4582 O O   . HOH E 3 .   ? 20.000 47.444 35.932 1.00 15.38 ? 358 HOH A O   1 
HETATM 4583 O O   . HOH E 3 .   ? 34.749 16.267 49.626 1.00 21.11 ? 359 HOH A O   1 
HETATM 4584 O O   . HOH E 3 .   ? 31.345 25.856 64.664 1.00 21.84 ? 360 HOH A O   1 
HETATM 4585 O O   . HOH E 3 .   ? 29.433 50.585 49.486 1.00 15.37 ? 361 HOH A O   1 
HETATM 4586 O O   . HOH E 3 .   ? 42.268 23.812 49.205 1.00 25.33 ? 362 HOH A O   1 
HETATM 4587 O O   . HOH E 3 .   ? 36.383 18.189 36.020 1.00 14.41 ? 363 HOH A O   1 
HETATM 4588 O O   . HOH E 3 .   ? 12.978 19.441 63.034 1.00 16.77 ? 364 HOH A O   1 
HETATM 4589 O O   . HOH E 3 .   ? 7.118  32.679 27.989 1.00 14.28 ? 365 HOH A O   1 
HETATM 4590 O O   . HOH E 3 .   ? 2.960  28.616 50.179 1.00 12.47 ? 366 HOH A O   1 
HETATM 4591 O O   . HOH E 3 .   ? 9.304  48.395 51.399 1.00 24.15 ? 367 HOH A O   1 
HETATM 4592 O O   . HOH E 3 .   ? 26.363 16.267 59.231 1.00 22.00 ? 368 HOH A O   1 
HETATM 4593 O O   . HOH E 3 .   ? 25.507 48.168 58.772 1.00 29.77 ? 369 HOH A O   1 
HETATM 4594 O O   . HOH E 3 .   ? 6.574  42.028 58.497 1.00 31.31 ? 370 HOH A O   1 
HETATM 4595 O O   . HOH E 3 .   ? 23.260 38.723 59.270 1.00 20.12 ? 371 HOH A O   1 
HETATM 4596 O O   . HOH E 3 .   ? 19.640 50.859 29.385 1.00 23.15 ? 372 HOH A O   1 
HETATM 4597 O O   . HOH E 3 .   ? 38.485 45.638 40.267 1.00 29.84 ? 373 HOH A O   1 
HETATM 4598 O O   . HOH E 3 .   ? 13.300 46.470 58.027 1.00 19.00 ? 374 HOH A O   1 
HETATM 4599 O O   . HOH E 3 .   ? 41.186 22.755 46.803 1.00 30.99 ? 375 HOH A O   1 
HETATM 4600 O O   . HOH E 3 .   ? 20.901 12.781 59.218 1.00 20.46 ? 376 HOH A O   1 
HETATM 4601 O O   . HOH E 3 .   ? -2.999 36.936 38.869 1.00 33.77 ? 377 HOH A O   1 
HETATM 4602 O O   . HOH E 3 .   ? 2.048  30.982 42.723 1.00 22.10 ? 378 HOH A O   1 
HETATM 4603 O O   . HOH E 3 .   ? 3.639  38.258 51.869 1.00 19.46 ? 379 HOH A O   1 
HETATM 4604 O O   . HOH E 3 .   ? 23.417 56.214 55.146 1.00 15.06 ? 380 HOH A O   1 
HETATM 4605 O O   . HOH E 3 .   ? 0.667  37.079 63.415 1.00 21.07 ? 381 HOH A O   1 
HETATM 4606 O O   . HOH E 3 .   ? 18.468 46.254 30.870 1.00 15.84 ? 382 HOH A O   1 
HETATM 4607 O O   . HOH E 3 .   ? 30.004 26.240 60.999 1.00 22.94 ? 383 HOH A O   1 
HETATM 4608 O O   . HOH E 3 .   ? 24.400 51.068 58.337 1.00 17.92 ? 384 HOH A O   1 
HETATM 4609 O O   . HOH E 3 .   ? 34.308 49.236 33.559 1.00 36.89 ? 385 HOH A O   1 
HETATM 4610 O O   . HOH E 3 .   ? 5.091  52.443 39.846 1.00 25.12 ? 386 HOH A O   1 
HETATM 4611 O O   . HOH E 3 .   ? 20.110 50.100 33.105 1.00 23.54 ? 387 HOH A O   1 
HETATM 4612 O O   . HOH E 3 .   ? 21.124 52.340 40.910 1.00 23.47 ? 388 HOH A O   1 
HETATM 4613 O O   . HOH E 3 .   ? 34.549 58.017 50.395 1.00 27.55 ? 389 HOH A O   1 
HETATM 4614 O O   . HOH E 3 .   ? 0.151  38.016 45.511 1.00 29.78 ? 390 HOH A O   1 
HETATM 4615 O O   . HOH F 3 .   ? 33.983 29.880 35.406 1.00 5.18  ? 4   HOH C O   1 
HETATM 4616 O O   . HOH F 3 .   ? 20.605 33.875 13.547 1.00 14.06 ? 5   HOH C O   1 
HETATM 4617 O O   . HOH F 3 .   ? 11.391 33.618 31.886 1.00 4.35  ? 6   HOH C O   1 
HETATM 4618 O O   . HOH F 3 .   ? 16.899 31.950 27.277 1.00 5.40  ? 7   HOH C O   1 
HETATM 4619 O O   . HOH F 3 .   ? 15.130 35.538 26.496 1.00 6.59  ? 8   HOH C O   1 
HETATM 4620 O O   . HOH F 3 .   ? 5.891  30.228 37.506 1.00 8.04  ? 9   HOH C O   1 
HETATM 4621 O O   . HOH F 3 .   ? 17.558 26.474 25.618 1.00 5.76  ? 10  HOH C O   1 
HETATM 4622 O O   . HOH F 3 .   ? 32.444 20.796 33.557 1.00 5.67  ? 11  HOH C O   1 
HETATM 4623 O O   . HOH F 3 .   ? 38.594 16.392 19.158 1.00 10.42 ? 13  HOH C O   1 
HETATM 4624 O O   . HOH F 3 .   ? 26.292 8.356  10.226 1.00 7.26  ? 15  HOH C O   1 
HETATM 4625 O O   . HOH F 3 .   ? 21.632 33.970 20.264 1.00 8.30  ? 16  HOH C O   1 
HETATM 4626 O O   . HOH F 3 .   ? 21.579 4.935  41.316 1.00 12.56 ? 17  HOH C O   1 
HETATM 4627 O O   . HOH F 3 .   ? 24.672 6.222  21.863 1.00 6.70  ? 18  HOH C O   1 
HETATM 4628 O O   . HOH F 3 .   ? -1.239 18.496 31.823 1.00 11.16 ? 19  HOH C O   1 
HETATM 4629 O O   . HOH F 3 .   ? 34.351 32.907 35.433 1.00 9.87  ? 20  HOH C O   1 
HETATM 4630 O O   . HOH F 3 .   ? 33.318 9.202  16.836 1.00 10.01 ? 22  HOH C O   1 
HETATM 4631 O O   . HOH F 3 .   ? 21.304 6.755  25.399 1.00 9.82  ? 23  HOH C O   1 
HETATM 4632 O O   . HOH F 3 .   ? 1.148  17.166 31.561 1.00 8.44  ? 25  HOH C O   1 
HETATM 4633 O O   . HOH F 3 .   ? 16.051 37.881 9.493  1.00 12.96 ? 27  HOH C O   1 
HETATM 4634 O O   . HOH F 3 .   ? 14.475 8.816  22.716 1.00 10.46 ? 28  HOH C O   1 
HETATM 4635 O O   . HOH F 3 .   ? 37.606 34.819 25.849 1.00 12.61 ? 29  HOH C O   1 
HETATM 4636 O O   . HOH F 3 .   ? 33.421 19.065 9.195  1.00 8.19  ? 30  HOH C O   1 
HETATM 4637 O O   . HOH F 3 .   ? 27.480 6.617  20.649 1.00 10.72 ? 31  HOH C O   1 
HETATM 4638 O O   . HOH F 3 .   ? -1.322 25.296 29.281 1.00 10.26 ? 32  HOH C O   1 
HETATM 4639 O O   . HOH F 3 .   ? 27.365 6.008  15.605 1.00 14.18 ? 35  HOH C O   1 
HETATM 4640 O O   . HOH F 3 .   ? 24.164 31.112 34.318 1.00 11.77 ? 37  HOH C O   1 
HETATM 4641 O O   . HOH F 3 .   ? 26.148 16.841 7.150  1.00 8.32  ? 39  HOH C O   1 
HETATM 4642 O O   . HOH F 3 .   ? 39.738 19.064 25.593 1.00 14.86 ? 42  HOH C O   1 
HETATM 4643 O O   . HOH F 3 .   ? 35.892 33.221 21.599 1.00 13.73 ? 43  HOH C O   1 
HETATM 4644 O O   . HOH F 3 .   ? 13.734 27.256 21.967 1.00 12.42 ? 44  HOH C O   1 
HETATM 4645 O O   . HOH F 3 .   ? 30.052 44.691 32.953 1.00 13.67 ? 45  HOH C O   1 
HETATM 4646 O O   . HOH F 3 .   ? 13.452 35.502 19.221 1.00 10.58 ? 48  HOH C O   1 
HETATM 4647 O O   . HOH F 3 .   ? 15.242 38.954 21.277 1.00 8.44  ? 49  HOH C O   1 
HETATM 4648 O O   . HOH F 3 .   ? 16.750 38.176 26.890 1.00 6.25  ? 50  HOH C O   1 
HETATM 4649 O O   . HOH F 3 .   ? 35.932 18.334 9.375  1.00 12.30 ? 56  HOH C O   1 
HETATM 4650 O O   . HOH F 3 .   ? 23.509 45.419 33.369 1.00 11.93 ? 59  HOH C O   1 
HETATM 4651 O O   . HOH F 3 .   ? 23.900 40.779 21.931 1.00 11.55 ? 62  HOH C O   1 
HETATM 4652 O O   . HOH F 3 .   ? 4.061  24.034 33.810 1.00 12.03 ? 66  HOH C O   1 
HETATM 4653 O O   . HOH F 3 .   ? 11.984 33.642 17.597 1.00 14.80 ? 70  HOH C O   1 
HETATM 4654 O O   . HOH F 3 .   ? 31.612 46.754 33.210 1.00 15.86 ? 72  HOH C O   1 
HETATM 4655 O O   . HOH F 3 .   ? 10.673 13.771 18.162 1.00 7.96  ? 73  HOH C O   1 
HETATM 4656 O O   . HOH F 3 .   ? 20.477 21.681 8.622  1.00 8.39  ? 74  HOH C O   1 
HETATM 4657 O O   . HOH F 3 .   ? 10.106 39.503 14.406 1.00 10.83 ? 75  HOH C O   1 
HETATM 4658 O O   . HOH F 3 .   ? 40.250 25.763 27.702 1.00 17.38 ? 77  HOH C O   1 
HETATM 4659 O O   . HOH F 3 .   ? 35.417 34.756 23.842 1.00 11.59 ? 79  HOH C O   1 
HETATM 4660 O O   . HOH F 3 .   ? 17.737 8.947  22.177 1.00 9.90  ? 80  HOH C O   1 
HETATM 4661 O O   . HOH F 3 .   ? 28.569 41.619 16.755 1.00 15.38 ? 82  HOH C O   1 
HETATM 4662 O O   . HOH F 3 .   ? 14.119 19.211 38.880 1.00 10.72 ? 83  HOH C O   1 
HETATM 4663 O O   . HOH F 3 .   ? 20.644 45.297 17.721 1.00 14.46 ? 86  HOH C O   1 
HETATM 4664 O O   . HOH F 3 .   ? 14.326 41.665 26.249 1.00 8.50  ? 87  HOH C O   1 
HETATM 4665 O O   . HOH F 3 .   ? 40.881 23.260 19.871 1.00 10.92 ? 89  HOH C O   1 
HETATM 4666 O O   . HOH F 3 .   ? 39.020 28.222 28.386 1.00 13.02 ? 91  HOH C O   1 
HETATM 4667 O O   . HOH F 3 .   ? 31.469 29.199 13.162 1.00 15.87 ? 92  HOH C O   1 
HETATM 4668 O O   . HOH F 3 .   ? 16.498 40.304 14.012 1.00 13.27 ? 93  HOH C O   1 
HETATM 4669 O O   . HOH F 3 .   ? 16.568 29.767 14.548 1.00 17.43 ? 94  HOH C O   1 
HETATM 4670 O O   . HOH F 3 .   ? 20.425 11.762 8.697  1.00 14.16 ? 96  HOH C O   1 
HETATM 4671 O O   . HOH F 3 .   ? 4.628  25.026 21.029 1.00 21.40 ? 98  HOH C O   1 
HETATM 4672 O O   . HOH F 3 .   ? 41.071 19.541 30.346 1.00 15.12 ? 101 HOH C O   1 
HETATM 4673 O O   . HOH F 3 .   ? 28.159 23.832 8.085  1.00 11.35 ? 105 HOH C O   1 
HETATM 4674 O O   . HOH F 3 .   ? 8.410  22.359 34.090 1.00 16.44 ? 106 HOH C O   1 
HETATM 4675 O O   . HOH F 3 .   ? 24.808 7.564  31.075 1.00 11.49 ? 108 HOH C O   1 
HETATM 4676 O O   . HOH F 3 .   ? 36.572 30.224 34.551 1.00 14.79 ? 112 HOH C O   1 
HETATM 4677 O O   . HOH F 3 .   ? 26.132 37.429 10.088 1.00 17.58 ? 113 HOH C O   1 
HETATM 4678 O O   . HOH F 3 .   ? 9.708  9.355  35.076 1.00 18.19 ? 114 HOH C O   1 
HETATM 4679 O O   . HOH F 3 .   ? 6.000  37.124 13.792 1.00 22.04 ? 115 HOH C O   1 
HETATM 4680 O O   . HOH F 3 .   ? 19.940 4.321  37.581 1.00 16.75 ? 120 HOH C O   1 
HETATM 4681 O O   . HOH F 3 .   ? -2.550 15.539 21.037 1.00 18.41 ? 121 HOH C O   1 
HETATM 4682 O O   . HOH F 3 .   ? 31.635 16.746 8.549  1.00 10.36 ? 122 HOH C O   1 
HETATM 4683 O O   . HOH F 3 .   ? 3.405  14.781 20.324 1.00 14.91 ? 123 HOH C O   1 
HETATM 4684 O O   . HOH F 3 .   ? 39.275 21.081 10.147 1.00 21.56 ? 124 HOH C O   1 
HETATM 4685 O O   . HOH F 3 .   ? 10.553 14.593 13.538 1.00 17.39 ? 125 HOH C O   1 
HETATM 4686 O O   . HOH F 3 .   ? 16.041 8.513  14.507 1.00 14.12 ? 126 HOH C O   1 
HETATM 4687 O O   . HOH F 3 .   ? 30.346 4.121  23.546 1.00 22.36 ? 128 HOH C O   1 
HETATM 4688 O O   . HOH F 3 .   ? 40.154 17.096 31.495 1.00 19.71 ? 130 HOH C O   1 
HETATM 4689 O O   . HOH F 3 .   ? 22.685 44.703 26.161 1.00 12.35 ? 131 HOH C O   1 
HETATM 4690 O O   . HOH F 3 .   ? 37.393 21.417 25.759 1.00 12.72 ? 134 HOH C O   1 
HETATM 4691 O O   . HOH F 3 .   ? 25.421 10.043 8.109  1.00 17.99 ? 135 HOH C O   1 
HETATM 4692 O O   . HOH F 3 .   ? 5.180  30.317 34.333 1.00 18.17 ? 136 HOH C O   1 
HETATM 4693 O O   . HOH F 3 .   ? 20.221 7.296  12.478 1.00 22.78 ? 137 HOH C O   1 
HETATM 4694 O O   . HOH F 3 .   ? 10.051 9.516  17.910 1.00 18.60 ? 141 HOH C O   1 
HETATM 4695 O O   . HOH F 3 .   ? -4.624 20.862 32.973 1.00 26.43 ? 145 HOH C O   1 
HETATM 4696 O O   . HOH F 3 .   ? -1.387 12.513 25.716 1.00 22.17 ? 148 HOH C O   1 
HETATM 4697 O O   . HOH F 3 .   ? 38.288 18.059 33.629 1.00 20.79 ? 150 HOH C O   1 
HETATM 4698 O O   . HOH F 3 .   ? 14.218 22.120 12.851 1.00 26.75 ? 152 HOH C O   1 
HETATM 4699 O O   . HOH F 3 .   ? 34.630 46.724 20.751 1.00 18.95 ? 153 HOH C O   1 
HETATM 4700 O O   . HOH F 3 .   ? 20.448 43.594 8.706  1.00 18.01 ? 156 HOH C O   1 
HETATM 4701 O O   . HOH F 3 .   ? 21.031 46.438 31.835 1.00 16.49 ? 159 HOH C O   1 
HETATM 4702 O O   . HOH F 3 .   ? 4.028  39.071 12.714 1.00 18.94 ? 160 HOH C O   1 
HETATM 4703 O O   . HOH F 3 .   ? 22.115 5.929  15.243 1.00 17.34 ? 162 HOH C O   1 
HETATM 4704 O O   . HOH F 3 .   ? 2.065  17.050 19.959 1.00 18.28 ? 163 HOH C O   1 
HETATM 4705 O O   . HOH F 3 .   ? 14.199 30.283 11.940 1.00 18.09 ? 164 HOH C O   1 
HETATM 4706 O O   . HOH F 3 .   ? 29.973 39.283 17.565 1.00 13.88 ? 167 HOH C O   1 
HETATM 4707 O O   . HOH F 3 .   ? 32.873 31.120 14.090 1.00 17.35 ? 169 HOH C O   1 
HETATM 4708 O O   . HOH F 3 .   ? 5.281  12.050 34.201 1.00 19.32 ? 170 HOH C O   1 
HETATM 4709 O O   . HOH F 3 .   ? 10.691 11.753 35.849 1.00 15.40 ? 171 HOH C O   1 
HETATM 4710 O O   . HOH F 3 .   ? 20.486 28.736 6.708  1.00 19.09 ? 172 HOH C O   1 
HETATM 4711 O O   . HOH F 3 .   ? 31.581 6.318  15.891 1.00 20.26 ? 175 HOH C O   1 
HETATM 4712 O O   . HOH F 3 .   ? 30.080 37.204 13.762 1.00 22.83 ? 176 HOH C O   1 
HETATM 4713 O O   . HOH F 3 .   ? 16.230 23.945 12.783 1.00 23.54 ? 177 HOH C O   1 
HETATM 4714 O O   . HOH F 3 .   ? 2.341  26.648 22.615 1.00 22.72 ? 179 HOH C O   1 
HETATM 4715 O O   . HOH F 3 .   ? 28.376 8.673  32.762 1.00 24.91 ? 180 HOH C O   1 
HETATM 4716 O O   . HOH F 3 .   ? 18.161 43.116 7.195  1.00 19.65 ? 183 HOH C O   1 
HETATM 4717 O O   . HOH F 3 .   ? 15.196 34.814 6.658  1.00 18.45 ? 184 HOH C O   1 
HETATM 4718 O O   . HOH F 3 .   ? 10.103 22.584 40.041 1.00 21.63 ? 185 HOH C O   1 
HETATM 4719 O O   . HOH F 3 .   ? 20.187 43.907 19.708 1.00 19.00 ? 186 HOH C O   1 
HETATM 4720 O O   . HOH F 3 .   ? 7.867  45.038 27.348 1.00 23.10 ? 188 HOH C O   1 
HETATM 4721 O O   . HOH F 3 .   ? 33.085 48.852 26.818 1.00 22.45 ? 191 HOH C O   1 
HETATM 4722 O O   . HOH F 3 .   ? 2.302  44.969 22.834 1.00 28.68 ? 193 HOH C O   1 
HETATM 4723 O O   . HOH F 3 .   ? 31.481 14.912 39.337 1.00 23.70 ? 194 HOH C O   1 
HETATM 4724 O O   . HOH F 3 .   ? 40.801 39.859 32.396 1.00 23.68 ? 196 HOH C O   1 
HETATM 4725 O O   . HOH F 3 .   ? 19.470 47.082 28.452 1.00 26.07 ? 199 HOH C O   1 
HETATM 4726 O O   . HOH F 3 .   ? 31.711 33.473 13.166 1.00 47.20 ? 201 HOH C O   1 
HETATM 4727 O O   . HOH F 3 .   ? 13.810 32.090 7.908  1.00 31.90 ? 204 HOH C O   1 
HETATM 4728 O O   . HOH F 3 .   ? 2.637  12.233 28.576 1.00 28.31 ? 206 HOH C O   1 
HETATM 4729 O O   . HOH F 3 .   ? 35.649 10.462 27.855 1.00 21.50 ? 207 HOH C O   1 
HETATM 4730 O O   . HOH F 3 .   ? 35.918 28.426 18.887 1.00 22.16 ? 210 HOH C O   1 
HETATM 4731 O O   . HOH F 3 .   ? 31.711 33.473 13.166 1.00 47.20 ? 211 HOH C O   1 
HETATM 4732 O O   . HOH F 3 .   ? 13.998 31.561 20.518 1.00 22.11 ? 212 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   1   1   THR THR A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  HIS 16  16  16  HIS HIS A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  TRP 22  22  22  TRP TRP A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 MET 103 103 103 MET MET A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 TRP 132 132 132 TRP TRP A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 HIS 178 178 178 HIS HIS A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 GLN 229 229 229 GLN GLN A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 CYS 232 232 232 CYS CYS A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ASN 244 244 244 ASN ASN A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 VAL 279 279 279 VAL VAL A . n 
A 1 280 HIS 280 280 280 HIS HIS A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 ALA 293 293 293 ALA ALA A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
B 1 1   THR 1   301 301 THR THR C . n 
B 1 2   THR 2   302 302 THR THR C . n 
B 1 3   ASN 3   303 303 ASN ASN C . n 
B 1 4   LYS 4   304 304 LYS LYS C . n 
B 1 5   PRO 5   305 305 PRO PRO C . n 
B 1 6   ILE 6   306 306 ILE ILE C . n 
B 1 7   VAL 7   307 307 VAL VAL C . n 
B 1 8   LEU 8   308 308 LEU LEU C . n 
B 1 9   SER 9   309 309 SER SER C . n 
B 1 10  THR 10  310 310 THR THR C . n 
B 1 11  TRP 11  311 311 TRP TRP C . n 
B 1 12  ASN 12  312 312 ASN ASN C . n 
B 1 13  PHE 13  313 313 PHE PHE C . n 
B 1 14  GLY 14  314 314 GLY GLY C . n 
B 1 15  LEU 15  315 315 LEU LEU C . n 
B 1 16  HIS 16  316 316 HIS HIS C . n 
B 1 17  ALA 17  317 317 ALA ALA C . n 
B 1 18  ASN 18  318 318 ASN ASN C . n 
B 1 19  VAL 19  319 319 VAL VAL C . n 
B 1 20  GLU 20  320 320 GLU GLU C . n 
B 1 21  ALA 21  321 321 ALA ALA C . n 
B 1 22  TRP 22  322 322 TRP TRP C . n 
B 1 23  LYS 23  323 323 LYS LYS C . n 
B 1 24  VAL 24  324 324 VAL VAL C . n 
B 1 25  LEU 25  325 325 LEU LEU C . n 
B 1 26  SER 26  326 326 SER SER C . n 
B 1 27  LYS 27  327 327 LYS LYS C . n 
B 1 28  GLY 28  328 328 GLY GLY C . n 
B 1 29  GLY 29  329 329 GLY GLY C . n 
B 1 30  LYS 30  330 330 LYS LYS C . n 
B 1 31  ALA 31  331 331 ALA ALA C . n 
B 1 32  LEU 32  332 332 LEU LEU C . n 
B 1 33  ASP 33  333 333 ASP ASP C . n 
B 1 34  ALA 34  334 334 ALA ALA C . n 
B 1 35  VAL 35  335 335 VAL VAL C . n 
B 1 36  GLU 36  336 336 GLU GLU C . n 
B 1 37  LYS 37  337 337 LYS LYS C . n 
B 1 38  GLY 38  338 338 GLY GLY C . n 
B 1 39  VAL 39  339 339 VAL VAL C . n 
B 1 40  ARG 40  340 340 ARG ARG C . n 
B 1 41  LEU 41  341 341 LEU LEU C . n 
B 1 42  VAL 42  342 342 VAL VAL C . n 
B 1 43  GLU 43  343 343 GLU GLU C . n 
B 1 44  ASP 44  344 344 ASP ASP C . n 
B 1 45  ASP 45  345 345 ASP ASP C . n 
B 1 46  PRO 46  346 346 PRO PRO C . n 
B 1 47  THR 47  347 347 THR THR C . n 
B 1 48  GLU 48  348 348 GLU GLU C . n 
B 1 49  ARG 49  349 349 ARG ARG C . n 
B 1 50  SER 50  350 350 SER SER C . n 
B 1 51  VAL 51  351 351 VAL VAL C . n 
B 1 52  GLY 52  352 352 GLY GLY C . n 
B 1 53  TYR 53  353 353 TYR TYR C . n 
B 1 54  GLY 54  354 354 GLY GLY C . n 
B 1 55  GLY 55  355 355 GLY GLY C . n 
B 1 56  ARG 56  356 356 ARG ARG C . n 
B 1 57  PRO 57  357 357 PRO PRO C . n 
B 1 58  ASP 58  358 358 ASP ASP C . n 
B 1 59  ARG 59  359 359 ARG ARG C . n 
B 1 60  ASP 60  360 360 ASP ASP C . n 
B 1 61  GLY 61  361 361 GLY GLY C . n 
B 1 62  ARG 62  362 362 ARG ARG C . n 
B 1 63  VAL 63  363 363 VAL VAL C . n 
B 1 64  THR 64  364 364 THR THR C . n 
B 1 65  LEU 65  365 365 LEU LEU C . n 
B 1 66  ASP 66  366 366 ASP ASP C . n 
B 1 67  ALA 67  367 367 ALA ALA C . n 
B 1 68  CYS 68  368 368 CYS CYS C . n 
B 1 69  ILE 69  369 369 ILE ILE C . n 
B 1 70  MET 70  370 370 MET MET C . n 
B 1 71  ASP 71  371 371 ASP ASP C . n 
B 1 72  GLU 72  372 372 GLU GLU C . n 
B 1 73  ASN 73  373 373 ASN ASN C . n 
B 1 74  TYR 74  374 374 TYR TYR C . n 
B 1 75  ASN 75  375 375 ASN ASN C . n 
B 1 76  ILE 76  376 376 ILE ILE C . n 
B 1 77  GLY 77  377 377 GLY GLY C . n 
B 1 78  SER 78  378 378 SER SER C . n 
B 1 79  VAL 79  379 379 VAL VAL C . n 
B 1 80  ALA 80  380 380 ALA ALA C . n 
B 1 81  CYS 81  381 381 CYS CYS C . n 
B 1 82  MET 82  382 382 MET MET C . n 
B 1 83  GLU 83  383 383 GLU GLU C . n 
B 1 84  HIS 84  384 384 HIS HIS C . n 
B 1 85  ILE 85  385 385 ILE ILE C . n 
B 1 86  LYS 86  386 386 LYS LYS C . n 
B 1 87  ASN 87  387 387 ASN ASN C . n 
B 1 88  PRO 88  388 388 PRO PRO C . n 
B 1 89  ILE 89  389 389 ILE ILE C . n 
B 1 90  SER 90  390 390 SER SER C . n 
B 1 91  VAL 91  391 391 VAL VAL C . n 
B 1 92  ALA 92  392 392 ALA ALA C . n 
B 1 93  ARG 93  393 393 ARG ARG C . n 
B 1 94  ALA 94  394 394 ALA ALA C . n 
B 1 95  VAL 95  395 395 VAL VAL C . n 
B 1 96  MET 96  396 396 MET MET C . n 
B 1 97  GLU 97  397 397 GLU GLU C . n 
B 1 98  LYS 98  398 398 LYS LYS C . n 
B 1 99  THR 99  399 399 THR THR C . n 
B 1 100 PRO 100 400 400 PRO PRO C . n 
B 1 101 HIS 101 401 401 HIS HIS C . n 
B 1 102 VAL 102 402 402 VAL VAL C . n 
B 1 103 MET 103 403 403 MET MET C . n 
B 1 104 LEU 104 404 404 LEU LEU C . n 
B 1 105 VAL 105 405 405 VAL VAL C . n 
B 1 106 GLY 106 406 406 GLY GLY C . n 
B 1 107 ASP 107 407 407 ASP ASP C . n 
B 1 108 GLY 108 408 408 GLY GLY C . n 
B 1 109 ALA 109 409 409 ALA ALA C . n 
B 1 110 LEU 110 410 410 LEU LEU C . n 
B 1 111 GLU 111 411 411 GLU GLU C . n 
B 1 112 PHE 112 412 412 PHE PHE C . n 
B 1 113 ALA 113 413 413 ALA ALA C . n 
B 1 114 LEU 114 414 414 LEU LEU C . n 
B 1 115 SER 115 415 415 SER SER C . n 
B 1 116 GLN 116 416 416 GLN GLN C . n 
B 1 117 GLY 117 417 417 GLY GLY C . n 
B 1 118 PHE 118 418 418 PHE PHE C . n 
B 1 119 LYS 119 419 419 LYS LYS C . n 
B 1 120 LYS 120 420 420 LYS LYS C . n 
B 1 121 GLU 121 421 421 GLU GLU C . n 
B 1 122 ASN 122 422 422 ASN ASN C . n 
B 1 123 LEU 123 423 423 LEU LEU C . n 
B 1 124 LEU 124 424 424 LEU LEU C . n 
B 1 125 THR 125 425 425 THR THR C . n 
B 1 126 ALA 126 426 426 ALA ALA C . n 
B 1 127 GLU 127 427 427 GLU GLU C . n 
B 1 128 SER 128 428 428 SER SER C . n 
B 1 129 GLU 129 429 429 GLU GLU C . n 
B 1 130 LYS 130 430 430 LYS LYS C . n 
B 1 131 GLU 131 431 431 GLU GLU C . n 
B 1 132 TRP 132 432 432 TRP TRP C . n 
B 1 133 LYS 133 433 433 LYS LYS C . n 
B 1 134 GLU 134 434 434 GLU GLU C . n 
B 1 135 TRP 135 435 435 TRP TRP C . n 
B 1 136 LEU 136 436 436 LEU LEU C . n 
B 1 137 LYS 137 437 437 LYS LYS C . n 
B 1 138 THR 138 438 438 THR THR C . n 
B 1 139 SER 139 439 439 SER SER C . n 
B 1 140 GLN 140 440 440 GLN GLN C . n 
B 1 141 TYR 141 441 441 TYR TYR C . n 
B 1 142 LYS 142 442 442 LYS LYS C . n 
B 1 143 PRO 143 443 443 PRO PRO C . n 
B 1 144 ILE 144 444 444 ILE ILE C . n 
B 1 145 VAL 145 445 445 VAL VAL C . n 
B 1 146 ASN 146 446 446 ASN ASN C . n 
B 1 147 ILE 147 447 447 ILE ILE C . n 
B 1 148 GLU 148 448 448 GLU GLU C . n 
B 1 149 ASN 149 449 449 ASN ASN C . n 
B 1 150 HIS 150 450 450 HIS HIS C . n 
B 1 151 ASN 151 451 451 ASN ASN C . n 
B 1 152 THR 152 452 452 THR THR C . n 
B 1 153 ILE 153 453 453 ILE ILE C . n 
B 1 154 GLY 154 454 454 GLY GLY C . n 
B 1 155 MET 155 455 455 MET MET C . n 
B 1 156 ILE 156 456 456 ILE ILE C . n 
B 1 157 ALA 157 457 457 ALA ALA C . n 
B 1 158 LEU 158 458 458 LEU LEU C . n 
B 1 159 ASP 159 459 459 ASP ASP C . n 
B 1 160 ALA 160 460 460 ALA ALA C . n 
B 1 161 GLN 161 461 461 GLN GLN C . n 
B 1 162 GLY 162 462 462 GLY GLY C . n 
B 1 163 ASN 163 463 463 ASN ASN C . n 
B 1 164 LEU 164 464 464 LEU LEU C . n 
B 1 165 SER 165 465 465 SER SER C . n 
B 1 166 GLY 166 466 466 GLY GLY C . n 
B 1 167 ALA 167 467 467 ALA ALA C . n 
B 1 168 CYS 168 468 468 CYS CYS C . n 
B 1 169 THR 169 469 469 THR THR C . n 
B 1 170 THR 170 470 470 THR THR C . n 
B 1 171 SER 171 471 471 SER SER C . n 
B 1 172 GLY 172 472 472 GLY GLY C . n 
B 1 173 MET 173 473 473 MET MET C . n 
B 1 174 ALA 174 474 474 ALA ALA C . n 
B 1 175 TYR 175 475 475 TYR TYR C . n 
B 1 176 LYS 176 476 476 LYS LYS C . n 
B 1 177 MET 177 477 477 MET MET C . n 
B 1 178 HIS 178 478 478 HIS HIS C . n 
B 1 179 GLY 179 479 479 GLY GLY C . n 
B 1 180 ARG 180 480 480 ARG ARG C . n 
B 1 181 VAL 181 481 481 VAL VAL C . n 
B 1 182 GLY 182 482 482 GLY GLY C . n 
B 1 183 ASP 183 483 483 ASP ASP C . n 
B 1 184 SER 184 484 484 SER SER C . n 
B 1 185 PRO 185 485 485 PRO PRO C . n 
B 1 186 ILE 186 486 486 ILE ILE C . n 
B 1 187 ILE 187 487 487 ILE ILE C . n 
B 1 188 GLY 188 488 488 GLY GLY C . n 
B 1 189 ALA 189 489 489 ALA ALA C . n 
B 1 190 GLY 190 490 490 GLY GLY C . n 
B 1 191 LEU 191 491 491 LEU LEU C . n 
B 1 192 PHE 192 492 492 PHE PHE C . n 
B 1 193 VAL 193 493 493 VAL VAL C . n 
B 1 194 ASP 194 494 494 ASP ASP C . n 
B 1 195 ASN 195 495 495 ASN ASN C . n 
B 1 196 GLU 196 496 496 GLU GLU C . n 
B 1 197 ILE 197 497 497 ILE ILE C . n 
B 1 198 GLY 198 498 498 GLY GLY C . n 
B 1 199 ALA 199 499 499 ALA ALA C . n 
B 1 200 ALA 200 500 500 ALA ALA C . n 
B 1 201 THR 201 501 501 THR THR C . n 
B 1 202 ALA 202 502 502 ALA ALA C . n 
B 1 203 THR 203 503 503 THR THR C . n 
B 1 204 GLY 204 504 504 GLY GLY C . n 
B 1 205 HIS 205 505 505 HIS HIS C . n 
B 1 206 GLY 206 506 506 GLY GLY C . n 
B 1 207 GLU 207 507 507 GLU GLU C . n 
B 1 208 GLU 208 508 508 GLU GLU C . n 
B 1 209 VAL 209 509 509 VAL VAL C . n 
B 1 210 ILE 210 510 510 ILE ILE C . n 
B 1 211 ARG 211 511 511 ARG ARG C . n 
B 1 212 THR 212 512 512 THR THR C . n 
B 1 213 VAL 213 513 513 VAL VAL C . n 
B 1 214 GLY 214 514 514 GLY GLY C . n 
B 1 215 THR 215 515 515 THR THR C . n 
B 1 216 HIS 216 516 516 HIS HIS C . n 
B 1 217 LEU 217 517 517 LEU LEU C . n 
B 1 218 VAL 218 518 518 VAL VAL C . n 
B 1 219 VAL 219 519 519 VAL VAL C . n 
B 1 220 GLU 220 520 520 GLU GLU C . n 
B 1 221 LEU 221 521 521 LEU LEU C . n 
B 1 222 MET 222 522 522 MET MET C . n 
B 1 223 ASN 223 523 523 ASN ASN C . n 
B 1 224 GLN 224 524 524 GLN GLN C . n 
B 1 225 GLY 225 525 525 GLY GLY C . n 
B 1 226 ARG 226 526 526 ARG ARG C . n 
B 1 227 THR 227 527 527 THR THR C . n 
B 1 228 PRO 228 528 528 PRO PRO C . n 
B 1 229 GLN 229 529 529 GLN GLN C . n 
B 1 230 GLN 230 530 530 GLN GLN C . n 
B 1 231 ALA 231 531 531 ALA ALA C . n 
B 1 232 CYS 232 532 532 CYS CYS C . n 
B 1 233 LYS 233 533 533 LYS LYS C . n 
B 1 234 GLU 234 534 534 GLU GLU C . n 
B 1 235 ALA 235 535 535 ALA ALA C . n 
B 1 236 VAL 236 536 536 VAL VAL C . n 
B 1 237 GLU 237 537 537 GLU GLU C . n 
B 1 238 ARG 238 538 538 ARG ARG C . n 
B 1 239 ILE 239 539 539 ILE ILE C . n 
B 1 240 VAL 240 540 540 VAL VAL C . n 
B 1 241 LYS 241 541 541 LYS LYS C . n 
B 1 242 ILE 242 542 542 ILE ILE C . n 
B 1 243 VAL 243 543 543 VAL VAL C . n 
B 1 244 ASN 244 544 544 ASN ASN C . n 
B 1 245 ARG 245 545 545 ARG ARG C . n 
B 1 246 ARG 246 546 546 ARG ARG C . n 
B 1 247 GLY 247 547 547 GLY GLY C . n 
B 1 248 LYS 248 548 548 LYS LYS C . n 
B 1 249 ASN 249 549 549 ASN ASN C . n 
B 1 250 LEU 250 550 550 LEU LEU C . n 
B 1 251 LYS 251 551 551 LYS LYS C . n 
B 1 252 ASP 252 552 552 ASP ASP C . n 
B 1 253 ILE 253 553 553 ILE ILE C . n 
B 1 254 GLN 254 554 554 GLN GLN C . n 
B 1 255 VAL 255 555 555 VAL VAL C . n 
B 1 256 GLY 256 556 556 GLY GLY C . n 
B 1 257 PHE 257 557 557 PHE PHE C . n 
B 1 258 ILE 258 558 558 ILE ILE C . n 
B 1 259 ALA 259 559 559 ALA ALA C . n 
B 1 260 LEU 260 560 560 LEU LEU C . n 
B 1 261 ASN 261 561 561 ASN ASN C . n 
B 1 262 LYS 262 562 562 LYS LYS C . n 
B 1 263 LYS 263 563 563 LYS LYS C . n 
B 1 264 GLY 264 564 564 GLY GLY C . n 
B 1 265 GLU 265 565 565 GLU GLU C . n 
B 1 266 TYR 266 566 566 TYR TYR C . n 
B 1 267 GLY 267 567 567 GLY GLY C . n 
B 1 268 ALA 268 568 568 ALA ALA C . n 
B 1 269 TYR 269 569 569 TYR TYR C . n 
B 1 270 CYS 270 570 570 CYS CYS C . n 
B 1 271 ILE 271 571 571 ILE ILE C . n 
B 1 272 GLN 272 572 572 GLN GLN C . n 
B 1 273 ASP 273 573 573 ASP ASP C . n 
B 1 274 GLY 274 574 574 GLY GLY C . n 
B 1 275 PHE 275 575 575 PHE PHE C . n 
B 1 276 ASN 276 576 576 ASN ASN C . n 
B 1 277 PHE 277 577 577 PHE PHE C . n 
B 1 278 ALA 278 578 578 ALA ALA C . n 
B 1 279 VAL 279 579 579 VAL VAL C . n 
B 1 280 HIS 280 580 580 HIS HIS C . n 
B 1 281 ASP 281 581 581 ASP ASP C . n 
B 1 282 GLN 282 582 582 GLN GLN C . n 
B 1 283 LYS 283 583 583 LYS LYS C . n 
B 1 284 GLY 284 584 584 GLY GLY C . n 
B 1 285 ASN 285 585 585 ASN ASN C . n 
B 1 286 ARG 286 586 586 ARG ARG C . n 
B 1 287 LEU 287 587 587 LEU LEU C . n 
B 1 288 GLU 288 588 588 GLU GLU C . n 
B 1 289 THR 289 589 589 THR THR C . n 
B 1 290 PRO 290 590 590 PRO PRO C . n 
B 1 291 GLY 291 591 591 GLY GLY C . n 
B 1 292 PHE 292 592 592 PHE PHE C . n 
B 1 293 ALA 293 593 593 ALA ALA C . n 
B 1 294 LEU 294 594 594 LEU LEU C . n 
B 1 295 LYS 295 595 595 LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GLY 1   296 1   GLY GLY A . 
D 2 GLY 1   596 2   GLY GLY C . 
E 3 HOH 1   297 1   HOH HOH A . 
E 3 HOH 2   298 2   HOH HOH A . 
E 3 HOH 3   299 3   HOH HOH A . 
E 3 HOH 4   300 12  HOH HOH A . 
E 3 HOH 5   301 14  HOH HOH A . 
E 3 HOH 6   302 21  HOH HOH A . 
E 3 HOH 7   303 24  HOH HOH A . 
E 3 HOH 8   304 26  HOH HOH A . 
E 3 HOH 9   305 33  HOH HOH A . 
E 3 HOH 10  306 34  HOH HOH A . 
E 3 HOH 11  307 36  HOH HOH A . 
E 3 HOH 12  308 38  HOH HOH A . 
E 3 HOH 13  309 40  HOH HOH A . 
E 3 HOH 14  310 41  HOH HOH A . 
E 3 HOH 15  311 46  HOH HOH A . 
E 3 HOH 16  312 47  HOH HOH A . 
E 3 HOH 17  313 51  HOH HOH A . 
E 3 HOH 18  314 52  HOH HOH A . 
E 3 HOH 19  315 53  HOH HOH A . 
E 3 HOH 20  316 54  HOH HOH A . 
E 3 HOH 21  317 55  HOH HOH A . 
E 3 HOH 22  318 57  HOH HOH A . 
E 3 HOH 23  319 58  HOH HOH A . 
E 3 HOH 24  320 60  HOH HOH A . 
E 3 HOH 25  321 61  HOH HOH A . 
E 3 HOH 26  322 63  HOH HOH A . 
E 3 HOH 27  323 64  HOH HOH A . 
E 3 HOH 28  324 65  HOH HOH A . 
E 3 HOH 29  325 67  HOH HOH A . 
E 3 HOH 30  326 68  HOH HOH A . 
E 3 HOH 31  327 69  HOH HOH A . 
E 3 HOH 32  328 71  HOH HOH A . 
E 3 HOH 33  329 76  HOH HOH A . 
E 3 HOH 34  330 78  HOH HOH A . 
E 3 HOH 35  331 81  HOH HOH A . 
E 3 HOH 36  332 84  HOH HOH A . 
E 3 HOH 37  333 85  HOH HOH A . 
E 3 HOH 38  334 88  HOH HOH A . 
E 3 HOH 39  335 90  HOH HOH A . 
E 3 HOH 40  336 95  HOH HOH A . 
E 3 HOH 41  337 97  HOH HOH A . 
E 3 HOH 42  338 99  HOH HOH A . 
E 3 HOH 43  339 100 HOH HOH A . 
E 3 HOH 44  340 102 HOH HOH A . 
E 3 HOH 45  341 103 HOH HOH A . 
E 3 HOH 46  342 104 HOH HOH A . 
E 3 HOH 47  343 107 HOH HOH A . 
E 3 HOH 48  344 109 HOH HOH A . 
E 3 HOH 49  345 110 HOH HOH A . 
E 3 HOH 50  346 111 HOH HOH A . 
E 3 HOH 51  347 116 HOH HOH A . 
E 3 HOH 52  348 117 HOH HOH A . 
E 3 HOH 53  349 118 HOH HOH A . 
E 3 HOH 54  350 119 HOH HOH A . 
E 3 HOH 55  351 127 HOH HOH A . 
E 3 HOH 56  352 129 HOH HOH A . 
E 3 HOH 57  353 132 HOH HOH A . 
E 3 HOH 58  354 133 HOH HOH A . 
E 3 HOH 59  355 138 HOH HOH A . 
E 3 HOH 60  356 139 HOH HOH A . 
E 3 HOH 61  357 140 HOH HOH A . 
E 3 HOH 62  358 142 HOH HOH A . 
E 3 HOH 63  359 143 HOH HOH A . 
E 3 HOH 64  360 144 HOH HOH A . 
E 3 HOH 65  361 146 HOH HOH A . 
E 3 HOH 66  362 147 HOH HOH A . 
E 3 HOH 67  363 149 HOH HOH A . 
E 3 HOH 68  364 151 HOH HOH A . 
E 3 HOH 69  365 154 HOH HOH A . 
E 3 HOH 70  366 155 HOH HOH A . 
E 3 HOH 71  367 157 HOH HOH A . 
E 3 HOH 72  368 158 HOH HOH A . 
E 3 HOH 73  369 161 HOH HOH A . 
E 3 HOH 74  370 165 HOH HOH A . 
E 3 HOH 75  371 166 HOH HOH A . 
E 3 HOH 76  372 168 HOH HOH A . 
E 3 HOH 77  373 173 HOH HOH A . 
E 3 HOH 78  374 174 HOH HOH A . 
E 3 HOH 79  375 178 HOH HOH A . 
E 3 HOH 80  376 181 HOH HOH A . 
E 3 HOH 81  377 182 HOH HOH A . 
E 3 HOH 82  378 187 HOH HOH A . 
E 3 HOH 83  379 189 HOH HOH A . 
E 3 HOH 84  380 190 HOH HOH A . 
E 3 HOH 85  381 192 HOH HOH A . 
E 3 HOH 86  382 195 HOH HOH A . 
E 3 HOH 87  383 197 HOH HOH A . 
E 3 HOH 88  384 198 HOH HOH A . 
E 3 HOH 89  385 200 HOH HOH A . 
E 3 HOH 90  386 202 HOH HOH A . 
E 3 HOH 91  387 203 HOH HOH A . 
E 3 HOH 92  388 205 HOH HOH A . 
E 3 HOH 93  389 208 HOH HOH A . 
E 3 HOH 94  390 209 HOH HOH A . 
F 3 HOH 1   4   4   HOH HOH C . 
F 3 HOH 2   5   5   HOH HOH C . 
F 3 HOH 3   6   6   HOH HOH C . 
F 3 HOH 4   7   7   HOH HOH C . 
F 3 HOH 5   8   8   HOH HOH C . 
F 3 HOH 6   9   9   HOH HOH C . 
F 3 HOH 7   10  10  HOH HOH C . 
F 3 HOH 8   11  11  HOH HOH C . 
F 3 HOH 9   13  13  HOH HOH C . 
F 3 HOH 10  15  15  HOH HOH C . 
F 3 HOH 11  16  16  HOH HOH C . 
F 3 HOH 12  17  17  HOH HOH C . 
F 3 HOH 13  18  18  HOH HOH C . 
F 3 HOH 14  19  19  HOH HOH C . 
F 3 HOH 15  20  20  HOH HOH C . 
F 3 HOH 16  22  22  HOH HOH C . 
F 3 HOH 17  23  23  HOH HOH C . 
F 3 HOH 18  25  25  HOH HOH C . 
F 3 HOH 19  27  27  HOH HOH C . 
F 3 HOH 20  28  28  HOH HOH C . 
F 3 HOH 21  29  29  HOH HOH C . 
F 3 HOH 22  30  30  HOH HOH C . 
F 3 HOH 23  31  31  HOH HOH C . 
F 3 HOH 24  32  32  HOH HOH C . 
F 3 HOH 25  35  35  HOH HOH C . 
F 3 HOH 26  37  37  HOH HOH C . 
F 3 HOH 27  39  39  HOH HOH C . 
F 3 HOH 28  42  42  HOH HOH C . 
F 3 HOH 29  43  43  HOH HOH C . 
F 3 HOH 30  44  44  HOH HOH C . 
F 3 HOH 31  45  45  HOH HOH C . 
F 3 HOH 32  48  48  HOH HOH C . 
F 3 HOH 33  49  49  HOH HOH C . 
F 3 HOH 34  50  50  HOH HOH C . 
F 3 HOH 35  56  56  HOH HOH C . 
F 3 HOH 36  59  59  HOH HOH C . 
F 3 HOH 37  62  62  HOH HOH C . 
F 3 HOH 38  66  66  HOH HOH C . 
F 3 HOH 39  70  70  HOH HOH C . 
F 3 HOH 40  72  72  HOH HOH C . 
F 3 HOH 41  73  73  HOH HOH C . 
F 3 HOH 42  74  74  HOH HOH C . 
F 3 HOH 43  75  75  HOH HOH C . 
F 3 HOH 44  77  77  HOH HOH C . 
F 3 HOH 45  79  79  HOH HOH C . 
F 3 HOH 46  80  80  HOH HOH C . 
F 3 HOH 47  82  82  HOH HOH C . 
F 3 HOH 48  83  83  HOH HOH C . 
F 3 HOH 49  86  86  HOH HOH C . 
F 3 HOH 50  87  87  HOH HOH C . 
F 3 HOH 51  89  89  HOH HOH C . 
F 3 HOH 52  91  91  HOH HOH C . 
F 3 HOH 53  92  92  HOH HOH C . 
F 3 HOH 54  93  93  HOH HOH C . 
F 3 HOH 55  94  94  HOH HOH C . 
F 3 HOH 56  96  96  HOH HOH C . 
F 3 HOH 57  98  98  HOH HOH C . 
F 3 HOH 58  101 101 HOH HOH C . 
F 3 HOH 59  105 105 HOH HOH C . 
F 3 HOH 60  106 106 HOH HOH C . 
F 3 HOH 61  108 108 HOH HOH C . 
F 3 HOH 62  112 112 HOH HOH C . 
F 3 HOH 63  113 113 HOH HOH C . 
F 3 HOH 64  114 114 HOH HOH C . 
F 3 HOH 65  115 115 HOH HOH C . 
F 3 HOH 66  120 120 HOH HOH C . 
F 3 HOH 67  121 121 HOH HOH C . 
F 3 HOH 68  122 122 HOH HOH C . 
F 3 HOH 69  123 123 HOH HOH C . 
F 3 HOH 70  124 124 HOH HOH C . 
F 3 HOH 71  125 125 HOH HOH C . 
F 3 HOH 72  126 126 HOH HOH C . 
F 3 HOH 73  128 128 HOH HOH C . 
F 3 HOH 74  130 130 HOH HOH C . 
F 3 HOH 75  131 131 HOH HOH C . 
F 3 HOH 76  134 134 HOH HOH C . 
F 3 HOH 77  135 135 HOH HOH C . 
F 3 HOH 78  136 136 HOH HOH C . 
F 3 HOH 79  137 137 HOH HOH C . 
F 3 HOH 80  141 141 HOH HOH C . 
F 3 HOH 81  145 145 HOH HOH C . 
F 3 HOH 82  148 148 HOH HOH C . 
F 3 HOH 83  150 150 HOH HOH C . 
F 3 HOH 84  152 152 HOH HOH C . 
F 3 HOH 85  153 153 HOH HOH C . 
F 3 HOH 86  156 156 HOH HOH C . 
F 3 HOH 87  159 159 HOH HOH C . 
F 3 HOH 88  160 160 HOH HOH C . 
F 3 HOH 89  162 162 HOH HOH C . 
F 3 HOH 90  163 163 HOH HOH C . 
F 3 HOH 91  164 164 HOH HOH C . 
F 3 HOH 92  167 167 HOH HOH C . 
F 3 HOH 93  169 169 HOH HOH C . 
F 3 HOH 94  170 170 HOH HOH C . 
F 3 HOH 95  171 171 HOH HOH C . 
F 3 HOH 96  172 172 HOH HOH C . 
F 3 HOH 97  175 175 HOH HOH C . 
F 3 HOH 98  176 176 HOH HOH C . 
F 3 HOH 99  177 177 HOH HOH C . 
F 3 HOH 100 179 179 HOH HOH C . 
F 3 HOH 101 180 180 HOH HOH C . 
F 3 HOH 102 183 183 HOH HOH C . 
F 3 HOH 103 184 184 HOH HOH C . 
F 3 HOH 104 185 185 HOH HOH C . 
F 3 HOH 105 186 186 HOH HOH C . 
F 3 HOH 106 188 188 HOH HOH C . 
F 3 HOH 107 191 191 HOH HOH C . 
F 3 HOH 108 193 193 HOH HOH C . 
F 3 HOH 109 194 194 HOH HOH C . 
F 3 HOH 110 196 196 HOH HOH C . 
F 3 HOH 111 199 199 HOH HOH C . 
F 3 HOH 112 201 201 HOH HOH C . 
F 3 HOH 113 204 204 HOH HOH C . 
F 3 HOH 114 206 206 HOH HOH C . 
F 3 HOH 115 207 207 HOH HOH C . 
F 3 HOH 116 210 210 HOH HOH C . 
F 3 HOH 117 211 211 HOH HOH C . 
F 3 HOH 118 212 212 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4050  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  19840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-05-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    201 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    211 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             0.00 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 11  ? ? 62.73   174.27  
2  1 ASN A 87  ? ? -115.48 72.77   
3  1 LYS A 142 ? ? -153.15 77.54   
4  1 ALA A 189 ? ? -101.51 -85.52  
5  1 ILE A 197 ? ? -122.48 -63.24  
6  1 ASP A 281 ? ? -145.60 -159.53 
7  1 LEU A 294 ? ? -68.13  95.45   
8  1 TRP C 311 ? ? 66.79   171.42  
9  1 ASP C 371 ? ? -100.03 -163.97 
10 1 ASN C 387 ? ? -119.80 75.43   
11 1 ALA C 489 ? ? -101.58 -84.87  
12 1 ILE C 497 ? ? -132.00 -64.70  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 119 ? CG  ? A LYS 119 CG  
2  1 Y 0 A LYS 119 ? CD  ? A LYS 119 CD  
3  1 Y 0 A LYS 119 ? CE  ? A LYS 119 CE  
4  1 Y 0 A LYS 119 ? NZ  ? A LYS 119 NZ  
5  1 Y 0 A LYS 130 ? CE  ? A LYS 130 CE  
6  1 Y 0 A LYS 130 ? NZ  ? A LYS 130 NZ  
7  1 Y 0 A LYS 142 ? CG  ? A LYS 142 CG  
8  1 Y 0 A LYS 142 ? CD  ? A LYS 142 CD  
9  1 Y 0 A LYS 142 ? CE  ? A LYS 142 CE  
10 1 Y 0 A LYS 142 ? NZ  ? A LYS 142 NZ  
11 1 Y 0 A ILE 147 ? CG1 ? A ILE 147 CG1 
12 1 Y 0 A ILE 147 ? CG2 ? A ILE 147 CG2 
13 1 Y 0 A ILE 147 ? CD1 ? A ILE 147 CD1 
14 1 Y 0 A GLU 148 ? CG  ? A GLU 148 CG  
15 1 Y 0 A GLU 148 ? CD  ? A GLU 148 CD  
16 1 Y 0 A GLU 148 ? OE1 ? A GLU 148 OE1 
17 1 Y 0 A GLU 148 ? OE2 ? A GLU 148 OE2 
18 1 Y 0 A LYS 283 ? CD  ? A LYS 283 CD  
19 1 Y 0 A LYS 283 ? CE  ? A LYS 283 CE  
20 1 Y 0 A LYS 283 ? NZ  ? A LYS 283 NZ  
21 1 Y 0 C LYS 419 ? CD  ? B LYS 119 CD  
22 1 Y 0 C LYS 419 ? CE  ? B LYS 119 CE  
23 1 Y 0 C LYS 419 ? NZ  ? B LYS 119 NZ  
24 1 Y 0 C LYS 430 ? CD  ? B LYS 130 CD  
25 1 Y 0 C LYS 430 ? CE  ? B LYS 130 CE  
26 1 Y 0 C LYS 430 ? NZ  ? B LYS 130 NZ  
27 1 Y 0 C GLU 448 ? CD  ? B GLU 148 CD  
28 1 Y 0 C GLU 448 ? OE1 ? B GLU 148 OE1 
29 1 Y 0 C GLU 448 ? OE2 ? B GLU 148 OE2 
30 1 Y 0 C LYS 563 ? CE  ? B LYS 263 CE  
31 1 Y 0 C LYS 563 ? NZ  ? B LYS 263 NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCINE GLY 
3 water   HOH 
#