data_1P57
# 
_entry.id   1P57 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P57         
RCSB  RCSB019021   
WWPDB D_1000019021 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P57 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Somoza, J.R.'     1  
'Ho, J.D.'         2  
'Luong, C.'        3  
'Sprengeler, P.A.' 4  
'Mortara, K.'      5  
'Shrader, W.D.'    6  
'Sperandio, D.'    7  
'Chan, H.'         8  
'McGrath, M.E.'    9  
'Katz, B.A.'       10 
# 
_citation.id                        primary 
_citation.title                     
;The Structure of the Extracellular Region of Human Hepsin Reveals a Serine Protease Domain and a Novel Scavenger Receptor Cysteine-Rich (SRCR) Domain
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                1123 
_citation.page_last                 1131 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12962630 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00148-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Somoza, J.R.'     1  
primary 'Ho, J.D.'         2  
primary 'Luong, C.'        3  
primary 'Ghate, M.'        4  
primary 'Sprengeler, P.A.' 5  
primary 'Mortara, K.'      6  
primary 'Shrader, W.D.'    7  
primary 'Sperandio, D.'    8  
primary 'Chan, H.'         9  
primary 'McGrath, M.E.'    10 
primary 'Katz, B.A.'       11 
# 
_cell.entry_id           1P57 
_cell.length_a           58.800 
_cell.length_b           47.800 
_cell.length_c           63.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1P57 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine protease hepsin'                                      12522.299 1   3.4.21.- N112A 
'Residues 1-114 (Light chain)'  ? 
2 polymer     man 'Serine protease hepsin'                                      27573.111 1   3.4.21.- ?     
'Residues 16-255 (Heavy chain)' ? 
3 non-polymer syn '2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BENZENOLATE' 252.271   1   ?        ?     ? ? 
4 water       nat water                                                         18.015    277 ?        ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Transmembrane protease, serine 1' 
2 'Transmembrane protease, serine 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRL
PHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP
;
;SDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRL
PHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP
;
A ? 
2 'polypeptide(L)' no no 
;IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGG
YLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVC
NGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQ
AIKTHSEASGMVTQL
;
;IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGG
YLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVC
NGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQ
AIKTHSEASGMVTQL
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASP n 
1 3   GLN n 
1 4   GLU n 
1 5   PRO n 
1 6   LEU n 
1 7   TYR n 
1 8   PRO n 
1 9   VAL n 
1 10  GLN n 
1 11  VAL n 
1 12  SER n 
1 13  SER n 
1 14  ALA n 
1 15  ASP n 
1 16  ALA n 
1 17  ARG n 
1 18  LEU n 
1 19  MET n 
1 20  VAL n 
1 21  PHE n 
1 22  ASP n 
1 23  LYS n 
1 24  THR n 
1 25  GLU n 
1 26  GLY n 
1 27  THR n 
1 28  TRP n 
1 29  ARG n 
1 30  LEU n 
1 31  LEU n 
1 32  CYS n 
1 33  SER n 
1 34  SER n 
1 35  ARG n 
1 36  SER n 
1 37  ASN n 
1 38  ALA n 
1 39  ARG n 
1 40  VAL n 
1 41  ALA n 
1 42  GLY n 
1 43  LEU n 
1 44  SER n 
1 45  CYS n 
1 46  GLU n 
1 47  GLU n 
1 48  MET n 
1 49  GLY n 
1 50  PHE n 
1 51  LEU n 
1 52  ARG n 
1 53  ALA n 
1 54  LEU n 
1 55  THR n 
1 56  HIS n 
1 57  SER n 
1 58  GLU n 
1 59  LEU n 
1 60  ASP n 
1 61  VAL n 
1 62  ARG n 
1 63  THR n 
1 64  ALA n 
1 65  GLY n 
1 66  ALA n 
1 67  ALA n 
1 68  GLY n 
1 69  THR n 
1 70  SER n 
1 71  GLY n 
1 72  PHE n 
1 73  PHE n 
1 74  CYS n 
1 75  VAL n 
1 76  ASP n 
1 77  GLU n 
1 78  GLY n 
1 79  ARG n 
1 80  LEU n 
1 81  PRO n 
1 82  HIS n 
1 83  THR n 
1 84  GLN n 
1 85  ARG n 
1 86  LEU n 
1 87  LEU n 
1 88  GLU n 
1 89  VAL n 
1 90  ILE n 
1 91  SER n 
1 92  VAL n 
1 93  CYS n 
1 94  ASP n 
1 95  CYS n 
1 96  PRO n 
1 97  ARG n 
1 98  GLY n 
1 99  ARG n 
1 100 PHE n 
1 101 LEU n 
1 102 ALA n 
1 103 ALA n 
1 104 ILE n 
1 105 CYS n 
1 106 GLN n 
1 107 ASP n 
1 108 CYS n 
1 109 GLY n 
1 110 ARG n 
1 111 ARG n 
1 112 LYS n 
1 113 LEU n 
1 114 PRO n 
2 1   ILE n 
2 2   VAL n 
2 3   GLY n 
2 4   GLY n 
2 5   ARG n 
2 6   ASP n 
2 7   THR n 
2 8   SER n 
2 9   LEU n 
2 10  GLY n 
2 11  ARG n 
2 12  TRP n 
2 13  PRO n 
2 14  TRP n 
2 15  GLN n 
2 16  VAL n 
2 17  SER n 
2 18  LEU n 
2 19  ARG n 
2 20  TYR n 
2 21  ASP n 
2 22  GLY n 
2 23  ALA n 
2 24  HIS n 
2 25  LEU n 
2 26  CYS n 
2 27  GLY n 
2 28  GLY n 
2 29  SER n 
2 30  LEU n 
2 31  LEU n 
2 32  SER n 
2 33  GLY n 
2 34  ASP n 
2 35  TRP n 
2 36  VAL n 
2 37  LEU n 
2 38  THR n 
2 39  ALA n 
2 40  ALA n 
2 41  HIS n 
2 42  CYS n 
2 43  PHE n 
2 44  PRO n 
2 45  GLU n 
2 46  ARG n 
2 47  ASN n 
2 48  ARG n 
2 49  VAL n 
2 50  LEU n 
2 51  SER n 
2 52  ARG n 
2 53  TRP n 
2 54  ARG n 
2 55  VAL n 
2 56  PHE n 
2 57  ALA n 
2 58  GLY n 
2 59  ALA n 
2 60  VAL n 
2 61  ALA n 
2 62  GLN n 
2 63  ALA n 
2 64  SER n 
2 65  PRO n 
2 66  HIS n 
2 67  GLY n 
2 68  LEU n 
2 69  GLN n 
2 70  LEU n 
2 71  GLY n 
2 72  VAL n 
2 73  GLN n 
2 74  ALA n 
2 75  VAL n 
2 76  VAL n 
2 77  TYR n 
2 78  HIS n 
2 79  GLY n 
2 80  GLY n 
2 81  TYR n 
2 82  LEU n 
2 83  PRO n 
2 84  PHE n 
2 85  ARG n 
2 86  ASP n 
2 87  PRO n 
2 88  ASN n 
2 89  SER n 
2 90  GLU n 
2 91  GLU n 
2 92  ASN n 
2 93  SER n 
2 94  ASN n 
2 95  ASP n 
2 96  ILE n 
2 97  ALA n 
2 98  LEU n 
2 99  VAL n 
2 100 HIS n 
2 101 LEU n 
2 102 SER n 
2 103 SER n 
2 104 PRO n 
2 105 LEU n 
2 106 PRO n 
2 107 LEU n 
2 108 THR n 
2 109 GLU n 
2 110 TYR n 
2 111 ILE n 
2 112 GLN n 
2 113 PRO n 
2 114 VAL n 
2 115 CYS n 
2 116 LEU n 
2 117 PRO n 
2 118 ALA n 
2 119 ALA n 
2 120 GLY n 
2 121 GLN n 
2 122 ALA n 
2 123 LEU n 
2 124 VAL n 
2 125 ASP n 
2 126 GLY n 
2 127 LYS n 
2 128 ILE n 
2 129 CYS n 
2 130 THR n 
2 131 VAL n 
2 132 THR n 
2 133 GLY n 
2 134 TRP n 
2 135 GLY n 
2 136 ASN n 
2 137 THR n 
2 138 GLN n 
2 139 TYR n 
2 140 TYR n 
2 141 GLY n 
2 142 GLN n 
2 143 GLN n 
2 144 ALA n 
2 145 GLY n 
2 146 VAL n 
2 147 LEU n 
2 148 GLN n 
2 149 GLU n 
2 150 ALA n 
2 151 ARG n 
2 152 VAL n 
2 153 PRO n 
2 154 ILE n 
2 155 ILE n 
2 156 SER n 
2 157 ASN n 
2 158 ASP n 
2 159 VAL n 
2 160 CYS n 
2 161 ASN n 
2 162 GLY n 
2 163 ALA n 
2 164 ASP n 
2 165 PHE n 
2 166 TYR n 
2 167 GLY n 
2 168 ASN n 
2 169 GLN n 
2 170 ILE n 
2 171 LYS n 
2 172 PRO n 
2 173 LYS n 
2 174 MET n 
2 175 PHE n 
2 176 CYS n 
2 177 ALA n 
2 178 GLY n 
2 179 TYR n 
2 180 PRO n 
2 181 GLU n 
2 182 GLY n 
2 183 GLY n 
2 184 ILE n 
2 185 ASP n 
2 186 ALA n 
2 187 CYS n 
2 188 GLN n 
2 189 GLY n 
2 190 ASP n 
2 191 SER n 
2 192 GLY n 
2 193 GLY n 
2 194 PRO n 
2 195 PHE n 
2 196 VAL n 
2 197 CYS n 
2 198 GLU n 
2 199 ASP n 
2 200 SER n 
2 201 ILE n 
2 202 SER n 
2 203 ARG n 
2 204 THR n 
2 205 PRO n 
2 206 ARG n 
2 207 TRP n 
2 208 ARG n 
2 209 LEU n 
2 210 CYS n 
2 211 GLY n 
2 212 ILE n 
2 213 VAL n 
2 214 SER n 
2 215 TRP n 
2 216 GLY n 
2 217 THR n 
2 218 GLY n 
2 219 CYS n 
2 220 ALA n 
2 221 LEU n 
2 222 ALA n 
2 223 GLN n 
2 224 LYS n 
2 225 PRO n 
2 226 GLY n 
2 227 VAL n 
2 228 TYR n 
2 229 THR n 
2 230 LYS n 
2 231 VAL n 
2 232 SER n 
2 233 ASP n 
2 234 PHE n 
2 235 ARG n 
2 236 GLU n 
2 237 TRP n 
2 238 ILE n 
2 239 PHE n 
2 240 GLN n 
2 241 ALA n 
2 242 ILE n 
2 243 LYS n 
2 244 THR n 
2 245 HIS n 
2 246 SER n 
2 247 GLU n 
2 248 ALA n 
2 249 SER n 
2 250 GLY n 
2 251 MET n 
2 252 VAL n 
2 253 THR n 
2 254 GLN n 
2 255 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 Pichia ? ? ? ? ? KM71 ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 Pichia ? ? ? ? ? KM71 ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HEPS_HUMAN P05981 1 
;SDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRL
PHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCF
PERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQAL
VDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISR
TPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
;
46  ? 
2 UNP HEPS_HUMAN P05981 2 
;IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGG
YLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVC
NGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQ
AIKTHSEASGMVTQL
;
163 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1P57 A 1 ? 114 ? P05981 46  ? 159 ? 1  114 
2 2 1P57 B 1 ? 255 ? P05981 163 ? 417 ? 16 255 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1P57 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      67 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P05981 
_struct_ref_seq_dif.db_mon_id                    ASN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          112 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            67 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                       ?        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                      ?        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                    ?        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                               ?        'C4 H7 N O4'     133.103 
CR4 non-polymer         . '2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BENZENOLATE' CRA_1144 'C14 H12 N4 O'   252.271 
CYS 'L-peptide linking' y CYSTEINE                                                      ?        'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                     ?        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                               ?        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                       ?        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                     ?        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                         ?        'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                    ?        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                       ?        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                        ?        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                    ?        'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                 ?        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                       ?        'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                        ?        'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                     ?        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                    ?        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                      ?        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                        ?        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1P57 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   42.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
'ammonium fluoride, PEG 3350, sodium cacodylate, tris, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K, pH 7.5, pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-10-09 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1P57 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.700 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   30969 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.1 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.820 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.83 
_reflns_shell.percent_possible_all   53.7 
_reflns_shell.Rmerge_I_obs           0.261 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.700 
_reflns_shell.pdbx_redundancy        2.11 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1P57 
_refine.ls_number_reflns_obs                     30969 
_refine.ls_number_reflns_all                     31246 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.700 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.70 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    90.0 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.206 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3107 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EKB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2713 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             277 
_refine_hist.number_atoms_total               3009 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        25.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.180 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             3.90  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.75 
_refine_ls_shell.d_res_low                        1.83 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.371 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.401 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             199 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1P57 
_struct.title                     'Extracellular domain of human hepsin' 
_struct.pdbx_descriptor           'Serine protease hepsin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P57 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'srcr, scavenger receptor cysteine-rich domain, serine protease, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 36  ? MET A 48  ? SER A 36  MET A 48  1 ? 13 
HELX_P HELX_P2 2 VAL A 61  ? GLY A 65  ? VAL A 61  GLY A 65  1 ? 5  
HELX_P HELX_P3 3 ARG A 79  ? THR A 83  ? ARG A 79  THR A 83  5 ? 5  
HELX_P HELX_P4 4 ARG A 85  ? GLU A 88  ? ARG A 85  GLU A 88  5 ? 4  
HELX_P HELX_P5 5 ALA B 39  ? PHE B 43  ? ALA B 55  PHE B 59  5 ? 5  
HELX_P HELX_P6 6 PRO B 44  ? ARG B 48  ? PRO B 60  ARG B 64  5 ? 5  
HELX_P HELX_P7 7 VAL B 49  ? SER B 51  B VAL B 65  SER B 65  5 ? 3  
HELX_P HELX_P8 8 SER B 156 ? ASN B 161 ? SER B 164 ASN B 169 1 ? 6  
HELX_P HELX_P9 9 PHE B 234 ? SER B 246 ? PHE B 234 SER B 246 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 32  SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 32  A CYS 95  1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf2 disulf ? ? A CYS 45  SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 45  A CYS 105 1_555 ? ? ? ? ? ? ? 2.004 ? 
disulf3 disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 93  SG ? ? A CYS 74  A CYS 93  1_555 ? ? ? ? ? ? ? 2.006 ? 
disulf4 disulf ? ? A CYS 108 SG ? ? ? 1_555 B CYS 115 SG ? ? A CYS 108 B CYS 122 1_555 ? ? ? ? ? ? ? 1.982 ? 
disulf5 disulf ? ? B CYS 26  SG ? ? ? 1_555 B CYS 42  SG ? ? B CYS 42  B CYS 58  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf6 disulf ? ? B CYS 129 SG ? ? ? 1_555 B CYS 197 SG ? ? B CYS 136 B CYS 201 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf7 disulf ? ? B CYS 160 SG ? ? ? 1_555 B CYS 176 SG ? ? B CYS 168 B CYS 182 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf8 disulf ? ? B CYS 187 SG ? ? ? 1_555 B CYS 219 SG ? ? B CYS 191 B CYS 220 1_555 ? ? ? ? ? ? ? 2.024 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 8 ? 
D ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 9   ? VAL A 11  ? VAL A 9   VAL A 11  
A 2 LEU A 18  ? ASP A 22  ? LEU A 18  ASP A 22  
A 3 THR A 27  ? LEU A 31  ? THR A 27  LEU A 31  
A 4 PHE A 72  ? VAL A 75  ? PHE A 72  VAL A 75  
A 5 ILE A 90  ? CYS A 93  ? ILE A 90  CYS A 93  
B 1 ARG A 99  ? CYS A 105 ? ARG A 99  CYS A 105 
B 2 ALA A 53  ? ASP A 60  ? ALA A 53  ASP A 60  
C 1 ARG B 5   ? ASP B 6   ? ARG B 20  ASP B 21  
C 2 GLN B 148 ? ILE B 155 ? GLN B 156 ILE B 163 
C 3 ILE B 128 ? GLY B 133 ? ILE B 135 GLY B 140 
C 4 PRO B 194 ? ASP B 199 ? PRO B 198 ASP B 203 
C 5 ARG B 206 B TRP B 215 ? ARG B 208 TRP B 215 
C 6 GLY B 226 ? LYS B 230 ? GLY B 226 LYS B 230 
C 7 MET B 174 ? ALA B 177 ? MET B 180 ALA B 183 
C 8 GLN B 148 ? ILE B 155 ? GLN B 156 ILE B 163 
D 1 LEU B 68  ? LEU B 70  ? LEU B 81  LEU B 83  
D 2 TRP B 53  D ALA B 57  ? TRP B 65  ALA B 68  
D 3 GLN B 15  ? TYR B 20  ? GLN B 30  TYR B 35  
D 4 ALA B 23  ? LEU B 30  ? ALA B 39  LEU B 46  
D 5 TRP B 35  ? THR B 38  ? TRP B 51  THR B 54  
D 6 ALA B 97  ? LEU B 101 ? ALA B 104 LEU B 108 
D 7 VAL B 72  ? TYR B 77  ? VAL B 85  TYR B 90  
D 8 GLY B 250 ? THR B 253 ? GLY B 250 THR B 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 10  ? O GLN A 10  N MET A 19  ? N MET A 19  
A 2 3 N ASP A 22  ? N ASP A 22  O THR A 27  ? O THR A 27  
A 3 4 O LEU A 30  ? O LEU A 30  N PHE A 73  ? N PHE A 73  
A 4 5 N CYS A 74  ? N CYS A 74  O SER A 91  ? O SER A 91  
B 1 2 O ILE A 104 ? O ILE A 104 N LEU A 54  ? N LEU A 54  
C 1 2 O ARG B 5   ? O ARG B 20  N GLU B 149 ? N GLU B 157 
C 2 3 O VAL B 152 ? O VAL B 160 N CYS B 129 ? N CYS B 136 
C 3 4 N THR B 132 ? N THR B 139 O PRO B 194 ? O PRO B 198 
C 4 5 O ASP B 199 ? O ASP B 203 N ARG B 206 B N ARG B 208 
C 5 6 O TRP B 215 ? O TRP B 215 N VAL B 227 ? N VAL B 227 
C 6 7 N TYR B 228 ? N TYR B 228 O PHE B 175 ? O PHE B 181 
C 7 8 O CYS B 176 ? O CYS B 182 N ILE B 155 ? N ILE B 163 
D 1 2 O LEU B 70  ? O LEU B 83  N VAL B 55  ? N VAL B 66  
D 2 3 N PHE B 56  ? N PHE B 67  O SER B 17  ? O SER B 32  
D 3 4 O TYR B 20  ? O TYR B 35  N ALA B 23  ? N ALA B 39  
D 4 5 O SER B 29  ? O SER B 45  N LEU B 37  ? N LEU B 53  
D 5 6 N THR B 38  ? N THR B 54  O ALA B 97  ? O ALA B 104 
D 6 7 O HIS B 100 ? O HIS B 107 N GLN B 73  ? N GLN B 86  
D 7 8 N VAL B 75  ? N VAL B 88  O GLY B 250 ? O GLY B 250 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    14 
_struct_site.details              'BINDING SITE FOR RESIDUE CR4 B 346' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 HIS B 41  ? HIS B 57  . ? 1_555 ? 
2  AC1 14 ASP B 185 ? ASP B 189 . ? 1_555 ? 
3  AC1 14 ALA B 186 ? ALA B 190 . ? 1_555 ? 
4  AC1 14 CYS B 187 ? CYS B 191 . ? 1_555 ? 
5  AC1 14 GLN B 188 ? GLN B 192 . ? 1_555 ? 
6  AC1 14 SER B 191 ? SER B 195 . ? 1_555 ? 
7  AC1 14 VAL B 213 ? VAL B 213 . ? 1_555 ? 
8  AC1 14 TRP B 215 ? TRP B 215 . ? 1_555 ? 
9  AC1 14 GLY B 218 ? GLY B 219 . ? 1_555 ? 
10 AC1 14 GLY B 226 ? GLY B 226 . ? 1_555 ? 
11 AC1 14 HOH E .   ? HOH B 360 . ? 1_555 ? 
12 AC1 14 HOH E .   ? HOH B 367 . ? 1_555 ? 
13 AC1 14 HOH E .   ? HOH B 471 . ? 1_555 ? 
14 AC1 14 HOH E .   ? HOH B 531 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1P57 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P57 
_atom_sites.fract_transf_matrix[1][1]   0.017007 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004493 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020921 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016392 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N      . PRO A 1 5   ? -4.964  -10.726 -0.403  0.32  29.06 ? 5   PRO A N      1 
ATOM   2    C CA     . PRO A 1 5   ? -5.053  -10.678 1.089   0.32  28.80 ? 5   PRO A CA     1 
ATOM   3    C C      . PRO A 1 5   ? -5.606  -9.300  1.504   1.00  28.15 ? 5   PRO A C      1 
ATOM   4    O O      . PRO A 1 5   ? -5.175  -8.800  2.528   1.00  28.40 ? 5   PRO A O      1 
ATOM   5    C CB     . PRO A 1 5   ? -3.623  -10.908 1.631   0.32  28.74 ? 5   PRO A CB     1 
ATOM   6    C CG     . PRO A 1 5   ? -2.787  -10.187 0.552   0.32  28.58 ? 5   PRO A CG     1 
ATOM   7    C CD     . PRO A 1 5   ? -3.498  -10.624 -0.741  0.32  29.12 ? 5   PRO A CD     1 
ATOM   8    H HA     . PRO A 1 5   ? -5.733  -11.446 1.442   0.32  28.75 ? 5   PRO A HA     1 
ATOM   9    H HB2    . PRO A 1 5   ? -3.495  -10.418 2.591   0.32  28.42 ? 5   PRO A HB2    1 
ATOM   10   H HB3    . PRO A 1 5   ? -3.376  -11.955 1.732   0.32  28.43 ? 5   PRO A HB3    1 
ATOM   11   H HG2    . PRO A 1 5   ? -2.817  -9.109  0.671   0.32  28.83 ? 5   PRO A HG2    1 
ATOM   12   H HG3    . PRO A 1 5   ? -1.752  -10.507 0.564   0.32  29.01 ? 5   PRO A HG3    1 
ATOM   13   H HD2    . PRO A 1 5   ? -3.356  -9.885  -1.522  0.32  28.75 ? 5   PRO A HD2    1 
ATOM   14   H HD3    . PRO A 1 5   ? -3.130  -11.580 -1.084  0.32  29.15 ? 5   PRO A HD3    1 
ATOM   15   N N      . LEU A 1 6   ? -6.520  -8.751  0.726   1.00  28.71 ? 6   LEU A N      1 
ATOM   16   C CA     . LEU A 1 6   ? -7.080  -7.416  1.077   1.00  26.71 ? 6   LEU A CA     1 
ATOM   17   C C      . LEU A 1 6   ? -7.874  -7.514  2.352   1.00  22.66 ? 6   LEU A C      1 
ATOM   18   O O      . LEU A 1 6   ? -8.415  -8.554  2.667   1.00  23.54 ? 6   LEU A O      1 
ATOM   19   C CB     . LEU A 1 6   ? -8.008  -6.925  -0.031  1.00  28.22 ? 6   LEU A CB     1 
ATOM   20   C CG     . LEU A 1 6   ? -7.240  -6.670  -1.335  1.00  32.75 ? 6   LEU A CG     1 
ATOM   21   C CD1    . LEU A 1 6   ? -8.244  -6.231  -2.440  1.00  33.95 ? 6   LEU A CD1    1 
ATOM   22   C CD2    . LEU A 1 6   ? -6.194  -5.527  -1.139  1.00  33.20 ? 6   LEU A CD2    1 
ATOM   23   H H      . LEU A 1 6   ? -6.880  -9.178  -0.074  1.00  27.77 ? 6   LEU A H      1 
ATOM   24   H HA     . LEU A 1 6   ? -6.264  -6.730  1.245   1.00  27.39 ? 6   LEU A HA     1 
ATOM   25   H HB2    . LEU A 1 6   ? -8.779  -7.668  -0.174  1.00  29.48 ? 6   LEU A HB2    1 
ATOM   26   H HB3    . LEU A 1 6   ? -8.499  -6.020  0.304   1.00  29.63 ? 6   LEU A HB3    1 
ATOM   27   H HG     . LEU A 1 6   ? -6.733  -7.566  -1.665  1.00  32.46 ? 6   LEU A HG     1 
ATOM   28   H HD11   . LEU A 1 6   ? -8.769  -5.331  -2.149  1.00  34.13 ? 6   LEU A HD11   1 
ATOM   29   H HD12   . LEU A 1 6   ? -8.969  -7.010  -2.628  1.00  34.08 ? 6   LEU A HD12   1 
ATOM   30   H HD13   . LEU A 1 6   ? -7.715  -6.031  -3.363  1.00  33.85 ? 6   LEU A HD13   1 
ATOM   31   H HD21   . LEU A 1 6   ? -5.676  -5.335  -2.069  1.00  33.15 ? 6   LEU A HD21   1 
ATOM   32   H HD22   . LEU A 1 6   ? -5.446  -5.793  -0.406  1.00  33.12 ? 6   LEU A HD22   1 
ATOM   33   H HD23   . LEU A 1 6   ? -6.675  -4.615  -0.819  1.00  33.04 ? 6   LEU A HD23   1 
ATOM   34   N N      . TYR A 1 7   ? -7.918  -6.411  3.034   1.00  17.11 ? 7   TYR A N      1 
ATOM   35   C CA     . TYR A 1 7   ? -8.662  -6.373  4.290   1.00  15.99 ? 7   TYR A CA     1 
ATOM   36   C C      . TYR A 1 7   ? -10.107 -6.137  3.783   1.00  14.90 ? 7   TYR A C      1 
ATOM   37   O O      . TYR A 1 7   ? -10.267 -5.411  2.824   1.00  15.29 ? 7   TYR A O      1 
ATOM   38   C CB     . TYR A 1 7   ? -8.172  -5.176  5.146   1.00  17.17 ? 7   TYR A CB     1 
ATOM   39   C CG     . TYR A 1 7   ? -8.735  -5.319  6.566   1.00  17.37 ? 7   TYR A CG     1 
ATOM   40   C CD1    . TYR A 1 7   ? -8.274  -6.345  7.411   1.00  15.22 ? 7   TYR A CD1    1 
ATOM   41   C CD2    . TYR A 1 7   ? -9.744  -4.471  7.016   1.00  15.87 ? 7   TYR A CD2    1 
ATOM   42   C CE1    . TYR A 1 7   ? -8.824  -6.511  8.669   1.00  17.09 ? 7   TYR A CE1    1 
ATOM   43   C CE2    . TYR A 1 7   ? -10.286 -4.647  8.273   1.00  18.94 ? 7   TYR A CE2    1 
ATOM   44   C CZ     . TYR A 1 7   ? -9.830  -5.667  9.097   1.00  14.98 ? 7   TYR A CZ     1 
ATOM   45   O OH     . TYR A 1 7   ? -10.399 -5.837  10.319  1.00  16.05 ? 7   TYR A OH     1 
ATOM   46   H H      . TYR A 1 7   ? -7.459  -5.607  2.712   1.00  18.84 ? 7   TYR A H      1 
ATOM   47   H HA     . TYR A 1 7   ? -8.576  -7.337  4.771   1.00  14.76 ? 7   TYR A HA     1 
ATOM   48   H HB2    . TYR A 1 7   ? -7.095  -5.153  5.193   1.00  18.23 ? 7   TYR A HB2    1 
ATOM   49   H HB3    . TYR A 1 7   ? -8.518  -4.242  4.720   1.00  17.52 ? 7   TYR A HB3    1 
ATOM   50   H HD1    . TYR A 1 7   ? -7.485  -7.008  7.088   1.00  15.45 ? 7   TYR A HD1    1 
ATOM   51   H HD2    . TYR A 1 7   ? -10.098 -3.671  6.386   1.00  17.26 ? 7   TYR A HD2    1 
ATOM   52   H HE1    . TYR A 1 7   ? -8.460  -7.300  9.315   1.00  15.92 ? 7   TYR A HE1    1 
ATOM   53   H HE2    . TYR A 1 7   ? -11.068 -3.988  8.621   1.00  17.03 ? 7   TYR A HE2    1 
ATOM   54   H HH     . TYR A 1 7   ? -9.860  -6.509  10.762  1.00  15.79 ? 7   TYR A HH     1 
ATOM   55   N N      . PRO A 1 8   ? -11.096 -6.729  4.403   1.00  17.90 ? 8   PRO A N      1 
ATOM   56   C CA     . PRO A 1 8   ? -12.523 -6.585  3.984   1.00  17.63 ? 8   PRO A CA     1 
ATOM   57   C C      . PRO A 1 8   ? -13.082 -5.180  4.090   1.00  19.09 ? 8   PRO A C      1 
ATOM   58   O O      . PRO A 1 8   ? -14.121 -4.927  3.515   1.00  20.35 ? 8   PRO A O      1 
ATOM   59   C CB     . PRO A 1 8   ? -13.260 -7.566  4.843   1.00  15.60 ? 8   PRO A CB     1 
ATOM   60   C CG     . PRO A 1 8   ? -12.410 -7.623  6.104   1.00  18.56 ? 8   PRO A CG     1 
ATOM   61   C CD     . PRO A 1 8   ? -10.981 -7.626  5.578   1.00  17.00 ? 8   PRO A CD     1 
ATOM   62   H HA     . PRO A 1 8   ? -12.592 -6.877  2.945   1.00  17.77 ? 8   PRO A HA     1 
ATOM   63   H HB2    . PRO A 1 8   ? -14.257 -7.208  5.060   1.00  17.26 ? 8   PRO A HB2    1 
ATOM   64   H HB3    . PRO A 1 8   ? -13.312 -8.530  4.362   1.00  17.01 ? 8   PRO A HB3    1 
ATOM   65   H HG2    . PRO A 1 8   ? -12.589 -6.775  6.753   1.00  18.08 ? 8   PRO A HG2    1 
ATOM   66   H HG3    . PRO A 1 8   ? -12.599 -8.536  6.648   1.00  17.93 ? 8   PRO A HG3    1 
ATOM   67   H HD2    . PRO A 1 8   ? -10.316 -7.219  6.318   1.00  18.16 ? 8   PRO A HD2    1 
ATOM   68   H HD3    . PRO A 1 8   ? -10.642 -8.608  5.275   1.00  17.18 ? 8   PRO A HD3    1 
ATOM   69   N N      . VAL A 1 9   ? -12.430 -4.321  4.812   1.00  16.35 ? 9   VAL A N      1 
ATOM   70   C CA     . VAL A 1 9   ? -12.921 -2.923  4.942   1.00  17.44 ? 9   VAL A CA     1 
ATOM   71   C C      . VAL A 1 9   ? -11.792 -2.054  4.296   1.00  20.13 ? 9   VAL A C      1 
ATOM   72   O O      . VAL A 1 9   ? -10.614 -2.180  4.651   1.00  15.73 ? 9   VAL A O      1 
ATOM   73   C CB     . VAL A 1 9   ? -13.133 -2.587  6.444   1.00  16.45 ? 9   VAL A CB     1 
ATOM   74   C CG1    . VAL A 1 9   ? -13.758 -1.179  6.643   1.00  17.76 ? 9   VAL A CG1    1 
ATOM   75   C CG2    . VAL A 1 9   ? -14.065 -3.631  7.057   1.00  18.90 ? 9   VAL A CG2    1 
ATOM   76   H H      . VAL A 1 9   ? -11.612 -4.605  5.260   1.00  19.17 ? 9   VAL A H      1 
ATOM   77   H HA     . VAL A 1 9   ? -13.837 -2.803  4.377   1.00  18.46 ? 9   VAL A HA     1 
ATOM   78   H HB     . VAL A 1 9   ? -12.177 -2.609  6.942   1.00  18.80 ? 9   VAL A HB     1 
ATOM   79   H HG11   . VAL A 1 9   ? -14.721 -1.109  6.157   1.00  17.33 ? 9   VAL A HG11   1 
ATOM   80   H HG12   . VAL A 1 9   ? -13.118 -0.421  6.212   1.00  17.07 ? 9   VAL A HG12   1 
ATOM   81   H HG13   . VAL A 1 9   ? -13.882 -0.961  7.694   1.00  16.51 ? 9   VAL A HG13   1 
ATOM   82   H HG21   . VAL A 1 9   ? -14.253 -3.420  8.100   1.00  17.26 ? 9   VAL A HG21   1 
ATOM   83   H HG22   . VAL A 1 9   ? -13.627 -4.617  6.974   1.00  18.40 ? 9   VAL A HG22   1 
ATOM   84   H HG23   . VAL A 1 9   ? -15.008 -3.642  6.531   1.00  17.73 ? 9   VAL A HG23   1 
ATOM   85   N N      . GLN A 1 10  ? -12.217 -1.218  3.367   1.00  16.35 ? 10  GLN A N      1 
ATOM   86   C CA     . GLN A 1 10  ? -11.334 -0.299  2.617   1.00  14.15 ? 10  GLN A CA     1 
ATOM   87   C C      . GLN A 1 10  ? -11.955 1.071   2.574   1.00  17.81 ? 10  GLN A C      1 
ATOM   88   O O      . GLN A 1 10  ? -13.166 1.195   2.718   1.00  16.53 ? 10  GLN A O      1 
ATOM   89   C CB     . GLN A 1 10  ? -11.175 -0.742  1.182   1.00  13.51 ? 10  GLN A CB     1 
ATOM   90   C CG     . GLN A 1 10  ? -10.635 -2.185  0.999   1.00  14.14 ? 10  GLN A CG     1 
ATOM   91   C CD     . GLN A 1 10  ? -9.128  -2.232  1.296   1.00  14.79 ? 10  GLN A CD     1 
ATOM   92   O OE1    . GLN A 1 10  ? -8.416  -1.265  1.129   1.00  16.84 ? 10  GLN A OE1    1 
ATOM   93   N NE2    . GLN A 1 10  ? -8.605  -3.325  1.732   1.00  14.26 ? 10  GLN A NE2    1 
ATOM   94   H H      . GLN A 1 10  ? -13.177 -1.183  3.155   1.00  19.75 ? 10  GLN A H      1 
ATOM   95   H HA     . GLN A 1 10  ? -10.386 -0.231  3.125   1.00  16.32 ? 10  GLN A HA     1 
ATOM   96   H HB2    . GLN A 1 10  ? -12.130 -0.677  0.688   1.00  15.17 ? 10  GLN A HB2    1 
ATOM   97   H HB3    . GLN A 1 10  ? -10.514 -0.046  0.690   1.00  13.48 ? 10  GLN A HB3    1 
ATOM   98   H HG2    . GLN A 1 10  ? -11.148 -2.858  1.672   1.00  13.06 ? 10  GLN A HG2    1 
ATOM   99   H HG3    . GLN A 1 10  ? -10.799 -2.524  -0.015  1.00  12.60 ? 10  GLN A HG3    1 
ATOM   100  H HE21   . GLN A 1 10  ? -9.174  -4.116  1.872   1.00  14.09 ? 10  GLN A HE21   1 
ATOM   101  H HE22   . GLN A 1 10  ? -7.646  -3.374  1.923   1.00  14.96 ? 10  GLN A HE22   1 
ATOM   102  N N      . VAL A 1 11  ? -11.105 2.039   2.374   1.00  16.20 ? 11  VAL A N      1 
ATOM   103  C CA     . VAL A 1 11  ? -11.556 3.439   2.290   1.00  19.87 ? 11  VAL A CA     1 
ATOM   104  C C      . VAL A 1 11  ? -10.865 3.925   1.011   1.00  21.09 ? 11  VAL A C      1 
ATOM   105  O O      . VAL A 1 11  ? -9.715  3.594   0.757   1.00  21.64 ? 11  VAL A O      1 
ATOM   106  C CB     . VAL A 1 11  ? -11.132 4.195   3.626   1.00  23.86 ? 11  VAL A CB     1 
ATOM   107  C CG1    . VAL A 1 11  ? -9.598  4.309   3.886   1.00  22.81 ? 11  VAL A CG1    1 
ATOM   108  C CG2    . VAL A 1 11  ? -11.777 5.591   3.653   1.00  25.43 ? 11  VAL A CG2    1 
ATOM   109  H H      . VAL A 1 11  ? -10.152 1.842   2.270   1.00  18.18 ? 11  VAL A H      1 
ATOM   110  H HA     . VAL A 1 11  ? -12.631 3.459   2.152   1.00  20.21 ? 11  VAL A HA     1 
ATOM   111  H HB     . VAL A 1 11  ? -11.570 3.650   4.451   1.00  23.49 ? 11  VAL A HB     1 
ATOM   112  H HG11   . VAL A 1 11  ? -9.113  4.865   3.094   1.00  22.69 ? 11  VAL A HG11   1 
ATOM   113  H HG12   . VAL A 1 11  ? -9.159  3.325   3.948   1.00  22.08 ? 11  VAL A HG12   1 
ATOM   114  H HG13   . VAL A 1 11  ? -9.415  4.818   4.819   1.00  22.24 ? 11  VAL A HG13   1 
ATOM   115  H HG21   . VAL A 1 11  ? -11.580 6.078   4.594   1.00  25.67 ? 11  VAL A HG21   1 
ATOM   116  H HG22   . VAL A 1 11  ? -12.852 5.517   3.553   1.00  25.66 ? 11  VAL A HG22   1 
ATOM   117  H HG23   . VAL A 1 11  ? -11.395 6.208   2.852   1.00  25.28 ? 11  VAL A HG23   1 
ATOM   118  N N      . SER A 1 12  ? -11.585 4.697   0.238   1.00  19.45 ? 12  SER A N      1 
ATOM   119  C CA     . SER A 1 12  ? -11.043 5.233   -1.034  1.00  18.66 ? 12  SER A CA     1 
ATOM   120  C C      . SER A 1 12  ? -10.117 6.392   -0.789  1.00  18.69 ? 12  SER A C      1 
ATOM   121  O O      . SER A 1 12  ? -10.357 7.214   0.067   1.00  22.21 ? 12  SER A O      1 
ATOM   122  C CB     . SER A 1 12  ? -12.223 5.686   -1.908  1.00  20.85 ? 12  SER A CB     1 
ATOM   123  O OG     . SER A 1 12  ? -11.756 6.590   -2.904  1.00  22.22 ? 12  SER A OG     1 
ATOM   124  H H      . SER A 1 12  ? -12.500 4.921   0.516   1.00  21.75 ? 12  SER A H      1 
ATOM   125  H HA     . SER A 1 12  ? -10.498 4.440   -1.526  1.00  18.09 ? 12  SER A HA     1 
ATOM   126  H HB2    . SER A 1 12  ? -12.678 4.837   -2.401  1.00  21.01 ? 12  SER A HB2    1 
ATOM   127  H HB3    . SER A 1 12  ? -12.958 6.189   -1.299  1.00  20.38 ? 12  SER A HB3    1 
ATOM   128  H HG     . SER A 1 12  ? -12.142 6.276   -3.745  1.00  21.77 ? 12  SER A HG     1 
ATOM   129  N N      . SER A 1 13  ? -9.089  6.453   -1.569  1.00  22.67 ? 13  SER A N      1 
ATOM   130  C CA     . SER A 1 13  ? -8.104  7.554   -1.432  1.00  28.19 ? 13  SER A CA     1 
ATOM   131  C C      . SER A 1 13  ? -8.583  8.718   -2.304  1.00  27.72 ? 13  SER A C      1 
ATOM   132  O O      . SER A 1 13  ? -8.091  9.819   -2.169  1.00  28.09 ? 13  SER A O      1 
ATOM   133  C CB     . SER A 1 13  ? -6.736  7.032   -1.905  1.00  31.39 ? 13  SER A CB     1 
ATOM   134  O OG     . SER A 1 13  ? -7.059  6.479   -3.184  1.00  37.79 ? 13  SER A OG     1 
ATOM   135  H H      . SER A 1 13  ? -8.920  5.789   -2.273  1.00  22.81 ? 13  SER A H      1 
ATOM   136  H HA     . SER A 1 13  ? -8.067  7.876   -0.400  1.00  28.18 ? 13  SER A HA     1 
ATOM   137  H HB2    . SER A 1 13  ? -6.024  7.838   -2.013  1.00  32.07 ? 13  SER A HB2    1 
ATOM   138  H HB3    . SER A 1 13  ? -6.329  6.266   -1.258  1.00  32.20 ? 13  SER A HB3    1 
ATOM   139  H HG     . SER A 1 13  ? -6.288  6.630   -3.756  1.00  36.59 ? 13  SER A HG     1 
ATOM   140  N N      . ALA A 1 14  ? -9.533  8.476   -3.176  1.00  28.60 ? 14  ALA A N      1 
ATOM   141  C CA     . ALA A 1 14  ? -10.032 9.587   -4.059  1.00  29.70 ? 14  ALA A CA     1 
ATOM   142  C C      . ALA A 1 14  ? -11.091 10.375  -3.321  1.00  26.52 ? 14  ALA A C      1 
ATOM   143  O O      . ALA A 1 14  ? -11.036 11.590  -3.367  1.00  27.19 ? 14  ALA A O      1 
ATOM   144  C CB     . ALA A 1 14  ? -10.674 9.052   -5.362  1.00  29.79 ? 14  ALA A CB     1 
ATOM   145  H H      . ALA A 1 14  ? -9.903  7.567   -3.233  1.00  28.82 ? 14  ALA A H      1 
ATOM   146  H HA     . ALA A 1 14  ? -9.209  10.242  -4.304  1.00  29.92 ? 14  ALA A HA     1 
ATOM   147  H HB1    . ALA A 1 14  ? -11.007 9.891   -5.959  1.00  29.58 ? 14  ALA A HB1    1 
ATOM   148  H HB2    . ALA A 1 14  ? -11.528 8.422   -5.156  1.00  29.24 ? 14  ALA A HB2    1 
ATOM   149  H HB3    . ALA A 1 14  ? -9.949  8.494   -5.936  1.00  29.08 ? 14  ALA A HB3    1 
ATOM   150  N N      . ASP A 1 15  ? -12.018 9.701   -2.687  1.00  24.48 ? 15  ASP A N      1 
ATOM   151  C CA     . ASP A 1 15  ? -13.076 10.461  -1.951  1.00  24.61 ? 15  ASP A CA     1 
ATOM   152  C C      . ASP A 1 15  ? -13.482 9.922   -0.576  1.00  26.37 ? 15  ASP A C      1 
ATOM   153  O O      . ASP A 1 15  ? -14.555 10.255  -0.090  1.00  27.32 ? 15  ASP A O      1 
ATOM   154  C CB     . ASP A 1 15  ? -14.345 10.550  -2.828  1.00  25.70 ? 15  ASP A CB     1 
ATOM   155  C CG     . ASP A 1 15  ? -14.854 9.173   -3.270  1.00  26.17 ? 15  ASP A CG     1 
ATOM   156  O OD1    . ASP A 1 15  ? -14.713 8.213   -2.534  1.00  22.43 ? 15  ASP A OD1    1 
ATOM   157  O OD2    . ASP A 1 15  ? -15.378 9.182   -4.360  1.00  29.88 ? 15  ASP A OD2    1 
ATOM   158  H H      . ASP A 1 15  ? -12.010 8.715   -2.704  1.00  25.08 ? 15  ASP A H      1 
ATOM   159  H HA     . ASP A 1 15  ? -12.723 11.468  -1.792  1.00  24.30 ? 15  ASP A HA     1 
ATOM   160  H HB2    . ASP A 1 15  ? -15.130 11.032  -2.262  1.00  26.58 ? 15  ASP A HB2    1 
ATOM   161  H HB3    . ASP A 1 15  ? -14.142 11.157  -3.699  1.00  25.86 ? 15  ASP A HB3    1 
ATOM   162  N N      . ALA A 1 16  ? -12.632 9.111   0.008   1.00  21.83 ? 16  ALA A N      1 
ATOM   163  C CA     . ALA A 1 16  ? -12.868 8.503   1.361   1.00  21.31 ? 16  ALA A CA     1 
ATOM   164  C C      . ALA A 1 16  ? -14.154 7.686   1.550   1.00  21.87 ? 16  ALA A C      1 
ATOM   165  O O      . ALA A 1 16  ? -14.564 7.495   2.683   1.00  17.37 ? 16  ALA A O      1 
ATOM   166  C CB     . ALA A 1 16  ? -12.849 9.627   2.409   1.00  21.89 ? 16  ALA A CB     1 
ATOM   167  H H      . ALA A 1 16  ? -11.795 8.881   -0.453  1.00  22.89 ? 16  ALA A H      1 
ATOM   168  H HA     . ALA A 1 16  ? -12.039 7.846   1.576   1.00  20.81 ? 16  ALA A HA     1 
ATOM   169  H HB1    . ALA A 1 16  ? -13.007 9.209   3.389   1.00  21.47 ? 16  ALA A HB1    1 
ATOM   170  H HB2    . ALA A 1 16  ? -13.644 10.331  2.215   1.00  21.75 ? 16  ALA A HB2    1 
ATOM   171  H HB3    . ALA A 1 16  ? -11.901 10.141  2.391   1.00  21.24 ? 16  ALA A HB3    1 
ATOM   172  N N      . ARG A 1 17  ? -14.760 7.216   0.478   1.00  21.74 ? 17  ARG A N      1 
ATOM   173  C CA     . ARG A 1 17  ? -15.999 6.428   0.691   1.00  21.51 ? 17  ARG A CA     1 
ATOM   174  C C      . ARG A 1 17  ? -15.532 5.095   1.291   1.00  21.40 ? 17  ARG A C      1 
ATOM   175  O O      . ARG A 1 17  ? -14.452 4.618   0.956   1.00  18.33 ? 17  ARG A O      1 
ATOM   176  C CB     . ARG A 1 17  ? -16.775 6.191   -0.678  1.00  21.25 ? 17  ARG A CB     1 
ATOM   177  C CG     . ARG A 1 17  ? -16.008 5.307   -1.677  1.00  21.57 ? 17  ARG A CG     1 
ATOM   178  C CD     . ARG A 1 17  ? -16.750 5.116   -3.052  1.00  23.68 ? 17  ARG A CD     1 
ATOM   179  N NE     . ARG A 1 17  ? -16.786 6.414   -3.788  1.00  22.44 ? 17  ARG A NE     1 
ATOM   180  C CZ     . ARG A 1 17  ? -17.705 6.668   -4.678  1.00  24.98 ? 17  ARG A CZ     1 
ATOM   181  N NH1    . ARG A 1 17  ? -18.421 5.701   -5.168  1.00  23.63 ? 17  ARG A NH1    1 
ATOM   182  N NH2    . ARG A 1 17  ? -17.879 7.898   -5.063  1.00  26.13 ? 17  ARG A NH2    1 
ATOM   183  H H      . ARG A 1 17  ? -14.398 7.393   -0.409  1.00  22.67 ? 17  ARG A H      1 
ATOM   184  H HA     . ARG A 1 17  ? -16.640 6.944   1.384   1.00  21.69 ? 17  ARG A HA     1 
ATOM   185  H HB2    . ARG A 1 17  ? -17.721 5.719   -0.441  1.00  20.89 ? 17  ARG A HB2    1 
ATOM   186  H HB3    . ARG A 1 17  ? -16.985 7.153   -1.120  1.00  21.61 ? 17  ARG A HB3    1 
ATOM   187  H HG2    . ARG A 1 17  ? -15.038 5.733   -1.875  1.00  22.60 ? 17  ARG A HG2    1 
ATOM   188  H HG3    . ARG A 1 17  ? -15.863 4.326   -1.247  1.00  22.37 ? 17  ARG A HG3    1 
ATOM   189  H HD2    . ARG A 1 17  ? -16.226 4.396   -3.672  1.00  22.85 ? 17  ARG A HD2    1 
ATOM   190  H HD3    . ARG A 1 17  ? -17.765 4.769   -2.904  1.00  23.17 ? 17  ARG A HD3    1 
ATOM   191  H HE     . ARG A 1 17  ? -16.106 7.093   -3.605  1.00  23.50 ? 17  ARG A HE     1 
ATOM   192  H HH11   . ARG A 1 17  ? -19.117 5.899   -5.856  1.00  25.22 ? 17  ARG A HH11   1 
ATOM   193  H HH12   . ARG A 1 17  ? -18.276 4.760   -4.862  1.00  24.77 ? 17  ARG A HH12   1 
ATOM   194  H HH21   . ARG A 1 17  ? -17.331 8.632   -4.667  1.00  25.97 ? 17  ARG A HH21   1 
ATOM   195  H HH22   . ARG A 1 17  ? -18.565 8.108   -5.758  1.00  26.31 ? 17  ARG A HH22   1 
ATOM   196  N N      . LEU A 1 18  ? -16.378 4.567   2.133   1.00  21.67 ? 18  LEU A N      1 
ATOM   197  C CA     . LEU A 1 18  ? -16.072 3.272   2.795   1.00  22.50 ? 18  LEU A CA     1 
ATOM   198  C C      . LEU A 1 18  ? -16.622 2.174   1.870   1.00  20.55 ? 18  LEU A C      1 
ATOM   199  O O      . LEU A 1 18  ? -17.655 2.372   1.258   1.00  18.36 ? 18  LEU A O      1 
ATOM   200  C CB     . LEU A 1 18  ? -16.776 3.207   4.159   1.00  23.13 ? 18  LEU A CB     1 
ATOM   201  C CG     . LEU A 1 18  ? -16.139 4.222   5.173   1.00  28.05 ? 18  LEU A CG     1 
ATOM   202  C CD1    . LEU A 1 18  ? -17.008 4.354   6.458   1.00  26.65 ? 18  LEU A CD1    1 
ATOM   203  C CD2    . LEU A 1 18  ? -14.709 3.733   5.560   1.00  29.32 ? 18  LEU A CD2    1 
ATOM   204  H H      . LEU A 1 18  ? -17.219 5.026   2.333   1.00  21.22 ? 18  LEU A H      1 
ATOM   205  H HA     . LEU A 1 18  ? -14.998 3.169   2.877   1.00  22.89 ? 18  LEU A HA     1 
ATOM   206  H HB2    . LEU A 1 18  ? -17.824 3.429   4.012   1.00  25.01 ? 18  LEU A HB2    1 
ATOM   207  H HB3    . LEU A 1 18  ? -16.706 2.192   4.529   1.00  24.56 ? 18  LEU A HB3    1 
ATOM   208  H HG     . LEU A 1 18  ? -16.059 5.198   4.706   1.00  27.90 ? 18  LEU A HG     1 
ATOM   209  H HD11   . LEU A 1 18  ? -17.129 3.409   6.969   1.00  26.42 ? 18  LEU A HD11   1 
ATOM   210  H HD12   . LEU A 1 18  ? -17.987 4.729   6.202   1.00  26.64 ? 18  LEU A HD12   1 
ATOM   211  H HD13   . LEU A 1 18  ? -16.562 5.056   7.147   1.00  26.32 ? 18  LEU A HD13   1 
ATOM   212  H HD21   . LEU A 1 18  ? -14.262 4.398   6.286   1.00  29.60 ? 18  LEU A HD21   1 
ATOM   213  H HD22   . LEU A 1 18  ? -14.057 3.719   4.697   1.00  29.17 ? 18  LEU A HD22   1 
ATOM   214  H HD23   . LEU A 1 18  ? -14.737 2.736   5.975   1.00  28.98 ? 18  LEU A HD23   1 
ATOM   215  N N      . MET A 1 19  ? -15.903 1.085   1.813   1.00  21.13 ? 19  MET A N      1 
ATOM   216  C CA     . MET A 1 19  ? -16.240 -0.095  0.984   1.00  19.60 ? 19  MET A CA     1 
ATOM   217  C C      . MET A 1 19  ? -16.072 -1.308  1.878   1.00  22.34 ? 19  MET A C      1 
ATOM   218  O O      . MET A 1 19  ? -15.054 -1.424  2.548   1.00  20.98 ? 19  MET A O      1 
ATOM   219  C CB     . MET A 1 19  ? -15.270 -0.200  -0.185  1.00  22.73 ? 19  MET A CB     1 
ATOM   220  C CG     . MET A 1 19  ? -15.381 1.006   -1.112  1.00  27.02 ? 19  MET A CG     1 
ATOM   221  S SD     . MET A 1 19  ? -14.229 1.062   -2.507  1.00  31.70 ? 19  MET A SD     1 
ATOM   222  C CE     . MET A 1 19  ? -12.912 1.764   -1.498  1.00  31.84 ? 19  MET A CE     1 
ATOM   223  H H      . MET A 1 19  ? -15.078 1.025   2.349   1.00  20.46 ? 19  MET A H      1 
ATOM   224  H HA     . MET A 1 19  ? -17.268 -0.014  0.661   1.00  22.82 ? 19  MET A HA     1 
ATOM   225  H HB2    . MET A 1 19  ? -14.265 -0.258  0.204   1.00  23.40 ? 19  MET A HB2    1 
ATOM   226  H HB3    . MET A 1 19  ? -15.446 -1.101  -0.735  1.00  23.26 ? 19  MET A HB3    1 
ATOM   227  H HG2    . MET A 1 19  ? -16.382 1.025   -1.518  1.00  27.49 ? 19  MET A HG2    1 
ATOM   228  H HG3    . MET A 1 19  ? -15.264 1.905   -0.524  1.00  26.75 ? 19  MET A HG3    1 
ATOM   229  H HE1    . MET A 1 19  ? -12.400 0.974   -0.969  1.00  32.09 ? 19  MET A HE1    1 
ATOM   230  H HE2    . MET A 1 19  ? -13.295 2.501   -0.810  1.00  32.04 ? 19  MET A HE2    1 
ATOM   231  H HE3    . MET A 1 19  ? -12.217 2.261   -2.157  1.00  32.40 ? 19  MET A HE3    1 
ATOM   232  N N      . VAL A 1 20  ? -17.043 -2.173  1.879   1.00  19.82 ? 20  VAL A N      1 
ATOM   233  C CA     . VAL A 1 20  ? -16.961 -3.389  2.714   1.00  19.42 ? 20  VAL A CA     1 
ATOM   234  C C      . VAL A 1 20  ? -17.240 -4.536  1.754   1.00  18.64 ? 20  VAL A C      1 
ATOM   235  O O      . VAL A 1 20  ? -18.177 -4.540  0.977   1.00  19.53 ? 20  VAL A O      1 
ATOM   236  C CB     . VAL A 1 20  ? -18.008 -3.279  3.860   1.00  20.99 ? 20  VAL A CB     1 
ATOM   237  C CG1    . VAL A 1 20  ? -17.820 -4.441  4.861   1.00  20.23 ? 20  VAL A CG1    1 
ATOM   238  C CG2    . VAL A 1 20  ? -17.899 -1.904  4.602   1.00  22.06 ? 20  VAL A CG2    1 
ATOM   239  H H      . VAL A 1 20  ? -17.840 -2.031  1.325   1.00  20.95 ? 20  VAL A H      1 
ATOM   240  H HA     . VAL A 1 20  ? -15.958 -3.480  3.107   1.00  20.50 ? 20  VAL A HA     1 
ATOM   241  H HB     . VAL A 1 20  ? -18.996 -3.364  3.426   1.00  22.00 ? 20  VAL A HB     1 
ATOM   242  H HG11   . VAL A 1 20  ? -16.823 -4.446  5.273   1.00  21.29 ? 20  VAL A HG11   1 
ATOM   243  H HG12   . VAL A 1 20  ? -17.986 -5.388  4.363   1.00  20.28 ? 20  VAL A HG12   1 
ATOM   244  H HG13   . VAL A 1 20  ? -18.522 -4.358  5.678   1.00  20.87 ? 20  VAL A HG13   1 
ATOM   245  H HG21   . VAL A 1 20  ? -18.623 -1.852  5.404   1.00  21.50 ? 20  VAL A HG21   1 
ATOM   246  H HG22   . VAL A 1 20  ? -18.086 -1.087  3.917   1.00  21.41 ? 20  VAL A HG22   1 
ATOM   247  H HG23   . VAL A 1 20  ? -16.911 -1.773  5.019   1.00  22.12 ? 20  VAL A HG23   1 
ATOM   248  N N      . PHE A 1 21  ? -16.383 -5.491  1.858   1.00  19.88 ? 21  PHE A N      1 
ATOM   249  C CA     . PHE A 1 21  ? -16.422 -6.714  1.027   1.00  20.04 ? 21  PHE A CA     1 
ATOM   250  C C      . PHE A 1 21  ? -17.634 -7.593  1.354   1.00  19.44 ? 21  PHE A C      1 
ATOM   251  O O      . PHE A 1 21  ? -17.990 -7.799  2.503   1.00  17.86 ? 21  PHE A O      1 
ATOM   252  C CB     . PHE A 1 21  ? -15.115 -7.502  1.270   1.00  17.96 ? 21  PHE A CB     1 
ATOM   253  C CG     . PHE A 1 21  ? -14.987 -8.680  0.335   1.00  15.13 ? 21  PHE A CG     1 
ATOM   254  C CD1    . PHE A 1 21  ? -14.834 -8.479  -1.007  1.00  16.55 ? 21  PHE A CD1    1 
ATOM   255  C CD2    . PHE A 1 21  ? -15.007 -9.964  0.840   1.00  19.01 ? 21  PHE A CD2    1 
ATOM   256  C CE1    . PHE A 1 21  ? -14.695 -9.544  -1.857  1.00  17.59 ? 21  PHE A CE1    1 
ATOM   257  C CE2    . PHE A 1 21  ? -14.869 -11.045 -0.012  1.00  16.96 ? 21  PHE A CE2    1 
ATOM   258  C CZ     . PHE A 1 21  ? -14.714 -10.836 -1.351  1.00  16.24 ? 21  PHE A CZ     1 
ATOM   259  H H      . PHE A 1 21  ? -15.673 -5.396  2.526   1.00  21.33 ? 21  PHE A H      1 
ATOM   260  H HA     . PHE A 1 21  ? -16.465 -6.414  -0.010  1.00  20.03 ? 21  PHE A HA     1 
ATOM   261  H HB2    . PHE A 1 21  ? -14.257 -6.868  1.119   1.00  16.97 ? 21  PHE A HB2    1 
ATOM   262  H HB3    . PHE A 1 21  ? -15.105 -7.866  2.287   1.00  16.72 ? 21  PHE A HB3    1 
ATOM   263  H HD1    . PHE A 1 21  ? -14.824 -7.474  -1.407  1.00  16.67 ? 21  PHE A HD1    1 
ATOM   264  H HD2    . PHE A 1 21  ? -15.130 -10.137 1.901   1.00  15.93 ? 21  PHE A HD2    1 
ATOM   265  H HE1    . PHE A 1 21  ? -14.571 -9.362  -2.916  1.00  15.53 ? 21  PHE A HE1    1 
ATOM   266  H HE2    . PHE A 1 21  ? -14.878 -12.055 0.377   1.00  16.79 ? 21  PHE A HE2    1 
ATOM   267  H HZ     . PHE A 1 21  ? -14.607 -11.691 -1.998  1.00  15.52 ? 21  PHE A HZ     1 
ATOM   268  N N      . ASP A 1 22  ? -18.202 -8.093  0.296   1.00  20.34 ? 22  ASP A N      1 
ATOM   269  C CA     . ASP A 1 22  ? -19.386 -8.975  0.369   1.00  20.76 ? 22  ASP A CA     1 
ATOM   270  C C      . ASP A 1 22  ? -18.845 -10.259 -0.219  1.00  17.38 ? 22  ASP A C      1 
ATOM   271  O O      . ASP A 1 22  ? -18.702 -10.366 -1.424  1.00  16.28 ? 22  ASP A O      1 
ATOM   272  C CB     . ASP A 1 22  ? -20.556 -8.443  -0.500  1.00  24.59 ? 22  ASP A CB     1 
ATOM   273  C CG     . ASP A 1 22  ? -21.776 -9.425  -0.313  1.00  29.69 ? 22  ASP A CG     1 
ATOM   274  O OD1    . ASP A 1 22  ? -22.883 -8.910  -0.260  1.00  34.08 ? 22  ASP A OD1    1 
ATOM   275  O OD2    . ASP A 1 22  ? -21.558 -10.630 -0.233  1.00  27.06 ? 22  ASP A OD2    1 
ATOM   276  H H      . ASP A 1 22  ? -17.824 -7.886  -0.586  1.00  20.40 ? 22  ASP A H      1 
ATOM   277  H HA     . ASP A 1 22  ? -19.686 -9.116  1.393   1.00  20.05 ? 22  ASP A HA     1 
ATOM   278  H HB2    . ASP A 1 22  ? -20.828 -7.447  -0.185  1.00  23.76 ? 22  ASP A HB2    1 
ATOM   279  H HB3    . ASP A 1 22  ? -20.270 -8.417  -1.544  1.00  24.37 ? 22  ASP A HB3    1 
ATOM   280  N N      . LYS A 1 23  ? -18.573 -11.199 0.640   1.00  21.15 ? 23  LYS A N      1 
ATOM   281  C CA     . LYS A 1 23  ? -18.022 -12.509 0.187   1.00  26.11 ? 23  LYS A CA     1 
ATOM   282  C C      . LYS A 1 23  ? -18.961 -13.352 -0.677  1.00  32.23 ? 23  LYS A C      1 
ATOM   283  O O      . LYS A 1 23  ? -18.464 -14.180 -1.414  1.00  31.15 ? 23  LYS A O      1 
ATOM   284  C CB     . LYS A 1 23  ? -17.596 -13.334 1.427   1.00  27.03 ? 23  LYS A CB     1 
ATOM   285  C CG     . LYS A 1 23  ? -18.807 -13.607 2.326   0.35  27.14 ? 23  LYS A CG     1 
ATOM   286  C CD     . LYS A 1 23  ? -18.309 -14.193 3.646   0.35  27.85 ? 23  LYS A CD     1 
ATOM   287  C CE     . LYS A 1 23  ? -19.522 -14.556 4.526   0.35  28.24 ? 23  LYS A CE     1 
ATOM   288  N NZ     . LYS A 1 23  ? -20.365 -13.348 4.766   0.35  29.63 ? 23  LYS A NZ     1 
ATOM   289  H H      . LYS A 1 23  ? -18.729 -11.044 1.595   1.00  19.78 ? 23  LYS A H      1 
ATOM   290  H HA     . LYS A 1 23  ? -17.144 -12.294 -0.408  1.00  25.47 ? 23  LYS A HA     1 
ATOM   291  H HB2    . LYS A 1 23  ? -17.177 -14.271 1.083   1.00  26.59 ? 23  LYS A HB2    1 
ATOM   292  H HB3    . LYS A 1 23  ? -16.819 -12.803 1.958   1.00  26.54 ? 23  LYS A HB3    1 
ATOM   293  H HG2    . LYS A 1 23  ? -19.362 -12.698 2.511   0.35  27.12 ? 23  LYS A HG2    1 
ATOM   294  H HG3    . LYS A 1 23  ? -19.465 -14.320 1.846   0.35  27.07 ? 23  LYS A HG3    1 
ATOM   295  H HD2    . LYS A 1 23  ? -17.713 -15.076 3.468   0.35  27.97 ? 23  LYS A HD2    1 
ATOM   296  H HD3    . LYS A 1 23  ? -17.700 -13.466 4.168   0.35  28.08 ? 23  LYS A HD3    1 
ATOM   297  H HE2    . LYS A 1 23  ? -20.128 -15.320 4.059   0.35  28.62 ? 23  LYS A HE2    1 
ATOM   298  H HE3    . LYS A 1 23  ? -19.180 -14.922 5.483   0.35  28.91 ? 23  LYS A HE3    1 
ATOM   299  H HZ1    . LYS A 1 23  ? -21.323 -13.509 4.393   1.00  29.03 ? 23  LYS A HZ1    1 
ATOM   300  H HZ2    . LYS A 1 23  ? -19.942 -12.525 4.290   0.35  29.16 ? 23  LYS A HZ2    1 
ATOM   301  H HZ3    . LYS A 1 23  ? -20.416 -13.161 5.788   0.35  29.31 ? 23  LYS A HZ3    1 
ATOM   302  N N      . THR A 1 24  ? -20.254 -13.158 -0.600  1.00  35.29 ? 24  THR A N      1 
ATOM   303  C CA     . THR A 1 24  ? -21.136 -14.007 -1.462  1.00  38.03 ? 24  THR A CA     1 
ATOM   304  C C      . THR A 1 24  ? -21.086 -13.514 -2.892  1.00  37.91 ? 24  THR A C      1 
ATOM   305  O O      . THR A 1 24  ? -21.479 -14.223 -3.800  1.00  42.52 ? 24  THR A O      1 
ATOM   306  C CB     . THR A 1 24  ? -22.626 -13.958 -0.988  1.00  37.53 ? 24  THR A CB     1 
ATOM   307  O OG1    . THR A 1 24  ? -23.060 -12.600 -1.104  1.00  39.16 ? 24  THR A OG1    1 
ATOM   308  C CG2    . THR A 1 24  ? -22.729 -14.249 0.503   1.00  37.64 ? 24  THR A CG2    1 
ATOM   309  H H      . THR A 1 24  ? -20.649 -12.494 -0.002  1.00  35.88 ? 24  THR A H      1 
ATOM   310  H HA     . THR A 1 24  ? -20.769 -15.027 -1.446  1.00  37.96 ? 24  THR A HA     1 
ATOM   311  H HB     . THR A 1 24  ? -23.247 -14.614 -1.587  1.00  37.86 ? 24  THR A HB     1 
ATOM   312  H HG1    . THR A 1 24  ? -23.682 -12.407 -0.392  1.00  38.08 ? 24  THR A HG1    1 
ATOM   313  H HG21   . THR A 1 24  ? -23.760 -14.239 0.823   1.00  37.79 ? 24  THR A HG21   1 
ATOM   314  H HG22   . THR A 1 24  ? -22.175 -13.532 1.093   1.00  37.83 ? 24  THR A HG22   1 
ATOM   315  H HG23   . THR A 1 24  ? -22.327 -15.234 0.709   1.00  37.62 ? 24  THR A HG23   1 
ATOM   316  N N      . GLU A 1 25  ? -20.616 -12.311 -3.054  1.00  37.21 ? 25  GLU A N      1 
ATOM   317  C CA     . GLU A 1 25  ? -20.539 -11.749 -4.428  1.00  40.74 ? 25  GLU A CA     1 
ATOM   318  C C      . GLU A 1 25  ? -19.102 -11.545 -4.915  1.00  37.99 ? 25  GLU A C      1 
ATOM   319  O O      . GLU A 1 25  ? -18.849 -11.590 -6.111  1.00  37.44 ? 25  GLU A O      1 
ATOM   320  C CB     . GLU A 1 25  ? -21.284 -10.424 -4.432  1.00  46.99 ? 25  GLU A CB     1 
ATOM   321  C CG     . GLU A 1 25  ? -22.712 -10.617 -3.775  1.00  53.89 ? 25  GLU A CG     1 
ATOM   322  C CD     . GLU A 1 25  ? -23.856 -10.216 -4.740  1.00  58.00 ? 25  GLU A CD     1 
ATOM   323  O OE1    . GLU A 1 25  ? -23.712 -9.192  -5.408  1.00  58.95 ? 25  GLU A OE1    1 
ATOM   324  O OE2    . GLU A 1 25  ? -24.814 -10.986 -4.723  1.00  61.53 ? 25  GLU A OE2    1 
ATOM   325  H H      . GLU A 1 25  ? -20.322 -11.798 -2.274  1.00  37.02 ? 25  GLU A H      1 
ATOM   326  H HA     . GLU A 1 25  ? -21.025 -12.429 -5.116  1.00  41.84 ? 25  GLU A HA     1 
ATOM   327  H HB2    . GLU A 1 25  ? -20.721 -9.678  -3.890  1.00  47.50 ? 25  GLU A HB2    1 
ATOM   328  H HB3    . GLU A 1 25  ? -21.363 -10.093 -5.456  1.00  47.24 ? 25  GLU A HB3    1 
ATOM   329  H HG2    . GLU A 1 25  ? -22.864 -11.652 -3.492  1.00  53.78 ? 25  GLU A HG2    1 
ATOM   330  H HG3    . GLU A 1 25  ? -22.797 -10.027 -2.875  1.00  53.56 ? 25  GLU A HG3    1 
ATOM   331  N N      . GLY A 1 26  ? -18.209 -11.318 -3.987  1.00  32.45 ? 26  GLY A N      1 
ATOM   332  C CA     . GLY A 1 26  ? -16.781 -11.098 -4.346  1.00  28.36 ? 26  GLY A CA     1 
ATOM   333  C C      . GLY A 1 26  ? -16.713 -9.618  -4.744  1.00  27.30 ? 26  GLY A C      1 
ATOM   334  O O      . GLY A 1 26  ? -15.844 -9.238  -5.495  1.00  27.21 ? 26  GLY A O      1 
ATOM   335  H H      . GLY A 1 26  ? -18.468 -11.291 -3.043  1.00  32.20 ? 26  GLY A H      1 
ATOM   336  H HA2    . GLY A 1 26  ? -16.152 -11.300 -3.496  1.00  29.89 ? 26  GLY A HA2    1 
ATOM   337  H HA3    . GLY A 1 26  ? -16.502 -11.723 -5.183  1.00  28.65 ? 26  GLY A HA3    1 
ATOM   338  N N      . THR A 1 27  ? -17.614 -8.818  -4.242  1.00  28.81 ? 27  THR A N      1 
ATOM   339  C CA     . THR A 1 27  ? -17.671 -7.359  -4.557  1.00  31.03 ? 27  THR A CA     1 
ATOM   340  C C      . THR A 1 27  ? -17.640 -6.539  -3.284  1.00  27.13 ? 27  THR A C      1 
ATOM   341  O O      . THR A 1 27  ? -17.866 -7.063  -2.217  1.00  25.41 ? 27  THR A O      1 
ATOM   342  C CB     . THR A 1 27  ? -19.026 -6.977  -5.292  1.00  33.43 ? 27  THR A CB     1 
ATOM   343  O OG1    . THR A 1 27  ? -20.105 -7.495  -4.482  1.00  37.54 ? 27  THR A OG1    1 
ATOM   344  C CG2    . THR A 1 27  ? -19.201 -7.683  -6.627  1.00  38.30 ? 27  THR A CG2    1 
ATOM   345  H H      . THR A 1 27  ? -18.290 -9.158  -3.623  1.00  29.18 ? 27  THR A H      1 
ATOM   346  H HA     . THR A 1 27  ? -16.816 -7.100  -5.160  1.00  29.63 ? 27  THR A HA     1 
ATOM   347  H HB     . THR A 1 27  ? -19.135 -5.905  -5.402  1.00  34.23 ? 27  THR A HB     1 
ATOM   348  H HG1    . THR A 1 27  ? -20.574 -6.734  -4.113  1.00  35.27 ? 27  THR A HG1    1 
ATOM   349  H HG21   . THR A 1 27  ? -20.128 -7.383  -7.096  1.00  37.29 ? 27  THR A HG21   1 
ATOM   350  H HG22   . THR A 1 27  ? -19.199 -8.756  -6.498  1.00  37.47 ? 27  THR A HG22   1 
ATOM   351  H HG23   . THR A 1 27  ? -18.387 -7.403  -7.278  1.00  37.25 ? 27  THR A HG23   1 
ATOM   352  N N      . TRP A 1 28  ? -17.405 -5.274  -3.445  1.00  31.32 ? 28  TRP A N      1 
ATOM   353  C CA     . TRP A 1 28  ? -17.359 -4.336  -2.285  1.00  31.82 ? 28  TRP A CA     1 
ATOM   354  C C      . TRP A 1 28  ? -18.717 -3.629  -2.388  1.00  27.95 ? 28  TRP A C      1 
ATOM   355  O O      . TRP A 1 28  ? -19.243 -3.459  -3.470  1.00  28.29 ? 28  TRP A O      1 
ATOM   356  C CB     . TRP A 1 28  ? -16.209 -3.262  -2.446  1.00  34.33 ? 28  TRP A CB     1 
ATOM   357  C CG     . TRP A 1 28  ? -15.001 -4.109  -2.640  1.00  36.73 ? 28  TRP A CG     1 
ATOM   358  C CD1    . TRP A 1 28  ? -14.657 -4.716  -3.799  1.00  39.68 ? 28  TRP A CD1    1 
ATOM   359  C CD2    . TRP A 1 28  ? -14.165 -4.469  -1.668  1.00  37.41 ? 28  TRP A CD2    1 
ATOM   360  N NE1    . TRP A 1 28  ? -13.612 -5.435  -3.446  1.00  41.96 ? 28  TRP A NE1    1 
ATOM   361  C CE2    . TRP A 1 28  ? -13.218 -5.370  -2.175  1.00  40.58 ? 28  TRP A CE2    1 
ATOM   362  C CE3    . TRP A 1 28  ? -14.147 -4.077  -0.334  1.00  34.14 ? 28  TRP A CE3    1 
ATOM   363  C CZ2    . TRP A 1 28  ? -12.237 -5.894  -1.307  1.00  38.47 ? 28  TRP A CZ2    1 
ATOM   364  C CZ3    . TRP A 1 28  ? -13.174 -4.595  0.509   1.00  36.23 ? 28  TRP A CZ3    1 
ATOM   365  C CH2    . TRP A 1 28  ? -12.223 -5.501  0.029   1.00  36.08 ? 28  TRP A CH2    1 
ATOM   366  H H      . TRP A 1 28  ? -17.263 -4.936  -4.357  1.00  30.89 ? 28  TRP A H      1 
ATOM   367  H HA     . TRP A 1 28  ? -17.294 -4.884  -1.355  1.00  31.07 ? 28  TRP A HA     1 
ATOM   368  H HB2    . TRP A 1 28  ? -16.337 -2.608  -3.297  1.00  34.12 ? 28  TRP A HB2    1 
ATOM   369  H HB3    . TRP A 1 28  ? -16.122 -2.693  -1.543  1.00  33.76 ? 28  TRP A HB3    1 
ATOM   370  H HD1    . TRP A 1 28  ? -15.116 -4.631  -4.776  1.00  39.82 ? 28  TRP A HD1    1 
ATOM   371  H HE1    . TRP A 1 28  ? -13.165 -5.986  -4.127  1.00  40.96 ? 28  TRP A HE1    1 
ATOM   372  H HE3    . TRP A 1 28  ? -14.877 -3.381  0.050   1.00  35.31 ? 28  TRP A HE3    1 
ATOM   373  H HZ2    . TRP A 1 28  ? -11.498 -6.598  -1.663  1.00  38.20 ? 28  TRP A HZ2    1 
ATOM   374  H HZ3    . TRP A 1 28  ? -13.153 -4.287  1.544   1.00  36.06 ? 28  TRP A HZ3    1 
ATOM   375  H HH2    . TRP A 1 28  ? -11.475 -5.898  0.701   1.00  37.61 ? 28  TRP A HH2    1 
ATOM   376  N N      . ARG A 1 29  ? -19.242 -3.245  -1.277  1.00  25.35 ? 29  ARG A N      1 
ATOM   377  C CA     . ARG A 1 29  ? -20.530 -2.536  -1.223  1.00  27.14 ? 29  ARG A CA     1 
ATOM   378  C C      . ARG A 1 29  ? -20.259 -1.264  -0.408  1.00  25.15 ? 29  ARG A C      1 
ATOM   379  O O      . ARG A 1 29  ? -19.319 -1.214  0.367   1.00  20.58 ? 29  ARG A O      1 
ATOM   380  C CB     . ARG A 1 29  ? -21.572 -3.344  -0.493  1.00  31.13 ? 29  ARG A CB     1 
ATOM   381  C CG     . ARG A 1 29  ? -21.985 -4.557  -1.330  1.00  37.61 ? 29  ARG A CG     1 
ATOM   382  C CD     . ARG A 1 29  ? -23.269 -5.228  -0.696  1.00  41.85 ? 29  ARG A CD     1 
ATOM   383  N NE     . ARG A 1 29  ? -24.274 -5.318  -1.795  1.00  50.22 ? 29  ARG A NE     1 
ATOM   384  C CZ     . ARG A 1 29  ? -24.484 -6.428  -2.465  1.00  54.27 ? 29  ARG A CZ     1 
ATOM   385  N NH1    . ARG A 1 29  ? -23.663 -7.438  -2.355  1.00  55.84 ? 29  ARG A NH1    1 
ATOM   386  N NH2    . ARG A 1 29  ? -25.532 -6.484  -3.246  1.00  58.31 ? 29  ARG A NH2    1 
ATOM   387  H H      . ARG A 1 29  ? -18.778 -3.426  -0.429  1.00  26.32 ? 29  ARG A H      1 
ATOM   388  H HA     . ARG A 1 29  ? -20.844 -2.260  -2.220  1.00  28.44 ? 29  ARG A HA     1 
ATOM   389  H HB2    . ARG A 1 29  ? -21.150 -3.667  0.447   1.00  32.05 ? 29  ARG A HB2    1 
ATOM   390  H HB3    . ARG A 1 29  ? -22.421 -2.708  -0.282  1.00  31.81 ? 29  ARG A HB3    1 
ATOM   391  H HG2    . ARG A 1 29  ? -22.205 -4.225  -2.332  1.00  36.88 ? 29  ARG A HG2    1 
ATOM   392  H HG3    . ARG A 1 29  ? -21.171 -5.267  -1.384  1.00  36.75 ? 29  ARG A HG3    1 
ATOM   393  H HD2    . ARG A 1 29  ? -23.078 -6.209  -0.290  1.00  42.57 ? 29  ARG A HD2    1 
ATOM   394  H HD3    . ARG A 1 29  ? -23.706 -4.623  0.087   1.00  42.68 ? 29  ARG A HD3    1 
ATOM   395  H HE     . ARG A 1 29  ? -24.793 -4.518  -2.023  1.00  49.22 ? 29  ARG A HE     1 
ATOM   396  H HH11   . ARG A 1 29  ? -23.839 -8.283  -2.860  1.00  55.00 ? 29  ARG A HH11   1 
ATOM   397  H HH12   . ARG A 1 29  ? -22.858 -7.370  -1.766  1.00  54.99 ? 29  ARG A HH12   1 
ATOM   398  H HH21   . ARG A 1 29  ? -26.143 -5.695  -3.321  1.00  56.73 ? 29  ARG A HH21   1 
ATOM   399  H HH22   . ARG A 1 29  ? -25.724 -7.314  -3.771  1.00  56.85 ? 29  ARG A HH22   1 
ATOM   400  N N      . LEU A 1 30  ? -21.110 -0.308  -0.609  1.00  21.90 ? 30  LEU A N      1 
ATOM   401  C CA     . LEU A 1 30  ? -21.032 1.004   0.081   1.00  20.33 ? 30  LEU A CA     1 
ATOM   402  C C      . LEU A 1 30  ? -21.839 0.831   1.369   1.00  20.06 ? 30  LEU A C      1 
ATOM   403  O O      . LEU A 1 30  ? -22.583 -0.126  1.502   1.00  21.10 ? 30  LEU A O      1 
ATOM   404  C CB     . LEU A 1 30  ? -21.670 2.064   -0.826  1.00  23.02 ? 30  LEU A CB     1 
ATOM   405  C CG     . LEU A 1 30  ? -20.726 2.954   -1.661  1.00  24.90 ? 30  LEU A CG     1 
ATOM   406  C CD1    . LEU A 1 30  ? -19.456 2.280   -2.060  1.00  24.63 ? 30  LEU A CD1    1 
ATOM   407  C CD2    . LEU A 1 30  ? -21.482 3.410   -2.935  1.00  24.52 ? 30  LEU A CD2    1 
ATOM   408  H H      . LEU A 1 30  ? -21.844 -0.459  -1.242  1.00  24.61 ? 30  LEU A H      1 
ATOM   409  H HA     . LEU A 1 30  ? -20.008 1.225   0.339   1.00  21.57 ? 30  LEU A HA     1 
ATOM   410  H HB2    . LEU A 1 30  ? -22.394 1.588   -1.473  1.00  23.43 ? 30  LEU A HB2    1 
ATOM   411  H HB3    . LEU A 1 30  ? -22.230 2.730   -0.183  1.00  23.45 ? 30  LEU A HB3    1 
ATOM   412  H HG     . LEU A 1 30  ? -20.474 3.831   -1.080  1.00  25.25 ? 30  LEU A HG     1 
ATOM   413  H HD11   . LEU A 1 30  ? -19.701 1.373   -2.588  1.00  24.68 ? 30  LEU A HD11   1 
ATOM   414  H HD12   . LEU A 1 30  ? -18.868 2.041   -1.185  1.00  24.33 ? 30  LEU A HD12   1 
ATOM   415  H HD13   . LEU A 1 30  ? -18.872 2.925   -2.697  1.00  23.94 ? 30  LEU A HD13   1 
ATOM   416  H HD21   . LEU A 1 30  ? -20.857 4.060   -3.533  1.00  24.36 ? 30  LEU A HD21   1 
ATOM   417  H HD22   . LEU A 1 30  ? -22.367 3.973   -2.668  1.00  23.99 ? 30  LEU A HD22   1 
ATOM   418  H HD23   . LEU A 1 30  ? -21.784 2.569   -3.541  1.00  24.42 ? 30  LEU A HD23   1 
ATOM   419  N N      . LEU A 1 31  ? -21.678 1.760   2.268   1.00  20.85 ? 31  LEU A N      1 
ATOM   420  C CA     . LEU A 1 31  ? -22.376 1.762   3.589   1.00  23.88 ? 31  LEU A CA     1 
ATOM   421  C C      . LEU A 1 31  ? -23.415 2.867   3.520   1.00  24.04 ? 31  LEU A C      1 
ATOM   422  O O      . LEU A 1 31  ? -23.098 4.047   3.414   1.00  21.65 ? 31  LEU A O      1 
ATOM   423  C CB     . LEU A 1 31  ? -21.429 2.101   4.803   1.00  27.91 ? 31  LEU A CB     1 
ATOM   424  C CG     . LEU A 1 31  ? -20.616 0.845   5.330   1.00  32.45 ? 31  LEU A CG     1 
ATOM   425  C CD1    . LEU A 1 31  ? -19.500 1.287   6.320   1.00  34.10 ? 31  LEU A CD1    1 
ATOM   426  C CD2    . LEU A 1 31  ? -21.565 -0.042  6.162   1.00  32.62 ? 31  LEU A CD2    1 
ATOM   427  H H      . LEU A 1 31  ? -21.070 2.500   2.058   1.00  22.01 ? 31  LEU A H      1 
ATOM   428  H HA     . LEU A 1 31  ? -22.858 0.806   3.728   1.00  24.25 ? 31  LEU A HA     1 
ATOM   429  H HB2    . LEU A 1 31  ? -20.751 2.878   4.476   1.00  28.54 ? 31  LEU A HB2    1 
ATOM   430  H HB3    . LEU A 1 31  ? -22.031 2.520   5.603   1.00  27.24 ? 31  LEU A HB3    1 
ATOM   431  H HG     . LEU A 1 31  ? -20.192 0.281   4.506   1.00  31.42 ? 31  LEU A HG     1 
ATOM   432  H HD11   . LEU A 1 31  ? -19.911 1.788   7.187   1.00  33.35 ? 31  LEU A HD11   1 
ATOM   433  H HD12   . LEU A 1 31  ? -18.813 1.962   5.830   1.00  34.15 ? 31  LEU A HD12   1 
ATOM   434  H HD13   . LEU A 1 31  ? -18.933 0.434   6.663   1.00  33.62 ? 31  LEU A HD13   1 
ATOM   435  H HD21   . LEU A 1 31  ? -21.006 -0.863  6.585   1.00  33.04 ? 31  LEU A HD21   1 
ATOM   436  H HD22   . LEU A 1 31  ? -22.364 -0.440  5.553   1.00  33.09 ? 31  LEU A HD22   1 
ATOM   437  H HD23   . LEU A 1 31  ? -22.005 0.516   6.978   1.00  32.93 ? 31  LEU A HD23   1 
ATOM   438  N N      . CYS A 1 32  ? -24.635 2.430   3.587   1.00  22.76 ? 32  CYS A N      1 
ATOM   439  C CA     . CYS A 1 32  ? -25.737 3.393   3.527   1.00  22.33 ? 32  CYS A CA     1 
ATOM   440  C C      . CYS A 1 32  ? -25.657 4.304   4.730   1.00  21.34 ? 32  CYS A C      1 
ATOM   441  O O      . CYS A 1 32  ? -25.489 3.864   5.861   1.00  22.83 ? 32  CYS A O      1 
ATOM   442  C CB     . CYS A 1 32  ? -27.061 2.645   3.526   1.00  26.09 ? 32  CYS A CB     1 
ATOM   443  S SG     . CYS A 1 32  ? -28.477 3.645   3.005   1.00  24.70 ? 32  CYS A SG     1 
ATOM   444  H H      . CYS A 1 32  ? -24.823 1.472   3.680   1.00  21.87 ? 32  CYS A H      1 
ATOM   445  H HA     . CYS A 1 32  ? -25.642 3.967   2.615   1.00  22.92 ? 32  CYS A HA     1 
ATOM   446  H HB2    . CYS A 1 32  ? -27.000 1.797   2.861   1.00  25.51 ? 32  CYS A HB2    1 
ATOM   447  H HB3    . CYS A 1 32  ? -27.260 2.262   4.515   1.00  24.63 ? 32  CYS A HB3    1 
ATOM   448  N N      . SER A 1 33  ? -25.794 5.558   4.424   1.00  22.34 ? 33  SER A N      1 
ATOM   449  C CA     . SER A 1 33  ? -25.752 6.635   5.437   1.00  22.69 ? 33  SER A CA     1 
ATOM   450  C C      . SER A 1 33  ? -26.916 6.392   6.451   1.00  25.05 ? 33  SER A C      1 
ATOM   451  O O      . SER A 1 33  ? -27.978 5.955   6.027   1.00  27.41 ? 33  SER A O      1 
ATOM   452  C CB     . SER A 1 33  ? -25.885 7.947   4.628   1.00  25.19 ? 33  SER A CB     1 
ATOM   453  O OG     . SER A 1 33  ? -25.782 8.989   5.583   1.00  27.38 ? 33  SER A OG     1 
ATOM   454  H H      . SER A 1 33  ? -25.943 5.791   3.482   1.00  21.95 ? 33  SER A H      1 
ATOM   455  H HA     . SER A 1 33  ? -24.807 6.578   5.957   1.00  24.70 ? 33  SER A HA     1 
ATOM   456  H HB2    . SER A 1 33  ? -25.097 8.039   3.894   1.00  24.52 ? 33  SER A HB2    1 
ATOM   457  H HB3    . SER A 1 33  ? -26.849 7.997   4.137   1.00  25.03 ? 33  SER A HB3    1 
ATOM   458  H HG     . SER A 1 33  ? -25.303 9.722   5.192   1.00  27.51 ? 33  SER A HG     1 
ATOM   459  N N      . SER A 1 34  ? -26.691 6.666   7.721   1.00  21.92 ? 34  SER A N      1 
ATOM   460  C CA     . SER A 1 34  ? -27.702 6.491   8.794   1.00  22.11 ? 34  SER A CA     1 
ATOM   461  C C      . SER A 1 34  ? -27.412 7.557   9.862   1.00  22.98 ? 34  SER A C      1 
ATOM   462  O O      . SER A 1 34  ? -26.438 8.298   9.814   1.00  22.27 ? 34  SER A O      1 
ATOM   463  C CB     . SER A 1 34  ? -27.575 5.070   9.422   1.00  21.43 ? 34  SER A CB     1 
ATOM   464  O OG     . SER A 1 34  ? -26.430 5.049   10.285  1.00  25.37 ? 34  SER A OG     1 
ATOM   465  H H      . SER A 1 34  ? -25.818 7.018   8.000   1.00  22.94 ? 34  SER A H      1 
ATOM   466  H HA     . SER A 1 34  ? -28.688 6.651   8.386   1.00  22.03 ? 34  SER A HA     1 
ATOM   467  H HB2    . SER A 1 34  ? -28.460 4.835   9.986   1.00  22.92 ? 34  SER A HB2    1 
ATOM   468  H HB3    . SER A 1 34  ? -27.450 4.332   8.644   1.00  23.02 ? 34  SER A HB3    1 
ATOM   469  H HG     . SER A 1 34  ? -25.754 4.553   9.782   1.00  25.02 ? 34  SER A HG     1 
ATOM   470  N N      . ARG A 1 35  ? -28.274 7.605   10.833  1.00  22.59 ? 35  ARG A N      1 
ATOM   471  C CA     . ARG A 1 35  ? -28.094 8.573   11.918  1.00  23.73 ? 35  ARG A CA     1 
ATOM   472  C C      . ARG A 1 35  ? -26.856 8.149   12.698  1.00  24.14 ? 35  ARG A C      1 
ATOM   473  O O      . ARG A 1 35  ? -26.331 9.000   13.387  1.00  26.41 ? 35  ARG A O      1 
ATOM   474  C CB     . ARG A 1 35  ? -29.264 8.563   12.899  1.00  26.89 ? 35  ARG A CB     1 
ATOM   475  C CG     . ARG A 1 35  ? -30.516 9.091   12.223  1.00  30.98 ? 35  ARG A CG     1 
ATOM   476  C CD     . ARG A 1 35  ? -31.673 9.229   13.270  1.00  33.41 ? 35  ARG A CD     1 
ATOM   477  N NE     . ARG A 1 35  ? -31.916 7.879   13.872  1.00  35.44 ? 35  ARG A NE     1 
ATOM   478  C CZ     . ARG A 1 35  ? -31.979 7.651   15.156  1.00  40.37 ? 35  ARG A CZ     1 
ATOM   479  N NH1    . ARG A 1 35  ? -31.829 8.619   16.034  1.00  41.25 ? 35  ARG A NH1    1 
ATOM   480  N NH2    . ARG A 1 35  ? -32.205 6.404   15.499  1.00  45.23 ? 35  ARG A NH2    1 
ATOM   481  H H      . ARG A 1 35  ? -29.044 6.999   10.840  1.00  24.27 ? 35  ARG A H      1 
ATOM   482  H HA     . ARG A 1 35  ? -27.917 9.550   11.491  1.00  23.30 ? 35  ARG A HA     1 
ATOM   483  H HB2    . ARG A 1 35  ? -29.428 7.553   13.245  1.00  27.36 ? 35  ARG A HB2    1 
ATOM   484  H HB3    . ARG A 1 35  ? -29.006 9.175   13.752  1.00  27.40 ? 35  ARG A HB3    1 
ATOM   485  H HG2    . ARG A 1 35  ? -30.322 10.053  11.771  1.00  31.02 ? 35  ARG A HG2    1 
ATOM   486  H HG3    . ARG A 1 35  ? -30.823 8.411   11.439  1.00  30.46 ? 35  ARG A HG3    1 
ATOM   487  H HD2    . ARG A 1 35  ? -31.446 9.960   14.030  1.00  32.20 ? 35  ARG A HD2    1 
ATOM   488  H HD3    . ARG A 1 35  ? -32.572 9.530   12.745  1.00  33.14 ? 35  ARG A HD3    1 
ATOM   489  H HE     . ARG A 1 35  ? -32.033 7.115   13.272  1.00  35.92 ? 35  ARG A HE     1 
ATOM   490  H HH11   . ARG A 1 35  ? -31.892 8.413   17.011  1.00  40.52 ? 35  ARG A HH11   1 
ATOM   491  H HH12   . ARG A 1 35  ? -31.653 9.557   15.737  1.00  40.29 ? 35  ARG A HH12   1 
ATOM   492  H HH21   . ARG A 1 35  ? -32.300 5.704   14.789  1.00  43.59 ? 35  ARG A HH21   1 
ATOM   493  H HH22   . ARG A 1 35  ? -32.282 6.149   16.463  1.00  44.33 ? 35  ARG A HH22   1 
ATOM   494  N N      A SER A 1 36  ? -26.401 6.915   12.614  1.00  24.41 ? 36  SER A N      1 
ATOM   495  C CA     A SER A 1 36  ? -25.173 6.543   13.410  1.00  23.17 ? 36  SER A CA     1 
ATOM   496  C C      . SER A 1 36  ? -23.828 6.669   12.627  1.00  24.76 ? 36  SER A C      1 
ATOM   497  O O      . SER A 1 36  ? -22.826 6.065   12.976  1.00  22.50 ? 36  SER A O      1 
ATOM   498  C CB     A SER A 1 36  ? -25.304 5.080   13.881  0.61  23.49 ? 36  SER A CB     1 
ATOM   499  C CB     B SER A 1 36  ? -25.360 5.121   13.919  0.28  24.62 ? 36  SER A CB     1 
ATOM   500  O OG     A SER A 1 36  ? -26.560 4.923   14.544  0.61  24.08 ? 36  SER A OG     1 
ATOM   501  O OG     B SER A 1 36  ? -26.094 4.427   12.919  0.28  25.50 ? 36  SER A OG     1 
ATOM   502  H H      A SER A 1 36  ? -26.844 6.244   12.046  1.00  23.76 ? 36  SER A H      1 
ATOM   503  H HA     A SER A 1 36  ? -25.104 7.189   14.277  1.00  24.04 ? 36  SER A HA     1 
ATOM   504  H HB2    A SER A 1 36  ? -25.237 4.409   13.034  0.61  23.26 ? 36  SER A HB2    1 
ATOM   505  H HB2    B SER A 1 36  ? -24.402 4.641   14.065  0.28  24.95 ? 36  SER A HB2    1 
ATOM   506  H HB3    A SER A 1 36  ? -24.502 4.851   14.571  0.61  23.84 ? 36  SER A HB3    1 
ATOM   507  H HB3    B SER A 1 36  ? -25.903 5.136   14.851  0.28  24.76 ? 36  SER A HB3    1 
ATOM   508  H HG     A SER A 1 36  ? -26.966 5.800   14.568  0.61  23.88 ? 36  SER A HG     1 
ATOM   509  H HG     B SER A 1 36  ? -25.870 4.744   12.026  0.28  25.62 ? 36  SER A HG     1 
ATOM   510  N N      . ASN A 1 37  ? -23.859 7.452   11.598  1.00  23.86 ? 37  ASN A N      1 
ATOM   511  C CA     . ASN A 1 37  ? -22.656 7.668   10.766  1.00  22.68 ? 37  ASN A CA     1 
ATOM   512  C C      . ASN A 1 37  ? -21.371 7.918   11.556  1.00  24.21 ? 37  ASN A C      1 
ATOM   513  O O      . ASN A 1 37  ? -20.348 7.353   11.220  1.00  19.76 ? 37  ASN A O      1 
ATOM   514  C CB     . ASN A 1 37  ? -22.875 8.853   9.848   1.00  21.62 ? 37  ASN A CB     1 
ATOM   515  C CG     . ASN A 1 37  ? -23.630 8.436   8.579   1.00  22.42 ? 37  ASN A CG     1 
ATOM   516  O OD1    . ASN A 1 37  ? -23.857 7.274   8.284   1.00  20.29 ? 37  ASN A OD1    1 
ATOM   517  N ND2    . ASN A 1 37  ? -24.038 9.361   7.772   1.00  23.43 ? 37  ASN A ND2    1 
ATOM   518  H H      . ASN A 1 37  ? -24.700 7.903   11.366  1.00  24.03 ? 37  ASN A H      1 
ATOM   519  H HA     . ASN A 1 37  ? -22.509 6.778   10.171  1.00  22.28 ? 37  ASN A HA     1 
ATOM   520  H HB2    . ASN A 1 37  ? -23.439 9.614   10.368  1.00  21.85 ? 37  ASN A HB2    1 
ATOM   521  H HB3    . ASN A 1 37  ? -21.916 9.264   9.567   1.00  22.27 ? 37  ASN A HB3    1 
ATOM   522  H HD21   . ASN A 1 37  ? -23.870 10.305  7.957   1.00  22.91 ? 37  ASN A HD21   1 
ATOM   523  H HD22   . ASN A 1 37  ? -24.531 9.095   6.966   1.00  23.08 ? 37  ASN A HD22   1 
ATOM   524  N N      . ALA A 1 38  ? -21.436 8.746   12.571  1.00  23.61 ? 38  ALA A N      1 
ATOM   525  C CA     . ALA A 1 38  ? -20.194 9.050   13.392  1.00  25.54 ? 38  ALA A CA     1 
ATOM   526  C C      . ALA A 1 38  ? -19.583 7.838   14.047  1.00  24.39 ? 38  ALA A C      1 
ATOM   527  O O      . ALA A 1 38  ? -18.385 7.654   14.049  1.00  22.94 ? 38  ALA A O      1 
ATOM   528  C CB     . ALA A 1 38  ? -20.496 10.063  14.506  1.00  26.48 ? 38  ALA A CB     1 
ATOM   529  H H      . ALA A 1 38  ? -22.298 9.161   12.784  1.00  22.59 ? 38  ALA A H      1 
ATOM   530  H HA     . ALA A 1 38  ? -19.457 9.482   12.729  1.00  26.31 ? 38  ALA A HA     1 
ATOM   531  H HB1    . ALA A 1 38  ? -19.592 10.261  15.061  1.00  26.51 ? 38  ALA A HB1    1 
ATOM   532  H HB2    . ALA A 1 38  ? -21.247 9.688   15.184  1.00  26.76 ? 38  ALA A HB2    1 
ATOM   533  H HB3    . ALA A 1 38  ? -20.833 10.993  14.071  1.00  26.32 ? 38  ALA A HB3    1 
ATOM   534  N N      . ARG A 1 39  ? -20.417 7.023   14.597  1.00  26.28 ? 39  ARG A N      1 
ATOM   535  C CA     . ARG A 1 39  ? -19.910 5.794   15.272  1.00  28.53 ? 39  ARG A CA     1 
ATOM   536  C C      . ARG A 1 39  ? -19.500 4.790   14.209  1.00  24.68 ? 39  ARG A C      1 
ATOM   537  O O      . ARG A 1 39  ? -18.548 4.074   14.424  1.00  27.00 ? 39  ARG A O      1 
ATOM   538  C CB     . ARG A 1 39  ? -21.016 5.186   16.189  1.00  34.30 ? 39  ARG A CB     1 
ATOM   539  C CG     . ARG A 1 39  ? -20.504 3.968   17.050  1.00  41.87 ? 39  ARG A CG     1 
ATOM   540  C CD     . ARG A 1 39  ? -19.223 4.284   17.964  1.00  47.58 ? 39  ARG A CD     1 
ATOM   541  N NE     . ARG A 1 39  ? -17.989 3.684   17.347  1.00  50.91 ? 39  ARG A NE     1 
ATOM   542  C CZ     . ARG A 1 39  ? -17.395 2.652   17.912  1.00  54.93 ? 39  ARG A CZ     1 
ATOM   543  N NH1    . ARG A 1 39  ? -18.127 1.725   18.490  1.00  56.85 ? 39  ARG A NH1    1 
ATOM   544  N NH2    . ARG A 1 39  ? -16.087 2.577   17.882  1.00  52.69 ? 39  ARG A NH2    1 
ATOM   545  H H      . ARG A 1 39  ? -21.370 7.235   14.545  1.00  28.43 ? 39  ARG A H      1 
ATOM   546  H HA     . ARG A 1 39  ? -19.028 6.063   15.838  1.00  27.39 ? 39  ARG A HA     1 
ATOM   547  H HB2    . ARG A 1 39  ? -21.423 5.938   16.849  1.00  34.75 ? 39  ARG A HB2    1 
ATOM   548  H HB3    . ARG A 1 39  ? -21.816 4.821   15.560  1.00  35.12 ? 39  ARG A HB3    1 
ATOM   549  H HG2    . ARG A 1 39  ? -21.311 3.631   17.690  1.00  41.17 ? 39  ARG A HG2    1 
ATOM   550  H HG3    . ARG A 1 39  ? -20.260 3.148   16.386  1.00  41.19 ? 39  ARG A HG3    1 
ATOM   551  H HD2    . ARG A 1 39  ? -19.040 5.344   18.076  1.00  47.05 ? 39  ARG A HD2    1 
ATOM   552  H HD3    . ARG A 1 39  ? -19.353 3.865   18.953  1.00  47.20 ? 39  ARG A HD3    1 
ATOM   553  H HE     . ARG A 1 39  ? -17.624 4.067   16.520  1.00  51.37 ? 39  ARG A HE     1 
ATOM   554  H HH11   . ARG A 1 39  ? -17.684 0.936   18.916  1.00  56.53 ? 39  ARG A HH11   1 
ATOM   555  H HH12   . ARG A 1 39  ? -19.124 1.806   18.504  1.00  56.21 ? 39  ARG A HH12   1 
ATOM   556  H HH21   . ARG A 1 39  ? -15.556 3.300   17.439  1.00  52.92 ? 39  ARG A HH21   1 
ATOM   557  H HH22   . ARG A 1 39  ? -15.619 1.799   18.300  1.00  52.66 ? 39  ARG A HH22   1 
ATOM   558  N N      . VAL A 1 40  ? -20.188 4.736   13.110  1.00  19.40 ? 40  VAL A N      1 
ATOM   559  C CA     . VAL A 1 40  ? -19.792 3.763   12.068  1.00  21.25 ? 40  VAL A CA     1 
ATOM   560  C C      . VAL A 1 40  ? -18.441 4.212   11.466  1.00  18.19 ? 40  VAL A C      1 
ATOM   561  O O      . VAL A 1 40  ? -17.612 3.377   11.191  1.00  16.15 ? 40  VAL A O      1 
ATOM   562  C CB     . VAL A 1 40  ? -20.909 3.721   10.981  1.00  20.81 ? 40  VAL A CB     1 
ATOM   563  C CG1    . VAL A 1 40  ? -20.509 2.769   9.852   1.00  22.71 ? 40  VAL A CG1    1 
ATOM   564  C CG2    . VAL A 1 40  ? -22.214 3.205   11.595  1.00  20.82 ? 40  VAL A CG2    1 
ATOM   565  H H      . VAL A 1 40  ? -20.957 5.327   12.967  1.00  21.66 ? 40  VAL A H      1 
ATOM   566  H HA     . VAL A 1 40  ? -19.645 2.799   12.538  1.00  20.17 ? 40  VAL A HA     1 
ATOM   567  H HB     . VAL A 1 40  ? -21.053 4.711   10.568  1.00  21.65 ? 40  VAL A HB     1 
ATOM   568  H HG11   . VAL A 1 40  ? -20.349 1.771   10.233  1.00  22.30 ? 40  VAL A HG11   1 
ATOM   569  H HG12   . VAL A 1 40  ? -19.588 3.102   9.390   1.00  22.57 ? 40  VAL A HG12   1 
ATOM   570  H HG13   . VAL A 1 40  ? -21.273 2.743   9.090   1.00  22.64 ? 40  VAL A HG13   1 
ATOM   571  H HG21   . VAL A 1 40  ? -22.985 3.196   10.838  1.00  20.68 ? 40  VAL A HG21   1 
ATOM   572  H HG22   . VAL A 1 40  ? -22.538 3.847   12.399  1.00  20.07 ? 40  VAL A HG22   1 
ATOM   573  H HG23   . VAL A 1 40  ? -22.082 2.204   11.976  1.00  20.49 ? 40  VAL A HG23   1 
ATOM   574  N N      . ALA A 1 41  ? -18.266 5.494   11.270  1.00  16.29 ? 41  ALA A N      1 
ATOM   575  C CA     . ALA A 1 41  ? -16.995 6.032   10.698  1.00  18.12 ? 41  ALA A CA     1 
ATOM   576  C C      . ALA A 1 41  ? -15.856 5.693   11.695  1.00  18.11 ? 41  ALA A C      1 
ATOM   577  O O      . ALA A 1 41  ? -14.843 5.190   11.257  1.00  17.64 ? 41  ALA A O      1 
ATOM   578  C CB     . ALA A 1 41  ? -17.073 7.592   10.519  1.00  19.26 ? 41  ALA A CB     1 
ATOM   579  H H      . ALA A 1 41  ? -18.997 6.099   11.508  1.00  18.55 ? 41  ALA A H      1 
ATOM   580  H HA     . ALA A 1 41  ? -16.805 5.530   9.761   1.00  17.84 ? 41  ALA A HA     1 
ATOM   581  H HB1    . ALA A 1 41  ? -16.146 7.965   10.104  1.00  18.20 ? 41  ALA A HB1    1 
ATOM   582  H HB2    . ALA A 1 41  ? -17.235 8.083   11.465  1.00  19.12 ? 41  ALA A HB2    1 
ATOM   583  H HB3    . ALA A 1 41  ? -17.885 7.862   9.860   1.00  19.21 ? 41  ALA A HB3    1 
ATOM   584  N N      . GLY A 1 42  ? -16.085 5.983   12.957  1.00  16.61 ? 42  GLY A N      1 
ATOM   585  C CA     . GLY A 1 42  ? -15.102 5.722   14.054  1.00  19.03 ? 42  GLY A CA     1 
ATOM   586  C C      . GLY A 1 42  ? -14.746 4.236   14.092  1.00  21.06 ? 42  GLY A C      1 
ATOM   587  O O      . GLY A 1 42  ? -13.578 3.890   14.051  1.00  17.38 ? 42  GLY A O      1 
ATOM   588  H H      . GLY A 1 42  ? -16.946 6.392   13.191  1.00  18.26 ? 42  GLY A H      1 
ATOM   589  H HA2    . GLY A 1 42  ? -14.205 6.293   13.860  1.00  18.47 ? 42  GLY A HA2    1 
ATOM   590  H HA3    . GLY A 1 42  ? -15.533 6.019   14.993  1.00  18.88 ? 42  GLY A HA3    1 
ATOM   591  N N      . LEU A 1 43  ? -15.754 3.404   14.176  1.00  18.26 ? 43  LEU A N      1 
ATOM   592  C CA     . LEU A 1 43  ? -15.549 1.935   14.211  1.00  19.99 ? 43  LEU A CA     1 
ATOM   593  C C      . LEU A 1 43  ? -14.773 1.425   12.955  1.00  19.77 ? 43  LEU A C      1 
ATOM   594  O O      . LEU A 1 43  ? -13.877 0.608   13.122  1.00  18.33 ? 43  LEU A O      1 
ATOM   595  C CB     . LEU A 1 43  ? -16.936 1.297   14.325  1.00  21.58 ? 43  LEU A CB     1 
ATOM   596  C CG     . LEU A 1 43  ? -16.849 -0.237  14.299  1.00  25.91 ? 43  LEU A CG     1 
ATOM   597  C CD1    . LEU A 1 43  ? -16.106 -0.768  15.543  1.00  28.26 ? 43  LEU A CD1    1 
ATOM   598  C CD2    . LEU A 1 43  ? -18.278 -0.835  14.242  1.00  29.31 ? 43  LEU A CD2    1 
ATOM   599  H H      . LEU A 1 43  ? -16.666 3.760   14.216  1.00  19.52 ? 43  LEU A H      1 
ATOM   600  H HA     . LEU A 1 43  ? -14.968 1.700   15.087  1.00  19.90 ? 43  LEU A HA     1 
ATOM   601  H HB2    . LEU A 1 43  ? -17.390 1.628   15.247  1.00  21.77 ? 43  LEU A HB2    1 
ATOM   602  H HB3    . LEU A 1 43  ? -17.543 1.636   13.496  1.00  22.84 ? 43  LEU A HB3    1 
ATOM   603  H HG     . LEU A 1 43  ? -16.310 -0.552  13.415  1.00  26.48 ? 43  LEU A HG     1 
ATOM   604  H HD11   . LEU A 1 43  ? -16.602 -0.465  16.456  1.00  27.83 ? 43  LEU A HD11   1 
ATOM   605  H HD12   . LEU A 1 43  ? -15.087 -0.404  15.566  1.00  27.70 ? 43  LEU A HD12   1 
ATOM   606  H HD13   . LEU A 1 43  ? -16.056 -1.846  15.513  1.00  27.46 ? 43  LEU A HD13   1 
ATOM   607  H HD21   . LEU A 1 43  ? -18.248 -1.914  14.206  1.00  28.13 ? 43  LEU A HD21   1 
ATOM   608  H HD22   . LEU A 1 43  ? -18.784 -0.480  13.351  1.00  28.38 ? 43  LEU A HD22   1 
ATOM   609  H HD23   . LEU A 1 43  ? -18.849 -0.529  15.109  1.00  28.33 ? 43  LEU A HD23   1 
ATOM   610  N N      . SER A 1 44  ? -15.129 1.885   11.769  1.00  16.64 ? 44  SER A N      1 
ATOM   611  C CA     . SER A 1 44  ? -14.467 1.490   10.469  1.00  18.69 ? 44  SER A CA     1 
ATOM   612  C C      . SER A 1 44  ? -12.968 1.850   10.459  1.00  15.32 ? 44  SER A C      1 
ATOM   613  O O      . SER A 1 44  ? -12.175 1.032   10.030  1.00  12.51 ? 44  SER A O      1 
ATOM   614  C CB     . SER A 1 44  ? -15.128 2.204   9.267   1.00  21.96 ? 44  SER A CB     1 
ATOM   615  O OG     . SER A 1 44  ? -16.446 1.649   9.123   1.00  24.53 ? 44  SER A OG     1 
ATOM   616  H H      . SER A 1 44  ? -15.878 2.520   11.723  1.00  19.45 ? 44  SER A H      1 
ATOM   617  H HA     . SER A 1 44  ? -14.565 0.419   10.358  1.00  17.89 ? 44  SER A HA     1 
ATOM   618  H HB2    . SER A 1 44  ? -15.183 3.274   9.435   1.00  21.88 ? 44  SER A HB2    1 
ATOM   619  H HB3    . SER A 1 44  ? -14.546 2.018   8.375   1.00  22.14 ? 44  SER A HB3    1 
ATOM   620  H HG     . SER A 1 44  ? -16.619 1.426   8.205   1.00  22.52 ? 44  SER A HG     1 
ATOM   621  N N      . CYS A 1 45  ? -12.635 3.034   10.899  1.00  15.17 ? 45  CYS A N      1 
ATOM   622  C CA     . CYS A 1 45  ? -11.212 3.477   10.948  1.00  14.77 ? 45  CYS A CA     1 
ATOM   623  C C      . CYS A 1 45  ? -10.470 2.562   11.947  1.00  13.08 ? 45  CYS A C      1 
ATOM   624  O O      . CYS A 1 45  ? -9.415  2.064   11.608  1.00  15.17 ? 45  CYS A O      1 
ATOM   625  C CB     . CYS A 1 45  ? -11.181 4.913   11.388  1.00  15.05 ? 45  CYS A CB     1 
ATOM   626  S SG     . CYS A 1 45  ? -11.710 6.040   10.084  1.00  17.61 ? 45  CYS A SG     1 
ATOM   627  H H      . CYS A 1 45  ? -13.340 3.651   11.201  1.00  15.32 ? 45  CYS A H      1 
ATOM   628  H HA     . CYS A 1 45  ? -10.774 3.368   9.968   1.00  14.97 ? 45  CYS A HA     1 
ATOM   629  H HB2    . CYS A 1 45  ? -11.815 5.052   12.249  1.00  15.56 ? 45  CYS A HB2    1 
ATOM   630  H HB3    . CYS A 1 45  ? -10.178 5.174   11.685  1.00  16.08 ? 45  CYS A HB3    1 
ATOM   631  N N      . GLU A 1 46  ? -11.032 2.368   13.115  1.00  13.05 ? 46  GLU A N      1 
ATOM   632  C CA     . GLU A 1 46  ? -10.403 1.475   14.164  1.00  19.48 ? 46  GLU A CA     1 
ATOM   633  C C      . GLU A 1 46  ? -10.095 0.077   13.576  1.00  21.24 ? 46  GLU A C      1 
ATOM   634  O O      . GLU A 1 46  ? -9.008  -0.465  13.658  1.00  16.75 ? 46  GLU A O      1 
ATOM   635  C CB     . GLU A 1 46  ? -11.350 1.275   15.378  1.00  19.34 ? 46  GLU A CB     1 
ATOM   636  C CG     . GLU A 1 46  ? -11.447 2.589   16.178  1.00  22.30 ? 46  GLU A CG     1 
ATOM   637  C CD     . GLU A 1 46  ? -12.490 2.553   17.338  1.00  25.04 ? 46  GLU A CD     1 
ATOM   638  O OE1    . GLU A 1 46  ? -12.575 3.589   17.968  1.00  25.87 ? 46  GLU A OE1    1 
ATOM   639  O OE2    . GLU A 1 46  ? -13.145 1.542   17.548  1.00  25.11 ? 46  GLU A OE2    1 
ATOM   640  H H      . GLU A 1 46  ? -11.883 2.824   13.291  1.00  15.14 ? 46  GLU A H      1 
ATOM   641  H HA     . GLU A 1 46  ? -9.467  1.916   14.480  1.00  19.68 ? 46  GLU A HA     1 
ATOM   642  H HB2    . GLU A 1 46  ? -12.318 0.914   15.063  1.00  20.44 ? 46  GLU A HB2    1 
ATOM   643  H HB3    . GLU A 1 46  ? -10.912 0.516   16.012  1.00  20.47 ? 46  GLU A HB3    1 
ATOM   644  H HG2    . GLU A 1 46  ? -10.471 2.798   16.600  1.00  23.31 ? 46  GLU A HG2    1 
ATOM   645  H HG3    . GLU A 1 46  ? -11.698 3.407   15.516  1.00  23.40 ? 46  GLU A HG3    1 
ATOM   646  N N      . GLU A 1 47  ? -11.125 -0.463  13.000  1.00  21.38 ? 47  GLU A N      1 
ATOM   647  C CA     . GLU A 1 47  ? -11.136 -1.806  12.333  1.00  22.50 ? 47  GLU A CA     1 
ATOM   648  C C      . GLU A 1 47  ? -9.969  -1.992  11.377  1.00  18.72 ? 47  GLU A C      1 
ATOM   649  O O      . GLU A 1 47  ? -9.293  -3.004  11.315  1.00  17.20 ? 47  GLU A O      1 
ATOM   650  C CB     . GLU A 1 47  ? -12.456 -1.974  11.493  1.00  27.71 ? 47  GLU A CB     1 
ATOM   651  C CG     . GLU A 1 47  ? -12.756 -3.427  11.094  1.00  32.74 ? 47  GLU A CG     1 
ATOM   652  C CD     . GLU A 1 47  ? -14.005 -3.983  11.857  1.00  39.24 ? 47  GLU A CD     1 
ATOM   653  O OE1    . GLU A 1 47  ? -14.513 -4.998  11.398  1.00  44.14 ? 47  GLU A OE1    1 
ATOM   654  O OE2    . GLU A 1 47  ? -14.395 -3.385  12.850  1.00  41.40 ? 47  GLU A OE2    1 
ATOM   655  H H      . GLU A 1 47  ? -11.956 0.059   13.019  1.00  22.78 ? 47  GLU A H      1 
ATOM   656  H HA     . GLU A 1 47  ? -11.072 -2.556  13.111  1.00  23.85 ? 47  GLU A HA     1 
ATOM   657  H HB2    . GLU A 1 47  ? -13.273 -1.520  12.032  1.00  27.30 ? 47  GLU A HB2    1 
ATOM   658  H HB3    . GLU A 1 47  ? -12.344 -1.427  10.566  1.00  27.05 ? 47  GLU A HB3    1 
ATOM   659  H HG2    . GLU A 1 47  ? -12.943 -3.473  10.032  1.00  33.49 ? 47  GLU A HG2    1 
ATOM   660  H HG3    . GLU A 1 47  ? -11.908 -4.065  11.305  1.00  33.60 ? 47  GLU A HG3    1 
ATOM   661  N N      . MET A 1 48  ? -9.777  -0.953  10.629  1.00  14.68 ? 48  MET A N      1 
ATOM   662  C CA     . MET A 1 48  ? -8.698  -0.975  9.625   1.00  14.71 ? 48  MET A CA     1 
ATOM   663  C C      . MET A 1 48  ? -7.328  -0.691  10.183  1.00  12.95 ? 48  MET A C      1 
ATOM   664  O O      . MET A 1 48  ? -6.395  -0.787  9.409   1.00  16.25 ? 48  MET A O      1 
ATOM   665  C CB     . MET A 1 48  ? -8.998  0.050   8.519   1.00  16.06 ? 48  MET A CB     1 
ATOM   666  C CG     . MET A 1 48  ? -10.294 -0.264  7.650   1.00  14.79 ? 48  MET A CG     1 
ATOM   667  S SD     . MET A 1 48  ? -10.466 0.853   6.251   1.00  16.44 ? 48  MET A SD     1 
ATOM   668  C CE     . MET A 1 48  ? -11.117 2.307   7.097   1.00  15.75 ? 48  MET A CE     1 
ATOM   669  H H      . MET A 1 48  ? -10.342 -0.159  10.746  1.00  16.70 ? 48  MET A H      1 
ATOM   670  H HA     . MET A 1 48  ? -8.656  -1.970  9.197   1.00  14.59 ? 48  MET A HA     1 
ATOM   671  H HB2    . MET A 1 48  ? -9.145  0.999   9.005   1.00  15.79 ? 48  MET A HB2    1 
ATOM   672  H HB3    . MET A 1 48  ? -8.138  0.129   7.866   1.00  14.58 ? 48  MET A HB3    1 
ATOM   673  H HG2    . MET A 1 48  ? -10.199 -1.259  7.241   1.00  15.96 ? 48  MET A HG2    1 
ATOM   674  H HG3    . MET A 1 48  ? -11.189 -0.237  8.258   1.00  15.86 ? 48  MET A HG3    1 
ATOM   675  H HE1    . MET A 1 48  ? -10.476 3.159   6.928   1.00  16.39 ? 48  MET A HE1    1 
ATOM   676  H HE2    . MET A 1 48  ? -11.159 2.126   8.158   1.00  16.45 ? 48  MET A HE2    1 
ATOM   677  H HE3    . MET A 1 48  ? -12.117 2.518   6.749   1.00  16.42 ? 48  MET A HE3    1 
ATOM   678  N N      . GLY A 1 49  ? -7.259  -0.349  11.434  1.00  14.17 ? 49  GLY A N      1 
ATOM   679  C CA     . GLY A 1 49  ? -5.919  -0.068  12.046  1.00  14.93 ? 49  GLY A CA     1 
ATOM   680  C C      . GLY A 1 49  ? -5.554  1.395   12.094  1.00  16.66 ? 49  GLY A C      1 
ATOM   681  O O      . GLY A 1 49  ? -4.398  1.717   12.328  1.00  18.28 ? 49  GLY A O      1 
ATOM   682  H H      . GLY A 1 49  ? -8.069  -0.273  11.985  1.00  11.80 ? 49  GLY A H      1 
ATOM   683  H HA2    . GLY A 1 49  ? -5.932  -0.448  13.056  1.00  13.93 ? 49  GLY A HA2    1 
ATOM   684  H HA3    . GLY A 1 49  ? -5.151  -0.589  11.491  1.00  15.43 ? 49  GLY A HA3    1 
ATOM   685  N N      . PHE A 1 50  ? -6.522  2.243   11.878  1.00  15.61 ? 50  PHE A N      1 
ATOM   686  C CA     . PHE A 1 50  ? -6.244  3.713   11.920  1.00  17.50 ? 50  PHE A CA     1 
ATOM   687  C C      . PHE A 1 50  ? -6.649  4.052   13.351  1.00  17.56 ? 50  PHE A C      1 
ATOM   688  O O      . PHE A 1 50  ? -7.368  3.301   13.988  1.00  22.32 ? 50  PHE A O      1 
ATOM   689  C CB     . PHE A 1 50  ? -7.115  4.546   10.922  1.00  21.15 ? 50  PHE A CB     1 
ATOM   690  C CG     . PHE A 1 50  ? -6.738  4.212   9.467   1.00  23.37 ? 50  PHE A CG     1 
ATOM   691  C CD1    . PHE A 1 50  ? -7.377  3.191   8.793   1.00  24.20 ? 50  PHE A CD1    1 
ATOM   692  C CD2    . PHE A 1 50  ? -5.749  4.906   8.813   1.00  28.77 ? 50  PHE A CD2    1 
ATOM   693  C CE1    . PHE A 1 50  ? -7.050  2.855   7.502   1.00  23.70 ? 50  PHE A CE1    1 
ATOM   694  C CE2    . PHE A 1 50  ? -5.405  4.590   7.520   1.00  30.86 ? 50  PHE A CE2    1 
ATOM   695  C CZ     . PHE A 1 50  ? -6.062  3.554   6.861   1.00  31.27 ? 50  PHE A CZ     1 
ATOM   696  H H      . PHE A 1 50  ? -7.428  1.916   11.696  1.00  16.69 ? 50  PHE A H      1 
ATOM   697  H HA     . PHE A 1 50  ? -5.183  3.884   11.779  1.00  17.86 ? 50  PHE A HA     1 
ATOM   698  H HB2    . PHE A 1 50  ? -8.163  4.339   11.077  1.00  21.72 ? 50  PHE A HB2    1 
ATOM   699  H HB3    . PHE A 1 50  ? -6.943  5.601   11.089  1.00  21.38 ? 50  PHE A HB3    1 
ATOM   700  H HD1    . PHE A 1 50  ? -8.154  2.652   9.309   1.00  23.99 ? 50  PHE A HD1    1 
ATOM   701  H HD2    . PHE A 1 50  ? -5.226  5.697   9.310   1.00  27.85 ? 50  PHE A HD2    1 
ATOM   702  H HE1    . PHE A 1 50  ? -7.562  2.049   6.998   1.00  24.69 ? 50  PHE A HE1    1 
ATOM   703  H HE2    . PHE A 1 50  ? -4.627  5.158   7.029   1.00  30.45 ? 50  PHE A HE2    1 
ATOM   704  H HZ     . PHE A 1 50  ? -5.795  3.297   5.846   1.00  30.17 ? 50  PHE A HZ     1 
ATOM   705  N N      . LEU A 1 51  ? -6.247  5.169   13.879  1.00  20.68 ? 51  LEU A N      1 
ATOM   706  C CA     . LEU A 1 51  ? -6.641  5.429   15.293  1.00  25.30 ? 51  LEU A CA     1 
ATOM   707  C C      . LEU A 1 51  ? -8.066  5.878   15.459  1.00  27.53 ? 51  LEU A C      1 
ATOM   708  O O      . LEU A 1 51  ? -8.792  5.391   16.306  1.00  27.54 ? 51  LEU A O      1 
ATOM   709  C CB     . LEU A 1 51  ? -5.653  6.520   15.908  1.00  23.88 ? 51  LEU A CB     1 
ATOM   710  C CG     . LEU A 1 51  ? -5.708  6.569   17.482  1.00  22.60 ? 51  LEU A CG     1 
ATOM   711  C CD1    . LEU A 1 51  ? -5.271  5.211   18.120  1.00  21.89 ? 51  LEU A CD1    1 
ATOM   712  C CD2    . LEU A 1 51  ? -4.777  7.698   17.961  1.00  25.04 ? 51  LEU A CD2    1 
ATOM   713  H H      . LEU A 1 51  ? -5.710  5.811   13.370  1.00  19.58 ? 51  LEU A H      1 
ATOM   714  H HA     . LEU A 1 51  ? -6.530  4.499   15.833  1.00  25.18 ? 51  LEU A HA     1 
ATOM   715  H HB2    . LEU A 1 51  ? -4.645  6.296   15.587  1.00  24.19 ? 51  LEU A HB2    1 
ATOM   716  H HB3    . LEU A 1 51  ? -5.908  7.490   15.503  1.00  23.08 ? 51  LEU A HB3    1 
ATOM   717  H HG     . LEU A 1 51  ? -6.718  6.786   17.804  1.00  22.96 ? 51  LEU A HG     1 
ATOM   718  H HD11   . LEU A 1 51  ? -4.281  4.936   17.785  1.00  22.05 ? 51  LEU A HD11   1 
ATOM   719  H HD12   . LEU A 1 51  ? -5.949  4.411   17.859  1.00  21.07 ? 51  LEU A HD12   1 
ATOM   720  H HD13   . LEU A 1 51  ? -5.258  5.280   19.195  1.00  21.62 ? 51  LEU A HD13   1 
ATOM   721  H HD21   . LEU A 1 51  ? -4.782  7.760   19.041  1.00  24.24 ? 51  LEU A HD21   1 
ATOM   722  H HD22   . LEU A 1 51  ? -5.105  8.646   17.560  1.00  24.16 ? 51  LEU A HD22   1 
ATOM   723  H HD23   . LEU A 1 51  ? -3.766  7.520   17.623  1.00  24.59 ? 51  LEU A HD23   1 
ATOM   724  N N      . ARG A 1 52  ? -8.390  6.814   14.626  1.00  30.38 ? 52  ARG A N      1 
ATOM   725  C CA     . ARG A 1 52  ? -9.740  7.395   14.652  1.00  31.14 ? 52  ARG A CA     1 
ATOM   726  C C      . ARG A 1 52  ? -10.132 7.994   13.297  1.00  29.03 ? 52  ARG A C      1 
ATOM   727  O O      . ARG A 1 52  ? -9.339  8.075   12.372  1.00  25.63 ? 52  ARG A O      1 
ATOM   728  C CB     . ARG A 1 52  ? -9.709  8.474   15.776  1.00  33.41 ? 52  ARG A CB     1 
ATOM   729  C CG     . ARG A 1 52  ? -8.473  9.444   15.615  1.00  36.41 ? 52  ARG A CG     1 
ATOM   730  C CD     . ARG A 1 52  ? -8.585  10.566  16.677  1.00  44.29 ? 52  ARG A CD     1 
ATOM   731  N NE     . ARG A 1 52  ? -7.247  11.254  16.880  1.00  52.40 ? 52  ARG A NE     1 
ATOM   732  C CZ     . ARG A 1 52  ? -6.687  11.396  18.085  1.00  57.77 ? 52  ARG A CZ     1 
ATOM   733  N NH1    . ARG A 1 52  ? -7.340  11.085  19.187  1.00  58.85 ? 52  ARG A NH1    1 
ATOM   734  N NH2    . ARG A 1 52  ? -5.455  11.859  18.172  1.00  57.24 ? 52  ARG A NH2    1 
ATOM   735  H H      . ARG A 1 52  ? -7.738  7.133   13.968  1.00  30.74 ? 52  ARG A H      1 
ATOM   736  H HA     . ARG A 1 52  ? -10.453 6.618   14.906  1.00  31.46 ? 52  ARG A HA     1 
ATOM   737  H HB2    . ARG A 1 52  ? -10.633 9.033   15.746  1.00  34.39 ? 52  ARG A HB2    1 
ATOM   738  H HB3    . ARG A 1 52  ? -9.658  7.962   16.727  1.00  33.39 ? 52  ARG A HB3    1 
ATOM   739  H HG2    . ARG A 1 52  ? -7.547  8.909   15.755  1.00  37.08 ? 52  ARG A HG2    1 
ATOM   740  H HG3    . ARG A 1 52  ? -8.468  9.886   14.630  1.00  36.66 ? 52  ARG A HG3    1 
ATOM   741  H HD2    . ARG A 1 52  ? -9.299  11.312  16.352  1.00  44.19 ? 52  ARG A HD2    1 
ATOM   742  H HD3    . ARG A 1 52  ? -8.930  10.148  17.611  1.00  44.48 ? 52  ARG A HD3    1 
ATOM   743  H HE     . ARG A 1 52  ? -6.775  11.610  16.096  1.00  51.58 ? 52  ARG A HE     1 
ATOM   744  H HH11   . ARG A 1 52  ? -6.893  11.204  20.074  1.00  59.11 ? 52  ARG A HH11   1 
ATOM   745  H HH12   . ARG A 1 52  ? -8.275  10.733  19.151  1.00  59.11 ? 52  ARG A HH12   1 
ATOM   746  H HH21   . ARG A 1 52  ? -4.952  12.102  17.343  1.00  57.07 ? 52  ARG A HH21   1 
ATOM   747  H HH22   . ARG A 1 52  ? -5.021  11.969  19.068  1.00  56.39 ? 52  ARG A HH22   1 
ATOM   748  N N      . ALA A 1 53  ? -11.360 8.407   13.269  1.00  26.14 ? 53  ALA A N      1 
ATOM   749  C CA     . ALA A 1 53  ? -11.916 9.033   12.058  1.00  24.98 ? 53  ALA A CA     1 
ATOM   750  C C      . ALA A 1 53  ? -11.779 10.497  12.450  1.00  20.68 ? 53  ALA A C      1 
ATOM   751  O O      . ALA A 1 53  ? -12.188 10.866  13.530  1.00  23.55 ? 53  ALA A O      1 
ATOM   752  C CB     . ALA A 1 53  ? -13.426 8.739   11.857  1.00  26.02 ? 53  ALA A CB     1 
ATOM   753  H H      . ALA A 1 53  ? -11.925 8.306   14.064  1.00  26.57 ? 53  ALA A H      1 
ATOM   754  H HA     . ALA A 1 53  ? -11.339 8.801   11.188  1.00  25.18 ? 53  ALA A HA     1 
ATOM   755  H HB1    . ALA A 1 53  ? -13.768 9.215   10.948  1.00  25.50 ? 53  ALA A HB1    1 
ATOM   756  H HB2    . ALA A 1 53  ? -14.005 9.121   12.685  1.00  25.31 ? 53  ALA A HB2    1 
ATOM   757  H HB3    . ALA A 1 53  ? -13.588 7.673   11.774  1.00  25.99 ? 53  ALA A HB3    1 
ATOM   758  N N      . LEU A 1 54  ? -11.218 11.274  11.602  1.00  22.33 ? 54  LEU A N      1 
ATOM   759  C CA     . LEU A 1 54  ? -11.044 12.734  11.867  1.00  26.81 ? 54  LEU A CA     1 
ATOM   760  C C      . LEU A 1 54  ? -12.403 13.344  11.513  1.00  30.42 ? 54  LEU A C      1 
ATOM   761  O O      . LEU A 1 54  ? -12.880 14.221  12.205  1.00  28.82 ? 54  LEU A O      1 
ATOM   762  C CB     . LEU A 1 54  ? -9.989  13.337  10.961  1.00  27.12 ? 54  LEU A CB     1 
ATOM   763  C CG     . LEU A 1 54  ? -8.618  12.636  11.233  1.00  30.34 ? 54  LEU A CG     1 
ATOM   764  C CD1    . LEU A 1 54  ? -7.532  13.238  10.304  1.00  31.97 ? 54  LEU A CD1    1 
ATOM   765  C CD2    . LEU A 1 54  ? -8.215  12.821  12.715  1.00  30.10 ? 54  LEU A CD2    1 
ATOM   766  H H      . LEU A 1 54  ? -10.893 10.889  10.777  1.00  20.32 ? 54  LEU A H      1 
ATOM   767  H HA     . LEU A 1 54  ? -10.857 12.897  12.917  1.00  28.07 ? 54  LEU A HA     1 
ATOM   768  H HB2    . LEU A 1 54  ? -10.290 13.208  9.930   1.00  27.63 ? 54  LEU A HB2    1 
ATOM   769  H HB3    . LEU A 1 54  ? -9.944  14.398  11.165  1.00  27.68 ? 54  LEU A HB3    1 
ATOM   770  H HG     . LEU A 1 54  ? -8.708  11.578  11.018  1.00  30.10 ? 54  LEU A HG     1 
ATOM   771  H HD11   . LEU A 1 54  ? -7.430  14.303  10.458  1.00  31.25 ? 54  LEU A HD11   1 
ATOM   772  H HD12   . LEU A 1 54  ? -7.779  13.062  9.264   1.00  31.35 ? 54  LEU A HD12   1 
ATOM   773  H HD13   . LEU A 1 54  ? -6.584  12.765  10.507  1.00  31.60 ? 54  LEU A HD13   1 
ATOM   774  H HD21   . LEU A 1 54  ? -7.250  12.372  12.903  1.00  30.77 ? 54  LEU A HD21   1 
ATOM   775  H HD22   . LEU A 1 54  ? -8.931  12.349  13.371  1.00  29.85 ? 54  LEU A HD22   1 
ATOM   776  H HD23   . LEU A 1 54  ? -8.158  13.868  12.970  1.00  30.39 ? 54  LEU A HD23   1 
ATOM   777  N N      . THR A 1 55  ? -13.000 12.889  10.439  1.00  33.30 ? 55  THR A N      1 
ATOM   778  C CA     . THR A 1 55  ? -14.334 13.434  10.060  1.00  30.22 ? 55  THR A CA     1 
ATOM   779  C C      . THR A 1 55  ? -14.984 12.407  9.105   1.00  29.89 ? 55  THR A C      1 
ATOM   780  O O      . THR A 1 55  ? -14.363 11.412  8.754   1.00  25.77 ? 55  THR A O      1 
ATOM   781  C CB     . THR A 1 55  ? -14.083 14.852  9.427   0.66  28.52 ? 55  THR A CB     1 
ATOM   782  O OG1    . THR A 1 55  ? -15.383 15.423  9.327   0.66  30.04 ? 55  THR A OG1    1 
ATOM   783  C CG2    . THR A 1 55  ? -13.513 14.816  8.029   0.66  26.35 ? 55  THR A CG2    1 
ATOM   784  H H      . THR A 1 55  ? -12.588 12.190  9.882   1.00  32.20 ? 55  THR A H      1 
ATOM   785  H HA     . THR A 1 55  ? -14.944 13.517  10.949  1.00  30.11 ? 55  THR A HA     1 
ATOM   786  H HB     . THR A 1 55  ? -13.476 15.467  10.080  0.66  28.56 ? 55  THR A HB     1 
ATOM   787  H HG1    . THR A 1 55  ? -15.552 15.790  8.451   0.66  30.15 ? 55  THR A HG1    1 
ATOM   788  H HG21   . THR A 1 55  ? -13.372 15.821  7.662   0.66  26.78 ? 55  THR A HG21   1 
ATOM   789  H HG22   . THR A 1 55  ? -14.158 14.279  7.346   0.66  26.71 ? 55  THR A HG22   1 
ATOM   790  H HG23   . THR A 1 55  ? -12.549 14.332  8.053   0.66  26.77 ? 55  THR A HG23   1 
ATOM   791  N N      . HIS A 1 56  ? -16.207 12.662  8.738   1.00  29.86 ? 56  HIS A N      1 
ATOM   792  C CA     . HIS A 1 56  ? -16.933 11.761  7.812   1.00  31.65 ? 56  HIS A CA     1 
ATOM   793  C C      . HIS A 1 56  ? -17.954 12.650  7.151   1.00  30.24 ? 56  HIS A C      1 
ATOM   794  O O      . HIS A 1 56  ? -18.290 13.699  7.672   1.00  25.08 ? 56  HIS A O      1 
ATOM   795  C CB     . HIS A 1 56  ? -17.608 10.626  8.591   1.00  34.35 ? 56  HIS A CB     1 
ATOM   796  C CG     . HIS A 1 56  ? -18.625 11.192  9.562   1.00  39.64 ? 56  HIS A CG     1 
ATOM   797  N ND1    . HIS A 1 56  ? -19.888 11.319  9.308   1.00  42.83 ? 56  HIS A ND1    1 
ATOM   798  C CD2    . HIS A 1 56  ? -18.468 11.677  10.848  1.00  41.09 ? 56  HIS A CD2    1 
ATOM   799  C CE1    . HIS A 1 56  ? -20.476 11.838  10.338  1.00  41.64 ? 56  HIS A CE1    1 
ATOM   800  N NE2    . HIS A 1 56  ? -19.633 12.078  11.315  1.00  42.18 ? 56  HIS A NE2    1 
ATOM   801  H H      . HIS A 1 56  ? -16.679 13.466  9.059   1.00  30.65 ? 56  HIS A H      1 
ATOM   802  H HA     . HIS A 1 56  ? -16.249 11.393  7.061   1.00  31.29 ? 56  HIS A HA     1 
ATOM   803  H HB2    . HIS A 1 56  ? -18.103 9.974   7.888   1.00  34.69 ? 56  HIS A HB2    1 
ATOM   804  H HB3    . HIS A 1 56  ? -16.874 10.055  9.139   1.00  35.17 ? 56  HIS A HB3    1 
ATOM   805  H HD1    . HIS A 1 56  ? -20.319 11.065  8.464   1.00  42.18 ? 56  HIS A HD1    1 
ATOM   806  H HD2    . HIS A 1 56  ? -17.534 11.726  11.390  1.00  40.75 ? 56  HIS A HD2    1 
ATOM   807  H HE1    . HIS A 1 56  ? -21.534 12.054  10.392  1.00  42.42 ? 56  HIS A HE1    1 
ATOM   808  N N      . SER A 1 57  ? -18.418 12.225  6.021   1.00  31.18 ? 57  SER A N      1 
ATOM   809  C CA     . SER A 1 57  ? -19.433 13.010  5.278   1.00  30.56 ? 57  SER A CA     1 
ATOM   810  C C      . SER A 1 57  ? -20.322 12.004  4.581   1.00  29.08 ? 57  SER A C      1 
ATOM   811  O O      . SER A 1 57  ? -20.130 10.807  4.684   1.00  26.12 ? 57  SER A O      1 
ATOM   812  C CB     . SER A 1 57  ? -18.706 13.981  4.265   1.00  30.22 ? 57  SER A CB     1 
ATOM   813  O OG     . SER A 1 57  ? -17.790 13.194  3.527   1.00  32.11 ? 57  SER A OG     1 
ATOM   814  H H      . SER A 1 57  ? -18.102 11.373  5.645   1.00  30.98 ? 57  SER A H      1 
ATOM   815  H HA     . SER A 1 57  ? -20.027 13.566  5.992   1.00  31.61 ? 57  SER A HA     1 
ATOM   816  H HB2    . SER A 1 57  ? -19.401 14.447  3.583   1.00  30.85 ? 57  SER A HB2    1 
ATOM   817  H HB3    . SER A 1 57  ? -18.162 14.744  4.806   1.00  31.21 ? 57  SER A HB3    1 
ATOM   818  H HG     . SER A 1 57  ? -16.954 13.232  4.006   1.00  32.17 ? 57  SER A HG     1 
ATOM   819  N N      . GLU A 1 58  ? -21.276 12.509  3.870   1.00  28.60 ? 58  GLU A N      1 
ATOM   820  C CA     . GLU A 1 58  ? -22.231 11.651  3.143   1.00  27.83 ? 58  GLU A CA     1 
ATOM   821  C C      . GLU A 1 58  ? -22.053 11.959  1.658   1.00  25.50 ? 58  GLU A C      1 
ATOM   822  O O      . GLU A 1 58  ? -21.982 13.124  1.326   1.00  29.42 ? 58  GLU A O      1 
ATOM   823  C CB     . GLU A 1 58  ? -23.560 12.064  3.764   1.00  30.37 ? 58  GLU A CB     1 
ATOM   824  C CG     . GLU A 1 58  ? -24.789 11.407  3.182   1.00  36.25 ? 58  GLU A CG     1 
ATOM   825  C CD     . GLU A 1 58  ? -26.018 12.006  3.945   1.00  38.03 ? 58  GLU A CD     1 
ATOM   826  O OE1    . GLU A 1 58  ? -26.213 13.211  3.808   1.00  40.73 ? 58  GLU A OE1    1 
ATOM   827  O OE2    . GLU A 1 58  ? -26.694 11.243  4.622   1.00  34.81 ? 58  GLU A OE2    1 
ATOM   828  H H      . GLU A 1 58  ? -21.367 13.479  3.786   1.00  29.20 ? 58  GLU A H      1 
ATOM   829  H HA     . GLU A 1 58  ? -22.000 10.611  3.325   1.00  28.07 ? 58  GLU A HA     1 
ATOM   830  H HB2    . GLU A 1 58  ? -23.529 11.872  4.826   1.00  30.64 ? 58  GLU A HB2    1 
ATOM   831  H HB3    . GLU A 1 58  ? -23.654 13.130  3.614   1.00  30.97 ? 58  GLU A HB3    1 
ATOM   832  H HG2    . GLU A 1 58  ? -24.872 11.638  2.126   1.00  35.34 ? 58  GLU A HG2    1 
ATOM   833  H HG3    . GLU A 1 58  ? -24.745 10.334  3.307   1.00  35.86 ? 58  GLU A HG3    1 
ATOM   834  N N      . LEU A 1 59  ? -21.979 10.963  0.828   1.00  22.83 ? 59  LEU A N      1 
ATOM   835  C CA     . LEU A 1 59  ? -21.823 11.179  -0.628  1.00  26.19 ? 59  LEU A CA     1 
ATOM   836  C C      . LEU A 1 59  ? -23.177 10.738  -1.257  1.00  26.94 ? 59  LEU A C      1 
ATOM   837  O O      . LEU A 1 59  ? -23.994 10.081  -0.635  1.00  24.72 ? 59  LEU A O      1 
ATOM   838  C CB     . LEU A 1 59  ? -20.676 10.316  -1.196  1.00  27.01 ? 59  LEU A CB     1 
ATOM   839  C CG     . LEU A 1 59  ? -19.281 10.818  -0.671  1.00  29.57 ? 59  LEU A CG     1 
ATOM   840  C CD1    . LEU A 1 59  ? -18.160 9.811   -1.073  1.00  29.66 ? 59  LEU A CD1    1 
ATOM   841  C CD2    . LEU A 1 59  ? -18.936 12.158  -1.321  1.00  30.76 ? 59  LEU A CD2    1 
ATOM   842  H H      . LEU A 1 59  ? -22.022 10.048  1.158   1.00  25.14 ? 59  LEU A H      1 
ATOM   843  H HA     . LEU A 1 59  ? -21.661 12.227  -0.820  1.00  27.04 ? 59  LEU A HA     1 
ATOM   844  H HB2    . LEU A 1 59  ? -20.850 9.290   -0.901  1.00  27.37 ? 59  LEU A HB2    1 
ATOM   845  H HB3    . LEU A 1 59  ? -20.707 10.355  -2.276  1.00  26.85 ? 59  LEU A HB3    1 
ATOM   846  H HG     . LEU A 1 59  ? -19.308 10.936  0.407   1.00  28.81 ? 59  LEU A HG     1 
ATOM   847  H HD11   . LEU A 1 59  ? -18.102 9.688   -2.145  1.00  29.42 ? 59  LEU A HD11   1 
ATOM   848  H HD12   . LEU A 1 59  ? -18.360 8.851   -0.621  1.00  29.48 ? 59  LEU A HD12   1 
ATOM   849  H HD13   . LEU A 1 59  ? -17.203 10.162  -0.706  1.00  29.61 ? 59  LEU A HD13   1 
ATOM   850  H HD21   . LEU A 1 59  ? -17.969 12.493  -0.970  1.00  30.82 ? 59  LEU A HD21   1 
ATOM   851  H HD22   . LEU A 1 59  ? -19.662 12.905  -1.033  1.00  30.95 ? 59  LEU A HD22   1 
ATOM   852  H HD23   . LEU A 1 59  ? -18.920 12.087  -2.397  1.00  30.42 ? 59  LEU A HD23   1 
ATOM   853  N N      . ASP A 1 60  ? -23.374 11.114  -2.485  1.00  30.03 ? 60  ASP A N      1 
ATOM   854  C CA     . ASP A 1 60  ? -24.621 10.779  -3.224  1.00  31.51 ? 60  ASP A CA     1 
ATOM   855  C C      . ASP A 1 60  ? -24.220 10.004  -4.460  1.00  31.12 ? 60  ASP A C      1 
ATOM   856  O O      . ASP A 1 60  ? -23.443 10.519  -5.243  1.00  30.65 ? 60  ASP A O      1 
ATOM   857  C CB     . ASP A 1 60  ? -25.298 12.045  -3.650  1.00  36.38 ? 60  ASP A CB     1 
ATOM   858  C CG     . ASP A 1 60  ? -26.747 11.752  -4.061  1.00  38.25 ? 60  ASP A CG     1 
ATOM   859  O OD1    . ASP A 1 60  ? -26.998 10.821  -4.816  1.00  37.02 ? 60  ASP A OD1    1 
ATOM   860  O OD2    . ASP A 1 60  ? -27.530 12.530  -3.553  1.00  46.39 ? 60  ASP A OD2    1 
ATOM   861  H H      . ASP A 1 60  ? -22.670 11.627  -2.934  1.00  28.93 ? 60  ASP A H      1 
ATOM   862  H HA     . ASP A 1 60  ? -25.263 10.171  -2.600  1.00  31.27 ? 60  ASP A HA     1 
ATOM   863  H HB2    . ASP A 1 60  ? -25.276 12.758  -2.838  1.00  35.83 ? 60  ASP A HB2    1 
ATOM   864  H HB3    . ASP A 1 60  ? -24.791 12.479  -4.499  1.00  35.88 ? 60  ASP A HB3    1 
ATOM   865  N N      . VAL A 1 61  ? -24.745 8.829   -4.639  1.00  34.39 ? 61  VAL A N      1 
ATOM   866  C CA     . VAL A 1 61  ? -24.362 8.037   -5.845  1.00  39.89 ? 61  VAL A CA     1 
ATOM   867  C C      . VAL A 1 61  ? -24.633 8.853   -7.100  1.00  39.62 ? 61  VAL A C      1 
ATOM   868  O O      . VAL A 1 61  ? -23.858 8.832   -8.028  1.00  37.08 ? 61  VAL A O      1 
ATOM   869  C CB     . VAL A 1 61  ? -25.153 6.688   -5.748  1.00  43.80 ? 61  VAL A CB     1 
ATOM   870  C CG1    . VAL A 1 61  ? -26.680 6.872   -5.687  1.00  42.99 ? 61  VAL A CG1    1 
ATOM   871  C CG2    . VAL A 1 61  ? -24.707 5.773   -6.926  1.00  47.05 ? 61  VAL A CG2    1 
ATOM   872  H H      . VAL A 1 61  ? -25.387 8.467   -3.987  1.00  35.23 ? 61  VAL A H      1 
ATOM   873  H HA     . VAL A 1 61  ? -23.295 7.847   -5.809  1.00  39.44 ? 61  VAL A HA     1 
ATOM   874  H HB     . VAL A 1 61  ? -24.847 6.190   -4.835  1.00  43.59 ? 61  VAL A HB     1 
ATOM   875  H HG11   . VAL A 1 61  ? -27.041 7.338   -6.589  1.00  43.47 ? 61  VAL A HG11   1 
ATOM   876  H HG12   . VAL A 1 61  ? -26.971 7.479   -4.846  1.00  43.16 ? 61  VAL A HG12   1 
ATOM   877  H HG13   . VAL A 1 61  ? -27.165 5.909   -5.582  1.00  43.10 ? 61  VAL A HG13   1 
ATOM   878  H HG21   . VAL A 1 61  ? -25.226 4.824   -6.894  1.00  46.44 ? 61  VAL A HG21   1 
ATOM   879  H HG22   . VAL A 1 61  ? -23.643 5.578   -6.854  1.00  46.22 ? 61  VAL A HG22   1 
ATOM   880  H HG23   . VAL A 1 61  ? -24.897 6.237   -7.885  1.00  46.09 ? 61  VAL A HG23   1 
ATOM   881  N N      . ARG A 1 62  ? -25.721 9.553   -7.120  1.00  42.17 ? 62  ARG A N      1 
ATOM   882  C CA     . ARG A 1 62  ? -25.980 10.365  -8.330  1.00  46.28 ? 62  ARG A CA     1 
ATOM   883  C C      . ARG A 1 62  ? -25.032 11.498  -8.711  1.00  46.82 ? 62  ARG A C      1 
ATOM   884  O O      . ARG A 1 62  ? -25.060 11.986  -9.824  1.00  49.02 ? 62  ARG A O      1 
ATOM   885  C CB     . ARG A 1 62  ? -27.518 10.933  -8.397  1.00  47.43 ? 62  ARG A CB     1 
ATOM   886  C CG     . ARG A 1 62  ? -28.509 9.734   -8.413  0.010 46.11 ? 62  ARG A CG     1 
ATOM   887  C CD     . ARG A 1 62  ? -29.974 10.253  -8.500  0.010 45.37 ? 62  ARG A CD     1 
ATOM   888  N NE     . ARG A 1 62  ? -30.102 11.159  -9.687  0.010 44.82 ? 62  ARG A NE     1 
ATOM   889  C CZ     . ARG A 1 62  ? -30.921 10.892  -10.672 0.010 44.37 ? 62  ARG A CZ     1 
ATOM   890  N NH1    . ARG A 1 62  ? -32.084 10.348  -10.430 0.010 44.96 ? 62  ARG A NH1    1 
ATOM   891  N NH2    . ARG A 1 62  ? -30.543 11.187  -11.885 0.010 43.69 ? 62  ARG A NH2    1 
ATOM   892  H H      . ARG A 1 62  ? -26.330 9.524   -6.357  1.00  43.29 ? 62  ARG A H      1 
ATOM   893  H HA     . ARG A 1 62  ? -26.172 11.058  -7.534  1.00  45.88 ? 62  ARG A HA     1 
ATOM   894  H HB2    . ARG A 1 62  ? -27.838 11.661  -7.648  1.00  47.10 ? 62  ARG A HB2    1 
ATOM   895  H HB3    . ARG A 1 62  ? -27.598 11.442  -9.352  1.00  46.99 ? 62  ARG A HB3    1 
ATOM   896  H HG2    . ARG A 1 62  ? -28.304 9.092   -9.258  0.010 45.99 ? 62  ARG A HG2    1 
ATOM   897  H HG3    . ARG A 1 62  ? -28.405 9.150   -7.510  0.010 45.99 ? 62  ARG A HG3    1 
ATOM   898  H HD2    . ARG A 1 62  ? -30.672 9.432   -8.590  0.010 45.19 ? 62  ARG A HD2    1 
ATOM   899  H HD3    . ARG A 1 62  ? -30.232 10.817  -7.617  0.010 45.19 ? 62  ARG A HD3    1 
ATOM   900  H HE     . ARG A 1 62  ? -29.559 11.973  -9.728  0.010 44.61 ? 62  ARG A HE     1 
ATOM   901  H HH11   . ARG A 1 62  ? -32.707 10.147  -11.185 0.010 44.26 ? 62  ARG A HH11   1 
ATOM   902  H HH12   . ARG A 1 62  ? -32.350 10.133  -9.490  0.010 44.26 ? 62  ARG A HH12   1 
ATOM   903  H HH21   . ARG A 1 62  ? -29.647 11.604  -12.041 0.010 43.50 ? 62  ARG A HH21   1 
ATOM   904  H HH22   . ARG A 1 62  ? -31.147 10.996  -12.659 0.010 43.50 ? 62  ARG A HH22   1 
ATOM   905  N N      . THR A 1 63  ? -24.211 11.898  -7.783  1.00  46.07 ? 63  THR A N      1 
ATOM   906  C CA     . THR A 1 63  ? -23.269 12.988  -8.071  1.00  45.20 ? 63  THR A CA     1 
ATOM   907  C C      . THR A 1 63  ? -21.835 12.447  -7.993  1.00  47.46 ? 63  THR A C      1 
ATOM   908  O O      . THR A 1 63  ? -20.951 12.945  -8.667  1.00  50.78 ? 63  THR A O      1 
ATOM   909  C CB     . THR A 1 63  ? -23.513 14.111  -7.020  1.00  43.97 ? 63  THR A CB     1 
ATOM   910  O OG1    . THR A 1 63  ? -23.213 13.535  -5.749  0.36  43.13 ? 63  THR A OG1    1 
ATOM   911  C CG2    . THR A 1 63  ? -25.012 14.429  -6.876  0.36  44.83 ? 63  THR A CG2    1 
ATOM   912  H H      . THR A 1 63  ? -24.194 11.495  -6.891  1.00  46.15 ? 63  THR A H      1 
ATOM   913  H HA     . THR A 1 63  ? -23.433 13.365  -9.073  1.00  44.55 ? 63  THR A HA     1 
ATOM   914  H HB     . THR A 1 63  ? -22.909 14.994  -7.201  1.00  44.41 ? 63  THR A HB     1 
ATOM   915  H HG1    . THR A 1 63  ? -22.274 13.766  -5.640  0.36  43.33 ? 63  THR A HG1    1 
ATOM   916  H HG21   . THR A 1 63  ? -25.156 15.230  -6.165  0.36  44.56 ? 63  THR A HG21   1 
ATOM   917  H HG22   . THR A 1 63  ? -25.572 13.567  -6.547  0.36  44.58 ? 63  THR A HG22   1 
ATOM   918  H HG23   . THR A 1 63  ? -25.404 14.751  -7.832  0.36  44.63 ? 63  THR A HG23   1 
ATOM   919  N N      . ALA A 1 64  ? -21.655 11.448  -7.168  1.00  46.13 ? 64  ALA A N      1 
ATOM   920  C CA     . ALA A 1 64  ? -20.309 10.836  -6.972  1.00  43.46 ? 64  ALA A CA     1 
ATOM   921  C C      . ALA A 1 64  ? -20.057 9.552   -7.723  1.00  41.07 ? 64  ALA A C      1 
ATOM   922  O O      . ALA A 1 64  ? -18.905 9.260   -7.981  1.00  37.08 ? 64  ALA A O      1 
ATOM   923  C CB     . ALA A 1 64  ? -20.126 10.590  -5.472  1.00  44.59 ? 64  ALA A CB     1 
ATOM   924  H H      . ALA A 1 64  ? -22.423 11.099  -6.675  1.00  44.65 ? 64  ALA A H      1 
ATOM   925  H HA     . ALA A 1 64  ? -19.565 11.551  -7.295  1.00  44.51 ? 64  ALA A HA     1 
ATOM   926  H HB1    . ALA A 1 64  ? -19.159 10.141  -5.299  1.00  44.92 ? 64  ALA A HB1    1 
ATOM   927  H HB2    . ALA A 1 64  ? -20.888 9.911   -5.114  1.00  44.42 ? 64  ALA A HB2    1 
ATOM   928  H HB3    . ALA A 1 64  ? -20.198 11.517  -4.923  1.00  44.99 ? 64  ALA A HB3    1 
ATOM   929  N N      . GLY A 1 65  ? -21.095 8.827   -8.023  1.00  39.74 ? 65  GLY A N      1 
ATOM   930  C CA     . GLY A 1 65  ? -20.933 7.543   -8.769  1.00  39.67 ? 65  GLY A CA     1 
ATOM   931  C C      . GLY A 1 65  ? -20.913 6.363   -7.793  1.00  40.52 ? 65  GLY A C      1 
ATOM   932  O O      . GLY A 1 65  ? -21.096 6.537   -6.605  1.00  39.69 ? 65  GLY A O      1 
ATOM   933  H H      . GLY A 1 65  ? -21.995 9.115   -7.763  1.00  39.63 ? 65  GLY A H      1 
ATOM   934  H HA2    . GLY A 1 65  ? -21.772 7.432   -9.441  1.00  40.07 ? 65  GLY A HA2    1 
ATOM   935  H HA3    . GLY A 1 65  ? -20.013 7.568   -9.328  1.00  39.87 ? 65  GLY A HA3    1 
ATOM   936  N N      . ALA A 1 66  ? -20.686 5.192   -8.330  1.00  40.84 ? 66  ALA A N      1 
ATOM   937  C CA     . ALA A 1 66  ? -20.633 3.938   -7.502  1.00  42.66 ? 66  ALA A CA     1 
ATOM   938  C C      . ALA A 1 66  ? -19.161 3.583   -7.228  1.00  46.70 ? 66  ALA A C      1 
ATOM   939  O O      . ALA A 1 66  ? -18.785 3.009   -6.217  1.00  45.95 ? 66  ALA A O      1 
ATOM   940  C CB     . ALA A 1 66  ? -21.227 2.772   -8.235  1.00  41.29 ? 66  ALA A CB     1 
ATOM   941  H H      . ALA A 1 66  ? -20.553 5.150   -9.298  1.00  41.58 ? 66  ALA A H      1 
ATOM   942  H HA     . ALA A 1 66  ? -21.145 4.108   -6.562  1.00  42.73 ? 66  ALA A HA     1 
ATOM   943  H HB1    . ALA A 1 66  ? -21.176 1.896   -7.602  1.00  41.88 ? 66  ALA A HB1    1 
ATOM   944  H HB2    . ALA A 1 66  ? -20.688 2.562   -9.146  1.00  41.54 ? 66  ALA A HB2    1 
ATOM   945  H HB3    . ALA A 1 66  ? -22.264 2.968   -8.462  1.00  41.89 ? 66  ALA A HB3    1 
ATOM   946  N N      . ALA A 1 67  ? -18.373 3.948   -8.196  1.00  49.35 ? 67  ALA A N      1 
ATOM   947  C CA     . ALA A 1 67  ? -16.889 3.722   -8.178  1.00  51.70 ? 67  ALA A CA     1 
ATOM   948  C C      . ALA A 1 67  ? -16.513 2.233   -8.105  1.00  49.81 ? 67  ALA A C      1 
ATOM   949  O O      . ALA A 1 67  ? -15.484 1.889   -7.546  1.00  49.43 ? 67  ALA A O      1 
ATOM   950  C CB     . ALA A 1 67  ? -16.250 4.490   -6.957  1.00  52.33 ? 67  ALA A CB     1 
ATOM   951  H H      . ALA A 1 67  ? -18.771 4.394   -8.972  1.00  48.60 ? 67  ALA A H      1 
ATOM   952  H HA     . ALA A 1 67  ? -16.474 4.120   -9.093  1.00  50.82 ? 67  ALA A HA     1 
ATOM   953  H HB1    . ALA A 1 67  ? -15.181 4.335   -6.953  1.00  52.43 ? 67  ALA A HB1    1 
ATOM   954  H HB2    . ALA A 1 67  ? -16.648 4.106   -6.031  1.00  52.72 ? 67  ALA A HB2    1 
ATOM   955  H HB3    . ALA A 1 67  ? -16.447 5.552   -7.025  1.00  52.11 ? 67  ALA A HB3    1 
ATOM   956  N N      . GLY A 1 68  ? -17.367 1.417   -8.667  1.00  47.74 ? 68  GLY A N      1 
ATOM   957  C CA     . GLY A 1 68  ? -17.107 -0.056  -8.682  1.00  46.16 ? 68  GLY A CA     1 
ATOM   958  C C      . GLY A 1 68  ? -17.559 -0.851  -7.473  1.00  44.40 ? 68  GLY A C      1 
ATOM   959  O O      . GLY A 1 68  ? -16.864 -1.742  -7.019  1.00  46.14 ? 68  GLY A O      1 
ATOM   960  H H      . GLY A 1 68  ? -18.181 1.773   -9.072  1.00  48.64 ? 68  GLY A H      1 
ATOM   961  H HA2    . GLY A 1 68  ? -17.601 -0.475  -9.547  1.00  47.29 ? 68  GLY A HA2    1 
ATOM   962  H HA3    . GLY A 1 68  ? -16.043 -0.207  -8.798  1.00  48.04 ? 68  GLY A HA3    1 
ATOM   963  N N      . THR A 1 69  ? -18.693 -0.541  -6.958  1.00  39.99 ? 69  THR A N      1 
ATOM   964  C CA     . THR A 1 69  ? -19.164 -1.298  -5.791  1.00  36.94 ? 69  THR A CA     1 
ATOM   965  C C      . THR A 1 69  ? -20.452 -1.901  -6.327  1.00  37.32 ? 69  THR A C      1 
ATOM   966  O O      . THR A 1 69  ? -20.906 -1.533  -7.399  1.00  37.23 ? 69  THR A O      1 
ATOM   967  C CB     . THR A 1 69  ? -19.303 -0.255  -4.659  1.00  36.77 ? 69  THR A CB     1 
ATOM   968  O OG1    . THR A 1 69  ? -20.056 0.847   -5.184  1.00  30.98 ? 69  THR A OG1    1 
ATOM   969  C CG2    . THR A 1 69  ? -17.885 0.306   -4.337  1.00  38.21 ? 69  THR A CG2    1 
ATOM   970  H H      . THR A 1 69  ? -19.268 0.170   -7.302  1.00  40.05 ? 69  THR A H      1 
ATOM   971  H HA     . THR A 1 69  ? -18.479 -2.099  -5.542  1.00  36.27 ? 69  THR A HA     1 
ATOM   972  H HB     . THR A 1 69  ? -19.790 -0.677  -3.790  1.00  36.49 ? 69  THR A HB     1 
ATOM   973  H HG1    . THR A 1 69  ? -19.485 1.629   -5.268  1.00  31.76 ? 69  THR A HG1    1 
ATOM   974  H HG21   . THR A 1 69  ? -17.897 1.031   -3.543  1.00  38.24 ? 69  THR A HG21   1 
ATOM   975  H HG22   . THR A 1 69  ? -17.439 0.772   -5.207  1.00  38.57 ? 69  THR A HG22   1 
ATOM   976  H HG23   . THR A 1 69  ? -17.239 -0.507  -4.037  1.00  38.05 ? 69  THR A HG23   1 
ATOM   977  N N      . SER A 1 70  ? -21.024 -2.811  -5.618  1.00  36.47 ? 70  SER A N      1 
ATOM   978  C CA     . SER A 1 70  ? -22.272 -3.425  -6.104  1.00  38.82 ? 70  SER A CA     1 
ATOM   979  C C      . SER A 1 70  ? -23.272 -3.398  -4.990  1.00  36.89 ? 70  SER A C      1 
ATOM   980  O O      . SER A 1 70  ? -23.357 -4.369  -4.264  1.00  41.99 ? 70  SER A O      1 
ATOM   981  C CB     . SER A 1 70  ? -21.957 -4.870  -6.539  1.00  42.42 ? 70  SER A CB     1 
ATOM   982  O OG     . SER A 1 70  ? -20.800 -4.746  -7.381  1.00  49.02 ? 70  SER A OG     1 
ATOM   983  H H      . SER A 1 70  ? -20.640 -3.101  -4.763  1.00  36.39 ? 70  SER A H      1 
ATOM   984  H HA     . SER A 1 70  ? -22.680 -2.849  -6.928  1.00  37.59 ? 70  SER A HA     1 
ATOM   985  H HB2    . SER A 1 70  ? -21.742 -5.504  -5.688  1.00  43.14 ? 70  SER A HB2    1 
ATOM   986  H HB3    . SER A 1 70  ? -22.784 -5.289  -7.095  1.00  43.39 ? 70  SER A HB3    1 
ATOM   987  H HG     . SER A 1 70  ? -20.713 -3.807  -7.610  1.00  47.53 ? 70  SER A HG     1 
ATOM   988  N N      . GLY A 1 71  ? -23.975 -2.328  -4.831  1.00  33.07 ? 71  GLY A N      1 
ATOM   989  C CA     . GLY A 1 71  ? -24.973 -2.330  -3.732  1.00  28.73 ? 71  GLY A CA     1 
ATOM   990  C C      . GLY A 1 71  ? -24.473 -1.626  -2.504  1.00  27.38 ? 71  GLY A C      1 
ATOM   991  O O      . GLY A 1 71  ? -23.413 -1.010  -2.485  1.00  25.10 ? 71  GLY A O      1 
ATOM   992  H H      . GLY A 1 71  ? -23.857 -1.538  -5.405  1.00  33.35 ? 71  GLY A H      1 
ATOM   993  H HA2    . GLY A 1 71  ? -25.855 -1.810  -4.078  1.00  28.10 ? 71  GLY A HA2    1 
ATOM   994  H HA3    . GLY A 1 71  ? -25.264 -3.341  -3.489  1.00  29.41 ? 71  GLY A HA3    1 
ATOM   995  N N      . PHE A 1 72  ? -25.316 -1.793  -1.536  1.00  24.96 ? 72  PHE A N      1 
ATOM   996  C CA     . PHE A 1 72  ? -25.177 -1.242  -0.184  1.00  25.90 ? 72  PHE A CA     1 
ATOM   997  C C      . PHE A 1 72  ? -25.372 -2.282  0.886   1.00  25.61 ? 72  PHE A C      1 
ATOM   998  O O      . PHE A 1 72  ? -25.955 -3.338  0.687   1.00  26.85 ? 72  PHE A O      1 
ATOM   999  C CB     . PHE A 1 72  ? -26.256 -0.133  0.114   1.00  23.94 ? 72  PHE A CB     1 
ATOM   1000 C CG     . PHE A 1 72  ? -26.183 1.008   -0.879  1.00  24.82 ? 72  PHE A CG     1 
ATOM   1001 C CD1    . PHE A 1 72  ? -26.836 0.903   -2.083  1.00  27.20 ? 72  PHE A CD1    1 
ATOM   1002 C CD2    . PHE A 1 72  ? -25.453 2.141   -0.609  1.00  23.42 ? 72  PHE A CD2    1 
ATOM   1003 C CE1    . PHE A 1 72  ? -26.752 1.927   -3.007  1.00  28.45 ? 72  PHE A CE1    1 
ATOM   1004 C CE2    . PHE A 1 72  ? -25.367 3.158   -1.526  1.00  23.87 ? 72  PHE A CE2    1 
ATOM   1005 C CZ     . PHE A 1 72  ? -26.016 3.055   -2.728  1.00  27.62 ? 72  PHE A CZ     1 
ATOM   1006 H H      . PHE A 1 72  ? -26.114 -2.336  -1.711  1.00  28.77 ? 72  PHE A H      1 
ATOM   1007 H HA     . PHE A 1 72  ? -24.186 -0.822  -0.098  1.00  26.04 ? 72  PHE A HA     1 
ATOM   1008 H HB2    . PHE A 1 72  ? -27.250 -0.558  0.070   1.00  24.09 ? 72  PHE A HB2    1 
ATOM   1009 H HB3    . PHE A 1 72  ? -26.129 0.265   1.109   1.00  24.38 ? 72  PHE A HB3    1 
ATOM   1010 H HD1    . PHE A 1 72  ? -27.420 0.021   -2.310  1.00  26.16 ? 72  PHE A HD1    1 
ATOM   1011 H HD2    . PHE A 1 72  ? -24.943 2.242   0.339   1.00  24.97 ? 72  PHE A HD2    1 
ATOM   1012 H HE1    . PHE A 1 72  ? -27.267 1.840   -3.954  1.00  27.90 ? 72  PHE A HE1    1 
ATOM   1013 H HE2    . PHE A 1 72  ? -24.790 4.042   -1.303  1.00  25.51 ? 72  PHE A HE2    1 
ATOM   1014 H HZ     . PHE A 1 72  ? -25.956 3.853   -3.455  1.00  27.44 ? 72  PHE A HZ     1 
ATOM   1015 N N      . PHE A 1 73  ? -24.849 -1.868  2.001   1.00  24.12 ? 73  PHE A N      1 
ATOM   1016 C CA     . PHE A 1 73  ? -24.873 -2.609  3.270   1.00  22.82 ? 73  PHE A CA     1 
ATOM   1017 C C      . PHE A 1 73  ? -25.483 -1.547  4.174   1.00  22.59 ? 73  PHE A C      1 
ATOM   1018 O O      . PHE A 1 73  ? -25.235 -0.366  3.980   1.00  24.00 ? 73  PHE A O      1 
ATOM   1019 C CB     . PHE A 1 73  ? -23.524 -2.882  3.834   1.00  22.54 ? 73  PHE A CB     1 
ATOM   1020 C CG     . PHE A 1 73  ? -22.970 -4.248  3.492   1.00  22.69 ? 73  PHE A CG     1 
ATOM   1021 C CD1    . PHE A 1 73  ? -23.669 -5.398  3.794   1.00  25.91 ? 73  PHE A CD1    1 
ATOM   1022 C CD2    . PHE A 1 73  ? -21.743 -4.346  2.883   1.00  21.65 ? 73  PHE A CD2    1 
ATOM   1023 C CE1    . PHE A 1 73  ? -23.141 -6.632  3.488   1.00  26.97 ? 73  PHE A CE1    1 
ATOM   1024 C CE2    . PHE A 1 73  ? -21.210 -5.572  2.575   1.00  23.40 ? 73  PHE A CE2    1 
ATOM   1025 C CZ     . PHE A 1 73  ? -21.906 -6.724  2.876   1.00  25.48 ? 73  PHE A CZ     1 
ATOM   1026 H H      . PHE A 1 73  ? -24.403 -0.993  2.018   1.00  25.37 ? 73  PHE A H      1 
ATOM   1027 H HA     . PHE A 1 73  ? -25.529 -3.462  3.190   1.00  23.42 ? 73  PHE A HA     1 
ATOM   1028 H HB2    . PHE A 1 73  ? -22.841 -2.130  3.468   1.00  23.11 ? 73  PHE A HB2    1 
ATOM   1029 H HB3    . PHE A 1 73  ? -23.580 -2.767  4.896   1.00  21.76 ? 73  PHE A HB3    1 
ATOM   1030 H HD1    . PHE A 1 73  ? -24.630 -5.336  4.272   1.00  24.71 ? 73  PHE A HD1    1 
ATOM   1031 H HD2    . PHE A 1 73  ? -21.187 -3.450  2.644   1.00  22.07 ? 73  PHE A HD2    1 
ATOM   1032 H HE1    . PHE A 1 73  ? -23.695 -7.528  3.730   1.00  26.69 ? 73  PHE A HE1    1 
ATOM   1033 H HE2    . PHE A 1 73  ? -20.240 -5.624  2.098   1.00  23.71 ? 73  PHE A HE2    1 
ATOM   1034 H HZ     . PHE A 1 73  ? -21.482 -7.688  2.639   1.00  24.71 ? 73  PHE A HZ     1 
ATOM   1035 N N      . CYS A 1 74  ? -26.234 -1.976  5.126   1.00  23.62 ? 74  CYS A N      1 
ATOM   1036 C CA     . CYS A 1 74  ? -26.889 -1.064  6.087   1.00  25.80 ? 74  CYS A CA     1 
ATOM   1037 C C      . CYS A 1 74  ? -26.493 -1.602  7.461   1.00  23.91 ? 74  CYS A C      1 
ATOM   1038 O O      . CYS A 1 74  ? -26.323 -2.801  7.651   1.00  24.03 ? 74  CYS A O      1 
ATOM   1039 C CB     . CYS A 1 74  ? -28.463 -1.091  5.887   1.00  27.70 ? 74  CYS A CB     1 
ATOM   1040 S SG     . CYS A 1 74  ? -29.113 -0.007  4.591   1.00  27.34 ? 74  CYS A SG     1 
ATOM   1041 H H      . CYS A 1 74  ? -26.378 -2.935  5.222   1.00  24.35 ? 74  CYS A H      1 
ATOM   1042 H HA     . CYS A 1 74  ? -26.489 -0.068  5.951   1.00  24.63 ? 74  CYS A HA     1 
ATOM   1043 H HB2    . CYS A 1 74  ? -28.799 -2.099  5.684   1.00  26.19 ? 74  CYS A HB2    1 
ATOM   1044 H HB3    . CYS A 1 74  ? -28.919 -0.791  6.818   1.00  26.40 ? 74  CYS A HB3    1 
ATOM   1045 N N      . VAL A 1 75  ? -26.383 -0.687  8.371   1.00  25.58 ? 75  VAL A N      1 
ATOM   1046 C CA     . VAL A 1 75  ? -25.992 -1.044  9.744   1.00  28.44 ? 75  VAL A CA     1 
ATOM   1047 C C      . VAL A 1 75  ? -27.188 -1.127  10.680  1.00  28.85 ? 75  VAL A C      1 
ATOM   1048 O O      . VAL A 1 75  ? -28.052 -0.269  10.672  1.00  30.45 ? 75  VAL A O      1 
ATOM   1049 C CB     A VAL A 1 75  ? -24.984 0.040   10.263  0.49  26.94 ? 75  VAL A CB     1 
ATOM   1050 C CB     B VAL A 1 75  ? -24.947 0.026   10.240  0.33  28.74 ? 75  VAL A CB     1 
ATOM   1051 C CG1    A VAL A 1 75  ? -24.541 -0.274  11.704  0.49  27.43 ? 75  VAL A CG1    1 
ATOM   1052 C CG1    B VAL A 1 75  ? -25.571 1.440   10.397  0.33  28.34 ? 75  VAL A CG1    1 
ATOM   1053 C CG2    A VAL A 1 75  ? -23.718 0.134   9.345   0.49  25.40 ? 75  VAL A CG2    1 
ATOM   1054 C CG2    B VAL A 1 75  ? -24.318 -0.423  11.570  0.33  29.12 ? 75  VAL A CG2    1 
ATOM   1055 H H      . VAL A 1 75  ? -26.562 0.251   8.148   1.00  26.63 ? 75  VAL A H      1 
ATOM   1056 H HA     . VAL A 1 75  ? -25.513 -2.017  9.711   1.00  29.01 ? 75  VAL A HA     1 
ATOM   1057 H HB     A VAL A 1 75  ? -25.487 0.999   10.268  0.49  26.77 ? 75  VAL A HB     1 
ATOM   1058 H HB     B VAL A 1 75  ? -24.152 0.097   9.510   0.33  28.96 ? 75  VAL A HB     1 
ATOM   1059 H HG11   A VAL A 1 75  ? -24.062 -1.241  11.764  0.49  27.29 ? 75  VAL A HG11   1 
ATOM   1060 H HG11   B VAL A 1 75  ? -26.374 1.440   11.116  0.33  28.54 ? 75  VAL A HG11   1 
ATOM   1061 H HG12   A VAL A 1 75  ? -25.385 -0.260  12.380  0.49  27.08 ? 75  VAL A HG12   1 
ATOM   1062 H HG12   B VAL A 1 75  ? -25.961 1.789   9.455   0.33  28.86 ? 75  VAL A HG12   1 
ATOM   1063 H HG13   A VAL A 1 75  ? -23.842 0.485   12.026  0.49  27.61 ? 75  VAL A HG13   1 
ATOM   1064 H HG13   B VAL A 1 75  ? -24.830 2.154   10.725  0.33  28.65 ? 75  VAL A HG13   1 
ATOM   1065 H HG21   A VAL A 1 75  ? -23.048 0.900   9.710   0.49  25.26 ? 75  VAL A HG21   1 
ATOM   1066 H HG21   B VAL A 1 75  ? -23.592 0.310   11.895  0.33  29.20 ? 75  VAL A HG21   1 
ATOM   1067 H HG22   A VAL A 1 75  ? -24.006 0.404   8.339   0.49  25.48 ? 75  VAL A HG22   1 
ATOM   1068 H HG22   B VAL A 1 75  ? -23.811 -1.368  11.439  0.33  28.90 ? 75  VAL A HG22   1 
ATOM   1069 H HG23   A VAL A 1 75  ? -23.181 -0.804  9.311   0.49  25.43 ? 75  VAL A HG23   1 
ATOM   1070 H HG23   B VAL A 1 75  ? -25.066 -0.536  12.342  0.33  28.82 ? 75  VAL A HG23   1 
ATOM   1071 N N      . ASP A 1 76  ? -27.162 -2.153  11.476  1.00  28.96 ? 76  ASP A N      1 
ATOM   1072 C CA     . ASP A 1 76  ? -28.242 -2.366  12.448  1.00  30.28 ? 76  ASP A CA     1 
ATOM   1073 C C      . ASP A 1 76  ? -27.790 -1.453  13.574  1.00  30.25 ? 76  ASP A C      1 
ATOM   1074 O O      . ASP A 1 76  ? -26.973 -1.790  14.414  1.00  30.83 ? 76  ASP A O      1 
ATOM   1075 C CB     . ASP A 1 76  ? -28.267 -3.818  12.905  1.00  32.53 ? 76  ASP A CB     1 
ATOM   1076 C CG     . ASP A 1 76  ? -29.261 -4.042  14.080  1.00  36.14 ? 76  ASP A CG     1 
ATOM   1077 O OD1    . ASP A 1 76  ? -29.749 -3.094  14.690  1.00  37.31 ? 76  ASP A OD1    1 
ATOM   1078 O OD2    . ASP A 1 76  ? -29.474 -5.222  14.303  1.00  41.00 ? 76  ASP A OD2    1 
ATOM   1079 H H      . ASP A 1 76  ? -26.411 -2.784  11.425  1.00  28.93 ? 76  ASP A H      1 
ATOM   1080 H HA     . ASP A 1 76  ? -29.187 -2.045  12.033  1.00  30.33 ? 76  ASP A HA     1 
ATOM   1081 H HB2    . ASP A 1 76  ? -28.631 -4.412  12.093  1.00  32.28 ? 76  ASP A HB2    1 
ATOM   1082 H HB3    . ASP A 1 76  ? -27.282 -4.167  13.180  1.00  32.78 ? 76  ASP A HB3    1 
ATOM   1083 N N      . GLU A 1 77  ? -28.338 -0.280  13.555  1.00  32.42 ? 77  GLU A N      1 
ATOM   1084 C CA     . GLU A 1 77  ? -28.008 0.747   14.591  1.00  32.49 ? 77  GLU A CA     1 
ATOM   1085 C C      . GLU A 1 77  ? -28.287 0.283   16.031  1.00  33.59 ? 77  GLU A C      1 
ATOM   1086 O O      . GLU A 1 77  ? -27.654 0.766   16.951  1.00  31.35 ? 77  GLU A O      1 
ATOM   1087 C CB     . GLU A 1 77  ? -28.809 2.024   14.253  1.00  31.11 ? 77  GLU A CB     1 
ATOM   1088 C CG     . GLU A 1 77  ? -28.276 2.509   12.896  1.00  33.13 ? 77  GLU A CG     1 
ATOM   1089 C CD     . GLU A 1 77  ? -28.993 3.804   12.453  1.00  33.87 ? 77  GLU A CD     1 
ATOM   1090 O OE1    . GLU A 1 77  ? -29.812 3.642   11.565  1.00  35.14 ? 77  GLU A OE1    1 
ATOM   1091 O OE2    . GLU A 1 77  ? -28.708 4.857   12.999  1.00  30.13 ? 77  GLU A OE2    1 
ATOM   1092 H H      . GLU A 1 77  ? -28.976 -0.069  12.834  1.00  32.05 ? 77  GLU A H      1 
ATOM   1093 H HA     . GLU A 1 77  ? -26.954 0.972   14.512  1.00  33.77 ? 77  GLU A HA     1 
ATOM   1094 H HB2    . GLU A 1 77  ? -29.869 1.833   14.207  1.00  31.96 ? 77  GLU A HB2    1 
ATOM   1095 H HB3    . GLU A 1 77  ? -28.627 2.784   14.999  1.00  31.98 ? 77  GLU A HB3    1 
ATOM   1096 H HG2    . GLU A 1 77  ? -27.215 2.668   12.958  1.00  33.04 ? 77  GLU A HG2    1 
ATOM   1097 H HG3    . GLU A 1 77  ? -28.432 1.758   12.134  1.00  33.00 ? 77  GLU A HG3    1 
ATOM   1098 N N      . GLY A 1 78  ? -29.214 -0.627  16.193  1.00  32.10 ? 78  GLY A N      1 
ATOM   1099 C CA     . GLY A 1 78  ? -29.537 -1.125  17.562  1.00  32.87 ? 78  GLY A CA     1 
ATOM   1100 C C      . GLY A 1 78  ? -28.460 -2.065  18.085  1.00  31.87 ? 78  GLY A C      1 
ATOM   1101 O O      . GLY A 1 78  ? -28.234 -2.171  19.274  1.00  32.52 ? 78  GLY A O      1 
ATOM   1102 H H      . GLY A 1 78  ? -29.714 -0.983  15.431  1.00  32.70 ? 78  GLY A H      1 
ATOM   1103 H HA2    . GLY A 1 78  ? -29.621 -0.285  18.235  1.00  32.59 ? 78  GLY A HA2    1 
ATOM   1104 H HA3    . GLY A 1 78  ? -30.477 -1.650  17.533  1.00  32.76 ? 78  GLY A HA3    1 
ATOM   1105 N N      . ARG A 1 79  ? -27.805 -2.732  17.186  1.00  31.87 ? 79  ARG A N      1 
ATOM   1106 C CA     . ARG A 1 79  ? -26.739 -3.677  17.621  1.00  33.60 ? 79  ARG A CA     1 
ATOM   1107 C C      . ARG A 1 79  ? -25.362 -2.966  17.558  1.00  36.25 ? 79  ARG A C      1 
ATOM   1108 O O      . ARG A 1 79  ? -24.432 -3.361  18.236  1.00  35.07 ? 79  ARG A O      1 
ATOM   1109 C CB     . ARG A 1 79  ? -26.864 -4.901  16.682  1.00  33.39 ? 79  ARG A CB     1 
ATOM   1110 C CG     . ARG A 1 79  ? -25.946 -6.038  17.176  0.40  33.61 ? 79  ARG A CG     1 
ATOM   1111 C CD     . ARG A 1 79  ? -26.425 -7.392  16.604  0.40  33.08 ? 79  ARG A CD     1 
ATOM   1112 N NE     . ARG A 1 79  ? -26.801 -7.217  15.168  0.40  32.98 ? 79  ARG A NE     1 
ATOM   1113 C CZ     . ARG A 1 79  ? -26.325 -7.970  14.213  0.40  33.53 ? 79  ARG A CZ     1 
ATOM   1114 N NH1    . ARG A 1 79  ? -25.532 -8.974  14.482  0.40  34.75 ? 79  ARG A NH1    1 
ATOM   1115 N NH2    . ARG A 1 79  ? -26.672 -7.682  12.986  0.40  33.86 ? 79  ARG A NH2    1 
ATOM   1116 H H      . ARG A 1 79  ? -28.011 -2.606  16.238  1.00  31.50 ? 79  ARG A H      1 
ATOM   1117 H HA     . ARG A 1 79  ? -26.921 -3.963  18.648  1.00  34.10 ? 79  ARG A HA     1 
ATOM   1118 H HB2    . ARG A 1 79  ? -27.893 -5.240  16.651  1.00  33.02 ? 79  ARG A HB2    1 
ATOM   1119 H HB3    . ARG A 1 79  ? -26.556 -4.620  15.685  1.00  32.87 ? 79  ARG A HB3    1 
ATOM   1120 H HG2    . ARG A 1 79  ? -24.930 -5.841  16.869  0.40  33.16 ? 79  ARG A HG2    1 
ATOM   1121 H HG3    . ARG A 1 79  ? -25.946 -6.092  18.256  0.40  33.18 ? 79  ARG A HG3    1 
ATOM   1122 H HD2    . ARG A 1 79  ? -25.617 -8.104  16.700  0.40  32.83 ? 79  ARG A HD2    1 
ATOM   1123 H HD3    . ARG A 1 79  ? -27.283 -7.775  17.137  0.40  32.98 ? 79  ARG A HD3    1 
ATOM   1124 H HE     . ARG A 1 79  ? -27.434 -6.507  14.931  0.40  33.17 ? 79  ARG A HE     1 
ATOM   1125 H HH11   . ARG A 1 79  ? -25.179 -9.536  13.735  0.40  34.70 ? 79  ARG A HH11   1 
ATOM   1126 H HH12   . ARG A 1 79  ? -25.274 -9.190  15.423  0.40  34.65 ? 79  ARG A HH12   1 
ATOM   1127 H HH21   . ARG A 1 79  ? -27.280 -6.909  12.806  0.40  33.66 ? 79  ARG A HH21   1 
ATOM   1128 H HH22   . ARG A 1 79  ? -26.328 -8.236  12.227  0.40  33.83 ? 79  ARG A HH22   1 
ATOM   1129 N N      . LEU A 1 80  ? -25.296 -1.956  16.732  1.00  38.47 ? 80  LEU A N      1 
ATOM   1130 C CA     . LEU A 1 80  ? -24.066 -1.140  16.538  1.00  42.29 ? 80  LEU A CA     1 
ATOM   1131 C C      . LEU A 1 80  ? -23.223 -0.981  17.840  1.00  45.79 ? 80  LEU A C      1 
ATOM   1132 O O      . LEU A 1 80  ? -22.041 -1.278  17.875  1.00  43.46 ? 80  LEU A O      1 
ATOM   1133 C CB     . LEU A 1 80  ? -24.465 0.252   16.032  1.00  42.63 ? 80  LEU A CB     1 
ATOM   1134 C CG     . LEU A 1 80  ? -23.546 0.685   14.888  1.00  44.20 ? 80  LEU A CG     1 
ATOM   1135 C CD1    . LEU A 1 80  ? -23.900 2.124   14.519  1.00  43.26 ? 80  LEU A CD1    1 
ATOM   1136 C CD2    . LEU A 1 80  ? -22.057 0.639   15.260  1.00  46.45 ? 80  LEU A CD2    1 
ATOM   1137 H H      . LEU A 1 80  ? -26.089 -1.729  16.211  1.00  37.79 ? 80  LEU A H      1 
ATOM   1138 H HA     . LEU A 1 80  ? -23.470 -1.655  15.801  1.00  42.36 ? 80  LEU A HA     1 
ATOM   1139 H HB2    . LEU A 1 80  ? -25.486 0.231   15.695  1.00  42.62 ? 80  LEU A HB2    1 
ATOM   1140 H HB3    . LEU A 1 80  ? -24.396 0.980   16.832  1.00  42.80 ? 80  LEU A HB3    1 
ATOM   1141 H HG     . LEU A 1 80  ? -23.713 0.013   14.064  1.00  44.17 ? 80  LEU A HG     1 
ATOM   1142 H HD11   . LEU A 1 80  ? -23.771 2.765   15.379  1.00  43.05 ? 80  LEU A HD11   1 
ATOM   1143 H HD12   . LEU A 1 80  ? -24.927 2.201   14.189  1.00  43.45 ? 80  LEU A HD12   1 
ATOM   1144 H HD13   . LEU A 1 80  ? -23.265 2.476   13.726  1.00  42.94 ? 80  LEU A HD13   1 
ATOM   1145 H HD21   . LEU A 1 80  ? -21.449 0.971   14.427  1.00  46.22 ? 80  LEU A HD21   1 
ATOM   1146 H HD22   . LEU A 1 80  ? -21.746 -0.364  15.514  1.00  46.51 ? 80  LEU A HD22   1 
ATOM   1147 H HD23   . LEU A 1 80  ? -21.858 1.278   16.111  1.00  46.44 ? 80  LEU A HD23   1 
ATOM   1148 N N      . PRO A 1 81  ? -23.836 -0.516  18.898  1.00  50.76 ? 81  PRO A N      1 
ATOM   1149 C CA     . PRO A 1 81  ? -23.091 -0.172  20.138  1.00  54.73 ? 81  PRO A CA     1 
ATOM   1150 C C      . PRO A 1 81  ? -22.664 -1.432  20.934  1.00  57.34 ? 81  PRO A C      1 
ATOM   1151 O O      . PRO A 1 81  ? -22.193 -1.308  22.048  1.00  64.56 ? 81  PRO A O      1 
ATOM   1152 C CB     . PRO A 1 81  ? -24.058 0.725   20.943  1.00  53.88 ? 81  PRO A CB     1 
ATOM   1153 C CG     . PRO A 1 81  ? -25.268 0.989   19.962  1.00  52.96 ? 81  PRO A CG     1 
ATOM   1154 C CD     . PRO A 1 81  ? -25.292 -0.239  19.047  1.00  52.38 ? 81  PRO A CD     1 
ATOM   1155 H HA     . PRO A 1 81  ? -22.198 0.374   19.863  1.00  54.29 ? 81  PRO A HA     1 
ATOM   1156 H HB2    . PRO A 1 81  ? -24.384 0.222   21.844  1.00  54.11 ? 81  PRO A HB2    1 
ATOM   1157 H HB3    . PRO A 1 81  ? -23.561 1.645   21.218  1.00  54.16 ? 81  PRO A HB3    1 
ATOM   1158 H HG2    . PRO A 1 81  ? -26.195 1.029   20.516  1.00  53.37 ? 81  PRO A HG2    1 
ATOM   1159 H HG3    . PRO A 1 81  ? -25.149 1.897   19.383  1.00  53.32 ? 81  PRO A HG3    1 
ATOM   1160 H HD2    . PRO A 1 81  ? -25.788 -1.087  19.502  1.00  52.26 ? 81  PRO A HD2    1 
ATOM   1161 H HD3    . PRO A 1 81  ? -25.752 -0.001  18.103  1.00  51.89 ? 81  PRO A HD3    1 
ATOM   1162 N N      . HIS A 1 82  ? -22.833 -2.597  20.381  0.66  56.95 ? 82  HIS A N      1 
ATOM   1163 C CA     . HIS A 1 82  ? -22.442 -3.860  21.097  0.66  56.21 ? 82  HIS A CA     1 
ATOM   1164 C C      . HIS A 1 82  ? -21.285 -4.484  20.366  0.66  55.67 ? 82  HIS A C      1 
ATOM   1165 O O      . HIS A 1 82  ? -20.779 -5.518  20.776  0.66  57.72 ? 82  HIS A O      1 
ATOM   1166 C CB     . HIS A 1 82  ? -23.533 -4.921  21.063  0.93  56.27 ? 82  HIS A CB     1 
ATOM   1167 C CG     . HIS A 1 82  ? -24.814 -4.499  21.757  0.93  58.17 ? 82  HIS A CG     1 
ATOM   1168 N ND1    . HIS A 1 82  ? -24.936 -3.551  22.623  0.93  59.41 ? 82  HIS A ND1    1 
ATOM   1169 C CD2    . HIS A 1 82  ? -26.090 -5.016  21.626  0.93  58.88 ? 82  HIS A CD2    1 
ATOM   1170 C CE1    . HIS A 1 82  ? -26.172 -3.472  23.008  0.93  59.24 ? 82  HIS A CE1    1 
ATOM   1171 N NE2    . HIS A 1 82  ? -26.924 -4.367  22.412  0.59  58.73 ? 82  HIS A NE2    1 
ATOM   1172 H H      . HIS A 1 82  ? -23.222 -2.650  19.481  0.66  57.67 ? 82  HIS A H      1 
ATOM   1173 H HA     . HIS A 1 82  ? -22.134 -3.637  22.109  0.66  57.00 ? 82  HIS A HA     1 
ATOM   1174 H HB2    . HIS A 1 82  ? -23.766 -5.125  20.027  0.93  56.26 ? 82  HIS A HB2    1 
ATOM   1175 H HB3    . HIS A 1 82  ? -23.173 -5.839  21.497  0.93  56.53 ? 82  HIS A HB3    1 
ATOM   1176 H HD1    . HIS A 1 82  ? -24.198 -2.977  22.935  0.93  59.38 ? 82  HIS A HD1    1 
ATOM   1177 H HD2    . HIS A 1 82  ? -26.352 -5.837  20.974  0.93  58.57 ? 82  HIS A HD2    1 
ATOM   1178 H HE1    . HIS A 1 82  ? -26.530 -2.751  23.732  0.93  59.38 ? 82  HIS A HE1    1 
ATOM   1179 N N      . THR A 1 83  ? -20.894 -3.839  19.316  0.70  52.91 ? 83  THR A N      1 
ATOM   1180 C CA     . THR A 1 83  ? -19.788 -4.352  18.481  0.70  50.99 ? 83  THR A CA     1 
ATOM   1181 C C      . THR A 1 83  ? -18.369 -3.828  18.661  0.70  50.40 ? 83  THR A C      1 
ATOM   1182 O O      . THR A 1 83  ? -18.086 -2.812  19.262  0.70  51.62 ? 83  THR A O      1 
ATOM   1183 C CB     . THR A 1 83  ? -20.224 -4.119  17.022  0.65  49.68 ? 83  THR A CB     1 
ATOM   1184 O OG1    . THR A 1 83  ? -21.623 -3.884  17.087  0.65  49.71 ? 83  THR A OG1    1 
ATOM   1185 C CG2    . THR A 1 83  ? -20.239 -5.401  16.224  0.65  48.75 ? 83  THR A CG2    1 
ATOM   1186 H H      . THR A 1 83  ? -21.330 -3.003  19.056  0.70  52.52 ? 83  THR A H      1 
ATOM   1187 H HA     . THR A 1 83  ? -19.746 -5.417  18.665  0.70  51.12 ? 83  THR A HA     1 
ATOM   1188 H HB     . THR A 1 83  ? -19.717 -3.294  16.533  0.65  49.45 ? 83  THR A HB     1 
ATOM   1189 H HG1    . THR A 1 83  ? -21.771 -2.926  17.094  0.65  49.47 ? 83  THR A HG1    1 
ATOM   1190 H HG21   . THR A 1 83  ? -20.956 -6.084  16.650  0.65  48.54 ? 83  THR A HG21   1 
ATOM   1191 H HG22   . THR A 1 83  ? -20.536 -5.168  15.211  0.65  48.69 ? 83  THR A HG22   1 
ATOM   1192 H HG23   . THR A 1 83  ? -19.270 -5.868  16.194  0.65  48.88 ? 83  THR A HG23   1 
ATOM   1193 N N      . GLN A 1 84  ? -17.524 -4.634  18.077  0.48  48.97 ? 84  GLN A N      1 
ATOM   1194 C CA     . GLN A 1 84  ? -16.052 -4.422  18.032  0.48  47.06 ? 84  GLN A CA     1 
ATOM   1195 C C      . GLN A 1 84  ? -15.810 -4.536  16.528  0.48  45.75 ? 84  GLN A C      1 
ATOM   1196 O O      . GLN A 1 84  ? -14.935 -3.876  16.010  0.48  47.11 ? 84  GLN A O      1 
ATOM   1197 C CB     . GLN A 1 84  ? -15.206 -5.543  18.746  0.010 46.59 ? 84  GLN A CB     1 
ATOM   1198 C CG     . GLN A 1 84  ? -13.681 -5.105  18.716  0.010 46.38 ? 84  GLN A CG     1 
ATOM   1199 C CD     . GLN A 1 84  ? -12.733 -6.200  19.241  0.010 46.45 ? 84  GLN A CD     1 
ATOM   1200 O OE1    . GLN A 1 84  ? -11.521 -6.100  19.180  0.010 46.33 ? 84  GLN A OE1    1 
ATOM   1201 N NE2    . GLN A 1 84  ? -13.223 -7.278  19.772  0.010 47.00 ? 84  GLN A NE2    1 
ATOM   1202 H H      . GLN A 1 84  ? -17.902 -5.423  17.649  0.48  50.23 ? 84  GLN A H      1 
ATOM   1203 H HA     . GLN A 1 84  ? -15.807 -3.422  18.359  0.48  46.19 ? 84  GLN A HA     1 
ATOM   1204 H HB2    . GLN A 1 84  ? -15.516 -5.635  19.777  0.010 46.32 ? 84  GLN A HB2    1 
ATOM   1205 H HB3    . GLN A 1 84  ? -15.315 -6.494  18.248  0.010 46.32 ? 84  GLN A HB3    1 
ATOM   1206 H HG2    . GLN A 1 84  ? -13.367 -4.848  17.714  0.010 46.01 ? 84  GLN A HG2    1 
ATOM   1207 H HG3    . GLN A 1 84  ? -13.548 -4.226  19.334  0.010 46.01 ? 84  GLN A HG3    1 
ATOM   1208 H HE21   . GLN A 1 84  ? -12.613 -7.969  20.102  0.010 46.73 ? 84  GLN A HE21   1 
ATOM   1209 H HE22   . GLN A 1 84  ? -14.190 -7.404  19.845  0.010 46.73 ? 84  GLN A HE22   1 
ATOM   1210 N N      . ARG A 1 85  ? -16.572 -5.375  15.849  1.00  44.79 ? 85  ARG A N      1 
ATOM   1211 C CA     . ARG A 1 85  ? -16.370 -5.515  14.376  1.00  43.14 ? 85  ARG A CA     1 
ATOM   1212 C C      . ARG A 1 85  ? -17.617 -5.178  13.554  1.00  43.26 ? 85  ARG A C      1 
ATOM   1213 O O      . ARG A 1 85  ? -18.710 -5.673  13.744  1.00  41.36 ? 85  ARG A O      1 
ATOM   1214 C CB     . ARG A 1 85  ? -15.899 -6.976  14.020  0.61  42.34 ? 85  ARG A CB     1 
ATOM   1215 C CG     . ARG A 1 85  ? -14.538 -7.249  14.788  0.61  42.93 ? 85  ARG A CG     1 
ATOM   1216 C CD     . ARG A 1 85  ? -13.519 -8.110  13.978  0.61  42.67 ? 85  ARG A CD     1 
ATOM   1217 N NE     . ARG A 1 85  ? -13.083 -7.345  12.761  0.61  42.99 ? 85  ARG A NE     1 
ATOM   1218 C CZ     . ARG A 1 85  ? -12.833 -7.930  11.607  0.61  43.06 ? 85  ARG A CZ     1 
ATOM   1219 N NH1    . ARG A 1 85  ? -12.595 -9.211  11.572  0.61  43.11 ? 85  ARG A NH1    1 
ATOM   1220 N NH2    . ARG A 1 85  ? -12.817 -7.220  10.505  0.61  42.51 ? 85  ARG A NH2    1 
ATOM   1221 H H      . ARG A 1 85  ? -17.264 -5.903  16.283  1.00  42.78 ? 85  ARG A H      1 
ATOM   1222 H HA     . ARG A 1 85  ? -15.584 -4.842  14.096  1.00  43.72 ? 85  ARG A HA     1 
ATOM   1223 H HB2    . ARG A 1 85  ? -16.658 -7.690  14.312  0.61  41.97 ? 85  ARG A HB2    1 
ATOM   1224 H HB3    . ARG A 1 85  ? -15.763 -7.055  12.949  0.61  41.80 ? 85  ARG A HB3    1 
ATOM   1225 H HG2    . ARG A 1 85  ? -14.050 -6.321  15.063  0.61  42.12 ? 85  ARG A HG2    1 
ATOM   1226 H HG3    . ARG A 1 85  ? -14.758 -7.781  15.703  0.61  42.53 ? 85  ARG A HG3    1 
ATOM   1227 H HD2    . ARG A 1 85  ? -12.647 -8.316  14.583  0.61  42.75 ? 85  ARG A HD2    1 
ATOM   1228 H HD3    . ARG A 1 85  ? -13.961 -9.052  13.682  0.61  43.05 ? 85  ARG A HD3    1 
ATOM   1229 H HE     . ARG A 1 85  ? -12.984 -6.373  12.830  0.61  43.01 ? 85  ARG A HE     1 
ATOM   1230 H HH11   . ARG A 1 85  ? -12.403 -9.656  10.697  0.61  42.96 ? 85  ARG A HH11   1 
ATOM   1231 H HH12   . ARG A 1 85  ? -12.604 -9.745  12.417  0.61  42.96 ? 85  ARG A HH12   1 
ATOM   1232 H HH21   . ARG A 1 85  ? -12.628 -7.667  9.630   0.61  42.11 ? 85  ARG A HH21   1 
ATOM   1233 H HH22   . ARG A 1 85  ? -12.992 -6.237  10.532  0.61  42.11 ? 85  ARG A HH22   1 
ATOM   1234 N N      . LEU A 1 86  ? -17.348 -4.308  12.641  1.00  40.88 ? 86  LEU A N      1 
ATOM   1235 C CA     . LEU A 1 86  ? -18.350 -3.788  11.693  1.00  38.41 ? 86  LEU A CA     1 
ATOM   1236 C C      . LEU A 1 86  ? -19.124 -4.870  10.950  1.00  38.66 ? 86  LEU A C      1 
ATOM   1237 O O      . LEU A 1 86  ? -20.339 -4.866  10.909  1.00  37.21 ? 86  LEU A O      1 
ATOM   1238 C CB     . LEU A 1 86  ? -17.593 -2.878  10.691  1.00  36.06 ? 86  LEU A CB     1 
ATOM   1239 C CG     . LEU A 1 86  ? -18.555 -2.241  9.700   1.00  34.39 ? 86  LEU A CG     1 
ATOM   1240 C CD1    . LEU A 1 86  ? -19.415 -1.203  10.445  1.00  32.31 ? 86  LEU A CD1    1 
ATOM   1241 C CD2    . LEU A 1 86  ? -17.750 -1.588  8.556   1.00  37.59 ? 86  LEU A CD2    1 
ATOM   1242 H H      . LEU A 1 86  ? -16.431 -3.973  12.580  1.00  40.90 ? 86  LEU A H      1 
ATOM   1243 H HA     . LEU A 1 86  ? -19.062 -3.210  12.266  1.00  37.93 ? 86  LEU A HA     1 
ATOM   1244 H HB2    . LEU A 1 86  ? -17.082 -2.094  11.234  1.00  36.73 ? 86  LEU A HB2    1 
ATOM   1245 H HB3    . LEU A 1 86  ? -16.850 -3.453  10.159  1.00  36.34 ? 86  LEU A HB3    1 
ATOM   1246 H HG     . LEU A 1 86  ? -19.208 -2.985  9.261   1.00  35.28 ? 86  LEU A HG     1 
ATOM   1247 H HD11   . LEU A 1 86  ? -18.799 -0.431  10.890  1.00  32.13 ? 86  LEU A HD11   1 
ATOM   1248 H HD12   . LEU A 1 86  ? -20.007 -1.663  11.221  1.00  31.98 ? 86  LEU A HD12   1 
ATOM   1249 H HD13   . LEU A 1 86  ? -20.096 -0.738  9.747   1.00  32.54 ? 86  LEU A HD13   1 
ATOM   1250 H HD21   . LEU A 1 86  ? -18.424 -1.148  7.836   1.00  36.84 ? 86  LEU A HD21   1 
ATOM   1251 H HD22   . LEU A 1 86  ? -17.151 -2.325  8.038   1.00  36.66 ? 86  LEU A HD22   1 
ATOM   1252 H HD23   . LEU A 1 86  ? -17.099 -0.811  8.937   1.00  37.08 ? 86  LEU A HD23   1 
ATOM   1253 N N      . LEU A 1 87  ? -18.389 -5.779  10.374  1.00  38.68 ? 87  LEU A N      1 
ATOM   1254 C CA     . LEU A 1 87  ? -19.044 -6.875  9.598   1.00  40.88 ? 87  LEU A CA     1 
ATOM   1255 C C      . LEU A 1 87  ? -20.132 -7.655  10.323  1.00  39.13 ? 87  LEU A C      1 
ATOM   1256 O O      . LEU A 1 87  ? -20.954 -8.252  9.651   1.00  38.59 ? 87  LEU A O      1 
ATOM   1257 C CB     . LEU A 1 87  ? -17.971 -7.890  9.084   1.00  44.68 ? 87  LEU A CB     1 
ATOM   1258 C CG     . LEU A 1 87  ? -17.004 -7.269  7.991   1.00  48.10 ? 87  LEU A CG     1 
ATOM   1259 C CD1    . LEU A 1 87  ? -16.150 -6.109  8.567   1.00  49.06 ? 87  LEU A CD1    1 
ATOM   1260 C CD2    . LEU A 1 87  ? -16.020 -8.354  7.470   1.00  48.66 ? 87  LEU A CD2    1 
ATOM   1261 H H      . LEU A 1 87  ? -17.418 -5.744  10.455  1.00  38.89 ? 87  LEU A H      1 
ATOM   1262 H HA     . LEU A 1 87  ? -19.513 -6.420  8.737   1.00  40.77 ? 87  LEU A HA     1 
ATOM   1263 H HB2    . LEU A 1 87  ? -17.420 -8.297  9.920   1.00  44.37 ? 87  LEU A HB2    1 
ATOM   1264 H HB3    . LEU A 1 87  ? -18.513 -8.708  8.622   1.00  44.06 ? 87  LEU A HB3    1 
ATOM   1265 H HG     . LEU A 1 87  ? -17.590 -6.909  7.153   1.00  46.88 ? 87  LEU A HG     1 
ATOM   1266 H HD11   . LEU A 1 87  ? -15.587 -6.432  9.432   1.00  48.56 ? 87  LEU A HD11   1 
ATOM   1267 H HD12   . LEU A 1 87  ? -16.766 -5.260  8.817   1.00  48.82 ? 87  LEU A HD12   1 
ATOM   1268 H HD13   . LEU A 1 87  ? -15.450 -5.782  7.809   1.00  49.02 ? 87  LEU A HD13   1 
ATOM   1269 H HD21   . LEU A 1 87  ? -15.376 -7.942  6.708   1.00  48.21 ? 87  LEU A HD21   1 
ATOM   1270 H HD22   . LEU A 1 87  ? -16.569 -9.174  7.027   1.00  48.31 ? 87  LEU A HD22   1 
ATOM   1271 H HD23   . LEU A 1 87  ? -15.400 -8.745  8.267   1.00  47.95 ? 87  LEU A HD23   1 
ATOM   1272 N N      . GLU A 1 88  ? -20.164 -7.654  11.632  1.00  36.48 ? 88  GLU A N      1 
ATOM   1273 C CA     . GLU A 1 88  ? -21.267 -8.461  12.244  1.00  38.30 ? 88  GLU A CA     1 
ATOM   1274 C C      . GLU A 1 88  ? -22.569 -7.669  12.494  1.00  36.25 ? 88  GLU A C      1 
ATOM   1275 O O      . GLU A 1 88  ? -23.468 -8.226  13.090  1.00  35.88 ? 88  GLU A O      1 
ATOM   1276 C CB     . GLU A 1 88  ? -20.733 -9.093  13.583  1.00  37.39 ? 88  GLU A CB     1 
ATOM   1277 C CG     . GLU A 1 88  ? -20.582 -8.035  14.674  0.26  36.11 ? 88  GLU A CG     1 
ATOM   1278 C CD     . GLU A 1 88  ? -19.734 -8.558  15.854  0.26  35.76 ? 88  GLU A CD     1 
ATOM   1279 O OE1    . GLU A 1 88  ? -20.200 -8.388  16.971  0.26  34.96 ? 88  GLU A OE1    1 
ATOM   1280 O OE2    . GLU A 1 88  ? -18.668 -9.092  15.579  0.26  32.91 ? 88  GLU A OE2    1 
ATOM   1281 H H      . GLU A 1 88  ? -19.514 -7.149  12.164  1.00  36.62 ? 88  GLU A H      1 
ATOM   1282 H HA     . GLU A 1 88  ? -21.520 -9.277  11.578  1.00  38.47 ? 88  GLU A HA     1 
ATOM   1283 H HB2    . GLU A 1 88  ? -21.468 -9.818  13.908  1.00  37.27 ? 88  GLU A HB2    1 
ATOM   1284 H HB3    . GLU A 1 88  ? -19.808 -9.620  13.398  1.00  36.54 ? 88  GLU A HB3    1 
ATOM   1285 H HG2    . GLU A 1 88  ? -20.121 -7.162  14.263  0.26  36.25 ? 88  GLU A HG2    1 
ATOM   1286 H HG3    . GLU A 1 88  ? -21.562 -7.760  15.033  0.26  36.22 ? 88  GLU A HG3    1 
ATOM   1287 N N      . VAL A 1 89  ? -22.666 -6.434  12.079  1.00  33.69 ? 89  VAL A N      1 
ATOM   1288 C CA     . VAL A 1 89  ? -23.945 -5.687  12.317  1.00  31.80 ? 89  VAL A CA     1 
ATOM   1289 C C      . VAL A 1 89  ? -24.357 -5.081  11.002  1.00  31.05 ? 89  VAL A C      1 
ATOM   1290 O O      . VAL A 1 89  ? -25.111 -4.124  10.975  1.00  29.64 ? 89  VAL A O      1 
ATOM   1291 C CB     . VAL A 1 89  ? -23.752 -4.562  13.363  1.00  31.05 ? 89  VAL A CB     1 
ATOM   1292 C CG1    . VAL A 1 89  ? -23.406 -5.227  14.689  1.00  30.41 ? 89  VAL A CG1    1 
ATOM   1293 C CG2    . VAL A 1 89  ? -22.606 -3.602  12.991  1.00  31.67 ? 89  VAL A CG2    1 
ATOM   1294 H H      . VAL A 1 89  ? -21.918 -5.994  11.616  1.00  34.59 ? 89  VAL A H      1 
ATOM   1295 H HA     . VAL A 1 89  ? -24.720 -6.372  12.624  1.00  33.10 ? 89  VAL A HA     1 
ATOM   1296 H HB     . VAL A 1 89  ? -24.673 -4.000  13.454  1.00  30.90 ? 89  VAL A HB     1 
ATOM   1297 H HG11   . VAL A 1 89  ? -22.493 -5.788  14.596  1.00  30.27 ? 89  VAL A HG11   1 
ATOM   1298 H HG12   . VAL A 1 89  ? -24.196 -5.909  14.962  1.00  30.18 ? 89  VAL A HG12   1 
ATOM   1299 H HG13   . VAL A 1 89  ? -23.289 -4.493  15.473  1.00  29.98 ? 89  VAL A HG13   1 
ATOM   1300 H HG21   . VAL A 1 89  ? -22.532 -2.814  13.726  1.00  31.79 ? 89  VAL A HG21   1 
ATOM   1301 H HG22   . VAL A 1 89  ? -22.798 -3.155  12.027  1.00  31.62 ? 89  VAL A HG22   1 
ATOM   1302 H HG23   . VAL A 1 89  ? -21.656 -4.117  12.946  1.00  32.21 ? 89  VAL A HG23   1 
ATOM   1303 N N      . ILE A 1 90  ? -23.872 -5.660  9.944   1.00  31.67 ? 90  ILE A N      1 
ATOM   1304 C CA     . ILE A 1 90  ? -24.217 -5.115  8.614   1.00  35.75 ? 90  ILE A CA     1 
ATOM   1305 C C      . ILE A 1 90  ? -25.053 -6.146  7.787   1.00  34.03 ? 90  ILE A C      1 
ATOM   1306 O O      . ILE A 1 90  ? -24.906 -7.355  7.926   1.00  34.29 ? 90  ILE A O      1 
ATOM   1307 C CB     . ILE A 1 90  ? -22.796 -4.713  8.052   1.00  38.35 ? 90  ILE A CB     1 
ATOM   1308 C CG1    . ILE A 1 90  ? -22.968 -3.701  6.983   1.00  41.07 ? 90  ILE A CG1    1 
ATOM   1309 C CG2    . ILE A 1 90  ? -22.018 -5.923  7.462   1.00  38.34 ? 90  ILE A CG2    1 
ATOM   1310 C CD1    . ILE A 1 90  ? -21.579 -3.297  6.451   1.00  44.86 ? 90  ILE A CD1    1 
ATOM   1311 H H      . ILE A 1 90  ? -23.296 -6.451  10.013  1.00  32.72 ? 90  ILE A H      1 
ATOM   1312 H HA     . ILE A 1 90  ? -24.812 -4.221  8.748   1.00  34.98 ? 90  ILE A HA     1 
ATOM   1313 H HB     . ILE A 1 90  ? -22.217 -4.270  8.853   1.00  38.07 ? 90  ILE A HB     1 
ATOM   1314 H HG12   . ILE A 1 90  ? -23.559 -4.160  6.205   1.00  41.33 ? 90  ILE A HG12   1 
ATOM   1315 H HG13   . ILE A 1 90  ? -23.486 -2.833  7.370   1.00  41.58 ? 90  ILE A HG13   1 
ATOM   1316 H HG21   . ILE A 1 90  ? -22.525 -6.327  6.598   1.00  38.02 ? 90  ILE A HG21   1 
ATOM   1317 H HG22   . ILE A 1 90  ? -21.949 -6.699  8.210   1.00  38.54 ? 90  ILE A HG22   1 
ATOM   1318 H HG23   . ILE A 1 90  ? -21.012 -5.665  7.172   1.00  37.50 ? 90  ILE A HG23   1 
ATOM   1319 H HD11   . ILE A 1 90  ? -21.672 -2.543  5.687   1.00  43.98 ? 90  ILE A HD11   1 
ATOM   1320 H HD12   . ILE A 1 90  ? -21.078 -4.135  5.990   1.00  44.10 ? 90  ILE A HD12   1 
ATOM   1321 H HD13   . ILE A 1 90  ? -20.957 -2.913  7.249   1.00  44.15 ? 90  ILE A HD13   1 
ATOM   1322 N N      . SER A 1 91  ? -25.914 -5.617  6.953   1.00  32.08 ? 91  SER A N      1 
ATOM   1323 C CA     . SER A 1 91  ? -26.799 -6.473  6.082   1.00  32.88 ? 91  SER A CA     1 
ATOM   1324 C C      . SER A 1 91  ? -26.988 -5.775  4.732   1.00  31.19 ? 91  SER A C      1 
ATOM   1325 O O      . SER A 1 91  ? -26.868 -4.565  4.681   1.00  25.37 ? 91  SER A O      1 
ATOM   1326 C CB     . SER A 1 91  ? -28.173 -6.689  6.832   1.00  33.78 ? 91  SER A CB     1 
ATOM   1327 O OG     . SER A 1 91  ? -28.314 -5.640  7.818   1.00  39.21 ? 91  SER A OG     1 
ATOM   1328 H H      . SER A 1 91  ? -25.988 -4.640  6.881   1.00  32.54 ? 91  SER A H      1 
ATOM   1329 H HA     . SER A 1 91  ? -26.318 -7.427  5.916   1.00  32.20 ? 91  SER A HA     1 
ATOM   1330 H HB2    . SER A 1 91  ? -28.991 -6.641  6.121   1.00  34.32 ? 91  SER A HB2    1 
ATOM   1331 H HB3    . SER A 1 91  ? -28.180 -7.656  7.316   1.00  34.29 ? 91  SER A HB3    1 
ATOM   1332 H HG     . SER A 1 91  ? -27.754 -4.900  7.555   1.00  38.46 ? 91  SER A HG     1 
ATOM   1333 N N      . VAL A 1 92  ? -27.274 -6.500  3.693   1.00  33.89 ? 92  VAL A N      1 
ATOM   1334 C CA     . VAL A 1 92  ? -27.459 -5.838  2.373   1.00  36.40 ? 92  VAL A CA     1 
ATOM   1335 C C      . VAL A 1 92  ? -28.759 -5.074  2.491   1.00  36.38 ? 92  VAL A C      1 
ATOM   1336 O O      . VAL A 1 92  ? -29.634 -5.489  3.224   1.00  39.17 ? 92  VAL A O      1 
ATOM   1337 C CB     . VAL A 1 92  ? -27.574 -6.898  1.275   1.00  39.81 ? 92  VAL A CB     1 
ATOM   1338 C CG1    . VAL A 1 92  ? -27.758 -6.202  -0.131  1.00  41.06 ? 92  VAL A CG1    1 
ATOM   1339 C CG2    . VAL A 1 92  ? -26.279 -7.789  1.317   1.00  40.17 ? 92  VAL A CG2    1 
ATOM   1340 H H      . VAL A 1 92  ? -27.381 -7.472  3.768   1.00  33.85 ? 92  VAL A H      1 
ATOM   1341 H HA     . VAL A 1 92  ? -26.648 -5.142  2.204   1.00  36.99 ? 92  VAL A HA     1 
ATOM   1342 H HB     . VAL A 1 92  ? -28.450 -7.503  1.475   1.00  39.17 ? 92  VAL A HB     1 
ATOM   1343 H HG11   . VAL A 1 92  ? -26.924 -5.547  -0.353  1.00  40.80 ? 92  VAL A HG11   1 
ATOM   1344 H HG12   . VAL A 1 92  ? -28.659 -5.606  -0.136  1.00  40.72 ? 92  VAL A HG12   1 
ATOM   1345 H HG13   . VAL A 1 92  ? -27.845 -6.941  -0.916  1.00  40.70 ? 92  VAL A HG13   1 
ATOM   1346 H HG21   . VAL A 1 92  ? -26.316 -8.552  0.553   1.00  40.43 ? 92  VAL A HG21   1 
ATOM   1347 H HG22   . VAL A 1 92  ? -26.183 -8.282  2.274   1.00  39.59 ? 92  VAL A HG22   1 
ATOM   1348 H HG23   . VAL A 1 92  ? -25.399 -7.183  1.160   1.00  40.32 ? 92  VAL A HG23   1 
ATOM   1349 N N      . CYS A 1 93  ? -28.864 -3.995  1.785   1.00  35.80 ? 93  CYS A N      1 
ATOM   1350 C CA     . CYS A 1 93  ? -30.105 -3.214  1.862   1.00  33.44 ? 93  CYS A CA     1 
ATOM   1351 C C      . CYS A 1 93  ? -30.208 -2.461  0.573   1.00  35.96 ? 93  CYS A C      1 
ATOM   1352 O O      . CYS A 1 93  ? -29.300 -2.515  -0.248  1.00  37.69 ? 93  CYS A O      1 
ATOM   1353 C CB     . CYS A 1 93  ? -30.013 -2.279  3.018   1.00  33.39 ? 93  CYS A CB     1 
ATOM   1354 S SG     . CYS A 1 93  ? -28.780 -0.971  2.864   1.00  28.99 ? 93  CYS A SG     1 
ATOM   1355 H H      . CYS A 1 93  ? -28.137 -3.686  1.201   1.00  37.19 ? 93  CYS A H      1 
ATOM   1356 H HA     . CYS A 1 93  ? -30.941 -3.890  1.958   1.00  34.59 ? 93  CYS A HA     1 
ATOM   1357 H HB2    . CYS A 1 93  ? -30.980 -1.832  3.190   1.00  32.04 ? 93  CYS A HB2    1 
ATOM   1358 H HB3    . CYS A 1 93  ? -29.767 -2.865  3.895   1.00  31.76 ? 93  CYS A HB3    1 
ATOM   1359 N N      . ASP A 1 94  ? -31.309 -1.765  0.442   1.00  35.47 ? 94  ASP A N      1 
ATOM   1360 C CA     . ASP A 1 94  ? -31.546 -0.972  -0.805  1.00  35.50 ? 94  ASP A CA     1 
ATOM   1361 C C      . ASP A 1 94  ? -31.024 0.422   -0.706  1.00  33.01 ? 94  ASP A C      1 
ATOM   1362 O O      . ASP A 1 94  ? -30.646 0.955   -1.725  1.00  35.11 ? 94  ASP A O      1 
ATOM   1363 C CB     . ASP A 1 94  ? -33.058 -0.846  -1.149  0.44  34.48 ? 94  ASP A CB     1 
ATOM   1364 C CG     . ASP A 1 94  ? -33.650 -2.217  -1.468  0.44  34.43 ? 94  ASP A CG     1 
ATOM   1365 O OD1    . ASP A 1 94  ? -33.219 -2.780  -2.462  0.44  32.38 ? 94  ASP A OD1    1 
ATOM   1366 O OD2    . ASP A 1 94  ? -34.503 -2.618  -0.693  0.44  36.23 ? 94  ASP A OD2    1 
ATOM   1367 H H      . ASP A 1 94  ? -31.967 -1.780  1.172   1.00  36.05 ? 94  ASP A H      1 
ATOM   1368 H HA     . ASP A 1 94  ? -31.028 -1.454  -1.624  1.00  35.30 ? 94  ASP A HA     1 
ATOM   1369 H HB2    . ASP A 1 94  ? -33.601 -0.393  -0.333  0.44  34.50 ? 94  ASP A HB2    1 
ATOM   1370 H HB3    . ASP A 1 94  ? -33.168 -0.218  -2.023  0.44  34.41 ? 94  ASP A HB3    1 
ATOM   1371 N N      . CYS A 1 95  ? -31.015 0.971   0.470   1.00  30.81 ? 95  CYS A N      1 
ATOM   1372 C CA     . CYS A 1 95  ? -30.508 2.352   0.617   1.00  31.33 ? 95  CYS A CA     1 
ATOM   1373 C C      . CYS A 1 95  ? -31.195 3.309   -0.389  1.00  36.44 ? 95  CYS A C      1 
ATOM   1374 O O      . CYS A 1 95  ? -30.558 3.904   -1.251  1.00  36.36 ? 95  CYS A O      1 
ATOM   1375 C CB     . CYS A 1 95  ? -28.962 2.384   0.391   1.00  30.32 ? 95  CYS A CB     1 
ATOM   1376 S SG     . CYS A 1 95  ? -28.247 3.914   1.024   1.00  28.49 ? 95  CYS A SG     1 
ATOM   1377 H H      . CYS A 1 95  ? -31.328 0.483   1.257   1.00  29.83 ? 95  CYS A H      1 
ATOM   1378 H HA     . CYS A 1 95  ? -30.703 2.690   1.623   1.00  33.96 ? 95  CYS A HA     1 
ATOM   1379 H HB2    . CYS A 1 95  ? -28.487 1.541   0.868   1.00  29.08 ? 95  CYS A HB2    1 
ATOM   1380 H HB3    . CYS A 1 95  ? -28.735 2.338   -0.668  1.00  28.78 ? 95  CYS A HB3    1 
ATOM   1381 N N      . PRO A 1 96  ? -32.508 3.430   -0.248  1.00  36.95 ? 96  PRO A N      1 
ATOM   1382 C CA     . PRO A 1 96  ? -33.342 4.267   -1.152  1.00  35.49 ? 96  PRO A CA     1 
ATOM   1383 C C      . PRO A 1 96  ? -32.789 5.670   -1.357  1.00  35.17 ? 96  PRO A C      1 
ATOM   1384 O O      . PRO A 1 96  ? -32.828 6.186   -2.448  1.00  35.21 ? 96  PRO A O      1 
ATOM   1385 C CB     . PRO A 1 96  ? -34.718 4.244   -0.505  0.62  36.10 ? 96  PRO A CB     1 
ATOM   1386 C CG     . PRO A 1 96  ? -34.438 3.839   0.972   0.62  36.18 ? 96  PRO A CG     1 
ATOM   1387 C CD     . PRO A 1 96  ? -33.342 2.796   0.816   0.62  36.22 ? 96  PRO A CD     1 
ATOM   1388 H HA     . PRO A 1 96  ? -33.377 3.791   -2.124  1.00  34.08 ? 96  PRO A HA     1 
ATOM   1389 H HB2    . PRO A 1 96  ? -35.171 5.228   -0.562  0.62  36.04 ? 96  PRO A HB2    1 
ATOM   1390 H HB3    . PRO A 1 96  ? -35.352 3.538   -1.018  0.62  35.98 ? 96  PRO A HB3    1 
ATOM   1391 H HG2    . PRO A 1 96  ? -34.097 4.684   1.555   0.62  36.19 ? 96  PRO A HG2    1 
ATOM   1392 H HG3    . PRO A 1 96  ? -35.314 3.416   1.444   0.62  36.15 ? 96  PRO A HG3    1 
ATOM   1393 H HD2    . PRO A 1 96  ? -32.788 2.687   1.739   0.62  36.84 ? 96  PRO A HD2    1 
ATOM   1394 H HD3    . PRO A 1 96  ? -33.721 1.842   0.482   0.62  36.42 ? 96  PRO A HD3    1 
ATOM   1395 N N      . ARG A 1 97  ? -32.285 6.271   -0.312  1.00  37.97 ? 97  ARG A N      1 
ATOM   1396 C CA     . ARG A 1 97  ? -31.732 7.653   -0.493  1.00  37.76 ? 97  ARG A CA     1 
ATOM   1397 C C      . ARG A 1 97  ? -30.452 7.697   -1.342  1.00  34.31 ? 97  ARG A C      1 
ATOM   1398 O O      . ARG A 1 97  ? -30.010 8.781   -1.660  1.00  37.18 ? 97  ARG A O      1 
ATOM   1399 C CB     . ARG A 1 97  ? -31.407 8.281   0.858   1.00  44.06 ? 97  ARG A CB     1 
ATOM   1400 C CG     . ARG A 1 97  ? -32.710 8.764   1.571   1.00  53.36 ? 97  ARG A CG     1 
ATOM   1401 C CD     . ARG A 1 97  ? -32.387 9.431   2.970   1.00  61.14 ? 97  ARG A CD     1 
ATOM   1402 N NE     . ARG A 1 97  ? -31.062 10.143  2.862   1.00  70.39 ? 97  ARG A NE     1 
ATOM   1403 C CZ     . ARG A 1 97  ? -30.933 11.449  2.929   1.00  76.09 ? 97  ARG A CZ     1 
ATOM   1404 N NH1    . ARG A 1 97  ? -31.826 12.235  2.365   1.00  78.25 ? 97  ARG A NH1    1 
ATOM   1405 N NH2    . ARG A 1 97  ? -29.884 11.912  3.568   1.00  76.85 ? 97  ARG A NH2    1 
ATOM   1406 H H      . ARG A 1 97  ? -32.281 5.805   0.549   1.00  37.29 ? 97  ARG A H      1 
ATOM   1407 H HA     . ARG A 1 97  ? -32.473 8.242   -1.013  1.00  37.71 ? 97  ARG A HA     1 
ATOM   1408 H HB2    . ARG A 1 97  ? -30.858 7.576   1.467   1.00  44.61 ? 97  ARG A HB2    1 
ATOM   1409 H HB3    . ARG A 1 97  ? -30.767 9.132   0.661   1.00  44.26 ? 97  ARG A HB3    1 
ATOM   1410 H HG2    . ARG A 1 97  ? -33.206 9.494   0.949   1.00  53.22 ? 97  ARG A HG2    1 
ATOM   1411 H HG3    . ARG A 1 97  ? -33.388 7.934   1.722   1.00  53.04 ? 97  ARG A HG3    1 
ATOM   1412 H HD2    . ARG A 1 97  ? -33.163 10.131  3.253   1.00  61.24 ? 97  ARG A HD2    1 
ATOM   1413 H HD3    . ARG A 1 97  ? -32.323 8.684   3.751   1.00  61.45 ? 97  ARG A HD3    1 
ATOM   1414 H HE     . ARG A 1 97  ? -30.250 9.605   2.736   1.00  69.73 ? 97  ARG A HE     1 
ATOM   1415 H HH11   . ARG A 1 97  ? -31.719 13.228  2.415   1.00  77.80 ? 97  ARG A HH11   1 
ATOM   1416 H HH12   . ARG A 1 97  ? -32.612 11.843  1.886   1.00  77.63 ? 97  ARG A HH12   1 
ATOM   1417 H HH21   . ARG A 1 97  ? -29.230 11.274  3.977   1.00  76.54 ? 97  ARG A HH21   1 
ATOM   1418 H HH22   . ARG A 1 97  ? -29.734 12.898  3.648   1.00  76.65 ? 97  ARG A HH22   1 
ATOM   1419 N N      . GLY A 1 98  ? -29.894 6.573   -1.679  1.00  28.60 ? 98  GLY A N      1 
ATOM   1420 C CA     . GLY A 1 98  ? -28.653 6.539   -2.497  1.00  30.33 ? 98  GLY A CA     1 
ATOM   1421 C C      . GLY A 1 98  ? -27.535 7.428   -1.917  1.00  31.70 ? 98  GLY A C      1 
ATOM   1422 O O      . GLY A 1 98  ? -26.738 7.987   -2.663  1.00  35.06 ? 98  GLY A O      1 
ATOM   1423 H H      . GLY A 1 98  ? -30.293 5.727   -1.392  1.00  28.80 ? 98  GLY A H      1 
ATOM   1424 H HA2    . GLY A 1 98  ? -28.299 5.520   -2.544  1.00  29.66 ? 98  GLY A HA2    1 
ATOM   1425 H HA3    . GLY A 1 98  ? -28.901 6.874   -3.494  1.00  29.45 ? 98  GLY A HA3    1 
ATOM   1426 N N      . ARG A 1 99  ? -27.496 7.530   -0.608  1.00  31.68 ? 99  ARG A N      1 
ATOM   1427 C CA     . ARG A 1 99  ? -26.454 8.358   0.091   1.00  31.24 ? 99  ARG A CA     1 
ATOM   1428 C C      . ARG A 1 99  ? -25.617 7.433   0.958   1.00  26.06 ? 99  ARG A C      1 
ATOM   1429 O O      . ARG A 1 99  ? -26.150 6.680   1.748   1.00  19.85 ? 99  ARG A O      1 
ATOM   1430 C CB     . ARG A 1 99  ? -27.095 9.429   0.984   1.00  33.20 ? 99  ARG A CB     1 
ATOM   1431 C CG     . ARG A 1 99  ? -27.432 10.569  0.025   1.00  37.90 ? 99  ARG A CG     1 
ATOM   1432 C CD     . ARG A 1 99  ? -27.916 11.774  0.780   1.00  43.83 ? 99  ARG A CD     1 
ATOM   1433 N NE     . ARG A 1 99  ? -27.984 12.888  -0.216  1.00  49.97 ? 99  ARG A NE     1 
ATOM   1434 C CZ     . ARG A 1 99  ? -27.296 14.000  -0.087  1.00  54.28 ? 99  ARG A CZ     1 
ATOM   1435 N NH1    . ARG A 1 99  ? -26.571 14.233  0.981   1.00  54.52 ? 99  ARG A NH1    1 
ATOM   1436 N NH2    . ARG A 1 99  ? -27.368 14.865  -1.070  1.00  57.30 ? 99  ARG A NH2    1 
ATOM   1437 H H      . ARG A 1 99  ? -28.160 7.043   -0.079  1.00  31.95 ? 99  ARG A H      1 
ATOM   1438 H HA     . ARG A 1 99  ? -25.813 8.792   -0.663  1.00  31.60 ? 99  ARG A HA     1 
ATOM   1439 H HB2    . ARG A 1 99  ? -27.973 9.030   1.474   1.00  34.04 ? 99  ARG A HB2    1 
ATOM   1440 H HB3    . ARG A 1 99  ? -26.384 9.738   1.733   1.00  33.74 ? 99  ARG A HB3    1 
ATOM   1441 H HG2    . ARG A 1 99  ? -26.559 10.847  -0.549  1.00  37.77 ? 99  ARG A HG2    1 
ATOM   1442 H HG3    . ARG A 1 99  ? -28.201 10.244  -0.665  1.00  37.74 ? 99  ARG A HG3    1 
ATOM   1443 H HD2    . ARG A 1 99  ? -28.910 11.602  1.165   1.00  43.72 ? 99  ARG A HD2    1 
ATOM   1444 H HD3    . ARG A 1 99  ? -27.257 12.027  1.590   1.00  43.61 ? 99  ARG A HD3    1 
ATOM   1445 H HE     . ARG A 1 99  ? -28.565 12.785  -0.999  1.00  49.78 ? 99  ARG A HE     1 
ATOM   1446 H HH11   . ARG A 1 99  ? -26.053 15.086  1.054   1.00  54.25 ? 99  ARG A HH11   1 
ATOM   1447 H HH12   . ARG A 1 99  ? -26.530 13.569  1.724   1.00  54.04 ? 99  ARG A HH12   1 
ATOM   1448 H HH21   . ARG A 1 99  ? -27.928 14.663  -1.874  1.00  56.80 ? 99  ARG A HH21   1 
ATOM   1449 H HH22   . ARG A 1 99  ? -26.863 15.728  -1.018  1.00  56.95 ? 99  ARG A HH22   1 
ATOM   1450 N N      . PHE A 1 100 ? -24.328 7.522   0.795   1.00  24.98 ? 100 PHE A N      1 
ATOM   1451 C CA     . PHE A 1 100 ? -23.399 6.647   1.590   1.00  24.43 ? 100 PHE A CA     1 
ATOM   1452 C C      . PHE A 1 100 ? -22.345 7.426   2.383   1.00  22.56 ? 100 PHE A C      1 
ATOM   1453 O O      . PHE A 1 100 ? -22.101 8.606   2.215   1.00  20.95 ? 100 PHE A O      1 
ATOM   1454 C CB     . PHE A 1 100 ? -22.744 5.618   0.606   1.00  21.80 ? 100 PHE A CB     1 
ATOM   1455 C CG     . PHE A 1 100 ? -22.105 6.231   -0.647  1.00  25.86 ? 100 PHE A CG     1 
ATOM   1456 C CD1    . PHE A 1 100 ? -20.730 6.380   -0.724  1.00  22.33 ? 100 PHE A CD1    1 
ATOM   1457 C CD2    . PHE A 1 100 ? -22.891 6.640   -1.730  1.00  25.38 ? 100 PHE A CD2    1 
ATOM   1458 C CE1    . PHE A 1 100 ? -20.143 6.922   -1.851  1.00  23.21 ? 100 PHE A CE1    1 
ATOM   1459 C CE2    . PHE A 1 100 ? -22.294 7.180   -2.847  1.00  25.52 ? 100 PHE A CE2    1 
ATOM   1460 C CZ     . PHE A 1 100 ? -20.921 7.322   -2.912  1.00  26.47 ? 100 PHE A CZ     1 
ATOM   1461 H H      . PHE A 1 100 ? -23.957 8.170   0.152   1.00  24.50 ? 100 PHE A H      1 
ATOM   1462 H HA     . PHE A 1 100 ? -23.983 6.079   2.300   1.00  24.04 ? 100 PHE A HA     1 
ATOM   1463 H HB2    . PHE A 1 100 ? -21.979 5.073   1.142   1.00  23.88 ? 100 PHE A HB2    1 
ATOM   1464 H HB3    . PHE A 1 100 ? -23.485 4.898   0.297   1.00  23.07 ? 100 PHE A HB3    1 
ATOM   1465 H HD1    . PHE A 1 100 ? -20.112 6.069   0.107   1.00  23.05 ? 100 PHE A HD1    1 
ATOM   1466 H HD2    . PHE A 1 100 ? -23.966 6.534   -1.699  1.00  25.69 ? 100 PHE A HD2    1 
ATOM   1467 H HE1    . PHE A 1 100 ? -19.074 7.033   -1.904  1.00  23.27 ? 100 PHE A HE1    1 
ATOM   1468 H HE2    . PHE A 1 100 ? -22.895 7.495   -3.681  1.00  26.13 ? 100 PHE A HE2    1 
ATOM   1469 H HZ     . PHE A 1 100 ? -20.464 7.744   -3.797  1.00  25.46 ? 100 PHE A HZ     1 
ATOM   1470 N N      . LEU A 1 101 ? -21.732 6.690   3.242   1.00  23.83 ? 101 LEU A N      1 
ATOM   1471 C CA     . LEU A 1 101 ? -20.687 7.270   4.140   1.00  23.74 ? 101 LEU A CA     1 
ATOM   1472 C C      . LEU A 1 101 ? -19.253 7.248   3.604   1.00  20.17 ? 101 LEU A C      1 
ATOM   1473 O O      . LEU A 1 101 ? -18.828 6.279   2.982   1.00  18.05 ? 101 LEU A O      1 
ATOM   1474 C CB     . LEU A 1 101 ? -20.836 6.463   5.485   1.00  22.52 ? 101 LEU A CB     1 
ATOM   1475 C CG     . LEU A 1 101 ? -19.881 6.865   6.651   1.00  21.52 ? 101 LEU A CG     1 
ATOM   1476 C CD1    . LEU A 1 101 ? -20.256 8.264   7.184   1.00  21.36 ? 101 LEU A CD1    1 
ATOM   1477 C CD2    . LEU A 1 101 ? -20.000 5.796   7.780   1.00  20.37 ? 101 LEU A CD2    1 
ATOM   1478 H H      . LEU A 1 101 ? -21.953 5.733   3.301   1.00  24.25 ? 101 LEU A H      1 
ATOM   1479 H HA     . LEU A 1 101 ? -20.960 8.302   4.327   1.00  22.63 ? 101 LEU A HA     1 
ATOM   1480 H HB2    . LEU A 1 101 ? -21.860 6.548   5.822   1.00  22.67 ? 101 LEU A HB2    1 
ATOM   1481 H HB3    . LEU A 1 101 ? -20.655 5.422   5.250   1.00  22.50 ? 101 LEU A HB3    1 
ATOM   1482 H HG     . LEU A 1 101 ? -18.855 6.889   6.303   1.00  21.48 ? 101 LEU A HG     1 
ATOM   1483 H HD11   . LEU A 1 101 ? -21.287 8.270   7.497   1.00  21.55 ? 101 LEU A HD11   1 
ATOM   1484 H HD12   . LEU A 1 101 ? -20.117 9.019   6.423   1.00  20.89 ? 101 LEU A HD12   1 
ATOM   1485 H HD13   . LEU A 1 101 ? -19.632 8.517   8.029   1.00  21.30 ? 101 LEU A HD13   1 
ATOM   1486 H HD21   . LEU A 1 101 ? -19.338 6.041   8.599   1.00  20.49 ? 101 LEU A HD21   1 
ATOM   1487 H HD22   . LEU A 1 101 ? -19.732 4.814   7.420   1.00  19.35 ? 101 LEU A HD22   1 
ATOM   1488 H HD23   . LEU A 1 101 ? -21.006 5.747   8.174   1.00  20.43 ? 101 LEU A HD23   1 
ATOM   1489 N N      . ALA A 1 102 ? -18.599 8.347   3.888   1.00  21.02 ? 102 ALA A N      1 
ATOM   1490 C CA     . ALA A 1 102 ? -17.186 8.589   3.514   1.00  22.55 ? 102 ALA A CA     1 
ATOM   1491 C C      . ALA A 1 102 ? -16.570 8.877   4.900   1.00  24.94 ? 102 ALA A C      1 
ATOM   1492 O O      . ALA A 1 102 ? -17.175 9.534   5.743   1.00  20.87 ? 102 ALA A O      1 
ATOM   1493 C CB     . ALA A 1 102 ? -17.027 9.811   2.622   1.00  24.34 ? 102 ALA A CB     1 
ATOM   1494 H H      . ALA A 1 102 ? -19.058 9.065   4.380   1.00  21.61 ? 102 ALA A H      1 
ATOM   1495 H HA     . ALA A 1 102 ? -16.758 7.688   3.123   1.00  22.41 ? 102 ALA A HA     1 
ATOM   1496 H HB1    . ALA A 1 102 ? -15.981 9.953   2.385   1.00  23.33 ? 102 ALA A HB1    1 
ATOM   1497 H HB2    . ALA A 1 102 ? -17.392 10.701  3.119   1.00  23.79 ? 102 ALA A HB2    1 
ATOM   1498 H HB3    . ALA A 1 102 ? -17.575 9.679   1.702   1.00  23.74 ? 102 ALA A HB3    1 
ATOM   1499 N N      . ALA A 1 103 ? -15.382 8.380   5.104   1.00  25.03 ? 103 ALA A N      1 
ATOM   1500 C CA     . ALA A 1 103 ? -14.696 8.583   6.409   1.00  23.69 ? 103 ALA A CA     1 
ATOM   1501 C C      . ALA A 1 103 ? -13.259 8.962   6.182   1.00  20.36 ? 103 ALA A C      1 
ATOM   1502 O O      . ALA A 1 103 ? -12.621 8.277   5.416   1.00  17.74 ? 103 ALA A O      1 
ATOM   1503 C CB     . ALA A 1 103 ? -14.736 7.273   7.224   1.00  25.43 ? 103 ALA A CB     1 
ATOM   1504 H H      . ALA A 1 103 ? -14.922 7.876   4.400   1.00  24.40 ? 103 ALA A H      1 
ATOM   1505 H HA     . ALA A 1 103 ? -15.188 9.371   6.962   1.00  24.36 ? 103 ALA A HA     1 
ATOM   1506 H HB1    . ALA A 1 103 ? -14.237 7.401   8.176   1.00  25.20 ? 103 ALA A HB1    1 
ATOM   1507 H HB2    . ALA A 1 103 ? -14.211 6.503   6.677   1.00  25.22 ? 103 ALA A HB2    1 
ATOM   1508 H HB3    . ALA A 1 103 ? -15.751 6.958   7.399   1.00  25.40 ? 103 ALA A HB3    1 
ATOM   1509 N N      . ILE A 1 104 ? -12.825 9.989   6.851   1.00  22.84 ? 104 ILE A N      1 
ATOM   1510 C CA     . ILE A 1 104 ? -11.427 10.506  6.767   1.00  26.30 ? 104 ILE A CA     1 
ATOM   1511 C C      . ILE A 1 104 ? -10.840 9.979   8.091   1.00  21.04 ? 104 ILE A C      1 
ATOM   1512 O O      . ILE A 1 104 ? -11.177 10.482  9.144   1.00  18.92 ? 104 ILE A O      1 
ATOM   1513 C CB     . ILE A 1 104 ? -11.408 12.030  6.788   1.00  29.99 ? 104 ILE A CB     1 
ATOM   1514 C CG1    . ILE A 1 104 ? -12.206 12.565  5.575   1.00  33.94 ? 104 ILE A CG1    1 
ATOM   1515 C CG2    . ILE A 1 104 ? -9.949  12.519  6.764   1.00  30.79 ? 104 ILE A CG2    1 
ATOM   1516 C CD1    . ILE A 1 104 ? -11.370 12.446  4.278   1.00  36.02 ? 104 ILE A CD1    1 
ATOM   1517 H H      . ILE A 1 104 ? -13.443 10.455  7.452   1.00  24.04 ? 104 ILE A H      1 
ATOM   1518 H HA     . ILE A 1 104 ? -10.912 10.081  5.917   1.00  24.43 ? 104 ILE A HA     1 
ATOM   1519 H HB     . ILE A 1 104 ? -11.867 12.356  7.711   1.00  30.00 ? 104 ILE A HB     1 
ATOM   1520 H HG12   . ILE A 1 104 ? -13.105 11.976  5.474   1.00  33.78 ? 104 ILE A HG12   1 
ATOM   1521 H HG13   . ILE A 1 104 ? -12.501 13.595  5.735   1.00  33.97 ? 104 ILE A HG13   1 
ATOM   1522 H HG21   . ILE A 1 104 ? -9.426  12.151  5.894   1.00  29.90 ? 104 ILE A HG21   1 
ATOM   1523 H HG22   . ILE A 1 104 ? -9.416  12.169  7.639   1.00  30.32 ? 104 ILE A HG22   1 
ATOM   1524 H HG23   . ILE A 1 104 ? -9.924  13.600  6.762   1.00  30.50 ? 104 ILE A HG23   1 
ATOM   1525 H HD11   . ILE A 1 104 ? -11.958 12.773  3.432   1.00  36.86 ? 104 ILE A HD11   1 
ATOM   1526 H HD12   . ILE A 1 104 ? -11.067 11.424  4.109   1.00  36.47 ? 104 ILE A HD12   1 
ATOM   1527 H HD13   . ILE A 1 104 ? -10.489 13.070  4.322   1.00  36.26 ? 104 ILE A HD13   1 
ATOM   1528 N N      . CYS A 1 105 ? -10.002 8.996   7.978   1.00  22.51 ? 105 CYS A N      1 
ATOM   1529 C CA     . CYS A 1 105 ? -9.341  8.370   9.165   1.00  23.20 ? 105 CYS A CA     1 
ATOM   1530 C C      . CYS A 1 105 ? -7.985  9.074   9.313   1.00  20.99 ? 105 CYS A C      1 
ATOM   1531 O O      . CYS A 1 105 ? -7.499  9.681   8.377   1.00  19.98 ? 105 CYS A O      1 
ATOM   1532 C CB     . CYS A 1 105 ? -9.105  6.829   8.928   1.00  20.70 ? 105 CYS A CB     1 
ATOM   1533 S SG     . CYS A 1 105 ? -10.519 5.763   8.496   1.00  17.52 ? 105 CYS A SG     1 
ATOM   1534 H H      . CYS A 1 105 ? -9.786  8.656   7.086   1.00  23.21 ? 105 CYS A H      1 
ATOM   1535 H HA     . CYS A 1 105 ? -9.923  8.544   10.047  1.00  22.52 ? 105 CYS A HA     1 
ATOM   1536 H HB2    . CYS A 1 105 ? -8.356  6.721   8.153   1.00  20.51 ? 105 CYS A HB2    1 
ATOM   1537 H HB3    . CYS A 1 105 ? -8.660  6.440   9.831   1.00  20.13 ? 105 CYS A HB3    1 
ATOM   1538 N N      . GLN A 1 106 ? -7.414  8.977   10.478  1.00  23.21 ? 106 GLN A N      1 
ATOM   1539 C CA     . GLN A 1 106 ? -6.088  9.636   10.680  1.00  24.61 ? 106 GLN A CA     1 
ATOM   1540 C C      . GLN A 1 106 ? -5.088  8.829   9.837   1.00  21.48 ? 106 GLN A C      1 
ATOM   1541 O O      . GLN A 1 106 ? -5.010  7.633   10.002  1.00  21.99 ? 106 GLN A O      1 
ATOM   1542 C CB     . GLN A 1 106 ? -5.737  9.560   12.134  1.00  26.95 ? 106 GLN A CB     1 
ATOM   1543 C CG     . GLN A 1 106 ? -4.386  10.305  12.371  1.00  31.17 ? 106 GLN A CG     1 
ATOM   1544 C CD     . GLN A 1 106 ? -4.115  10.085  13.829  1.00  35.25 ? 106 GLN A CD     1 
ATOM   1545 O OE1    . GLN A 1 106 ? -4.488  10.884  14.670  1.00  39.62 ? 106 GLN A OE1    1 
ATOM   1546 N NE2    . GLN A 1 106 ? -3.476  9.001   14.146  1.00  37.48 ? 106 GLN A NE2    1 
ATOM   1547 H H      . GLN A 1 106 ? -7.861  8.478   11.194  1.00  23.19 ? 106 GLN A H      1 
ATOM   1548 H HA     . GLN A 1 106 ? -6.142  10.651  10.310  1.00  24.52 ? 106 GLN A HA     1 
ATOM   1549 H HB2    . GLN A 1 106 ? -6.516  10.008  12.731  1.00  27.21 ? 106 GLN A HB2    1 
ATOM   1550 H HB3    . GLN A 1 106 ? -5.631  8.525   12.424  1.00  27.19 ? 106 GLN A HB3    1 
ATOM   1551 H HG2    . GLN A 1 106 ? -3.582  9.870   11.793  1.00  30.73 ? 106 GLN A HG2    1 
ATOM   1552 H HG3    . GLN A 1 106 ? -4.460  11.367  12.181  1.00  30.83 ? 106 GLN A HG3    1 
ATOM   1553 H HE21   . GLN A 1 106 ? -3.219  8.363   13.441  1.00  36.40 ? 106 GLN A HE21   1 
ATOM   1554 H HE22   . GLN A 1 106 ? -3.249  8.789   15.076  1.00  36.94 ? 106 GLN A HE22   1 
ATOM   1555 N N      . ASP A 1 107 ? -4.361  9.483   8.979   1.00  19.73 ? 107 ASP A N      1 
ATOM   1556 C CA     . ASP A 1 107 ? -3.355  8.787   8.102   1.00  22.40 ? 107 ASP A CA     1 
ATOM   1557 C C      . ASP A 1 107 ? -2.204  8.293   8.988   1.00  19.32 ? 107 ASP A C      1 
ATOM   1558 O O      . ASP A 1 107 ? -1.916  8.916   10.001  1.00  17.41 ? 107 ASP A O      1 
ATOM   1559 C CB     . ASP A 1 107 ? -2.808  9.768   7.050   1.00  24.01 ? 107 ASP A CB     1 
ATOM   1560 C CG     . ASP A 1 107 ? -1.857  9.062   6.068   1.00  29.62 ? 107 ASP A CG     1 
ATOM   1561 O OD1    . ASP A 1 107 ? -2.244  7.988   5.622   1.00  28.70 ? 107 ASP A OD1    1 
ATOM   1562 O OD2    . ASP A 1 107 ? -0.803  9.642   5.819   1.00  35.46 ? 107 ASP A OD2    1 
ATOM   1563 H H      . ASP A 1 107 ? -4.488  10.451  8.919   1.00  21.80 ? 107 ASP A H      1 
ATOM   1564 H HA     . ASP A 1 107 ? -3.844  7.939   7.639   1.00  22.77 ? 107 ASP A HA     1 
ATOM   1565 H HB2    . ASP A 1 107 ? -3.626  10.182  6.486   1.00  25.60 ? 107 ASP A HB2    1 
ATOM   1566 H HB3    . ASP A 1 107 ? -2.277  10.572  7.537   1.00  24.49 ? 107 ASP A HB3    1 
ATOM   1567 N N      . CYS A 1 108 ? -1.599  7.219   8.570   1.00  17.11 ? 108 CYS A N      1 
ATOM   1568 C CA     . CYS A 1 108 ? -0.496  6.639   9.332   1.00  14.00 ? 108 CYS A CA     1 
ATOM   1569 C C      . CYS A 1 108 ? 0.296   5.652   8.497   1.00  14.74 ? 108 CYS A C      1 
ATOM   1570 O O      . CYS A 1 108 ? -0.104  5.267   7.418   1.00  12.19 ? 108 CYS A O      1 
ATOM   1571 C CB     . CYS A 1 108 ? -1.079  5.903   10.514  1.00  15.77 ? 108 CYS A CB     1 
ATOM   1572 S SG     . CYS A 1 108 ? -2.178  4.527   10.133  1.00  15.03 ? 108 CYS A SG     1 
ATOM   1573 H H      . CYS A 1 108 ? -1.848  6.763   7.738   1.00  17.55 ? 108 CYS A H      1 
ATOM   1574 H HA     . CYS A 1 108 ? 0.162   7.438   9.651   1.00  15.45 ? 108 CYS A HA     1 
ATOM   1575 H HB2    . CYS A 1 108 ? -0.274  5.514   11.114  1.00  15.83 ? 108 CYS A HB2    1 
ATOM   1576 H HB3    . CYS A 1 108 ? -1.615  6.616   11.124  1.00  15.36 ? 108 CYS A HB3    1 
ATOM   1577 N N      . GLY A 1 109 ? 1.429   5.290   9.060   1.00  14.97 ? 109 GLY A N      1 
ATOM   1578 C CA     . GLY A 1 109 ? 2.369   4.316   8.480   1.00  9.89  ? 109 GLY A CA     1 
ATOM   1579 C C      . GLY A 1 109 ? 3.006   4.590   7.178   1.00  13.17 ? 109 GLY A C      1 
ATOM   1580 O O      . GLY A 1 109 ? 3.440   3.649   6.530   1.00  19.07 ? 109 GLY A O      1 
ATOM   1581 H H      . GLY A 1 109 ? 1.656   5.713   9.915   1.00  14.31 ? 109 GLY A H      1 
ATOM   1582 H HA2    . GLY A 1 109 ? 3.148   4.153   9.206   1.00  12.92 ? 109 GLY A HA2    1 
ATOM   1583 H HA3    . GLY A 1 109 ? 1.823   3.388   8.392   1.00  11.74 ? 109 GLY A HA3    1 
ATOM   1584 N N      . ARG A 1 110 ? 3.066   5.837   6.790   1.00  17.10 ? 110 ARG A N      1 
ATOM   1585 C CA     . ARG A 1 110 ? 3.713   6.188   5.485   1.00  19.69 ? 110 ARG A CA     1 
ATOM   1586 C C      . ARG A 1 110 ? 4.744   7.318   5.638   1.00  17.65 ? 110 ARG A C      1 
ATOM   1587 O O      . ARG A 1 110 ? 4.513   8.253   6.390   1.00  19.22 ? 110 ARG A O      1 
ATOM   1588 C CB     . ARG A 1 110 ? 2.643   6.639   4.494   1.00  25.75 ? 110 ARG A CB     1 
ATOM   1589 C CG     . ARG A 1 110 ? 1.694   5.435   4.214   1.00  33.52 ? 110 ARG A CG     1 
ATOM   1590 C CD     . ARG A 1 110 ? 0.760   5.763   3.045   1.00  38.73 ? 110 ARG A CD     1 
ATOM   1591 N NE     . ARG A 1 110 ? 0.032   7.016   3.393   1.00  45.80 ? 110 ARG A NE     1 
ATOM   1592 C CZ     . ARG A 1 110 ? -0.763  7.581   2.519   1.00  55.73 ? 110 ARG A CZ     1 
ATOM   1593 N NH1    . ARG A 1 110 ? -0.913  7.063   1.321   1.00  59.30 ? 110 ARG A NH1    1 
ATOM   1594 N NH2    . ARG A 1 110 ? -1.398  8.663   2.881   1.00  59.49 ? 110 ARG A NH2    1 
ATOM   1595 H H      . ARG A 1 110 ? 2.676   6.538   7.358   1.00  17.36 ? 110 ARG A H      1 
ATOM   1596 H HA     . ARG A 1 110 ? 4.224   5.317   5.094   1.00  20.89 ? 110 ARG A HA     1 
ATOM   1597 H HB2    . ARG A 1 110 ? 2.093   7.466   4.923   1.00  25.70 ? 110 ARG A HB2    1 
ATOM   1598 H HB3    . ARG A 1 110 ? 3.129   6.973   3.587   1.00  26.31 ? 110 ARG A HB3    1 
ATOM   1599 H HG2    . ARG A 1 110 ? 2.269   4.550   3.970   1.00  32.65 ? 110 ARG A HG2    1 
ATOM   1600 H HG3    . ARG A 1 110 ? 1.097   5.231   5.094   1.00  32.76 ? 110 ARG A HG3    1 
ATOM   1601 H HD2    . ARG A 1 110 ? 1.319   5.917   2.131   1.00  38.45 ? 110 ARG A HD2    1 
ATOM   1602 H HD3    . ARG A 1 110 ? 0.048   4.967   2.882   1.00  38.93 ? 110 ARG A HD3    1 
ATOM   1603 H HE     . ARG A 1 110 ? 0.148   7.424   4.277   1.00  46.41 ? 110 ARG A HE     1 
ATOM   1604 H HH11   . ARG A 1 110 ? -1.532  7.495   0.663   1.00  58.60 ? 110 ARG A HH11   1 
ATOM   1605 H HH12   . ARG A 1 110 ? -0.412  6.237   1.062   1.00  58.50 ? 110 ARG A HH12   1 
ATOM   1606 H HH21   . ARG A 1 110 ? -1.260  9.040   3.796   1.00  58.71 ? 110 ARG A HH21   1 
ATOM   1607 H HH22   . ARG A 1 110 ? -2.023  9.113   2.241   1.00  58.84 ? 110 ARG A HH22   1 
ATOM   1608 N N      . ARG A 1 111 ? 5.820   7.205   4.918   1.00  17.70 ? 111 ARG A N      1 
ATOM   1609 C CA     . ARG A 1 111 ? 6.888   8.243   4.980   1.00  20.89 ? 111 ARG A CA     1 
ATOM   1610 C C      . ARG A 1 111 ? 6.402   9.305   3.996   1.00  19.75 ? 111 ARG A C      1 
ATOM   1611 O O      . ARG A 1 111 ? 5.712   9.015   3.042   1.00  21.28 ? 111 ARG A O      1 
ATOM   1612 C CB     . ARG A 1 111 ? 8.253   7.671   4.510   1.00  18.98 ? 111 ARG A CB     1 
ATOM   1613 C CG     . ARG A 1 111 ? 8.610   6.439   5.364   1.00  17.98 ? 111 ARG A CG     1 
ATOM   1614 C CD     . ARG A 1 111 ? 9.897   5.807   4.800   1.00  20.90 ? 111 ARG A CD     1 
ATOM   1615 N NE     . ARG A 1 111 ? 10.264  4.640   5.658   1.00  21.58 ? 111 ARG A NE     1 
ATOM   1616 C CZ     . ARG A 1 111 ? 10.886  3.557   5.224   1.00  25.11 ? 111 ARG A CZ     1 
ATOM   1617 N NH1    . ARG A 1 111 ? 10.953  3.261   3.951   1.00  24.54 ? 111 ARG A NH1    1 
ATOM   1618 N NH2    . ARG A 1 111 ? 11.445  2.770   6.115   1.00  23.68 ? 111 ARG A NH2    1 
ATOM   1619 H H      . ARG A 1 111 ? 5.924   6.436   4.327   1.00  18.61 ? 111 ARG A H      1 
ATOM   1620 H HA     . ARG A 1 111 ? 6.936   8.657   5.977   1.00  19.74 ? 111 ARG A HA     1 
ATOM   1621 H HB2    . ARG A 1 111 ? 8.213   7.440   3.456   1.00  18.34 ? 111 ARG A HB2    1 
ATOM   1622 H HB3    . ARG A 1 111 ? 8.996   8.443   4.650   1.00  18.91 ? 111 ARG A HB3    1 
ATOM   1623 H HG2    . ARG A 1 111 ? 8.768   6.741   6.387   1.00  18.81 ? 111 ARG A HG2    1 
ATOM   1624 H HG3    . ARG A 1 111 ? 7.817   5.709   5.348   1.00  19.49 ? 111 ARG A HG3    1 
ATOM   1625 H HD2    . ARG A 1 111 ? 9.717   5.458   3.795   1.00  20.20 ? 111 ARG A HD2    1 
ATOM   1626 H HD3    . ARG A 1 111 ? 10.716  6.510   4.783   1.00  20.12 ? 111 ARG A HD3    1 
ATOM   1627 H HE     . ARG A 1 111 ? 10.024  4.679   6.606   1.00  22.73 ? 111 ARG A HE     1 
ATOM   1628 H HH11   . ARG A 1 111 ? 11.432  2.433   3.657   1.00  25.01 ? 111 ARG A HH11   1 
ATOM   1629 H HH12   . ARG A 1 111 ? 10.527  3.855   3.269   1.00  25.63 ? 111 ARG A HH12   1 
ATOM   1630 H HH21   . ARG A 1 111 ? 11.379  2.991   7.088   1.00  25.06 ? 111 ARG A HH21   1 
ATOM   1631 H HH22   . ARG A 1 111 ? 11.937  1.950   5.828   1.00  24.14 ? 111 ARG A HH22   1 
ATOM   1632 N N      . LYS A 1 112 ? 6.783   10.511  4.241   1.00  20.25 ? 112 LYS A N      1 
ATOM   1633 C CA     . LYS A 1 112 ? 6.397   11.660  3.409   1.00  21.01 ? 112 LYS A CA     1 
ATOM   1634 C C      . LYS A 1 112 ? 7.554   12.342  2.703   1.00  23.33 ? 112 LYS A C      1 
ATOM   1635 O O      . LYS A 1 112 ? 7.372   13.478  2.292   1.00  26.92 ? 112 LYS A O      1 
ATOM   1636 C CB     A LYS A 1 112 ? 5.647   12.655  4.330   0.27  21.67 ? 112 LYS A CB     1 
ATOM   1637 C CB     B LYS A 1 112 ? 5.681   12.678  4.324   0.55  20.73 ? 112 LYS A CB     1 
ATOM   1638 C CG     A LYS A 1 112 ? 4.423   11.955  5.013   0.27  22.84 ? 112 LYS A CG     1 
ATOM   1639 C CG     B LYS A 1 112 ? 4.452   12.047  5.044   0.55  21.49 ? 112 LYS A CG     1 
ATOM   1640 C CD     A LYS A 1 112 ? 3.338   11.547  3.975   0.27  24.51 ? 112 LYS A CD     1 
ATOM   1641 C CD     B LYS A 1 112 ? 3.283   11.815  4.055   0.55  23.50 ? 112 LYS A CD     1 
ATOM   1642 C CE     A LYS A 1 112 ? 2.244   10.686  4.647   0.27  26.16 ? 112 LYS A CE     1 
ATOM   1643 C CE     B LYS A 1 112 ? 2.108   11.108  4.755   0.55  26.15 ? 112 LYS A CE     1 
ATOM   1644 N NZ     A LYS A 1 112 ? 1.457   11.488  5.625   0.27  27.21 ? 112 LYS A NZ     1 
ATOM   1645 N NZ     B LYS A 1 112 ? 1.185   10.535  3.723   0.55  28.75 ? 112 LYS A NZ     1 
ATOM   1646 H H      . LYS A 1 112 ? 7.353   10.660  5.014   1.00  20.06 ? 112 LYS A H      1 
ATOM   1647 H HA     . LYS A 1 112 ? 5.734   11.295  2.645   1.00  22.41 ? 112 LYS A HA     1 
ATOM   1648 H HB2    A LYS A 1 112 ? 6.340   12.959  5.094   0.27  21.25 ? 112 LYS A HB2    1 
ATOM   1649 H HB2    B LYS A 1 112 ? 6.398   12.975  5.069   0.55  20.79 ? 112 LYS A HB2    1 
ATOM   1650 H HB3    A LYS A 1 112 ? 5.349   13.545  3.795   0.27  21.32 ? 112 LYS A HB3    1 
ATOM   1651 H HB3    B LYS A 1 112 ? 5.409   13.573  3.783   0.55  20.89 ? 112 LYS A HB3    1 
ATOM   1652 H HG2    A LYS A 1 112 ? 4.756   11.074  5.547   0.27  22.58 ? 112 LYS A HG2    1 
ATOM   1653 H HG2    B LYS A 1 112 ? 4.735   11.098  5.481   0.55  21.53 ? 112 LYS A HG2    1 
ATOM   1654 H HG3    A LYS A 1 112 ? 3.989   12.628  5.740   0.27  22.75 ? 112 LYS A HG3    1 
ATOM   1655 H HG3    B LYS A 1 112 ? 4.137   12.697  5.849   0.55  21.95 ? 112 LYS A HG3    1 
ATOM   1656 H HD2    A LYS A 1 112 ? 2.856   12.431  3.578   0.27  24.73 ? 112 LYS A HD2    1 
ATOM   1657 H HD2    B LYS A 1 112 ? 2.914   12.767  3.700   0.55  23.41 ? 112 LYS A HD2    1 
ATOM   1658 H HD3    A LYS A 1 112 ? 3.755   10.960  3.171   0.27  24.79 ? 112 LYS A HD3    1 
ATOM   1659 H HD3    B LYS A 1 112 ? 3.589   11.201  3.222   0.55  23.52 ? 112 LYS A HD3    1 
ATOM   1660 H HE2    A LYS A 1 112 ? 1.561   10.303  3.903   0.27  26.66 ? 112 LYS A HE2    1 
ATOM   1661 H HE2    B LYS A 1 112 ? 2.448   10.304  5.392   0.55  25.93 ? 112 LYS A HE2    1 
ATOM   1662 H HE3    A LYS A 1 112 ? 2.684   9.847   5.166   0.27  26.38 ? 112 LYS A HE3    1 
ATOM   1663 H HE3    B LYS A 1 112 ? 1.541   11.809  5.354   0.55  25.92 ? 112 LYS A HE3    1 
ATOM   1664 H HZ1    A LYS A 1 112 ? 0.457   11.495  5.338   0.27  26.87 ? 112 LYS A HZ1    1 
ATOM   1665 H HZ1    B LYS A 1 112 ? 1.112   9.506   3.864   0.55  27.92 ? 112 LYS A HZ1    1 
ATOM   1666 H HZ2    A LYS A 1 112 ? 1.819   12.462  5.649   0.27  26.92 ? 112 LYS A HZ2    1 
ATOM   1667 H HZ2    B LYS A 1 112 ? 1.559   10.726  2.771   0.55  27.50 ? 112 LYS A HZ2    1 
ATOM   1668 H HZ3    A LYS A 1 112 ? 1.542   11.057  6.567   0.27  27.05 ? 112 LYS A HZ3    1 
ATOM   1669 H HZ3    B LYS A 1 112 ? 0.241   10.962  3.820   0.55  27.68 ? 112 LYS A HZ3    1 
ATOM   1670 N N      . LEU A 1 113 ? 8.652   11.665  2.548   1.00  24.32 ? 113 LEU A N      1 
ATOM   1671 C CA     . LEU A 1 113 ? 9.835   12.293  1.864   1.00  27.87 ? 113 LEU A CA     1 
ATOM   1672 C C      . LEU A 1 113 ? 9.696   12.051  0.372   1.00  28.41 ? 113 LEU A C      1 
ATOM   1673 O O      . LEU A 1 113 ? 8.987   11.121  0.027   1.00  32.13 ? 113 LEU A O      1 
ATOM   1674 C CB     . LEU A 1 113 ? 11.160  11.649  2.315   1.00  28.68 ? 113 LEU A CB     1 
ATOM   1675 C CG     . LEU A 1 113 ? 11.523  11.950  3.805   1.00  31.81 ? 113 LEU A CG     1 
ATOM   1676 C CD1    . LEU A 1 113 ? 12.812  11.142  4.145   1.00  32.36 ? 113 LEU A CD1    1 
ATOM   1677 C CD2    . LEU A 1 113 ? 11.782  13.455  4.030   1.00  32.77 ? 113 LEU A CD2    1 
ATOM   1678 H H      . LEU A 1 113 ? 8.698   10.740  2.871   1.00  23.69 ? 113 LEU A H      1 
ATOM   1679 H HA     . LEU A 1 113 ? 9.827   13.350  2.065   1.00  28.17 ? 113 LEU A HA     1 
ATOM   1680 H HB2    . LEU A 1 113 ? 11.075  10.582  2.149   1.00  28.88 ? 113 LEU A HB2    1 
ATOM   1681 H HB3    . LEU A 1 113 ? 11.941  11.995  1.652   1.00  29.62 ? 113 LEU A HB3    1 
ATOM   1682 H HG     . LEU A 1 113 ? 10.721  11.618  4.451   1.00  32.09 ? 113 LEU A HG     1 
ATOM   1683 H HD11   . LEU A 1 113 ? 13.634  11.401  3.499   1.00  31.67 ? 113 LEU A HD11   1 
ATOM   1684 H HD12   . LEU A 1 113 ? 12.633  10.078  4.037   1.00  31.35 ? 113 LEU A HD12   1 
ATOM   1685 H HD13   . LEU A 1 113 ? 13.127  11.328  5.158   1.00  31.88 ? 113 LEU A HD13   1 
ATOM   1686 H HD21   . LEU A 1 113 ? 12.023  13.626  5.069   1.00  32.73 ? 113 LEU A HD21   1 
ATOM   1687 H HD22   . LEU A 1 113 ? 10.909  14.041  3.785   1.00  32.87 ? 113 LEU A HD22   1 
ATOM   1688 H HD23   . LEU A 1 113 ? 12.607  13.797  3.423   1.00  32.99 ? 113 LEU A HD23   1 
ATOM   1689 N N      . PRO A 1 114 ? 10.345  12.866  -0.421  1.00  29.51 ? 114 PRO A N      1 
ATOM   1690 C CA     . PRO A 1 114 ? 10.417  12.670  -1.893  1.00  31.26 ? 114 PRO A CA     1 
ATOM   1691 C C      . PRO A 1 114 ? 10.859  11.248  -2.291  1.00  35.59 ? 114 PRO A C      1 
ATOM   1692 O O      . PRO A 1 114 ? 11.746  10.714  -1.634  1.00  36.63 ? 114 PRO A O      1 
ATOM   1693 C CB     . PRO A 1 114 ? 11.392  13.741  -2.360  1.00  30.27 ? 114 PRO A CB     1 
ATOM   1694 C CG     . PRO A 1 114 ? 11.247  14.895  -1.301  1.00  29.50 ? 114 PRO A CG     1 
ATOM   1695 C CD     . PRO A 1 114 ? 11.100  14.101  0.009   1.00  31.22 ? 114 PRO A CD     1 
ATOM   1696 O OXT    . PRO A 1 114 ? 10.288  10.773  -3.254  1.00  41.62 ? 114 PRO A OXT    1 
ATOM   1697 H HA     . PRO A 1 114 ? 9.437   12.853  -2.311  1.00  31.79 ? 114 PRO A HA     1 
ATOM   1698 H HB2    . PRO A 1 114 ? 12.384  13.317  -2.382  1.00  30.17 ? 114 PRO A HB2    1 
ATOM   1699 H HB3    . PRO A 1 114 ? 11.103  14.050  -3.350  1.00  30.37 ? 114 PRO A HB3    1 
ATOM   1700 H HG2    . PRO A 1 114 ? 12.129  15.518  -1.264  1.00  29.87 ? 114 PRO A HG2    1 
ATOM   1701 H HG3    . PRO A 1 114 ? 10.378  15.503  -1.492  1.00  30.40 ? 114 PRO A HG3    1 
ATOM   1702 H HD2    . PRO A 1 114 ? 12.065  13.820  0.405   1.00  30.61 ? 114 PRO A HD2    1 
ATOM   1703 H HD3    . PRO A 1 114 ? 10.544  14.670  0.737   1.00  30.49 ? 114 PRO A HD3    1 
ATOM   1704 N N      . ILE B 2 1   ? 20.357  -0.965  20.031  1.00  16.61 ? 16  ILE B N      1 
ATOM   1705 C CA     . ILE B 2 1   ? 20.201  -1.968  18.961  1.00  16.43 ? 16  ILE B CA     1 
ATOM   1706 C C      . ILE B 2 1   ? 21.627  -2.460  18.651  1.00  15.58 ? 16  ILE B C      1 
ATOM   1707 O O      . ILE B 2 1   ? 22.497  -1.650  18.361  1.00  15.85 ? 16  ILE B O      1 
ATOM   1708 C CB     . ILE B 2 1   ? 19.601  -1.319  17.642  1.00  15.21 ? 16  ILE B CB     1 
ATOM   1709 C CG1    . ILE B 2 1   ? 18.192  -0.626  17.837  1.00  14.07 ? 16  ILE B CG1    1 
ATOM   1710 C CG2    . ILE B 2 1   ? 19.618  -2.313  16.466  1.00  18.13 ? 16  ILE B CG2    1 
ATOM   1711 C CD1    . ILE B 2 1   ? 17.067  -1.624  18.144  1.00  14.26 ? 16  ILE B CD1    1 
ATOM   1712 H H1     . ILE B 2 1   ? 21.377  -0.807  20.195  1.00  18.25 ? 16  ILE B H1     1 
ATOM   1713 H H2     . ILE B 2 1   ? 19.938  -1.292  20.916  1.00  15.90 ? 16  ILE B H2     1 
ATOM   1714 H H3     . ILE B 2 1   ? 19.941  -0.075  19.713  1.00  16.70 ? 16  ILE B H3     1 
ATOM   1715 H HA     . ILE B 2 1   ? 19.609  -2.793  19.329  1.00  15.19 ? 16  ILE B HA     1 
ATOM   1716 H HB     . ILE B 2 1   ? 20.287  -0.541  17.335  1.00  16.13 ? 16  ILE B HB     1 
ATOM   1717 H HG12   . ILE B 2 1   ? 18.228  0.134   18.605  1.00  14.27 ? 16  ILE B HG12   1 
ATOM   1718 H HG13   . ILE B 2 1   ? 17.932  -0.122  16.915  1.00  14.86 ? 16  ILE B HG13   1 
ATOM   1719 H HG21   . ILE B 2 1   ? 19.044  -3.199  16.702  1.00  17.63 ? 16  ILE B HG21   1 
ATOM   1720 H HG22   . ILE B 2 1   ? 20.623  -2.623  16.211  1.00  16.99 ? 16  ILE B HG22   1 
ATOM   1721 H HG23   . ILE B 2 1   ? 19.192  -1.850  15.586  1.00  17.70 ? 16  ILE B HG23   1 
ATOM   1722 H HD11   . ILE B 2 1   ? 16.124  -1.100  18.235  1.00  13.60 ? 16  ILE B HD11   1 
ATOM   1723 H HD12   . ILE B 2 1   ? 17.237  -2.176  19.047  1.00  13.59 ? 16  ILE B HD12   1 
ATOM   1724 H HD13   . ILE B 2 1   ? 16.974  -2.316  17.319  1.00  14.46 ? 16  ILE B HD13   1 
ATOM   1725 N N      . VAL B 2 2   ? 21.770  -3.745  18.700  1.00  16.22 ? 17  VAL B N      1 
ATOM   1726 C CA     . VAL B 2 2   ? 23.052  -4.431  18.433  1.00  17.19 ? 17  VAL B CA     1 
ATOM   1727 C C      . VAL B 2 2   ? 22.965  -4.975  17.007  1.00  18.19 ? 17  VAL B C      1 
ATOM   1728 O O      . VAL B 2 2   ? 21.963  -5.567  16.637  1.00  21.42 ? 17  VAL B O      1 
ATOM   1729 C CB     . VAL B 2 2   ? 23.205  -5.608  19.433  1.00  17.97 ? 17  VAL B CB     1 
ATOM   1730 C CG1    . VAL B 2 2   ? 24.561  -6.336  19.185  1.00  19.12 ? 17  VAL B CG1    1 
ATOM   1731 C CG2    . VAL B 2 2   ? 23.082  -5.158  20.890  1.00  18.65 ? 17  VAL B CG2    1 
ATOM   1732 H H      . VAL B 2 2   ? 21.007  -4.320  18.917  1.00  17.97 ? 17  VAL B H      1 
ATOM   1733 H HA     . VAL B 2 2   ? 23.866  -3.723  18.491  1.00  17.27 ? 17  VAL B HA     1 
ATOM   1734 H HB     . VAL B 2 2   ? 22.412  -6.318  19.242  1.00  17.69 ? 17  VAL B HB     1 
ATOM   1735 H HG11   . VAL B 2 2   ? 25.402  -5.666  19.324  1.00  18.99 ? 17  VAL B HG11   1 
ATOM   1736 H HG12   . VAL B 2 2   ? 24.608  -6.739  18.181  1.00  17.96 ? 17  VAL B HG12   1 
ATOM   1737 H HG13   . VAL B 2 2   ? 24.685  -7.161  19.868  1.00  19.30 ? 17  VAL B HG13   1 
ATOM   1738 H HG21   . VAL B 2 2   ? 23.197  -6.006  21.550  1.00  18.44 ? 17  VAL B HG21   1 
ATOM   1739 H HG22   . VAL B 2 2   ? 22.116  -4.727  21.090  1.00  18.36 ? 17  VAL B HG22   1 
ATOM   1740 H HG23   . VAL B 2 2   ? 23.840  -4.433  21.145  1.00  18.59 ? 17  VAL B HG23   1 
ATOM   1741 N N      . GLY B 2 3   ? 23.992  -4.761  16.253  1.00  15.65 ? 18  GLY B N      1 
ATOM   1742 C CA     . GLY B 2 3   ? 24.044  -5.251  14.849  1.00  19.53 ? 18  GLY B CA     1 
ATOM   1743 C C      . GLY B 2 3   ? 23.152  -4.498  13.866  1.00  21.78 ? 18  GLY B C      1 
ATOM   1744 O O      . GLY B 2 3   ? 22.778  -5.074  12.865  1.00  22.67 ? 18  GLY B O      1 
ATOM   1745 H H      . GLY B 2 3   ? 24.751  -4.264  16.615  1.00  17.39 ? 18  GLY B H      1 
ATOM   1746 H HA2    . GLY B 2 3   ? 25.063  -5.199  14.502  1.00  20.16 ? 18  GLY B HA2    1 
ATOM   1747 H HA3    . GLY B 2 3   ? 23.744  -6.292  14.852  1.00  19.66 ? 18  GLY B HA3    1 
ATOM   1748 N N      . GLY B 2 4   ? 22.845  -3.266  14.141  1.00  19.70 ? 19  GLY B N      1 
ATOM   1749 C CA     . GLY B 2 4   ? 21.981  -2.453  13.245  1.00  18.72 ? 19  GLY B CA     1 
ATOM   1750 C C      . GLY B 2 4   ? 22.879  -1.454  12.521  1.00  20.61 ? 19  GLY B C      1 
ATOM   1751 O O      . GLY B 2 4   ? 24.098  -1.576  12.523  1.00  19.26 ? 19  GLY B O      1 
ATOM   1752 H H      . GLY B 2 4   ? 23.194  -2.852  14.957  1.00  19.70 ? 19  GLY B H      1 
ATOM   1753 H HA2    . GLY B 2 4   ? 21.487  -3.087  12.524  1.00  20.62 ? 19  GLY B HA2    1 
ATOM   1754 H HA3    . GLY B 2 4   ? 21.254  -1.925  13.841  1.00  19.55 ? 19  GLY B HA3    1 
ATOM   1755 N N      . ARG B 2 5   ? 22.258  -0.501  11.899  1.00  19.13 ? 20  ARG B N      1 
ATOM   1756 C CA     . ARG B 2 5   ? 22.980  0.567   11.139  1.00  21.33 ? 20  ARG B CA     1 
ATOM   1757 C C      . ARG B 2 5   ? 22.338  1.912   11.435  1.00  18.39 ? 20  ARG B C      1 
ATOM   1758 O O      . ARG B 2 5   ? 21.211  1.964   11.894  1.00  15.29 ? 20  ARG B O      1 
ATOM   1759 C CB     . ARG B 2 5   ? 22.890  0.357   9.606   1.00  26.89 ? 20  ARG B CB     1 
ATOM   1760 C CG     . ARG B 2 5   ? 23.834  -0.770  9.124   1.00  32.92 ? 20  ARG B CG     1 
ATOM   1761 C CD     . ARG B 2 5   ? 23.311  -2.211  9.371   0.03  32.69 ? 20  ARG B CD     1 
ATOM   1762 N NE     . ARG B 2 5   ? 24.479  -3.150  9.296   0.03  33.01 ? 20  ARG B NE     1 
ATOM   1763 C CZ     . ARG B 2 5   ? 24.504  -4.191  8.499   0.03  32.36 ? 20  ARG B CZ     1 
ATOM   1764 N NH1    . ARG B 2 5   ? 23.397  -4.698  8.024   0.03  31.41 ? 20  ARG B NH1    1 
ATOM   1765 N NH2    . ARG B 2 5   ? 25.664  -4.706  8.199   0.03  32.58 ? 20  ARG B NH2    1 
ATOM   1766 H H      . ARG B 2 5   ? 21.277  -0.468  11.924  1.00  20.91 ? 20  ARG B H      1 
ATOM   1767 H HA     . ARG B 2 5   ? 24.006  0.591   11.475  1.00  21.32 ? 20  ARG B HA     1 
ATOM   1768 H HB2    . ARG B 2 5   ? 21.870  0.136   9.324   1.00  27.41 ? 20  ARG B HB2    1 
ATOM   1769 H HB3    . ARG B 2 5   ? 23.162  1.281   9.113   1.00  27.46 ? 20  ARG B HB3    1 
ATOM   1770 H HG2    . ARG B 2 5   ? 24.002  -0.646  8.063   1.00  32.45 ? 20  ARG B HG2    1 
ATOM   1771 H HG3    . ARG B 2 5   ? 24.791  -0.663  9.619   1.00  32.57 ? 20  ARG B HG3    1 
ATOM   1772 H HD2    . ARG B 2 5   ? 22.839  -2.333  10.327  0.03  33.15 ? 20  ARG B HD2    1 
ATOM   1773 H HD3    . ARG B 2 5   ? 22.592  -2.479  8.609   0.03  33.15 ? 20  ARG B HD3    1 
ATOM   1774 H HE     . ARG B 2 5   ? 25.258  -2.979  9.865   0.03  33.15 ? 20  ARG B HE     1 
ATOM   1775 H HH11   . ARG B 2 5   ? 23.434  -5.492  7.418   0.03  31.38 ? 20  ARG B HH11   1 
ATOM   1776 H HH12   . ARG B 2 5   ? 22.515  -4.295  8.265   0.03  31.38 ? 20  ARG B HH12   1 
ATOM   1777 H HH21   . ARG B 2 5   ? 26.502  -4.306  8.572   0.03  32.33 ? 20  ARG B HH21   1 
ATOM   1778 H HH22   . ARG B 2 5   ? 25.716  -5.503  7.596   0.03  32.33 ? 20  ARG B HH22   1 
ATOM   1779 N N      . ASP B 2 6   ? 23.059  2.955   11.147  1.00  14.47 ? 21  ASP B N      1 
ATOM   1780 C CA     . ASP B 2 6   ? 22.538  4.311   11.388  1.00  15.84 ? 21  ASP B CA     1 
ATOM   1781 C C      . ASP B 2 6   ? 21.415  4.507   10.387  1.00  18.60 ? 21  ASP B C      1 
ATOM   1782 O O      . ASP B 2 6   ? 21.523  4.002   9.292   1.00  19.25 ? 21  ASP B O      1 
ATOM   1783 C CB     . ASP B 2 6   ? 23.546  5.429   11.074  1.00  18.43 ? 21  ASP B CB     1 
ATOM   1784 C CG     . ASP B 2 6   ? 24.737  5.567   12.035  1.00  20.55 ? 21  ASP B CG     1 
ATOM   1785 O OD1    . ASP B 2 6   ? 24.843  4.815   12.977  1.00  21.67 ? 21  ASP B OD1    1 
ATOM   1786 O OD2    . ASP B 2 6   ? 25.511  6.465   11.762  1.00  23.57 ? 21  ASP B OD2    1 
ATOM   1787 H H      . ASP B 2 6   ? 23.951  2.835   10.764  1.00  17.38 ? 21  ASP B H      1 
ATOM   1788 H HA     . ASP B 2 6   ? 22.150  4.373   12.394  1.00  15.96 ? 21  ASP B HA     1 
ATOM   1789 H HB2    . ASP B 2 6   ? 23.927  5.276   10.076  1.00  17.45 ? 21  ASP B HB2    1 
ATOM   1790 H HB3    . ASP B 2 6   ? 23.020  6.374   11.067  1.00  18.24 ? 21  ASP B HB3    1 
ATOM   1791 N N      . THR B 2 7   ? 20.383  5.211   10.748  1.00  20.46 ? 22  THR B N      1 
ATOM   1792 C CA     . THR B 2 7   ? 19.281  5.431   9.779   1.00  21.91 ? 22  THR B CA     1 
ATOM   1793 C C      . THR B 2 7   ? 19.239  6.996   9.541   1.00  22.97 ? 22  THR B C      1 
ATOM   1794 O O      . THR B 2 7   ? 19.976  7.744   10.175  1.00  21.67 ? 22  THR B O      1 
ATOM   1795 C CB     . THR B 2 7   ? 18.016  4.804   10.450  1.00  22.70 ? 22  THR B CB     1 
ATOM   1796 O OG1    . THR B 2 7   ? 17.015  4.807   9.422   1.00  26.50 ? 22  THR B OG1    1 
ATOM   1797 C CG2    . THR B 2 7   ? 17.474  5.638   11.632  1.00  20.39 ? 22  THR B CG2    1 
ATOM   1798 H H      . THR B 2 7   ? 20.322  5.596   11.652  1.00  19.93 ? 22  THR B H      1 
ATOM   1799 H HA     . THR B 2 7   ? 19.529  4.940   8.847   1.00  22.69 ? 22  THR B HA     1 
ATOM   1800 H HB     . THR B 2 7   ? 18.221  3.789   10.767  1.00  22.38 ? 22  THR B HB     1 
ATOM   1801 H HG1    . THR B 2 7   ? 17.490  4.568   8.614   1.00  24.82 ? 22  THR B HG1    1 
ATOM   1802 H HG21   . THR B 2 7   ? 16.624  5.144   12.072  1.00  21.43 ? 22  THR B HG21   1 
ATOM   1803 H HG22   . THR B 2 7   ? 17.198  6.641   11.341  1.00  20.55 ? 22  THR B HG22   1 
ATOM   1804 H HG23   . THR B 2 7   ? 18.232  5.717   12.391  1.00  21.37 ? 22  THR B HG23   1 
ATOM   1805 N N      . SER B 2 8   ? 18.402  7.465   8.644   1.00  21.08 ? 23  SER B N      1 
ATOM   1806 C CA     . SER B 2 8   ? 18.301  8.916   8.364   1.00  21.61 ? 23  SER B CA     1 
ATOM   1807 C C      . SER B 2 8   ? 16.926  9.452   8.705   1.00  20.09 ? 23  SER B C      1 
ATOM   1808 O O      . SER B 2 8   ? 15.990  8.714   8.987   1.00  17.17 ? 23  SER B O      1 
ATOM   1809 C CB     . SER B 2 8   ? 18.605  9.160   6.863   1.00  23.94 ? 23  SER B CB     1 
ATOM   1810 O OG     . SER B 2 8   ? 17.991  8.054   6.221   1.00  27.46 ? 23  SER B OG     1 
ATOM   1811 H H      . SER B 2 8   ? 17.812  6.892   8.119   1.00  21.61 ? 23  SER B H      1 
ATOM   1812 H HA     . SER B 2 8   ? 19.023  9.447   8.964   1.00  22.59 ? 23  SER B HA     1 
ATOM   1813 H HB2    . SER B 2 8   ? 18.145  10.069  6.499   1.00  24.31 ? 23  SER B HB2    1 
ATOM   1814 H HB3    . SER B 2 8   ? 19.661  9.171   6.638   1.00  24.94 ? 23  SER B HB3    1 
ATOM   1815 H HG     . SER B 2 8   ? 17.330  8.413   5.600   1.00  25.85 ? 23  SER B HG     1 
ATOM   1816 N N      . LEU B 2 9   ? 16.902  10.759  8.660   1.00  19.69 ? 24  LEU B N      1 
ATOM   1817 C CA     . LEU B 2 9   ? 15.679  11.560  8.940   1.00  19.29 ? 24  LEU B CA     1 
ATOM   1818 C C      . LEU B 2 9   ? 14.524  11.161  8.024   1.00  16.03 ? 24  LEU B C      1 
ATOM   1819 O O      . LEU B 2 9   ? 14.750  10.956  6.846   1.00  15.55 ? 24  LEU B O      1 
ATOM   1820 C CB     . LEU B 2 9   ? 15.931  13.024  8.667   1.00  20.64 ? 24  LEU B CB     1 
ATOM   1821 C CG     . LEU B 2 9   ? 16.570  13.722  9.827   1.00  24.56 ? 24  LEU B CG     1 
ATOM   1822 C CD1    . LEU B 2 9   ? 17.126  15.056  9.297   1.00  27.75 ? 24  LEU B CD1    1 
ATOM   1823 C CD2    . LEU B 2 9   ? 15.463  14.032  10.898  1.00  23.89 ? 24  LEU B CD2    1 
ATOM   1824 H H      . LEU B 2 9   ? 17.727  11.232  8.433   1.00  20.15 ? 24  LEU B H      1 
ATOM   1825 H HA     . LEU B 2 9   ? 15.385  11.398  9.966   1.00  18.67 ? 24  LEU B HA     1 
ATOM   1826 H HB2    . LEU B 2 9   ? 16.545  13.104  7.779   1.00  21.69 ? 24  LEU B HB2    1 
ATOM   1827 H HB3    . LEU B 2 9   ? 14.993  13.513  8.436   1.00  21.73 ? 24  LEU B HB3    1 
ATOM   1828 H HG     . LEU B 2 9   ? 17.372  13.126  10.241  1.00  25.13 ? 24  LEU B HG     1 
ATOM   1829 H HD11   . LEU B 2 9   ? 16.338  15.657  8.860   1.00  26.03 ? 24  LEU B HD11   1 
ATOM   1830 H HD12   . LEU B 2 9   ? 17.869  14.854  8.539   1.00  26.10 ? 24  LEU B HD12   1 
ATOM   1831 H HD13   . LEU B 2 9   ? 17.596  15.624  10.089  1.00  26.37 ? 24  LEU B HD13   1 
ATOM   1832 H HD21   . LEU B 2 9   ? 15.912  14.564  11.719  1.00  23.56 ? 24  LEU B HD21   1 
ATOM   1833 H HD22   . LEU B 2 9   ? 15.003  13.133  11.284  1.00  23.52 ? 24  LEU B HD22   1 
ATOM   1834 H HD23   . LEU B 2 9   ? 14.683  14.657  10.481  1.00  23.36 ? 24  LEU B HD23   1 
ATOM   1835 N N      . GLY B 2 10  ? 13.354  11.067  8.597   1.00  20.43 ? 25  GLY B N      1 
ATOM   1836 C CA     . GLY B 2 10  ? 12.102  10.714  7.838   1.00  17.86 ? 25  GLY B CA     1 
ATOM   1837 C C      . GLY B 2 10  ? 11.838  9.267   7.535   1.00  18.86 ? 25  GLY B C      1 
ATOM   1838 O O      . GLY B 2 10  ? 10.787  8.934   7.024   1.00  18.63 ? 25  GLY B O      1 
ATOM   1839 H H      . GLY B 2 10  ? 13.277  11.233  9.564   1.00  18.19 ? 25  GLY B H      1 
ATOM   1840 H HA2    . GLY B 2 10  ? 11.267  11.068  8.423   1.00  18.37 ? 25  GLY B HA2    1 
ATOM   1841 H HA3    . GLY B 2 10  ? 12.099  11.263  6.909   1.00  18.19 ? 25  GLY B HA3    1 
ATOM   1842 N N      . ARG B 2 11  ? 12.771  8.428   7.847   1.00  17.18 ? 26  ARG B N      1 
ATOM   1843 C CA     . ARG B 2 11  ? 12.584  6.989   7.569   1.00  16.57 ? 26  ARG B CA     1 
ATOM   1844 C C      . ARG B 2 11  ? 11.647  6.296   8.565   1.00  12.96 ? 26  ARG B C      1 
ATOM   1845 O O      . ARG B 2 11  ? 10.829  5.485   8.186   1.00  14.71 ? 26  ARG B O      1 
ATOM   1846 C CB     . ARG B 2 11  ? 14.039  6.436   7.518   1.00  17.99 ? 26  ARG B CB     1 
ATOM   1847 C CG     . ARG B 2 11  ? 14.026  5.053   7.029   1.00  22.50 ? 26  ARG B CG     1 
ATOM   1848 C CD     . ARG B 2 11  ? 15.373  4.681   6.459   1.00  25.08 ? 26  ARG B CD     1 
ATOM   1849 N NE     . ARG B 2 11  ? 15.306  3.191   6.389   1.00  29.91 ? 26  ARG B NE     1 
ATOM   1850 C CZ     . ARG B 2 11  ? 15.128  2.529   5.267   1.00  34.41 ? 26  ARG B CZ     1 
ATOM   1851 N NH1    . ARG B 2 11  ? 14.725  3.141   4.178   1.00  32.39 ? 26  ARG B NH1    1 
ATOM   1852 N NH2    . ARG B 2 11  ? 15.362  1.240   5.290   1.00  36.22 ? 26  ARG B NH2    1 
ATOM   1853 H H      . ARG B 2 11  ? 13.596  8.755   8.263   1.00  18.15 ? 26  ARG B H      1 
ATOM   1854 H HA     . ARG B 2 11  ? 12.137  6.901   6.589   1.00  16.49 ? 26  ARG B HA     1 
ATOM   1855 H HB2    . ARG B 2 11  ? 14.628  7.054   6.851   1.00  18.39 ? 26  ARG B HB2    1 
ATOM   1856 H HB3    . ARG B 2 11  ? 14.487  6.448   8.501   1.00  18.71 ? 26  ARG B HB3    1 
ATOM   1857 H HG2    . ARG B 2 11  ? 13.773  4.390   7.843   1.00  22.42 ? 26  ARG B HG2    1 
ATOM   1858 H HG3    . ARG B 2 11  ? 13.282  4.930   6.253   1.00  22.08 ? 26  ARG B HG3    1 
ATOM   1859 H HD2    . ARG B 2 11  ? 15.526  5.103   5.474   1.00  26.13 ? 26  ARG B HD2    1 
ATOM   1860 H HD3    . ARG B 2 11  ? 16.177  4.988   7.110   1.00  25.85 ? 26  ARG B HD3    1 
ATOM   1861 H HE     . ARG B 2 11  ? 15.394  2.680   7.219   1.00  30.43 ? 26  ARG B HE     1 
ATOM   1862 H HH11   . ARG B 2 11  ? 14.597  2.615   3.336   1.00  32.61 ? 26  ARG B HH11   1 
ATOM   1863 H HH12   . ARG B 2 11  ? 14.544  4.126   4.185   1.00  32.36 ? 26  ARG B HH12   1 
ATOM   1864 H HH21   . ARG B 2 11  ? 15.668  0.803   6.136   1.00  35.43 ? 26  ARG B HH21   1 
ATOM   1865 H HH22   . ARG B 2 11  ? 15.235  0.692   4.463   1.00  35.91 ? 26  ARG B HH22   1 
ATOM   1866 N N      . TRP B 2 12  ? 11.765  6.612   9.810   1.00  13.55 ? 27  TRP B N      1 
ATOM   1867 C CA     . TRP B 2 12  ? 10.912  6.010   10.875  1.00  15.92 ? 27  TRP B CA     1 
ATOM   1868 C C      . TRP B 2 12  ? 10.335  7.205   11.657  1.00  15.02 ? 27  TRP B C      1 
ATOM   1869 O O      . TRP B 2 12  ? 10.709  7.438   12.793  1.00  12.35 ? 27  TRP B O      1 
ATOM   1870 C CB     . TRP B 2 12  ? 11.800  5.099   11.786  1.00  16.71 ? 27  TRP B CB     1 
ATOM   1871 C CG     . TRP B 2 12  ? 12.643  4.130   10.926  1.00  14.22 ? 27  TRP B CG     1 
ATOM   1872 C CD1    . TRP B 2 12  ? 13.983  4.230   10.796  1.00  15.69 ? 27  TRP B CD1    1 
ATOM   1873 C CD2    . TRP B 2 12  ? 12.204  3.061   10.198  1.00  14.68 ? 27  TRP B CD2    1 
ATOM   1874 N NE1    . TRP B 2 12  ? 14.271  3.227   10.010  1.00  12.96 ? 27  TRP B NE1    1 
ATOM   1875 C CE2    . TRP B 2 12  ? 13.285  2.450   9.584   1.00  14.63 ? 27  TRP B CE2    1 
ATOM   1876 C CE3    . TRP B 2 12  ? 10.908  2.539   9.996   1.00  12.93 ? 27  TRP B CE3    1 
ATOM   1877 C CZ2    . TRP B 2 12  ? 13.094  1.325   8.779   1.00  15.70 ? 27  TRP B CZ2    1 
ATOM   1878 C CZ3    . TRP B 2 12  ? 10.722  1.416   9.192   1.00  14.62 ? 27  TRP B CZ3    1 
ATOM   1879 C CH2    . TRP B 2 12  ? 11.814  0.803   8.582   1.00  14.81 ? 27  TRP B CH2    1 
ATOM   1880 H H      . TRP B 2 12  ? 12.435  7.278   10.049  1.00  15.78 ? 27  TRP B H      1 
ATOM   1881 H HA     . TRP B 2 12  ? 10.110  5.434   10.430  1.00  15.19 ? 27  TRP B HA     1 
ATOM   1882 H HB2    . TRP B 2 12  ? 12.459  5.702   12.394  1.00  16.39 ? 27  TRP B HB2    1 
ATOM   1883 H HB3    . TRP B 2 12  ? 11.162  4.529   12.449  1.00  15.98 ? 27  TRP B HB3    1 
ATOM   1884 H HD1    . TRP B 2 12  ? 14.655  4.953   11.227  1.00  14.82 ? 27  TRP B HD1    1 
ATOM   1885 H HE1    . TRP B 2 12  ? 15.197  3.081   9.748   1.00  14.59 ? 27  TRP B HE1    1 
ATOM   1886 H HE3    . TRP B 2 12  ? 10.060  3.015   10.461  1.00  11.54 ? 27  TRP B HE3    1 
ATOM   1887 H HZ2    . TRP B 2 12  ? 13.932  0.847   8.292   1.00  14.73 ? 27  TRP B HZ2    1 
ATOM   1888 H HZ3    . TRP B 2 12  ? 9.729   1.018   9.034   1.00  14.56 ? 27  TRP B HZ3    1 
ATOM   1889 H HH2    . TRP B 2 12  ? 11.664  -0.071  7.965   1.00  13.83 ? 27  TRP B HH2    1 
ATOM   1890 N N      . PRO B 2 13  ? 9.452   7.965   11.044  1.00  14.73 ? 28  PRO B N      1 
ATOM   1891 C CA     . PRO B 2 13  ? 8.975   9.275   11.620  1.00  14.44 ? 28  PRO B CA     1 
ATOM   1892 C C      . PRO B 2 13  ? 8.107   9.164   12.906  1.00  11.72 ? 28  PRO B C      1 
ATOM   1893 O O      . PRO B 2 13  ? 7.797   10.141  13.566  1.00  13.58 ? 28  PRO B O      1 
ATOM   1894 C CB     . PRO B 2 13  ? 8.285   9.919   10.411  1.00  14.12 ? 28  PRO B CB     1 
ATOM   1895 C CG     . PRO B 2 13  ? 7.663   8.692   9.674   1.00  15.14 ? 28  PRO B CG     1 
ATOM   1896 C CD     . PRO B 2 13  ? 8.828   7.654   9.725   1.00  14.05 ? 28  PRO B CD     1 
ATOM   1897 H HA     . PRO B 2 13  ? 9.841   9.870   11.874  1.00  14.69 ? 28  PRO B HA     1 
ATOM   1898 H HB2    . PRO B 2 13  ? 7.541   10.629  10.740  1.00  15.03 ? 28  PRO B HB2    1 
ATOM   1899 H HB3    . PRO B 2 13  ? 9.014   10.430  9.799   1.00  12.91 ? 28  PRO B HB3    1 
ATOM   1900 H HG2    . PRO B 2 13  ? 6.801   8.284   10.187  1.00  12.62 ? 28  PRO B HG2    1 
ATOM   1901 H HG3    . PRO B 2 13  ? 7.402   8.930   8.652   1.00  13.41 ? 28  PRO B HG3    1 
ATOM   1902 H HD2    . PRO B 2 13  ? 8.461   6.636   9.715   1.00  13.43 ? 28  PRO B HD2    1 
ATOM   1903 H HD3    . PRO B 2 13  ? 9.538   7.802   8.924   1.00  13.03 ? 28  PRO B HD3    1 
ATOM   1904 N N      . TRP B 2 14  ? 7.743   7.952   13.222  1.00  10.25 ? 29  TRP B N      1 
ATOM   1905 C CA     . TRP B 2 14  ? 6.919   7.674   14.436  1.00  9.88  ? 29  TRP B CA     1 
ATOM   1906 C C      . TRP B 2 14  ? 7.780   7.452   15.716  1.00  11.91 ? 29  TRP B C      1 
ATOM   1907 O O      . TRP B 2 14  ? 7.295   7.466   16.831  1.00  13.76 ? 29  TRP B O      1 
ATOM   1908 C CB     . TRP B 2 14  ? 6.064   6.412   14.220  1.00  9.91  ? 29  TRP B CB     1 
ATOM   1909 C CG     . TRP B 2 14  ? 6.752   5.293   13.425  1.00  12.71 ? 29  TRP B CG     1 
ATOM   1910 C CD1    . TRP B 2 14  ? 7.589   4.333   13.917  1.00  14.69 ? 29  TRP B CD1    1 
ATOM   1911 C CD2    . TRP B 2 14  ? 6.629   5.119   12.082  1.00  15.73 ? 29  TRP B CD2    1 
ATOM   1912 N NE1    . TRP B 2 14  ? 7.918   3.647   12.835  1.00  14.19 ? 29  TRP B NE1    1 
ATOM   1913 C CE2    . TRP B 2 14  ? 7.400   4.028   11.671  1.00  15.89 ? 29  TRP B CE2    1 
ATOM   1914 C CE3    . TRP B 2 14  ? 5.875   5.854   11.140  1.00  16.57 ? 29  TRP B CE3    1 
ATOM   1915 C CZ2    . TRP B 2 14  ? 7.410   3.690   10.312  1.00  15.76 ? 29  TRP B CZ2    1 
ATOM   1916 C CZ3    . TRP B 2 14  ? 5.888   5.514   9.798   1.00  16.31 ? 29  TRP B CZ3    1 
ATOM   1917 C CH2    . TRP B 2 14  ? 6.662   4.424   9.378   1.00  16.36 ? 29  TRP B CH2    1 
ATOM   1918 H H      . TRP B 2 14  ? 8.021   7.216   12.635  1.00  8.20  ? 29  TRP B H      1 
ATOM   1919 H HA     . TRP B 2 14  ? 6.284   8.529   14.609  1.00  11.64 ? 29  TRP B HA     1 
ATOM   1920 H HB2    . TRP B 2 14  ? 5.786   6.010   15.182  1.00  10.13 ? 29  TRP B HB2    1 
ATOM   1921 H HB3    . TRP B 2 14  ? 5.156   6.698   13.711  1.00  11.74 ? 29  TRP B HB3    1 
ATOM   1922 H HD1    . TRP B 2 14  ? 7.902   4.167   14.939  1.00  13.83 ? 29  TRP B HD1    1 
ATOM   1923 H HE1    . TRP B 2 14  ? 8.540   2.882   12.915  1.00  15.15 ? 29  TRP B HE1    1 
ATOM   1924 H HE3    . TRP B 2 14  ? 5.276   6.695   11.467  1.00  16.34 ? 29  TRP B HE3    1 
ATOM   1925 H HZ2    . TRP B 2 14  ? 8.000   2.852   9.969   1.00  15.52 ? 29  TRP B HZ2    1 
ATOM   1926 H HZ3    . TRP B 2 14  ? 5.309   6.088   9.089   1.00  16.05 ? 29  TRP B HZ3    1 
ATOM   1927 H HH2    . TRP B 2 14  ? 6.686   4.146   8.333   1.00  15.34 ? 29  TRP B HH2    1 
ATOM   1928 N N      . GLN B 2 15  ? 9.042   7.244   15.506  1.00  12.36 ? 30  GLN B N      1 
ATOM   1929 C CA     . GLN B 2 15  ? 9.993   7.008   16.649  1.00  12.43 ? 30  GLN B CA     1 
ATOM   1930 C C      . GLN B 2 15  ? 10.236  8.246   17.516  1.00  10.56 ? 30  GLN B C      1 
ATOM   1931 O O      . GLN B 2 15  ? 10.528  9.279   16.968  1.00  13.51 ? 30  GLN B O      1 
ATOM   1932 C CB     . GLN B 2 15  ? 11.374  6.559   16.087  1.00  13.28 ? 30  GLN B CB     1 
ATOM   1933 C CG     . GLN B 2 15  ? 12.480  6.433   17.162  1.00  10.60 ? 30  GLN B CG     1 
ATOM   1934 C CD     . GLN B 2 15  ? 12.396  5.137   17.934  1.00  12.90 ? 30  GLN B CD     1 
ATOM   1935 O OE1    . GLN B 2 15  ? 12.465  4.083   17.347  1.00  14.86 ? 30  GLN B OE1    1 
ATOM   1936 N NE2    . GLN B 2 15  ? 12.259  5.106   19.223  1.00  11.78 ? 30  GLN B NE2    1 
ATOM   1937 H H      . GLN B 2 15  ? 9.376   7.251   14.584  1.00  12.58 ? 30  GLN B H      1 
ATOM   1938 H HA     . GLN B 2 15  ? 9.571   6.229   17.275  1.00  12.44 ? 30  GLN B HA     1 
ATOM   1939 H HB2    . GLN B 2 15  ? 11.274  5.620   15.561  1.00  12.96 ? 30  GLN B HB2    1 
ATOM   1940 H HB3    . GLN B 2 15  ? 11.717  7.310   15.392  1.00  12.19 ? 30  GLN B HB3    1 
ATOM   1941 H HG2    . GLN B 2 15  ? 13.432  6.459   16.656  1.00  12.12 ? 30  GLN B HG2    1 
ATOM   1942 H HG3    . GLN B 2 15  ? 12.460  7.263   17.850  1.00  11.27 ? 30  GLN B HG3    1 
ATOM   1943 H HE21   . GLN B 2 15  ? 12.186  5.945   19.728  1.00  12.18 ? 30  GLN B HE21   1 
ATOM   1944 H HE22   . GLN B 2 15  ? 12.228  4.242   19.681  1.00  12.09 ? 30  GLN B HE22   1 
ATOM   1945 N N      . VAL B 2 16  ? 10.097  8.091   18.790  1.00  12.55 ? 31  VAL B N      1 
ATOM   1946 C CA     . VAL B 2 16  ? 10.354  9.214   19.722  1.00  15.41 ? 31  VAL B CA     1 
ATOM   1947 C C      . VAL B 2 16  ? 11.280  8.634   20.824  1.00  13.88 ? 31  VAL B C      1 
ATOM   1948 O O      . VAL B 2 16  ? 11.427  7.421   20.979  1.00  12.61 ? 31  VAL B O      1 
ATOM   1949 C CB     . VAL B 2 16  ? 9.007   9.770   20.392  1.00  14.45 ? 31  VAL B CB     1 
ATOM   1950 C CG1    . VAL B 2 16  ? 8.140   10.347  19.243  1.00  14.71 ? 31  VAL B CG1    1 
ATOM   1951 C CG2    . VAL B 2 16  ? 8.205   8.723   21.209  1.00  12.23 ? 31  VAL B CG2    1 
ATOM   1952 H H      . VAL B 2 16  ? 9.813   7.225   19.150  1.00  11.43 ? 31  VAL B H      1 
ATOM   1953 H HA     . VAL B 2 16  ? 10.889  9.993   19.193  1.00  15.20 ? 31  VAL B HA     1 
ATOM   1954 H HB     . VAL B 2 16  ? 9.263   10.582  21.057  1.00  14.93 ? 31  VAL B HB     1 
ATOM   1955 H HG11   . VAL B 2 16  ? 7.893   9.569   18.535  1.00  15.44 ? 31  VAL B HG11   1 
ATOM   1956 H HG12   . VAL B 2 16  ? 8.678   11.109  18.700  1.00  14.20 ? 31  VAL B HG12   1 
ATOM   1957 H HG13   . VAL B 2 16  ? 7.230   10.775  19.636  1.00  15.01 ? 31  VAL B HG13   1 
ATOM   1958 H HG21   . VAL B 2 16  ? 7.323   9.178   21.633  1.00  12.67 ? 31  VAL B HG21   1 
ATOM   1959 H HG22   . VAL B 2 16  ? 8.797   8.330   22.021  1.00  12.42 ? 31  VAL B HG22   1 
ATOM   1960 H HG23   . VAL B 2 16  ? 7.901   7.910   20.569  1.00  11.96 ? 31  VAL B HG23   1 
ATOM   1961 N N      . SER B 2 17  ? 11.869  9.530   21.556  1.00  13.37 ? 32  SER B N      1 
ATOM   1962 C CA     . SER B 2 17  ? 12.783  9.213   22.686  1.00  14.22 ? 32  SER B CA     1 
ATOM   1963 C C      . SER B 2 17  ? 12.063  9.804   23.934  1.00  12.26 ? 32  SER B C      1 
ATOM   1964 O O      . SER B 2 17  ? 11.621  10.949  23.915  1.00  13.23 ? 32  SER B O      1 
ATOM   1965 C CB     . SER B 2 17  ? 14.189  9.897   22.471  1.00  10.97 ? 32  SER B CB     1 
ATOM   1966 O OG     . SER B 2 17  ? 14.856  9.973   23.743  1.00  14.22 ? 32  SER B OG     1 
ATOM   1967 H H      . SER B 2 17  ? 11.694  10.475  21.346  1.00  15.39 ? 32  SER B H      1 
ATOM   1968 H HA     . SER B 2 17  ? 12.872  8.140   22.786  1.00  13.46 ? 32  SER B HA     1 
ATOM   1969 H HB2    . SER B 2 17  ? 14.802  9.333   21.786  1.00  12.18 ? 32  SER B HB2    1 
ATOM   1970 H HB3    . SER B 2 17  ? 14.068  10.893  22.078  1.00  12.56 ? 32  SER B HB3    1 
ATOM   1971 H HG     . SER B 2 17  ? 15.368  10.801  23.666  1.00  13.26 ? 32  SER B HG     1 
ATOM   1972 N N      . LEU B 2 18  ? 11.978  9.004   24.964  1.00  13.16 ? 33  LEU B N      1 
ATOM   1973 C CA     . LEU B 2 18  ? 11.343  9.397   26.250  1.00  15.75 ? 33  LEU B CA     1 
ATOM   1974 C C      . LEU B 2 18  ? 12.576  9.602   27.186  1.00  16.75 ? 33  LEU B C      1 
ATOM   1975 O O      . LEU B 2 18  ? 13.350  8.682   27.448  1.00  14.14 ? 33  LEU B O      1 
ATOM   1976 C CB     . LEU B 2 18  ? 10.445  8.278   26.855  1.00  17.36 ? 33  LEU B CB     1 
ATOM   1977 C CG     . LEU B 2 18  ? 9.309   7.843   25.885  1.00  22.99 ? 33  LEU B CG     1 
ATOM   1978 C CD1    . LEU B 2 18  ? 8.421   6.812   26.595  1.00  24.40 ? 33  LEU B CD1    1 
ATOM   1979 C CD2    . LEU B 2 18  ? 8.470   9.046   25.501  1.00  26.02 ? 33  LEU B CD2    1 
ATOM   1980 H H      . LEU B 2 18  ? 12.344  8.100   24.901  1.00  13.90 ? 33  LEU B H      1 
ATOM   1981 H HA     . LEU B 2 18  ? 10.806  10.328  26.129  1.00  16.87 ? 33  LEU B HA     1 
ATOM   1982 H HB2    . LEU B 2 18  ? 11.063  7.424   27.089  1.00  18.39 ? 33  LEU B HB2    1 
ATOM   1983 H HB3    . LEU B 2 18  ? 10.020  8.648   27.778  1.00  17.53 ? 33  LEU B HB3    1 
ATOM   1984 H HG     . LEU B 2 18  ? 9.735   7.397   24.993  1.00  22.51 ? 33  LEU B HG     1 
ATOM   1985 H HD11   . LEU B 2 18  ? 7.977   7.221   27.492  1.00  23.83 ? 33  LEU B HD11   1 
ATOM   1986 H HD12   . LEU B 2 18  ? 8.994   5.933   26.867  1.00  24.17 ? 33  LEU B HD12   1 
ATOM   1987 H HD13   . LEU B 2 18  ? 7.630   6.484   25.939  1.00  24.83 ? 33  LEU B HD13   1 
ATOM   1988 H HD21   . LEU B 2 18  ? 7.670   8.749   24.838  1.00  26.56 ? 33  LEU B HD21   1 
ATOM   1989 H HD22   . LEU B 2 18  ? 9.072   9.776   24.974  1.00  25.70 ? 33  LEU B HD22   1 
ATOM   1990 H HD23   . LEU B 2 18  ? 8.041   9.501   26.384  1.00  25.51 ? 33  LEU B HD23   1 
ATOM   1991 N N      . ARG B 2 19  ? 12.709  10.817  27.638  1.00  17.16 ? 34  ARG B N      1 
ATOM   1992 C CA     . ARG B 2 19  ? 13.842  11.205  28.556  1.00  20.12 ? 34  ARG B CA     1 
ATOM   1993 C C      . ARG B 2 19  ? 13.341  11.598  29.946  1.00  19.58 ? 34  ARG B C      1 
ATOM   1994 O O      . ARG B 2 19  ? 12.322  12.258  30.031  1.00  19.10 ? 34  ARG B O      1 
ATOM   1995 C CB     . ARG B 2 19  ? 14.567  12.395  27.974  1.00  21.33 ? 34  ARG B CB     1 
ATOM   1996 C CG     . ARG B 2 19  ? 15.101  12.060  26.593  1.00  23.48 ? 34  ARG B CG     1 
ATOM   1997 C CD     . ARG B 2 19  ? 15.388  13.367  25.906  1.00  27.88 ? 34  ARG B CD     1 
ATOM   1998 N NE     . ARG B 2 19  ? 15.772  13.048  24.498  1.00  32.75 ? 34  ARG B NE     1 
ATOM   1999 C CZ     . ARG B 2 19  ? 16.761  13.641  23.867  1.00  34.87 ? 34  ARG B CZ     1 
ATOM   2000 N NH1    . ARG B 2 19  ? 17.191  14.822  24.231  1.00  35.98 ? 34  ARG B NH1    1 
ATOM   2001 N NH2    . ARG B 2 19  ? 17.288  13.003  22.860  1.00  36.98 ? 34  ARG B NH2    1 
ATOM   2002 H H      . ARG B 2 19  ? 12.051  11.501  27.381  1.00  17.56 ? 34  ARG B H      1 
ATOM   2003 H HA     . ARG B 2 19  ? 14.497  10.356  28.648  1.00  21.08 ? 34  ARG B HA     1 
ATOM   2004 H HB2    . ARG B 2 19  ? 13.874  13.226  27.951  1.00  21.96 ? 34  ARG B HB2    1 
ATOM   2005 H HB3    . ARG B 2 19  ? 15.376  12.669  28.639  1.00  22.29 ? 34  ARG B HB3    1 
ATOM   2006 H HG2    . ARG B 2 19  ? 16.014  11.493  26.682  1.00  24.23 ? 34  ARG B HG2    1 
ATOM   2007 H HG3    . ARG B 2 19  ? 14.381  11.494  26.019  1.00  24.82 ? 34  ARG B HG3    1 
ATOM   2008 H HD2    . ARG B 2 19  ? 14.515  14.007  25.897  1.00  28.42 ? 34  ARG B HD2    1 
ATOM   2009 H HD3    . ARG B 2 19  ? 16.196  13.893  26.399  1.00  28.70 ? 34  ARG B HD3    1 
ATOM   2010 H HE     . ARG B 2 19  ? 15.261  12.358  24.023  1.00  32.78 ? 34  ARG B HE     1 
ATOM   2011 H HH11   . ARG B 2 19  ? 17.950  15.250  23.740  1.00  35.83 ? 34  ARG B HH11   1 
ATOM   2012 H HH12   . ARG B 2 19  ? 16.763  15.299  24.998  1.00  35.83 ? 34  ARG B HH12   1 
ATOM   2013 H HH21   . ARG B 2 19  ? 16.912  12.114  22.612  1.00  35.89 ? 34  ARG B HH21   1 
ATOM   2014 H HH22   . ARG B 2 19  ? 18.050  13.396  22.345  1.00  36.58 ? 34  ARG B HH22   1 
ATOM   2015 N N      . TYR B 2 20  ? 14.053  11.213  30.980  1.00  18.55 ? 35  TYR B N      1 
ATOM   2016 C CA     . TYR B 2 20  ? 13.644  11.551  32.374  1.00  20.93 ? 35  TYR B CA     1 
ATOM   2017 C C      . TYR B 2 20  ? 14.819  12.341  32.918  1.00  21.57 ? 35  TYR B C      1 
ATOM   2018 O O      . TYR B 2 20  ? 15.932  11.873  32.820  1.00  19.39 ? 35  TYR B O      1 
ATOM   2019 C CB     . TYR B 2 20  ? 13.469  10.302  33.227  1.00  21.40 ? 35  TYR B CB     1 
ATOM   2020 C CG     . TYR B 2 20  ? 12.812  10.618  34.572  1.00  23.26 ? 35  TYR B CG     1 
ATOM   2021 C CD1    . TYR B 2 20  ? 11.507  11.005  34.594  1.00  25.29 ? 35  TYR B CD1    1 
ATOM   2022 C CD2    . TYR B 2 20  ? 13.466  10.500  35.781  1.00  26.16 ? 35  TYR B CD2    1 
ATOM   2023 C CE1    . TYR B 2 20  ? 10.838  11.267  35.763  1.00  26.94 ? 35  TYR B CE1    1 
ATOM   2024 C CE2    . TYR B 2 20  ? 12.791  10.765  36.971  1.00  27.59 ? 35  TYR B CE2    1 
ATOM   2025 C CZ     . TYR B 2 20  ? 11.460  11.149  36.968  1.00  28.29 ? 35  TYR B CZ     1 
ATOM   2026 O OH     . TYR B 2 20  ? 10.726  11.379  38.121  1.00  34.80 ? 35  TYR B OH     1 
ATOM   2027 H H      . TYR B 2 20  ? 14.880  10.699  30.835  1.00  18.32 ? 35  TYR B H      1 
ATOM   2028 H HA     . TYR B 2 20  ? 12.753  12.163  32.360  1.00  21.96 ? 35  TYR B HA     1 
ATOM   2029 H HB2    . TYR B 2 20  ? 12.832  9.605   32.704  1.00  21.93 ? 35  TYR B HB2    1 
ATOM   2030 H HB3    . TYR B 2 20  ? 14.434  9.848   33.393  1.00  22.25 ? 35  TYR B HB3    1 
ATOM   2031 H HD1    . TYR B 2 20  ? 10.973  11.115  33.661  1.00  26.18 ? 35  TYR B HD1    1 
ATOM   2032 H HD2    . TYR B 2 20  ? 14.506  10.204  35.813  1.00  24.85 ? 35  TYR B HD2    1 
ATOM   2033 H HE1    . TYR B 2 20  ? 9.802   11.574  35.718  1.00  26.54 ? 35  TYR B HE1    1 
ATOM   2034 H HE2    . TYR B 2 20  ? 13.327  10.662  37.907  1.00  26.87 ? 35  TYR B HE2    1 
ATOM   2035 H HH     . TYR B 2 20  ? 11.186  10.915  38.834  1.00  33.17 ? 35  TYR B HH     1 
ATOM   2036 N N      . ASP B 2 21  ? 14.575  13.479  33.477  1.00  19.58 ? 37  ASP B N      1 
ATOM   2037 C CA     . ASP B 2 21  ? 15.679  14.332  34.040  1.00  23.90 ? 37  ASP B CA     1 
ATOM   2038 C C      . ASP B 2 21  ? 16.921  14.404  33.136  1.00  22.31 ? 37  ASP B C      1 
ATOM   2039 O O      . ASP B 2 21  ? 18.050  14.297  33.590  1.00  24.28 ? 37  ASP B O      1 
ATOM   2040 C CB     . ASP B 2 21  ? 16.157  13.799  35.425  1.00  22.40 ? 37  ASP B CB     1 
ATOM   2041 C CG     . ASP B 2 21  ? 15.242  14.113  36.580  1.00  24.85 ? 37  ASP B CG     1 
ATOM   2042 O OD1    . ASP B 2 21  ? 14.541  15.095  36.470  1.00  27.52 ? 37  ASP B OD1    1 
ATOM   2043 O OD2    . ASP B 2 21  ? 15.299  13.355  37.531  1.00  31.71 ? 37  ASP B OD2    1 
ATOM   2044 H H      . ASP B 2 21  ? 13.643  13.790  33.529  1.00  20.98 ? 37  ASP B H      1 
ATOM   2045 H HA     . ASP B 2 21  ? 15.301  15.339  34.152  1.00  22.54 ? 37  ASP B HA     1 
ATOM   2046 H HB2    . ASP B 2 21  ? 16.260  12.728  35.356  1.00  23.59 ? 37  ASP B HB2    1 
ATOM   2047 H HB3    . ASP B 2 21  ? 17.122  14.220  35.665  1.00  24.15 ? 37  ASP B HB3    1 
ATOM   2048 N N      . GLY B 2 22  ? 16.680  14.567  31.872  1.00  20.29 ? 38  GLY B N      1 
ATOM   2049 C CA     . GLY B 2 22  ? 17.801  14.670  30.926  1.00  21.50 ? 38  GLY B CA     1 
ATOM   2050 C C      . GLY B 2 22  ? 18.311  13.414  30.296  1.00  22.34 ? 38  GLY B C      1 
ATOM   2051 O O      . GLY B 2 22  ? 19.019  13.530  29.321  1.00  26.65 ? 38  GLY B O      1 
ATOM   2052 H H      . GLY B 2 22  ? 15.762  14.623  31.530  1.00  22.17 ? 38  GLY B H      1 
ATOM   2053 H HA2    . GLY B 2 22  ? 17.492  15.327  30.127  1.00  21.47 ? 38  GLY B HA2    1 
ATOM   2054 H HA3    . GLY B 2 22  ? 18.634  15.143  31.425  1.00  21.58 ? 38  GLY B HA3    1 
ATOM   2055 N N      . ALA B 2 23  ? 17.996  12.248  30.779  1.00  23.30 ? 39  ALA B N      1 
ATOM   2056 C CA     . ALA B 2 23  ? 18.577  11.046  30.081  1.00  24.01 ? 39  ALA B CA     1 
ATOM   2057 C C      . ALA B 2 23  ? 17.549  10.247  29.286  1.00  20.25 ? 39  ALA B C      1 
ATOM   2058 O O      . ALA B 2 23  ? 16.406  10.169  29.674  1.00  19.53 ? 39  ALA B O      1 
ATOM   2059 C CB     . ALA B 2 23  ? 19.211  10.110  31.118  1.00  25.94 ? 39  ALA B CB     1 
ATOM   2060 H H      . ALA B 2 23  ? 17.401  12.155  31.557  1.00  22.89 ? 39  ALA B H      1 
ATOM   2061 H HA     . ALA B 2 23  ? 19.361  11.365  29.408  1.00  23.65 ? 39  ALA B HA     1 
ATOM   2062 H HB1    . ALA B 2 23  ? 19.637  9.252   30.625  1.00  25.24 ? 39  ALA B HB1    1 
ATOM   2063 H HB2    . ALA B 2 23  ? 18.460  9.768   31.817  1.00  25.16 ? 39  ALA B HB2    1 
ATOM   2064 H HB3    . ALA B 2 23  ? 19.990  10.630  31.651  1.00  26.18 ? 39  ALA B HB3    1 
ATOM   2065 N N      . HIS B 2 24  ? 18.014  9.672   28.219  1.00  20.58 ? 40  HIS B N      1 
ATOM   2066 C CA     . HIS B 2 24  ? 17.145  8.853   27.332  1.00  19.44 ? 40  HIS B CA     1 
ATOM   2067 C C      . HIS B 2 24  ? 16.996  7.541   28.057  1.00  18.62 ? 40  HIS B C      1 
ATOM   2068 O O      . HIS B 2 24  ? 17.979  6.876   28.348  1.00  18.03 ? 40  HIS B O      1 
ATOM   2069 C CB     . HIS B 2 24  ? 17.830  8.606   25.930  1.00  20.72 ? 40  HIS B CB     1 
ATOM   2070 C CG     . HIS B 2 24  ? 17.069  7.490   25.169  1.00  22.28 ? 40  HIS B CG     1 
ATOM   2071 N ND1    . HIS B 2 24  ? 16.047  7.649   24.354  1.00  21.56 ? 40  HIS B ND1    1 
ATOM   2072 C CD2    . HIS B 2 24  ? 17.319  6.116   25.225  1.00  20.90 ? 40  HIS B CD2    1 
ATOM   2073 C CE1    . HIS B 2 24  ? 15.672  6.484   23.924  1.00  21.41 ? 40  HIS B CE1    1 
ATOM   2074 N NE2    . HIS B 2 24  ? 16.430  5.564   24.442  1.00  20.80 ? 40  HIS B NE2    1 
ATOM   2075 H H      . HIS B 2 24  ? 18.965  9.781   28.006  1.00  20.22 ? 40  HIS B H      1 
ATOM   2076 H HA     . HIS B 2 24  ? 16.178  9.330   27.246  1.00  19.29 ? 40  HIS B HA     1 
ATOM   2077 H HB2    . HIS B 2 24  ? 17.839  9.513   25.342  1.00  21.39 ? 40  HIS B HB2    1 
ATOM   2078 H HB3    . HIS B 2 24  ? 18.856  8.290   26.066  1.00  21.88 ? 40  HIS B HB3    1 
ATOM   2079 H HD1    . HIS B 2 24  ? 15.623  8.508   24.104  1.00  21.28 ? 40  HIS B HD1    1 
ATOM   2080 H HD2    . HIS B 2 24  ? 18.086  5.615   25.800  1.00  20.84 ? 40  HIS B HD2    1 
ATOM   2081 H HE1    . HIS B 2 24  ? 14.852  6.305   23.239  1.00  20.42 ? 40  HIS B HE1    1 
ATOM   2082 H HE2    . HIS B 2 24  ? 16.344  4.588   24.272  1.00  21.86 ? 40  HIS B HE2    1 
ATOM   2083 N N      . LEU B 2 25  ? 15.777  7.206   28.326  1.00  17.60 ? 41  LEU B N      1 
ATOM   2084 C CA     . LEU B 2 25  ? 15.493  5.925   29.040  1.00  19.39 ? 41  LEU B CA     1 
ATOM   2085 C C      . LEU B 2 25  ? 14.739  4.942   28.162  1.00  19.67 ? 41  LEU B C      1 
ATOM   2086 O O      . LEU B 2 25  ? 15.052  3.766   28.168  1.00  20.63 ? 41  LEU B O      1 
ATOM   2087 C CB     A LEU B 2 25  ? 14.650  6.212   30.353  0.42  20.52 ? 41  LEU B CB     1 
ATOM   2088 C CB     B LEU B 2 25  ? 14.643  6.182   30.326  0.49  19.03 ? 41  LEU B CB     1 
ATOM   2089 C CG     A LEU B 2 25  ? 15.554  6.563   31.612  0.42  22.33 ? 41  LEU B CG     1 
ATOM   2090 C CG     B LEU B 2 25  ? 15.418  7.058   31.367  0.49  19.87 ? 41  LEU B CG     1 
ATOM   2091 C CD1    A LEU B 2 25  ? 16.500  7.754   31.395  0.42  22.63 ? 41  LEU B CD1    1 
ATOM   2092 C CD1    B LEU B 2 25  ? 14.569  7.193   32.618  0.49  20.76 ? 41  LEU B CD1    1 
ATOM   2093 C CD2    A LEU B 2 25  ? 14.671  6.976   32.786  0.42  22.77 ? 41  LEU B CD2    1 
ATOM   2094 C CD2    B LEU B 2 25  ? 16.759  6.386   31.796  0.49  17.90 ? 41  LEU B CD2    1 
ATOM   2095 H H      . LEU B 2 25  ? 15.041  7.802   28.061  1.00  17.88 ? 41  LEU B H      1 
ATOM   2096 H HA     . LEU B 2 25  ? 16.427  5.456   29.309  1.00  19.95 ? 41  LEU B HA     1 
ATOM   2097 H HB2    A LEU B 2 25  ? 13.944  7.009   30.165  0.42  20.88 ? 41  LEU B HB2    1 
ATOM   2098 H HB2    B LEU B 2 25  ? 13.717  6.668   30.051  0.49  19.20 ? 41  LEU B HB2    1 
ATOM   2099 H HB3    A LEU B 2 25  ? 14.080  5.322   30.586  0.42  20.78 ? 41  LEU B HB3    1 
ATOM   2100 H HB3    B LEU B 2 25  ? 14.390  5.228   30.769  0.49  18.97 ? 41  LEU B HB3    1 
ATOM   2101 H HG     A LEU B 2 25  ? 16.125  5.691   31.906  0.42  21.86 ? 41  LEU B HG     1 
ATOM   2102 H HG     B LEU B 2 25  ? 15.607  8.046   30.964  0.49  19.33 ? 41  LEU B HG     1 
ATOM   2103 H HD11   A LEU B 2 25  ? 15.928  8.643   31.188  0.42  22.57 ? 41  LEU B HD11   1 
ATOM   2104 H HD11   B LEU B 2 25  ? 14.373  6.226   33.059  0.49  20.78 ? 41  LEU B HD11   1 
ATOM   2105 H HD12   A LEU B 2 25  ? 17.192  7.572   30.589  0.42  22.80 ? 41  LEU B HD12   1 
ATOM   2106 H HD12   B LEU B 2 25  ? 13.619  7.654   32.388  0.49  20.76 ? 41  LEU B HD12   1 
ATOM   2107 H HD13   A LEU B 2 25  ? 17.078  7.925   32.293  0.42  22.84 ? 41  LEU B HD13   1 
ATOM   2108 H HD13   B LEU B 2 25  ? 15.084  7.797   33.353  0.49  20.68 ? 41  LEU B HD13   1 
ATOM   2109 H HD21   A LEU B 2 25  ? 15.276  7.252   33.639  0.42  22.70 ? 41  LEU B HD21   1 
ATOM   2110 H HD21   B LEU B 2 25  ? 17.252  7.003   32.535  0.49  18.45 ? 41  LEU B HD21   1 
ATOM   2111 H HD22   A LEU B 2 25  ? 14.031  6.171   33.097  0.42  22.97 ? 41  LEU B HD22   1 
ATOM   2112 H HD22   B LEU B 2 25  ? 17.435  6.280   30.961  0.49  18.29 ? 41  LEU B HD22   1 
ATOM   2113 H HD23   A LEU B 2 25  ? 14.046  7.814   32.516  0.42  22.89 ? 41  LEU B HD23   1 
ATOM   2114 H HD23   B LEU B 2 25  ? 16.582  5.412   32.229  0.49  18.17 ? 41  LEU B HD23   1 
ATOM   2115 N N      . CYS B 2 26  ? 13.777  5.422   27.435  1.00  19.25 ? 42  CYS B N      1 
ATOM   2116 C CA     . CYS B 2 26  ? 12.978  4.516   26.553  1.00  14.66 ? 42  CYS B CA     1 
ATOM   2117 C C      . CYS B 2 26  ? 12.631  5.093   25.210  1.00  14.09 ? 42  CYS B C      1 
ATOM   2118 O O      . CYS B 2 26  ? 12.737  6.283   24.966  1.00  16.63 ? 42  CYS B O      1 
ATOM   2119 C CB     . CYS B 2 26  ? 11.732  4.189   27.308  1.00  14.39 ? 42  CYS B CB     1 
ATOM   2120 S SG     . CYS B 2 26  ? 11.865  2.967   28.622  1.00  19.92 ? 42  CYS B SG     1 
ATOM   2121 H H      . CYS B 2 26  ? 13.564  6.378   27.455  1.00  19.16 ? 42  CYS B H      1 
ATOM   2122 H HA     . CYS B 2 26  ? 13.524  3.597   26.390  1.00  14.87 ? 42  CYS B HA     1 
ATOM   2123 H HB2    . CYS B 2 26  ? 11.332  5.096   27.735  1.00  15.60 ? 42  CYS B HB2    1 
ATOM   2124 H HB3    . CYS B 2 26  ? 10.985  3.822   26.618  1.00  16.86 ? 42  CYS B HB3    1 
ATOM   2125 N N      . GLY B 2 27  ? 12.215  4.212   24.369  1.00  13.83 ? 43  GLY B N      1 
ATOM   2126 C CA     . GLY B 2 27  ? 11.803  4.592   23.012  1.00  13.01 ? 43  GLY B CA     1 
ATOM   2127 C C      . GLY B 2 27  ? 10.242  4.598   23.119  1.00  12.14 ? 43  GLY B C      1 
ATOM   2128 O O      . GLY B 2 27  ? 9.651   4.230   24.121  1.00  11.05 ? 43  GLY B O      1 
ATOM   2129 H H      . GLY B 2 27  ? 12.161  3.274   24.653  1.00  12.78 ? 43  GLY B H      1 
ATOM   2130 H HA2    . GLY B 2 27  ? 12.166  5.579   22.762  1.00  13.29 ? 43  GLY B HA2    1 
ATOM   2131 H HA3    . GLY B 2 27  ? 12.134  3.847   22.307  1.00  13.58 ? 43  GLY B HA3    1 
ATOM   2132 N N      . GLY B 2 28  ? 9.599   5.030   22.080  1.00  13.17 ? 44  GLY B N      1 
ATOM   2133 C CA     . GLY B 2 28  ? 8.114   5.076   22.061  1.00  14.39 ? 44  GLY B CA     1 
ATOM   2134 C C      . GLY B 2 28  ? 7.733   5.270   20.594  1.00  13.15 ? 44  GLY B C      1 
ATOM   2135 O O      . GLY B 2 28  ? 8.601   5.605   19.783  1.00  13.24 ? 44  GLY B O      1 
ATOM   2136 H H      . GLY B 2 28  ? 10.064  5.342   21.273  1.00  12.81 ? 44  GLY B H      1 
ATOM   2137 H HA2    . GLY B 2 28  ? 7.715   4.147   22.445  1.00  13.70 ? 44  GLY B HA2    1 
ATOM   2138 H HA3    . GLY B 2 28  ? 7.771   5.913   22.649  1.00  13.17 ? 44  GLY B HA3    1 
ATOM   2139 N N      . SER B 2 29  ? 6.459   5.054   20.302  1.00  15.37 ? 45  SER B N      1 
ATOM   2140 C CA     . SER B 2 29  ? 5.921   5.208   18.916  1.00  13.35 ? 45  SER B CA     1 
ATOM   2141 C C      . SER B 2 29  ? 4.689   6.142   18.946  1.00  10.78 ? 45  SER B C      1 
ATOM   2142 O O      . SER B 2 29  ? 3.819   5.984   19.779  1.00  11.41 ? 45  SER B O      1 
ATOM   2143 C CB     . SER B 2 29  ? 5.470   3.857   18.345  1.00  13.86 ? 45  SER B CB     1 
ATOM   2144 O OG     . SER B 2 29  ? 6.664   3.100   18.281  1.00  17.33 ? 45  SER B OG     1 
ATOM   2145 H H      . SER B 2 29  ? 5.837   4.778   21.008  1.00  13.83 ? 45  SER B H      1 
ATOM   2146 H HA     . SER B 2 29  ? 6.690   5.644   18.291  1.00  14.51 ? 45  SER B HA     1 
ATOM   2147 H HB2    . SER B 2 29  ? 4.747   3.367   18.983  1.00  14.32 ? 45  SER B HB2    1 
ATOM   2148 H HB3    . SER B 2 29  ? 5.071   3.981   17.350  1.00  14.56 ? 45  SER B HB3    1 
ATOM   2149 H HG     . SER B 2 29  ? 6.596   2.422   18.978  1.00  15.76 ? 45  SER B HG     1 
ATOM   2150 N N      . LEU B 2 30  ? 4.655   7.074   18.049  1.00  12.96 ? 46  LEU B N      1 
ATOM   2151 C CA     . LEU B 2 30  ? 3.515   8.019   17.985  1.00  14.64 ? 46  LEU B CA     1 
ATOM   2152 C C      . LEU B 2 30  ? 2.334   7.314   17.328  1.00  12.64 ? 46  LEU B C      1 
ATOM   2153 O O      . LEU B 2 30  ? 2.487   6.691   16.290  1.00  14.73 ? 46  LEU B O      1 
ATOM   2154 C CB     . LEU B 2 30  ? 3.803   9.212   17.096  1.00  17.18 ? 46  LEU B CB     1 
ATOM   2155 C CG     . LEU B 2 30  ? 4.790   10.149  17.727  1.00  20.09 ? 46  LEU B CG     1 
ATOM   2156 C CD1    . LEU B 2 30  ? 5.354   11.029  16.593  1.00  22.17 ? 46  LEU B CD1    1 
ATOM   2157 C CD2    . LEU B 2 30  ? 4.017   11.034  18.753  1.00  17.99 ? 46  LEU B CD2    1 
ATOM   2158 H H      . LEU B 2 30  ? 5.393   7.161   17.410  1.00  13.07 ? 46  LEU B H      1 
ATOM   2159 H HA     . LEU B 2 30  ? 3.253   8.323   18.988  1.00  13.67 ? 46  LEU B HA     1 
ATOM   2160 H HB2    . LEU B 2 30  ? 4.177   8.843   16.152  1.00  16.52 ? 46  LEU B HB2    1 
ATOM   2161 H HB3    . LEU B 2 30  ? 2.884   9.749   16.895  1.00  16.75 ? 46  LEU B HB3    1 
ATOM   2162 H HG     . LEU B 2 30  ? 5.586   9.591   18.201  1.00  19.96 ? 46  LEU B HG     1 
ATOM   2163 H HD11   . LEU B 2 30  ? 4.562   11.575  16.097  1.00  21.04 ? 46  LEU B HD11   1 
ATOM   2164 H HD12   . LEU B 2 30  ? 5.876   10.430  15.858  1.00  20.95 ? 46  LEU B HD12   1 
ATOM   2165 H HD13   . LEU B 2 30  ? 6.067   11.735  16.997  1.00  22.12 ? 46  LEU B HD13   1 
ATOM   2166 H HD21   . LEU B 2 30  ? 4.694   11.709  19.254  1.00  18.32 ? 46  LEU B HD21   1 
ATOM   2167 H HD22   . LEU B 2 30  ? 3.533   10.427  19.503  1.00  17.98 ? 46  LEU B HD22   1 
ATOM   2168 H HD23   . LEU B 2 30  ? 3.248   11.619  18.267  1.00  18.54 ? 46  LEU B HD23   1 
ATOM   2169 N N      . LEU B 2 31  ? 1.214   7.458   17.969  1.00  16.15 ? 47  LEU B N      1 
ATOM   2170 C CA     . LEU B 2 31  ? -0.059  6.866   17.483  1.00  15.90 ? 47  LEU B CA     1 
ATOM   2171 C C      . LEU B 2 31  ? -0.818  8.072   16.871  1.00  18.57 ? 47  LEU B C      1 
ATOM   2172 O O      . LEU B 2 31  ? -1.659  7.888   16.002  1.00  16.83 ? 47  LEU B O      1 
ATOM   2173 C CB     . LEU B 2 31  ? -0.879  6.279   18.630  1.00  16.74 ? 47  LEU B CB     1 
ATOM   2174 C CG     . LEU B 2 31  ? -0.323  4.915   19.140  1.00  17.85 ? 47  LEU B CG     1 
ATOM   2175 C CD1    . LEU B 2 31  ? -1.411  4.335   20.055  1.00  18.47 ? 47  LEU B CD1    1 
ATOM   2176 C CD2    . LEU B 2 31  ? -0.006  3.917   17.994  1.00  19.80 ? 47  LEU B CD2    1 
ATOM   2177 H H      . LEU B 2 31  ? 1.225   7.976   18.804  1.00  15.04 ? 47  LEU B H      1 
ATOM   2178 H HA     . LEU B 2 31  ? 0.144   6.153   16.697  1.00  16.63 ? 47  LEU B HA     1 
ATOM   2179 H HB2    . LEU B 2 31  ? -0.900  6.987   19.446  1.00  15.93 ? 47  LEU B HB2    1 
ATOM   2180 H HB3    . LEU B 2 31  ? -1.894  6.155   18.277  1.00  16.90 ? 47  LEU B HB3    1 
ATOM   2181 H HG     . LEU B 2 31  ? 0.579   5.086   19.711  1.00  18.28 ? 47  LEU B HG     1 
ATOM   2182 H HD11   . LEU B 2 31  ? -2.328  4.172   19.508  1.00  18.80 ? 47  LEU B HD11   1 
ATOM   2183 H HD12   . LEU B 2 31  ? -1.629  5.008   20.873  1.00  17.81 ? 47  LEU B HD12   1 
ATOM   2184 H HD13   . LEU B 2 31  ? -1.095  3.388   20.468  1.00  18.49 ? 47  LEU B HD13   1 
ATOM   2185 H HD21   . LEU B 2 31  ? 0.349   2.981   18.401  1.00  18.99 ? 47  LEU B HD21   1 
ATOM   2186 H HD22   . LEU B 2 31  ? 0.764   4.301   17.342  1.00  18.22 ? 47  LEU B HD22   1 
ATOM   2187 H HD23   . LEU B 2 31  ? -0.879  3.708   17.390  1.00  18.64 ? 47  LEU B HD23   1 
ATOM   2188 N N      . SER B 2 32  ? -0.529  9.259   17.343  1.00  15.22 ? 48  SER B N      1 
ATOM   2189 C CA     . SER B 2 32  ? -1.173  10.523  16.828  1.00  17.78 ? 48  SER B CA     1 
ATOM   2190 C C      . SER B 2 32  ? -0.213  11.661  17.229  1.00  18.97 ? 48  SER B C      1 
ATOM   2191 O O      . SER B 2 32  ? 0.842   11.396  17.758  1.00  17.87 ? 48  SER B O      1 
ATOM   2192 C CB     . SER B 2 32  ? -2.604  10.771  17.469  1.00  14.70 ? 48  SER B CB     1 
ATOM   2193 O OG     . SER B 2 32  ? -2.433  10.890  18.878  1.00  16.68 ? 48  SER B OG     1 
ATOM   2194 H H      . SER B 2 32  ? 0.134   9.367   18.059  1.00  16.29 ? 48  SER B H      1 
ATOM   2195 H HA     . SER B 2 32  ? -1.235  10.478  15.750  1.00  15.38 ? 48  SER B HA     1 
ATOM   2196 H HB2    . SER B 2 32  ? -3.031  11.687  17.085  1.00  15.50 ? 48  SER B HB2    1 
ATOM   2197 H HB3    . SER B 2 32  ? -3.277  9.958   17.236  1.00  15.30 ? 48  SER B HB3    1 
ATOM   2198 H HG     . SER B 2 32  ? -3.005  10.214  19.261  1.00  16.81 ? 48  SER B HG     1 
ATOM   2199 N N      . GLY B 2 33  ? -0.579  12.880  16.997  1.00  20.08 ? 49  GLY B N      1 
ATOM   2200 C CA     . GLY B 2 33  ? 0.301   14.015  17.365  1.00  20.65 ? 49  GLY B CA     1 
ATOM   2201 C C      . GLY B 2 33  ? 0.401   14.130  18.895  1.00  21.54 ? 49  GLY B C      1 
ATOM   2202 O O      . GLY B 2 33  ? 1.324   14.748  19.392  1.00  23.33 ? 49  GLY B O      1 
ATOM   2203 H H      . GLY B 2 33  ? -1.444  13.064  16.577  1.00  22.31 ? 49  GLY B H      1 
ATOM   2204 H HA2    . GLY B 2 33  ? 1.287   13.833  16.963  1.00  21.37 ? 49  GLY B HA2    1 
ATOM   2205 H HA3    . GLY B 2 33  ? -0.092  14.929  16.946  1.00  20.26 ? 49  GLY B HA3    1 
ATOM   2206 N N      . ASP B 2 34  ? -0.518  13.565  19.633  1.00  20.78 ? 50  ASP B N      1 
ATOM   2207 C CA     . ASP B 2 34  ? -0.422  13.676  21.108  1.00  21.31 ? 50  ASP B CA     1 
ATOM   2208 C C      . ASP B 2 34  ? -0.463  12.384  21.919  1.00  18.07 ? 50  ASP B C      1 
ATOM   2209 O O      . ASP B 2 34  ? -0.592  12.463  23.132  1.00  19.76 ? 50  ASP B O      1 
ATOM   2210 C CB     . ASP B 2 34  ? -1.535  14.587  21.596  1.00  27.01 ? 50  ASP B CB     1 
ATOM   2211 C CG     . ASP B 2 34  ? -2.924  14.088  21.215  1.00  28.74 ? 50  ASP B CG     1 
ATOM   2212 O OD1    . ASP B 2 34  ? -3.787  14.551  21.932  1.00  37.90 ? 50  ASP B OD1    1 
ATOM   2213 O OD2    . ASP B 2 34  ? -3.081  13.320  20.280  1.00  30.74 ? 50  ASP B OD2    1 
ATOM   2214 H H      . ASP B 2 34  ? -1.255  13.067  19.215  1.00  22.49 ? 50  ASP B H      1 
ATOM   2215 H HA     . ASP B 2 34  ? 0.507   14.163  21.357  1.00  23.18 ? 50  ASP B HA     1 
ATOM   2216 H HB2    . ASP B 2 34  ? -1.471  14.652  22.673  1.00  26.33 ? 50  ASP B HB2    1 
ATOM   2217 H HB3    . ASP B 2 34  ? -1.406  15.586  21.216  1.00  26.02 ? 50  ASP B HB3    1 
ATOM   2218 N N      . TRP B 2 35  ? -0.377  11.244  21.289  1.00  16.85 ? 51  TRP B N      1 
ATOM   2219 C CA     . TRP B 2 35  ? -0.398  9.959   22.053  1.00  16.79 ? 51  TRP B CA     1 
ATOM   2220 C C      . TRP B 2 35  ? 0.793   9.121   21.578  1.00  15.35 ? 51  TRP B C      1 
ATOM   2221 O O      . TRP B 2 35  ? 1.018   9.010   20.383  1.00  12.47 ? 51  TRP B O      1 
ATOM   2222 C CB     . TRP B 2 35  ? -1.634  9.094   21.801  1.00  16.78 ? 51  TRP B CB     1 
ATOM   2223 C CG     . TRP B 2 35  ? -2.865  9.637   22.511  1.00  19.01 ? 51  TRP B CG     1 
ATOM   2224 C CD1    . TRP B 2 35  ? -3.807  10.423  21.929  1.00  21.27 ? 51  TRP B CD1    1 
ATOM   2225 C CD2    . TRP B 2 35  ? -3.215  9.383   23.791  1.00  20.06 ? 51  TRP B CD2    1 
ATOM   2226 N NE1    . TRP B 2 35  ? -4.671  10.589  22.898  1.00  19.21 ? 51  TRP B NE1    1 
ATOM   2227 C CE2    . TRP B 2 35  ? -4.421  10.012  24.054  1.00  22.13 ? 51  TRP B CE2    1 
ATOM   2228 C CE3    . TRP B 2 35  ? -2.601  8.651   24.805  1.00  19.63 ? 51  TRP B CE3    1 
ATOM   2229 C CZ2    . TRP B 2 35  ? -5.009  9.906   25.305  1.00  24.53 ? 51  TRP B CZ2    1 
ATOM   2230 C CZ3    . TRP B 2 35  ? -3.177  8.539   26.065  1.00  21.15 ? 51  TRP B CZ3    1 
ATOM   2231 C CH2    . TRP B 2 35  ? -4.390  9.169   26.321  1.00  24.12 ? 51  TRP B CH2    1 
ATOM   2232 H H      . TRP B 2 35  ? -0.289  11.219  20.311  1.00  15.33 ? 51  TRP B H      1 
ATOM   2233 H HA     . TRP B 2 35  ? -0.299  10.160  23.109  1.00  16.31 ? 51  TRP B HA     1 
ATOM   2234 H HB2    . TRP B 2 35  ? -1.830  9.029   20.744  1.00  16.24 ? 51  TRP B HB2    1 
ATOM   2235 H HB3    . TRP B 2 35  ? -1.453  8.095   22.172  1.00  16.59 ? 51  TRP B HB3    1 
ATOM   2236 H HD1    . TRP B 2 35  ? -3.851  10.819  20.926  1.00  20.83 ? 51  TRP B HD1    1 
ATOM   2237 H HE1    . TRP B 2 35  ? -5.486  11.124  22.767  1.00  21.85 ? 51  TRP B HE1    1 
ATOM   2238 H HE3    . TRP B 2 35  ? -1.661  8.158   24.608  1.00  21.43 ? 51  TRP B HE3    1 
ATOM   2239 H HZ2    . TRP B 2 35  ? -5.955  10.388  25.493  1.00  24.39 ? 51  TRP B HZ2    1 
ATOM   2240 H HZ3    . TRP B 2 35  ? -2.694  7.967   26.845  1.00  20.86 ? 51  TRP B HZ3    1 
ATOM   2241 H HH2    . TRP B 2 35  ? -4.851  9.091   27.296  1.00  22.96 ? 51  TRP B HH2    1 
ATOM   2242 N N      . VAL B 2 36  ? 1.489   8.570   22.540  1.00  17.60 ? 52  VAL B N      1 
ATOM   2243 C CA     . VAL B 2 36  ? 2.674   7.715   22.289  1.00  15.01 ? 52  VAL B CA     1 
ATOM   2244 C C      . VAL B 2 36  ? 2.400   6.377   22.976  1.00  12.02 ? 52  VAL B C      1 
ATOM   2245 O O      . VAL B 2 36  ? 1.899   6.320   24.089  1.00  16.86 ? 52  VAL B O      1 
ATOM   2246 C CB     . VAL B 2 36  ? 3.975   8.366   22.919  1.00  15.46 ? 52  VAL B CB     1 
ATOM   2247 C CG1    . VAL B 2 36  ? 5.215   7.434   22.836  1.00  15.85 ? 52  VAL B CG1    1 
ATOM   2248 C CG2    . VAL B 2 36  ? 4.310   9.664   22.210  1.00  16.04 ? 52  VAL B CG2    1 
ATOM   2249 H H      . VAL B 2 36  ? 1.227   8.720   23.476  1.00  14.59 ? 52  VAL B H      1 
ATOM   2250 H HA     . VAL B 2 36  ? 2.781   7.562   21.226  1.00  16.43 ? 52  VAL B HA     1 
ATOM   2251 H HB     . VAL B 2 36  ? 3.789   8.578   23.955  1.00  15.33 ? 52  VAL B HB     1 
ATOM   2252 H HG11   . VAL B 2 36  ? 5.450   7.188   21.810  1.00  14.79 ? 52  VAL B HG11   1 
ATOM   2253 H HG12   . VAL B 2 36  ? 5.037   6.523   23.392  1.00  14.44 ? 52  VAL B HG12   1 
ATOM   2254 H HG13   . VAL B 2 36  ? 6.071   7.926   23.277  1.00  16.25 ? 52  VAL B HG13   1 
ATOM   2255 H HG21   . VAL B 2 36  ? 5.176   10.124  22.662  1.00  16.54 ? 52  VAL B HG21   1 
ATOM   2256 H HG22   . VAL B 2 36  ? 3.482   10.356  22.283  1.00  16.02 ? 52  VAL B HG22   1 
ATOM   2257 H HG23   . VAL B 2 36  ? 4.520   9.476   21.167  1.00  15.98 ? 52  VAL B HG23   1 
ATOM   2258 N N      . LEU B 2 37  ? 2.759   5.342   22.295  1.00  12.65 ? 53  LEU B N      1 
ATOM   2259 C CA     . LEU B 2 37  ? 2.573   3.977   22.844  1.00  14.83 ? 53  LEU B CA     1 
ATOM   2260 C C      . LEU B 2 37  ? 4.037   3.538   23.223  1.00  14.99 ? 53  LEU B C      1 
ATOM   2261 O O      . LEU B 2 37  ? 4.956   3.666   22.420  1.00  15.34 ? 53  LEU B O      1 
ATOM   2262 C CB     . LEU B 2 37  ? 2.012   3.033   21.762  1.00  14.97 ? 53  LEU B CB     1 
ATOM   2263 C CG     . LEU B 2 37  ? 1.578   1.669   22.387  1.00  18.59 ? 53  LEU B CG     1 
ATOM   2264 C CD1    . LEU B 2 37  ? 0.379   1.814   23.340  1.00  21.27 ? 53  LEU B CD1    1 
ATOM   2265 C CD2    . LEU B 2 37  ? 1.262   0.669   21.288  1.00  21.85 ? 53  LEU B CD2    1 
ATOM   2266 H H      . LEU B 2 37  ? 3.156   5.461   21.408  1.00  10.79 ? 53  LEU B H      1 
ATOM   2267 H HA     . LEU B 2 37  ? 1.961   4.025   23.735  1.00  14.75 ? 53  LEU B HA     1 
ATOM   2268 H HB2    . LEU B 2 37  ? 1.177   3.510   21.277  1.00  16.06 ? 53  LEU B HB2    1 
ATOM   2269 H HB3    . LEU B 2 37  ? 2.777   2.862   21.016  1.00  15.40 ? 53  LEU B HB3    1 
ATOM   2270 H HG     . LEU B 2 37  ? 2.397   1.256   22.959  1.00  20.01 ? 53  LEU B HG     1 
ATOM   2271 H HD11   . LEU B 2 37  ? -0.484  2.221   22.835  1.00  20.84 ? 53  LEU B HD11   1 
ATOM   2272 H HD12   . LEU B 2 37  ? 0.620   2.458   24.175  1.00  21.13 ? 53  LEU B HD12   1 
ATOM   2273 H HD13   . LEU B 2 37  ? 0.113   0.853   23.749  1.00  21.36 ? 53  LEU B HD13   1 
ATOM   2274 H HD21   . LEU B 2 37  ? 0.923   -0.258  21.725  1.00  20.42 ? 53  LEU B HD21   1 
ATOM   2275 H HD22   . LEU B 2 37  ? 2.161   0.459   20.733  1.00  19.94 ? 53  LEU B HD22   1 
ATOM   2276 H HD23   . LEU B 2 37  ? 0.501   1.037   20.613  1.00  19.83 ? 53  LEU B HD23   1 
ATOM   2277 N N      . THR B 2 38  ? 4.193   3.053   24.417  1.00  16.48 ? 54  THR B N      1 
ATOM   2278 C CA     . THR B 2 38  ? 5.515   2.595   24.895  1.00  16.42 ? 54  THR B CA     1 
ATOM   2279 C C      . THR B 2 38  ? 5.282   1.396   25.864  1.00  16.44 ? 54  THR B C      1 
ATOM   2280 O O      . THR B 2 38  ? 4.208   0.805   25.897  1.00  16.30 ? 54  THR B O      1 
ATOM   2281 C CB     . THR B 2 38  ? 6.218   3.872   25.534  1.00  16.59 ? 54  THR B CB     1 
ATOM   2282 O OG1    . THR B 2 38  ? 7.527   3.472   25.955  1.00  17.41 ? 54  THR B OG1    1 
ATOM   2283 C CG2    . THR B 2 38  ? 5.542   4.363   26.811  1.00  16.85 ? 54  THR B CG2    1 
ATOM   2284 H H      . THR B 2 38  ? 3.424   2.973   25.028  1.00  14.59 ? 54  THR B H      1 
ATOM   2285 H HA     . THR B 2 38  ? 6.076   2.237   24.043  1.00  15.87 ? 54  THR B HA     1 
ATOM   2286 H HB     . THR B 2 38  ? 6.300   4.662   24.799  1.00  16.68 ? 54  THR B HB     1 
ATOM   2287 H HG1    . THR B 2 38  ? 8.235   3.920   25.451  1.00  15.79 ? 54  THR B HG1    1 
ATOM   2288 H HG21   . THR B 2 38  ? 6.041   5.240   27.195  1.00  17.20 ? 54  THR B HG21   1 
ATOM   2289 H HG22   . THR B 2 38  ? 5.577   3.597   27.571  1.00  16.97 ? 54  THR B HG22   1 
ATOM   2290 H HG23   . THR B 2 38  ? 4.511   4.618   26.613  1.00  17.49 ? 54  THR B HG23   1 
ATOM   2291 N N      . ALA B 2 39  ? 6.290   1.082   26.649  1.00  15.57 ? 55  ALA B N      1 
ATOM   2292 C CA     . ALA B 2 39  ? 6.197   -0.054  27.608  1.00  14.14 ? 55  ALA B CA     1 
ATOM   2293 C C      . ALA B 2 39  ? 5.952   0.472   29.006  1.00  15.55 ? 55  ALA B C      1 
ATOM   2294 O O      . ALA B 2 39  ? 6.492   1.479   29.413  1.00  16.06 ? 55  ALA B O      1 
ATOM   2295 C CB     . ALA B 2 39  ? 7.511   -0.860  27.570  1.00  13.06 ? 55  ALA B CB     1 
ATOM   2296 H H      . ALA B 2 39  ? 7.109   1.634   26.606  1.00  16.73 ? 55  ALA B H      1 
ATOM   2297 H HA     . ALA B 2 39  ? 5.383   -0.695  27.304  1.00  15.04 ? 55  ALA B HA     1 
ATOM   2298 H HB1    . ALA B 2 39  ? 7.488   -1.675  28.266  1.00  13.22 ? 55  ALA B HB1    1 
ATOM   2299 H HB2    . ALA B 2 39  ? 8.333   -0.207  27.826  1.00  13.70 ? 55  ALA B HB2    1 
ATOM   2300 H HB3    . ALA B 2 39  ? 7.678   -1.258  26.584  1.00  12.24 ? 55  ALA B HB3    1 
ATOM   2301 N N      . ALA B 2 40  ? 5.124   -0.243  29.724  1.00  13.58 ? 56  ALA B N      1 
ATOM   2302 C CA     . ALA B 2 40  ? 4.798   0.147   31.114  1.00  14.18 ? 56  ALA B CA     1 
ATOM   2303 C C      . ALA B 2 40  ? 6.038   0.163   32.008  1.00  13.91 ? 56  ALA B C      1 
ATOM   2304 O O      . ALA B 2 40  ? 6.141   1.005   32.860  1.00  15.49 ? 56  ALA B O      1 
ATOM   2305 C CB     . ALA B 2 40  ? 3.812   -0.829  31.733  1.00  14.59 ? 56  ALA B CB     1 
ATOM   2306 H H      . ALA B 2 40  ? 4.714   -1.036  29.332  1.00  12.87 ? 56  ALA B H      1 
ATOM   2307 H HA     . ALA B 2 40  ? 4.390   1.147   31.102  1.00  13.71 ? 56  ALA B HA     1 
ATOM   2308 H HB1    . ALA B 2 40  ? 3.605   -0.518  32.749  1.00  13.83 ? 56  ALA B HB1    1 
ATOM   2309 H HB2    . ALA B 2 40  ? 4.209   -1.832  31.768  1.00  13.98 ? 56  ALA B HB2    1 
ATOM   2310 H HB3    . ALA B 2 40  ? 2.878   -0.837  31.192  1.00  15.21 ? 56  ALA B HB3    1 
ATOM   2311 N N      . HIS B 2 41  ? 6.947   -0.742  31.786  1.00  15.23 ? 57  HIS B N      1 
ATOM   2312 C CA     . HIS B 2 41  ? 8.149   -0.779  32.646  1.00  17.78 ? 57  HIS B CA     1 
ATOM   2313 C C      . HIS B 2 41  ? 9.034   0.430   32.540  1.00  19.34 ? 57  HIS B C      1 
ATOM   2314 O O      . HIS B 2 41  ? 10.024  0.501   33.240  1.00  20.75 ? 57  HIS B O      1 
ATOM   2315 C CB     . HIS B 2 41  ? 8.960   -2.090  32.359  1.00  16.05 ? 57  HIS B CB     1 
ATOM   2316 C CG     . HIS B 2 41  ? 10.008  -2.138  31.236  1.00  16.14 ? 57  HIS B CG     1 
ATOM   2317 N ND1    . HIS B 2 41  ? 9.911   -2.781  30.097  1.00  16.71 ? 57  HIS B ND1    1 
ATOM   2318 C CD2    . HIS B 2 41  ? 11.274  -1.553  31.216  1.00  16.55 ? 57  HIS B CD2    1 
ATOM   2319 C CE1    . HIS B 2 41  ? 10.989  -2.635  29.412  1.00  15.38 ? 57  HIS B CE1    1 
ATOM   2320 N NE2    . HIS B 2 41  ? 11.811  -1.900  30.082  1.00  16.16 ? 57  HIS B NE2    1 
ATOM   2321 H H      . HIS B 2 41  ? 6.817   -1.363  31.060  1.00  14.77 ? 57  HIS B H      1 
ATOM   2322 H HA     . HIS B 2 41  ? 7.803   -0.833  33.668  1.00  16.91 ? 57  HIS B HA     1 
ATOM   2323 H HB2    . HIS B 2 41  ? 9.506   -2.275  33.273  1.00  16.23 ? 57  HIS B HB2    1 
ATOM   2324 H HB3    . HIS B 2 41  ? 8.290   -2.929  32.257  1.00  15.99 ? 57  HIS B HB3    1 
ATOM   2325 H HD1    . HIS B 2 41  ? 9.156   -3.314  29.815  1.00  16.01 ? 57  HIS B HD1    1 
ATOM   2326 H HD2    . HIS B 2 41  ? 11.719  -0.933  31.986  1.00  16.26 ? 57  HIS B HD2    1 
ATOM   2327 H HE1    . HIS B 2 41  ? 11.193  -3.050  28.437  1.00  15.32 ? 57  HIS B HE1    1 
ATOM   2328 H HE2    . HIS B 2 41  ? 12.715  -1.655  29.773  1.00  16.98 ? 57  HIS B HE2    1 
ATOM   2329 N N      . CYS B 2 42  ? 8.677   1.350   31.703  1.00  18.55 ? 58  CYS B N      1 
ATOM   2330 C CA     . CYS B 2 42  ? 9.526   2.554   31.593  1.00  19.32 ? 58  CYS B CA     1 
ATOM   2331 C C      . CYS B 2 42  ? 9.118   3.512   32.691  1.00  18.33 ? 58  CYS B C      1 
ATOM   2332 O O      . CYS B 2 42  ? 9.755   4.523   32.836  1.00  20.37 ? 58  CYS B O      1 
ATOM   2333 C CB     . CYS B 2 42  ? 9.331   3.200   30.202  1.00  20.53 ? 58  CYS B CB     1 
ATOM   2334 S SG     . CYS B 2 42  ? 9.989   2.251   28.807  1.00  18.88 ? 58  CYS B SG     1 
ATOM   2335 H H      . CYS B 2 42  ? 7.872   1.283   31.145  1.00  19.57 ? 58  CYS B H      1 
ATOM   2336 H HA     . CYS B 2 42  ? 10.560  2.279   31.741  1.00  19.35 ? 58  CYS B HA     1 
ATOM   2337 H HB2    . CYS B 2 42  ? 8.279   3.374   30.033  1.00  20.72 ? 58  CYS B HB2    1 
ATOM   2338 H HB3    . CYS B 2 42  ? 9.797   4.175   30.213  1.00  20.39 ? 58  CYS B HB3    1 
ATOM   2339 N N      . PHE B 2 43  ? 8.101   3.206   33.447  1.00  18.81 ? 59  PHE B N      1 
ATOM   2340 C CA     . PHE B 2 43  ? 7.647   4.112   34.550  1.00  22.18 ? 59  PHE B CA     1 
ATOM   2341 C C      . PHE B 2 43  ? 7.669   3.432   35.940  1.00  20.70 ? 59  PHE B C      1 
ATOM   2342 O O      . PHE B 2 43  ? 6.644   3.261   36.558  1.00  19.87 ? 59  PHE B O      1 
ATOM   2343 C CB     . PHE B 2 43  ? 6.214   4.598   34.249  1.00  23.60 ? 59  PHE B CB     1 
ATOM   2344 C CG     . PHE B 2 43  ? 6.200   5.245   32.885  1.00  23.38 ? 59  PHE B CG     1 
ATOM   2345 C CD1    . PHE B 2 43  ? 5.904   4.487   31.784  1.00  24.63 ? 59  PHE B CD1    1 
ATOM   2346 C CD2    . PHE B 2 43  ? 6.529   6.569   32.727  1.00  22.42 ? 59  PHE B CD2    1 
ATOM   2347 C CE1    . PHE B 2 43  ? 5.944   5.056   30.528  1.00  25.25 ? 59  PHE B CE1    1 
ATOM   2348 C CE2    . PHE B 2 43  ? 6.568   7.133   31.472  1.00  23.00 ? 59  PHE B CE2    1 
ATOM   2349 C CZ     . PHE B 2 43  ? 6.278   6.381   30.368  1.00  23.75 ? 59  PHE B CZ     1 
ATOM   2350 H H      . PHE B 2 43  ? 7.621   2.366   33.292  1.00  19.66 ? 59  PHE B H      1 
ATOM   2351 H HA     . PHE B 2 43  ? 8.291   4.981   34.588  1.00  22.53 ? 59  PHE B HA     1 
ATOM   2352 H HB2    . PHE B 2 43  ? 5.516   3.775   34.284  1.00  24.14 ? 59  PHE B HB2    1 
ATOM   2353 H HB3    . PHE B 2 43  ? 5.938   5.330   34.993  1.00  24.76 ? 59  PHE B HB3    1 
ATOM   2354 H HD1    . PHE B 2 43  ? 5.640   3.445   31.899  1.00  24.74 ? 59  PHE B HD1    1 
ATOM   2355 H HD2    . PHE B 2 43  ? 6.757   7.174   33.592  1.00  22.89 ? 59  PHE B HD2    1 
ATOM   2356 H HE1    . PHE B 2 43  ? 5.713   4.452   29.662  1.00  26.16 ? 59  PHE B HE1    1 
ATOM   2357 H HE2    . PHE B 2 43  ? 6.833   8.174   31.356  1.00  23.24 ? 59  PHE B HE2    1 
ATOM   2358 H HZ     . PHE B 2 43  ? 6.313   6.821   29.382  1.00  23.93 ? 59  PHE B HZ     1 
ATOM   2359 N N      . PRO B 2 44  ? 8.827   3.055   36.417  1.00  24.74 ? 60  PRO B N      1 
ATOM   2360 C CA     . PRO B 2 44  ? 8.982   2.497   37.781  1.00  26.12 ? 60  PRO B CA     1 
ATOM   2361 C C      . PRO B 2 44  ? 8.774   3.636   38.759  1.00  28.06 ? 60  PRO B C      1 
ATOM   2362 O O      . PRO B 2 44  ? 8.823   4.785   38.373  1.00  28.46 ? 60  PRO B O      1 
ATOM   2363 C CB     . PRO B 2 44  ? 10.359  1.964   37.820  1.00  25.64 ? 60  PRO B CB     1 
ATOM   2364 C CG     . PRO B 2 44  ? 11.103  2.973   36.902  1.00  26.22 ? 60  PRO B CG     1 
ATOM   2365 C CD     . PRO B 2 44  ? 10.143  3.136   35.717  1.00  23.19 ? 60  PRO B CD     1 
ATOM   2366 H HA     . PRO B 2 44  ? 8.228   1.735   37.925  1.00  27.33 ? 60  PRO B HA     1 
ATOM   2367 H HB2    . PRO B 2 44  ? 10.738  2.000   38.824  1.00  26.29 ? 60  PRO B HB2    1 
ATOM   2368 H HB3    . PRO B 2 44  ? 10.395  0.951   37.450  1.00  25.69 ? 60  PRO B HB3    1 
ATOM   2369 H HG2    . PRO B 2 44  ? 11.237  3.920   37.407  1.00  25.05 ? 60  PRO B HG2    1 
ATOM   2370 H HG3    . PRO B 2 44  ? 12.062  2.597   36.570  1.00  25.65 ? 60  PRO B HG3    1 
ATOM   2371 H HD2    . PRO B 2 44  ? 10.265  4.100   35.241  1.00  24.30 ? 60  PRO B HD2    1 
ATOM   2372 H HD3    . PRO B 2 44  ? 10.233  2.341   34.993  1.00  24.84 ? 60  PRO B HD3    1 
ATOM   2373 N N      . GLU B 2 45  ? 8.561   3.291   39.995  1.00  32.30 ? 61  GLU B N      1 
ATOM   2374 C CA     . GLU B 2 45  ? 8.328   4.319   41.058  1.00  34.56 ? 61  GLU B CA     1 
ATOM   2375 C C      . GLU B 2 45  ? 9.265   5.493   41.049  1.00  33.25 ? 61  GLU B C      1 
ATOM   2376 O O      . GLU B 2 45  ? 8.827   6.610   41.237  1.00  40.57 ? 61  GLU B O      1 
ATOM   2377 C CB     . GLU B 2 45  ? 8.390   3.665   42.454  0.32  34.97 ? 61  GLU B CB     1 
ATOM   2378 C CG     . GLU B 2 45  ? 7.086   2.857   42.688  0.32  35.88 ? 61  GLU B CG     1 
ATOM   2379 C CD     . GLU B 2 45  ? 7.057   2.169   44.072  0.32  38.10 ? 61  GLU B CD     1 
ATOM   2380 O OE1    . GLU B 2 45  ? 5.985   1.656   44.348  0.32  41.03 ? 61  GLU B OE1    1 
ATOM   2381 O OE2    . GLU B 2 45  ? 8.062   2.175   44.773  0.32  37.06 ? 61  GLU B OE2    1 
ATOM   2382 H H      . GLU B 2 45  ? 8.564   2.338   40.211  1.00  32.49 ? 61  GLU B H      1 
ATOM   2383 H HA     . GLU B 2 45  ? 7.340   4.722   40.894  1.00  33.87 ? 61  GLU B HA     1 
ATOM   2384 H HB2    . GLU B 2 45  ? 9.268   3.044   42.537  0.32  34.75 ? 61  GLU B HB2    1 
ATOM   2385 H HB3    . GLU B 2 45  ? 8.457   4.444   43.204  0.32  34.89 ? 61  GLU B HB3    1 
ATOM   2386 H HG2    . GLU B 2 45  ? 6.232   3.519   42.625  0.32  35.78 ? 61  GLU B HG2    1 
ATOM   2387 H HG3    . GLU B 2 45  ? 6.980   2.096   41.929  0.32  36.02 ? 61  GLU B HG3    1 
ATOM   2388 N N      . ARG B 2 46  ? 10.513  5.227   40.843  1.00  34.98 ? 62  ARG B N      1 
ATOM   2389 C CA     . ARG B 2 46  ? 11.508  6.333   40.819  1.00  35.96 ? 62  ARG B CA     1 
ATOM   2390 C C      . ARG B 2 46  ? 11.381  7.262   39.608  1.00  37.07 ? 62  ARG B C      1 
ATOM   2391 O O      . ARG B 2 46  ? 12.074  8.265   39.561  1.00  36.81 ? 62  ARG B O      1 
ATOM   2392 C CB     . ARG B 2 46  ? 12.914  5.740   40.816  1.00  36.72 ? 62  ARG B CB     1 
ATOM   2393 C CG     . ARG B 2 46  ? 13.273  5.248   42.240  0.02  35.75 ? 62  ARG B CG     1 
ATOM   2394 C CD     . ARG B 2 46  ? 14.710  4.685   42.263  0.02  35.33 ? 62  ARG B CD     1 
ATOM   2395 N NE     . ARG B 2 46  ? 14.697  3.299   41.694  0.02  34.71 ? 62  ARG B NE     1 
ATOM   2396 C CZ     . ARG B 2 46  ? 15.082  2.277   42.419  0.02  34.57 ? 62  ARG B CZ     1 
ATOM   2397 N NH1    . ARG B 2 46  ? 16.088  2.410   43.241  0.02  34.60 ? 62  ARG B NH1    1 
ATOM   2398 N NH2    . ARG B 2 46  ? 14.446  1.144   42.298  0.02  34.56 ? 62  ARG B NH2    1 
ATOM   2399 H H      . ARG B 2 46  ? 10.799  4.301   40.700  1.00  34.77 ? 62  ARG B H      1 
ATOM   2400 H HA     . ARG B 2 46  ? 11.355  6.935   41.703  1.00  34.62 ? 62  ARG B HA     1 
ATOM   2401 H HB2    . ARG B 2 46  ? 12.948  4.934   40.094  1.00  36.41 ? 62  ARG B HB2    1 
ATOM   2402 H HB3    . ARG B 2 46  ? 13.612  6.501   40.486  1.00  36.73 ? 62  ARG B HB3    1 
ATOM   2403 H HG2    . ARG B 2 46  ? 13.221  6.073   42.936  0.02  35.95 ? 62  ARG B HG2    1 
ATOM   2404 H HG3    . ARG B 2 46  ? 12.575  4.484   42.553  0.02  35.95 ? 62  ARG B HG3    1 
ATOM   2405 H HD2    . ARG B 2 46  ? 15.368  5.297   41.660  0.02  35.11 ? 62  ARG B HD2    1 
ATOM   2406 H HD3    . ARG B 2 46  ? 15.094  4.680   43.273  0.02  35.11 ? 62  ARG B HD3    1 
ATOM   2407 H HE     . ARG B 2 46  ? 14.396  3.152   40.773  0.02  34.67 ? 62  ARG B HE     1 
ATOM   2408 H HH11   . ARG B 2 46  ? 16.385  1.634   43.797  0.02  34.71 ? 62  ARG B HH11   1 
ATOM   2409 H HH12   . ARG B 2 46  ? 16.559  3.289   43.316  0.02  34.71 ? 62  ARG B HH12   1 
ATOM   2410 H HH21   . ARG B 2 46  ? 13.680  1.063   41.662  0.02  34.76 ? 62  ARG B HH21   1 
ATOM   2411 H HH22   . ARG B 2 46  ? 14.728  0.356   42.845  0.02  34.76 ? 62  ARG B HH22   1 
ATOM   2412 N N      . ASN B 2 47  ? 10.534  6.947   38.666  1.00  36.31 ? 63  ASN B N      1 
ATOM   2413 C CA     . ASN B 2 47  ? 10.400  7.834   37.473  1.00  35.09 ? 63  ASN B CA     1 
ATOM   2414 C C      . ASN B 2 47  ? 8.966   8.189   37.227  1.00  33.59 ? 63  ASN B C      1 
ATOM   2415 O O      . ASN B 2 47  ? 8.488   8.091   36.111  1.00  34.02 ? 63  ASN B O      1 
ATOM   2416 C CB     . ASN B 2 47  ? 11.004  7.095   36.239  1.00  37.13 ? 63  ASN B CB     1 
ATOM   2417 C CG     . ASN B 2 47  ? 12.419  6.602   36.577  1.00  38.13 ? 63  ASN B CG     1 
ATOM   2418 O OD1    . ASN B 2 47  ? 12.601  5.740   37.402  1.00  43.46 ? 63  ASN B OD1    1 
ATOM   2419 N ND2    . ASN B 2 47  ? 13.476  7.079   36.008  1.00  41.57 ? 63  ASN B ND2    1 
ATOM   2420 H H      . ASN B 2 47  ? 9.996   6.133   38.748  1.00  36.41 ? 63  ASN B H      1 
ATOM   2421 H HA     . ASN B 2 47  ? 10.947  8.745   37.643  1.00  36.74 ? 63  ASN B HA     1 
ATOM   2422 H HB2    . ASN B 2 47  ? 10.387  6.251   35.974  1.00  37.02 ? 63  ASN B HB2    1 
ATOM   2423 H HB3    . ASN B 2 47  ? 11.048  7.763   35.392  1.00  37.14 ? 63  ASN B HB3    1 
ATOM   2424 H HD21   . ASN B 2 47  ? 13.407  7.786   35.336  1.00  41.89 ? 63  ASN B HD21   1 
ATOM   2425 H HD22   . ASN B 2 47  ? 14.359  6.725   36.252  1.00  41.26 ? 63  ASN B HD22   1 
ATOM   2426 N N      . ARG B 2 48  ? 8.277   8.608   38.242  1.00  33.24 ? 64  ARG B N      1 
ATOM   2427 C CA     . ARG B 2 48  ? 6.843   8.965   38.031  1.00  34.72 ? 64  ARG B CA     1 
ATOM   2428 C C      . ARG B 2 48  ? 6.447   10.433  38.229  1.00  34.74 ? 64  ARG B C      1 
ATOM   2429 O O      . ARG B 2 48  ? 5.296   10.714  38.517  1.00  36.37 ? 64  ARG B O      1 
ATOM   2430 C CB     . ARG B 2 48  ? 5.998   8.068   38.955  1.00  37.00 ? 64  ARG B CB     1 
ATOM   2431 C CG     . ARG B 2 48  ? 6.226   6.597   38.554  1.00  41.44 ? 64  ARG B CG     1 
ATOM   2432 C CD     . ARG B 2 48  ? 5.247   5.656   39.310  1.00  45.49 ? 64  ARG B CD     1 
ATOM   2433 N NE     . ARG B 2 48  ? 5.585   4.255   38.909  1.00  48.25 ? 64  ARG B NE     1 
ATOM   2434 C CZ     . ARG B 2 48  ? 4.709   3.305   39.061  1.00  51.79 ? 64  ARG B CZ     1 
ATOM   2435 N NH1    . ARG B 2 48  ? 4.334   3.010   40.271  1.00  55.47 ? 64  ARG B NH1    1 
ATOM   2436 N NH2    . ARG B 2 48  ? 4.240   2.680   38.023  1.00  53.54 ? 64  ARG B NH2    1 
ATOM   2437 H H      . ARG B 2 48  ? 8.701   8.681   39.122  1.00  34.20 ? 64  ARG B H      1 
ATOM   2438 H HA     . ARG B 2 48  ? 6.565   8.722   37.015  1.00  34.72 ? 64  ARG B HA     1 
ATOM   2439 H HB2    . ARG B 2 48  ? 6.291   8.223   39.983  1.00  37.85 ? 64  ARG B HB2    1 
ATOM   2440 H HB3    . ARG B 2 48  ? 4.955   8.335   38.851  1.00  37.71 ? 64  ARG B HB3    1 
ATOM   2441 H HG2    . ARG B 2 48  ? 6.124   6.459   37.487  1.00  41.24 ? 64  ARG B HG2    1 
ATOM   2442 H HG3    . ARG B 2 48  ? 7.233   6.325   38.829  1.00  41.36 ? 64  ARG B HG3    1 
ATOM   2443 H HD2    . ARG B 2 48  ? 5.332   5.754   40.383  1.00  45.03 ? 64  ARG B HD2    1 
ATOM   2444 H HD3    . ARG B 2 48  ? 4.219   5.851   39.036  1.00  45.06 ? 64  ARG B HD3    1 
ATOM   2445 H HE     . ARG B 2 48  ? 6.465   4.052   38.530  1.00  48.20 ? 64  ARG B HE     1 
ATOM   2446 H HH11   . ARG B 2 48  ? 3.667   2.283   40.430  1.00  54.75 ? 64  ARG B HH11   1 
ATOM   2447 H HH12   . ARG B 2 48  ? 4.719   3.518   41.043  1.00  54.65 ? 64  ARG B HH12   1 
ATOM   2448 H HH21   . ARG B 2 48  ? 4.548   2.927   37.104  1.00  52.38 ? 64  ARG B HH21   1 
ATOM   2449 H HH22   . ARG B 2 48  ? 3.569   1.950   38.149  1.00  52.30 ? 64  ARG B HH22   1 
ATOM   2450 N N      . VAL B 2 49  ? 7.362   11.355  38.076  1.00  34.29 ? 65  VAL B N      1 
ATOM   2451 C CA     . VAL B 2 49  ? 6.966   12.795  38.253  1.00  31.38 ? 65  VAL B CA     1 
ATOM   2452 C C      . VAL B 2 49  ? 6.928   13.162  36.796  1.00  27.45 ? 65  VAL B C      1 
ATOM   2453 O O      . VAL B 2 49  ? 7.958   13.275  36.154  1.00  22.83 ? 65  VAL B O      1 
ATOM   2454 C CB     . VAL B 2 49  ? 8.031   13.607  38.948  1.00  32.20 ? 65  VAL B CB     1 
ATOM   2455 C CG1    . VAL B 2 49  ? 7.455   15.000  39.197  1.00  29.58 ? 65  VAL B CG1    1 
ATOM   2456 C CG2    . VAL B 2 49  ? 8.409   12.907  40.263  1.00  33.73 ? 65  VAL B CG2    1 
ATOM   2457 H H      . VAL B 2 49  ? 8.290   11.125  37.846  1.00  32.84 ? 65  VAL B H      1 
ATOM   2458 H HA     . VAL B 2 49  ? 5.989   12.883  38.705  1.00  31.51 ? 65  VAL B HA     1 
ATOM   2459 H HB     . VAL B 2 49  ? 8.858   13.681  38.271  1.00  31.88 ? 65  VAL B HB     1 
ATOM   2460 H HG11   . VAL B 2 49  ? 6.555   14.952  39.793  1.00  30.13 ? 65  VAL B HG11   1 
ATOM   2461 H HG12   . VAL B 2 49  ? 7.216   15.451  38.247  1.00  30.05 ? 65  VAL B HG12   1 
ATOM   2462 H HG13   . VAL B 2 49  ? 8.164   15.640  39.697  1.00  30.84 ? 65  VAL B HG13   1 
ATOM   2463 H HG21   . VAL B 2 49  ? 9.165   13.468  40.793  1.00  34.08 ? 65  VAL B HG21   1 
ATOM   2464 H HG22   . VAL B 2 49  ? 8.798   11.917  40.066  1.00  33.69 ? 65  VAL B HG22   1 
ATOM   2465 H HG23   . VAL B 2 49  ? 7.540   12.816  40.901  1.00  33.52 ? 65  VAL B HG23   1 
ATOM   2466 N N      . LEU B 2 50  A 5.721   13.312  36.344  1.00  24.90 ? 65  LEU B N      1 
ATOM   2467 C CA     . LEU B 2 50  A 5.495   13.654  34.941  1.00  28.11 ? 65  LEU B CA     1 
ATOM   2468 C C      . LEU B 2 50  A 6.246   14.872  34.489  1.00  26.90 ? 65  LEU B C      1 
ATOM   2469 O O      . LEU B 2 50  A 6.731   14.881  33.376  1.00  25.57 ? 65  LEU B O      1 
ATOM   2470 C CB     . LEU B 2 50  A 3.977   13.819  34.725  1.00  30.13 ? 65  LEU B CB     1 
ATOM   2471 C CG     . LEU B 2 50  A 3.233   12.466  34.966  1.00  31.99 ? 65  LEU B CG     1 
ATOM   2472 C CD1    . LEU B 2 50  A 1.846   12.593  34.340  1.00  33.75 ? 65  LEU B CD1    1 
ATOM   2473 C CD2    . LEU B 2 50  A 3.938   11.219  34.326  1.00  31.62 ? 65  LEU B CD2    1 
ATOM   2474 H H      . LEU B 2 50  A 4.964   13.196  36.952  1.00  25.89 ? 65  LEU B H      1 
ATOM   2475 H HA     . LEU B 2 50  A 5.856   12.838  34.337  1.00  27.20 ? 65  LEU B HA     1 
ATOM   2476 H HB2    . LEU B 2 50  A 3.597   14.584  35.388  1.00  29.51 ? 65  LEU B HB2    1 
ATOM   2477 H HB3    . LEU B 2 50  A 3.822   14.164  33.709  1.00  29.94 ? 65  LEU B HB3    1 
ATOM   2478 H HG     . LEU B 2 50  A 3.126   12.302  36.029  1.00  31.39 ? 65  LEU B HG     1 
ATOM   2479 H HD11   . LEU B 2 50  A 1.921   12.796  33.280  1.00  33.35 ? 65  LEU B HD11   1 
ATOM   2480 H HD12   . LEU B 2 50  A 1.292   13.403  34.793  1.00  33.27 ? 65  LEU B HD12   1 
ATOM   2481 H HD13   . LEU B 2 50  A 1.306   11.665  34.465  1.00  32.84 ? 65  LEU B HD13   1 
ATOM   2482 H HD21   . LEU B 2 50  A 3.347   10.327  34.500  1.00  31.33 ? 65  LEU B HD21   1 
ATOM   2483 H HD22   . LEU B 2 50  A 4.906   11.039  34.768  1.00  31.42 ? 65  LEU B HD22   1 
ATOM   2484 H HD23   . LEU B 2 50  A 4.060   11.336  33.259  1.00  31.08 ? 65  LEU B HD23   1 
ATOM   2485 N N      . SER B 2 51  B 6.340   15.856  35.332  1.00  29.01 ? 65  SER B N      1 
ATOM   2486 C CA     . SER B 2 51  B 7.078   17.089  34.919  1.00  28.58 ? 65  SER B CA     1 
ATOM   2487 C C      . SER B 2 51  B 8.527   16.819  34.590  1.00  25.07 ? 65  SER B C      1 
ATOM   2488 O O      . SER B 2 51  B 9.145   17.653  33.957  1.00  25.53 ? 65  SER B O      1 
ATOM   2489 C CB     . SER B 2 51  B 7.009   18.155  36.054  1.00  30.74 ? 65  SER B CB     1 
ATOM   2490 O OG     . SER B 2 51  B 7.459   17.471  37.215  1.00  33.45 ? 65  SER B OG     1 
ATOM   2491 H H      . SER B 2 51  B 5.937   15.799  36.226  1.00  29.86 ? 65  SER B H      1 
ATOM   2492 H HA     . SER B 2 51  B 6.612   17.472  34.021  1.00  27.77 ? 65  SER B HA     1 
ATOM   2493 H HB2    . SER B 2 51  B 7.664   18.990  35.846  1.00  30.43 ? 65  SER B HB2    1 
ATOM   2494 H HB3    . SER B 2 51  B 5.997   18.506  36.211  1.00  30.79 ? 65  SER B HB3    1 
ATOM   2495 H HG     . SER B 2 51  B 6.668   17.364  37.764  1.00  33.06 ? 65  SER B HG     1 
ATOM   2496 N N      . ARG B 2 52  C 9.027   15.689  35.014  1.00  22.81 ? 65  ARG B N      1 
ATOM   2497 C CA     . ARG B 2 52  C 10.456  15.385  34.725  1.00  24.16 ? 65  ARG B CA     1 
ATOM   2498 C C      . ARG B 2 52  C 10.650  14.576  33.449  1.00  20.68 ? 65  ARG B C      1 
ATOM   2499 O O      . ARG B 2 52  C 11.781  14.243  33.149  1.00  18.84 ? 65  ARG B O      1 
ATOM   2500 C CB     . ARG B 2 52  C 11.044  14.633  35.940  1.00  25.62 ? 65  ARG B CB     1 
ATOM   2501 C CG     . ARG B 2 52  C 10.917  15.530  37.213  0.48  26.78 ? 65  ARG B CG     1 
ATOM   2502 C CD     . ARG B 2 52  C 11.136  14.650  38.449  0.48  29.38 ? 65  ARG B CD     1 
ATOM   2503 N NE     . ARG B 2 52  C 12.584  14.443  38.690  0.48  31.27 ? 65  ARG B NE     1 
ATOM   2504 C CZ     . ARG B 2 52  C 13.100  14.658  39.865  0.48  33.99 ? 65  ARG B CZ     1 
ATOM   2505 N NH1    . ARG B 2 52  C 12.324  14.622  40.922  0.48  34.56 ? 65  ARG B NH1    1 
ATOM   2506 N NH2    . ARG B 2 52  C 14.386  14.900  39.927  0.48  35.89 ? 65  ARG B NH2    1 
ATOM   2507 H H      . ARG B 2 52  C 8.467   15.055  35.513  1.00  23.41 ? 65  ARG B H      1 
ATOM   2508 H HA     . ARG B 2 52  C 10.987  16.318  34.592  1.00  24.15 ? 65  ARG B HA     1 
ATOM   2509 H HB2    . ARG B 2 52  C 10.493  13.715  36.067  1.00  25.52 ? 65  ARG B HB2    1 
ATOM   2510 H HB3    . ARG B 2 52  C 12.074  14.381  35.731  1.00  24.97 ? 65  ARG B HB3    1 
ATOM   2511 H HG2    . ARG B 2 52  C 11.661  16.312  37.189  0.48  26.72 ? 65  ARG B HG2    1 
ATOM   2512 H HG3    . ARG B 2 52  C 9.939   15.990  37.270  0.48  26.91 ? 65  ARG B HG3    1 
ATOM   2513 H HD2    . ARG B 2 52  C 10.656  15.103  39.303  0.48  29.23 ? 65  ARG B HD2    1 
ATOM   2514 H HD3    . ARG B 2 52  C 10.729  13.663  38.303  0.48  29.09 ? 65  ARG B HD3    1 
ATOM   2515 H HE     . ARG B 2 52  C 13.160  14.141  37.958  0.48  32.01 ? 65  ARG B HE     1 
ATOM   2516 H HH11   . ARG B 2 52  C 12.705  14.791  41.831  0.48  34.48 ? 65  ARG B HH11   1 
ATOM   2517 H HH12   . ARG B 2 52  C 11.349  14.426  40.824  0.48  34.13 ? 65  ARG B HH12   1 
ATOM   2518 H HH21   . ARG B 2 52  C 14.932  14.916  39.089  0.48  35.17 ? 65  ARG B HH21   1 
ATOM   2519 H HH22   . ARG B 2 52  C 14.826  15.067  40.810  0.48  35.33 ? 65  ARG B HH22   1 
ATOM   2520 N N      . TRP B 2 53  D 9.586   14.285  32.746  1.00  19.69 ? 65  TRP B N      1 
ATOM   2521 C CA     . TRP B 2 53  D 9.743   13.512  31.492  1.00  18.41 ? 65  TRP B CA     1 
ATOM   2522 C C      . TRP B 2 53  D 9.546   14.480  30.284  1.00  19.26 ? 65  TRP B C      1 
ATOM   2523 O O      . TRP B 2 53  D 8.812   15.452  30.392  1.00  19.00 ? 65  TRP B O      1 
ATOM   2524 C CB     . TRP B 2 53  D 8.667   12.424  31.298  1.00  17.76 ? 65  TRP B CB     1 
ATOM   2525 C CG     . TRP B 2 53  D 8.807   11.161  32.132  1.00  16.64 ? 65  TRP B CG     1 
ATOM   2526 C CD1    . TRP B 2 53  D 8.230   10.943  33.347  1.00  18.70 ? 65  TRP B CD1    1 
ATOM   2527 C CD2    . TRP B 2 53  D 9.494   10.056  31.747  1.00  14.42 ? 65  TRP B CD2    1 
ATOM   2528 N NE1    . TRP B 2 53  D 8.606   9.698   33.619  1.00  17.76 ? 65  TRP B NE1    1 
ATOM   2529 C CE2    . TRP B 2 53  D 9.364   9.084   32.724  1.00  16.34 ? 65  TRP B CE2    1 
ATOM   2530 C CE3    . TRP B 2 53  D 10.251  9.789   30.605  1.00  13.66 ? 65  TRP B CE3    1 
ATOM   2531 C CZ2    . TRP B 2 53  D 9.976   7.842   32.571  1.00  14.97 ? 65  TRP B CZ2    1 
ATOM   2532 C CZ3    . TRP B 2 53  D 10.863  8.557   30.451  1.00  14.48 ? 65  TRP B CZ3    1 
ATOM   2533 C CH2    . TRP B 2 53  D 10.721  7.585   31.439  1.00  14.07 ? 65  TRP B CH2    1 
ATOM   2534 H H      . TRP B 2 53  D 8.692   14.574  33.030  1.00  18.23 ? 65  TRP B H      1 
ATOM   2535 H HA     . TRP B 2 53  D 10.727  13.073  31.454  1.00  20.01 ? 65  TRP B HA     1 
ATOM   2536 H HB2    . TRP B 2 53  D 7.704   12.861  31.514  1.00  16.51 ? 65  TRP B HB2    1 
ATOM   2537 H HB3    . TRP B 2 53  D 8.664   12.131  30.258  1.00  16.30 ? 65  TRP B HB3    1 
ATOM   2538 H HD1    . TRP B 2 53  D 7.627   11.617  33.938  1.00  16.85 ? 65  TRP B HD1    1 
ATOM   2539 H HE1    . TRP B 2 53  D 8.349   9.225   34.447  1.00  16.48 ? 65  TRP B HE1    1 
ATOM   2540 H HE3    . TRP B 2 53  D 10.364  10.544  29.840  1.00  13.15 ? 65  TRP B HE3    1 
ATOM   2541 H HZ2    . TRP B 2 53  D 9.871   7.077   33.327  1.00  14.09 ? 65  TRP B HZ2    1 
ATOM   2542 H HZ3    . TRP B 2 53  D 11.450  8.350   29.571  1.00  13.40 ? 65  TRP B HZ3    1 
ATOM   2543 H HH2    . TRP B 2 53  D 11.187  6.618   31.332  1.00  14.26 ? 65  TRP B HH2    1 
ATOM   2544 N N      . ARG B 2 54  E 10.206  14.186  29.192  1.00  16.07 ? 65  ARG B N      1 
ATOM   2545 C CA     . ARG B 2 54  E 10.108  14.973  27.936  1.00  19.09 ? 65  ARG B CA     1 
ATOM   2546 C C      . ARG B 2 54  E 10.067  13.936  26.825  1.00  18.55 ? 65  ARG B C      1 
ATOM   2547 O O      . ARG B 2 54  E 10.662  12.888  26.978  1.00  19.45 ? 65  ARG B O      1 
ATOM   2548 C CB     . ARG B 2 54  E 11.325  15.866  27.634  1.00  17.28 ? 65  ARG B CB     1 
ATOM   2549 C CG     . ARG B 2 54  E 11.329  17.102  28.572  1.00  17.91 ? 65  ARG B CG     1 
ATOM   2550 C CD     . ARG B 2 54  E 10.023  17.932  28.524  1.00  19.37 ? 65  ARG B CD     1 
ATOM   2551 N NE     . ARG B 2 54  E 10.250  19.128  29.366  1.00  18.72 ? 65  ARG B NE     1 
ATOM   2552 C CZ     . ARG B 2 54  E 9.806   19.204  30.587  1.00  17.59 ? 65  ARG B CZ     1 
ATOM   2553 N NH1    . ARG B 2 54  E 9.380   18.155  31.217  1.00  17.95 ? 65  ARG B NH1    1 
ATOM   2554 N NH2    . ARG B 2 54  E 9.809   20.360  31.164  1.00  20.07 ? 65  ARG B NH2    1 
ATOM   2555 H H      . ARG B 2 54  E 10.798  13.400  29.194  1.00  17.24 ? 65  ARG B H      1 
ATOM   2556 H HA     . ARG B 2 54  E 9.173   15.513  27.935  1.00  20.07 ? 65  ARG B HA     1 
ATOM   2557 H HB2    . ARG B 2 54  E 12.232  15.295  27.778  1.00  17.51 ? 65  ARG B HB2    1 
ATOM   2558 H HB3    . ARG B 2 54  E 11.316  16.188  26.603  1.00  17.47 ? 65  ARG B HB3    1 
ATOM   2559 H HG2    . ARG B 2 54  E 11.499  16.784  29.591  1.00  17.34 ? 65  ARG B HG2    1 
ATOM   2560 H HG3    . ARG B 2 54  E 12.143  17.748  28.271  1.00  17.94 ? 65  ARG B HG3    1 
ATOM   2561 H HD2    . ARG B 2 54  E 9.827   18.280  27.520  1.00  18.37 ? 65  ARG B HD2    1 
ATOM   2562 H HD3    . ARG B 2 54  E 9.171   17.387  28.902  1.00  18.60 ? 65  ARG B HD3    1 
ATOM   2563 H HE     . ARG B 2 54  E 10.751  19.881  28.995  1.00  18.28 ? 65  ARG B HE     1 
ATOM   2564 H HH11   . ARG B 2 54  E 9.031   18.254  32.145  1.00  16.85 ? 65  ARG B HH11   1 
ATOM   2565 H HH12   . ARG B 2 54  E 9.402   17.263  30.775  1.00  17.75 ? 65  ARG B HH12   1 
ATOM   2566 H HH21   . ARG B 2 54  E 10.153  21.168  30.690  1.00  18.38 ? 65  ARG B HH21   1 
ATOM   2567 H HH22   . ARG B 2 54  E 9.461   20.428  32.092  1.00  18.17 ? 65  ARG B HH22   1 
ATOM   2568 N N      . VAL B 2 55  ? 9.386   14.244  25.755  1.00  18.55 ? 66  VAL B N      1 
ATOM   2569 C CA     . VAL B 2 55  ? 9.274   13.341  24.587  1.00  18.07 ? 66  VAL B CA     1 
ATOM   2570 C C      . VAL B 2 55  ? 10.017  14.160  23.517  1.00  15.67 ? 66  VAL B C      1 
ATOM   2571 O O      . VAL B 2 55  ? 9.673   15.311  23.305  1.00  17.16 ? 66  VAL B O      1 
ATOM   2572 C CB     . VAL B 2 55  ? 7.775   13.134  24.236  1.00  19.57 ? 66  VAL B CB     1 
ATOM   2573 C CG1    . VAL B 2 55  ? 7.649   12.288  22.938  1.00  20.58 ? 66  VAL B CG1    1 
ATOM   2574 C CG2    . VAL B 2 55  ? 7.148   12.429  25.467  1.00  22.75 ? 66  VAL B CG2    1 
ATOM   2575 H H      . VAL B 2 55  ? 8.922   15.108  25.703  1.00  19.90 ? 66  VAL B H      1 
ATOM   2576 H HA     . VAL B 2 55  ? 9.798   12.417  24.787  1.00  19.65 ? 66  VAL B HA     1 
ATOM   2577 H HB     . VAL B 2 55  ? 7.297   14.092  24.071  1.00  20.63 ? 66  VAL B HB     1 
ATOM   2578 H HG11   . VAL B 2 55  ? 8.118   11.320  23.051  1.00  19.98 ? 66  VAL B HG11   1 
ATOM   2579 H HG12   . VAL B 2 55  ? 8.116   12.800  22.108  1.00  19.29 ? 66  VAL B HG12   1 
ATOM   2580 H HG13   . VAL B 2 55  ? 6.610   12.145  22.687  1.00  20.59 ? 66  VAL B HG13   1 
ATOM   2581 H HG21   . VAL B 2 55  ? 6.099   12.231  25.306  1.00  23.20 ? 66  VAL B HG21   1 
ATOM   2582 H HG22   . VAL B 2 55  ? 7.240   13.061  26.340  1.00  22.49 ? 66  VAL B HG22   1 
ATOM   2583 H HG23   . VAL B 2 55  ? 7.645   11.497  25.682  1.00  22.59 ? 66  VAL B HG23   1 
ATOM   2584 N N      . PHE B 2 56  ? 10.975  13.532  22.899  1.00  13.62 ? 67  PHE B N      1 
ATOM   2585 C CA     . PHE B 2 56  ? 11.828  14.129  21.845  1.00  15.37 ? 67  PHE B CA     1 
ATOM   2586 C C      . PHE B 2 56  ? 11.464  13.450  20.551  1.00  18.65 ? 67  PHE B C      1 
ATOM   2587 O O      . PHE B 2 56  ? 11.499  12.227  20.459  1.00  14.78 ? 67  PHE B O      1 
ATOM   2588 C CB     . PHE B 2 56  ? 13.326  13.880  22.240  1.00  19.12 ? 67  PHE B CB     1 
ATOM   2589 C CG     . PHE B 2 56  ? 14.385  14.265  21.164  1.00  19.49 ? 67  PHE B CG     1 
ATOM   2590 C CD1    . PHE B 2 56  ? 14.778  15.574  20.968  1.00  21.90 ? 67  PHE B CD1    1 
ATOM   2591 C CD2    . PHE B 2 56  ? 14.998  13.282  20.378  1.00  19.78 ? 67  PHE B CD2    1 
ATOM   2592 C CE1    . PHE B 2 56  ? 15.746  15.890  20.030  1.00  22.07 ? 67  PHE B CE1    1 
ATOM   2593 C CE2    . PHE B 2 56  ? 15.969  13.603  19.440  1.00  22.30 ? 67  PHE B CE2    1 
ATOM   2594 C CZ     . PHE B 2 56  ? 16.346  14.918  19.265  1.00  22.60 ? 67  PHE B CZ     1 
ATOM   2595 H H      . PHE B 2 56  ? 11.131  12.596  23.144  1.00  14.63 ? 67  PHE B H      1 
ATOM   2596 H HA     . PHE B 2 56  ? 11.609  15.183  21.780  1.00  16.77 ? 67  PHE B HA     1 
ATOM   2597 H HB2    . PHE B 2 56  ? 13.541  14.445  23.133  1.00  18.69 ? 67  PHE B HB2    1 
ATOM   2598 H HB3    . PHE B 2 56  ? 13.445  12.839  22.482  1.00  18.35 ? 67  PHE B HB3    1 
ATOM   2599 H HD1    . PHE B 2 56  ? 14.330  16.365  21.550  1.00  22.11 ? 67  PHE B HD1    1 
ATOM   2600 H HD2    . PHE B 2 56  ? 14.728  12.242  20.484  1.00  20.94 ? 67  PHE B HD2    1 
ATOM   2601 H HE1    . PHE B 2 56  ? 16.043  16.917  19.886  1.00  23.96 ? 67  PHE B HE1    1 
ATOM   2602 H HE2    . PHE B 2 56  ? 16.428  12.821  18.849  1.00  21.14 ? 67  PHE B HE2    1 
ATOM   2603 H HZ     . PHE B 2 56  ? 17.109  15.174  18.543  1.00  22.22 ? 67  PHE B HZ     1 
ATOM   2604 N N      . ALA B 2 57  ? 11.130  14.282  19.605  1.00  17.72 ? 68  ALA B N      1 
ATOM   2605 C CA     . ALA B 2 57  ? 10.721  13.805  18.255  1.00  18.04 ? 68  ALA B CA     1 
ATOM   2606 C C      . ALA B 2 57  ? 11.251  14.604  17.094  1.00  16.99 ? 68  ALA B C      1 
ATOM   2607 O O      . ALA B 2 57  ? 11.690  15.725  17.238  1.00  17.87 ? 68  ALA B O      1 
ATOM   2608 C CB     . ALA B 2 57  ? 9.147   13.823  18.153  1.00  19.85 ? 68  ALA B CB     1 
ATOM   2609 H H      . ALA B 2 57  ? 11.154  15.249  19.781  1.00  17.41 ? 68  ALA B H      1 
ATOM   2610 H HA     . ALA B 2 57  ? 11.077  12.789  18.140  1.00  19.53 ? 68  ALA B HA     1 
ATOM   2611 H HB1    . ALA B 2 57  ? 8.829   13.463  17.184  1.00  19.14 ? 68  ALA B HB1    1 
ATOM   2612 H HB2    . ALA B 2 57  ? 8.778   14.832  18.278  1.00  18.46 ? 68  ALA B HB2    1 
ATOM   2613 H HB3    . ALA B 2 57  ? 8.704   13.202  18.913  1.00  19.21 ? 68  ALA B HB3    1 
ATOM   2614 N N      . GLY B 2 58  ? 11.181  13.993  15.951  1.00  16.49 ? 69  GLY B N      1 
ATOM   2615 C CA     . GLY B 2 58  ? 11.624  14.641  14.697  1.00  18.88 ? 69  GLY B CA     1 
ATOM   2616 C C      . GLY B 2 58  ? 13.071  14.713  14.362  1.00  17.64 ? 69  GLY B C      1 
ATOM   2617 O O      . GLY B 2 58  ? 13.381  15.501  13.489  1.00  19.60 ? 69  GLY B O      1 
ATOM   2618 H H      . GLY B 2 58  ? 10.826  13.076  15.909  1.00  17.04 ? 69  GLY B H      1 
ATOM   2619 H HA2    . GLY B 2 58  ? 11.132  14.119  13.887  1.00  18.21 ? 69  GLY B HA2    1 
ATOM   2620 H HA3    . GLY B 2 58  ? 11.246  15.653  14.712  1.00  18.04 ? 69  GLY B HA3    1 
ATOM   2621 N N      . ALA B 2 59  ? 13.905  13.951  15.015  1.00  20.80 ? 70  ALA B N      1 
ATOM   2622 C CA     . ALA B 2 59  ? 15.391  13.968  14.711  1.00  20.31 ? 70  ALA B CA     1 
ATOM   2623 C C      . ALA B 2 59  ? 15.925  12.547  14.949  1.00  17.09 ? 70  ALA B C      1 
ATOM   2624 O O      . ALA B 2 59  ? 15.310  11.815  15.704  1.00  18.12 ? 70  ALA B O      1 
ATOM   2625 C CB     . ALA B 2 59  ? 16.158  14.962  15.667  1.00  18.86 ? 70  ALA B CB     1 
ATOM   2626 H H      . ALA B 2 59  ? 13.574  13.342  15.715  1.00  18.93 ? 70  ALA B H      1 
ATOM   2627 H HA     . ALA B 2 59  ? 15.542  14.236  13.679  1.00  19.49 ? 70  ALA B HA     1 
ATOM   2628 H HB1    . ALA B 2 59  ? 17.213  14.932  15.450  1.00  18.40 ? 70  ALA B HB1    1 
ATOM   2629 H HB2    . ALA B 2 59  ? 16.010  14.669  16.694  1.00  18.53 ? 70  ALA B HB2    1 
ATOM   2630 H HB3    . ALA B 2 59  ? 15.812  15.976  15.536  1.00  19.05 ? 70  ALA B HB3    1 
ATOM   2631 N N      . VAL B 2 60  ? 17.016  12.188  14.335  1.00  16.84 ? 71  VAL B N      1 
ATOM   2632 C CA     . VAL B 2 60  ? 17.593  10.826  14.541  1.00  17.04 ? 71  VAL B CA     1 
ATOM   2633 C C      . VAL B 2 60  ? 18.850  10.983  15.465  1.00  18.88 ? 71  VAL B C      1 
ATOM   2634 O O      . VAL B 2 60  ? 19.316  10.008  16.028  1.00  17.54 ? 71  VAL B O      1 
ATOM   2635 C CB     . VAL B 2 60  ? 17.986  10.153  13.160  1.00  17.17 ? 71  VAL B CB     1 
ATOM   2636 C CG1    . VAL B 2 60  ? 16.683  9.758   12.463  1.00  18.80 ? 71  VAL B CG1    1 
ATOM   2637 C CG2    . VAL B 2 60  ? 18.816  11.006  12.185  1.00  15.55 ? 71  VAL B CG2    1 
ATOM   2638 H H      . VAL B 2 60  ? 17.457  12.826  13.734  1.00  17.98 ? 71  VAL B H      1 
ATOM   2639 H HA     . VAL B 2 60  ? 16.874  10.208  15.067  1.00  17.98 ? 71  VAL B HA     1 
ATOM   2640 H HB     . VAL B 2 60  ? 18.548  9.249   13.359  1.00  17.43 ? 71  VAL B HB     1 
ATOM   2641 H HG11   . VAL B 2 60  ? 16.058  10.618  12.266  1.00  17.92 ? 71  VAL B HG11   1 
ATOM   2642 H HG12   . VAL B 2 60  ? 16.122  9.079   13.094  1.00  18.03 ? 71  VAL B HG12   1 
ATOM   2643 H HG13   . VAL B 2 60  ? 16.907  9.254   11.534  1.00  17.74 ? 71  VAL B HG13   1 
ATOM   2644 H HG21   . VAL B 2 60  ? 19.058  10.431  11.302  1.00  14.66 ? 71  VAL B HG21   1 
ATOM   2645 H HG22   . VAL B 2 60  ? 19.745  11.302  12.654  1.00  15.57 ? 71  VAL B HG22   1 
ATOM   2646 H HG23   . VAL B 2 60  ? 18.282  11.896  11.892  1.00  15.78 ? 71  VAL B HG23   1 
ATOM   2647 N N      . ALA B 2 61  ? 19.361  12.181  15.612  1.00  16.98 ? 72  ALA B N      1 
ATOM   2648 C CA     . ALA B 2 61  ? 20.564  12.387  16.498  1.00  21.26 ? 72  ALA B CA     1 
ATOM   2649 C C      . ALA B 2 61  ? 20.026  12.891  17.837  1.00  20.57 ? 72  ALA B C      1 
ATOM   2650 O O      . ALA B 2 61  ? 19.304  13.877  17.873  1.00  19.25 ? 72  ALA B O      1 
ATOM   2651 C CB     . ALA B 2 61  ? 21.505  13.450  15.902  1.00  19.71 ? 72  ALA B CB     1 
ATOM   2652 H H      . ALA B 2 61  ? 18.965  12.951  15.147  1.00  18.61 ? 72  ALA B H      1 
ATOM   2653 H HA     . ALA B 2 61  ? 21.085  11.449  16.629  1.00  19.77 ? 72  ALA B HA     1 
ATOM   2654 H HB1    . ALA B 2 61  ? 22.350  13.611  16.551  1.00  19.57 ? 72  ALA B HB1    1 
ATOM   2655 H HB2    . ALA B 2 61  ? 20.977  14.387  15.793  1.00  20.06 ? 72  ALA B HB2    1 
ATOM   2656 H HB3    . ALA B 2 61  ? 21.861  13.128  14.934  1.00  19.66 ? 72  ALA B HB3    1 
ATOM   2657 N N      . GLN B 2 62  ? 20.392  12.219  18.899  1.00  19.58 ? 73  GLN B N      1 
ATOM   2658 C CA     . GLN B 2 62  ? 19.910  12.633  20.243  1.00  19.72 ? 73  GLN B CA     1 
ATOM   2659 C C      . GLN B 2 62  ? 20.253  14.073  20.572  1.00  22.67 ? 73  GLN B C      1 
ATOM   2660 O O      . GLN B 2 62  ? 19.535  14.731  21.303  1.00  23.84 ? 73  GLN B O      1 
ATOM   2661 C CB     A GLN B 2 62  ? 20.519  11.690  21.259  0.70  23.35 ? 73  GLN B CB     1 
ATOM   2662 C CB     B GLN B 2 62  ? 20.531  11.752  21.372  0.31  19.40 ? 73  GLN B CB     1 
ATOM   2663 C CG     A GLN B 2 62  ? 19.911  10.278  21.029  0.70  25.27 ? 73  GLN B CG     1 
ATOM   2664 C CG     B GLN B 2 62  ? 20.167  10.241  21.248  0.31  18.45 ? 73  GLN B CG     1 
ATOM   2665 C CD     A GLN B 2 62  ? 18.796  9.967   22.057  0.70  28.53 ? 73  GLN B CD     1 
ATOM   2666 C CD     B GLN B 2 62  ? 20.284  9.588   22.651  0.31  17.72 ? 73  GLN B CD     1 
ATOM   2667 O OE1    A GLN B 2 62  ? 17.713  10.522  22.088  0.70  21.80 ? 73  GLN B OE1    1 
ATOM   2668 O OE1    B GLN B 2 62  ? 19.673  10.069  23.591  0.31  20.39 ? 73  GLN B OE1    1 
ATOM   2669 N NE2    A GLN B 2 62  ? 19.042  9.051   22.952  0.70  34.32 ? 73  GLN B NE2    1 
ATOM   2670 N NE2    B GLN B 2 62  ? 21.018  8.532   22.856  0.31  13.47 ? 73  GLN B NE2    1 
ATOM   2671 H H      . GLN B 2 62  ? 20.987  11.446  18.801  1.00  20.05 ? 73  GLN B H      1 
ATOM   2672 H HA     . GLN B 2 62  ? 18.830  12.548  20.266  1.00  20.12 ? 73  GLN B HA     1 
ATOM   2673 H HB2    A GLN B 2 62  ? 21.593  11.669  21.153  0.70  22.79 ? 73  GLN B HB2    1 
ATOM   2674 H HB2    B GLN B 2 62  ? 21.606  11.861  21.366  0.31  19.07 ? 73  GLN B HB2    1 
ATOM   2675 H HB3    A GLN B 2 62  ? 20.277  12.046  22.251  0.70  22.95 ? 73  GLN B HB3    1 
ATOM   2676 H HB3    B GLN B 2 62  ? 20.175  12.122  22.324  0.31  19.19 ? 73  GLN B HB3    1 
ATOM   2677 H HG2    A GLN B 2 62  ? 19.469  10.209  20.048  0.70  25.71 ? 73  GLN B HG2    1 
ATOM   2678 H HG2    B GLN B 2 62  ? 19.155  10.108  20.891  0.31  18.46 ? 73  GLN B HG2    1 
ATOM   2679 H HG3    A GLN B 2 62  ? 20.686  9.526   21.097  0.70  25.47 ? 73  GLN B HG3    1 
ATOM   2680 H HG3    B GLN B 2 62  ? 20.846  9.743   20.572  0.31  18.23 ? 73  GLN B HG3    1 
ATOM   2681 H HE21   A GLN B 2 62  ? 19.914  8.593   22.953  0.70  32.91 ? 73  GLN B HE21   1 
ATOM   2682 H HE21   B GLN B 2 62  ? 21.516  8.111   22.121  0.31  13.91 ? 73  GLN B HE21   1 
ATOM   2683 H HE22   A GLN B 2 62  ? 18.382  8.811   23.621  0.70  32.88 ? 73  GLN B HE22   1 
ATOM   2684 H HE22   B GLN B 2 62  ? 21.072  8.148   23.758  0.31  13.86 ? 73  GLN B HE22   1 
ATOM   2685 N N      . ALA B 2 63  ? 21.347  14.534  20.036  1.00  25.66 ? 74  ALA B N      1 
ATOM   2686 C CA     . ALA B 2 63  ? 21.763  15.945  20.315  1.00  30.74 ? 74  ALA B CA     1 
ATOM   2687 C C      . ALA B 2 63  ? 21.427  16.896  19.156  1.00  36.03 ? 74  ALA B C      1 
ATOM   2688 O O      . ALA B 2 63  ? 22.182  17.805  18.855  1.00  41.98 ? 74  ALA B O      1 
ATOM   2689 C CB     . ALA B 2 63  ? 23.267  15.945  20.573  1.00  30.85 ? 74  ALA B CB     1 
ATOM   2690 H H      . ALA B 2 63  ? 21.895  13.960  19.458  1.00  24.97 ? 74  ALA B H      1 
ATOM   2691 H HA     . ALA B 2 63  ? 21.263  16.304  21.206  1.00  29.40 ? 74  ALA B HA     1 
ATOM   2692 H HB1    . ALA B 2 63  ? 23.584  16.957  20.778  1.00  30.89 ? 74  ALA B HB1    1 
ATOM   2693 H HB2    . ALA B 2 63  ? 23.795  15.590  19.699  1.00  30.29 ? 74  ALA B HB2    1 
ATOM   2694 H HB3    . ALA B 2 63  ? 23.505  15.321  21.421  1.00  30.43 ? 74  ALA B HB3    1 
ATOM   2695 N N      . SER B 2 64  ? 20.301  16.678  18.529  1.00  38.44 ? 75  SER B N      1 
ATOM   2696 C CA     . SER B 2 64  ? 19.916  17.562  17.403  1.00  36.72 ? 75  SER B CA     1 
ATOM   2697 C C      . SER B 2 64  ? 19.169  18.706  18.107  1.00  40.36 ? 75  SER B C      1 
ATOM   2698 O O      . SER B 2 64  ? 18.290  18.480  18.938  1.00  42.95 ? 75  SER B O      1 
ATOM   2699 C CB     . SER B 2 64  ? 18.945  16.878  16.446  1.00  35.99 ? 75  SER B CB     1 
ATOM   2700 O OG     . SER B 2 64  ? 18.632  17.887  15.484  1.00  36.66 ? 75  SER B OG     1 
ATOM   2701 H H      . SER B 2 64  ? 19.717  15.939  18.800  1.00  39.57 ? 75  SER B H      1 
ATOM   2702 H HA     . SER B 2 64  ? 20.813  17.888  16.903  1.00  36.51 ? 75  SER B HA     1 
ATOM   2703 H HB2    . SER B 2 64  ? 19.407  16.030  15.957  1.00  36.27 ? 75  SER B HB2    1 
ATOM   2704 H HB3    . SER B 2 64  ? 18.043  16.565  16.952  1.00  35.93 ? 75  SER B HB3    1 
ATOM   2705 H HG     . SER B 2 64  ? 18.667  17.427  14.630  1.00  36.76 ? 75  SER B HG     1 
ATOM   2706 N N      . PRO B 2 65  ? 19.525  19.920  17.758  1.00  40.90 ? 76  PRO B N      1 
ATOM   2707 C CA     . PRO B 2 65  ? 18.788  21.125  18.222  1.00  43.18 ? 76  PRO B CA     1 
ATOM   2708 C C      . PRO B 2 65  ? 17.458  21.271  17.457  1.00  42.32 ? 76  PRO B C      1 
ATOM   2709 O O      . PRO B 2 65  ? 16.599  22.036  17.864  1.00  45.39 ? 76  PRO B O      1 
ATOM   2710 C CB     . PRO B 2 65  ? 19.782  22.269  17.968  0.62  41.89 ? 76  PRO B CB     1 
ATOM   2711 C CG     . PRO B 2 65  ? 20.510  21.789  16.669  0.62  40.77 ? 76  PRO B CG     1 
ATOM   2712 C CD     . PRO B 2 65  ? 20.691  20.266  16.886  0.62  40.25 ? 76  PRO B CD     1 
ATOM   2713 H HA     . PRO B 2 65  ? 18.576  21.021  19.280  1.00  42.81 ? 76  PRO B HA     1 
ATOM   2714 H HB2    . PRO B 2 65  ? 19.264  23.204  17.796  0.62  41.62 ? 76  PRO B HB2    1 
ATOM   2715 H HB3    . PRO B 2 65  ? 20.475  22.371  18.792  0.62  41.65 ? 76  PRO B HB3    1 
ATOM   2716 H HG2    . PRO B 2 65  ? 19.915  22.000  15.793  0.62  41.03 ? 76  PRO B HG2    1 
ATOM   2717 H HG3    . PRO B 2 65  ? 21.473  22.266  16.563  0.62  40.79 ? 76  PRO B HG3    1 
ATOM   2718 H HD2    . PRO B 2 65  ? 20.640  19.718  15.955  0.62  40.31 ? 76  PRO B HD2    1 
ATOM   2719 H HD3    . PRO B 2 65  ? 21.610  20.027  17.407  0.62  40.57 ? 76  PRO B HD3    1 
ATOM   2720 N N      . HIS B 2 66  ? 17.352  20.515  16.396  1.00  40.82 ? 77  HIS B N      1 
ATOM   2721 C CA     . HIS B 2 66  ? 16.125  20.560  15.541  1.00  40.94 ? 77  HIS B CA     1 
ATOM   2722 C C      . HIS B 2 66  ? 15.011  19.557  15.878  1.00  38.10 ? 77  HIS B C      1 
ATOM   2723 O O      . HIS B 2 66  ? 14.081  19.385  15.108  1.00  42.53 ? 77  HIS B O      1 
ATOM   2724 C CB     . HIS B 2 66  ? 16.505  20.316  14.091  1.00  41.14 ? 77  HIS B CB     1 
ATOM   2725 C CG     . HIS B 2 66  ? 17.581  21.286  13.606  1.00  42.29 ? 77  HIS B CG     1 
ATOM   2726 N ND1    . HIS B 2 66  ? 18.847  21.092  13.770  0.15  41.24 ? 77  HIS B ND1    1 
ATOM   2727 C CD2    . HIS B 2 66  ? 17.486  22.488  12.933  0.15  40.52 ? 77  HIS B CD2    1 
ATOM   2728 C CE1    . HIS B 2 66  ? 19.498  22.084  13.246  0.15  41.26 ? 77  HIS B CE1    1 
ATOM   2729 N NE2    . HIS B 2 66  ? 18.691  22.973  12.716  0.15  40.58 ? 77  HIS B NE2    1 
ATOM   2730 H H      . HIS B 2 66  ? 18.084  19.902  16.159  1.00  40.91 ? 77  HIS B H      1 
ATOM   2731 H HA     . HIS B 2 66  ? 15.701  21.552  15.623  1.00  41.32 ? 77  HIS B HA     1 
ATOM   2732 H HB2    . HIS B 2 66  ? 16.854  19.297  13.989  1.00  41.82 ? 77  HIS B HB2    1 
ATOM   2733 H HB3    . HIS B 2 66  ? 15.625  20.429  13.473  1.00  42.07 ? 77  HIS B HB3    1 
ATOM   2734 H HD1    . HIS B 2 66  ? 19.244  20.309  14.218  0.15  41.38 ? 77  HIS B HD1    1 
ATOM   2735 H HD2    . HIS B 2 66  ? 16.562  22.961  12.629  0.15  41.19 ? 77  HIS B HD2    1 
ATOM   2736 H HE1    . HIS B 2 66  ? 20.576  22.171  13.240  0.15  41.53 ? 77  HIS B HE1    1 
ATOM   2737 N N      . GLY B 2 67  ? 15.093  18.905  16.988  1.00  34.16 ? 78  GLY B N      1 
ATOM   2738 C CA     . GLY B 2 67  ? 13.995  17.944  17.295  1.00  31.94 ? 78  GLY B CA     1 
ATOM   2739 C C      . GLY B 2 67  ? 13.057  18.780  18.157  1.00  31.06 ? 78  GLY B C      1 
ATOM   2740 O O      . GLY B 2 67  ? 13.418  19.875  18.559  1.00  33.72 ? 78  GLY B O      1 
ATOM   2741 H H      . GLY B 2 67  ? 15.843  19.046  17.596  1.00  34.04 ? 78  GLY B H      1 
ATOM   2742 H HA2    . GLY B 2 67  ? 13.489  17.611  16.400  1.00  31.81 ? 78  GLY B HA2    1 
ATOM   2743 H HA3    . GLY B 2 67  ? 14.375  17.108  17.861  1.00  32.02 ? 78  GLY B HA3    1 
ATOM   2744 N N      . LEU B 2 68  ? 11.902  18.273  18.438  1.00  26.25 ? 81  LEU B N      1 
ATOM   2745 C CA     . LEU B 2 68  ? 10.936  19.014  19.268  1.00  23.79 ? 81  LEU B CA     1 
ATOM   2746 C C      . LEU B 2 68  ? 10.884  18.186  20.531  1.00  21.31 ? 81  LEU B C      1 
ATOM   2747 O O      . LEU B 2 68  ? 11.033  16.974  20.459  1.00  16.93 ? 81  LEU B O      1 
ATOM   2748 C CB     . LEU B 2 68  ? 9.525   19.037  18.619  1.00  27.48 ? 81  LEU B CB     1 
ATOM   2749 C CG     . LEU B 2 68  ? 9.435   19.899  17.345  1.00  30.15 ? 81  LEU B CG     1 
ATOM   2750 C CD1    . LEU B 2 68  ? 8.020   19.735  16.716  1.00  29.72 ? 81  LEU B CD1    1 
ATOM   2751 C CD2    . LEU B 2 68  ? 9.632   21.398  17.740  1.00  32.36 ? 81  LEU B CD2    1 
ATOM   2752 H H      . LEU B 2 68  ? 11.660  17.382  18.110  1.00  26.83 ? 81  LEU B H      1 
ATOM   2753 H HA     . LEU B 2 68  ? 11.315  20.002  19.491  1.00  24.31 ? 81  LEU B HA     1 
ATOM   2754 H HB2    . LEU B 2 68  ? 9.265   18.015  18.377  1.00  28.13 ? 81  LEU B HB2    1 
ATOM   2755 H HB3    . LEU B 2 68  ? 8.817   19.388  19.358  1.00  27.70 ? 81  LEU B HB3    1 
ATOM   2756 H HG     . LEU B 2 68  ? 10.193  19.591  16.635  1.00  30.20 ? 81  LEU B HG     1 
ATOM   2757 H HD11   . LEU B 2 68  ? 7.251   20.054  17.405  1.00  29.26 ? 81  LEU B HD11   1 
ATOM   2758 H HD12   . LEU B 2 68  ? 7.842   18.702  16.451  1.00  29.80 ? 81  LEU B HD12   1 
ATOM   2759 H HD13   . LEU B 2 68  ? 7.935   20.324  15.811  1.00  29.42 ? 81  LEU B HD13   1 
ATOM   2760 H HD21   . LEU B 2 68  ? 9.552   22.024  16.863  1.00  32.24 ? 81  LEU B HD21   1 
ATOM   2761 H HD22   . LEU B 2 68  ? 10.622  21.548  18.153  1.00  31.98 ? 81  LEU B HD22   1 
ATOM   2762 H HD23   . LEU B 2 68  ? 8.900   21.731  18.459  1.00  31.73 ? 81  LEU B HD23   1 
ATOM   2763 N N      . GLN B 2 69  ? 10.670  18.873  21.615  1.00  19.33 ? 82  GLN B N      1 
ATOM   2764 C CA     . GLN B 2 69  ? 10.580  18.268  22.964  1.00  23.73 ? 82  GLN B CA     1 
ATOM   2765 C C      . GLN B 2 69  ? 9.330   18.767  23.648  1.00  24.94 ? 82  GLN B C      1 
ATOM   2766 O O      . GLN B 2 69  ? 9.251   19.958  23.879  1.00  26.31 ? 82  GLN B O      1 
ATOM   2767 C CB     . GLN B 2 69  ? 11.780  18.660  23.856  1.00  26.34 ? 82  GLN B CB     1 
ATOM   2768 C CG     . GLN B 2 69  ? 13.030  17.898  23.459  1.00  31.56 ? 82  GLN B CG     1 
ATOM   2769 C CD     . GLN B 2 69  ? 14.101  18.157  24.520  1.00  34.84 ? 82  GLN B CD     1 
ATOM   2770 O OE1    . GLN B 2 69  ? 13.917  17.866  25.687  1.00  34.00 ? 82  GLN B OE1    1 
ATOM   2771 N NE2    . GLN B 2 69  ? 15.233  18.693  24.179  1.00  36.28 ? 82  GLN B NE2    1 
ATOM   2772 H H      . GLN B 2 69  ? 10.560  19.840  21.535  1.00  21.75 ? 82  GLN B H      1 
ATOM   2773 H HA     . GLN B 2 69  ? 10.522  17.203  22.849  1.00  23.38 ? 82  GLN B HA     1 
ATOM   2774 H HB2    . GLN B 2 69  ? 11.959  19.723  23.805  1.00  26.54 ? 82  GLN B HB2    1 
ATOM   2775 H HB3    . GLN B 2 69  ? 11.551  18.423  24.886  1.00  27.30 ? 82  GLN B HB3    1 
ATOM   2776 H HG2    . GLN B 2 69  ? 12.834  16.836  23.423  1.00  31.39 ? 82  GLN B HG2    1 
ATOM   2777 H HG3    . GLN B 2 69  ? 13.385  18.236  22.498  1.00  31.14 ? 82  GLN B HG3    1 
ATOM   2778 H HE21   . GLN B 2 69  ? 15.406  18.932  23.245  1.00  35.36 ? 82  GLN B HE21   1 
ATOM   2779 H HE22   . GLN B 2 69  ? 15.922  18.862  24.858  1.00  36.38 ? 82  GLN B HE22   1 
ATOM   2780 N N      . LEU B 2 70  ? 8.420   17.891  23.953  1.00  22.71 ? 83  LEU B N      1 
ATOM   2781 C CA     . LEU B 2 70  ? 7.155   18.298  24.635  1.00  23.06 ? 83  LEU B CA     1 
ATOM   2782 C C      . LEU B 2 70  ? 7.040   17.557  25.965  1.00  21.49 ? 83  LEU B C      1 
ATOM   2783 O O      . LEU B 2 70  ? 7.696   16.555  26.182  1.00  22.14 ? 83  LEU B O      1 
ATOM   2784 C CB     . LEU B 2 70  ? 5.868   17.920  23.812  1.00  23.88 ? 83  LEU B CB     1 
ATOM   2785 C CG     . LEU B 2 70  ? 5.796   18.533  22.417  1.00  25.85 ? 83  LEU B CG     1 
ATOM   2786 C CD1    . LEU B 2 70  ? 4.392   18.173  21.840  1.00  29.00 ? 83  LEU B CD1    1 
ATOM   2787 C CD2    . LEU B 2 70  ? 5.854   20.067  22.495  1.00  27.00 ? 83  LEU B CD2    1 
ATOM   2788 H H      . LEU B 2 70  ? 8.575   16.945  23.736  1.00  23.24 ? 83  LEU B H      1 
ATOM   2789 H HA     . LEU B 2 70  ? 7.199   19.357  24.848  1.00  23.12 ? 83  LEU B HA     1 
ATOM   2790 H HB2    . LEU B 2 70  ? 5.831   16.840  23.729  1.00  23.74 ? 83  LEU B HB2    1 
ATOM   2791 H HB3    . LEU B 2 70  ? 4.997   18.218  24.383  1.00  23.74 ? 83  LEU B HB3    1 
ATOM   2792 H HG     . LEU B 2 70  ? 6.587   18.143  21.793  1.00  26.16 ? 83  LEU B HG     1 
ATOM   2793 H HD11   . LEU B 2 70  ? 3.634   18.622  22.463  1.00  28.18 ? 83  LEU B HD11   1 
ATOM   2794 H HD12   . LEU B 2 70  ? 4.217   17.106  21.830  1.00  28.09 ? 83  LEU B HD12   1 
ATOM   2795 H HD13   . LEU B 2 70  ? 4.254   18.543  20.833  1.00  28.44 ? 83  LEU B HD13   1 
ATOM   2796 H HD21   . LEU B 2 70  ? 5.789   20.491  21.503  1.00  26.71 ? 83  LEU B HD21   1 
ATOM   2797 H HD22   . LEU B 2 70  ? 6.787   20.392  22.936  1.00  27.41 ? 83  LEU B HD22   1 
ATOM   2798 H HD23   . LEU B 2 70  ? 5.036   20.449  23.091  1.00  26.31 ? 83  LEU B HD23   1 
ATOM   2799 N N      . GLY B 2 71  ? 6.191   18.067  26.795  1.00  19.26 ? 84  GLY B N      1 
ATOM   2800 C CA     . GLY B 2 71  ? 5.940   17.499  28.126  1.00  21.37 ? 84  GLY B CA     1 
ATOM   2801 C C      . GLY B 2 71  ? 4.880   16.413  28.017  1.00  21.69 ? 84  GLY B C      1 
ATOM   2802 O O      . GLY B 2 71  ? 4.324   16.155  26.958  1.00  19.65 ? 84  GLY B O      1 
ATOM   2803 H H      . GLY B 2 71  ? 5.679   18.861  26.541  1.00  21.25 ? 84  GLY B H      1 
ATOM   2804 H HA2    . GLY B 2 71  ? 6.848   17.076  28.524  1.00  20.71 ? 84  GLY B HA2    1 
ATOM   2805 H HA3    . GLY B 2 71  ? 5.568   18.272  28.777  1.00  20.01 ? 84  GLY B HA3    1 
ATOM   2806 N N      . VAL B 2 72  ? 4.672   15.840  29.160  1.00  24.09 ? 85  VAL B N      1 
ATOM   2807 C CA     . VAL B 2 72  ? 3.722   14.742  29.382  1.00  27.99 ? 85  VAL B CA     1 
ATOM   2808 C C      . VAL B 2 72  ? 2.600   15.200  30.315  1.00  27.93 ? 85  VAL B C      1 
ATOM   2809 O O      . VAL B 2 72  ? 2.824   15.775  31.359  1.00  28.11 ? 85  VAL B O      1 
ATOM   2810 C CB     . VAL B 2 72  ? 4.570   13.591  29.967  1.00  26.64 ? 85  VAL B CB     1 
ATOM   2811 C CG1    . VAL B 2 72  ? 3.739   12.404  30.454  1.00  28.01 ? 85  VAL B CG1    1 
ATOM   2812 C CG2    . VAL B 2 72  ? 5.566   13.150  28.866  1.00  27.89 ? 85  VAL B CG2    1 
ATOM   2813 H H      . VAL B 2 72  ? 5.161   16.152  29.940  1.00  23.40 ? 85  VAL B H      1 
ATOM   2814 H HA     . VAL B 2 72  ? 3.301   14.465  28.425  1.00  27.22 ? 85  VAL B HA     1 
ATOM   2815 H HB     . VAL B 2 72  ? 5.113   13.983  30.818  1.00  27.69 ? 85  VAL B HB     1 
ATOM   2816 H HG11   . VAL B 2 72  ? 3.137   11.989  29.659  1.00  28.53 ? 85  VAL B HG11   1 
ATOM   2817 H HG12   . VAL B 2 72  ? 3.084   12.726  31.252  1.00  27.87 ? 85  VAL B HG12   1 
ATOM   2818 H HG13   . VAL B 2 72  ? 4.383   11.629  30.845  1.00  28.16 ? 85  VAL B HG13   1 
ATOM   2819 H HG21   . VAL B 2 72  ? 6.189   12.337  29.210  1.00  27.81 ? 85  VAL B HG21   1 
ATOM   2820 H HG22   . VAL B 2 72  ? 6.204   13.980  28.592  1.00  27.41 ? 85  VAL B HG22   1 
ATOM   2821 H HG23   . VAL B 2 72  ? 5.040   12.836  27.978  1.00  27.74 ? 85  VAL B HG23   1 
ATOM   2822 N N      . GLN B 2 73  ? 1.417   14.905  29.899  1.00  26.10 ? 86  GLN B N      1 
ATOM   2823 C CA     . GLN B 2 73  ? 0.197   15.256  30.653  1.00  29.17 ? 86  GLN B CA     1 
ATOM   2824 C C      . GLN B 2 73  ? -0.217  14.049  31.457  1.00  23.81 ? 86  GLN B C      1 
ATOM   2825 O O      . GLN B 2 73  ? -0.598  14.194  32.597  1.00  26.28 ? 86  GLN B O      1 
ATOM   2826 C CB     . GLN B 2 73  ? -0.863  15.660  29.619  1.00  34.26 ? 86  GLN B CB     1 
ATOM   2827 C CG     . GLN B 2 73  ? -2.274  15.626  30.185  1.00  41.10 ? 86  GLN B CG     1 
ATOM   2828 C CD     . GLN B 2 73  ? -3.111  16.422  29.196  1.00  45.26 ? 86  GLN B CD     1 
ATOM   2829 O OE1    . GLN B 2 73  ? -3.096  16.203  28.004  1.00  49.55 ? 86  GLN B OE1    1 
ATOM   2830 N NE2    . GLN B 2 73  ? -3.866  17.373  29.623  1.00  49.47 ? 86  GLN B NE2    1 
ATOM   2831 H H      . GLN B 2 73  ? 1.342   14.433  29.049  1.00  27.00 ? 86  GLN B H      1 
ATOM   2832 H HA     . GLN B 2 73  ? 0.416   16.065  31.339  1.00  28.31 ? 86  GLN B HA     1 
ATOM   2833 H HB2    . GLN B 2 73  ? -0.647  16.652  29.261  1.00  34.54 ? 86  GLN B HB2    1 
ATOM   2834 H HB3    . GLN B 2 73  ? -0.842  14.992  28.770  1.00  34.62 ? 86  GLN B HB3    1 
ATOM   2835 H HG2    . GLN B 2 73  ? -2.657  14.615  30.233  1.00  40.55 ? 86  GLN B HG2    1 
ATOM   2836 H HG3    . GLN B 2 73  ? -2.324  16.074  31.167  1.00  40.82 ? 86  GLN B HG3    1 
ATOM   2837 H HE21   . GLN B 2 73  ? -3.908  17.572  30.580  1.00  49.22 ? 86  GLN B HE21   1 
ATOM   2838 H HE22   . GLN B 2 73  ? -4.391  17.886  28.976  1.00  49.46 ? 86  GLN B HE22   1 
ATOM   2839 N N      . ALA B 2 74  ? -0.160  12.884  30.878  1.00  20.41 ? 87  ALA B N      1 
ATOM   2840 C CA     . ALA B 2 74  ? -0.555  11.684  31.633  1.00  18.16 ? 87  ALA B CA     1 
ATOM   2841 C C      . ALA B 2 74  ? 0.052   10.446  31.054  1.00  18.07 ? 87  ALA B C      1 
ATOM   2842 O O      . ALA B 2 74  ? 0.469   10.459  29.908  1.00  19.85 ? 87  ALA B O      1 
ATOM   2843 C CB     . ALA B 2 74  ? -2.048  11.497  31.591  1.00  25.03 ? 87  ALA B CB     1 
ATOM   2844 H H      . ALA B 2 74  ? 0.146   12.795  29.948  1.00  20.18 ? 87  ALA B H      1 
ATOM   2845 H HA     . ALA B 2 74  ? -0.218  11.791  32.650  1.00  20.00 ? 87  ALA B HA     1 
ATOM   2846 H HB1    . ALA B 2 74  ? -2.326  10.625  32.169  1.00  23.81 ? 87  ALA B HB1    1 
ATOM   2847 H HB2    . ALA B 2 74  ? -2.367  11.349  30.567  1.00  23.16 ? 87  ALA B HB2    1 
ATOM   2848 H HB3    . ALA B 2 74  ? -2.561  12.356  31.994  1.00  24.00 ? 87  ALA B HB3    1 
ATOM   2849 N N      . VAL B 2 75  ? 0.067   9.427   31.857  1.00  19.16 ? 88  VAL B N      1 
ATOM   2850 C CA     . VAL B 2 75  ? 0.618   8.124   31.438  1.00  19.82 ? 88  VAL B CA     1 
ATOM   2851 C C      . VAL B 2 75  ? -0.468  7.184   31.955  1.00  21.93 ? 88  VAL B C      1 
ATOM   2852 O O      . VAL B 2 75  ? -0.886  7.302   33.092  1.00  23.19 ? 88  VAL B O      1 
ATOM   2853 C CB     . VAL B 2 75  ? 1.993   7.813   32.136  1.00  22.41 ? 88  VAL B CB     1 
ATOM   2854 C CG1    . VAL B 2 75  ? 2.426   6.386   31.754  1.00  20.62 ? 88  VAL B CG1    1 
ATOM   2855 C CG2    . VAL B 2 75  ? 3.117   8.830   31.679  1.00  22.97 ? 88  VAL B CG2    1 
ATOM   2856 H H      . VAL B 2 75  ? -0.301  9.498   32.766  1.00  17.48 ? 88  VAL B H      1 
ATOM   2857 H HA     . VAL B 2 75  ? 0.679   8.085   30.359  1.00  20.34 ? 88  VAL B HA     1 
ATOM   2858 H HB     . VAL B 2 75  ? 1.869   7.864   33.210  1.00  21.70 ? 88  VAL B HB     1 
ATOM   2859 H HG11   . VAL B 2 75  ? 2.531   6.292   30.682  1.00  21.35 ? 88  VAL B HG11   1 
ATOM   2860 H HG12   . VAL B 2 75  ? 1.696   5.667   32.093  1.00  20.71 ? 88  VAL B HG12   1 
ATOM   2861 H HG13   . VAL B 2 75  ? 3.374   6.147   32.218  1.00  21.59 ? 88  VAL B HG13   1 
ATOM   2862 H HG21   . VAL B 2 75  ? 4.053   8.604   32.172  1.00  23.08 ? 88  VAL B HG21   1 
ATOM   2863 H HG22   . VAL B 2 75  ? 2.833   9.838   31.940  1.00  23.11 ? 88  VAL B HG22   1 
ATOM   2864 H HG23   . VAL B 2 75  ? 3.274   8.785   30.612  1.00  22.84 ? 88  VAL B HG23   1 
ATOM   2865 N N      . VAL B 2 76  ? -0.882  6.287   31.109  1.00  24.29 ? 89  VAL B N      1 
ATOM   2866 C CA     . VAL B 2 76  ? -1.930  5.283   31.439  1.00  26.26 ? 89  VAL B CA     1 
ATOM   2867 C C      . VAL B 2 76  ? -1.172  3.965   31.266  1.00  28.25 ? 89  VAL B C      1 
ATOM   2868 O O      . VAL B 2 76  ? -0.734  3.706   30.151  1.00  25.92 ? 89  VAL B O      1 
ATOM   2869 C CB     . VAL B 2 76  ? -3.102  5.275   30.417  1.00  25.73 ? 89  VAL B CB     1 
ATOM   2870 C CG1    . VAL B 2 76  ? -4.194  4.271   30.885  1.00  27.10 ? 89  VAL B CG1    1 
ATOM   2871 C CG2    . VAL B 2 76  ? -3.677  6.678   30.229  1.00  26.46 ? 89  VAL B CG2    1 
ATOM   2872 H H      . VAL B 2 76  ? -0.479  6.269   30.213  1.00  24.94 ? 89  VAL B H      1 
ATOM   2873 H HA     . VAL B 2 76  ? -2.256  5.416   32.459  1.00  26.04 ? 89  VAL B HA     1 
ATOM   2874 H HB     . VAL B 2 76  ? -2.728  4.932   29.461  1.00  25.79 ? 89  VAL B HB     1 
ATOM   2875 H HG11   . VAL B 2 76  ? -4.586  4.528   31.857  1.00  25.88 ? 89  VAL B HG11   1 
ATOM   2876 H HG12   . VAL B 2 76  ? -3.790  3.269   30.947  1.00  26.10 ? 89  VAL B HG12   1 
ATOM   2877 H HG13   . VAL B 2 76  ? -5.011  4.259   30.178  1.00  26.29 ? 89  VAL B HG13   1 
ATOM   2878 H HG21   . VAL B 2 76  ? -4.488  6.665   29.515  1.00  26.36 ? 89  VAL B HG21   1 
ATOM   2879 H HG22   . VAL B 2 76  ? -2.918  7.356   29.861  1.00  26.40 ? 89  VAL B HG22   1 
ATOM   2880 H HG23   . VAL B 2 76  ? -4.045  7.063   31.171  1.00  26.68 ? 89  VAL B HG23   1 
ATOM   2881 N N      . TYR B 2 77  ? -1.020  3.180   32.295  1.00  28.66 ? 90  TYR B N      1 
ATOM   2882 C CA     . TYR B 2 77  ? -0.292  1.913   32.081  1.00  31.98 ? 90  TYR B CA     1 
ATOM   2883 C C      . TYR B 2 77  ? -1.283  0.821   32.336  1.00  30.91 ? 90  TYR B C      1 
ATOM   2884 O O      . TYR B 2 77  ? -2.316  1.022   32.948  1.00  27.91 ? 90  TYR B O      1 
ATOM   2885 C CB     . TYR B 2 77  ? 0.905   1.823   33.023  1.00  36.80 ? 90  TYR B CB     1 
ATOM   2886 C CG     . TYR B 2 77  ? 0.639   1.722   34.526  1.00  42.13 ? 90  TYR B CG     1 
ATOM   2887 C CD1    . TYR B 2 77  ? 0.466   0.477   35.127  1.00  45.11 ? 90  TYR B CD1    1 
ATOM   2888 C CD2    . TYR B 2 77  ? 0.634   2.862   35.312  1.00  44.15 ? 90  TYR B CD2    1 
ATOM   2889 C CE1    . TYR B 2 77  ? 0.302   0.371   36.490  1.00  45.92 ? 90  TYR B CE1    1 
ATOM   2890 C CE2    . TYR B 2 77  ? 0.469   2.751   36.675  1.00  45.90 ? 90  TYR B CE2    1 
ATOM   2891 C CZ     . TYR B 2 77  ? 0.306   1.511   37.274  1.00  47.17 ? 90  TYR B CZ     1 
ATOM   2892 O OH     . TYR B 2 77  ? 0.165   1.433   38.644  1.00  50.51 ? 90  TYR B OH     1 
ATOM   2893 H H      . TYR B 2 77  ? -1.382  3.411   33.179  1.00  28.58 ? 90  TYR B H      1 
ATOM   2894 H HA     . TYR B 2 77  ? 0.044   1.837   31.058  1.00  31.38 ? 90  TYR B HA     1 
ATOM   2895 H HB2    . TYR B 2 77  ? 1.473   0.950   32.733  1.00  36.71 ? 90  TYR B HB2    1 
ATOM   2896 H HB3    . TYR B 2 77  ? 1.538   2.680   32.850  1.00  37.15 ? 90  TYR B HB3    1 
ATOM   2897 H HD1    . TYR B 2 77  ? 0.456   -0.427  34.533  1.00  44.76 ? 90  TYR B HD1    1 
ATOM   2898 H HD2    . TYR B 2 77  ? 0.751   3.839   34.867  1.00  43.53 ? 90  TYR B HD2    1 
ATOM   2899 H HE1    . TYR B 2 77  ? 0.171   -0.608  36.937  1.00  45.71 ? 90  TYR B HE1    1 
ATOM   2900 H HE2    . TYR B 2 77  ? 0.464   3.641   37.286  1.00  45.89 ? 90  TYR B HE2    1 
ATOM   2901 H HH     . TYR B 2 77  ? -0.118  0.528   38.860  1.00  49.48 ? 90  TYR B HH     1 
ATOM   2902 N N      . HIS B 2 78  ? -0.914  -0.322  31.852  1.00  32.41 ? 91  HIS B N      1 
ATOM   2903 C CA     . HIS B 2 78  ? -1.787  -1.504  31.998  1.00  34.14 ? 91  HIS B CA     1 
ATOM   2904 C C      . HIS B 2 78  ? -1.848  -2.030  33.429  1.00  32.46 ? 91  HIS B C      1 
ATOM   2905 O O      . HIS B 2 78  ? -0.846  -2.420  33.998  1.00  30.49 ? 91  HIS B O      1 
ATOM   2906 C CB     . HIS B 2 78  ? -1.256  -2.592  31.039  1.00  36.94 ? 91  HIS B CB     1 
ATOM   2907 C CG     . HIS B 2 78  ? -2.425  -3.512  30.657  1.00  36.59 ? 91  HIS B CG     1 
ATOM   2908 N ND1    . HIS B 2 78  ? -3.097  -4.252  31.530  1.00  37.33 ? 91  HIS B ND1    1 
ATOM   2909 C CD2    . HIS B 2 78  ? -2.918  -3.684  29.388  1.00  35.16 ? 91  HIS B CD2    1 
ATOM   2910 C CE1    . HIS B 2 78  ? -3.988  -4.868  30.802  1.00  35.58 ? 91  HIS B CE1    1 
ATOM   2911 N NE2    . HIS B 2 78  ? -3.878  -4.534  29.556  1.00  36.98 ? 91  HIS B NE2    1 
ATOM   2912 H H      . HIS B 2 78  ? -0.056  -0.418  31.386  1.00  32.35 ? 91  HIS B H      1 
ATOM   2913 H HA     . HIS B 2 78  ? -2.778  -1.221  31.678  1.00  34.68 ? 91  HIS B HA     1 
ATOM   2914 H HB2    . HIS B 2 78  ? -0.849  -2.149  30.143  1.00  36.06 ? 91  HIS B HB2    1 
ATOM   2915 H HB3    . HIS B 2 78  ? -0.483  -3.179  31.521  1.00  36.23 ? 91  HIS B HB3    1 
ATOM   2916 H HD2    . HIS B 2 78  ? -2.583  -3.212  28.473  1.00  35.78 ? 91  HIS B HD2    1 
ATOM   2917 H HE1    . HIS B 2 78  ? -4.723  -5.557  31.187  1.00  36.07 ? 91  HIS B HE1    1 
ATOM   2918 H HE2    . HIS B 2 78  ? -4.442  -4.872  28.823  1.00  36.72 ? 91  HIS B HE2    1 
ATOM   2919 N N      . GLY B 2 79  ? -3.015  -2.035  33.991  1.00  34.42 ? 92  GLY B N      1 
ATOM   2920 C CA     . GLY B 2 79  ? -3.175  -2.538  35.381  1.00  37.46 ? 92  GLY B CA     1 
ATOM   2921 C C      . GLY B 2 79  ? -2.715  -4.013  35.458  1.00  41.49 ? 92  GLY B C      1 
ATOM   2922 O O      . GLY B 2 79  ? -2.245  -4.463  36.484  1.00  45.34 ? 92  GLY B O      1 
ATOM   2923 H H      . GLY B 2 79  ? -3.800  -1.702  33.493  1.00  33.39 ? 92  GLY B H      1 
ATOM   2924 H HA2    . GLY B 2 79  ? -2.570  -1.940  36.048  1.00  38.41 ? 92  GLY B HA2    1 
ATOM   2925 H HA3    . GLY B 2 79  ? -4.215  -2.468  35.663  1.00  38.59 ? 92  GLY B HA3    1 
ATOM   2926 N N      . GLY B 2 80  ? -2.834  -4.771  34.393  1.00  41.75 ? 93  GLY B N      1 
ATOM   2927 C CA     . GLY B 2 80  ? -2.390  -6.208  34.468  1.00  40.50 ? 93  GLY B CA     1 
ATOM   2928 C C      . GLY B 2 80  ? -0.860  -6.347  34.440  1.00  41.62 ? 93  GLY B C      1 
ATOM   2929 O O      . GLY B 2 80  ? -0.367  -7.459  34.317  1.00  36.56 ? 93  GLY B O      1 
ATOM   2930 H H      . GLY B 2 80  ? -3.208  -4.393  33.566  1.00  40.72 ? 93  GLY B H      1 
ATOM   2931 H HA2    . GLY B 2 80  ? -2.749  -6.640  35.392  1.00  40.95 ? 93  GLY B HA2    1 
ATOM   2932 H HA3    . GLY B 2 80  ? -2.806  -6.749  33.633  1.00  40.52 ? 93  GLY B HA3    1 
ATOM   2933 N N      . TYR B 2 81  ? -0.130  -5.254  34.564  1.00  43.08 ? 94  TYR B N      1 
ATOM   2934 C CA     . TYR B 2 81  ? 1.371   -5.341  34.537  1.00  42.57 ? 94  TYR B CA     1 
ATOM   2935 C C      . TYR B 2 81  ? 1.762   -5.587  35.986  1.00  45.47 ? 94  TYR B C      1 
ATOM   2936 O O      . TYR B 2 81  ? 2.215   -4.703  36.678  1.00  45.43 ? 94  TYR B O      1 
ATOM   2937 C CB     . TYR B 2 81  ? 2.050   -3.994  34.044  1.00  39.69 ? 94  TYR B CB     1 
ATOM   2938 C CG     . TYR B 2 81  ? 3.595   -4.215  33.924  1.00  35.15 ? 94  TYR B CG     1 
ATOM   2939 C CD1    . TYR B 2 81  ? 4.096   -5.189  33.055  1.00  32.30 ? 94  TYR B CD1    1 
ATOM   2940 C CD2    . TYR B 2 81  ? 4.508   -3.474  34.672  1.00  33.15 ? 94  TYR B CD2    1 
ATOM   2941 C CE1    . TYR B 2 81  ? 5.448   -5.427  32.928  1.00  30.12 ? 94  TYR B CE1    1 
ATOM   2942 C CE2    . TYR B 2 81  ? 5.878   -3.713  34.542  1.00  31.19 ? 94  TYR B CE2    1 
ATOM   2943 C CZ     . TYR B 2 81  ? 6.348   -4.695  33.667  1.00  30.82 ? 94  TYR B CZ     1 
ATOM   2944 O OH     . TYR B 2 81  ? 7.687   -4.982  33.494  1.00  32.72 ? 94  TYR B OH     1 
ATOM   2945 H H      . TYR B 2 81  ? -0.555  -4.375  34.686  1.00  42.37 ? 94  TYR B H      1 
ATOM   2946 H HA     . TYR B 2 81  ? 1.676   -6.178  33.928  1.00  42.52 ? 94  TYR B HA     1 
ATOM   2947 H HB2    . TYR B 2 81  ? 1.648   -3.701  33.084  1.00  39.37 ? 94  TYR B HB2    1 
ATOM   2948 H HB3    . TYR B 2 81  ? 1.860   -3.203  34.758  1.00  39.36 ? 94  TYR B HB3    1 
ATOM   2949 H HD1    . TYR B 2 81  ? 3.408   -5.769  32.463  1.00  32.20 ? 94  TYR B HD1    1 
ATOM   2950 H HD2    . TYR B 2 81  ? 4.158   -2.714  35.356  1.00  31.82 ? 94  TYR B HD2    1 
ATOM   2951 H HE1    . TYR B 2 81  ? 5.800   -6.185  32.247  1.00  29.88 ? 94  TYR B HE1    1 
ATOM   2952 H HE2    . TYR B 2 81  ? 6.562   -3.121  35.137  1.00  31.29 ? 94  TYR B HE2    1 
ATOM   2953 H HH     . TYR B 2 81  ? 8.060   -5.146  34.375  1.00  32.22 ? 94  TYR B HH     1 
ATOM   2954 N N      . LEU B 2 82  ? 1.537   -6.810  36.360  1.00  49.72 ? 95  LEU B N      1 
ATOM   2955 C CA     . LEU B 2 82  ? 1.834   -7.317  37.736  1.00  52.59 ? 95  LEU B CA     1 
ATOM   2956 C C      . LEU B 2 82  ? 3.099   -6.787  38.418  1.00  52.28 ? 95  LEU B C      1 
ATOM   2957 O O      . LEU B 2 82  ? 3.059   -6.588  39.614  1.00  51.75 ? 95  LEU B O      1 
ATOM   2958 C CB     . LEU B 2 82  ? 1.913   -8.860  37.707  1.00  54.13 ? 95  LEU B CB     1 
ATOM   2959 C CG     . LEU B 2 82  ? 0.629   -9.460  37.076  1.00  55.11 ? 95  LEU B CG     1 
ATOM   2960 C CD1    . LEU B 2 82  ? 0.806   -10.993 37.030  1.00  55.56 ? 95  LEU B CD1    1 
ATOM   2961 C CD2    . LEU B 2 82  ? -0.595  -9.092  37.933  1.00  55.57 ? 95  LEU B CD2    1 
ATOM   2962 H H      . LEU B 2 82  ? 1.148   -7.411  35.698  1.00  48.28 ? 95  LEU B H      1 
ATOM   2963 H HA     . LEU B 2 82  ? 1.016   -7.005  38.372  1.00  52.74 ? 95  LEU B HA     1 
ATOM   2964 H HB2    . LEU B 2 82  ? 2.796   -9.183  37.179  1.00  53.68 ? 95  LEU B HB2    1 
ATOM   2965 H HB3    . LEU B 2 82  ? 2.008   -9.196  38.734  1.00  53.60 ? 95  LEU B HB3    1 
ATOM   2966 H HG     . LEU B 2 82  ? 0.471   -9.092  36.074  1.00  55.20 ? 95  LEU B HG     1 
ATOM   2967 H HD11   . LEU B 2 82  ? 0.962   -11.389 38.026  1.00  55.40 ? 95  LEU B HD11   1 
ATOM   2968 H HD12   . LEU B 2 82  ? 1.668   -11.259 36.431  1.00  55.54 ? 95  LEU B HD12   1 
ATOM   2969 H HD13   . LEU B 2 82  ? -0.063  -11.472 36.602  1.00  55.52 ? 95  LEU B HD13   1 
ATOM   2970 H HD21   . LEU B 2 82  ? -1.492  -9.524  37.514  1.00  55.75 ? 95  LEU B HD21   1 
ATOM   2971 H HD22   . LEU B 2 82  ? -0.737  -8.022  37.986  1.00  55.44 ? 95  LEU B HD22   1 
ATOM   2972 H HD23   . LEU B 2 82  ? -0.470  -9.469  38.941  1.00  55.81 ? 95  LEU B HD23   1 
ATOM   2973 N N      . PRO B 2 83  ? 4.191   -6.585  37.708  1.00  51.15 ? 96  PRO B N      1 
ATOM   2974 C CA     . PRO B 2 83  ? 5.360   -5.926  38.337  1.00  53.06 ? 96  PRO B CA     1 
ATOM   2975 C C      . PRO B 2 83  ? 5.055   -4.532  38.968  1.00  55.22 ? 96  PRO B C      1 
ATOM   2976 O O      . PRO B 2 83  ? 5.954   -4.019  39.612  1.00  59.40 ? 96  PRO B O      1 
ATOM   2977 C CB     . PRO B 2 83  ? 6.400   -5.893  37.185  1.00  51.91 ? 96  PRO B CB     1 
ATOM   2978 C CG     . PRO B 2 83  ? 5.981   -7.103  36.271  1.00  49.65 ? 96  PRO B CG     1 
ATOM   2979 C CD     . PRO B 2 83  ? 4.456   -6.962  36.287  1.00  49.66 ? 96  PRO B CD     1 
ATOM   2980 H HA     . PRO B 2 83  ? 5.714   -6.559  39.138  1.00  52.64 ? 96  PRO B HA     1 
ATOM   2981 H HB2    . PRO B 2 83  ? 6.349   -4.941  36.680  1.00  51.47 ? 96  PRO B HB2    1 
ATOM   2982 H HB3    . PRO B 2 83  ? 7.395   -6.031  37.586  1.00  51.57 ? 96  PRO B HB3    1 
ATOM   2983 H HG2    . PRO B 2 83  ? 6.388   -6.989  35.277  1.00  49.66 ? 96  PRO B HG2    1 
ATOM   2984 H HG3    . PRO B 2 83  ? 6.312   -8.040  36.696  1.00  49.50 ? 96  PRO B HG3    1 
ATOM   2985 H HD2    . PRO B 2 83  ? 4.138   -6.166  35.634  1.00  49.76 ? 96  PRO B HD2    1 
ATOM   2986 H HD3    . PRO B 2 83  ? 3.958   -7.884  36.041  1.00  49.73 ? 96  PRO B HD3    1 
ATOM   2987 N N      . PHE B 2 84  ? 3.872   -3.995  38.772  0.50  55.49 ? 97  PHE B N      1 
ATOM   2988 C CA     . PHE B 2 84  ? 3.458   -2.659  39.315  0.50  56.14 ? 97  PHE B CA     1 
ATOM   2989 C C      . PHE B 2 84  ? 2.165   -2.737  40.155  0.50  57.23 ? 97  PHE B C      1 
ATOM   2990 O O      . PHE B 2 84  ? 2.159   -2.186  41.239  0.50  56.96 ? 97  PHE B O      1 
ATOM   2991 C CB     . PHE B 2 84  ? 3.160   -1.659  38.186  1.00  56.29 ? 97  PHE B CB     1 
ATOM   2992 C CG     . PHE B 2 84  ? 4.361   -1.121  37.371  1.00  55.78 ? 97  PHE B CG     1 
ATOM   2993 C CD1    . PHE B 2 84  ? 4.055   -0.255  36.340  1.00  54.08 ? 97  PHE B CD1    1 
ATOM   2994 C CD2    . PHE B 2 84  ? 5.704   -1.423  37.612  1.00  54.82 ? 97  PHE B CD2    1 
ATOM   2995 C CE1    . PHE B 2 84  ? 5.051   0.298   35.571  1.00  52.43 ? 97  PHE B CE1    1 
ATOM   2996 C CE2    . PHE B 2 84  ? 6.703   -0.867  36.837  1.00  53.12 ? 97  PHE B CE2    1 
ATOM   2997 C CZ     . PHE B 2 84  ? 6.372   -0.005  35.817  1.00  51.68 ? 97  PHE B CZ     1 
ATOM   2998 H H      . PHE B 2 84  ? 3.196   -4.479  38.259  0.50  54.81 ? 97  PHE B H      1 
ATOM   2999 H HA     . PHE B 2 84  ? 4.252   -2.287  39.947  0.50  56.72 ? 97  PHE B HA     1 
ATOM   3000 H HB2    . PHE B 2 84  ? 2.454   -2.132  37.519  1.00  56.04 ? 97  PHE B HB2    1 
ATOM   3001 H HB3    . PHE B 2 84  ? 2.663   -0.815  38.644  1.00  56.07 ? 97  PHE B HB3    1 
ATOM   3002 H HD1    . PHE B 2 84  ? 3.022   -0.010  36.140  1.00  53.57 ? 97  PHE B HD1    1 
ATOM   3003 H HD2    . PHE B 2 84  ? 5.971   -2.096  38.413  1.00  55.15 ? 97  PHE B HD2    1 
ATOM   3004 H HE1    . PHE B 2 84  ? 4.791   0.978   34.774  1.00  52.16 ? 97  PHE B HE1    1 
ATOM   3005 H HE2    . PHE B 2 84  ? 7.741   -1.106  37.027  1.00  53.21 ? 97  PHE B HE2    1 
ATOM   3006 H HZ     . PHE B 2 84  ? 7.143   0.446   35.211  1.00  52.06 ? 97  PHE B HZ     1 
ATOM   3007 N N      . ASN B 2 92  ? 5.830   -10.256 33.453  1.00  44.32 ? 99  ASN B N      1 
ATOM   3008 C CA     . ASN B 2 92  ? 6.152   -9.274  32.363  1.00  43.85 ? 99  ASN B CA     1 
ATOM   3009 C C      . ASN B 2 92  ? 5.053   -9.058  31.328  1.00  36.26 ? 99  ASN B C      1 
ATOM   3010 O O      . ASN B 2 92  ? 5.264   -8.253  30.439  1.00  30.34 ? 99  ASN B O      1 
ATOM   3011 C CB     . ASN B 2 92  ? 7.425   -9.692  31.554  1.00  46.86 ? 99  ASN B CB     1 
ATOM   3012 C CG     . ASN B 2 92  ? 8.626   -9.343  32.391  1.00  50.21 ? 99  ASN B CG     1 
ATOM   3013 O OD1    . ASN B 2 92  ? 8.455   -8.950  33.533  1.00  53.36 ? 99  ASN B OD1    1 
ATOM   3014 N ND2    . ASN B 2 92  ? 9.827   -9.463  31.906  1.00  51.52 ? 99  ASN B ND2    1 
ATOM   3015 H H      . ASN B 2 92  ? 4.869   -10.638 33.358  1.00  44.66 ? 99  ASN B H      1 
ATOM   3016 H HA     . ASN B 2 92  ? 6.343   -8.317  32.831  1.00  42.23 ? 99  ASN B HA     1 
ATOM   3017 H HB2    . ASN B 2 92  ? 7.441   -10.751 31.332  1.00  47.01 ? 99  ASN B HB2    1 
ATOM   3018 H HB3    . ASN B 2 92  ? 7.488   -9.134  30.629  1.00  47.13 ? 99  ASN B HB3    1 
ATOM   3019 H HD21   . ASN B 2 92  ? 9.983   -9.774  30.985  1.00  52.14 ? 99  ASN B HD21   1 
ATOM   3020 H HD22   . ASN B 2 92  ? 10.611  -9.244  32.458  1.00  52.14 ? 99  ASN B HD22   1 
ATOM   3021 N N      . SER B 2 93  ? 3.943   -9.739  31.440  1.00  31.83 ? 100 SER B N      1 
ATOM   3022 C CA     . SER B 2 93  ? 2.868   -9.547  30.445  1.00  32.19 ? 100 SER B CA     1 
ATOM   3023 C C      . SER B 2 93  ? 2.242   -8.189  30.740  1.00  29.24 ? 100 SER B C      1 
ATOM   3024 O O      . SER B 2 93  ? 2.353   -7.669  31.846  1.00  26.72 ? 100 SER B O      1 
ATOM   3025 C CB     . SER B 2 93  ? 1.772   -10.675 30.576  1.00  33.07 ? 100 SER B CB     1 
ATOM   3026 O OG     . SER B 2 93  ? 2.446   -11.938 30.454  1.00  34.15 ? 100 SER B OG     1 
ATOM   3027 H H      . SER B 2 93  ? 3.767   -10.378 32.154  1.00  32.77 ? 100 SER B H      1 
ATOM   3028 H HA     . SER B 2 93  ? 3.294   -9.531  29.451  1.00  32.23 ? 100 SER B HA     1 
ATOM   3029 H HB2    . SER B 2 93  ? 1.248   -10.621 31.522  1.00  32.50 ? 100 SER B HB2    1 
ATOM   3030 H HB3    . SER B 2 93  ? 1.051   -10.562 29.774  1.00  33.16 ? 100 SER B HB3    1 
ATOM   3031 H HG     . SER B 2 93  ? 2.160   -12.315 29.600  1.00  32.86 ? 100 SER B HG     1 
ATOM   3032 N N      . ASN B 2 94  ? 1.614   -7.704  29.708  1.00  24.26 ? 101 ASN B N      1 
ATOM   3033 C CA     . ASN B 2 94  ? 0.913   -6.406  29.713  1.00  23.90 ? 101 ASN B CA     1 
ATOM   3034 C C      . ASN B 2 94  ? 1.912   -5.253  29.891  1.00  21.12 ? 101 ASN B C      1 
ATOM   3035 O O      . ASN B 2 94  ? 1.649   -4.239  30.511  1.00  19.87 ? 101 ASN B O      1 
ATOM   3036 C CB     . ASN B 2 94  ? -0.153  -6.410  30.850  1.00  24.78 ? 101 ASN B CB     1 
ATOM   3037 C CG     . ASN B 2 94  ? -1.006  -7.671  30.705  1.00  26.32 ? 101 ASN B CG     1 
ATOM   3038 O OD1    . ASN B 2 94  ? -1.494  -8.042  29.661  1.00  27.58 ? 101 ASN B OD1    1 
ATOM   3039 N ND2    . ASN B 2 94  ? -1.230  -8.404  31.736  1.00  27.64 ? 101 ASN B ND2    1 
ATOM   3040 H H      . ASN B 2 94  ? 1.599   -8.227  28.875  1.00  24.49 ? 101 ASN B H      1 
ATOM   3041 H HA     . ASN B 2 94  ? 0.415   -6.287  28.761  1.00  24.78 ? 101 ASN B HA     1 
ATOM   3042 H HB2    . ASN B 2 94  ? 0.327   -6.383  31.816  1.00  23.87 ? 101 ASN B HB2    1 
ATOM   3043 H HB3    . ASN B 2 94  ? -0.792  -5.544  30.751  1.00  24.28 ? 101 ASN B HB3    1 
ATOM   3044 H HD21   . ASN B 2 94  ? -0.864  -8.159  32.615  1.00  28.79 ? 101 ASN B HD21   1 
ATOM   3045 H HD22   . ASN B 2 94  ? -1.770  -9.210  31.632  1.00  28.83 ? 101 ASN B HD22   1 
ATOM   3046 N N      . ASP B 2 95  ? 3.057   -5.434  29.300  1.00  18.91 ? 102 ASP B N      1 
ATOM   3047 C CA     . ASP B 2 95  ? 4.099   -4.380  29.407  1.00  17.82 ? 102 ASP B CA     1 
ATOM   3048 C C      . ASP B 2 95  ? 3.795   -3.397  28.275  1.00  14.88 ? 102 ASP B C      1 
ATOM   3049 O O      . ASP B 2 95  ? 4.383   -3.413  27.197  1.00  14.67 ? 102 ASP B O      1 
ATOM   3050 C CB     . ASP B 2 95  ? 5.509   -5.033  29.250  1.00  18.95 ? 102 ASP B CB     1 
ATOM   3051 C CG     . ASP B 2 95  ? 6.667   -4.010  29.505  1.00  19.30 ? 102 ASP B CG     1 
ATOM   3052 O OD1    . ASP B 2 95  ? 6.390   -2.976  30.089  1.00  20.01 ? 102 ASP B OD1    1 
ATOM   3053 O OD2    . ASP B 2 95  ? 7.768   -4.335  29.094  1.00  18.90 ? 102 ASP B OD2    1 
ATOM   3054 H H      . ASP B 2 95  ? 3.235   -6.253  28.784  1.00  20.39 ? 102 ASP B H      1 
ATOM   3055 H HA     . ASP B 2 95  ? 4.002   -3.892  30.368  1.00  17.35 ? 102 ASP B HA     1 
ATOM   3056 H HB2    . ASP B 2 95  ? 5.618   -5.854  29.943  1.00  18.22 ? 102 ASP B HB2    1 
ATOM   3057 H HB3    . ASP B 2 95  ? 5.607   -5.414  28.241  1.00  17.71 ? 102 ASP B HB3    1 
ATOM   3058 N N      . ILE B 2 96  ? 2.831   -2.570  28.591  1.00  16.42 ? 103 ILE B N      1 
ATOM   3059 C CA     . ILE B 2 96  ? 2.374   -1.526  27.626  1.00  17.38 ? 103 ILE B CA     1 
ATOM   3060 C C      . ILE B 2 96  ? 1.813   -0.297  28.385  1.00  15.79 ? 103 ILE B C      1 
ATOM   3061 O O      . ILE B 2 96  ? 1.245   -0.461  29.462  1.00  15.77 ? 103 ILE B O      1 
ATOM   3062 C CB     . ILE B 2 96  ? 1.292   -2.219  26.686  1.00  17.35 ? 103 ILE B CB     1 
ATOM   3063 C CG1    . ILE B 2 96  ? 0.817   -1.210  25.615  1.00  20.03 ? 103 ILE B CG1    1 
ATOM   3064 C CG2    . ILE B 2 96  ? 0.101   -2.734  27.545  1.00  17.27 ? 103 ILE B CG2    1 
ATOM   3065 C CD1    . ILE B 2 96  ? 0.118   -1.944  24.436  1.00  21.48 ? 103 ILE B CD1    1 
ATOM   3066 H H      . ILE B 2 96  ? 2.379   -2.623  29.466  1.00  13.42 ? 103 ILE B H      1 
ATOM   3067 H HA     . ILE B 2 96  ? 3.213   -1.219  27.015  1.00  17.43 ? 103 ILE B HA     1 
ATOM   3068 H HB     . ILE B 2 96  ? 1.752   -3.060  26.192  1.00  17.62 ? 103 ILE B HB     1 
ATOM   3069 H HG12   . ILE B 2 96  ? 0.132   -0.497  26.057  1.00  19.77 ? 103 ILE B HG12   1 
ATOM   3070 H HG13   . ILE B 2 96  ? 1.665   -0.659  25.224  1.00  19.83 ? 103 ILE B HG13   1 
ATOM   3071 H HG21   . ILE B 2 96  ? -0.398  -1.908  28.029  1.00  16.47 ? 103 ILE B HG21   1 
ATOM   3072 H HG22   . ILE B 2 96  ? 0.429   -3.417  28.315  1.00  16.58 ? 103 ILE B HG22   1 
ATOM   3073 H HG23   . ILE B 2 96  ? -0.618  -3.253  26.930  1.00  16.60 ? 103 ILE B HG23   1 
ATOM   3074 H HD11   . ILE B 2 96  ? -0.188  -1.237  23.681  1.00  20.60 ? 103 ILE B HD11   1 
ATOM   3075 H HD12   . ILE B 2 96  ? -0.757  -2.467  24.789  1.00  21.47 ? 103 ILE B HD12   1 
ATOM   3076 H HD13   . ILE B 2 96  ? 0.786   -2.660  23.978  1.00  20.95 ? 103 ILE B HD13   1 
ATOM   3077 N N      . ALA B 2 97  ? 2.004   0.873   27.821  1.00  16.25 ? 104 ALA B N      1 
ATOM   3078 C CA     . ALA B 2 97  ? 1.494   2.130   28.436  1.00  15.82 ? 104 ALA B CA     1 
ATOM   3079 C C      . ALA B 2 97  ? 1.303   3.158   27.312  1.00  13.99 ? 104 ALA B C      1 
ATOM   3080 O O      . ALA B 2 97  ? 1.904   3.056   26.255  1.00  15.35 ? 104 ALA B O      1 
ATOM   3081 C CB     . ALA B 2 97  ? 2.498   2.690   29.484  1.00  19.03 ? 104 ALA B CB     1 
ATOM   3082 H H      . ALA B 2 97  ? 2.492   0.941   26.965  1.00  16.96 ? 104 ALA B H      1 
ATOM   3083 H HA     . ALA B 2 97  ? 0.539   1.926   28.896  1.00  17.05 ? 104 ALA B HA     1 
ATOM   3084 H HB1    . ALA B 2 97  ? 2.114   3.615   29.896  1.00  17.31 ? 104 ALA B HB1    1 
ATOM   3085 H HB2    . ALA B 2 97  ? 3.462   2.888   29.035  1.00  17.15 ? 104 ALA B HB2    1 
ATOM   3086 H HB3    . ALA B 2 97  ? 2.612   1.980   30.284  1.00  17.91 ? 104 ALA B HB3    1 
ATOM   3087 N N      . LEU B 2 98  ? 0.483   4.121   27.595  1.00  14.66 ? 105 LEU B N      1 
ATOM   3088 C CA     . LEU B 2 98  ? 0.164   5.212   26.643  1.00  16.61 ? 105 LEU B CA     1 
ATOM   3089 C C      . LEU B 2 98  ? 0.599   6.490   27.330  1.00  15.51 ? 105 LEU B C      1 
ATOM   3090 O O      . LEU B 2 98  ? 0.399   6.643   28.518  1.00  18.20 ? 105 LEU B O      1 
ATOM   3091 C CB     . LEU B 2 98  ? -1.364  5.307   26.360  1.00  19.12 ? 105 LEU B CB     1 
ATOM   3092 C CG     . LEU B 2 98  ? -1.794  4.377   25.221  1.00  19.65 ? 105 LEU B CG     1 
ATOM   3093 C CD1    . LEU B 2 98  ? -3.317  4.154   25.304  1.00  20.74 ? 105 LEU B CD1    1 
ATOM   3094 C CD2    . LEU B 2 98  ? -1.434  5.053   23.871  1.00  21.02 ? 105 LEU B CD2    1 
ATOM   3095 H H      . LEU B 2 98  ? 0.062   4.134   28.482  1.00  12.33 ? 105 LEU B H      1 
ATOM   3096 H HA     . LEU B 2 98  ? 0.737   5.072   25.737  1.00  16.84 ? 105 LEU B HA     1 
ATOM   3097 H HB2    . LEU B 2 98  ? -1.904  5.071   27.266  1.00  18.59 ? 105 LEU B HB2    1 
ATOM   3098 H HB3    . LEU B 2 98  ? -1.600  6.330   26.104  1.00  18.75 ? 105 LEU B HB3    1 
ATOM   3099 H HG     . LEU B 2 98  ? -1.286  3.425   25.301  1.00  20.81 ? 105 LEU B HG     1 
ATOM   3100 H HD11   . LEU B 2 98  ? -3.854  5.089   25.224  1.00  20.68 ? 105 LEU B HD11   1 
ATOM   3101 H HD12   . LEU B 2 98  ? -3.589  3.686   26.241  1.00  19.89 ? 105 LEU B HD12   1 
ATOM   3102 H HD13   . LEU B 2 98  ? -3.641  3.501   24.504  1.00  20.34 ? 105 LEU B HD13   1 
ATOM   3103 H HD21   . LEU B 2 98  ? -1.752  4.421   23.055  1.00  20.99 ? 105 LEU B HD21   1 
ATOM   3104 H HD22   . LEU B 2 98  ? -0.367  5.207   23.784  1.00  19.95 ? 105 LEU B HD22   1 
ATOM   3105 H HD23   . LEU B 2 98  ? -1.928  6.009   23.765  1.00  20.55 ? 105 LEU B HD23   1 
ATOM   3106 N N      . VAL B 2 99  ? 1.159   7.357   26.561  1.00  16.46 ? 106 VAL B N      1 
ATOM   3107 C CA     . VAL B 2 99  ? 1.638   8.649   27.093  1.00  19.40 ? 106 VAL B CA     1 
ATOM   3108 C C      . VAL B 2 99  ? 0.900   9.745   26.321  1.00  18.14 ? 106 VAL B C      1 
ATOM   3109 O O      . VAL B 2 99  ? 0.928   9.773   25.102  1.00  18.75 ? 106 VAL B O      1 
ATOM   3110 C CB     . VAL B 2 99  ? 3.161   8.758   26.854  1.00  19.99 ? 106 VAL B CB     1 
ATOM   3111 C CG1    . VAL B 2 99  ? 3.706   10.046  27.456  1.00  20.45 ? 106 VAL B CG1    1 
ATOM   3112 C CG2    . VAL B 2 99  ? 3.905   7.513   27.426  1.00  22.35 ? 106 VAL B CG2    1 
ATOM   3113 H H      . VAL B 2 99  ? 1.269   7.166   25.607  1.00  18.65 ? 106 VAL B H      1 
ATOM   3114 H HA     . VAL B 2 99  ? 1.391   8.716   28.147  1.00  18.51 ? 106 VAL B HA     1 
ATOM   3115 H HB     . VAL B 2 99  ? 3.322   8.818   25.794  1.00  20.00 ? 106 VAL B HB     1 
ATOM   3116 H HG11   . VAL B 2 99  ? 3.519   10.079  28.519  1.00  20.46 ? 106 VAL B HG11   1 
ATOM   3117 H HG12   . VAL B 2 99  ? 3.242   10.906  26.993  1.00  19.74 ? 106 VAL B HG12   1 
ATOM   3118 H HG13   . VAL B 2 99  ? 4.772   10.114  27.289  1.00  21.38 ? 106 VAL B HG13   1 
ATOM   3119 H HG21   . VAL B 2 99  ? 4.969   7.584   27.251  1.00  21.51 ? 106 VAL B HG21   1 
ATOM   3120 H HG22   . VAL B 2 99  ? 3.545   6.614   26.947  1.00  21.13 ? 106 VAL B HG22   1 
ATOM   3121 H HG23   . VAL B 2 99  ? 3.734   7.426   28.491  1.00  21.18 ? 106 VAL B HG23   1 
ATOM   3122 N N      . HIS B 2 100 ? 0.289   10.623  27.061  1.00  17.73 ? 107 HIS B N      1 
ATOM   3123 C CA     . HIS B 2 100 ? -0.474  11.753  26.472  1.00  19.65 ? 107 HIS B CA     1 
ATOM   3124 C C      . HIS B 2 100 ? 0.419   12.984  26.620  1.00  18.43 ? 107 HIS B C      1 
ATOM   3125 O O      . HIS B 2 100 ? 0.755   13.363  27.722  1.00  18.89 ? 107 HIS B O      1 
ATOM   3126 C CB     . HIS B 2 100 ? -1.796  11.875  27.283  1.00  21.32 ? 107 HIS B CB     1 
ATOM   3127 C CG     . HIS B 2 100 ? -2.835  12.747  26.628  1.00  22.00 ? 107 HIS B CG     1 
ATOM   3128 N ND1    . HIS B 2 100 ? -3.003  12.964  25.348  1.00  26.33 ? 107 HIS B ND1    1 
ATOM   3129 C CD2    . HIS B 2 100 ? -3.818  13.461  27.287  1.00  24.00 ? 107 HIS B CD2    1 
ATOM   3130 C CE1    . HIS B 2 100 ? -4.030  13.762  25.205  1.00  25.91 ? 107 HIS B CE1    1 
ATOM   3131 N NE2    . HIS B 2 100 ? -4.518  14.057  26.374  1.00  26.09 ? 107 HIS B NE2    1 
ATOM   3132 H H      . HIS B 2 100 ? 0.340   10.534  28.039  1.00  17.91 ? 107 HIS B H      1 
ATOM   3133 H HA     . HIS B 2 100 ? -0.647  11.548  25.426  1.00  19.30 ? 107 HIS B HA     1 
ATOM   3134 H HB2    . HIS B 2 100 ? -2.239  10.903  27.443  1.00  21.17 ? 107 HIS B HB2    1 
ATOM   3135 H HB3    . HIS B 2 100 ? -1.592  12.299  28.257  1.00  20.25 ? 107 HIS B HB3    1 
ATOM   3136 H HD1    . HIS B 2 100 ? -2.460  12.587  24.611  1.00  24.29 ? 107 HIS B HD1    1 
ATOM   3137 H HD2    . HIS B 2 100 ? -3.971  13.546  28.345  1.00  23.77 ? 107 HIS B HD2    1 
ATOM   3138 H HE1    . HIS B 2 100 ? -4.422  14.126  24.266  1.00  25.89 ? 107 HIS B HE1    1 
ATOM   3139 H HE2    . HIS B 2 100 ? -5.297  14.630  26.595  1.00  25.99 ? 107 HIS B HE2    1 
ATOM   3140 N N      . LEU B 2 101 ? 0.771   13.556  25.520  1.00  19.08 ? 108 LEU B N      1 
ATOM   3141 C CA     . LEU B 2 101 ? 1.638   14.762  25.539  1.00  22.26 ? 108 LEU B CA     1 
ATOM   3142 C C      . LEU B 2 101 ? 0.805   15.975  25.994  1.00  25.46 ? 108 LEU B C      1 
ATOM   3143 O O      . LEU B 2 101 ? -0.406  16.000  25.811  1.00  22.52 ? 108 LEU B O      1 
ATOM   3144 C CB     . LEU B 2 101 ? 2.179   15.048  24.127  1.00  22.11 ? 108 LEU B CB     1 
ATOM   3145 C CG     . LEU B 2 101 ? 2.747   13.750  23.403  1.00  24.96 ? 108 LEU B CG     1 
ATOM   3146 C CD1    . LEU B 2 101 ? 3.323   14.173  22.014  1.00  24.70 ? 108 LEU B CD1    1 
ATOM   3147 C CD2    . LEU B 2 101 ? 3.883   13.111  24.230  1.00  25.23 ? 108 LEU B CD2    1 
ATOM   3148 H H      . LEU B 2 101 ? 0.468   13.195  24.663  1.00  20.30 ? 108 LEU B H      1 
ATOM   3149 H HA     . LEU B 2 101 ? 2.442   14.608  26.245  1.00  22.76 ? 108 LEU B HA     1 
ATOM   3150 H HB2    . LEU B 2 101 ? 1.392   15.496  23.537  1.00  22.63 ? 108 LEU B HB2    1 
ATOM   3151 H HB3    . LEU B 2 101 ? 2.951   15.801  24.232  1.00  22.83 ? 108 LEU B HB3    1 
ATOM   3152 H HG     . LEU B 2 101 ? 1.970   13.013  23.254  1.00  24.64 ? 108 LEU B HG     1 
ATOM   3153 H HD11   . LEU B 2 101 ? 4.153   14.855  22.135  1.00  24.64 ? 108 LEU B HD11   1 
ATOM   3154 H HD12   . LEU B 2 101 ? 2.580   14.685  21.419  1.00  24.92 ? 108 LEU B HD12   1 
ATOM   3155 H HD13   . LEU B 2 101 ? 3.662   13.309  21.459  1.00  24.28 ? 108 LEU B HD13   1 
ATOM   3156 H HD21   . LEU B 2 101 ? 4.267   12.235  23.730  1.00  24.72 ? 108 LEU B HD21   1 
ATOM   3157 H HD22   . LEU B 2 101 ? 3.519   12.806  25.201  1.00  25.11 ? 108 LEU B HD22   1 
ATOM   3158 H HD23   . LEU B 2 101 ? 4.693   13.816  24.375  1.00  24.36 ? 108 LEU B HD23   1 
ATOM   3159 N N      . SER B 2 102 ? 1.463   16.950  26.553  1.00  26.95 ? 109 SER B N      1 
ATOM   3160 C CA     . SER B 2 102 ? 0.721   18.151  27.022  1.00  26.17 ? 109 SER B CA     1 
ATOM   3161 C C      . SER B 2 102 ? 0.155   18.940  25.836  1.00  26.17 ? 109 SER B C      1 
ATOM   3162 O O      . SER B 2 102 ? -0.821  19.649  25.992  1.00  29.74 ? 109 SER B O      1 
ATOM   3163 C CB     A SER B 2 102 ? 1.696   19.016  27.853  0.34  25.66 ? 109 SER B CB     1 
ATOM   3164 C CB     B SER B 2 102 ? 1.701   19.018  27.901  0.55  24.41 ? 109 SER B CB     1 
ATOM   3165 O OG     A SER B 2 102 ? 2.411   18.069  28.654  0.34  24.42 ? 109 SER B OG     1 
ATOM   3166 O OG     B SER B 2 102 ? 3.020   18.842  27.379  0.55  22.04 ? 109 SER B OG     1 
ATOM   3167 H H      . SER B 2 102 ? 2.442   16.940  26.691  1.00  25.79 ? 109 SER B H      1 
ATOM   3168 H HA     . SER B 2 102 ? -0.117  17.830  27.624  1.00  26.41 ? 109 SER B HA     1 
ATOM   3169 H HB2    A SER B 2 102 ? 2.375   19.579  27.222  0.34  25.46 ? 109 SER B HB2    1 
ATOM   3170 H HB2    B SER B 2 102 ? 1.420   20.063  27.846  0.55  24.16 ? 109 SER B HB2    1 
ATOM   3171 H HB3    A SER B 2 102 ? 1.138   19.699  28.482  0.34  25.68 ? 109 SER B HB3    1 
ATOM   3172 H HB3    B SER B 2 102 ? 1.671   18.694  28.932  0.55  23.70 ? 109 SER B HB3    1 
ATOM   3173 H HG     A SER B 2 102 ? 2.099   18.125  29.566  0.34  24.83 ? 109 SER B HG     1 
ATOM   3174 H HG     B SER B 2 102 ? 3.377   19.707  27.113  0.55  22.00 ? 109 SER B HG     1 
ATOM   3175 N N      . SER B 2 103 ? 0.769   18.842  24.696  1.00  24.66 ? 110 SER B N      1 
ATOM   3176 C CA     . SER B 2 103 ? 0.264   19.560  23.513  1.00  28.73 ? 110 SER B CA     1 
ATOM   3177 C C      . SER B 2 103 ? 0.659   18.636  22.359  1.00  27.38 ? 110 SER B C      1 
ATOM   3178 O O      . SER B 2 103 ? 1.586   17.872  22.500  1.00  26.43 ? 110 SER B O      1 
ATOM   3179 C CB     . SER B 2 103 ? 0.919   21.010  23.457  1.00  32.14 ? 110 SER B CB     1 
ATOM   3180 O OG     . SER B 2 103 ? 2.324   20.962  23.737  1.00  39.58 ? 110 SER B OG     1 
ATOM   3181 H H      . SER B 2 103 ? 1.576   18.293  24.593  1.00  24.95 ? 110 SER B H      1 
ATOM   3182 H HA     . SER B 2 103 ? -0.811  19.613  23.580  1.00  29.86 ? 110 SER B HA     1 
ATOM   3183 H HB2    . SER B 2 103 ? 0.760   21.431  22.478  1.00  32.83 ? 110 SER B HB2    1 
ATOM   3184 H HB3    . SER B 2 103 ? 0.436   21.645  24.186  1.00  32.73 ? 110 SER B HB3    1 
ATOM   3185 H HG     . SER B 2 103 ? 2.729   21.081  22.862  1.00  37.40 ? 110 SER B HG     1 
ATOM   3186 N N      . PRO B 2 104 ? -0.016  18.662  21.250  1.00  26.88 ? 111 PRO B N      1 
ATOM   3187 C CA     . PRO B 2 104 ? 0.335   17.751  20.148  1.00  27.01 ? 111 PRO B CA     1 
ATOM   3188 C C      . PRO B 2 104 ? 1.498   18.245  19.306  1.00  26.75 ? 111 PRO B C      1 
ATOM   3189 O O      . PRO B 2 104 ? 1.744   19.432  19.176  1.00  27.01 ? 111 PRO B O      1 
ATOM   3190 C CB     . PRO B 2 104 ? -0.944  17.631  19.351  1.00  29.43 ? 111 PRO B CB     1 
ATOM   3191 C CG     . PRO B 2 104 ? -1.524  19.074  19.503  1.00  29.38 ? 111 PRO B CG     1 
ATOM   3192 C CD     . PRO B 2 104 ? -1.187  19.516  20.954  1.00  28.69 ? 111 PRO B CD     1 
ATOM   3193 H HA     . PRO B 2 104 ? 0.604   16.794  20.579  1.00  26.81 ? 111 PRO B HA     1 
ATOM   3194 H HB2    . PRO B 2 104 ? -0.719  17.408  18.317  1.00  28.75 ? 111 PRO B HB2    1 
ATOM   3195 H HB3    . PRO B 2 104 ? -1.623  16.890  19.743  1.00  28.75 ? 111 PRO B HB3    1 
ATOM   3196 H HG2    . PRO B 2 104 ? -1.061  19.746  18.791  1.00  29.87 ? 111 PRO B HG2    1 
ATOM   3197 H HG3    . PRO B 2 104 ? -2.596  19.072  19.356  1.00  29.91 ? 111 PRO B HG3    1 
ATOM   3198 H HD2    . PRO B 2 104 ? -0.902  20.558  21.017  1.00  28.22 ? 111 PRO B HD2    1 
ATOM   3199 H HD3    . PRO B 2 104 ? -1.993  19.295  21.643  1.00  27.61 ? 111 PRO B HD3    1 
ATOM   3200 N N      . LEU B 2 105 ? 2.164   17.288  18.747  1.00  24.31 ? 112 LEU B N      1 
ATOM   3201 C CA     . LEU B 2 105 ? 3.309   17.554  17.890  1.00  23.93 ? 112 LEU B CA     1 
ATOM   3202 C C      . LEU B 2 105 ? 2.654   17.854  16.542  1.00  26.97 ? 112 LEU B C      1 
ATOM   3203 O O      . LEU B 2 105 ? 1.602   17.296  16.249  1.00  25.56 ? 112 LEU B O      1 
ATOM   3204 C CB     . LEU B 2 105 ? 4.169   16.314  17.741  1.00  25.19 ? 112 LEU B CB     1 
ATOM   3205 C CG     . LEU B 2 105 ? 5.028   16.044  18.945  1.00  24.75 ? 112 LEU B CG     1 
ATOM   3206 C CD1    . LEU B 2 105 ? 5.595   14.613  18.820  1.00  25.59 ? 112 LEU B CD1    1 
ATOM   3207 C CD2    . LEU B 2 105 ? 6.225   17.032  18.901  1.00  23.71 ? 112 LEU B CD2    1 
ATOM   3208 H H      . LEU B 2 105 ? 1.899   16.365  18.898  1.00  24.84 ? 112 LEU B H      1 
ATOM   3209 H HA     . LEU B 2 105 ? 3.835   18.416  18.270  1.00  25.08 ? 112 LEU B HA     1 
ATOM   3210 H HB2    . LEU B 2 105 ? 3.504   15.477  17.573  1.00  25.16 ? 112 LEU B HB2    1 
ATOM   3211 H HB3    . LEU B 2 105 ? 4.775   16.425  16.850  1.00  25.32 ? 112 LEU B HB3    1 
ATOM   3212 H HG     . LEU B 2 105 ? 4.441   16.146  19.848  1.00  24.77 ? 112 LEU B HG     1 
ATOM   3213 H HD11   . LEU B 2 105 ? 6.178   14.495  17.917  1.00  24.94 ? 112 LEU B HD11   1 
ATOM   3214 H HD12   . LEU B 2 105 ? 4.776   13.906  18.795  1.00  25.30 ? 112 LEU B HD12   1 
ATOM   3215 H HD13   . LEU B 2 105 ? 6.220   14.371  19.669  1.00  25.33 ? 112 LEU B HD13   1 
ATOM   3216 H HD21   . LEU B 2 105 ? 6.870   16.852  19.750  1.00  23.62 ? 112 LEU B HD21   1 
ATOM   3217 H HD22   . LEU B 2 105 ? 5.885   18.057  18.944  1.00  23.15 ? 112 LEU B HD22   1 
ATOM   3218 H HD23   . LEU B 2 105 ? 6.804   16.897  17.998  1.00  23.45 ? 112 LEU B HD23   1 
ATOM   3219 N N      . PRO B 2 106 ? 3.269   18.710  15.756  1.00  26.67 ? 113 PRO B N      1 
ATOM   3220 C CA     . PRO B 2 106 ? 2.875   18.911  14.341  1.00  26.96 ? 113 PRO B CA     1 
ATOM   3221 C C      . PRO B 2 106 ? 3.255   17.671  13.549  1.00  25.42 ? 113 PRO B C      1 
ATOM   3222 O O      . PRO B 2 106 ? 4.237   17.050  13.895  1.00  23.88 ? 113 PRO B O      1 
ATOM   3223 C CB     . PRO B 2 106 ? 3.638   20.157  13.926  1.00  29.88 ? 113 PRO B CB     1 
ATOM   3224 C CG     . PRO B 2 106 ? 4.953   20.032  14.761  1.00  32.07 ? 113 PRO B CG     1 
ATOM   3225 C CD     . PRO B 2 106 ? 4.420   19.592  16.142  1.00  29.99 ? 113 PRO B CD     1 
ATOM   3226 H HA     . PRO B 2 106 ? 1.807   19.064  14.292  1.00  28.41 ? 113 PRO B HA     1 
ATOM   3227 H HB2    . PRO B 2 106 ? 3.847   20.135  12.864  1.00  29.51 ? 113 PRO B HB2    1 
ATOM   3228 H HB3    . PRO B 2 106 ? 3.092   21.055  14.178  1.00  29.32 ? 113 PRO B HB3    1 
ATOM   3229 H HG2    . PRO B 2 106 ? 5.618   19.285  14.345  1.00  31.72 ? 113 PRO B HG2    1 
ATOM   3230 H HG3    . PRO B 2 106 ? 5.476   20.976  14.830  1.00  31.64 ? 113 PRO B HG3    1 
ATOM   3231 H HD2    . PRO B 2 106 ? 5.167   19.032  16.688  1.00  29.23 ? 113 PRO B HD2    1 
ATOM   3232 H HD3    . PRO B 2 106 ? 4.067   20.436  16.722  1.00  29.89 ? 113 PRO B HD3    1 
ATOM   3233 N N      . LEU B 2 107 ? 2.531   17.341  12.529  1.00  23.11 ? 114 LEU B N      1 
ATOM   3234 C CA     . LEU B 2 107 ? 2.903   16.138  11.762  1.00  24.82 ? 114 LEU B CA     1 
ATOM   3235 C C      . LEU B 2 107 ? 3.581   16.719  10.558  1.00  24.21 ? 114 LEU B C      1 
ATOM   3236 O O      . LEU B 2 107 ? 3.010   17.539  9.868   1.00  26.43 ? 114 LEU B O      1 
ATOM   3237 C CB     . LEU B 2 107 ? 1.667   15.355  11.362  1.00  25.73 ? 114 LEU B CB     1 
ATOM   3238 C CG     . LEU B 2 107 ? 0.921   14.813  12.597  1.00  26.41 ? 114 LEU B CG     1 
ATOM   3239 C CD1    . LEU B 2 107 ? -0.192  13.890  12.069  1.00  27.89 ? 114 LEU B CD1    1 
ATOM   3240 C CD2    . LEU B 2 107 ? 1.873   14.017  13.540  1.00  24.62 ? 114 LEU B CD2    1 
ATOM   3241 H H      . LEU B 2 107 ? 1.762   17.884  12.266  1.00  24.71 ? 114 LEU B H      1 
ATOM   3242 H HA     . LEU B 2 107 ? 3.606   15.534  12.318  1.00  25.42 ? 114 LEU B HA     1 
ATOM   3243 H HB2    . LEU B 2 107 ? 1.022   16.002  10.782  1.00  25.64 ? 114 LEU B HB2    1 
ATOM   3244 H HB3    . LEU B 2 107 ? 1.989   14.544  10.725  1.00  25.48 ? 114 LEU B HB3    1 
ATOM   3245 H HG     . LEU B 2 107 ? 0.487   15.640  13.145  1.00  25.93 ? 114 LEU B HG     1 
ATOM   3246 H HD11   . LEU B 2 107 ? 0.212   13.076  11.483  1.00  27.00 ? 114 LEU B HD11   1 
ATOM   3247 H HD12   . LEU B 2 107 ? -0.858  14.453  11.432  1.00  27.48 ? 114 LEU B HD12   1 
ATOM   3248 H HD13   . LEU B 2 107 ? -0.769  13.479  12.886  1.00  27.19 ? 114 LEU B HD13   1 
ATOM   3249 H HD21   . LEU B 2 107 ? 1.328   13.615  14.380  1.00  24.40 ? 114 LEU B HD21   1 
ATOM   3250 H HD22   . LEU B 2 107 ? 2.637   14.678  13.930  1.00  24.30 ? 114 LEU B HD22   1 
ATOM   3251 H HD23   . LEU B 2 107 ? 2.360   13.210  13.014  1.00  24.26 ? 114 LEU B HD23   1 
ATOM   3252 N N      . THR B 2 108 ? 4.779   16.291  10.325  1.00  23.23 ? 115 THR B N      1 
ATOM   3253 C CA     . THR B 2 108 ? 5.567   16.785  9.181   1.00  21.05 ? 115 THR B CA     1 
ATOM   3254 C C      . THR B 2 108 ? 6.182   15.588  8.494   1.00  17.46 ? 115 THR B C      1 
ATOM   3255 O O      . THR B 2 108 ? 5.884   14.443  8.784   1.00  20.85 ? 115 THR B O      1 
ATOM   3256 C CB     . THR B 2 108 ? 6.626   17.758  9.788   1.00  21.13 ? 115 THR B CB     1 
ATOM   3257 O OG1    . THR B 2 108 ? 7.494   16.943  10.582  1.00  22.37 ? 115 THR B OG1    1 
ATOM   3258 C CG2    . THR B 2 108 ? 5.989   18.666  10.872  1.00  20.59 ? 115 THR B CG2    1 
ATOM   3259 H H      . THR B 2 108 ? 5.178   15.618  10.915  1.00  24.48 ? 115 THR B H      1 
ATOM   3260 H HA     . THR B 2 108 ? 4.915   17.298  8.487   1.00  20.95 ? 115 THR B HA     1 
ATOM   3261 H HB     . THR B 2 108 ? 7.183   18.306  9.039   1.00  21.04 ? 115 THR B HB     1 
ATOM   3262 H HG1    . THR B 2 108 ? 8.383   17.331  10.549  1.00  21.58 ? 115 THR B HG1    1 
ATOM   3263 H HG21   . THR B 2 108 ? 6.721   19.346  11.281  1.00  20.73 ? 115 THR B HG21   1 
ATOM   3264 H HG22   . THR B 2 108 ? 5.585   18.078  11.686  1.00  21.10 ? 115 THR B HG22   1 
ATOM   3265 H HG23   . THR B 2 108 ? 5.181   19.242  10.443  1.00  20.63 ? 115 THR B HG23   1 
ATOM   3266 N N      . GLU B 2 109 ? 7.053   15.861  7.578   1.00  17.10 ? 116 GLU B N      1 
ATOM   3267 C CA     . GLU B 2 109 ? 7.703   14.735  6.881   1.00  21.35 ? 116 GLU B CA     1 
ATOM   3268 C C      . GLU B 2 109 ? 8.648   13.993  7.868   1.00  21.54 ? 116 GLU B C      1 
ATOM   3269 O O      . GLU B 2 109 ? 9.160   12.946  7.526   1.00  24.81 ? 116 GLU B O      1 
ATOM   3270 C CB     . GLU B 2 109 ? 8.524   15.227  5.661   1.00  23.90 ? 116 GLU B CB     1 
ATOM   3271 C CG     . GLU B 2 109 ? 9.650   16.248  5.979   1.00  26.60 ? 116 GLU B CG     1 
ATOM   3272 C CD     . GLU B 2 109 ? 9.184   17.730  5.889   1.00  30.34 ? 116 GLU B CD     1 
ATOM   3273 O OE1    . GLU B 2 109 ? 10.009  18.536  5.475   1.00  34.86 ? 116 GLU B OE1    1 
ATOM   3274 O OE2    . GLU B 2 109 ? 8.052   18.002  6.236   1.00  31.84 ? 116 GLU B OE2    1 
ATOM   3275 H H      . GLU B 2 109 ? 7.233   16.790  7.385   1.00  18.37 ? 116 GLU B H      1 
ATOM   3276 H HA     . GLU B 2 109 ? 6.930   14.044  6.605   1.00  21.56 ? 116 GLU B HA     1 
ATOM   3277 H HB2    . GLU B 2 109 ? 8.976   14.349  5.220   1.00  24.04 ? 116 GLU B HB2    1 
ATOM   3278 H HB3    . GLU B 2 109 ? 7.851   15.641  4.924   1.00  24.61 ? 116 GLU B HB3    1 
ATOM   3279 H HG2    . GLU B 2 109 ? 10.048  16.079  6.970   1.00  27.31 ? 116 GLU B HG2    1 
ATOM   3280 H HG3    . GLU B 2 109 ? 10.464  16.097  5.281   1.00  27.37 ? 116 GLU B HG3    1 
ATOM   3281 N N      . TYR B 2 110 ? 8.851   14.528  9.050   1.00  18.93 ? 117 TYR B N      1 
ATOM   3282 C CA     . TYR B 2 110 ? 9.743   13.872  10.043  1.00  17.90 ? 117 TYR B CA     1 
ATOM   3283 C C      . TYR B 2 110 ? 9.017   13.386  11.263  1.00  16.47 ? 117 TYR B C      1 
ATOM   3284 O O      . TYR B 2 110 ? 9.642   12.723  12.064  1.00  14.08 ? 117 TYR B O      1 
ATOM   3285 C CB     . TYR B 2 110 ? 10.830  14.860  10.498  1.00  21.80 ? 117 TYR B CB     1 
ATOM   3286 C CG     . TYR B 2 110 ? 11.739  15.316  9.353   1.00  22.69 ? 117 TYR B CG     1 
ATOM   3287 C CD1    . TYR B 2 110 ? 12.204  14.445  8.380   1.00  21.68 ? 117 TYR B CD1    1 
ATOM   3288 C CD2    . TYR B 2 110 ? 12.115  16.642  9.305   1.00  24.94 ? 117 TYR B CD2    1 
ATOM   3289 C CE1    . TYR B 2 110 ? 13.030  14.890  7.375   1.00  24.76 ? 117 TYR B CE1    1 
ATOM   3290 C CE2    . TYR B 2 110 ? 12.942  17.087  8.301   1.00  27.86 ? 117 TYR B CE2    1 
ATOM   3291 C CZ     . TYR B 2 110 ? 13.403  16.217  7.331   1.00  26.83 ? 117 TYR B CZ     1 
ATOM   3292 O OH     . TYR B 2 110 ? 14.218  16.706  6.338   1.00  29.94 ? 117 TYR B OH     1 
ATOM   3293 H H      . TYR B 2 110 ? 8.414   15.369  9.301   1.00  19.93 ? 117 TYR B H      1 
ATOM   3294 H HA     . TYR B 2 110 ? 10.204  13.007  9.594   1.00  19.23 ? 117 TYR B HA     1 
ATOM   3295 H HB2    . TYR B 2 110 ? 10.352  15.725  10.935  1.00  20.44 ? 117 TYR B HB2    1 
ATOM   3296 H HB3    . TYR B 2 110 ? 11.448  14.400  11.258  1.00  21.28 ? 117 TYR B HB3    1 
ATOM   3297 H HD1    . TYR B 2 110 ? 11.925  13.404  8.399   1.00  22.83 ? 117 TYR B HD1    1 
ATOM   3298 H HD2    . TYR B 2 110 ? 11.761  17.338  10.053  1.00  25.45 ? 117 TYR B HD2    1 
ATOM   3299 H HE1    . TYR B 2 110 ? 13.385  14.194  6.629   1.00  24.38 ? 117 TYR B HE1    1 
ATOM   3300 H HE2    . TYR B 2 110 ? 13.234  18.128  8.275   1.00  27.22 ? 117 TYR B HE2    1 
ATOM   3301 H HH     . TYR B 2 110 ? 14.810  15.980  6.086   1.00  29.51 ? 117 TYR B HH     1 
ATOM   3302 N N      . ILE B 2 111 ? 7.766   13.722  11.397  1.00  15.88 ? 118 ILE B N      1 
ATOM   3303 C CA     . ILE B 2 111 ? 6.946   13.310  12.557  1.00  14.57 ? 118 ILE B CA     1 
ATOM   3304 C C      . ILE B 2 111 ? 5.627   12.787  11.957  1.00  17.77 ? 118 ILE B C      1 
ATOM   3305 O O      . ILE B 2 111 ? 4.848   13.580  11.459  1.00  17.50 ? 118 ILE B O      1 
ATOM   3306 C CB     . ILE B 2 111 ? 6.670   14.549  13.514  1.00  15.40 ? 118 ILE B CB     1 
ATOM   3307 C CG1    . ILE B 2 111 ? 8.014   15.213  14.022  1.00  16.15 ? 118 ILE B CG1    1 
ATOM   3308 C CG2    . ILE B 2 111 ? 5.818   14.088  14.722  1.00  18.08 ? 118 ILE B CG2    1 
ATOM   3309 C CD1    . ILE B 2 111 ? 7.788   16.312  15.039  1.00  14.95 ? 118 ILE B CD1    1 
ATOM   3310 H H      . ILE B 2 111 ? 7.332   14.265  10.710  1.00  15.99 ? 118 ILE B H      1 
ATOM   3311 H HA     . ILE B 2 111 ? 7.447   12.509  13.082  1.00  16.84 ? 118 ILE B HA     1 
ATOM   3312 H HB     . ILE B 2 111 ? 6.100   15.284  12.961  1.00  16.68 ? 118 ILE B HB     1 
ATOM   3313 H HG12   . ILE B 2 111 ? 8.637   14.454  14.474  1.00  15.73 ? 118 ILE B HG12   1 
ATOM   3314 H HG13   . ILE B 2 111 ? 8.542   15.623  13.172  1.00  15.47 ? 118 ILE B HG13   1 
ATOM   3315 H HG21   . ILE B 2 111 ? 6.329   13.326  15.289  1.00  18.28 ? 118 ILE B HG21   1 
ATOM   3316 H HG22   . ILE B 2 111 ? 4.878   13.682  14.378  1.00  17.57 ? 118 ILE B HG22   1 
ATOM   3317 H HG23   . ILE B 2 111 ? 5.598   14.919  15.372  1.00  17.32 ? 118 ILE B HG23   1 
ATOM   3318 H HD11   . ILE B 2 111 ? 8.730   16.761  15.317  1.00  14.77 ? 118 ILE B HD11   1 
ATOM   3319 H HD12   . ILE B 2 111 ? 7.326   15.925  15.933  1.00  14.85 ? 118 ILE B HD12   1 
ATOM   3320 H HD13   . ILE B 2 111 ? 7.151   17.070  14.610  1.00  15.57 ? 118 ILE B HD13   1 
ATOM   3321 N N      . GLN B 2 112 ? 5.409   11.503  12.005  1.00  17.23 ? 119 GLN B N      1 
ATOM   3322 C CA     . GLN B 2 112 ? 4.161   10.877  11.454  1.00  17.47 ? 119 GLN B CA     1 
ATOM   3323 C C      . GLN B 2 112 ? 3.753   9.770   12.419  1.00  18.17 ? 119 GLN B C      1 
ATOM   3324 O O      . GLN B 2 112 ? 4.646   9.160   12.964  1.00  16.46 ? 119 GLN B O      1 
ATOM   3325 C CB     . GLN B 2 112 ? 4.425   10.249  10.062  1.00  18.43 ? 119 GLN B CB     1 
ATOM   3326 C CG     . GLN B 2 112 ? 4.634   11.303  8.946   1.00  15.46 ? 119 GLN B CG     1 
ATOM   3327 C CD     . GLN B 2 112 ? 3.277   11.948  8.685   1.00  20.19 ? 119 GLN B CD     1 
ATOM   3328 O OE1    . GLN B 2 112 ? 2.264   11.268  8.570   1.00  19.23 ? 119 GLN B OE1    1 
ATOM   3329 N NE2    . GLN B 2 112 ? 3.209   13.236  8.588   1.00  19.53 ? 119 GLN B NE2    1 
ATOM   3330 H H      . GLN B 2 112 ? 6.071   10.913  12.429  1.00  18.51 ? 119 GLN B H      1 
ATOM   3331 H HA     . GLN B 2 112 ? 3.388   11.630  11.427  1.00  19.33 ? 119 GLN B HA     1 
ATOM   3332 H HB2    . GLN B 2 112 ? 5.279   9.600   10.123  1.00  19.38 ? 119 GLN B HB2    1 
ATOM   3333 H HB3    . GLN B 2 112 ? 3.583   9.618   9.808   1.00  18.86 ? 119 GLN B HB3    1 
ATOM   3334 H HG2    . GLN B 2 112 ? 5.340   12.060  9.259   1.00  17.59 ? 119 GLN B HG2    1 
ATOM   3335 H HG3    . GLN B 2 112 ? 4.992   10.842  8.037   1.00  16.65 ? 119 GLN B HG3    1 
ATOM   3336 H HE21   . GLN B 2 112 ? 4.028   13.774  8.690   1.00  20.49 ? 119 GLN B HE21   1 
ATOM   3337 H HE22   . GLN B 2 112 ? 2.353   13.681  8.417   1.00  20.37 ? 119 GLN B HE22   1 
ATOM   3338 N N      . PRO B 2 113 ? 2.489   9.497   12.636  1.00  15.59 ? 120 PRO B N      1 
ATOM   3339 C CA     . PRO B 2 113 ? 2.122   8.298   13.399  1.00  14.82 ? 120 PRO B CA     1 
ATOM   3340 C C      . PRO B 2 113 ? 2.242   6.991   12.597  1.00  9.46  ? 120 PRO B C      1 
ATOM   3341 O O      . PRO B 2 113 ? 2.269   6.969   11.377  1.00  12.87 ? 120 PRO B O      1 
ATOM   3342 C CB     . PRO B 2 113 ? 0.704   8.602   13.885  1.00  17.55 ? 120 PRO B CB     1 
ATOM   3343 C CG     . PRO B 2 113 ? 0.108   9.509   12.763  1.00  18.52 ? 120 PRO B CG     1 
ATOM   3344 C CD     . PRO B 2 113 ? 1.313   10.314  12.195  1.00  17.20 ? 120 PRO B CD     1 
ATOM   3345 H HA     . PRO B 2 113 ? 2.786   8.230   14.251  1.00  16.32 ? 120 PRO B HA     1 
ATOM   3346 H HB2    . PRO B 2 113 ? 0.131   7.690   13.979  1.00  16.38 ? 120 PRO B HB2    1 
ATOM   3347 H HB3    . PRO B 2 113 ? 0.742   9.104   14.840  1.00  16.86 ? 120 PRO B HB3    1 
ATOM   3348 H HG2    . PRO B 2 113 ? -0.341  8.904   11.986  1.00  18.47 ? 120 PRO B HG2    1 
ATOM   3349 H HG3    . PRO B 2 113 ? -0.639  10.182  13.161  1.00  17.75 ? 120 PRO B HG3    1 
ATOM   3350 H HD2    . PRO B 2 113 ? 1.287   10.378  11.115  1.00  15.47 ? 120 PRO B HD2    1 
ATOM   3351 H HD3    . PRO B 2 113 ? 1.363   11.302  12.630  1.00  16.66 ? 120 PRO B HD3    1 
ATOM   3352 N N      . VAL B 2 114 ? 2.299   5.935   13.340  1.00  11.41 ? 121 VAL B N      1 
ATOM   3353 C CA     . VAL B 2 114 ? 2.412   4.597   12.743  1.00  13.25 ? 121 VAL B CA     1 
ATOM   3354 C C      . VAL B 2 114 ? 1.003   4.022   12.948  1.00  12.67 ? 121 VAL B C      1 
ATOM   3355 O O      . VAL B 2 114 ? 0.275   4.484   13.818  1.00  13.20 ? 121 VAL B O      1 
ATOM   3356 C CB     . VAL B 2 114 ? 3.511   3.733   13.519  1.00  13.68 ? 121 VAL B CB     1 
ATOM   3357 C CG1    . VAL B 2 114 ? 3.145   3.501   15.022  1.00  15.13 ? 121 VAL B CG1    1 
ATOM   3358 C CG2    . VAL B 2 114 ? 3.801   2.369   12.823  1.00  13.05 ? 121 VAL B CG2    1 
ATOM   3359 H H      . VAL B 2 114 ? 2.260   6.022   14.318  1.00  9.02  ? 121 VAL B H      1 
ATOM   3360 H HA     . VAL B 2 114 ? 2.641   4.690   11.692  1.00  11.65 ? 121 VAL B HA     1 
ATOM   3361 H HB     . VAL B 2 114 ? 4.426   4.301   13.477  1.00  13.70 ? 121 VAL B HB     1 
ATOM   3362 H HG11   . VAL B 2 114 ? 2.196   2.996   15.130  1.00  14.85 ? 121 VAL B HG11   1 
ATOM   3363 H HG12   . VAL B 2 114 ? 3.076   4.447   15.541  1.00  14.97 ? 121 VAL B HG12   1 
ATOM   3364 H HG13   . VAL B 2 114 ? 3.898   2.903   15.511  1.00  14.88 ? 121 VAL B HG13   1 
ATOM   3365 H HG21   . VAL B 2 114 ? 4.549   1.819   13.373  1.00  12.45 ? 121 VAL B HG21   1 
ATOM   3366 H HG22   . VAL B 2 114 ? 4.180   2.544   11.827  1.00  11.13 ? 121 VAL B HG22   1 
ATOM   3367 H HG23   . VAL B 2 114 ? 2.915   1.758   12.762  1.00  12.30 ? 121 VAL B HG23   1 
ATOM   3368 N N      . CYS B 2 115 ? 0.710   3.021   12.155  1.00  12.35 ? 122 CYS B N      1 
ATOM   3369 C CA     . CYS B 2 115 ? -0.638  2.359   12.235  1.00  15.93 ? 122 CYS B CA     1 
ATOM   3370 C C      . CYS B 2 115 ? -0.659  1.186   13.197  1.00  17.72 ? 122 CYS B C      1 
ATOM   3371 O O      . CYS B 2 115 ? 0.390   0.718   13.617  1.00  14.93 ? 122 CYS B O      1 
ATOM   3372 C CB     . CYS B 2 115 ? -1.056  1.852   10.798  1.00  14.61 ? 122 CYS B CB     1 
ATOM   3373 S SG     . CYS B 2 115 ? -1.073  3.031   9.447   1.00  15.63 ? 122 CYS B SG     1 
ATOM   3374 H H      . CYS B 2 115 ? 1.360   2.689   11.500  1.00  11.52 ? 122 CYS B H      1 
ATOM   3375 H HA     . CYS B 2 115 ? -1.361  3.086   12.586  1.00  16.02 ? 122 CYS B HA     1 
ATOM   3376 H HB2    . CYS B 2 115 ? -0.411  1.034   10.515  1.00  14.42 ? 122 CYS B HB2    1 
ATOM   3377 H HB3    . CYS B 2 115 ? -2.054  1.442   10.879  1.00  15.61 ? 122 CYS B HB3    1 
ATOM   3378 N N      . LEU B 2 116 ? -1.857  0.748   13.501  1.00  15.21 ? 123 LEU B N      1 
ATOM   3379 C CA     . LEU B 2 116 ? -2.032  -0.400  14.420  1.00  15.15 ? 123 LEU B CA     1 
ATOM   3380 C C      . LEU B 2 116 ? -2.359  -1.535  13.464  1.00  13.54 ? 123 LEU B C      1 
ATOM   3381 O O      . LEU B 2 116 ? -2.757  -1.288  12.336  1.00  12.68 ? 123 LEU B O      1 
ATOM   3382 C CB     . LEU B 2 116 ? -3.234  -0.213  15.407  1.00  16.83 ? 123 LEU B CB     1 
ATOM   3383 C CG     . LEU B 2 116 ? -3.029  0.942   16.420  1.00  19.79 ? 123 LEU B CG     1 
ATOM   3384 C CD1    . LEU B 2 116 ? -4.240  1.033   17.366  1.00  19.24 ? 123 LEU B CD1    1 
ATOM   3385 C CD2    . LEU B 2 116 ? -1.737  0.717   17.263  1.00  23.42 ? 123 LEU B CD2    1 
ATOM   3386 H H      . LEU B 2 116 ? -2.652  1.173   13.105  1.00  16.48 ? 123 LEU B H      1 
ATOM   3387 H HA     . LEU B 2 116 ? -1.095  -0.607  14.917  1.00  17.50 ? 123 LEU B HA     1 
ATOM   3388 H HB2    . LEU B 2 116 ? -4.114  -0.013  14.812  1.00  17.30 ? 123 LEU B HB2    1 
ATOM   3389 H HB3    . LEU B 2 116 ? -3.417  -1.142  15.924  1.00  17.35 ? 123 LEU B HB3    1 
ATOM   3390 H HG     . LEU B 2 116 ? -2.944  1.873   15.873  1.00  20.15 ? 123 LEU B HG     1 
ATOM   3391 H HD11   . LEU B 2 116 ? -4.379  0.127   17.937  1.00  19.98 ? 123 LEU B HD11   1 
ATOM   3392 H HD12   . LEU B 2 116 ? -5.142  1.209   16.794  1.00  20.13 ? 123 LEU B HD12   1 
ATOM   3393 H HD13   . LEU B 2 116 ? -4.131  1.858   18.054  1.00  19.24 ? 123 LEU B HD13   1 
ATOM   3394 H HD21   . LEU B 2 116 ? -1.612  1.513   17.987  1.00  22.80 ? 123 LEU B HD21   1 
ATOM   3395 H HD22   . LEU B 2 116 ? -0.856  0.714   16.635  1.00  22.92 ? 123 LEU B HD22   1 
ATOM   3396 H HD23   . LEU B 2 116 ? -1.780  -0.223  17.794  1.00  22.96 ? 123 LEU B HD23   1 
ATOM   3397 N N      . PRO B 2 117 ? -2.175  -2.756  13.913  1.00  16.43 ? 124 PRO B N      1 
ATOM   3398 C CA     . PRO B 2 117 ? -2.691  -3.937  13.192  1.00  17.89 ? 124 PRO B CA     1 
ATOM   3399 C C      . PRO B 2 117 ? -4.219  -3.805  13.024  1.00  13.85 ? 124 PRO B C      1 
ATOM   3400 O O      . PRO B 2 117 ? -4.880  -3.284  13.911  1.00  12.69 ? 124 PRO B O      1 
ATOM   3401 C CB     . PRO B 2 117 ? -2.283  -5.173  14.047  1.00  18.09 ? 124 PRO B CB     1 
ATOM   3402 C CG     . PRO B 2 117 ? -1.699  -4.608  15.368  1.00  20.40 ? 124 PRO B CG     1 
ATOM   3403 C CD     . PRO B 2 117 ? -1.445  -3.111  15.168  1.00  17.56 ? 124 PRO B CD     1 
ATOM   3404 H HA     . PRO B 2 117 ? -2.235  -3.970  12.215  1.00  16.82 ? 124 PRO B HA     1 
ATOM   3405 H HB2    . PRO B 2 117 ? -3.149  -5.775  14.270  1.00  18.06 ? 124 PRO B HB2    1 
ATOM   3406 H HB3    . PRO B 2 117 ? -1.562  -5.803  13.553  1.00  18.71 ? 124 PRO B HB3    1 
ATOM   3407 H HG2    . PRO B 2 117 ? -2.396  -4.753  16.180  1.00  19.35 ? 124 PRO B HG2    1 
ATOM   3408 H HG3    . PRO B 2 117 ? -0.767  -5.107  15.607  1.00  18.84 ? 124 PRO B HG3    1 
ATOM   3409 H HD2    . PRO B 2 117 ? -1.836  -2.544  16.002  1.00  17.47 ? 124 PRO B HD2    1 
ATOM   3410 H HD3    . PRO B 2 117 ? -0.392  -2.899  15.048  1.00  18.90 ? 124 PRO B HD3    1 
ATOM   3411 N N      . ALA B 2 118 ? -4.711  -4.287  11.922  1.00  15.04 ? 125 ALA B N      1 
ATOM   3412 C CA     . ALA B 2 118 ? -6.184  -4.201  11.691  1.00  15.19 ? 125 ALA B CA     1 
ATOM   3413 C C      . ALA B 2 118 ? -6.822  -5.331  12.522  1.00  16.94 ? 125 ALA B C      1 
ATOM   3414 O O      . ALA B 2 118 ? -6.148  -6.272  12.921  1.00  16.98 ? 125 ALA B O      1 
ATOM   3415 C CB     . ALA B 2 118 ? -6.429  -4.386  10.214  1.00  13.28 ? 125 ALA B CB     1 
ATOM   3416 H H      . ALA B 2 118 ? -4.124  -4.699  11.262  1.00  14.86 ? 125 ALA B H      1 
ATOM   3417 H HA     . ALA B 2 118 ? -6.549  -3.241  12.032  1.00  13.72 ? 125 ALA B HA     1 
ATOM   3418 H HB1    . ALA B 2 118 ? -7.489  -4.298  10.029  1.00  15.34 ? 125 ALA B HB1    1 
ATOM   3419 H HB2    . ALA B 2 118 ? -6.099  -5.354  9.876   1.00  14.87 ? 125 ALA B HB2    1 
ATOM   3420 H HB3    . ALA B 2 118 ? -5.924  -3.619  9.647   1.00  14.27 ? 125 ALA B HB3    1 
ATOM   3421 N N      . ALA B 2 119 ? -8.114  -5.239  12.760  1.00  17.47 ? 126 ALA B N      1 
ATOM   3422 C CA     . ALA B 2 119 ? -8.826  -6.276  13.564  1.00  16.26 ? 126 ALA B CA     1 
ATOM   3423 C C      . ALA B 2 119 ? -8.631  -7.630  12.882  1.00  14.85 ? 126 ALA B C      1 
ATOM   3424 O O      . ALA B 2 119 ? -8.777  -7.795  11.683  1.00  18.78 ? 126 ALA B O      1 
ATOM   3425 C CB     . ALA B 2 119 ? -10.335 -5.940  13.656  1.00  16.58 ? 126 ALA B CB     1 
ATOM   3426 H H      . ALA B 2 119 ? -8.608  -4.473  12.387  1.00  16.91 ? 126 ALA B H      1 
ATOM   3427 H HA     . ALA B 2 119 ? -8.405  -6.295  14.561  1.00  15.40 ? 126 ALA B HA     1 
ATOM   3428 H HB1    . ALA B 2 119 ? -10.848 -6.685  14.240  1.00  15.85 ? 126 ALA B HB1    1 
ATOM   3429 H HB2    . ALA B 2 119 ? -10.774 -5.901  12.671  1.00  16.02 ? 126 ALA B HB2    1 
ATOM   3430 H HB3    . ALA B 2 119 ? -10.474 -4.981  14.136  1.00  16.19 ? 126 ALA B HB3    1 
ATOM   3431 N N      . GLY B 2 120 ? -8.288  -8.588  13.678  1.00  20.75 ? 127 GLY B N      1 
ATOM   3432 C CA     . GLY B 2 120 ? -8.076  -9.937  13.099  1.00  22.38 ? 127 GLY B CA     1 
ATOM   3433 C C      . GLY B 2 120 ? -6.718  -10.067 12.422  1.00  22.70 ? 127 GLY B C      1 
ATOM   3434 O O      . GLY B 2 120 ? -6.373  -11.166 12.052  1.00  23.14 ? 127 GLY B O      1 
ATOM   3435 H H      . GLY B 2 120 ? -8.163  -8.432  14.639  1.00  19.52 ? 127 GLY B H      1 
ATOM   3436 H HA2    . GLY B 2 120 ? -8.129  -10.667 13.892  1.00  22.62 ? 127 GLY B HA2    1 
ATOM   3437 H HA3    . GLY B 2 120 ? -8.838  -10.135 12.360  1.00  22.78 ? 127 GLY B HA3    1 
ATOM   3438 N N      . GLN B 2 121 ? -5.982  -8.996  12.260  1.00  21.26 ? 128 GLN B N      1 
ATOM   3439 C CA     . GLN B 2 121 ? -4.658  -9.131  11.592  1.00  22.02 ? 128 GLN B CA     1 
ATOM   3440 C C      . GLN B 2 121 ? -3.707  -9.880  12.516  1.00  22.29 ? 128 GLN B C      1 
ATOM   3441 O O      . GLN B 2 121 ? -3.445  -9.407  13.608  1.00  25.69 ? 128 GLN B O      1 
ATOM   3442 C CB     . GLN B 2 121 ? -4.104  -7.734  11.290  1.00  21.21 ? 128 GLN B CB     1 
ATOM   3443 C CG     . GLN B 2 121 ? -2.838  -7.885  10.469  1.00  20.00 ? 128 GLN B CG     1 
ATOM   3444 C CD     . GLN B 2 121 ? -2.413  -6.560  9.867   1.00  19.59 ? 128 GLN B CD     1 
ATOM   3445 O OE1    . GLN B 2 121 ? -2.794  -5.505  10.316  1.00  18.05 ? 128 GLN B OE1    1 
ATOM   3446 N NE2    . GLN B 2 121 ? -1.622  -6.542  8.848   1.00  19.16 ? 128 GLN B NE2    1 
ATOM   3447 H H      . GLN B 2 121 ? -6.298  -8.125  12.569  1.00  22.11 ? 128 GLN B H      1 
ATOM   3448 H HA     . GLN B 2 121 ? -4.802  -9.703  10.688  1.00  21.37 ? 128 GLN B HA     1 
ATOM   3449 H HB2    . GLN B 2 121 ? -4.831  -7.145  10.755  1.00  21.95 ? 128 GLN B HB2    1 
ATOM   3450 H HB3    . GLN B 2 121 ? -3.852  -7.225  12.208  1.00  21.06 ? 128 GLN B HB3    1 
ATOM   3451 H HG2    . GLN B 2 121 ? -2.041  -8.249  11.098  1.00  20.82 ? 128 GLN B HG2    1 
ATOM   3452 H HG3    . GLN B 2 121 ? -2.997  -8.584  9.660   1.00  20.61 ? 128 GLN B HG3    1 
ATOM   3453 H HE21   . GLN B 2 121 ? -1.271  -7.371  8.453   1.00  19.85 ? 128 GLN B HE21   1 
ATOM   3454 H HE22   . GLN B 2 121 ? -1.378  -5.679  8.472   1.00  20.24 ? 128 GLN B HE22   1 
ATOM   3455 N N      . ALA B 2 122 ? -3.202  -10.994 12.080  1.00  24.06 ? 129 ALA B N      1 
ATOM   3456 C CA     . ALA B 2 122 ? -2.262  -11.779 12.950  1.00  28.33 ? 129 ALA B CA     1 
ATOM   3457 C C      . ALA B 2 122 ? -0.783  -11.658 12.524  1.00  24.88 ? 129 ALA B C      1 
ATOM   3458 O O      . ALA B 2 122 ? -0.477  -11.283 11.403  1.00  24.32 ? 129 ALA B O      1 
ATOM   3459 C CB     . ALA B 2 122 ? -2.672  -13.256 12.901  1.00  30.75 ? 129 ALA B CB     1 
ATOM   3460 H H      . ALA B 2 122 ? -3.439  -11.312 11.181  1.00  23.50 ? 129 ALA B H      1 
ATOM   3461 H HA     . ALA B 2 122 ? -2.356  -11.426 13.970  1.00  27.07 ? 129 ALA B HA     1 
ATOM   3462 H HB1    . ALA B 2 122 ? -2.000  -13.858 13.495  1.00  29.55 ? 129 ALA B HB1    1 
ATOM   3463 H HB2    . ALA B 2 122 ? -2.622  -13.601 11.876  1.00  29.28 ? 129 ALA B HB2    1 
ATOM   3464 H HB3    . ALA B 2 122 ? -3.682  -13.385 13.268  1.00  29.96 ? 129 ALA B HB3    1 
ATOM   3465 N N      . LEU B 2 123 ? 0.088   -11.979 13.449  1.00  25.76 ? 130 LEU B N      1 
ATOM   3466 C CA     . LEU B 2 123 ? 1.554   -11.914 13.161  1.00  27.00 ? 130 LEU B CA     1 
ATOM   3467 C C      . LEU B 2 123 ? 1.898   -13.075 12.238  1.00  25.49 ? 130 LEU B C      1 
ATOM   3468 O O      . LEU B 2 123 ? 1.402   -14.178 12.391  1.00  24.03 ? 130 LEU B O      1 
ATOM   3469 C CB     . LEU B 2 123 ? 2.464   -12.158 14.370  1.00  30.49 ? 130 LEU B CB     1 
ATOM   3470 C CG     . LEU B 2 123 ? 2.438   -11.120 15.462  1.00  32.48 ? 130 LEU B CG     1 
ATOM   3471 C CD1    . LEU B 2 123 ? 3.402   -11.658 16.542  1.00  33.14 ? 130 LEU B CD1    1 
ATOM   3472 C CD2    . LEU B 2 123 ? 3.012   -9.779  14.953  1.00  33.44 ? 130 LEU B CD2    1 
ATOM   3473 H H      . LEU B 2 123 ? -0.221  -12.264 14.332  1.00  26.09 ? 130 LEU B H      1 
ATOM   3474 H HA     . LEU B 2 123 ? 1.786   -10.984 12.666  1.00  28.41 ? 130 LEU B HA     1 
ATOM   3475 H HB2    . LEU B 2 123 ? 2.180   -13.113 14.787  1.00  30.77 ? 130 LEU B HB2    1 
ATOM   3476 H HB3    . LEU B 2 123 ? 3.479   -12.266 14.005  1.00  30.05 ? 130 LEU B HB3    1 
ATOM   3477 H HG     . LEU B 2 123 ? 1.436   -10.993 15.858  1.00  32.32 ? 130 LEU B HG     1 
ATOM   3478 H HD11   . LEU B 2 123 ? 4.400   -11.781 16.140  1.00  32.84 ? 130 LEU B HD11   1 
ATOM   3479 H HD12   . LEU B 2 123 ? 3.066   -12.609 16.933  1.00  33.15 ? 130 LEU B HD12   1 
ATOM   3480 H HD13   . LEU B 2 123 ? 3.456   -10.962 17.367  1.00  33.56 ? 130 LEU B HD13   1 
ATOM   3481 H HD21   . LEU B 2 123 ? 2.997   -9.060  15.763  1.00  32.76 ? 130 LEU B HD21   1 
ATOM   3482 H HD22   . LEU B 2 123 ? 2.416   -9.385  14.141  1.00  33.12 ? 130 LEU B HD22   1 
ATOM   3483 H HD23   . LEU B 2 123 ? 4.031   -9.885  14.610  1.00  32.77 ? 130 LEU B HD23   1 
ATOM   3484 N N      . VAL B 2 124 ? 2.769   -12.800 11.338  1.00  25.45 ? 131 VAL B N      1 
ATOM   3485 C CA     . VAL B 2 124 ? 3.214   -13.808 10.368  1.00  27.20 ? 131 VAL B CA     1 
ATOM   3486 C C      . VAL B 2 124 ? 4.555   -14.363 10.881  1.00  29.14 ? 131 VAL B C      1 
ATOM   3487 O O      . VAL B 2 124 ? 5.553   -13.667 10.845  1.00  25.56 ? 131 VAL B O      1 
ATOM   3488 C CB     . VAL B 2 124 ? 3.382   -13.107 9.043   1.00  28.35 ? 131 VAL B CB     1 
ATOM   3489 C CG1    . VAL B 2 124 ? 3.712   -14.136 7.978   1.00  30.42 ? 131 VAL B CG1    1 
ATOM   3490 C CG2    . VAL B 2 124 ? 2.124   -12.213 8.655   1.00  30.21 ? 131 VAL B CG2    1 
ATOM   3491 H H      . VAL B 2 124 ? 3.153   -11.897 11.292  1.00  26.63 ? 131 VAL B H      1 
ATOM   3492 H HA     . VAL B 2 124 ? 2.484   -14.604 10.310  1.00  28.13 ? 131 VAL B HA     1 
ATOM   3493 H HB     . VAL B 2 124 ? 4.232   -12.448 9.149   1.00  29.16 ? 131 VAL B HB     1 
ATOM   3494 H HG11   . VAL B 2 124 ? 2.929   -14.874 7.906   1.00  30.74 ? 131 VAL B HG11   1 
ATOM   3495 H HG12   . VAL B 2 124 ? 4.636   -14.641 8.229   1.00  30.44 ? 131 VAL B HG12   1 
ATOM   3496 H HG13   . VAL B 2 124 ? 3.838   -13.652 7.019   1.00  30.49 ? 131 VAL B HG13   1 
ATOM   3497 H HG21   . VAL B 2 124 ? 2.272   -11.741 7.694   1.00  28.48 ? 131 VAL B HG21   1 
ATOM   3498 H HG22   . VAL B 2 124 ? 1.970   -11.432 9.388   1.00  28.83 ? 131 VAL B HG22   1 
ATOM   3499 H HG23   . VAL B 2 124 ? 1.222   -12.807 8.616   1.00  29.62 ? 131 VAL B HG23   1 
ATOM   3500 N N      . ASP B 2 125 ? 4.580   -15.578 11.360  1.00  30.74 ? 132 ASP B N      1 
ATOM   3501 C CA     . ASP B 2 125 ? 5.885   -16.130 11.851  1.00  30.63 ? 132 ASP B CA     1 
ATOM   3502 C C      . ASP B 2 125 ? 6.889   -16.129 10.708  1.00  28.11 ? 132 ASP B C      1 
ATOM   3503 O O      . ASP B 2 125 ? 6.527   -16.435 9.586   1.00  28.22 ? 132 ASP B O      1 
ATOM   3504 C CB     . ASP B 2 125 ? 5.798   -17.609 12.317  1.00  31.56 ? 132 ASP B CB     1 
ATOM   3505 C CG     . ASP B 2 125 ? 5.129   -17.771 13.690  1.00  35.96 ? 132 ASP B CG     1 
ATOM   3506 O OD1    . ASP B 2 125 ? 5.140   -16.832 14.471  1.00  37.78 ? 132 ASP B OD1    1 
ATOM   3507 O OD2    . ASP B 2 125 ? 4.636   -18.865 13.894  1.00  40.67 ? 132 ASP B OD2    1 
ATOM   3508 H H      . ASP B 2 125 ? 3.757   -16.104 11.392  1.00  32.25 ? 132 ASP B H      1 
ATOM   3509 H HA     . ASP B 2 125 ? 6.252   -15.484 12.634  1.00  30.38 ? 132 ASP B HA     1 
ATOM   3510 H HB2    . ASP B 2 125 ? 5.248   -18.169 11.576  1.00  32.10 ? 132 ASP B HB2    1 
ATOM   3511 H HB3    . ASP B 2 125 ? 6.788   -18.041 12.381  1.00  32.58 ? 132 ASP B HB3    1 
ATOM   3512 N N      . GLY B 2 126 ? 8.117   -15.787 10.982  1.00  24.47 ? 133 GLY B N      1 
ATOM   3513 C CA     . GLY B 2 126 ? 9.099   -15.800 9.866   1.00  22.30 ? 133 GLY B CA     1 
ATOM   3514 C C      . GLY B 2 126 ? 9.172   -14.466 9.159   1.00  21.48 ? 133 GLY B C      1 
ATOM   3515 O O      . GLY B 2 126 ? 10.174  -14.217 8.511   1.00  18.84 ? 133 GLY B O      1 
ATOM   3516 H H      . GLY B 2 126 ? 8.400   -15.525 11.885  1.00  24.67 ? 133 GLY B H      1 
ATOM   3517 H HA2    . GLY B 2 126 ? 10.071  -16.039 10.264  1.00  22.79 ? 133 GLY B HA2    1 
ATOM   3518 H HA3    . GLY B 2 126 ? 8.829   -16.562 9.147   1.00  22.32 ? 133 GLY B HA3    1 
ATOM   3519 N N      . LYS B 2 127 ? 8.150   -13.644 9.276   1.00  18.34 ? 134 LYS B N      1 
ATOM   3520 C CA     . LYS B 2 127 ? 8.227   -12.346 8.573   1.00  20.19 ? 134 LYS B CA     1 
ATOM   3521 C C      . LYS B 2 127 ? 9.340   -11.508 9.216   1.00  13.59 ? 134 LYS B C      1 
ATOM   3522 O O      . LYS B 2 127 ? 9.510   -11.549 10.416  1.00  14.47 ? 134 LYS B O      1 
ATOM   3523 C CB     . LYS B 2 127 ? 6.859   -11.613 8.692   1.00  21.75 ? 134 LYS B CB     1 
ATOM   3524 C CG     . LYS B 2 127 ? 6.916   -10.297 7.874   1.00  24.29 ? 134 LYS B CG     1 
ATOM   3525 C CD     . LYS B 2 127 ? 5.509   -9.640  7.857   1.00  28.96 ? 134 LYS B CD     1 
ATOM   3526 C CE     . LYS B 2 127 ? 5.486   -8.498  6.793   1.00  33.91 ? 134 LYS B CE     1 
ATOM   3527 N NZ     . LYS B 2 127 ? 4.078   -8.010  6.591   1.00  38.32 ? 134 LYS B NZ     1 
ATOM   3528 H H      . LYS B 2 127 ? 7.355   -13.867 9.808   1.00  18.63 ? 134 LYS B H      1 
ATOM   3529 H HA     . LYS B 2 127 ? 8.469   -12.537 7.537   1.00  18.29 ? 134 LYS B HA     1 
ATOM   3530 H HB2    . LYS B 2 127 ? 6.091   -12.267 8.312   1.00  21.93 ? 134 LYS B HB2    1 
ATOM   3531 H HB3    . LYS B 2 127 ? 6.652   -11.398 9.731   1.00  21.51 ? 134 LYS B HB3    1 
ATOM   3532 H HG2    . LYS B 2 127 ? 7.609   -9.613  8.345   1.00  24.47 ? 134 LYS B HG2    1 
ATOM   3533 H HG3    . LYS B 2 127 ? 7.269   -10.498 6.872   1.00  24.14 ? 134 LYS B HG3    1 
ATOM   3534 H HD2    . LYS B 2 127 ? 4.750   -10.371 7.619   1.00  28.71 ? 134 LYS B HD2    1 
ATOM   3535 H HD3    . LYS B 2 127 ? 5.290   -9.224  8.832   1.00  28.01 ? 134 LYS B HD3    1 
ATOM   3536 H HE2    . LYS B 2 127 ? 6.092   -7.665  7.120   1.00  33.21 ? 134 LYS B HE2    1 
ATOM   3537 H HE3    . LYS B 2 127 ? 5.857   -8.845  5.837   1.00  33.15 ? 134 LYS B HE3    1 
ATOM   3538 H HZ1    . LYS B 2 127 ? 4.014   -7.002  6.839   1.00  37.69 ? 134 LYS B HZ1    1 
ATOM   3539 H HZ2    . LYS B 2 127 ? 3.426   -8.550  7.195   1.00  37.43 ? 134 LYS B HZ2    1 
ATOM   3540 H HZ3    . LYS B 2 127 ? 3.808   -8.137  5.594   1.00  37.31 ? 134 LYS B HZ3    1 
ATOM   3541 N N      . ILE B 2 128 ? 10.005  -10.788 8.371   1.00  15.93 ? 135 ILE B N      1 
ATOM   3542 C CA     . ILE B 2 128 ? 11.123  -9.908  8.765   1.00  18.94 ? 135 ILE B CA     1 
ATOM   3543 C C      . ILE B 2 128 ? 10.578  -8.458  8.894   1.00  17.03 ? 135 ILE B C      1 
ATOM   3544 O O      . ILE B 2 128 ? 10.095  -7.843  7.955   1.00  19.24 ? 135 ILE B O      1 
ATOM   3545 C CB     . ILE B 2 128 ? 12.211  -10.043 7.675   1.00  20.75 ? 135 ILE B CB     1 
ATOM   3546 C CG1    . ILE B 2 128 ? 12.757  -11.535 7.670   1.00  21.84 ? 135 ILE B CG1    1 
ATOM   3547 C CG2    . ILE B 2 128 ? 13.400  -9.077  8.030   1.00  22.64 ? 135 ILE B CG2    1 
ATOM   3548 C CD1    . ILE B 2 128 ? 13.432  -11.794 6.331   1.00  22.32 ? 135 ILE B CD1    1 
ATOM   3549 H H      . ILE B 2 128 ? 9.760   -10.819 7.421   1.00  17.84 ? 135 ILE B H      1 
ATOM   3550 H HA     . ILE B 2 128 ? 11.498  -10.236 9.724   1.00  19.18 ? 135 ILE B HA     1 
ATOM   3551 H HB     . ILE B 2 128 ? 11.790  -9.778  6.713   1.00  20.75 ? 135 ILE B HB     1 
ATOM   3552 H HG12   . ILE B 2 128 ? 13.470  -11.699 8.466   1.00  20.79 ? 135 ILE B HG12   1 
ATOM   3553 H HG13   . ILE B 2 128 ? 11.948  -12.242 7.798   1.00  21.57 ? 135 ILE B HG13   1 
ATOM   3554 H HG21   . ILE B 2 128 ? 13.829  -9.322  8.993   1.00  22.12 ? 135 ILE B HG21   1 
ATOM   3555 H HG22   . ILE B 2 128 ? 13.060  -8.051  8.066   1.00  22.22 ? 135 ILE B HG22   1 
ATOM   3556 H HG23   . ILE B 2 128 ? 14.169  -9.156  7.278   1.00  22.42 ? 135 ILE B HG23   1 
ATOM   3557 H HD11   . ILE B 2 128 ? 13.823  -12.801 6.310   1.00  22.55 ? 135 ILE B HD11   1 
ATOM   3558 H HD12   . ILE B 2 128 ? 14.245  -11.104 6.179   1.00  22.58 ? 135 ILE B HD12   1 
ATOM   3559 H HD13   . ILE B 2 128 ? 12.721  -11.677 5.525   1.00  21.65 ? 135 ILE B HD13   1 
ATOM   3560 N N      . CYS B 2 129 ? 10.684  -7.962  10.089  1.00  15.48 ? 136 CYS B N      1 
ATOM   3561 C CA     . CYS B 2 129 ? 10.218  -6.594  10.407  1.00  15.47 ? 136 CYS B CA     1 
ATOM   3562 C C      . CYS B 2 129 ? 11.445  -5.799  10.872  1.00  15.67 ? 136 CYS B C      1 
ATOM   3563 O O      . CYS B 2 129 ? 12.544  -6.323  10.910  1.00  14.30 ? 136 CYS B O      1 
ATOM   3564 C CB     . CYS B 2 129 ? 9.132   -6.806  11.439  1.00  15.00 ? 136 CYS B CB     1 
ATOM   3565 S SG     . CYS B 2 129 ? 7.722   -7.783  10.828  1.00  19.03 ? 136 CYS B SG     1 
ATOM   3566 H H      . CYS B 2 129 ? 11.088  -8.500  10.807  1.00  16.89 ? 136 CYS B H      1 
ATOM   3567 H HA     . CYS B 2 129 ? 9.799   -6.126  9.534   1.00  14.34 ? 136 CYS B HA     1 
ATOM   3568 H HB2    . CYS B 2 129 ? 9.558   -7.312  12.286  1.00  16.06 ? 136 CYS B HB2    1 
ATOM   3569 H HB3    . CYS B 2 129 ? 8.763   -5.857  11.789  1.00  16.17 ? 136 CYS B HB3    1 
ATOM   3570 N N      . THR B 2 130 ? 11.219  -4.570  11.202  1.00  15.02 ? 137 THR B N      1 
ATOM   3571 C CA     . THR B 2 130 ? 12.297  -3.651  11.655  1.00  15.68 ? 137 THR B CA     1 
ATOM   3572 C C      . THR B 2 130 ? 12.088  -3.184  13.075  1.00  14.34 ? 137 THR B C      1 
ATOM   3573 O O      . THR B 2 130 ? 10.965  -2.957  13.484  1.00  13.13 ? 137 THR B O      1 
ATOM   3574 C CB     . THR B 2 130 ? 12.307  -2.425  10.716  1.00  14.83 ? 137 THR B CB     1 
ATOM   3575 O OG1    . THR B 2 130 ? 12.588  -2.906  9.406   1.00  17.74 ? 137 THR B OG1    1 
ATOM   3576 C CG2    . THR B 2 130 ? 13.363  -1.348  11.045  1.00  13.40 ? 137 THR B CG2    1 
ATOM   3577 H H      . THR B 2 130 ? 10.296  -4.231  11.159  1.00  16.72 ? 137 THR B H      1 
ATOM   3578 H HA     . THR B 2 130 ? 13.242  -4.170  11.594  1.00  15.86 ? 137 THR B HA     1 
ATOM   3579 H HB     . THR B 2 130 ? 11.332  -1.955  10.719  1.00  16.38 ? 137 THR B HB     1 
ATOM   3580 H HG1    . THR B 2 130 ? 11.979  -3.641  9.213   1.00  18.69 ? 137 THR B HG1    1 
ATOM   3581 H HG21   . THR B 2 130 ? 13.300  -0.537  10.343  1.00  13.73 ? 137 THR B HG21   1 
ATOM   3582 H HG22   . THR B 2 130 ? 14.361  -1.759  11.014  1.00  14.45 ? 137 THR B HG22   1 
ATOM   3583 H HG23   . THR B 2 130 ? 13.181  -0.946  12.028  1.00  13.04 ? 137 THR B HG23   1 
ATOM   3584 N N      . VAL B 2 131 ? 13.171  -3.048  13.789  1.00  10.87 ? 138 VAL B N      1 
ATOM   3585 C CA     . VAL B 2 131 ? 13.119  -2.584  15.152  1.00  11.47 ? 138 VAL B CA     1 
ATOM   3586 C C      . VAL B 2 131 ? 14.147  -1.378  15.108  1.00  11.81 ? 138 VAL B C      1 
ATOM   3587 O O      . VAL B 2 131 ? 15.186  -1.418  14.450  1.00  11.41 ? 138 VAL B O      1 
ATOM   3588 C CB     . VAL B 2 131 ? 13.502  -3.778  16.080  1.00  14.56 ? 138 VAL B CB     1 
ATOM   3589 C CG1    . VAL B 2 131 ? 14.945  -4.328  15.881  1.00  16.03 ? 138 VAL B CG1    1 
ATOM   3590 C CG2    . VAL B 2 131 ? 13.187  -3.345  17.534  1.00  16.88 ? 138 VAL B CG2    1 
ATOM   3591 H H      . VAL B 2 131 ? 14.049  -3.257  13.399  1.00  13.74 ? 138 VAL B H      1 
ATOM   3592 H HA     . VAL B 2 131 ? 12.128  -2.208  15.368  1.00  12.64 ? 138 VAL B HA     1 
ATOM   3593 H HB     . VAL B 2 131 ? 12.824  -4.587  15.838  1.00  14.71 ? 138 VAL B HB     1 
ATOM   3594 H HG11   . VAL B 2 131 ? 15.679  -3.551  16.039  1.00  16.02 ? 138 VAL B HG11   1 
ATOM   3595 H HG12   . VAL B 2 131 ? 15.061  -4.691  14.868  1.00  16.07 ? 138 VAL B HG12   1 
ATOM   3596 H HG13   . VAL B 2 131 ? 15.155  -5.151  16.551  1.00  16.12 ? 138 VAL B HG13   1 
ATOM   3597 H HG21   . VAL B 2 131 ? 13.421  -4.120  18.245  1.00  16.63 ? 138 VAL B HG21   1 
ATOM   3598 H HG22   . VAL B 2 131 ? 12.131  -3.114  17.617  1.00  17.55 ? 138 VAL B HG22   1 
ATOM   3599 H HG23   . VAL B 2 131 ? 13.732  -2.451  17.805  1.00  16.35 ? 138 VAL B HG23   1 
ATOM   3600 N N      . THR B 2 132 ? 13.784  -0.331  15.801  1.00  12.23 ? 139 THR B N      1 
ATOM   3601 C CA     . THR B 2 132 ? 14.641  0.873   15.853  1.00  12.59 ? 139 THR B CA     1 
ATOM   3602 C C      . THR B 2 132 ? 14.773  1.415   17.299  1.00  11.42 ? 139 THR B C      1 
ATOM   3603 O O      . THR B 2 132 ? 13.963  1.148   18.184  1.00  12.75 ? 139 THR B O      1 
ATOM   3604 C CB     . THR B 2 132 ? 14.020  1.994   14.894  1.00  13.20 ? 139 THR B CB     1 
ATOM   3605 O OG1    . THR B 2 132 ? 12.644  2.180   15.229  1.00  13.09 ? 139 THR B OG1    1 
ATOM   3606 C CG2    . THR B 2 132 ? 14.006  1.564   13.431  1.00  14.04 ? 139 THR B CG2    1 
ATOM   3607 H H      . THR B 2 132 ? 12.938  -0.310  16.302  1.00  9.79  ? 139 THR B H      1 
ATOM   3608 H HA     . THR B 2 132 ? 15.625  0.592   15.504  1.00  12.55 ? 139 THR B HA     1 
ATOM   3609 H HB     . THR B 2 132 ? 14.540  2.935   15.018  1.00  13.78 ? 139 THR B HB     1 
ATOM   3610 H HG1    . THR B 2 132 ? 12.593  2.889   15.896  1.00  10.32 ? 139 THR B HG1    1 
ATOM   3611 H HG21   . THR B 2 132 ? 13.595  2.347   12.815  1.00  14.54 ? 139 THR B HG21   1 
ATOM   3612 H HG22   . THR B 2 132 ? 13.427  0.665   13.298  1.00  13.68 ? 139 THR B HG22   1 
ATOM   3613 H HG23   . THR B 2 132 ? 15.012  1.375   13.101  1.00  13.80 ? 139 THR B HG23   1 
ATOM   3614 N N      . GLY B 2 133 ? 15.803  2.198   17.509  1.00  11.69 ? 140 GLY B N      1 
ATOM   3615 C CA     . GLY B 2 133 ? 16.041  2.795   18.829  1.00  10.82 ? 140 GLY B CA     1 
ATOM   3616 C C      . GLY B 2 133 ? 17.451  3.351   18.979  1.00  8.15  ? 140 GLY B C      1 
ATOM   3617 O O      . GLY B 2 133 ? 18.299  3.170   18.117  1.00  11.52 ? 140 GLY B O      1 
ATOM   3618 H H      . GLY B 2 133 ? 16.437  2.390   16.780  1.00  13.01 ? 140 GLY B H      1 
ATOM   3619 H HA2    . GLY B 2 133 ? 15.342  3.610   18.950  1.00  10.26 ? 140 GLY B HA2    1 
ATOM   3620 H HA3    . GLY B 2 133 ? 15.847  2.055   19.584  1.00  10.44 ? 140 GLY B HA3    1 
ATOM   3621 N N      . TRP B 2 134 ? 17.612  4.003   20.082  1.00  13.18 ? 141 TRP B N      1 
ATOM   3622 C CA     . TRP B 2 134 ? 18.910  4.675   20.512  1.00  16.44 ? 141 TRP B CA     1 
ATOM   3623 C C      . TRP B 2 134 ? 19.567  3.922   21.679  1.00  15.36 ? 141 TRP B C      1 
ATOM   3624 O O      . TRP B 2 134 ? 20.412  4.471   22.351  1.00  17.19 ? 141 TRP B O      1 
ATOM   3625 C CB     . TRP B 2 134 ? 18.658  6.106   21.028  1.00  13.54 ? 141 TRP B CB     1 
ATOM   3626 C CG     . TRP B 2 134 ? 18.301  7.112   19.960  1.00  15.42 ? 141 TRP B CG     1 
ATOM   3627 C CD1    . TRP B 2 134 ? 19.206  7.763   19.173  1.00  17.51 ? 141 TRP B CD1    1 
ATOM   3628 C CD2    . TRP B 2 134 ? 17.054  7.564   19.682  1.00  16.24 ? 141 TRP B CD2    1 
ATOM   3629 N NE1    . TRP B 2 134 ? 18.444  8.592   18.460  1.00  20.33 ? 141 TRP B NE1    1 
ATOM   3630 C CE2    . TRP B 2 134 ? 17.134  8.560   18.689  1.00  17.77 ? 141 TRP B CE2    1 
ATOM   3631 C CE3    . TRP B 2 134 ? 15.818  7.187   20.215  1.00  15.41 ? 141 TRP B CE3    1 
ATOM   3632 C CZ2    . TRP B 2 134 ? 15.975  9.205   18.232  1.00  15.17 ? 141 TRP B CZ2    1 
ATOM   3633 C CZ3    . TRP B 2 134 ? 14.660  7.829   19.753  1.00  15.37 ? 141 TRP B CZ3    1 
ATOM   3634 C CH2    . TRP B 2 134 ? 14.748  8.831   18.771  1.00  16.45 ? 141 TRP B CH2    1 
ATOM   3635 H H      . TRP B 2 134 ? 16.836  4.071   20.679  1.00  12.07 ? 141 TRP B H      1 
ATOM   3636 H HA     . TRP B 2 134 ? 19.594  4.696   19.674  1.00  14.51 ? 141 TRP B HA     1 
ATOM   3637 H HB2    . TRP B 2 134 ? 17.892  6.117   21.785  1.00  13.73 ? 141 TRP B HB2    1 
ATOM   3638 H HB3    . TRP B 2 134 ? 19.562  6.464   21.502  1.00  15.35 ? 141 TRP B HB3    1 
ATOM   3639 H HD1    . TRP B 2 134 ? 20.280  7.634   19.144  1.00  16.95 ? 141 TRP B HD1    1 
ATOM   3640 H HE1    . TRP B 2 134 ? 18.825  9.199   17.782  1.00  18.02 ? 141 TRP B HE1    1 
ATOM   3641 H HE3    . TRP B 2 134 ? 15.758  6.410   20.961  1.00  14.52 ? 141 TRP B HE3    1 
ATOM   3642 H HZ2    . TRP B 2 134 ? 16.022  9.975   17.476  1.00  14.36 ? 141 TRP B HZ2    1 
ATOM   3643 H HZ3    . TRP B 2 134 ? 13.694  7.551   20.147  1.00  15.92 ? 141 TRP B HZ3    1 
ATOM   3644 H HH2    . TRP B 2 134 ? 13.853  9.330   18.419  1.00  17.49 ? 141 TRP B HH2    1 
ATOM   3645 N N      . GLY B 2 135 ? 19.170  2.700   21.886  1.00  14.41 ? 142 GLY B N      1 
ATOM   3646 C CA     . GLY B 2 135 ? 19.732  1.884   22.997  1.00  14.53 ? 142 GLY B CA     1 
ATOM   3647 C C      . GLY B 2 135 ? 21.172  1.471   22.683  1.00  12.20 ? 142 GLY B C      1 
ATOM   3648 O O      . GLY B 2 135 ? 21.725  1.736   21.623  1.00  12.95 ? 142 GLY B O      1 
ATOM   3649 H H      . GLY B 2 135 ? 18.498  2.337   21.286  1.00  14.75 ? 142 GLY B H      1 
ATOM   3650 H HA2    . GLY B 2 135 ? 19.734  2.482   23.897  1.00  13.34 ? 142 GLY B HA2    1 
ATOM   3651 H HA3    . GLY B 2 135 ? 19.132  1.008   23.174  1.00  12.96 ? 142 GLY B HA3    1 
ATOM   3652 N N      . ASN B 2 136 ? 21.721  0.809   23.657  1.00  17.84 ? 143 ASN B N      1 
ATOM   3653 C CA     . ASN B 2 136 ? 23.127  0.332   23.544  1.00  16.28 ? 143 ASN B CA     1 
ATOM   3654 C C      . ASN B 2 136 ? 23.366  -0.475  22.300  1.00  16.24 ? 143 ASN B C      1 
ATOM   3655 O O      . ASN B 2 136 ? 22.492  -1.230  21.892  1.00  15.57 ? 143 ASN B O      1 
ATOM   3656 C CB     . ASN B 2 136 ? 23.468  -0.515  24.765  1.00  18.01 ? 143 ASN B CB     1 
ATOM   3657 C CG     . ASN B 2 136 ? 23.441  0.212   26.104  1.00  19.31 ? 143 ASN B CG     1 
ATOM   3658 O OD1    . ASN B 2 136 ? 23.132  1.387   26.247  1.00  17.35 ? 143 ASN B OD1    1 
ATOM   3659 N ND2    . ASN B 2 136 ? 23.770  -0.487  27.156  1.00  22.79 ? 143 ASN B ND2    1 
ATOM   3660 H H      . ASN B 2 136 ? 21.205  0.621   24.473  1.00  14.66 ? 143 ASN B H      1 
ATOM   3661 H HA     . ASN B 2 136 ? 23.765  1.198   23.515  1.00  18.04 ? 143 ASN B HA     1 
ATOM   3662 H HB2    . ASN B 2 136 ? 22.819  -1.377  24.816  1.00  17.90 ? 143 ASN B HB2    1 
ATOM   3663 H HB3    . ASN B 2 136 ? 24.476  -0.855  24.623  1.00  18.55 ? 143 ASN B HB3    1 
ATOM   3664 H HD21   . ASN B 2 136 ? 24.034  -1.428  27.070  1.00  21.36 ? 143 ASN B HD21   1 
ATOM   3665 H HD22   . ASN B 2 136 ? 23.760  -0.073  28.044  1.00  21.85 ? 143 ASN B HD22   1 
ATOM   3666 N N      . THR B 2 137 ? 24.524  -0.310  21.716  1.00  16.16 ? 144 THR B N      1 
ATOM   3667 C CA     . THR B 2 137 ? 24.865  -1.062  20.488  1.00  18.22 ? 144 THR B CA     1 
ATOM   3668 C C      . THR B 2 137 ? 25.646  -2.365  20.808  1.00  16.47 ? 144 THR B C      1 
ATOM   3669 O O      . THR B 2 137 ? 25.988  -3.110  19.902  1.00  17.38 ? 144 THR B O      1 
ATOM   3670 C CB     . THR B 2 137 ? 25.640  -0.071  19.563  1.00  19.97 ? 144 THR B CB     1 
ATOM   3671 O OG1    . THR B 2 137 ? 26.647  0.553   20.371  1.00  20.28 ? 144 THR B OG1    1 
ATOM   3672 C CG2    . THR B 2 137 ? 24.648  1.088   19.156  1.00  20.51 ? 144 THR B CG2    1 
ATOM   3673 H H      . THR B 2 137 ? 25.198  0.324   22.060  1.00  17.57 ? 144 THR B H      1 
ATOM   3674 H HA     . THR B 2 137 ? 23.948  -1.353  20.014  1.00  18.83 ? 144 THR B HA     1 
ATOM   3675 H HB     . THR B 2 137 ? 26.088  -0.561  18.706  1.00  18.93 ? 144 THR B HB     1 
ATOM   3676 H HG1    . THR B 2 137 ? 27.397  0.753   19.785  1.00  19.40 ? 144 THR B HG1    1 
ATOM   3677 H HG21   . THR B 2 137 ? 25.148  1.775   18.489  1.00  20.24 ? 144 THR B HG21   1 
ATOM   3678 H HG22   . THR B 2 137 ? 24.311  1.635   20.027  1.00  20.45 ? 144 THR B HG22   1 
ATOM   3679 H HG23   . THR B 2 137 ? 23.787  0.684   18.646  1.00  19.81 ? 144 THR B HG23   1 
ATOM   3680 N N      . GLN B 2 138 ? 25.861  -2.528  22.091  1.00  18.34 ? 145 GLN B N      1 
ATOM   3681 C CA     . GLN B 2 138 ? 26.548  -3.670  22.744  1.00  21.37 ? 145 GLN B CA     1 
ATOM   3682 C C      . GLN B 2 138 ? 26.011  -3.629  24.171  1.00  20.65 ? 145 GLN B C      1 
ATOM   3683 O O      . GLN B 2 138 ? 25.816  -2.549  24.706  1.00  18.65 ? 145 GLN B O      1 
ATOM   3684 C CB     . GLN B 2 138 ? 28.095  -3.503  22.808  1.00  27.89 ? 145 GLN B CB     1 
ATOM   3685 C CG     . GLN B 2 138 ? 28.715  -3.707  21.421  1.00  33.49 ? 145 GLN B CG     1 
ATOM   3686 C CD     . GLN B 2 138 ? 28.777  -5.204  21.115  1.00  39.93 ? 145 GLN B CD     1 
ATOM   3687 O OE1    . GLN B 2 138 ? 27.888  -5.979  21.416  1.00  44.29 ? 145 GLN B OE1    1 
ATOM   3688 N NE2    . GLN B 2 138 ? 29.826  -5.666  20.510  1.00  43.96 ? 145 GLN B NE2    1 
ATOM   3689 H H      . GLN B 2 138 ? 25.536  -1.831  22.697  1.00  17.34 ? 145 GLN B H      1 
ATOM   3690 H HA     . GLN B 2 138 ? 26.229  -4.588  22.271  1.00  21.47 ? 145 GLN B HA     1 
ATOM   3691 H HB2    . GLN B 2 138 ? 28.361  -2.534  23.191  1.00  28.08 ? 145 GLN B HB2    1 
ATOM   3692 H HB3    . GLN B 2 138 ? 28.492  -4.248  23.482  1.00  27.99 ? 145 GLN B HB3    1 
ATOM   3693 H HG2    . GLN B 2 138 ? 28.146  -3.216  20.649  1.00  34.36 ? 145 GLN B HG2    1 
ATOM   3694 H HG3    . GLN B 2 138 ? 29.717  -3.302  21.404  1.00  33.95 ? 145 GLN B HG3    1 
ATOM   3695 H HE21   . GLN B 2 138 ? 30.553  -5.050  20.275  1.00  42.64 ? 145 GLN B HE21   1 
ATOM   3696 H HE22   . GLN B 2 138 ? 29.869  -6.617  20.299  1.00  42.65 ? 145 GLN B HE22   1 
ATOM   3697 N N      . TYR B 2 139 ? 25.788  -4.763  24.761  1.00  18.14 ? 146 TYR B N      1 
ATOM   3698 C CA     . TYR B 2 139 ? 25.278  -4.801  26.138  1.00  20.08 ? 146 TYR B CA     1 
ATOM   3699 C C      . TYR B 2 139 ? 26.186  -3.945  27.073  1.00  23.91 ? 146 TYR B C      1 
ATOM   3700 O O      . TYR B 2 139 ? 25.687  -3.163  27.868  1.00  20.86 ? 146 TYR B O      1 
ATOM   3701 C CB     . TYR B 2 139 ? 25.247  -6.239  26.650  1.00  21.04 ? 146 TYR B CB     1 
ATOM   3702 C CG     . TYR B 2 139 ? 24.575  -6.170  28.012  1.00  21.22 ? 146 TYR B CG     1 
ATOM   3703 C CD1    . TYR B 2 139 ? 23.200  -6.363  28.170  1.00  23.55 ? 146 TYR B CD1    1 
ATOM   3704 C CD2    . TYR B 2 139 ? 25.341  -5.883  29.128  1.00  24.38 ? 146 TYR B CD2    1 
ATOM   3705 C CE1    . TYR B 2 139 ? 22.607  -6.266  29.422  1.00  23.23 ? 146 TYR B CE1    1 
ATOM   3706 C CE2    . TYR B 2 139 ? 24.754  -5.786  30.369  1.00  24.97 ? 146 TYR B CE2    1 
ATOM   3707 C CZ     . TYR B 2 139 ? 23.384  -5.974  30.540  1.00  26.79 ? 146 TYR B CZ     1 
ATOM   3708 O OH     . TYR B 2 139 ? 22.836  -5.869  31.807  1.00  25.01 ? 146 TYR B OH     1 
ATOM   3709 H H      . TYR B 2 139 ? 25.954  -5.597  24.284  1.00  18.40 ? 146 TYR B H      1 
ATOM   3710 H HA     . TYR B 2 139 ? 24.283  -4.381  26.131  1.00  21.57 ? 146 TYR B HA     1 
ATOM   3711 H HB2    . TYR B 2 139 ? 24.666  -6.863  25.986  1.00  21.82 ? 146 TYR B HB2    1 
ATOM   3712 H HB3    . TYR B 2 139 ? 26.247  -6.633  26.755  1.00  21.68 ? 146 TYR B HB3    1 
ATOM   3713 H HD1    . TYR B 2 139 ? 22.587  -6.590  27.308  1.00  22.59 ? 146 TYR B HD1    1 
ATOM   3714 H HD2    . TYR B 2 139 ? 26.407  -5.731  29.031  1.00  23.59 ? 146 TYR B HD2    1 
ATOM   3715 H HE1    . TYR B 2 139 ? 21.543  -6.420  29.523  1.00  24.16 ? 146 TYR B HE1    1 
ATOM   3716 H HE2    . TYR B 2 139 ? 25.374  -5.560  31.223  1.00  26.49 ? 146 TYR B HE2    1 
ATOM   3717 H HH     . TYR B 2 139 ? 22.174  -5.169  31.804  1.00  26.63 ? 146 TYR B HH     1 
ATOM   3718 N N      . TYR B 2 140 ? 27.482  -4.121  26.964  1.00  23.43 ? 147 TYR B N      1 
ATOM   3719 C CA     . TYR B 2 140 ? 28.443  -3.336  27.819  1.00  25.82 ? 147 TYR B CA     1 
ATOM   3720 C C      . TYR B 2 140 ? 28.993  -2.268  26.875  1.00  27.87 ? 147 TYR B C      1 
ATOM   3721 O O      . TYR B 2 140 ? 30.189  -2.097  26.729  1.00  36.64 ? 147 TYR B O      1 
ATOM   3722 C CB     . TYR B 2 140 ? 29.643  -4.202  28.320  1.00  21.79 ? 147 TYR B CB     1 
ATOM   3723 C CG     . TYR B 2 140 ? 29.193  -5.319  29.263  1.00  19.21 ? 147 TYR B CG     1 
ATOM   3724 C CD1    . TYR B 2 140 ? 29.414  -6.646  28.936  1.00  18.70 ? 147 TYR B CD1    1 
ATOM   3725 C CD2    . TYR B 2 140 ? 28.556  -5.028  30.442  1.00  16.69 ? 147 TYR B CD2    1 
ATOM   3726 C CE1    . TYR B 2 140 ? 29.000  -7.653  29.773  1.00  16.88 ? 147 TYR B CE1    1 
ATOM   3727 C CE2    . TYR B 2 140 ? 28.146  -6.045  31.267  1.00  17.33 ? 147 TYR B CE2    1 
ATOM   3728 C CZ     . TYR B 2 140 ? 28.368  -7.363  30.928  1.00  14.37 ? 147 TYR B CZ     1 
ATOM   3729 O OH     . TYR B 2 140 ? 27.948  -8.413  31.700  1.00  20.30 ? 147 TYR B OH     1 
ATOM   3730 H H      . TYR B 2 140 ? 27.813  -4.771  26.317  1.00  23.59 ? 147 TYR B H      1 
ATOM   3731 H HA     . TYR B 2 140 ? 27.914  -2.865  28.637  1.00  24.71 ? 147 TYR B HA     1 
ATOM   3732 H HB2    . TYR B 2 140 ? 30.171  -4.625  27.479  1.00  21.86 ? 147 TYR B HB2    1 
ATOM   3733 H HB3    . TYR B 2 140 ? 30.329  -3.555  28.851  1.00  22.60 ? 147 TYR B HB3    1 
ATOM   3734 H HD1    . TYR B 2 140 ? 29.917  -6.904  28.015  1.00  17.20 ? 147 TYR B HD1    1 
ATOM   3735 H HD2    . TYR B 2 140 ? 28.377  -4.001  30.725  1.00  17.25 ? 147 TYR B HD2    1 
ATOM   3736 H HE1    . TYR B 2 140 ? 29.190  -8.683  29.508  1.00  16.90 ? 147 TYR B HE1    1 
ATOM   3737 H HE2    . TYR B 2 140 ? 27.644  -5.792  32.191  1.00  14.99 ? 147 TYR B HE2    1 
ATOM   3738 H HH     . TYR B 2 140 ? 27.375  -8.079  32.402  1.00  15.75 ? 147 TYR B HH     1 
ATOM   3739 N N      . GLY B 2 141 ? 28.093  -1.573  26.244  1.00  29.38 ? 148 GLY B N      1 
ATOM   3740 C CA     . GLY B 2 141 ? 28.435  -0.489  25.275  1.00  28.30 ? 148 GLY B CA     1 
ATOM   3741 C C      . GLY B 2 141 ? 27.656  0.752   25.653  1.00  23.14 ? 148 GLY B C      1 
ATOM   3742 O O      . GLY B 2 141 ? 27.072  0.807   26.708  1.00  25.68 ? 148 GLY B O      1 
ATOM   3743 H H      . GLY B 2 141 ? 27.142  -1.758  26.415  1.00  28.66 ? 148 GLY B H      1 
ATOM   3744 H HA2    . GLY B 2 141 ? 29.494  -0.279  25.329  1.00  28.41 ? 148 GLY B HA2    1 
ATOM   3745 H HA3    . GLY B 2 141 ? 28.169  -0.786  24.274  1.00  29.56 ? 148 GLY B HA3    1 
ATOM   3746 N N      . GLN B 2 142 ? 27.639  1.725   24.805  1.00  23.56 ? 150 GLN B N      1 
ATOM   3747 C CA     . GLN B 2 142 ? 26.892  2.967   25.149  1.00  23.49 ? 150 GLN B CA     1 
ATOM   3748 C C      . GLN B 2 142 ? 25.724  3.086   24.197  1.00  18.48 ? 150 GLN B C      1 
ATOM   3749 O O      . GLN B 2 142 ? 25.665  2.407   23.187  1.00  17.06 ? 150 GLN B O      1 
ATOM   3750 C CB     . GLN B 2 142 ? 27.838  4.214   24.985  1.00  25.04 ? 150 GLN B CB     1 
ATOM   3751 C CG     . GLN B 2 142 ? 29.092  4.207   25.936  1.00  29.23 ? 150 GLN B CG     1 
ATOM   3752 C CD     . GLN B 2 142 ? 28.661  4.420   27.403  0.34  28.10 ? 150 GLN B CD     1 
ATOM   3753 O OE1    . GLN B 2 142 ? 27.848  5.273   27.702  0.34  25.42 ? 150 GLN B OE1    1 
ATOM   3754 N NE2    . GLN B 2 142 ? 29.160  3.697   28.356  0.34  30.07 ? 150 GLN B NE2    1 
ATOM   3755 H H      . GLN B 2 142 ? 28.094  1.662   23.938  1.00  21.23 ? 150 GLN B H      1 
ATOM   3756 H HA     . GLN B 2 142 ? 26.500  2.905   26.156  1.00  22.20 ? 150 GLN B HA     1 
ATOM   3757 H HB2    . GLN B 2 142 ? 28.180  4.267   23.961  1.00  24.95 ? 150 GLN B HB2    1 
ATOM   3758 H HB3    . GLN B 2 142 ? 27.275  5.112   25.181  1.00  25.31 ? 150 GLN B HB3    1 
ATOM   3759 H HG2    . GLN B 2 142 ? 29.627  3.270   25.848  1.00  27.58 ? 150 GLN B HG2    1 
ATOM   3760 H HG3    . GLN B 2 142 ? 29.762  5.006   25.647  1.00  27.77 ? 150 GLN B HG3    1 
ATOM   3761 H HE21   . GLN B 2 142 ? 29.814  2.990   28.170  0.34  29.78 ? 150 GLN B HE21   1 
ATOM   3762 H HE22   . GLN B 2 142 ? 28.883  3.859   29.284  0.34  29.83 ? 150 GLN B HE22   1 
ATOM   3763 N N      . GLN B 2 143 ? 24.843  3.963   24.571  1.00  18.09 ? 151 GLN B N      1 
ATOM   3764 C CA     . GLN B 2 143 ? 23.628  4.221   23.736  1.00  19.97 ? 151 GLN B CA     1 
ATOM   3765 C C      . GLN B 2 143 ? 24.112  4.756   22.400  1.00  20.15 ? 151 GLN B C      1 
ATOM   3766 O O      . GLN B 2 143 ? 25.228  5.247   22.291  1.00  21.96 ? 151 GLN B O      1 
ATOM   3767 C CB     . GLN B 2 143 ? 22.720  5.290   24.393  1.00  19.48 ? 151 GLN B CB     1 
ATOM   3768 C CG     . GLN B 2 143 ? 22.054  4.744   25.643  1.00  21.69 ? 151 GLN B CG     1 
ATOM   3769 C CD     . GLN B 2 143 ? 21.041  5.781   26.183  1.00  25.44 ? 151 GLN B CD     1 
ATOM   3770 O OE1    . GLN B 2 143 ? 20.947  6.913   25.747  1.00  27.37 ? 151 GLN B OE1    1 
ATOM   3771 N NE2    . GLN B 2 143 ? 20.254  5.440   27.148  1.00  28.80 ? 151 GLN B NE2    1 
ATOM   3772 H H      . GLN B 2 143 ? 24.977  4.450   25.409  1.00  17.82 ? 151 GLN B H      1 
ATOM   3773 H HA     . GLN B 2 143 ? 23.108  3.290   23.569  1.00  19.49 ? 151 GLN B HA     1 
ATOM   3774 H HB2    . GLN B 2 143 ? 23.298  6.167   24.642  1.00  19.83 ? 151 GLN B HB2    1 
ATOM   3775 H HB3    . GLN B 2 143 ? 21.954  5.604   23.701  1.00  20.98 ? 151 GLN B HB3    1 
ATOM   3776 H HG2    . GLN B 2 143 ? 21.530  3.830   25.414  1.00  21.69 ? 151 GLN B HG2    1 
ATOM   3777 H HG3    . GLN B 2 143 ? 22.789  4.527   26.405  1.00  22.11 ? 151 GLN B HG3    1 
ATOM   3778 H HE21   . GLN B 2 143 ? 20.329  4.535   27.524  1.00  28.38 ? 151 GLN B HE21   1 
ATOM   3779 H HE22   . GLN B 2 143 ? 19.597  6.074   27.506  1.00  28.40 ? 151 GLN B HE22   1 
ATOM   3780 N N      . ALA B 2 144 ? 23.260  4.675   21.423  1.00  20.88 ? 152 ALA B N      1 
ATOM   3781 C CA     . ALA B 2 144 ? 23.614  5.160   20.075  1.00  19.84 ? 152 ALA B CA     1 
ATOM   3782 C C      . ALA B 2 144 ? 23.351  6.677   20.001  1.00  19.90 ? 152 ALA B C      1 
ATOM   3783 O O      . ALA B 2 144 ? 22.400  7.195   20.570  1.00  18.65 ? 152 ALA B O      1 
ATOM   3784 C CB     . ALA B 2 144 ? 22.752  4.440   19.019  1.00  16.82 ? 152 ALA B CB     1 
ATOM   3785 H H      . ALA B 2 144 ? 22.373  4.292   21.599  1.00  22.64 ? 152 ALA B H      1 
ATOM   3786 H HA     . ALA B 2 144 ? 24.661  4.959   19.903  1.00  20.60 ? 152 ALA B HA     1 
ATOM   3787 H HB1    . ALA B 2 144 ? 23.003  4.810   18.036  1.00  16.79 ? 152 ALA B HB1    1 
ATOM   3788 H HB2    . ALA B 2 144 ? 21.710  4.639   19.208  1.00  17.56 ? 152 ALA B HB2    1 
ATOM   3789 H HB3    . ALA B 2 144 ? 22.937  3.378   19.061  1.00  17.59 ? 152 ALA B HB3    1 
ATOM   3790 N N      . GLY B 2 145 ? 24.216  7.326   19.269  1.00  19.04 ? 153 GLY B N      1 
ATOM   3791 C CA     . GLY B 2 145 ? 24.127  8.804   19.082  1.00  22.18 ? 153 GLY B CA     1 
ATOM   3792 C C      . GLY B 2 145 ? 23.093  9.123   17.999  1.00  23.06 ? 153 GLY B C      1 
ATOM   3793 O O      . GLY B 2 145 ? 22.416  10.143  18.048  1.00  23.01 ? 153 GLY B O      1 
ATOM   3794 H H      . GLY B 2 145 ? 24.948  6.837   18.831  1.00  18.90 ? 153 GLY B H      1 
ATOM   3795 H HA2    . GLY B 2 145 ? 23.839  9.267   20.016  1.00  21.57 ? 153 GLY B HA2    1 
ATOM   3796 H HA3    . GLY B 2 145 ? 25.093  9.174   18.774  1.00  22.56 ? 153 GLY B HA3    1 
ATOM   3797 N N      . VAL B 2 146 ? 23.029  8.220   17.062  1.00  20.66 ? 154 VAL B N      1 
ATOM   3798 C CA     . VAL B 2 146 ? 22.094  8.338   15.927  1.00  18.29 ? 154 VAL B CA     1 
ATOM   3799 C C      . VAL B 2 146 ? 21.200  7.098   16.017  1.00  18.02 ? 154 VAL B C      1 
ATOM   3800 O O      . VAL B 2 146 ? 21.683  6.016   16.347  1.00  16.71 ? 154 VAL B O      1 
ATOM   3801 C CB     . VAL B 2 146 ? 22.900  8.342   14.638  1.00  19.34 ? 154 VAL B CB     1 
ATOM   3802 C CG1    . VAL B 2 146 ? 21.934  8.444   13.439  1.00  22.12 ? 154 VAL B CG1    1 
ATOM   3803 C CG2    . VAL B 2 146 ? 23.776  9.603   14.636  1.00  21.16 ? 154 VAL B CG2    1 
ATOM   3804 H H      . VAL B 2 146 ? 23.606  7.431   17.104  1.00  20.41 ? 154 VAL B H      1 
ATOM   3805 H HA     . VAL B 2 146 ? 21.499  9.233   16.042  1.00  19.77 ? 154 VAL B HA     1 
ATOM   3806 H HB     . VAL B 2 146 ? 23.498  7.444   14.551  1.00  18.51 ? 154 VAL B HB     1 
ATOM   3807 H HG11   . VAL B 2 146 ? 21.347  9.353   13.488  1.00  21.37 ? 154 VAL B HG11   1 
ATOM   3808 H HG12   . VAL B 2 146 ? 21.258  7.601   13.419  1.00  21.98 ? 154 VAL B HG12   1 
ATOM   3809 H HG13   . VAL B 2 146 ? 22.487  8.453   12.510  1.00  22.08 ? 154 VAL B HG13   1 
ATOM   3810 H HG21   . VAL B 2 146 ? 24.330  9.668   13.711  1.00  19.09 ? 154 VAL B HG21   1 
ATOM   3811 H HG22   . VAL B 2 146 ? 24.462  9.584   15.470  1.00  20.10 ? 154 VAL B HG22   1 
ATOM   3812 H HG23   . VAL B 2 146 ? 23.166  10.495  14.714  1.00  19.50 ? 154 VAL B HG23   1 
ATOM   3813 N N      . LEU B 2 147 ? 19.956  7.335   15.717  1.00  13.65 ? 155 LEU B N      1 
ATOM   3814 C CA     . LEU B 2 147 ? 18.928  6.267   15.742  1.00  11.35 ? 155 LEU B CA     1 
ATOM   3815 C C      . LEU B 2 147 ? 19.447  5.106   14.868  1.00  8.36  ? 155 LEU B C      1 
ATOM   3816 O O      . LEU B 2 147 ? 19.982  5.323   13.783  1.00  11.94 ? 155 LEU B O      1 
ATOM   3817 C CB     . LEU B 2 147 ? 17.620  6.846   15.168  1.00  11.91 ? 155 LEU B CB     1 
ATOM   3818 C CG     . LEU B 2 147 ? 16.465  5.858   15.217  1.00  11.00 ? 155 LEU B CG     1 
ATOM   3819 C CD1    . LEU B 2 147 ? 16.044  5.510   16.635  1.00  12.56 ? 155 LEU B CD1    1 
ATOM   3820 C CD2    . LEU B 2 147 ? 15.265  6.507   14.515  1.00  13.17 ? 155 LEU B CD2    1 
ATOM   3821 H H      . LEU B 2 147 ? 19.708  8.245   15.466  1.00  14.50 ? 155 LEU B H      1 
ATOM   3822 H HA     . LEU B 2 147 ? 18.808  5.942   16.765  1.00  8.91  ? 155 LEU B HA     1 
ATOM   3823 H HB2    . LEU B 2 147 ? 17.350  7.740   15.710  1.00  12.38 ? 155 LEU B HB2    1 
ATOM   3824 H HB3    . LEU B 2 147 ? 17.815  7.122   14.142  1.00  11.46 ? 155 LEU B HB3    1 
ATOM   3825 H HG     . LEU B 2 147 ? 16.738  4.952   14.693  1.00  12.34 ? 155 LEU B HG     1 
ATOM   3826 H HD11   . LEU B 2 147 ? 15.721  6.392   17.171  1.00  13.11 ? 155 LEU B HD11   1 
ATOM   3827 H HD12   . LEU B 2 147 ? 16.867  5.081   17.184  1.00  13.11 ? 155 LEU B HD12   1 
ATOM   3828 H HD13   . LEU B 2 147 ? 15.234  4.796   16.640  1.00  12.49 ? 155 LEU B HD13   1 
ATOM   3829 H HD21   . LEU B 2 147 ? 14.407  5.848   14.521  1.00  11.32 ? 155 LEU B HD21   1 
ATOM   3830 H HD22   . LEU B 2 147 ? 15.504  6.744   13.488  1.00  11.77 ? 155 LEU B HD22   1 
ATOM   3831 H HD23   . LEU B 2 147 ? 14.998  7.429   15.017  1.00  12.49 ? 155 LEU B HD23   1 
ATOM   3832 N N      . GLN B 2 148 ? 19.257  3.920   15.366  1.00  10.65 ? 156 GLN B N      1 
ATOM   3833 C CA     . GLN B 2 148 ? 19.697  2.691   14.654  1.00  12.67 ? 156 GLN B CA     1 
ATOM   3834 C C      . GLN B 2 148 ? 18.468  1.845   14.217  1.00  14.72 ? 156 GLN B C      1 
ATOM   3835 O O      . GLN B 2 148 ? 17.431  1.903   14.856  1.00  13.11 ? 156 GLN B O      1 
ATOM   3836 C CB     . GLN B 2 148 ? 20.496  1.694   15.546  1.00  13.36 ? 156 GLN B CB     1 
ATOM   3837 C CG     . GLN B 2 148 ? 21.730  2.307   16.253  1.00  13.73 ? 156 GLN B CG     1 
ATOM   3838 C CD     . GLN B 2 148 ? 22.773  2.589   15.256  1.00  13.20 ? 156 GLN B CD     1 
ATOM   3839 O OE1    . GLN B 2 148 ? 23.361  1.687   14.681  1.00  14.61 ? 156 GLN B OE1    1 
ATOM   3840 N NE2    . GLN B 2 148 ? 23.043  3.829   15.020  1.00  14.41 ? 156 GLN B NE2    1 
ATOM   3841 H H      . GLN B 2 148 ? 18.810  3.828   16.235  1.00  9.89  ? 156 GLN B H      1 
ATOM   3842 H HA     . GLN B 2 148 ? 20.258  2.976   13.776  1.00  12.36 ? 156 GLN B HA     1 
ATOM   3843 H HB2    . GLN B 2 148 ? 19.811  1.328   16.295  1.00  12.85 ? 156 GLN B HB2    1 
ATOM   3844 H HB3    . GLN B 2 148 ? 20.803  0.846   14.949  1.00  12.52 ? 156 GLN B HB3    1 
ATOM   3845 H HG2    . GLN B 2 148 ? 21.467  3.228   16.753  1.00  14.25 ? 156 GLN B HG2    1 
ATOM   3846 H HG3    . GLN B 2 148 ? 22.130  1.620   16.982  1.00  14.67 ? 156 GLN B HG3    1 
ATOM   3847 H HE21   . GLN B 2 148 ? 22.554  4.536   15.500  1.00  14.41 ? 156 GLN B HE21   1 
ATOM   3848 H HE22   . GLN B 2 148 ? 23.722  4.077   14.373  1.00  13.44 ? 156 GLN B HE22   1 
ATOM   3849 N N      . GLU B 2 149 ? 18.656  1.095   13.164  1.00  13.69 ? 157 GLU B N      1 
ATOM   3850 C CA     . GLU B 2 149 ? 17.578  0.216   12.662  1.00  18.50 ? 157 GLU B CA     1 
ATOM   3851 C C      . GLU B 2 149 ? 18.181  -1.176  12.366  1.00  17.49 ? 157 GLU B C      1 
ATOM   3852 O O      . GLU B 2 149 ? 19.328  -1.266  11.942  1.00  15.81 ? 157 GLU B O      1 
ATOM   3853 C CB     . GLU B 2 149 ? 16.954  0.757   11.354  1.00  18.47 ? 157 GLU B CB     1 
ATOM   3854 C CG     . GLU B 2 149 ? 17.874  0.741   10.123  1.00  21.32 ? 157 GLU B CG     1 
ATOM   3855 C CD     . GLU B 2 149 ? 17.023  1.138   8.863   1.00  24.99 ? 157 GLU B CD     1 
ATOM   3856 O OE1    . GLU B 2 149 ? 16.838  2.319   8.690   1.00  22.98 ? 157 GLU B OE1    1 
ATOM   3857 O OE2    . GLU B 2 149 ? 16.583  0.259   8.135   1.00  31.16 ? 157 GLU B OE2    1 
ATOM   3858 H H      . GLU B 2 149 ? 19.523  1.110   12.700  1.00  16.29 ? 157 GLU B H      1 
ATOM   3859 H HA     . GLU B 2 149 ? 16.835  0.105   13.442  1.00  18.17 ? 157 GLU B HA     1 
ATOM   3860 H HB2    . GLU B 2 149 ? 16.089  0.144   11.131  1.00  19.65 ? 157 GLU B HB2    1 
ATOM   3861 H HB3    . GLU B 2 149 ? 16.611  1.764   11.528  1.00  19.91 ? 157 GLU B HB3    1 
ATOM   3862 H HG2    . GLU B 2 149 ? 18.690  1.442   10.245  1.00  22.15 ? 157 GLU B HG2    1 
ATOM   3863 H HG3    . GLU B 2 149 ? 18.288  -0.242  9.963   1.00  22.30 ? 157 GLU B HG3    1 
ATOM   3864 N N      . ALA B 2 150 ? 17.406  -2.200  12.599  1.00  16.50 ? 158 ALA B N      1 
ATOM   3865 C CA     . ALA B 2 150 ? 17.826  -3.613  12.348  1.00  17.93 ? 158 ALA B CA     1 
ATOM   3866 C C      . ALA B 2 150 ? 16.558  -4.373  11.886  1.00  17.36 ? 158 ALA B C      1 
ATOM   3867 O O      . ALA B 2 150 ? 15.463  -4.012  12.276  1.00  16.02 ? 158 ALA B O      1 
ATOM   3868 C CB     . ALA B 2 150 ? 18.345  -4.276  13.629  1.00  16.81 ? 158 ALA B CB     1 
ATOM   3869 H H      . ALA B 2 150 ? 16.498  -2.056  12.959  1.00  18.71 ? 158 ALA B H      1 
ATOM   3870 H HA     . ALA B 2 150 ? 18.568  -3.638  11.564  1.00  18.49 ? 158 ALA B HA     1 
ATOM   3871 H HB1    . ALA B 2 150 ? 18.599  -5.298  13.400  1.00  17.35 ? 158 ALA B HB1    1 
ATOM   3872 H HB2    . ALA B 2 150 ? 17.585  -4.274  14.397  1.00  16.37 ? 158 ALA B HB2    1 
ATOM   3873 H HB3    . ALA B 2 150 ? 19.230  -3.778  13.991  1.00  17.17 ? 158 ALA B HB3    1 
ATOM   3874 N N      . ARG B 2 151 ? 16.756  -5.383  11.110  1.00  15.80 ? 159 ARG B N      1 
ATOM   3875 C CA     . ARG B 2 151 ? 15.656  -6.227  10.572  1.00  17.27 ? 159 ARG B CA     1 
ATOM   3876 C C      . ARG B 2 151 ? 15.823  -7.577  11.252  1.00  18.68 ? 159 ARG B C      1 
ATOM   3877 O O      . ARG B 2 151 ? 16.919  -8.115  11.280  1.00  18.24 ? 159 ARG B O      1 
ATOM   3878 C CB     . ARG B 2 151 ? 15.820  -6.378  9.069   1.00  16.65 ? 159 ARG B CB     1 
ATOM   3879 C CG     . ARG B 2 151 ? 15.368  -5.082  8.328   1.00  19.97 ? 159 ARG B CG     1 
ATOM   3880 C CD     . ARG B 2 151 ? 15.686  -5.178  6.832   1.00  22.24 ? 159 ARG B CD     1 
ATOM   3881 N NE     . ARG B 2 151 ? 15.385  -6.556  6.311   0.17  21.61 ? 159 ARG B NE     1 
ATOM   3882 C CZ     . ARG B 2 151 ? 16.326  -7.358  5.866   0.17  21.92 ? 159 ARG B CZ     1 
ATOM   3883 N NH1    . ARG B 2 151 ? 17.595  -7.055  5.971   0.17  23.46 ? 159 ARG B NH1    1 
ATOM   3884 N NH2    . ARG B 2 151 ? 15.962  -8.480  5.313   0.17  21.71 ? 159 ARG B NH2    1 
ATOM   3885 H H      . ARG B 2 151 ? 17.673  -5.621  10.863  1.00  16.87 ? 159 ARG B H      1 
ATOM   3886 H HA     . ARG B 2 151 ? 14.706  -5.793  10.838  1.00  17.89 ? 159 ARG B HA     1 
ATOM   3887 H HB2    . ARG B 2 151 ? 16.854  -6.606  8.858   1.00  17.43 ? 159 ARG B HB2    1 
ATOM   3888 H HB3    . ARG B 2 151 ? 15.216  -7.214  8.749   1.00  17.53 ? 159 ARG B HB3    1 
ATOM   3889 H HG2    . ARG B 2 151 ? 14.304  -4.935  8.447   1.00  20.12 ? 159 ARG B HG2    1 
ATOM   3890 H HG3    . ARG B 2 151 ? 15.861  -4.209  8.733   1.00  19.45 ? 159 ARG B HG3    1 
ATOM   3891 H HD2    . ARG B 2 151 ? 15.051  -4.475  6.312   1.00  22.08 ? 159 ARG B HD2    1 
ATOM   3892 H HD3    . ARG B 2 151 ? 16.709  -4.900  6.638   1.00  21.77 ? 159 ARG B HD3    1 
ATOM   3893 H HE     . ARG B 2 151 ? 14.456  -6.868  6.301   0.17  21.82 ? 159 ARG B HE     1 
ATOM   3894 H HH11   . ARG B 2 151 ? 18.284  -7.691  5.624   0.17  23.02 ? 159 ARG B HH11   1 
ATOM   3895 H HH12   . ARG B 2 151 ? 17.884  -6.197  6.394   0.17  23.17 ? 159 ARG B HH12   1 
ATOM   3896 H HH21   . ARG B 2 151 ? 14.992  -8.709  5.234   0.17  21.47 ? 159 ARG B HH21   1 
ATOM   3897 H HH22   . ARG B 2 151 ? 16.656  -9.113  4.967   0.17  21.36 ? 159 ARG B HH22   1 
ATOM   3898 N N      . VAL B 2 152 ? 14.748  -8.068  11.775  1.00  18.72 ? 160 VAL B N      1 
ATOM   3899 C CA     . VAL B 2 152 ? 14.754  -9.374  12.471  1.00  20.20 ? 160 VAL B CA     1 
ATOM   3900 C C      . VAL B 2 152 ? 13.435  -10.092 12.137  1.00  20.15 ? 160 VAL B C      1 
ATOM   3901 O O      . VAL B 2 152 ? 12.410  -9.437  12.023  1.00  16.86 ? 160 VAL B O      1 
ATOM   3902 C CB     . VAL B 2 152 ? 14.859  -9.171  14.023  1.00  20.43 ? 160 VAL B CB     1 
ATOM   3903 C CG1    . VAL B 2 152 ? 16.347  -8.779  14.401  1.00  22.84 ? 160 VAL B CG1    1 
ATOM   3904 C CG2    . VAL B 2 152 ? 13.897  -8.051  14.498  1.00  20.68 ? 160 VAL B CG2    1 
ATOM   3905 H H      . VAL B 2 152 ? 13.898  -7.578  11.704  1.00  21.56 ? 160 VAL B H      1 
ATOM   3906 H HA     . VAL B 2 152 ? 15.589  -9.943  12.085  1.00  19.81 ? 160 VAL B HA     1 
ATOM   3907 H HB     . VAL B 2 152 ? 14.585  -10.087 14.528  1.00  21.10 ? 160 VAL B HB     1 
ATOM   3908 H HG11   . VAL B 2 152 ? 16.655  -7.876  13.889  1.00  22.08 ? 160 VAL B HG11   1 
ATOM   3909 H HG12   . VAL B 2 152 ? 17.022  -9.575  14.120  1.00  21.14 ? 160 VAL B HG12   1 
ATOM   3910 H HG13   . VAL B 2 152 ? 16.434  -8.622  15.467  1.00  21.61 ? 160 VAL B HG13   1 
ATOM   3911 H HG21   . VAL B 2 152 ? 13.905  -7.958  15.573  1.00  20.58 ? 160 VAL B HG21   1 
ATOM   3912 H HG22   . VAL B 2 152 ? 12.906  -8.310  14.171  1.00  20.60 ? 160 VAL B HG22   1 
ATOM   3913 H HG23   . VAL B 2 152 ? 14.156  -7.094  14.068  1.00  20.21 ? 160 VAL B HG23   1 
ATOM   3914 N N      . PRO B 2 153 ? 13.483  -11.398 12.000  1.00  19.58 ? 161 PRO B N      1 
ATOM   3915 C CA     . PRO B 2 153 ? 12.262  -12.211 11.874  1.00  17.52 ? 161 PRO B CA     1 
ATOM   3916 C C      . PRO B 2 153 ? 11.549  -12.602 13.190  1.00  17.73 ? 161 PRO B C      1 
ATOM   3917 O O      . PRO B 2 153 ? 12.123  -12.718 14.275  1.00  13.66 ? 161 PRO B O      1 
ATOM   3918 C CB     . PRO B 2 153 ? 12.760  -13.414 11.049  1.00  16.76 ? 161 PRO B CB     1 
ATOM   3919 C CG     . PRO B 2 153 ? 14.173  -13.639 11.604  1.00  20.10 ? 161 PRO B CG     1 
ATOM   3920 C CD     . PRO B 2 153 ? 14.715  -12.233 11.906  1.00  19.91 ? 161 PRO B CD     1 
ATOM   3921 H HA     . PRO B 2 153 ? 11.564  -11.645 11.281  1.00  18.30 ? 161 PRO B HA     1 
ATOM   3922 H HB2    . PRO B 2 153 ? 12.153  -14.285 11.234  1.00  17.41 ? 161 PRO B HB2    1 
ATOM   3923 H HB3    . PRO B 2 153 ? 12.786  -13.202 9.991   1.00  16.54 ? 161 PRO B HB3    1 
ATOM   3924 H HG2    . PRO B 2 153 ? 14.158  -14.229 12.507  1.00  19.60 ? 161 PRO B HG2    1 
ATOM   3925 H HG3    . PRO B 2 153 ? 14.794  -14.122 10.862  1.00  20.07 ? 161 PRO B HG3    1 
ATOM   3926 H HD2    . PRO B 2 153 ? 15.249  -12.213 12.845  1.00  19.31 ? 161 PRO B HD2    1 
ATOM   3927 H HD3    . PRO B 2 153 ? 15.336  -11.873 11.097  1.00  19.49 ? 161 PRO B HD3    1 
ATOM   3928 N N      . ILE B 2 154 ? 10.267  -12.798 12.986  1.00  15.18 ? 162 ILE B N      1 
ATOM   3929 C CA     . ILE B 2 154 ? 9.370   -13.195 14.079  1.00  17.19 ? 162 ILE B CA     1 
ATOM   3930 C C      . ILE B 2 154 ? 9.697   -14.700 14.262  1.00  15.19 ? 162 ILE B C      1 
ATOM   3931 O O      . ILE B 2 154 ? 9.889   -15.399 13.278  1.00  14.98 ? 162 ILE B O      1 
ATOM   3932 C CB     . ILE B 2 154 ? 7.866   -12.950 13.620  1.00  15.71 ? 162 ILE B CB     1 
ATOM   3933 C CG1    . ILE B 2 154 ? 7.675   -11.435 13.436  1.00  18.12 ? 162 ILE B CG1    1 
ATOM   3934 C CG2    . ILE B 2 154 ? 6.879   -13.488 14.657  1.00  15.63 ? 162 ILE B CG2    1 
ATOM   3935 C CD1    . ILE B 2 154 ? 6.250   -11.028 13.019  1.00  20.85 ? 162 ILE B CD1    1 
ATOM   3936 H H      . ILE B 2 154 ? 9.894   -12.669 12.086  1.00  18.51 ? 162 ILE B H      1 
ATOM   3937 H HA     . ILE B 2 154 ? 9.636   -12.651 14.976  1.00  16.80 ? 162 ILE B HA     1 
ATOM   3938 H HB     . ILE B 2 154 ? 7.707   -13.443 12.671  1.00  15.94 ? 162 ILE B HB     1 
ATOM   3939 H HG12   . ILE B 2 154 ? 7.922   -10.923 14.354  1.00  18.52 ? 162 ILE B HG12   1 
ATOM   3940 H HG13   . ILE B 2 154 ? 8.350   -11.088 12.662  1.00  18.80 ? 162 ILE B HG13   1 
ATOM   3941 H HG21   . ILE B 2 154 ? 7.010   -12.977 15.600  1.00  15.68 ? 162 ILE B HG21   1 
ATOM   3942 H HG22   . ILE B 2 154 ? 7.021   -14.545 14.821  1.00  15.86 ? 162 ILE B HG22   1 
ATOM   3943 H HG23   . ILE B 2 154 ? 5.864   -13.339 14.321  1.00  15.87 ? 162 ILE B HG23   1 
ATOM   3944 H HD11   . ILE B 2 154 ? 6.209   -9.954  12.882  1.00  19.53 ? 162 ILE B HD11   1 
ATOM   3945 H HD12   . ILE B 2 154 ? 5.533   -11.299 13.778  1.00  20.03 ? 162 ILE B HD12   1 
ATOM   3946 H HD13   . ILE B 2 154 ? 5.975   -11.494 12.082  1.00  19.69 ? 162 ILE B HD13   1 
ATOM   3947 N N      . ILE B 2 155 ? 9.730   -15.117 15.491  1.00  17.01 ? 163 ILE B N      1 
ATOM   3948 C CA     . ILE B 2 155 ? 10.030  -16.544 15.857  1.00  22.19 ? 163 ILE B CA     1 
ATOM   3949 C C      . ILE B 2 155 ? 8.721   -17.110 16.459  1.00  20.00 ? 163 ILE B C      1 
ATOM   3950 O O      . ILE B 2 155 ? 7.972   -16.376 17.087  1.00  20.83 ? 163 ILE B O      1 
ATOM   3951 C CB     . ILE B 2 155 ? 11.264  -16.540 16.909  1.00  21.30 ? 163 ILE B CB     1 
ATOM   3952 C CG1    . ILE B 2 155 ? 12.555  -16.008 16.201  1.00  22.75 ? 163 ILE B CG1    1 
ATOM   3953 C CG2    . ILE B 2 155 ? 11.534  -17.962 17.538  1.00  22.90 ? 163 ILE B CG2    1 
ATOM   3954 C CD1    . ILE B 2 155 ? 13.717  -15.923 17.210  1.00  23.86 ? 163 ILE B CD1    1 
ATOM   3955 H H      . ILE B 2 155 ? 9.546   -14.489 16.226  1.00  16.55 ? 163 ILE B H      1 
ATOM   3956 H HA     . ILE B 2 155 ? 10.282  -17.098 14.965  1.00  21.43 ? 163 ILE B HA     1 
ATOM   3957 H HB     . ILE B 2 155 ? 11.002  -15.867 17.717  1.00  21.72 ? 163 ILE B HB     1 
ATOM   3958 H HG12   . ILE B 2 155 ? 12.828  -16.659 15.382  1.00  22.02 ? 163 ILE B HG12   1 
ATOM   3959 H HG13   . ILE B 2 155 ? 12.376  -15.020 15.795  1.00  22.87 ? 163 ILE B HG13   1 
ATOM   3960 H HG21   . ILE B 2 155 ? 11.772  -18.690 16.777  1.00  21.88 ? 163 ILE B HG21   1 
ATOM   3961 H HG22   . ILE B 2 155 ? 10.654  -18.298 18.070  1.00  22.30 ? 163 ILE B HG22   1 
ATOM   3962 H HG23   . ILE B 2 155 ? 12.337  -17.938 18.260  1.00  22.38 ? 163 ILE B HG23   1 
ATOM   3963 H HD11   . ILE B 2 155 ? 14.592  -15.527 16.718  1.00  23.28 ? 163 ILE B HD11   1 
ATOM   3964 H HD12   . ILE B 2 155 ? 13.972  -16.895 17.601  1.00  23.27 ? 163 ILE B HD12   1 
ATOM   3965 H HD13   . ILE B 2 155 ? 13.457  -15.268 18.029  1.00  22.84 ? 163 ILE B HD13   1 
ATOM   3966 N N      . SER B 2 156 ? 8.467   -18.384 16.283  1.00  19.97 ? 164 SER B N      1 
ATOM   3967 C CA     . SER B 2 156 ? 7.210   -18.940 16.852  1.00  23.90 ? 164 SER B CA     1 
ATOM   3968 C C      . SER B 2 156 ? 7.396   -19.165 18.334  1.00  24.97 ? 164 SER B C      1 
ATOM   3969 O O      . SER B 2 156 ? 8.482   -19.431 18.826  1.00  23.93 ? 164 SER B O      1 
ATOM   3970 C CB     . SER B 2 156 ? 6.844   -20.308 16.179  1.00  28.39 ? 164 SER B CB     1 
ATOM   3971 O OG     . SER B 2 156 ? 8.050   -21.064 16.259  1.00  33.07 ? 164 SER B OG     1 
ATOM   3972 H H      . SER B 2 156 ? 9.086   -18.969 15.798  1.00  18.38 ? 164 SER B H      1 
ATOM   3973 H HA     . SER B 2 156 ? 6.413   -18.225 16.700  1.00  25.15 ? 164 SER B HA     1 
ATOM   3974 H HB2    . SER B 2 156 ? 6.056   -20.821 16.714  1.00  27.94 ? 164 SER B HB2    1 
ATOM   3975 H HB3    . SER B 2 156 ? 6.558   -20.195 15.141  1.00  28.55 ? 164 SER B HB3    1 
ATOM   3976 H HG     . SER B 2 156 ? 8.424   -21.051 15.362  1.00  31.54 ? 164 SER B HG     1 
ATOM   3977 N N      . ASN B 2 157 ? 6.301   -19.060 19.016  1.00  24.31 ? 165 ASN B N      1 
ATOM   3978 C CA     . ASN B 2 157 ? 6.304   -19.258 20.490  1.00  30.68 ? 165 ASN B CA     1 
ATOM   3979 C C      . ASN B 2 157 ? 6.712   -20.701 20.805  1.00  29.08 ? 165 ASN B C      1 
ATOM   3980 O O      . ASN B 2 157 ? 7.263   -20.976 21.853  1.00  26.34 ? 165 ASN B O      1 
ATOM   3981 C CB     . ASN B 2 157 ? 4.886   -18.938 21.043  1.00  34.41 ? 165 ASN B CB     1 
ATOM   3982 C CG     . ASN B 2 157 ? 4.769   -17.417 21.271  1.00  36.56 ? 165 ASN B CG     1 
ATOM   3983 O OD1    . ASN B 2 157 ? 5.113   -16.619 20.417  1.00  38.09 ? 165 ASN B OD1    1 
ATOM   3984 N ND2    . ASN B 2 157 ? 4.295   -16.953 22.388  1.00  39.54 ? 165 ASN B ND2    1 
ATOM   3985 H H      . ASN B 2 157 ? 5.471   -18.845 18.552  1.00  25.53 ? 165 ASN B H      1 
ATOM   3986 H HA     . ASN B 2 157 ? 7.042   -18.592 20.923  1.00  31.06 ? 165 ASN B HA     1 
ATOM   3987 H HB2    . ASN B 2 157 ? 4.122   -19.253 20.345  1.00  34.04 ? 165 ASN B HB2    1 
ATOM   3988 H HB3    . ASN B 2 157 ? 4.739   -19.453 21.985  1.00  34.23 ? 165 ASN B HB3    1 
ATOM   3989 H HD21   . ASN B 2 157 ? 3.995   -17.553 23.106  1.00  39.11 ? 165 ASN B HD21   1 
ATOM   3990 H HD22   . ASN B 2 157 ? 4.221   -15.983 22.540  1.00  39.52 ? 165 ASN B HD22   1 
ATOM   3991 N N      . ASP B 2 158 ? 6.428   -21.601 19.897  1.00  29.57 ? 166 ASP B N      1 
ATOM   3992 C CA     . ASP B 2 158 ? 6.822   -23.025 20.167  1.00  32.24 ? 166 ASP B CA     1 
ATOM   3993 C C      . ASP B 2 158 ? 8.353   -23.077 20.292  1.00  30.24 ? 166 ASP B C      1 
ATOM   3994 O O      . ASP B 2 158 ? 8.882   -23.728 21.185  1.00  27.75 ? 166 ASP B O      1 
ATOM   3995 C CB     . ASP B 2 158 ? 6.348   -23.972 18.992  1.00  34.15 ? 166 ASP B CB     1 
ATOM   3996 C CG     . ASP B 2 158 ? 4.820   -24.316 19.103  1.00  38.26 ? 166 ASP B CG     1 
ATOM   3997 O OD1    . ASP B 2 158 ? 4.230   -24.633 18.076  1.00  40.19 ? 166 ASP B OD1    1 
ATOM   3998 O OD2    . ASP B 2 158 ? 4.301   -24.260 20.210  1.00  36.73 ? 166 ASP B OD2    1 
ATOM   3999 H H      . ASP B 2 158 ? 5.973   -21.341 19.072  1.00  30.32 ? 166 ASP B H      1 
ATOM   4000 H HA     . ASP B 2 158 ? 6.408   -23.325 21.118  1.00  31.25 ? 166 ASP B HA     1 
ATOM   4001 H HB2    . ASP B 2 158 ? 6.551   -23.515 18.033  1.00  34.85 ? 166 ASP B HB2    1 
ATOM   4002 H HB3    . ASP B 2 158 ? 6.904   -24.898 19.032  1.00  34.90 ? 166 ASP B HB3    1 
ATOM   4003 N N      . VAL B 2 159 ? 9.000   -22.386 19.383  1.00  26.87 ? 167 VAL B N      1 
ATOM   4004 C CA     . VAL B 2 159 ? 10.469  -22.364 19.403  1.00  24.90 ? 167 VAL B CA     1 
ATOM   4005 C C      . VAL B 2 159 ? 10.910  -21.535 20.611  1.00  24.15 ? 167 VAL B C      1 
ATOM   4006 O O      . VAL B 2 159 ? 11.642  -22.029 21.451  1.00  21.49 ? 167 VAL B O      1 
ATOM   4007 C CB     . VAL B 2 159 ? 10.951  -21.753 18.054  1.00  24.77 ? 167 VAL B CB     1 
ATOM   4008 C CG1    . VAL B 2 159 ? 12.471  -21.481 18.048  1.00  25.10 ? 167 VAL B CG1    1 
ATOM   4009 C CG2    . VAL B 2 159 ? 10.667  -22.752 16.929  1.00  25.31 ? 167 VAL B CG2    1 
ATOM   4010 H H      . VAL B 2 159 ? 8.532   -21.875 18.685  1.00  27.40 ? 167 VAL B H      1 
ATOM   4011 H HA     . VAL B 2 159 ? 10.833  -23.375 19.511  1.00  25.92 ? 167 VAL B HA     1 
ATOM   4012 H HB     . VAL B 2 159 ? 10.428  -20.828 17.853  1.00  25.32 ? 167 VAL B HB     1 
ATOM   4013 H HG11   . VAL B 2 159 ? 13.032  -22.390 18.219  1.00  24.38 ? 167 VAL B HG11   1 
ATOM   4014 H HG12   . VAL B 2 159 ? 12.732  -20.769 18.819  1.00  24.44 ? 167 VAL B HG12   1 
ATOM   4015 H HG13   . VAL B 2 159 ? 12.776  -21.066 17.102  1.00  24.18 ? 167 VAL B HG13   1 
ATOM   4016 H HG21   . VAL B 2 159 ? 10.977  -22.341 15.979  1.00  24.75 ? 167 VAL B HG21   1 
ATOM   4017 H HG22   . VAL B 2 159 ? 9.608   -22.960 16.889  1.00  25.64 ? 167 VAL B HG22   1 
ATOM   4018 H HG23   . VAL B 2 159 ? 11.200  -23.678 17.101  1.00  25.29 ? 167 VAL B HG23   1 
ATOM   4019 N N      . CYS B 2 160 ? 10.451  -20.315 20.694  1.00  24.32 ? 168 CYS B N      1 
ATOM   4020 C CA     . CYS B 2 160 ? 10.889  -19.484 21.848  1.00  24.64 ? 168 CYS B CA     1 
ATOM   4021 C C      . CYS B 2 160 ? 10.650  -20.021 23.245  1.00  25.72 ? 168 CYS B C      1 
ATOM   4022 O O      . CYS B 2 160 ? 11.439  -19.749 24.134  1.00  25.36 ? 168 CYS B O      1 
ATOM   4023 C CB     . CYS B 2 160 ? 10.256  -18.070 21.740  1.00  23.33 ? 168 CYS B CB     1 
ATOM   4024 S SG     . CYS B 2 160 ? 11.483  -16.845 22.260  1.00  21.13 ? 168 CYS B SG     1 
ATOM   4025 H H      . CYS B 2 160 ? 9.838   -19.966 20.013  1.00  24.71 ? 168 CYS B H      1 
ATOM   4026 H HA     . CYS B 2 160 ? 11.958  -19.366 21.743  1.00  25.55 ? 168 CYS B HA     1 
ATOM   4027 H HB2    . CYS B 2 160 ? 9.945   -17.845 20.729  1.00  22.14 ? 168 CYS B HB2    1 
ATOM   4028 H HB3    . CYS B 2 160 ? 9.393   -17.984 22.387  1.00  22.33 ? 168 CYS B HB3    1 
ATOM   4029 N N      . ASN B 2 161 ? 9.604   -20.767 23.446  1.00  26.47 ? 169 ASN B N      1 
ATOM   4030 C CA     . ASN B 2 161 ? 9.358   -21.304 24.832  1.00  27.40 ? 169 ASN B CA     1 
ATOM   4031 C C      . ASN B 2 161 ? 10.095  -22.616 25.072  1.00  25.95 ? 169 ASN B C      1 
ATOM   4032 O O      . ASN B 2 161 ? 9.927   -23.185 26.128  1.00  24.36 ? 169 ASN B O      1 
ATOM   4033 C CB     . ASN B 2 161 ? 7.879   -21.612 25.089  1.00  31.12 ? 169 ASN B CB     1 
ATOM   4034 C CG     . ASN B 2 161 ? 7.184   -20.367 25.534  1.00  32.73 ? 169 ASN B CG     1 
ATOM   4035 O OD1    . ASN B 2 161 ? 7.607   -19.749 26.498  1.00  33.34 ? 169 ASN B OD1    1 
ATOM   4036 N ND2    . ASN B 2 161 ? 6.133   -19.971 24.873  1.00  34.10 ? 169 ASN B ND2    1 
ATOM   4037 H H      . ASN B 2 161 ? 8.996   -20.966 22.701  1.00  26.87 ? 169 ASN B H      1 
ATOM   4038 H HA     . ASN B 2 161 ? 9.709   -20.581 25.557  1.00  27.26 ? 169 ASN B HA     1 
ATOM   4039 H HB2    . ASN B 2 161 ? 7.407   -21.996 24.195  1.00  30.64 ? 169 ASN B HB2    1 
ATOM   4040 H HB3    . ASN B 2 161 ? 7.776   -22.343 25.881  1.00  30.75 ? 169 ASN B HB3    1 
ATOM   4041 H HD21   . ASN B 2 161 ? 5.818   -20.487 24.097  1.00  33.19 ? 169 ASN B HD21   1 
ATOM   4042 H HD22   . ASN B 2 161 ? 5.661   -19.158 25.161  1.00  34.03 ? 169 ASN B HD22   1 
ATOM   4043 N N      . GLY B 2 162 ? 10.873  -23.055 24.124  1.00  27.78 ? 170 GLY B N      1 
ATOM   4044 C CA     . GLY B 2 162 ? 11.596  -24.326 24.336  1.00  28.10 ? 170 GLY B CA     1 
ATOM   4045 C C      . GLY B 2 162 ? 12.706  -24.106 25.375  1.00  31.48 ? 170 GLY B C      1 
ATOM   4046 O O      . GLY B 2 162 ? 13.243  -23.020 25.541  1.00  27.59 ? 170 GLY B O      1 
ATOM   4047 H H      . GLY B 2 162 ? 10.980  -22.552 23.288  1.00  26.61 ? 170 GLY B H      1 
ATOM   4048 H HA2    . GLY B 2 162 ? 10.902  -25.081 24.678  1.00  28.78 ? 170 GLY B HA2    1 
ATOM   4049 H HA3    . GLY B 2 162 ? 12.043  -24.632 23.406  1.00  28.69 ? 170 GLY B HA3    1 
ATOM   4050 N N      . ALA B 2 163 ? 13.000  -25.176 26.048  1.00  32.33 ? 171 ALA B N      1 
ATOM   4051 C CA     . ALA B 2 163 ? 14.040  -25.219 27.099  1.00  34.43 ? 171 ALA B CA     1 
ATOM   4052 C C      . ALA B 2 163 ? 15.348  -24.577 26.663  1.00  32.55 ? 171 ALA B C      1 
ATOM   4053 O O      . ALA B 2 163 ? 16.082  -24.107 27.503  1.00  34.57 ? 171 ALA B O      1 
ATOM   4054 C CB     . ALA B 2 163 ? 14.323  -26.704 27.505  1.00  36.04 ? 171 ALA B CB     1 
ATOM   4055 H H      . ALA B 2 163 ? 12.494  -25.997 25.852  1.00  33.02 ? 171 ALA B H      1 
ATOM   4056 H HA     . ALA B 2 163 ? 13.661  -24.677 27.955  1.00  34.33 ? 171 ALA B HA     1 
ATOM   4057 H HB1    . ALA B 2 163 ? 15.086  -26.743 28.267  1.00  34.96 ? 171 ALA B HB1    1 
ATOM   4058 H HB2    . ALA B 2 163 ? 14.651  -27.285 26.653  1.00  35.25 ? 171 ALA B HB2    1 
ATOM   4059 H HB3    . ALA B 2 163 ? 13.414  -27.143 27.897  1.00  35.21 ? 171 ALA B HB3    1 
ATOM   4060 N N      . ASP B 2 164 ? 15.640  -24.556 25.394  1.00  33.43 ? 172 ASP B N      1 
ATOM   4061 C CA     . ASP B 2 164 ? 16.934  -23.931 24.978  1.00  32.34 ? 172 ASP B CA     1 
ATOM   4062 C C      . ASP B 2 164 ? 16.851  -22.444 24.684  1.00  31.88 ? 172 ASP B C      1 
ATOM   4063 O O      . ASP B 2 164 ? 17.870  -21.817 24.474  1.00  30.45 ? 172 ASP B O      1 
ATOM   4064 C CB     . ASP B 2 164 ? 17.470  -24.648 23.738  1.00  35.23 ? 172 ASP B CB     1 
ATOM   4065 C CG     . ASP B 2 164 ? 17.802  -26.149 24.027  0.43  33.51 ? 172 ASP B CG     1 
ATOM   4066 O OD1    . ASP B 2 164 ? 18.035  -26.495 25.175  0.43  31.24 ? 172 ASP B OD1    1 
ATOM   4067 O OD2    . ASP B 2 164 ? 17.814  -26.888 23.059  0.43  34.41 ? 172 ASP B OD2    1 
ATOM   4068 H H      . ASP B 2 164 ? 15.019  -24.940 24.738  1.00  31.52 ? 172 ASP B H      1 
ATOM   4069 H HA     . ASP B 2 164 ? 17.647  -24.044 25.782  1.00  34.67 ? 172 ASP B HA     1 
ATOM   4070 H HB2    . ASP B 2 164 ? 16.748  -24.577 22.936  1.00  33.74 ? 172 ASP B HB2    1 
ATOM   4071 H HB3    . ASP B 2 164 ? 18.378  -24.141 23.432  1.00  34.47 ? 172 ASP B HB3    1 
ATOM   4072 N N      . PHE B 2 165 ? 15.653  -21.929 24.675  1.00  31.35 ? 173 PHE B N      1 
ATOM   4073 C CA     . PHE B 2 165 ? 15.465  -20.480 24.409  1.00  26.91 ? 173 PHE B CA     1 
ATOM   4074 C C      . PHE B 2 165 ? 14.988  -19.909 25.724  1.00  26.38 ? 173 PHE B C      1 
ATOM   4075 O O      . PHE B 2 165 ? 15.799  -19.779 26.615  1.00  30.08 ? 173 PHE B O      1 
ATOM   4076 C CB     . PHE B 2 165 ? 14.421  -20.267 23.325  1.00  24.55 ? 173 PHE B CB     1 
ATOM   4077 C CG     . PHE B 2 165 ? 15.043  -20.416 21.937  1.00  22.66 ? 173 PHE B CG     1 
ATOM   4078 C CD1    . PHE B 2 165 ? 15.445  -21.635 21.443  1.00  22.18 ? 173 PHE B CD1    1 
ATOM   4079 C CD2    . PHE B 2 165 ? 15.198  -19.295 21.144  1.00  23.03 ? 173 PHE B CD2    1 
ATOM   4080 C CE1    . PHE B 2 165 ? 15.989  -21.733 20.183  1.00  21.70 ? 173 PHE B CE1    1 
ATOM   4081 C CE2    . PHE B 2 165 ? 15.746  -19.391 19.879  1.00  24.39 ? 173 PHE B CE2    1 
ATOM   4082 C CZ     . PHE B 2 165 ? 16.147  -20.619 19.389  1.00  25.05 ? 173 PHE B CZ     1 
ATOM   4083 H H      . PHE B 2 165 ? 14.876  -22.495 24.850  1.00  29.70 ? 173 PHE B H      1 
ATOM   4084 H HA     . PHE B 2 165 ? 16.410  -20.025 24.152  1.00  26.73 ? 173 PHE B HA     1 
ATOM   4085 H HB2    . PHE B 2 165 ? 13.620  -20.983 23.433  1.00  24.39 ? 173 PHE B HB2    1 
ATOM   4086 H HB3    . PHE B 2 165 ? 14.011  -19.271 23.413  1.00  24.59 ? 173 PHE B HB3    1 
ATOM   4087 H HD1    . PHE B 2 165 ? 15.334  -22.523 22.048  1.00  22.18 ? 173 PHE B HD1    1 
ATOM   4088 H HD2    . PHE B 2 165 ? 14.883  -18.335 21.524  1.00  22.57 ? 173 PHE B HD2    1 
ATOM   4089 H HE1    . PHE B 2 165 ? 16.295  -22.699 19.810  1.00  24.09 ? 173 PHE B HE1    1 
ATOM   4090 H HE2    . PHE B 2 165 ? 15.861  -18.507 19.266  1.00  24.67 ? 173 PHE B HE2    1 
ATOM   4091 H HZ     . PHE B 2 165 ? 16.576  -20.706 18.401  1.00  22.77 ? 173 PHE B HZ     1 
ATOM   4092 N N      . TYR B 2 166 ? 13.726  -19.602 25.885  1.00  28.56 ? 174 TYR B N      1 
ATOM   4093 C CA     . TYR B 2 166 ? 13.261  -19.020 27.187  1.00  26.74 ? 174 TYR B CA     1 
ATOM   4094 C C      . TYR B 2 166 ? 12.408  -19.953 28.005  1.00  30.39 ? 174 TYR B C      1 
ATOM   4095 O O      . TYR B 2 166 ? 11.609  -19.514 28.797  1.00  36.53 ? 174 TYR B O      1 
ATOM   4096 C CB     . TYR B 2 166 ? 12.465  -17.700 26.908  1.00  26.65 ? 174 TYR B CB     1 
ATOM   4097 C CG     . TYR B 2 166 ? 13.392  -16.513 26.484  1.00  23.54 ? 174 TYR B CG     1 
ATOM   4098 C CD1    . TYR B 2 166 ? 13.476  -16.021 25.184  1.00  23.97 ? 174 TYR B CD1    1 
ATOM   4099 C CD2    . TYR B 2 166 ? 14.181  -15.892 27.445  1.00  27.65 ? 174 TYR B CD2    1 
ATOM   4100 C CE1    . TYR B 2 166 ? 14.312  -14.959 24.872  1.00  20.54 ? 174 TYR B CE1    1 
ATOM   4101 C CE2    . TYR B 2 166 ? 15.013  -14.832 27.122  1.00  24.20 ? 174 TYR B CE2    1 
ATOM   4102 C CZ     . TYR B 2 166 ? 15.085  -14.362 25.844  1.00  20.10 ? 174 TYR B CZ     1 
ATOM   4103 O OH     . TYR B 2 166 ? 15.944  -13.321 25.603  1.00  21.95 ? 174 TYR B OH     1 
ATOM   4104 H H      . TYR B 2 166 ? 13.079  -19.754 25.164  1.00  28.16 ? 174 TYR B H      1 
ATOM   4105 H HA     . TYR B 2 166 ? 14.120  -18.777 27.795  1.00  28.96 ? 174 TYR B HA     1 
ATOM   4106 H HB2    . TYR B 2 166 ? 11.714  -17.876 26.151  1.00  25.78 ? 174 TYR B HB2    1 
ATOM   4107 H HB3    . TYR B 2 166 ? 11.957  -17.407 27.815  1.00  25.62 ? 174 TYR B HB3    1 
ATOM   4108 H HD1    . TYR B 2 166 ? 12.880  -16.464 24.398  1.00  23.65 ? 174 TYR B HD1    1 
ATOM   4109 H HD2    . TYR B 2 166 ? 14.152  -16.235 28.473  1.00  26.31 ? 174 TYR B HD2    1 
ATOM   4110 H HE1    . TYR B 2 166 ? 14.340  -14.601 23.854  1.00  21.55 ? 174 TYR B HE1    1 
ATOM   4111 H HE2    . TYR B 2 166 ? 15.607  -14.371 27.896  1.00  24.57 ? 174 TYR B HE2    1 
ATOM   4112 H HH     . TYR B 2 166 ? 15.736  -12.926 24.736  1.00  21.66 ? 174 TYR B HH     1 
ATOM   4113 N N      . GLY B 2 167 ? 12.584  -21.217 27.808  1.00  33.33 ? 175 GLY B N      1 
ATOM   4114 C CA     . GLY B 2 167 ? 11.807  -22.249 28.564  1.00  33.42 ? 175 GLY B CA     1 
ATOM   4115 C C      . GLY B 2 167 ? 10.543  -21.846 29.307  1.00  30.69 ? 175 GLY B C      1 
ATOM   4116 O O      . GLY B 2 167 ? 10.512  -21.672 30.508  1.00  30.99 ? 175 GLY B O      1 
ATOM   4117 H H      . GLY B 2 167 ? 13.241  -21.513 27.143  1.00  32.86 ? 175 GLY B H      1 
ATOM   4118 H HA2    . GLY B 2 167 ? 11.548  -23.040 27.877  1.00  34.21 ? 175 GLY B HA2    1 
ATOM   4119 H HA3    . GLY B 2 167 ? 12.473  -22.676 29.299  1.00  33.86 ? 175 GLY B HA3    1 
ATOM   4120 N N      . ASN B 2 168 A 9.518   -21.706 28.537  1.00  32.20 ? 175 ASN B N      1 
ATOM   4121 C CA     . ASN B 2 168 A 8.135   -21.332 28.998  1.00  34.21 ? 175 ASN B CA     1 
ATOM   4122 C C      . ASN B 2 168 A 7.924   -19.970 29.644  1.00  36.25 ? 175 ASN B C      1 
ATOM   4123 O O      . ASN B 2 168 A 6.988   -19.779 30.405  1.00  37.93 ? 175 ASN B O      1 
ATOM   4124 C CB     A ASN B 2 168 A 7.633   -22.442 29.977  0.25  34.65 ? 175 ASN B CB     1 
ATOM   4125 C CB     B ASN B 2 168 A 7.602   -22.415 30.006  0.36  31.83 ? 175 ASN B CB     1 
ATOM   4126 C CG     A ASN B 2 168 A 7.631   -23.792 29.250  0.25  35.01 ? 175 ASN B CG     1 
ATOM   4127 C CG     B ASN B 2 168 A 7.590   -23.813 29.384  0.36  30.07 ? 175 ASN B CG     1 
ATOM   4128 O OD1    A ASN B 2 168 A 8.654   -24.314 28.855  0.25  35.67 ? 175 ASN B OD1    1 
ATOM   4129 O OD1    B ASN B 2 168 A 7.768   -23.988 28.195  0.36  29.30 ? 175 ASN B OD1    1 
ATOM   4130 N ND2    A ASN B 2 168 A 6.521   -24.422 29.023  0.25  35.31 ? 175 ASN B ND2    1 
ATOM   4131 N ND2    B ASN B 2 168 A 7.383   -24.858 30.124  0.36  28.88 ? 175 ASN B ND2    1 
ATOM   4132 H H      . ASN B 2 168 A 9.665   -21.867 27.582  1.00  32.94 ? 175 ASN B H      1 
ATOM   4133 H HA     . ASN B 2 168 A 7.497   -21.370 28.129  1.00  34.18 ? 175 ASN B HA     1 
ATOM   4134 H HB2    A ASN B 2 168 A 8.279   -22.496 30.841  0.25  34.35 ? 175 ASN B HB2    1 
ATOM   4135 H HB2    B ASN B 2 168 A 8.217   -22.413 30.893  0.36  31.97 ? 175 ASN B HB2    1 
ATOM   4136 H HB3    A ASN B 2 168 A 6.634   -22.204 30.313  0.25  34.41 ? 175 ASN B HB3    1 
ATOM   4137 H HB3    B ASN B 2 168 A 6.591   -22.156 30.289  0.36  32.08 ? 175 ASN B HB3    1 
ATOM   4138 H HD21   A ASN B 2 168 A 5.665   -24.042 29.301  0.25  35.40 ? 175 ASN B HD21   1 
ATOM   4139 H HD21   B ASN B 2 168 A 7.237   -24.765 31.085  0.36  29.02 ? 175 ASN B HD21   1 
ATOM   4140 H HD22   A ASN B 2 168 A 6.544   -25.291 28.567  0.25  35.43 ? 175 ASN B HD22   1 
ATOM   4141 H HD22   B ASN B 2 168 A 7.376   -25.749 29.712  0.36  29.27 ? 175 ASN B HD22   1 
ATOM   4142 N N      . GLN B 2 169 B 8.767   -19.036 29.329  1.00  38.04 ? 175 GLN B N      1 
ATOM   4143 C CA     . GLN B 2 169 B 8.603   -17.676 29.929  1.00  39.48 ? 175 GLN B CA     1 
ATOM   4144 C C      . GLN B 2 169 B 7.851   -16.742 28.932  1.00  37.62 ? 175 GLN B C      1 
ATOM   4145 O O      . GLN B 2 169 B 7.511   -15.620 29.265  1.00  37.56 ? 175 GLN B O      1 
ATOM   4146 C CB     . GLN B 2 169 B 9.993   -17.088 30.226  1.00  40.96 ? 175 GLN B CB     1 
ATOM   4147 C CG     . GLN B 2 169 B 10.783  -17.980 31.198  1.00  43.47 ? 175 GLN B CG     1 
ATOM   4148 C CD     . GLN B 2 169 B 12.175  -17.344 31.324  1.00  47.81 ? 175 GLN B CD     1 
ATOM   4149 O OE1    . GLN B 2 169 B 13.102  -17.534 30.559  1.00  48.71 ? 175 GLN B OE1    1 
ATOM   4150 N NE2    . GLN B 2 169 B 12.387  -16.533 32.308  1.00  51.21 ? 175 GLN B NE2    1 
ATOM   4151 H H      . GLN B 2 169 B 9.502   -19.235 28.708  1.00  37.57 ? 175 GLN B H      1 
ATOM   4152 H HA     . GLN B 2 169 B 8.021   -17.754 30.836  1.00  39.55 ? 175 GLN B HA     1 
ATOM   4153 H HB2    . GLN B 2 169 B 10.547  -16.986 29.306  1.00  41.47 ? 175 GLN B HB2    1 
ATOM   4154 H HB3    . GLN B 2 169 B 9.873   -16.103 30.653  1.00  41.64 ? 175 GLN B HB3    1 
ATOM   4155 H HG2    . GLN B 2 169 B 10.304  -18.016 32.164  1.00  43.49 ? 175 GLN B HG2    1 
ATOM   4156 H HG3    . GLN B 2 169 B 10.880  -18.991 30.830  1.00  43.71 ? 175 GLN B HG3    1 
ATOM   4157 H HE21   . GLN B 2 169 B 11.675  -16.334 32.948  1.00  50.50 ? 175 GLN B HE21   1 
ATOM   4158 H HE22   . GLN B 2 169 B 13.275  -16.129 32.395  1.00  50.95 ? 175 GLN B HE22   1 
ATOM   4159 N N      . ILE B 2 170 ? 7.596   -17.218 27.747  1.00  33.39 ? 176 ILE B N      1 
ATOM   4160 C CA     . ILE B 2 170 ? 6.899   -16.377 26.741  1.00  31.66 ? 176 ILE B CA     1 
ATOM   4161 C C      . ILE B 2 170 ? 5.411   -16.677 26.873  1.00  32.54 ? 176 ILE B C      1 
ATOM   4162 O O      . ILE B 2 170 ? 4.922   -17.748 26.550  1.00  33.20 ? 176 ILE B O      1 
ATOM   4163 C CB     . ILE B 2 170 ? 7.491   -16.747 25.344  1.00  28.33 ? 176 ILE B CB     1 
ATOM   4164 C CG1    . ILE B 2 170 ? 9.061   -16.765 25.425  1.00  26.72 ? 176 ILE B CG1    1 
ATOM   4165 C CG2    . ILE B 2 170 ? 7.038   -15.721 24.250  1.00  29.07 ? 176 ILE B CG2    1 
ATOM   4166 C CD1    . ILE B 2 170 ? 9.602   -15.412 25.931  1.00  25.31 ? 176 ILE B CD1    1 
ATOM   4167 H H      . ILE B 2 170 ? 7.852   -18.136 27.517  1.00  35.64 ? 176 ILE B H      1 
ATOM   4168 H HA     . ILE B 2 170 ? 7.075   -15.333 26.961  1.00  30.83 ? 176 ILE B HA     1 
ATOM   4169 H HB     . ILE B 2 170 ? 7.143   -17.724 25.051  1.00  29.07 ? 176 ILE B HB     1 
ATOM   4170 H HG12   . ILE B 2 170 ? 9.392   -17.561 26.079  1.00  26.95 ? 176 ILE B HG12   1 
ATOM   4171 H HG13   . ILE B 2 170 ? 9.482   -16.959 24.447  1.00  27.14 ? 176 ILE B HG13   1 
ATOM   4172 H HG21   . ILE B 2 170 ? 7.351   -14.715 24.489  1.00  28.33 ? 176 ILE B HG21   1 
ATOM   4173 H HG22   . ILE B 2 170 ? 5.961   -15.721 24.152  1.00  27.92 ? 176 ILE B HG22   1 
ATOM   4174 H HG23   . ILE B 2 170 ? 7.474   -15.988 23.295  1.00  27.98 ? 176 ILE B HG23   1 
ATOM   4175 H HD11   . ILE B 2 170 ? 10.681  -15.455 25.974  1.00  25.89 ? 176 ILE B HD11   1 
ATOM   4176 H HD12   . ILE B 2 170 ? 9.234   -15.173 26.917  1.00  25.33 ? 176 ILE B HD12   1 
ATOM   4177 H HD13   . ILE B 2 170 ? 9.338   -14.613 25.253  1.00  25.38 ? 176 ILE B HD13   1 
ATOM   4178 N N      . LYS B 2 171 ? 4.742   -15.683 27.363  1.00  30.99 ? 177 LYS B N      1 
ATOM   4179 C CA     . LYS B 2 171 ? 3.287   -15.790 27.567  1.00  30.80 ? 177 LYS B CA     1 
ATOM   4180 C C      . LYS B 2 171 ? 2.615   -15.415 26.240  1.00  31.94 ? 177 LYS B C      1 
ATOM   4181 O O      . LYS B 2 171 ? 3.238   -14.902 25.326  1.00  28.41 ? 177 LYS B O      1 
ATOM   4182 C CB     . LYS B 2 171 ? 2.863   -14.815 28.700  1.00  32.89 ? 177 LYS B CB     1 
ATOM   4183 C CG     . LYS B 2 171 ? 3.733   -14.962 29.983  1.00  32.81 ? 177 LYS B CG     1 
ATOM   4184 C CD     . LYS B 2 171 ? 3.710   -16.414 30.501  1.00  35.47 ? 177 LYS B CD     1 
ATOM   4185 C CE     . LYS B 2 171 ? 4.492   -16.554 31.831  0.35  34.70 ? 177 LYS B CE     1 
ATOM   4186 N NZ     . LYS B 2 171 ? 4.505   -17.987 32.248  0.35  34.61 ? 177 LYS B NZ     1 
ATOM   4187 H H      . LYS B 2 171 ? 5.214   -14.859 27.593  1.00  30.68 ? 177 LYS B H      1 
ATOM   4188 H HA     . LYS B 2 171 ? 3.055   -16.818 27.800  1.00  31.38 ? 177 LYS B HA     1 
ATOM   4189 H HB2    . LYS B 2 171 ? 2.964   -13.810 28.317  1.00  32.73 ? 177 LYS B HB2    1 
ATOM   4190 H HB3    . LYS B 2 171 ? 1.827   -14.960 28.957  1.00  32.13 ? 177 LYS B HB3    1 
ATOM   4191 H HG2    . LYS B 2 171 ? 4.755   -14.681 29.765  1.00  33.85 ? 177 LYS B HG2    1 
ATOM   4192 H HG3    . LYS B 2 171 ? 3.351   -14.293 30.738  1.00  33.37 ? 177 LYS B HG3    1 
ATOM   4193 H HD2    . LYS B 2 171 ? 2.693   -16.749 30.648  1.00  35.27 ? 177 LYS B HD2    1 
ATOM   4194 H HD3    . LYS B 2 171 ? 4.184   -17.064 29.776  1.00  34.99 ? 177 LYS B HD3    1 
ATOM   4195 H HE2    . LYS B 2 171 ? 5.516   -16.228 31.709  0.35  34.64 ? 177 LYS B HE2    1 
ATOM   4196 H HE3    . LYS B 2 171 ? 4.031   -15.978 32.618  0.35  34.42 ? 177 LYS B HE3    1 
ATOM   4197 H HZ1    . LYS B 2 171 ? 5.486   -18.324 32.318  0.35  34.58 ? 177 LYS B HZ1    1 
ATOM   4198 H HZ2    . LYS B 2 171 ? 3.994   -18.559 31.545  0.35  34.63 ? 177 LYS B HZ2    1 
ATOM   4199 H HZ3    . LYS B 2 171 ? 4.039   -18.081 33.173  0.35  34.68 ? 177 LYS B HZ3    1 
ATOM   4200 N N      . PRO B 2 172 ? 1.338   -15.680 26.154  1.00  35.61 ? 178 PRO B N      1 
ATOM   4201 C CA     . PRO B 2 172 ? 0.585   -15.555 24.882  1.00  36.19 ? 178 PRO B CA     1 
ATOM   4202 C C      . PRO B 2 172 ? 0.512   -14.109 24.317  1.00  32.20 ? 178 PRO B C      1 
ATOM   4203 O O      . PRO B 2 172 ? 0.371   -13.947 23.113  1.00  31.24 ? 178 PRO B O      1 
ATOM   4204 C CB     . PRO B 2 172 ? -0.800  -16.167 25.232  1.00  37.43 ? 178 PRO B CB     1 
ATOM   4205 C CG     . PRO B 2 172 ? -0.499  -17.058 26.466  1.00  36.58 ? 178 PRO B CG     1 
ATOM   4206 C CD     . PRO B 2 172 ? 0.446   -16.167 27.250  1.00  37.09 ? 178 PRO B CD     1 
ATOM   4207 H HA     . PRO B 2 172 ? 1.084   -16.169 24.142  1.00  36.76 ? 178 PRO B HA     1 
ATOM   4208 H HB2    . PRO B 2 172 ? -1.516  -15.392 25.466  1.00  37.13 ? 178 PRO B HB2    1 
ATOM   4209 H HB3    . PRO B 2 172 ? -1.165  -16.755 24.401  1.00  37.02 ? 178 PRO B HB3    1 
ATOM   4210 H HG2    . PRO B 2 172 ? -1.390  -17.277 27.036  1.00  37.38 ? 178 PRO B HG2    1 
ATOM   4211 H HG3    . PRO B 2 172 ? -0.006  -17.980 26.181  1.00  36.57 ? 178 PRO B HG3    1 
ATOM   4212 H HD2    . PRO B 2 172 ? -0.050  -15.336 27.730  1.00  36.76 ? 178 PRO B HD2    1 
ATOM   4213 H HD3    . PRO B 2 172 ? 0.989   -16.758 27.972  1.00  37.29 ? 178 PRO B HD3    1 
ATOM   4214 N N      . LYS B 2 173 ? 0.605   -13.108 25.170  1.00  22.63 ? 179 LYS B N      1 
ATOM   4215 C CA     . LYS B 2 173 ? 0.526   -11.737 24.590  1.00  22.80 ? 179 LYS B CA     1 
ATOM   4216 C C      . LYS B 2 173 ? 1.920   -11.109 24.342  1.00  22.64 ? 179 LYS B C      1 
ATOM   4217 O O      . LYS B 2 173 ? 2.119   -9.904  24.428  1.00  17.00 ? 179 LYS B O      1 
ATOM   4218 C CB     . LYS B 2 173 ? -0.284  -10.805 25.512  1.00  24.45 ? 179 LYS B CB     1 
ATOM   4219 C CG     . LYS B 2 173 ? -1.778  -11.265 25.708  1.00  26.07 ? 179 LYS B CG     1 
ATOM   4220 C CD     . LYS B 2 173 ? -2.487  -10.136 26.504  1.00  26.62 ? 179 LYS B CD     1 
ATOM   4221 C CE     . LYS B 2 173 ? -3.625  -10.613 27.403  0.48  28.59 ? 179 LYS B CE     1 
ATOM   4222 N NZ     . LYS B 2 173 ? -3.815  -9.585  28.480  0.48  29.62 ? 179 LYS B NZ     1 
ATOM   4223 H H      . LYS B 2 173 ? 0.730   -13.285 26.129  1.00  22.46 ? 179 LYS B H      1 
ATOM   4224 H HA     . LYS B 2 173 ? 0.027   -11.792 23.635  1.00  23.12 ? 179 LYS B HA     1 
ATOM   4225 H HB2    . LYS B 2 173 ? 0.230   -10.729 26.459  1.00  25.05 ? 179 LYS B HB2    1 
ATOM   4226 H HB3    . LYS B 2 173 ? -0.275  -9.817  25.068  1.00  25.07 ? 179 LYS B HB3    1 
ATOM   4227 H HG2    . LYS B 2 173 ? -2.258  -11.401 24.751  1.00  26.16 ? 179 LYS B HG2    1 
ATOM   4228 H HG3    . LYS B 2 173 ? -1.813  -12.203 26.243  1.00  26.36 ? 179 LYS B HG3    1 
ATOM   4229 H HD2    . LYS B 2 173 ? -1.782  -9.616  27.137  1.00  27.45 ? 179 LYS B HD2    1 
ATOM   4230 H HD3    . LYS B 2 173 ? -2.894  -9.411  25.812  1.00  26.64 ? 179 LYS B HD3    1 
ATOM   4231 H HE2    . LYS B 2 173 ? -4.552  -10.696 26.851  0.48  28.31 ? 179 LYS B HE2    1 
ATOM   4232 H HE3    . LYS B 2 173 ? -3.404  -11.560 27.872  0.48  28.44 ? 179 LYS B HE3    1 
ATOM   4233 H HZ1    . LYS B 2 173 ? -4.785  -9.213  28.444  0.48  29.26 ? 179 LYS B HZ1    1 
ATOM   4234 H HZ2    . LYS B 2 173 ? -3.143  -8.802  28.344  0.48  28.98 ? 179 LYS B HZ2    1 
ATOM   4235 H HZ3    . LYS B 2 173 ? -3.645  -10.021 29.409  0.48  29.09 ? 179 LYS B HZ3    1 
ATOM   4236 N N      . MET B 2 174 ? 2.866   -11.949 24.051  1.00  22.53 ? 180 MET B N      1 
ATOM   4237 C CA     . MET B 2 174 ? 4.229   -11.459 23.765  1.00  24.63 ? 180 MET B CA     1 
ATOM   4238 C C      . MET B 2 174 ? 4.766   -12.409 22.724  1.00  22.68 ? 180 MET B C      1 
ATOM   4239 O O      . MET B 2 174 ? 4.219   -13.497 22.568  1.00  19.58 ? 180 MET B O      1 
ATOM   4240 C CB     . MET B 2 174 ? 5.124   -11.428 25.064  1.00  28.55 ? 180 MET B CB     1 
ATOM   4241 C CG     . MET B 2 174 ? 5.005   -12.563 26.066  1.00  31.25 ? 180 MET B CG     1 
ATOM   4242 S SD     . MET B 2 174 ? 6.110   -12.419 27.509  1.00  28.45 ? 180 MET B SD     1 
ATOM   4243 C CE     . MET B 2 174 ? 5.008   -11.609 28.677  1.00  30.89 ? 180 MET B CE     1 
ATOM   4244 H H      . MET B 2 174 ? 2.704   -12.920 24.007  1.00  22.30 ? 180 MET B H      1 
ATOM   4245 H HA     . MET B 2 174 ? 4.166   -10.472 23.332  1.00  24.92 ? 180 MET B HA     1 
ATOM   4246 H HB2    . MET B 2 174 ? 6.152   -11.379 24.731  1.00  28.68 ? 180 MET B HB2    1 
ATOM   4247 H HB3    . MET B 2 174 ? 4.918   -10.504 25.590  1.00  28.60 ? 180 MET B HB3    1 
ATOM   4248 H HG2    . MET B 2 174 ? 3.979   -12.619 26.403  1.00  30.35 ? 180 MET B HG2    1 
ATOM   4249 H HG3    . MET B 2 174 ? 5.226   -13.490 25.554  1.00  30.58 ? 180 MET B HG3    1 
ATOM   4250 H HE1    . MET B 2 174 ? 5.059   -12.118 29.629  1.00  30.21 ? 180 MET B HE1    1 
ATOM   4251 H HE2    . MET B 2 174 ? 3.991   -11.672 28.323  1.00  30.74 ? 180 MET B HE2    1 
ATOM   4252 H HE3    . MET B 2 174 ? 5.288   -10.571 28.770  1.00  30.72 ? 180 MET B HE3    1 
ATOM   4253 N N      . PHE B 2 175 ? 5.782   -11.978 22.025  1.00  17.86 ? 181 PHE B N      1 
ATOM   4254 C CA     . PHE B 2 175 ? 6.399   -12.836 20.980  1.00  19.89 ? 181 PHE B CA     1 
ATOM   4255 C C      . PHE B 2 175 ? 7.895   -12.519 20.949  1.00  21.12 ? 181 PHE B C      1 
ATOM   4256 O O      . PHE B 2 175 ? 8.347   -11.546 21.530  1.00  21.50 ? 181 PHE B O      1 
ATOM   4257 C CB     . PHE B 2 175 ? 5.769   -12.576 19.584  1.00  16.85 ? 181 PHE B CB     1 
ATOM   4258 C CG     . PHE B 2 175 ? 6.001   -11.191 19.021  1.00  15.58 ? 181 PHE B CG     1 
ATOM   4259 C CD1    . PHE B 2 175 ? 7.037   -10.968 18.141  1.00  14.62 ? 181 PHE B CD1    1 
ATOM   4260 C CD2    . PHE B 2 175 ? 5.154   -10.159 19.364  1.00  16.48 ? 181 PHE B CD2    1 
ATOM   4261 C CE1    . PHE B 2 175 ? 7.217   -9.714  17.604  1.00  16.45 ? 181 PHE B CE1    1 
ATOM   4262 C CE2    . PHE B 2 175 ? 5.336   -8.910  18.826  1.00  14.12 ? 181 PHE B CE2    1 
ATOM   4263 C CZ     . PHE B 2 175 ? 6.366   -8.693  17.947  1.00  15.67 ? 181 PHE B CZ     1 
ATOM   4264 H H      . PHE B 2 175 ? 6.161   -11.083 22.179  1.00  22.31 ? 181 PHE B H      1 
ATOM   4265 H HA     . PHE B 2 175 ? 6.274   -13.876 21.257  1.00  21.20 ? 181 PHE B HA     1 
ATOM   4266 H HB2    . PHE B 2 175 ? 6.187   -13.289 18.890  1.00  16.33 ? 181 PHE B HB2    1 
ATOM   4267 H HB3    . PHE B 2 175 ? 4.708   -12.752 19.628  1.00  17.33 ? 181 PHE B HB3    1 
ATOM   4268 H HD1    . PHE B 2 175 ? 7.715   -11.764 17.865  1.00  13.96 ? 181 PHE B HD1    1 
ATOM   4269 H HD2    . PHE B 2 175 ? 4.347   -10.327 20.061  1.00  14.97 ? 181 PHE B HD2    1 
ATOM   4270 H HE1    . PHE B 2 175 ? 8.025   -9.525  16.912  1.00  15.07 ? 181 PHE B HE1    1 
ATOM   4271 H HE2    . PHE B 2 175 ? 4.674   -8.101  19.096  1.00  15.06 ? 181 PHE B HE2    1 
ATOM   4272 H HZ     . PHE B 2 175 ? 6.517   -7.717  17.512  1.00  16.45 ? 181 PHE B HZ     1 
ATOM   4273 N N      . CYS B 2 176 ? 8.610   -13.350 20.270  1.00  20.88 ? 182 CYS B N      1 
ATOM   4274 C CA     . CYS B 2 176 ? 10.081  -13.200 20.132  1.00  19.85 ? 182 CYS B CA     1 
ATOM   4275 C C      . CYS B 2 176 ? 10.437  -12.917 18.700  1.00  18.27 ? 182 CYS B C      1 
ATOM   4276 O O      . CYS B 2 176 ? 9.733   -13.320 17.788  1.00  17.45 ? 182 CYS B O      1 
ATOM   4277 C CB     . CYS B 2 176 ? 10.771  -14.506 20.558  1.00  21.40 ? 182 CYS B CB     1 
ATOM   4278 S SG     . CYS B 2 176 ? 10.455  -15.109 22.225  1.00  22.17 ? 182 CYS B SG     1 
ATOM   4279 H H      . CYS B 2 176 ? 8.182   -14.108 19.830  1.00  21.96 ? 182 CYS B H      1 
ATOM   4280 H HA     . CYS B 2 176 ? 10.410  -12.381 20.753  1.00  21.18 ? 182 CYS B HA     1 
ATOM   4281 H HB2    . CYS B 2 176 ? 10.466  -15.282 19.870  1.00  21.43 ? 182 CYS B HB2    1 
ATOM   4282 H HB3    . CYS B 2 176 ? 11.838  -14.376 20.449  1.00  21.97 ? 182 CYS B HB3    1 
ATOM   4283 N N      . ALA B 2 177 ? 11.519  -12.220 18.530  1.00  15.38 ? 183 ALA B N      1 
ATOM   4284 C CA     . ALA B 2 177 ? 11.971  -11.900 17.175  1.00  16.08 ? 183 ALA B CA     1 
ATOM   4285 C C      . ALA B 2 177 ? 13.459  -11.861 17.330  1.00  17.56 ? 183 ALA B C      1 
ATOM   4286 O O      . ALA B 2 177 ? 13.930  -11.334 18.330  1.00  18.53 ? 183 ALA B O      1 
ATOM   4287 C CB     . ALA B 2 177 ? 11.447  -10.547 16.739  1.00  17.06 ? 183 ALA B CB     1 
ATOM   4288 H H      . ALA B 2 177 ? 12.043  -11.907 19.307  1.00  16.19 ? 183 ALA B H      1 
ATOM   4289 H HA     . ALA B 2 177 ? 11.689  -12.697 16.502  1.00  16.70 ? 183 ALA B HA     1 
ATOM   4290 H HB1    . ALA B 2 177 ? 11.786  -10.362 15.728  1.00  15.50 ? 183 ALA B HB1    1 
ATOM   4291 H HB2    . ALA B 2 177 ? 11.818  -9.767  17.383  1.00  16.73 ? 183 ALA B HB2    1 
ATOM   4292 H HB3    . ALA B 2 177 ? 10.367  -10.542 16.764  1.00  15.73 ? 183 ALA B HB3    1 
ATOM   4293 N N      . GLY B 2 178 ? 14.134  -12.390 16.359  1.00  19.06 ? 184 GLY B N      1 
ATOM   4294 C CA     . GLY B 2 178 ? 15.628  -12.423 16.389  1.00  20.52 ? 184 GLY B CA     1 
ATOM   4295 C C      . GLY B 2 178 ? 16.127  -13.608 15.578  1.00  21.57 ? 184 GLY B C      1 
ATOM   4296 O O      . GLY B 2 178 ? 15.351  -14.265 14.901  1.00  24.37 ? 184 GLY B O      1 
ATOM   4297 H H      . GLY B 2 178 ? 13.660  -12.780 15.585  1.00  18.86 ? 184 GLY B H      1 
ATOM   4298 H HA2    . GLY B 2 178 ? 16.019  -11.509 15.966  1.00  20.55 ? 184 GLY B HA2    1 
ATOM   4299 H HA3    . GLY B 2 178 ? 15.965  -12.519 17.411  1.00  20.70 ? 184 GLY B HA3    1 
ATOM   4300 N N      . TYR B 2 179 A 17.400  -13.868 15.654  1.00  22.12 ? 184 TYR B N      1 
ATOM   4301 C CA     . TYR B 2 179 A 18.027  -14.984 14.911  1.00  22.40 ? 184 TYR B CA     1 
ATOM   4302 C C      . TYR B 2 179 A 18.479  -16.005 15.949  1.00  25.42 ? 184 TYR B C      1 
ATOM   4303 O O      . TYR B 2 179 A 19.013  -15.594 16.956  1.00  24.31 ? 184 TYR B O      1 
ATOM   4304 C CB     . TYR B 2 179 A 19.224  -14.432 14.130  1.00  23.48 ? 184 TYR B CB     1 
ATOM   4305 C CG     . TYR B 2 179 A 18.768  -13.458 13.009  1.00  23.68 ? 184 TYR B CG     1 
ATOM   4306 C CD1    . TYR B 2 179 A 18.463  -13.923 11.746  1.00  23.59 ? 184 TYR B CD1    1 
ATOM   4307 C CD2    . TYR B 2 179 A 18.656  -12.085 13.251  1.00  23.76 ? 184 TYR B CD2    1 
ATOM   4308 C CE1    . TYR B 2 179 A 18.060  -13.050 10.759  1.00  22.88 ? 184 TYR B CE1    1 
ATOM   4309 C CE2    . TYR B 2 179 A 18.255  -11.216 12.266  1.00  21.27 ? 184 TYR B CE2    1 
ATOM   4310 C CZ     . TYR B 2 179 A 17.952  -11.691 11.014  1.00  25.54 ? 184 TYR B CZ     1 
ATOM   4311 O OH     . TYR B 2 179 A 17.528  -10.809 10.038  1.00  28.75 ? 184 TYR B OH     1 
ATOM   4312 H H      . TYR B 2 179 A 17.972  -13.317 16.230  1.00  22.15 ? 184 TYR B H      1 
ATOM   4313 H HA     . TYR B 2 179 A 17.295  -15.392 14.234  1.00  23.99 ? 184 TYR B HA     1 
ATOM   4314 H HB2    . TYR B 2 179 A 19.888  -13.911 14.809  1.00  22.51 ? 184 TYR B HB2    1 
ATOM   4315 H HB3    . TYR B 2 179 A 19.788  -15.231 13.685  1.00  23.11 ? 184 TYR B HB3    1 
ATOM   4316 H HD1    . TYR B 2 179 A 18.538  -14.972 11.518  1.00  23.44 ? 184 TYR B HD1    1 
ATOM   4317 H HD2    . TYR B 2 179 A 18.887  -11.686 14.228  1.00  23.24 ? 184 TYR B HD2    1 
ATOM   4318 H HE1    . TYR B 2 179 A 17.828  -13.440 9.778   1.00  23.31 ? 184 TYR B HE1    1 
ATOM   4319 H HE2    . TYR B 2 179 A 18.180  -10.158 12.472  1.00  22.32 ? 184 TYR B HE2    1 
ATOM   4320 H HH     . TYR B 2 179 A 17.239  -11.340 9.279   1.00  28.09 ? 184 TYR B HH     1 
ATOM   4321 N N      . PRO B 2 180 ? 18.303  -17.300 15.770  1.00  26.53 ? 185 PRO B N      1 
ATOM   4322 C CA     . PRO B 2 180 ? 18.820  -18.328 16.712  1.00  27.28 ? 185 PRO B CA     1 
ATOM   4323 C C      . PRO B 2 180 ? 20.299  -18.096 17.025  1.00  26.61 ? 185 PRO B C      1 
ATOM   4324 O O      . PRO B 2 180 ? 20.766  -18.313 18.118  1.00  31.26 ? 185 PRO B O      1 
ATOM   4325 C CB     A PRO B 2 180 ? 18.533  -19.663 16.004  0.32  26.34 ? 185 PRO B CB     1 
ATOM   4326 C CB     B PRO B 2 180 ? 18.538  -19.645 16.003  0.45  26.91 ? 185 PRO B CB     1 
ATOM   4327 C CG     A PRO B 2 180 ? 18.305  -19.272 14.512  0.32  26.50 ? 185 PRO B CG     1 
ATOM   4328 C CG     B PRO B 2 180 ? 17.243  -19.318 15.214  0.45  27.15 ? 185 PRO B CG     1 
ATOM   4329 C CD     A PRO B 2 180 ? 17.590  -17.917 14.611  0.32  26.34 ? 185 PRO B CD     1 
ATOM   4330 C CD     B PRO B 2 180 ? 17.559  -17.926 14.641  0.45  26.96 ? 185 PRO B CD     1 
ATOM   4331 H HA     . PRO B 2 180 ? 18.258  -18.273 17.638  1.00  25.81 ? 185 PRO B HA     1 
ATOM   4332 H HB2    A PRO B 2 180 ? 19.371  -20.341 16.103  0.32  26.15 ? 185 PRO B HB2    1 
ATOM   4333 H HB2    B PRO B 2 180 ? 19.349  -19.926 15.344  0.45  27.00 ? 185 PRO B HB2    1 
ATOM   4334 H HB3    A PRO B 2 180 ? 17.653  -20.133 16.418  0.32  26.01 ? 185 PRO B HB3    1 
ATOM   4335 H HB3    B PRO B 2 180 ? 18.375  -20.437 16.720  0.45  27.27 ? 185 PRO B HB3    1 
ATOM   4336 H HG2    A PRO B 2 180 ? 19.226  -19.223 13.955  0.32  26.13 ? 185 PRO B HG2    1 
ATOM   4337 H HG2    B PRO B 2 180 ? 17.074  -20.028 14.416  0.45  26.99 ? 185 PRO B HG2    1 
ATOM   4338 H HG3    A PRO B 2 180 ? 17.650  -19.989 14.035  0.32  26.16 ? 185 PRO B HG3    1 
ATOM   4339 H HG3    B PRO B 2 180 ? 16.372  -19.281 15.855  0.45  27.03 ? 185 PRO B HG3    1 
ATOM   4340 H HD2    A PRO B 2 180 ? 17.726  -17.338 13.709  0.32  26.52 ? 185 PRO B HD2    1 
ATOM   4341 H HD2    B PRO B 2 180 ? 18.155  -17.955 13.741  0.45  27.01 ? 185 PRO B HD2    1 
ATOM   4342 H HD3    A PRO B 2 180 ? 16.534  -18.015 14.830  0.32  26.63 ? 185 PRO B HD3    1 
ATOM   4343 H HD3    B PRO B 2 180 ? 16.645  -17.387 14.473  0.45  27.15 ? 185 PRO B HD3    1 
ATOM   4344 N N      . GLU B 2 181 ? 20.950  -17.655 16.004  1.00  29.02 ? 186 GLU B N      1 
ATOM   4345 C CA     . GLU B 2 181 ? 22.403  -17.356 16.053  1.00  33.03 ? 186 GLU B CA     1 
ATOM   4346 C C      . GLU B 2 181 ? 22.741  -16.110 16.880  1.00  30.65 ? 186 GLU B C      1 
ATOM   4347 O O      . GLU B 2 181 ? 23.875  -15.964 17.297  1.00  28.93 ? 186 GLU B O      1 
ATOM   4348 C CB     . GLU B 2 181 ? 22.926  -17.156 14.609  1.00  38.70 ? 186 GLU B CB     1 
ATOM   4349 C CG     . GLU B 2 181 ? 22.568  -18.407 13.699  1.00  44.26 ? 186 GLU B CG     1 
ATOM   4350 C CD     . GLU B 2 181 ? 21.504  -18.103 12.612  1.00  45.94 ? 186 GLU B CD     1 
ATOM   4351 O OE1    . GLU B 2 181 ? 20.562  -17.397 12.937  1.00  45.24 ? 186 GLU B OE1    1 
ATOM   4352 O OE2    . GLU B 2 181 ? 21.704  -18.615 11.513  1.00  48.89 ? 186 GLU B OE2    1 
ATOM   4353 H H      . GLU B 2 181 ? 20.443  -17.518 15.181  1.00  30.20 ? 186 GLU B H      1 
ATOM   4354 H HA     . GLU B 2 181 ? 22.905  -18.195 16.513  1.00  32.34 ? 186 GLU B HA     1 
ATOM   4355 H HB2    . GLU B 2 181 ? 22.531  -16.241 14.191  1.00  38.64 ? 186 GLU B HB2    1 
ATOM   4356 H HB3    . GLU B 2 181 ? 24.001  -17.035 14.661  1.00  38.26 ? 186 GLU B HB3    1 
ATOM   4357 H HG2    . GLU B 2 181 ? 23.475  -18.725 13.196  1.00  43.84 ? 186 GLU B HG2    1 
ATOM   4358 H HG3    . GLU B 2 181 ? 22.214  -19.238 14.295  1.00  43.53 ? 186 GLU B HG3    1 
ATOM   4359 N N      . GLY B 2 182 A 21.794  -15.246 17.093  1.00  27.06 ? 186 GLY B N      1 
ATOM   4360 C CA     . GLY B 2 182 A 22.093  -14.016 17.893  1.00  27.04 ? 186 GLY B CA     1 
ATOM   4361 C C      . GLY B 2 182 A 22.735  -12.999 16.916  1.00  23.46 ? 186 GLY B C      1 
ATOM   4362 O O      . GLY B 2 182 A 22.588  -13.122 15.706  1.00  23.66 ? 186 GLY B O      1 
ATOM   4363 H H      . GLY B 2 182 A 20.895  -15.386 16.738  1.00  28.35 ? 186 GLY B H      1 
ATOM   4364 H HA2    . GLY B 2 182 A 21.176  -13.622 18.306  1.00  27.47 ? 186 GLY B HA2    1 
ATOM   4365 H HA3    . GLY B 2 182 A 22.786  -14.260 18.688  1.00  26.26 ? 186 GLY B HA3    1 
ATOM   4366 N N      . GLY B 2 183 B 23.420  -12.000 17.431  1.00  21.17 ? 186 GLY B N      1 
ATOM   4367 C CA     . GLY B 2 183 B 24.064  -11.010 16.508  1.00  21.58 ? 186 GLY B CA     1 
ATOM   4368 C C      . GLY B 2 183 B 23.295  -9.705  16.253  1.00  21.84 ? 186 GLY B C      1 
ATOM   4369 O O      . GLY B 2 183 B 23.902  -8.652  16.219  1.00  21.43 ? 186 GLY B O      1 
ATOM   4370 H H      . GLY B 2 183 B 23.518  -11.904 18.402  1.00  19.66 ? 186 GLY B H      1 
ATOM   4371 H HA2    . GLY B 2 183 B 25.020  -10.751 16.935  1.00  22.11 ? 186 GLY B HA2    1 
ATOM   4372 H HA3    . GLY B 2 183 B 24.253  -11.482 15.554  1.00  21.15 ? 186 GLY B HA3    1 
ATOM   4373 N N      . ILE B 2 184 C 21.996  -9.808  16.071  1.00  20.56 ? 186 ILE B N      1 
ATOM   4374 C CA     . ILE B 2 184 C 21.143  -8.595  15.811  1.00  19.65 ? 186 ILE B CA     1 
ATOM   4375 C C      . ILE B 2 184 C 20.025  -8.659  16.849  1.00  17.11 ? 186 ILE B C      1 
ATOM   4376 O O      . ILE B 2 184 C 19.352  -9.673  16.993  1.00  18.25 ? 186 ILE B O      1 
ATOM   4377 C CB     . ILE B 2 184 C 20.613  -8.673  14.342  1.00  19.36 ? 186 ILE B CB     1 
ATOM   4378 C CG1    . ILE B 2 184 C 21.822  -8.756  13.387  1.00  20.40 ? 186 ILE B CG1    1 
ATOM   4379 C CG2    . ILE B 2 184 C 19.873  -7.380  14.016  1.00  21.00 ? 186 ILE B CG2    1 
ATOM   4380 C CD1    . ILE B 2 184 C 21.383  -8.874  11.928  1.00  23.99 ? 186 ILE B CD1    1 
ATOM   4381 H H      . ILE B 2 184 C 21.571  -10.690 16.105  1.00  19.88 ? 186 ILE B H      1 
ATOM   4382 H HA     . ILE B 2 184 C 21.737  -7.706  15.961  1.00  20.81 ? 186 ILE B HA     1 
ATOM   4383 H HB     . ILE B 2 184 C 19.953  -9.519  14.220  1.00  20.23 ? 186 ILE B HB     1 
ATOM   4384 H HG12   . ILE B 2 184 C 22.432  -7.869  13.495  1.00  20.87 ? 186 ILE B HG12   1 
ATOM   4385 H HG13   . ILE B 2 184 C 22.430  -9.614  13.629  1.00  21.19 ? 186 ILE B HG13   1 
ATOM   4386 H HG21   . ILE B 2 184 C 19.054  -7.233  14.702  1.00  19.97 ? 186 ILE B HG21   1 
ATOM   4387 H HG22   . ILE B 2 184 C 20.542  -6.531  14.088  1.00  20.05 ? 186 ILE B HG22   1 
ATOM   4388 H HG23   . ILE B 2 184 C 19.467  -7.420  13.015  1.00  20.25 ? 186 ILE B HG23   1 
ATOM   4389 H HD11   . ILE B 2 184 C 22.250  -8.940  11.289  1.00  23.15 ? 186 ILE B HD11   1 
ATOM   4390 H HD12   . ILE B 2 184 C 20.780  -9.760  11.775  1.00  22.71 ? 186 ILE B HD12   1 
ATOM   4391 H HD13   . ILE B 2 184 C 20.817  -8.007  11.615  1.00  23.20 ? 186 ILE B HD13   1 
ATOM   4392 N N      . ASP B 2 185 ? 19.835  -7.586  17.555  1.00  17.57 ? 189 ASP B N      1 
ATOM   4393 C CA     . ASP B 2 185 ? 18.782  -7.555  18.601  1.00  16.41 ? 189 ASP B CA     1 
ATOM   4394 C C      . ASP B 2 185 ? 18.637  -6.158  19.148  1.00  15.68 ? 189 ASP B C      1 
ATOM   4395 O O      . ASP B 2 185 ? 19.410  -5.255  18.885  1.00  17.28 ? 189 ASP B O      1 
ATOM   4396 C CB     . ASP B 2 185 ? 19.209  -8.531  19.747  1.00  18.94 ? 189 ASP B CB     1 
ATOM   4397 C CG     . ASP B 2 185 ? 18.182  -8.840  20.858  1.00  18.84 ? 189 ASP B CG     1 
ATOM   4398 O OD1    . ASP B 2 185 ? 16.995  -8.572  20.736  1.00  17.40 ? 189 ASP B OD1    1 
ATOM   4399 O OD2    . ASP B 2 185 ? 18.680  -9.372  21.833  1.00  19.18 ? 189 ASP B OD2    1 
ATOM   4400 H H      . ASP B 2 185 ? 20.387  -6.785  17.394  1.00  18.15 ? 189 ASP B H      1 
ATOM   4401 H HA     . ASP B 2 185 ? 17.844  -7.871  18.162  1.00  19.07 ? 189 ASP B HA     1 
ATOM   4402 H HB2    . ASP B 2 185 ? 19.524  -9.476  19.333  1.00  19.39 ? 189 ASP B HB2    1 
ATOM   4403 H HB3    . ASP B 2 185 ? 20.067  -8.079  20.225  1.00  18.73 ? 189 ASP B HB3    1 
ATOM   4404 N N      . ALA B 2 186 ? 17.618  -6.026  19.924  1.00  15.12 ? 190 ALA B N      1 
ATOM   4405 C CA     . ALA B 2 186 ? 17.319  -4.751  20.582  1.00  17.28 ? 190 ALA B CA     1 
ATOM   4406 C C      . ALA B 2 186 ? 18.171  -4.851  21.889  1.00  16.94 ? 190 ALA B C      1 
ATOM   4407 O O      . ALA B 2 186 ? 18.721  -5.899  22.170  1.00  17.37 ? 190 ALA B O      1 
ATOM   4408 C CB     . ALA B 2 186 ? 15.821  -4.660  20.929  1.00  17.48 ? 190 ALA B CB     1 
ATOM   4409 H H      . ALA B 2 186 ? 17.023  -6.780  20.078  1.00  16.99 ? 190 ALA B H      1 
ATOM   4410 H HA     . ALA B 2 186 ? 17.671  -3.949  19.959  1.00  17.94 ? 190 ALA B HA     1 
ATOM   4411 H HB1    . ALA B 2 186 ? 15.594  -3.750  21.463  1.00  16.52 ? 190 ALA B HB1    1 
ATOM   4412 H HB2    . ALA B 2 186 ? 15.532  -5.496  21.555  1.00  17.35 ? 190 ALA B HB2    1 
ATOM   4413 H HB3    . ALA B 2 186 ? 15.226  -4.696  20.029  1.00  17.38 ? 190 ALA B HB3    1 
ATOM   4414 N N      . CYS B 2 187 ? 18.249  -3.785  22.641  1.00  16.65 ? 191 CYS B N      1 
ATOM   4415 C CA     . CYS B 2 187 ? 19.045  -3.834  23.874  1.00  17.44 ? 191 CYS B CA     1 
ATOM   4416 C C      . CYS B 2 187 ? 18.560  -2.744  24.812  1.00  17.39 ? 191 CYS B C      1 
ATOM   4417 O O      . CYS B 2 187 ? 17.613  -2.026  24.546  1.00  17.75 ? 191 CYS B O      1 
ATOM   4418 C CB     . CYS B 2 187 ? 20.553  -3.672  23.459  1.00  18.71 ? 191 CYS B CB     1 
ATOM   4419 S SG     . CYS B 2 187 ? 21.774  -4.259  24.666  1.00  19.59 ? 191 CYS B SG     1 
ATOM   4420 H H      . CYS B 2 187 ? 17.784  -2.958  22.439  1.00  16.04 ? 191 CYS B H      1 
ATOM   4421 H HA     . CYS B 2 187 ? 18.885  -4.798  24.344  1.00  16.99 ? 191 CYS B HA     1 
ATOM   4422 H HB2    . CYS B 2 187 ? 20.727  -4.235  22.557  1.00  17.88 ? 191 CYS B HB2    1 
ATOM   4423 H HB3    . CYS B 2 187 ? 20.768  -2.631  23.258  1.00  18.73 ? 191 CYS B HB3    1 
ATOM   4424 N N      . GLN B 2 188 ? 19.238  -2.641  25.909  1.00  19.76 ? 192 GLN B N      1 
ATOM   4425 C CA     . GLN B 2 188 ? 18.926  -1.630  26.965  1.00  21.48 ? 192 GLN B CA     1 
ATOM   4426 C C      . GLN B 2 188 ? 18.870  -0.214  26.317  1.00  16.35 ? 192 GLN B C      1 
ATOM   4427 O O      . GLN B 2 188 ? 19.750  0.228   25.600  1.00  17.80 ? 192 GLN B O      1 
ATOM   4428 C CB     . GLN B 2 188 ? 20.032  -1.765  27.992  1.00  25.68 ? 192 GLN B CB     1 
ATOM   4429 C CG     . GLN B 2 188 ? 19.638  -1.063  29.229  1.00  33.75 ? 192 GLN B CG     1 
ATOM   4430 C CD     . GLN B 2 188 ? 20.769  -1.214  30.276  1.00  39.52 ? 192 GLN B CD     1 
ATOM   4431 O OE1    . GLN B 2 188 ? 20.778  -0.453  31.222  1.00  47.14 ? 192 GLN B OE1    1 
ATOM   4432 N NE2    . GLN B 2 188 ? 21.705  -2.130  30.181  1.00  40.26 ? 192 GLN B NE2    1 
ATOM   4433 H H      . GLN B 2 188 ? 19.986  -3.269  26.012  1.00  21.25 ? 192 GLN B H      1 
ATOM   4434 H HA     . GLN B 2 188 ? 17.960  -1.866  27.388  1.00  19.63 ? 192 GLN B HA     1 
ATOM   4435 H HB2    . GLN B 2 188 ? 20.224  -2.803  28.216  1.00  26.98 ? 192 GLN B HB2    1 
ATOM   4436 H HB3    . GLN B 2 188 ? 20.936  -1.308  27.612  1.00  26.71 ? 192 GLN B HB3    1 
ATOM   4437 H HG2    . GLN B 2 188 ? 19.496  -0.011  29.028  1.00  33.82 ? 192 GLN B HG2    1 
ATOM   4438 H HG3    . GLN B 2 188 ? 18.720  -1.459  29.638  1.00  33.09 ? 192 GLN B HG3    1 
ATOM   4439 H HE21   . GLN B 2 188 ? 21.744  -2.766  29.439  1.00  39.86 ? 192 GLN B HE21   1 
ATOM   4440 H HE22   . GLN B 2 188 ? 22.389  -2.168  30.887  1.00  40.24 ? 192 GLN B HE22   1 
ATOM   4441 N N      . GLY B 2 189 ? 17.819  0.473   26.595  1.00  15.31 ? 193 GLY B N      1 
ATOM   4442 C CA     . GLY B 2 189 ? 17.616  1.833   26.046  1.00  15.56 ? 193 GLY B CA     1 
ATOM   4443 C C      . GLY B 2 189 ? 16.633  1.742   24.862  1.00  16.38 ? 193 GLY B C      1 
ATOM   4444 O O      . GLY B 2 189 ? 16.168  2.758   24.371  1.00  14.64 ? 193 GLY B O      1 
ATOM   4445 H H      . GLY B 2 189 ? 17.167  0.077   27.188  1.00  13.22 ? 193 GLY B H      1 
ATOM   4446 H HA2    . GLY B 2 189 ? 17.191  2.456   26.819  1.00  14.88 ? 193 GLY B HA2    1 
ATOM   4447 H HA3    . GLY B 2 189 ? 18.558  2.246   25.713  1.00  14.85 ? 193 GLY B HA3    1 
ATOM   4448 N N      . ASP B 2 190 ? 16.333  0.549   24.418  1.00  13.55 ? 194 ASP B N      1 
ATOM   4449 C CA     . ASP B 2 190 ? 15.391  0.410   23.271  1.00  12.86 ? 194 ASP B CA     1 
ATOM   4450 C C      . ASP B 2 190 ? 14.004  0.063   23.778  1.00  12.11 ? 194 ASP B C      1 
ATOM   4451 O O      . ASP B 2 190 ? 13.085  0.134   22.981  1.00  13.19 ? 194 ASP B O      1 
ATOM   4452 C CB     . ASP B 2 190 ? 15.843  -0.708  22.269  1.00  12.99 ? 194 ASP B CB     1 
ATOM   4453 C CG     . ASP B 2 190 ? 17.125  -0.365  21.477  1.00  13.25 ? 194 ASP B CG     1 
ATOM   4454 O OD1    . ASP B 2 190 ? 17.254  0.765   21.048  1.00  10.35 ? 194 ASP B OD1    1 
ATOM   4455 O OD2    . ASP B 2 190 ? 17.929  -1.262  21.314  1.00  11.69 ? 194 ASP B OD2    1 
ATOM   4456 H H      . ASP B 2 190 ? 16.732  -0.243  24.849  1.00  15.03 ? 194 ASP B H      1 
ATOM   4457 H HA     . ASP B 2 190 ? 15.327  1.342   22.735  1.00  13.55 ? 194 ASP B HA     1 
ATOM   4458 H HB2    . ASP B 2 190 ? 15.975  -1.640  22.800  1.00  12.99 ? 194 ASP B HB2    1 
ATOM   4459 H HB3    . ASP B 2 190 ? 15.044  -0.866  21.556  1.00  13.10 ? 194 ASP B HB3    1 
ATOM   4460 N N      . SER B 2 191 ? 13.895  -0.284  25.025  1.00  11.74 ? 195 SER B N      1 
ATOM   4461 C CA     . SER B 2 191 ? 12.577  -0.641  25.628  1.00  12.95 ? 195 SER B CA     1 
ATOM   4462 C C      . SER B 2 191 ? 11.473  0.425   25.320  1.00  15.04 ? 195 SER B C      1 
ATOM   4463 O O      . SER B 2 191 ? 11.764  1.604   25.408  1.00  10.46 ? 195 SER B O      1 
ATOM   4464 C CB     . SER B 2 191 ? 12.680  -0.735  27.138  1.00  14.83 ? 195 SER B CB     1 
ATOM   4465 O OG     . SER B 2 191 ? 13.294  -1.993  27.440  1.00  18.72 ? 195 SER B OG     1 
ATOM   4466 H H      . SER B 2 191 ? 14.702  -0.303  25.575  1.00  12.88 ? 195 SER B H      1 
ATOM   4467 H HA     . SER B 2 191 ? 12.271  -1.587  25.211  1.00  14.88 ? 195 SER B HA     1 
ATOM   4468 H HB2    . SER B 2 191 ? 13.246  0.097   27.536  1.00  16.36 ? 195 SER B HB2    1 
ATOM   4469 H HB3    . SER B 2 191 ? 11.693  -0.690  27.576  1.00  15.80 ? 195 SER B HB3    1 
ATOM   4470 H HG     . SER B 2 191 ? 14.255  -1.907  27.443  1.00  17.14 ? 195 SER B HG     1 
ATOM   4471 N N      . GLY B 2 192 ? 10.284  -0.023  24.972  1.00  14.99 ? 196 GLY B N      1 
ATOM   4472 C CA     . GLY B 2 192 ? 9.186   0.916   24.671  1.00  11.33 ? 196 GLY B CA     1 
ATOM   4473 C C      . GLY B 2 192 ? 9.078   1.248   23.202  1.00  13.30 ? 196 GLY B C      1 
ATOM   4474 O O      . GLY B 2 192 ? 8.046   1.668   22.717  1.00  13.92 ? 196 GLY B O      1 
ATOM   4475 H H      . GLY B 2 192 ? 10.111  -0.985  24.904  1.00  13.03 ? 196 GLY B H      1 
ATOM   4476 H HA2    . GLY B 2 192 ? 8.264   0.477   24.998  1.00  13.10 ? 196 GLY B HA2    1 
ATOM   4477 H HA3    . GLY B 2 192 ? 9.336   1.834   25.227  1.00  11.35 ? 196 GLY B HA3    1 
ATOM   4478 N N      . GLY B 2 193 ? 10.126  1.060   22.467  1.00  13.14 ? 197 GLY B N      1 
ATOM   4479 C CA     . GLY B 2 193 ? 10.046  1.400   21.039  1.00  16.85 ? 197 GLY B CA     1 
ATOM   4480 C C      . GLY B 2 193 ? 9.410   0.403   20.099  1.00  13.35 ? 197 GLY B C      1 
ATOM   4481 O O      . GLY B 2 193 ? 8.934   -0.629  20.518  1.00  15.42 ? 197 GLY B O      1 
ATOM   4482 H H      . GLY B 2 193 ? 10.949  0.697   22.856  1.00  16.59 ? 197 GLY B H      1 
ATOM   4483 H HA2    . GLY B 2 193 ? 9.488   2.323   20.950  1.00  15.72 ? 197 GLY B HA2    1 
ATOM   4484 H HA3    . GLY B 2 193 ? 11.044  1.574   20.690  1.00  16.30 ? 197 GLY B HA3    1 
ATOM   4485 N N      . PRO B 2 194 ? 9.432   0.767   18.849  1.00  13.76 ? 198 PRO B N      1 
ATOM   4486 C CA     . PRO B 2 194 ? 8.755   0.029   17.793  1.00  13.65 ? 198 PRO B CA     1 
ATOM   4487 C C      . PRO B 2 194 ? 9.392   -1.171  17.119  1.00  13.33 ? 198 PRO B C      1 
ATOM   4488 O O      . PRO B 2 194 ? 10.579  -1.224  16.895  1.00  13.66 ? 198 PRO B O      1 
ATOM   4489 C CB     . PRO B 2 194 ? 8.457   1.095   16.786  1.00  14.56 ? 198 PRO B CB     1 
ATOM   4490 C CG     . PRO B 2 194 ? 9.647   2.067   16.864  1.00  13.62 ? 198 PRO B CG     1 
ATOM   4491 C CD     . PRO B 2 194 ? 10.099  2.008   18.292  1.00  15.37 ? 198 PRO B CD     1 
ATOM   4492 H HA     . PRO B 2 194 ? 7.814   -0.295  18.213  1.00  13.91 ? 198 PRO B HA     1 
ATOM   4493 H HB2    . PRO B 2 194 ? 8.425   0.693   15.787  1.00  13.74 ? 198 PRO B HB2    1 
ATOM   4494 H HB3    . PRO B 2 194 ? 7.527   1.583   17.002  1.00  15.14 ? 198 PRO B HB3    1 
ATOM   4495 H HG2    . PRO B 2 194 ? 10.448  1.761   16.207  1.00  14.86 ? 198 PRO B HG2    1 
ATOM   4496 H HG3    . PRO B 2 194 ? 9.342   3.077   16.628  1.00  13.74 ? 198 PRO B HG3    1 
ATOM   4497 H HD2    . PRO B 2 194 ? 11.175  1.916   18.345  1.00  15.12 ? 198 PRO B HD2    1 
ATOM   4498 H HD3    . PRO B 2 194 ? 9.761   2.890   18.820  1.00  14.35 ? 198 PRO B HD3    1 
ATOM   4499 N N      . PHE B 2 195 ? 8.524   -2.091  16.808  1.00  13.59 ? 199 PHE B N      1 
ATOM   4500 C CA     . PHE B 2 195 ? 8.834   -3.360  16.103  1.00  12.94 ? 199 PHE B CA     1 
ATOM   4501 C C      . PHE B 2 195 ? 7.702   -3.170  15.030  1.00  12.71 ? 199 PHE B C      1 
ATOM   4502 O O      . PHE B 2 195 ? 6.534   -3.383  15.331  1.00  12.76 ? 199 PHE B O      1 
ATOM   4503 C CB     . PHE B 2 195 ? 8.569   -4.561  16.989  1.00  13.67 ? 199 PHE B CB     1 
ATOM   4504 C CG     . PHE B 2 195 ? 8.822   -5.809  16.121  1.00  16.10 ? 199 PHE B CG     1 
ATOM   4505 C CD1    . PHE B 2 195 ? 10.100  -6.310  15.973  1.00  18.98 ? 199 PHE B CD1    1 
ATOM   4506 C CD2    . PHE B 2 195 ? 7.772   -6.462  15.488  1.00  15.21 ? 199 PHE B CD2    1 
ATOM   4507 C CE1    . PHE B 2 195 ? 10.319  -7.439  15.215  1.00  19.83 ? 199 PHE B CE1    1 
ATOM   4508 C CE2    . PHE B 2 195 ? 7.988   -7.587  14.732  1.00  14.10 ? 199 PHE B CE2    1 
ATOM   4509 C CZ     . PHE B 2 195 ? 9.265   -8.079  14.594  1.00  18.36 ? 199 PHE B CZ     1 
ATOM   4510 H H      . PHE B 2 195 ? 7.588   -1.935  17.060  1.00  13.19 ? 199 PHE B H      1 
ATOM   4511 H HA     . PHE B 2 195 ? 9.813   -3.323  15.649  1.00  13.74 ? 199 PHE B HA     1 
ATOM   4512 H HB2    . PHE B 2 195 ? 9.249   -4.558  17.824  1.00  14.66 ? 199 PHE B HB2    1 
ATOM   4513 H HB3    . PHE B 2 195 ? 7.558   -4.572  17.361  1.00  15.17 ? 199 PHE B HB3    1 
ATOM   4514 H HD1    . PHE B 2 195 ? 10.937  -5.822  16.447  1.00  18.34 ? 199 PHE B HD1    1 
ATOM   4515 H HD2    . PHE B 2 195 ? 6.767   -6.082  15.585  1.00  15.64 ? 199 PHE B HD2    1 
ATOM   4516 H HE1    . PHE B 2 195 ? 11.318  -7.819  15.110  1.00  19.31 ? 199 PHE B HE1    1 
ATOM   4517 H HE2    . PHE B 2 195 ? 7.164   -8.088  14.243  1.00  14.52 ? 199 PHE B HE2    1 
ATOM   4518 H HZ     . PHE B 2 195 ? 9.445   -8.961  13.995  1.00  18.01 ? 199 PHE B HZ     1 
ATOM   4519 N N      . VAL B 2 196 ? 8.062   -2.776  13.849  1.00  13.37 ? 200 VAL B N      1 
ATOM   4520 C CA     . VAL B 2 196 ? 7.081   -2.538  12.772  1.00  13.21 ? 200 VAL B CA     1 
ATOM   4521 C C      . VAL B 2 196 ? 7.252   -3.435  11.557  1.00  15.37 ? 200 VAL B C      1 
ATOM   4522 O O      . VAL B 2 196 ? 8.377   -3.728  11.153  1.00  13.63 ? 200 VAL B O      1 
ATOM   4523 C CB     . VAL B 2 196 ? 7.176   -0.981  12.339  1.00  12.23 ? 200 VAL B CB     1 
ATOM   4524 C CG1    . VAL B 2 196 ? 6.738   -0.042  13.496  1.00  11.68 ? 200 VAL B CG1    1 
ATOM   4525 C CG2    . VAL B 2 196 ? 8.620   -0.593  11.882  1.00  11.28 ? 200 VAL B CG2    1 
ATOM   4526 H H      . VAL B 2 196 ? 9.013   -2.640  13.654  1.00  14.38 ? 200 VAL B H      1 
ATOM   4527 H HA     . VAL B 2 196 ? 6.106   -2.749  13.181  1.00  14.07 ? 200 VAL B HA     1 
ATOM   4528 H HB     . VAL B 2 196 ? 6.500   -0.810  11.511  1.00  12.45 ? 200 VAL B HB     1 
ATOM   4529 H HG11   . VAL B 2 196 ? 7.330   -0.217  14.379  1.00  12.03 ? 200 VAL B HG11   1 
ATOM   4530 H HG12   . VAL B 2 196 ? 5.703   -0.216  13.745  1.00  12.01 ? 200 VAL B HG12   1 
ATOM   4531 H HG13   . VAL B 2 196 ? 6.842   0.993   13.204  1.00  12.54 ? 200 VAL B HG13   1 
ATOM   4532 H HG21   . VAL B 2 196 ? 8.670   0.446   11.599  1.00  11.38 ? 200 VAL B HG21   1 
ATOM   4533 H HG22   . VAL B 2 196 ? 8.912   -1.182  11.025  1.00  10.78 ? 200 VAL B HG22   1 
ATOM   4534 H HG23   . VAL B 2 196 ? 9.336   -0.758  12.675  1.00  11.74 ? 200 VAL B HG23   1 
ATOM   4535 N N      . CYS B 2 197 ? 6.103   -3.812  11.025  1.00  14.61 ? 201 CYS B N      1 
ATOM   4536 C CA     . CYS B 2 197 ? 6.042   -4.687  9.811   1.00  15.67 ? 201 CYS B CA     1 
ATOM   4537 C C      . CYS B 2 197 ? 5.203   -3.912  8.777   1.00  17.51 ? 201 CYS B C      1 
ATOM   4538 O O      . CYS B 2 197 ? 4.221   -3.270  9.134   1.00  17.46 ? 201 CYS B O      1 
ATOM   4539 C CB     . CYS B 2 197 ? 5.361   -6.006  10.162  1.00  16.91 ? 201 CYS B CB     1 
ATOM   4540 S SG     . CYS B 2 197 ? 6.050   -6.919  11.564  1.00  16.74 ? 201 CYS B SG     1 
ATOM   4541 H H      . CYS B 2 197 ? 5.262   -3.511  11.433  1.00  14.75 ? 201 CYS B H      1 
ATOM   4542 H HA     . CYS B 2 197 ? 7.042   -4.851  9.434   1.00  16.07 ? 201 CYS B HA     1 
ATOM   4543 H HB2    . CYS B 2 197 ? 4.326   -5.799  10.391  1.00  16.63 ? 201 CYS B HB2    1 
ATOM   4544 H HB3    . CYS B 2 197 ? 5.362   -6.646  9.293   1.00  16.84 ? 201 CYS B HB3    1 
ATOM   4545 N N      . GLU B 2 198 ? 5.599   -4.018  7.544   1.00  17.83 ? 202 GLU B N      1 
ATOM   4546 C CA     . GLU B 2 198 ? 4.913   -3.320  6.404   1.00  19.36 ? 202 GLU B CA     1 
ATOM   4547 C C      . GLU B 2 198 ? 4.006   -4.302  5.629   1.00  19.97 ? 202 GLU B C      1 
ATOM   4548 O O      . GLU B 2 198 ? 4.377   -5.438  5.386   1.00  18.10 ? 202 GLU B O      1 
ATOM   4549 C CB     . GLU B 2 198 ? 5.972   -2.757  5.424   1.00  19.44 ? 202 GLU B CB     1 
ATOM   4550 C CG     . GLU B 2 198 ? 5.355   -1.770  4.413   1.00  18.74 ? 202 GLU B CG     1 
ATOM   4551 C CD     . GLU B 2 198 ? 6.377   -1.330  3.368   1.00  22.26 ? 202 GLU B CD     1 
ATOM   4552 O OE1    . GLU B 2 198 ? 7.076   -2.200  2.894   1.00  27.28 ? 202 GLU B OE1    1 
ATOM   4553 O OE2    . GLU B 2 198 ? 6.406   -0.143  3.085   1.00  27.96 ? 202 GLU B OE2    1 
ATOM   4554 H H      . GLU B 2 198 ? 6.375   -4.582  7.358   1.00  17.78 ? 202 GLU B H      1 
ATOM   4555 H HA     . GLU B 2 198 ? 4.321   -2.515  6.813   1.00  19.65 ? 202 GLU B HA     1 
ATOM   4556 H HB2    . GLU B 2 198 ? 6.752   -2.254  5.977   1.00  19.75 ? 202 GLU B HB2    1 
ATOM   4557 H HB3    . GLU B 2 198 ? 6.410   -3.585  4.885   1.00  18.99 ? 202 GLU B HB3    1 
ATOM   4558 H HG2    . GLU B 2 198 ? 4.516   -2.207  3.892   1.00  20.32 ? 202 GLU B HG2    1 
ATOM   4559 H HG3    . GLU B 2 198 ? 5.013   -0.894  4.945   1.00  20.04 ? 202 GLU B HG3    1 
ATOM   4560 N N      . ASP B 2 199 ? 2.844   -3.819  5.269   1.00  18.10 ? 203 ASP B N      1 
ATOM   4561 C CA     . ASP B 2 199 ? 1.888   -4.668  4.510   1.00  17.53 ? 203 ASP B CA     1 
ATOM   4562 C C      . ASP B 2 199 ? 1.102   -3.749  3.560   1.00  17.99 ? 203 ASP B C      1 
ATOM   4563 O O      . ASP B 2 199 ? 1.132   -2.535  3.720   1.00  15.09 ? 203 ASP B O      1 
ATOM   4564 C CB     . ASP B 2 199 ? 0.922   -5.394  5.496   1.00  15.54 ? 203 ASP B CB     1 
ATOM   4565 C CG     . ASP B 2 199 ? -0.101  -4.472  6.205   1.00  15.07 ? 203 ASP B CG     1 
ATOM   4566 O OD1    . ASP B 2 199 ? -0.810  -3.717  5.567   1.00  15.79 ? 203 ASP B OD1    1 
ATOM   4567 O OD2    . ASP B 2 199 ? -0.132  -4.584  7.403   1.00  17.68 ? 203 ASP B OD2    1 
ATOM   4568 H H      . ASP B 2 199 ? 2.587   -2.894  5.486   1.00  18.84 ? 203 ASP B H      1 
ATOM   4569 H HA     . ASP B 2 199 ? 2.445   -5.390  3.930   1.00  18.27 ? 203 ASP B HA     1 
ATOM   4570 H HB2    . ASP B 2 199 ? 0.385   -6.161  4.957   1.00  16.74 ? 203 ASP B HB2    1 
ATOM   4571 H HB3    . ASP B 2 199 ? 1.511   -5.904  6.243   1.00  16.49 ? 203 ASP B HB3    1 
ATOM   4572 N N      . SER B 2 200 ? 0.421   -4.349  2.623   1.00  17.77 ? 204 SER B N      1 
ATOM   4573 C CA     . SER B 2 200 ? -0.402  -3.589  1.625   1.00  21.19 ? 204 SER B CA     1 
ATOM   4574 C C      . SER B 2 200 ? -1.905  -4.041  1.660   1.00  20.94 ? 204 SER B C      1 
ATOM   4575 O O      . SER B 2 200 ? -2.574  -3.955  0.635   1.00  21.04 ? 204 SER B O      1 
ATOM   4576 C CB     . SER B 2 200 ? 0.180   -3.853  0.255   1.00  21.37 ? 204 SER B CB     1 
ATOM   4577 O OG     . SER B 2 200 ? 1.523   -3.399  0.351   1.00  29.90 ? 204 SER B OG     1 
ATOM   4578 H H      . SER B 2 200 ? 0.451   -5.325  2.553   1.00  18.01 ? 204 SER B H      1 
ATOM   4579 H HA     . SER B 2 200 ? -0.347  -2.530  1.837   1.00  20.07 ? 204 SER B HA     1 
ATOM   4580 H HB2    . SER B 2 200 ? 0.166   -4.907  0.012   1.00  22.20 ? 204 SER B HB2    1 
ATOM   4581 H HB3    . SER B 2 200 ? -0.340  -3.283  -0.504  1.00  23.78 ? 204 SER B HB3    1 
ATOM   4582 H HG     . SER B 2 200 ? 1.728   -2.901  -0.454  1.00  26.98 ? 204 SER B HG     1 
ATOM   4583 N N      . ILE B 2 201 ? -2.389  -4.472  2.815   1.00  19.49 ? 205 ILE B N      1 
ATOM   4584 C CA     . ILE B 2 201 ? -3.812  -4.936  2.921   1.00  21.84 ? 205 ILE B CA     1 
ATOM   4585 C C      . ILE B 2 201 ? -4.792  -3.783  2.787   1.00  20.69 ? 205 ILE B C      1 
ATOM   4586 O O      . ILE B 2 201 ? -5.953  -4.050  2.542   1.00  19.12 ? 205 ILE B O      1 
ATOM   4587 C CB     . ILE B 2 201 ? -4.090  -5.665  4.272   1.00  20.11 ? 205 ILE B CB     1 
ATOM   4588 C CG1    . ILE B 2 201 ? -4.053  -4.730  5.465   1.00  18.70 ? 205 ILE B CG1    1 
ATOM   4589 C CG2    . ILE B 2 201 ? -3.120  -6.871  4.391   1.00  22.52 ? 205 ILE B CG2    1 
ATOM   4590 C CD1    . ILE B 2 201 ? -4.508  -5.443  6.770   1.00  21.16 ? 205 ILE B CD1    1 
ATOM   4591 H H      . ILE B 2 201 ? -1.824  -4.485  3.613   1.00  19.86 ? 205 ILE B H      1 
ATOM   4592 H HA     . ILE B 2 201 ? -3.999  -5.630  2.112   1.00  20.82 ? 205 ILE B HA     1 
ATOM   4593 H HB     . ILE B 2 201 ? -5.091  -6.069  4.203   1.00  21.50 ? 205 ILE B HB     1 
ATOM   4594 H HG12   . ILE B 2 201 ? -3.077  -4.303  5.590   1.00  20.13 ? 205 ILE B HG12   1 
ATOM   4595 H HG13   . ILE B 2 201 ? -4.741  -3.908  5.309   1.00  19.80 ? 205 ILE B HG13   1 
ATOM   4596 H HG21   . ILE B 2 201 ? -2.084  -6.577  4.384   1.00  21.90 ? 205 ILE B HG21   1 
ATOM   4597 H HG22   . ILE B 2 201 ? -3.285  -7.542  3.559   1.00  20.73 ? 205 ILE B HG22   1 
ATOM   4598 H HG23   . ILE B 2 201 ? -3.314  -7.419  5.300   1.00  21.58 ? 205 ILE B HG23   1 
ATOM   4599 H HD11   . ILE B 2 201 ? -4.486  -4.732  7.584   1.00  19.35 ? 205 ILE B HD11   1 
ATOM   4600 H HD12   . ILE B 2 201 ? -3.871  -6.276  7.022   1.00  20.24 ? 205 ILE B HD12   1 
ATOM   4601 H HD13   . ILE B 2 201 ? -5.521  -5.796  6.676   1.00  20.25 ? 205 ILE B HD13   1 
ATOM   4602 N N      . SER B 2 202 ? -4.333  -2.568  2.949   1.00  18.23 ? 206 SER B N      1 
ATOM   4603 C CA     . SER B 2 202 ? -5.270  -1.413  2.801   1.00  19.51 ? 206 SER B CA     1 
ATOM   4604 C C      . SER B 2 202 ? -5.026  -0.868  1.364   1.00  17.58 ? 206 SER B C      1 
ATOM   4605 O O      . SER B 2 202 ? -5.362  0.262   1.047   1.00  17.03 ? 206 SER B O      1 
ATOM   4606 C CB     . SER B 2 202 ? -4.933  -0.336  3.850   1.00  18.84 ? 206 SER B CB     1 
ATOM   4607 O OG     . SER B 2 202 ? -3.638  0.132   3.493   1.00  18.35 ? 206 SER B OG     1 
ATOM   4608 H H      . SER B 2 202 ? -3.396  -2.393  3.175   1.00  20.70 ? 206 SER B H      1 
ATOM   4609 H HA     . SER B 2 202 ? -6.295  -1.747  2.895   1.00  17.86 ? 206 SER B HA     1 
ATOM   4610 H HB2    . SER B 2 202 ? -5.638  0.481   3.816   1.00  19.04 ? 206 SER B HB2    1 
ATOM   4611 H HB3    . SER B 2 202 ? -4.923  -0.753  4.848   1.00  18.88 ? 206 SER B HB3    1 
ATOM   4612 H HG     . SER B 2 202 ? -3.060  -0.265  4.159   1.00  19.86 ? 206 SER B HG     1 
ATOM   4613 N N      . ARG B 2 203 ? -4.431  -1.712  0.552   1.00  19.20 ? 207 ARG B N      1 
ATOM   4614 C CA     . ARG B 2 203 ? -4.087  -1.434  -0.867  1.00  24.18 ? 207 ARG B CA     1 
ATOM   4615 C C      . ARG B 2 203 ? -2.937  -0.436  -0.976  1.00  28.22 ? 207 ARG B C      1 
ATOM   4616 O O      . ARG B 2 203 ? -2.599  -0.052  -2.066  1.00  32.43 ? 207 ARG B O      1 
ATOM   4617 C CB     . ARG B 2 203 ? -5.338  -0.858  -1.658  1.00  28.65 ? 207 ARG B CB     1 
ATOM   4618 C CG     . ARG B 2 203 ? -6.563  -1.791  -1.433  1.00  30.09 ? 207 ARG B CG     1 
ATOM   4619 C CD     . ARG B 2 203 ? -7.828  -1.201  -2.125  0.71  31.25 ? 207 ARG B CD     1 
ATOM   4620 N NE     . ARG B 2 203 ? -7.733  -1.507  -3.567  0.71  29.95 ? 207 ARG B NE     1 
ATOM   4621 C CZ     . ARG B 2 203 ? -8.270  -2.615  -4.000  0.71  32.32 ? 207 ARG B CZ     1 
ATOM   4622 N NH1    . ARG B 2 203 ? -9.460  -2.969  -3.609  0.71  32.22 ? 207 ARG B NH1    1 
ATOM   4623 N NH2    . ARG B 2 203 ? -7.577  -3.342  -4.818  0.71  33.61 ? 207 ARG B NH2    1 
ATOM   4624 H H      . ARG B 2 203 ? -4.188  -2.594  0.897   1.00  21.11 ? 207 ARG B H      1 
ATOM   4625 H HA     . ARG B 2 203 ? -3.753  -2.359  -1.312  1.00  23.60 ? 207 ARG B HA     1 
ATOM   4626 H HB2    . ARG B 2 203 ? -5.563  0.145   -1.312  1.00  27.52 ? 207 ARG B HB2    1 
ATOM   4627 H HB3    . ARG B 2 203 ? -5.098  -0.797  -2.711  1.00  27.26 ? 207 ARG B HB3    1 
ATOM   4628 H HG2    . ARG B 2 203 ? -6.354  -2.768  -1.847  1.00  29.78 ? 207 ARG B HG2    1 
ATOM   4629 H HG3    . ARG B 2 203 ? -6.769  -1.903  -0.379  1.00  29.97 ? 207 ARG B HG3    1 
ATOM   4630 H HD2    . ARG B 2 203 ? -8.746  -1.602  -1.714  0.71  30.86 ? 207 ARG B HD2    1 
ATOM   4631 H HD3    . ARG B 2 203 ? -7.852  -0.126  -2.025  0.71  30.87 ? 207 ARG B HD3    1 
ATOM   4632 H HE     . ARG B 2 203 ? -7.277  -0.894  -4.180  0.71  30.07 ? 207 ARG B HE     1 
ATOM   4633 H HH11   . ARG B 2 203 ? -9.886  -3.809  -3.942  0.71  31.96 ? 207 ARG B HH11   1 
ATOM   4634 H HH12   . ARG B 2 203 ? -9.938  -2.384  -2.966  0.71  31.94 ? 207 ARG B HH12   1 
ATOM   4635 H HH21   . ARG B 2 203 ? -6.662  -3.055  -5.103  0.71  33.60 ? 207 ARG B HH21   1 
ATOM   4636 H HH22   . ARG B 2 203 ? -7.970  -4.191  -5.157  0.71  34.07 ? 207 ARG B HH22   1 
ATOM   4637 N N      . THR B 2 204 ? -2.358  0.003   0.098   1.00  30.50 ? 208 THR B N      1 
ATOM   4638 C CA     . THR B 2 204 ? -1.216  0.970   0.034   1.00  30.11 ? 208 THR B CA     1 
ATOM   4639 C C      . THR B 2 204 ? -0.240  0.337   1.042   1.00  21.41 ? 208 THR B C      1 
ATOM   4640 O O      . THR B 2 204 ? -0.690  -0.114  2.078   1.00  18.79 ? 208 THR B O      1 
ATOM   4641 C CB     . THR B 2 204 ? -1.624  2.342   0.549   1.00  33.86 ? 208 THR B CB     1 
ATOM   4642 O OG1    . THR B 2 204 ? -2.867  2.638   -0.077  1.00  42.14 ? 208 THR B OG1    1 
ATOM   4643 C CG2    . THR B 2 204 ? -0.644  3.414   0.023   1.00  34.73 ? 208 THR B CG2    1 
ATOM   4644 H H      . THR B 2 204 ? -2.656  -0.285  0.987   1.00  30.65 ? 208 THR B H      1 
ATOM   4645 H HA     . THR B 2 204 ? -0.798  0.982   -0.962  1.00  28.70 ? 208 THR B HA     1 
ATOM   4646 H HB     . THR B 2 204 ? -1.732  2.366   1.627   1.00  34.19 ? 208 THR B HB     1 
ATOM   4647 H HG1    . THR B 2 204 ? -3.144  1.886   -0.621  1.00  40.06 ? 208 THR B HG1    1 
ATOM   4648 H HG21   . THR B 2 204 ? -0.953  4.391   0.366   1.00  34.53 ? 208 THR B HG21   1 
ATOM   4649 H HG22   . THR B 2 204 ? -0.618  3.422   -1.057  1.00  34.15 ? 208 THR B HG22   1 
ATOM   4650 H HG23   . THR B 2 204 ? 0.357   3.232   0.384   1.00  34.37 ? 208 THR B HG23   1 
ATOM   4651 N N      . PRO B 2 205 A 1.030   0.291   0.770   1.00  22.75 ? 208 PRO B N      1 
ATOM   4652 C CA     . PRO B 2 205 A 1.998   -0.134  1.804   1.00  20.51 ? 208 PRO B CA     1 
ATOM   4653 C C      . PRO B 2 205 A 2.003   0.802   3.004   1.00  17.29 ? 208 PRO B C      1 
ATOM   4654 O O      . PRO B 2 205 A 2.169   2.007   2.861   1.00  21.66 ? 208 PRO B O      1 
ATOM   4655 C CB     . PRO B 2 205 A 3.313   -0.191  1.078   1.00  21.00 ? 208 PRO B CB     1 
ATOM   4656 C CG     . PRO B 2 205 A 3.158   0.771   -0.105  1.00  23.83 ? 208 PRO B CG     1 
ATOM   4657 C CD     . PRO B 2 205 A 1.681   0.621   -0.519  1.00  22.87 ? 208 PRO B CD     1 
ATOM   4658 H HA     . PRO B 2 205 A 1.739   -1.133  2.117   1.00  21.94 ? 208 PRO B HA     1 
ATOM   4659 H HB2    . PRO B 2 205 A 4.113   0.133   1.725   1.00  21.38 ? 208 PRO B HB2    1 
ATOM   4660 H HB3    . PRO B 2 205 A 3.513   -1.198  0.736   1.00  21.31 ? 208 PRO B HB3    1 
ATOM   4661 H HG2    . PRO B 2 205 A 3.405   1.787   0.169   1.00  23.35 ? 208 PRO B HG2    1 
ATOM   4662 H HG3    . PRO B 2 205 A 3.810   0.453   -0.907  1.00  23.08 ? 208 PRO B HG3    1 
ATOM   4663 H HD2    . PRO B 2 205 A 1.285   1.547   -0.912  1.00  23.23 ? 208 PRO B HD2    1 
ATOM   4664 H HD3    . PRO B 2 205 A 1.530   -0.189  -1.219  1.00  23.40 ? 208 PRO B HD3    1 
ATOM   4665 N N      . ARG B 2 206 B 1.816   0.243   4.153   1.00  17.30 ? 208 ARG B N      1 
ATOM   4666 C CA     . ARG B 2 206 B 1.806   1.009   5.419   1.00  17.18 ? 208 ARG B CA     1 
ATOM   4667 C C      . ARG B 2 206 B 2.597   0.183   6.454   1.00  17.97 ? 208 ARG B C      1 
ATOM   4668 O O      . ARG B 2 206 B 2.593   -1.041  6.407   1.00  15.74 ? 208 ARG B O      1 
ATOM   4669 C CB     . ARG B 2 206 B 0.413   1.188   6.017   1.00  15.31 ? 208 ARG B CB     1 
ATOM   4670 C CG     . ARG B 2 206 B -0.493  2.033   5.080   1.00  16.95 ? 208 ARG B CG     1 
ATOM   4671 C CD     . ARG B 2 206 B -1.884  2.272   5.744   1.00  17.19 ? 208 ARG B CD     1 
ATOM   4672 N NE     . ARG B 2 206 B -2.719  2.950   4.714   1.00  21.02 ? 208 ARG B NE     1 
ATOM   4673 C CZ     . ARG B 2 206 B -2.912  4.242   4.730   1.00  23.18 ? 208 ARG B CZ     1 
ATOM   4674 N NH1    . ARG B 2 206 B -2.219  5.012   5.527   1.00  21.53 ? 208 ARG B NH1    1 
ATOM   4675 N NH2    . ARG B 2 206 B -3.812  4.724   3.920   1.00  22.33 ? 208 ARG B NH2    1 
ATOM   4676 H H      . ARG B 2 206 B 1.676   -0.729  4.192   1.00  16.15 ? 208 ARG B H      1 
ATOM   4677 H HA     . ARG B 2 206 B 2.292   1.963   5.267   1.00  18.07 ? 208 ARG B HA     1 
ATOM   4678 H HB2    . ARG B 2 206 B -0.017  0.213   6.203   1.00  14.74 ? 208 ARG B HB2    1 
ATOM   4679 H HB3    . ARG B 2 206 B 0.508   1.689   6.971   1.00  14.71 ? 208 ARG B HB3    1 
ATOM   4680 H HG2    . ARG B 2 206 B -0.026  2.991   4.903   1.00  15.68 ? 208 ARG B HG2    1 
ATOM   4681 H HG3    . ARG B 2 206 B -0.619  1.530   4.131   1.00  16.41 ? 208 ARG B HG3    1 
ATOM   4682 H HD2    . ARG B 2 206 B -2.363  1.346   6.023   1.00  17.16 ? 208 ARG B HD2    1 
ATOM   4683 H HD3    . ARG B 2 206 B -1.810  2.897   6.626   1.00  18.51 ? 208 ARG B HD3    1 
ATOM   4684 H HE     . ARG B 2 206 B -3.135  2.416   4.006   1.00  20.44 ? 208 ARG B HE     1 
ATOM   4685 H HH11   . ARG B 2 206 B -2.379  5.995   5.530   1.00  21.41 ? 208 ARG B HH11   1 
ATOM   4686 H HH12   . ARG B 2 206 B -1.533  4.614   6.131   1.00  21.72 ? 208 ARG B HH12   1 
ATOM   4687 H HH21   . ARG B 2 206 B -4.322  4.106   3.325   1.00  22.55 ? 208 ARG B HH21   1 
ATOM   4688 H HH22   . ARG B 2 206 B -3.991  5.709   3.893   1.00  22.52 ? 208 ARG B HH22   1 
ATOM   4689 N N      . TRP B 2 207 C 3.229   0.894   7.351   1.00  18.18 ? 208 TRP B N      1 
ATOM   4690 C CA     . TRP B 2 207 C 4.022   0.250   8.435   1.00  15.21 ? 208 TRP B CA     1 
ATOM   4691 C C      . TRP B 2 207 C 3.074   0.238   9.618   1.00  15.07 ? 208 TRP B C      1 
ATOM   4692 O O      . TRP B 2 207 C 2.399   1.228   9.901   1.00  14.53 ? 208 TRP B O      1 
ATOM   4693 C CB     . TRP B 2 207 C 5.271   1.083   8.849   1.00  11.70 ? 208 TRP B CB     1 
ATOM   4694 C CG     . TRP B 2 207 C 6.278   1.065   7.711   1.00  12.93 ? 208 TRP B CG     1 
ATOM   4695 C CD1    . TRP B 2 207 C 6.401   1.947   6.679   1.00  15.60 ? 208 TRP B CD1    1 
ATOM   4696 C CD2    . TRP B 2 207 C 7.206   0.102   7.575   1.00  12.84 ? 208 TRP B CD2    1 
ATOM   4697 N NE1    . TRP B 2 207 C 7.408   1.444   5.983   1.00  16.32 ? 208 TRP B NE1    1 
ATOM   4698 C CE2    . TRP B 2 207 C 7.962   0.331   6.443   1.00  14.43 ? 208 TRP B CE2    1 
ATOM   4699 C CE3    . TRP B 2 207 C 7.462   -0.972  8.407   1.00  14.22 ? 208 TRP B CE3    1 
ATOM   4700 C CZ2    . TRP B 2 207 C 8.994   -0.528  6.135   1.00  18.36 ? 208 TRP B CZ2    1 
ATOM   4701 C CZ3    . TRP B 2 207 C 8.506   -1.840  8.104   1.00  16.83 ? 208 TRP B CZ3    1 
ATOM   4702 C CH2    . TRP B 2 207 C 9.271   -1.616  6.967   1.00  17.36 ? 208 TRP B CH2    1 
ATOM   4703 H H      . TRP B 2 207 C 3.179   1.871   7.312   1.00  17.95 ? 208 TRP B H      1 
ATOM   4704 H HA     . TRP B 2 207 C 4.283   -0.764  8.160   1.00  16.19 ? 208 TRP B HA     1 
ATOM   4705 H HB2    . TRP B 2 207 C 5.005   2.101   9.078   1.00  12.69 ? 208 TRP B HB2    1 
ATOM   4706 H HB3    . TRP B 2 207 C 5.715   0.646   9.731   1.00  12.03 ? 208 TRP B HB3    1 
ATOM   4707 H HD1    . TRP B 2 207 C 5.825   2.841   6.481   1.00  15.35 ? 208 TRP B HD1    1 
ATOM   4708 H HE1    . TRP B 2 207 C 7.736   1.876   5.166   1.00  14.91 ? 208 TRP B HE1    1 
ATOM   4709 H HE3    . TRP B 2 207 C 6.858   -1.139  9.284   1.00  13.82 ? 208 TRP B HE3    1 
ATOM   4710 H HZ2    . TRP B 2 207 C 9.589   -0.363  5.248   1.00  16.62 ? 208 TRP B HZ2    1 
ATOM   4711 H HZ3    . TRP B 2 207 C 8.722   -2.680  8.753   1.00  16.68 ? 208 TRP B HZ3    1 
ATOM   4712 H HH2    . TRP B 2 207 C 10.085  -2.282  6.727   1.00  17.07 ? 208 TRP B HH2    1 
ATOM   4713 N N      . ARG B 2 208 D 3.040   -0.881  10.277  1.00  12.11 ? 208 ARG B N      1 
ATOM   4714 C CA     . ARG B 2 208 D 2.163   -1.031  11.469  1.00  12.97 ? 208 ARG B CA     1 
ATOM   4715 C C      . ARG B 2 208 D 3.018   -1.473  12.656  1.00  12.64 ? 208 ARG B C      1 
ATOM   4716 O O      . ARG B 2 208 D 3.992   -2.181  12.480  1.00  14.95 ? 208 ARG B O      1 
ATOM   4717 C CB     . ARG B 2 208 D 1.019   -2.145  11.241  1.00  15.61 ? 208 ARG B CB     1 
ATOM   4718 C CG     . ARG B 2 208 D 0.267   -1.880  9.924   1.00  16.67 ? 208 ARG B CG     1 
ATOM   4719 C CD     . ARG B 2 208 D -1.008  -2.756  9.878   1.00  17.49 ? 208 ARG B CD     1 
ATOM   4720 N NE     . ARG B 2 208 D -1.613  -2.546  8.549   1.00  17.90 ? 208 ARG B NE     1 
ATOM   4721 C CZ     . ARG B 2 208 D -2.724  -1.913  8.365   1.00  18.32 ? 208 ARG B CZ     1 
ATOM   4722 N NH1    . ARG B 2 208 D -3.354  -1.367  9.353   1.00  18.81 ? 208 ARG B NH1    1 
ATOM   4723 N NH2    . ARG B 2 208 D -3.165  -1.849  7.147   1.00  15.64 ? 208 ARG B NH2    1 
ATOM   4724 H H      . ARG B 2 208 D 3.599   -1.637  9.993   1.00  13.69 ? 208 ARG B H      1 
ATOM   4725 H HA     . ARG B 2 208 D 1.732   -0.067  11.708  1.00  14.21 ? 208 ARG B HA     1 
ATOM   4726 H HB2    . ARG B 2 208 D 1.460   -3.133  11.216  1.00  14.79 ? 208 ARG B HB2    1 
ATOM   4727 H HB3    . ARG B 2 208 D 0.328   -2.117  12.075  1.00  14.76 ? 208 ARG B HB3    1 
ATOM   4728 H HG2    . ARG B 2 208 D -0.024  -0.842  9.858   1.00  16.48 ? 208 ARG B HG2    1 
ATOM   4729 H HG3    . ARG B 2 208 D 0.909   -2.106  9.083   1.00  16.12 ? 208 ARG B HG3    1 
ATOM   4730 H HD2    . ARG B 2 208 D -0.788  -3.811  9.984   1.00  17.58 ? 208 ARG B HD2    1 
ATOM   4731 H HD3    . ARG B 2 208 D -1.703  -2.469  10.648  1.00  18.29 ? 208 ARG B HD3    1 
ATOM   4732 H HE     . ARG B 2 208 D -1.159  -2.895  7.756   1.00  18.47 ? 208 ARG B HE     1 
ATOM   4733 H HH11   . ARG B 2 208 D -4.208  -0.880  9.179   1.00  20.90 ? 208 ARG B HH11   1 
ATOM   4734 H HH12   . ARG B 2 208 D -3.001  -1.423  10.284  1.00  20.13 ? 208 ARG B HH12   1 
ATOM   4735 H HH21   . ARG B 2 208 D -2.663  -2.297  6.405   1.00  16.88 ? 208 ARG B HH21   1 
ATOM   4736 H HH22   . ARG B 2 208 D -4.004  -1.348  6.952   1.00  17.18 ? 208 ARG B HH22   1 
ATOM   4737 N N      . LEU B 2 209 ? 2.595   -1.075  13.803  1.00  13.60 ? 209 LEU B N      1 
ATOM   4738 C CA     . LEU B 2 209 ? 3.267   -1.386  15.085  1.00  14.04 ? 209 LEU B CA     1 
ATOM   4739 C C      . LEU B 2 209 ? 2.747   -2.744  15.555  1.00  15.03 ? 209 LEU B C      1 
ATOM   4740 O O      . LEU B 2 209 ? 1.666   -2.813  16.107  1.00  16.38 ? 209 LEU B O      1 
ATOM   4741 C CB     . LEU B 2 209 ? 2.910   -0.309  16.082  1.00  14.57 ? 209 LEU B CB     1 
ATOM   4742 C CG     . LEU B 2 209 ? 3.653   -0.441  17.423  1.00  14.50 ? 209 LEU B CG     1 
ATOM   4743 C CD1    . LEU B 2 209 ? 5.169   -0.256  17.209  1.00  13.59 ? 209 LEU B CD1    1 
ATOM   4744 C CD2    . LEU B 2 209 ? 3.129   0.594   18.460  1.00  15.88 ? 209 LEU B CD2    1 
ATOM   4745 H H      . LEU B 2 209 ? 1.777   -0.536  13.826  1.00  14.79 ? 209 LEU B H      1 
ATOM   4746 H HA     . LEU B 2 209 ? 4.329   -1.441  14.916  1.00  14.41 ? 209 LEU B HA     1 
ATOM   4747 H HB2    . LEU B 2 209 ? 3.118   0.653   15.639  1.00  15.38 ? 209 LEU B HB2    1 
ATOM   4748 H HB3    . LEU B 2 209 ? 1.844   -0.371  16.262  1.00  15.60 ? 209 LEU B HB3    1 
ATOM   4749 H HG     . LEU B 2 209 ? 3.489   -1.428  17.828  1.00  15.70 ? 209 LEU B HG     1 
ATOM   4750 H HD11   . LEU B 2 209 ? 5.396   0.708   16.780  1.00  12.68 ? 209 LEU B HD11   1 
ATOM   4751 H HD12   . LEU B 2 209 ? 5.580   -1.023  16.573  1.00  13.26 ? 209 LEU B HD12   1 
ATOM   4752 H HD13   . LEU B 2 209 ? 5.646   -0.332  18.177  1.00  13.28 ? 209 LEU B HD13   1 
ATOM   4753 H HD21   . LEU B 2 209 ? 3.681   0.485   19.386  1.00  15.44 ? 209 LEU B HD21   1 
ATOM   4754 H HD22   . LEU B 2 209 ? 2.082   0.427   18.661  1.00  15.09 ? 209 LEU B HD22   1 
ATOM   4755 H HD23   . LEU B 2 209 ? 3.250   1.608   18.112  1.00  15.21 ? 209 LEU B HD23   1 
ATOM   4756 N N      . CYS B 2 210 ? 3.540   -3.763  15.311  1.00  14.48 ? 210 CYS B N      1 
ATOM   4757 C CA     . CYS B 2 210 ? 3.184   -5.163  15.703  1.00  15.65 ? 210 CYS B CA     1 
ATOM   4758 C C      . CYS B 2 210 ? 3.712   -5.526  17.080  1.00  15.76 ? 210 CYS B C      1 
ATOM   4759 O O      . CYS B 2 210 ? 3.149   -6.378  17.755  1.00  11.15 ? 210 CYS B O      1 
ATOM   4760 C CB     . CYS B 2 210 ? 3.740   -6.106  14.600  1.00  18.31 ? 210 CYS B CB     1 
ATOM   4761 S SG     . CYS B 2 210 ? 2.989   -5.842  12.970  1.00  20.34 ? 210 CYS B SG     1 
ATOM   4762 H H      . CYS B 2 210 ? 4.392   -3.586  14.853  1.00  15.32 ? 210 CYS B H      1 
ATOM   4763 H HA     . CYS B 2 210 ? 2.103   -5.229  15.734  1.00  17.44 ? 210 CYS B HA     1 
ATOM   4764 H HB2    . CYS B 2 210 ? 4.804   -5.958  14.494  1.00  18.46 ? 210 CYS B HB2    1 
ATOM   4765 H HB3    . CYS B 2 210 ? 3.587   -7.135  14.889  1.00  17.47 ? 210 CYS B HB3    1 
ATOM   4766 H HG     . CYS B 2 210 ? 2.163   -6.330  12.956  1.00  20.01 ? 210 CYS B HG     1 
ATOM   4767 N N      . GLY B 2 211 ? 4.790   -4.891  17.467  1.00  15.85 ? 211 GLY B N      1 
ATOM   4768 C CA     . GLY B 2 211 ? 5.347   -5.181  18.793  1.00  16.01 ? 211 GLY B CA     1 
ATOM   4769 C C      . GLY B 2 211 ? 5.957   -3.926  19.425  1.00  14.98 ? 211 GLY B C      1 
ATOM   4770 O O      . GLY B 2 211 ? 6.202   -2.955  18.730  1.00  12.89 ? 211 GLY B O      1 
ATOM   4771 H H      . GLY B 2 211 ? 5.228   -4.223  16.894  1.00  16.47 ? 211 GLY B H      1 
ATOM   4772 H HA2    . GLY B 2 211 ? 4.564   -5.553  19.430  1.00  15.76 ? 211 GLY B HA2    1 
ATOM   4773 H HA3    . GLY B 2 211 ? 6.112   -5.935  18.690  1.00  16.55 ? 211 GLY B HA3    1 
ATOM   4774 N N      . ILE B 2 212 ? 6.167   -4.039  20.710  1.00  14.97 ? 212 ILE B N      1 
ATOM   4775 C CA     . ILE B 2 212 ? 6.771   -2.969  21.541  1.00  14.83 ? 212 ILE B CA     1 
ATOM   4776 C C      . ILE B 2 212 ? 7.984   -3.692  22.177  1.00  15.72 ? 212 ILE B C      1 
ATOM   4777 O O      . ILE B 2 212 ? 7.804   -4.755  22.771  1.00  13.50 ? 212 ILE B O      1 
ATOM   4778 C CB     . ILE B 2 212 ? 5.843   -2.495  22.687  1.00  16.62 ? 212 ILE B CB     1 
ATOM   4779 C CG1    . ILE B 2 212 ? 4.529   -1.865  22.097  1.00  17.16 ? 212 ILE B CG1    1 
ATOM   4780 C CG2    . ILE B 2 212 ? 6.598   -1.416  23.500  1.00  14.19 ? 212 ILE B CG2    1 
ATOM   4781 C CD1    . ILE B 2 212 ? 3.506   -1.664  23.209  1.00  20.59 ? 212 ILE B CD1    1 
ATOM   4782 H H      . ILE B 2 212 ? 5.917   -4.872  21.160  1.00  15.73 ? 212 ILE B H      1 
ATOM   4783 H HA     . ILE B 2 212 ? 7.097   -2.153  20.907  1.00  15.29 ? 212 ILE B HA     1 
ATOM   4784 H HB     . ILE B 2 212 ? 5.631   -3.313  23.357  1.00  15.66 ? 212 ILE B HB     1 
ATOM   4785 H HG12   . ILE B 2 212 ? 4.738   -0.919  21.611  1.00  17.13 ? 212 ILE B HG12   1 
ATOM   4786 H HG13   . ILE B 2 212 ? 4.109   -2.524  21.350  1.00  18.34 ? 212 ILE B HG13   1 
ATOM   4787 H HG21   . ILE B 2 212 ? 6.859   -0.576  22.872  1.00  13.63 ? 212 ILE B HG21   1 
ATOM   4788 H HG22   . ILE B 2 212 ? 7.504   -1.828  23.916  1.00  13.66 ? 212 ILE B HG22   1 
ATOM   4789 H HG23   . ILE B 2 212 ? 5.974   -1.074  24.310  1.00  13.99 ? 212 ILE B HG23   1 
ATOM   4790 H HD11   . ILE B 2 212 ? 2.612   -1.226  22.791  1.00  20.64 ? 212 ILE B HD11   1 
ATOM   4791 H HD12   . ILE B 2 212 ? 3.875   -0.990  23.970  1.00  20.81 ? 212 ILE B HD12   1 
ATOM   4792 H HD13   . ILE B 2 212 ? 3.246   -2.605  23.675  1.00  19.56 ? 212 ILE B HD13   1 
ATOM   4793 N N      . VAL B 2 213 ? 9.152   -3.108  22.030  1.00  13.66 ? 213 VAL B N      1 
ATOM   4794 C CA     . VAL B 2 213 ? 10.400  -3.695  22.611  1.00  12.56 ? 213 VAL B CA     1 
ATOM   4795 C C      . VAL B 2 213 ? 10.132  -3.819  24.124  1.00  13.46 ? 213 VAL B C      1 
ATOM   4796 O O      . VAL B 2 213 ? 9.882   -2.821  24.791  1.00  13.46 ? 213 VAL B O      1 
ATOM   4797 C CB     . VAL B 2 213 ? 11.548  -2.747  22.366  1.00  11.10 ? 213 VAL B CB     1 
ATOM   4798 C CG1    . VAL B 2 213 ? 12.848  -3.372  22.922  1.00  13.28 ? 213 VAL B CG1    1 
ATOM   4799 C CG2    . VAL B 2 213 ? 11.738  -2.517  20.869  1.00  12.87 ? 213 VAL B CG2    1 
ATOM   4800 H H      . VAL B 2 213 ? 9.196   -2.263  21.531  1.00  13.88 ? 213 VAL B H      1 
ATOM   4801 H HA     . VAL B 2 213 ? 10.567  -4.673  22.187  1.00  13.64 ? 213 VAL B HA     1 
ATOM   4802 H HB     . VAL B 2 213 ? 11.333  -1.818  22.869  1.00  12.33 ? 213 VAL B HB     1 
ATOM   4803 H HG11   . VAL B 2 213 ? 13.067  -4.315  22.444  1.00  12.02 ? 213 VAL B HG11   1 
ATOM   4804 H HG12   . VAL B 2 213 ? 12.737  -3.555  23.981  1.00  10.90 ? 213 VAL B HG12   1 
ATOM   4805 H HG13   . VAL B 2 213 ? 13.688  -2.714  22.773  1.00  12.48 ? 213 VAL B HG13   1 
ATOM   4806 H HG21   . VAL B 2 213 ? 12.538  -1.815  20.685  1.00  12.83 ? 213 VAL B HG21   1 
ATOM   4807 H HG22   . VAL B 2 213 ? 10.840  -2.123  20.418  1.00  12.94 ? 213 VAL B HG22   1 
ATOM   4808 H HG23   . VAL B 2 213 ? 11.988  -3.442  20.384  1.00  12.91 ? 213 VAL B HG23   1 
ATOM   4809 N N      . SER B 2 214 ? 10.187  -5.027  24.640  1.00  13.14 ? 214 SER B N      1 
ATOM   4810 C CA     . SER B 2 214 ? 9.937   -5.253  26.093  1.00  16.16 ? 214 SER B CA     1 
ATOM   4811 C C      . SER B 2 214 ? 11.164  -5.810  26.919  1.00  17.71 ? 214 SER B C      1 
ATOM   4812 O O      . SER B 2 214 ? 11.553  -5.179  27.886  1.00  16.52 ? 214 SER B O      1 
ATOM   4813 C CB     . SER B 2 214 ? 8.704   -6.218  26.171  1.00  14.31 ? 214 SER B CB     1 
ATOM   4814 O OG     . SER B 2 214 ? 8.362   -6.391  27.546  1.00  16.19 ? 214 SER B OG     1 
ATOM   4815 H H      . SER B 2 214 ? 10.396  -5.789  24.060  1.00  15.29 ? 214 SER B H      1 
ATOM   4816 H HA     . SER B 2 214 ? 9.644   -4.305  26.522  1.00  16.05 ? 214 SER B HA     1 
ATOM   4817 H HB2    . SER B 2 214 ? 7.859   -5.784  25.651  1.00  15.65 ? 214 SER B HB2    1 
ATOM   4818 H HB3    . SER B 2 214 ? 8.933   -7.182  25.732  1.00  15.44 ? 214 SER B HB3    1 
ATOM   4819 H HG     . SER B 2 214 ? 9.022   -5.981  28.121  1.00  15.37 ? 214 SER B HG     1 
ATOM   4820 N N      . TRP B 2 215 ? 11.730  -6.931  26.568  1.00  15.58 ? 215 TRP B N      1 
ATOM   4821 C CA     . TRP B 2 215 ? 12.863  -7.452  27.350  1.00  18.31 ? 215 TRP B CA     1 
ATOM   4822 C C      . TRP B 2 215 ? 13.646  -8.527  26.599  1.00  20.09 ? 215 TRP B C      1 
ATOM   4823 O O      . TRP B 2 215 ? 13.353  -8.851  25.465  1.00  16.87 ? 215 TRP B O      1 
ATOM   4824 C CB     . TRP B 2 215 ? 12.328  -8.030  28.700  1.00  20.31 ? 215 TRP B CB     1 
ATOM   4825 C CG     . TRP B 2 215 ? 11.311  -9.194  28.594  1.00  25.63 ? 215 TRP B CG     1 
ATOM   4826 C CD1    . TRP B 2 215 ? 9.972   -9.038  28.386  1.00  26.80 ? 215 TRP B CD1    1 
ATOM   4827 C CD2    . TRP B 2 215 ? 11.575  -10.538 28.713  1.00  30.07 ? 215 TRP B CD2    1 
ATOM   4828 N NE1    . TRP B 2 215 ? 9.500   -10.268 28.389  1.00  26.83 ? 215 TRP B NE1    1 
ATOM   4829 C CE2    . TRP B 2 215 ? 10.369  -11.256 28.578  1.00  30.33 ? 215 TRP B CE2    1 
ATOM   4830 C CE3    . TRP B 2 215 ? 12.779  -11.253 28.932  1.00  32.60 ? 215 TRP B CE3    1 
ATOM   4831 C CZ2    . TRP B 2 215 ? 10.382  -12.657 28.666  1.00  32.70 ? 215 TRP B CZ2    1 
ATOM   4832 C CZ3    . TRP B 2 215 ? 12.787  -12.655 29.019  1.00  32.07 ? 215 TRP B CZ3    1 
ATOM   4833 C CH2    . TRP B 2 215 ? 11.588  -13.350 28.886  1.00  32.07 ? 215 TRP B CH2    1 
ATOM   4834 H H      . TRP B 2 215 ? 11.426  -7.443  25.786  1.00  16.38 ? 215 TRP B H      1 
ATOM   4835 H HA     . TRP B 2 215 ? 13.533  -6.628  27.542  1.00  19.51 ? 215 TRP B HA     1 
ATOM   4836 H HB2    . TRP B 2 215 ? 13.157  -8.369  29.302  1.00  21.87 ? 215 TRP B HB2    1 
ATOM   4837 H HB3    . TRP B 2 215 ? 11.849  -7.241  29.257  1.00  21.38 ? 215 TRP B HB3    1 
ATOM   4838 H HD1    . TRP B 2 215 ? 9.426   -8.126  28.254  1.00  26.59 ? 215 TRP B HD1    1 
ATOM   4839 H HE1    . TRP B 2 215 ? 8.540   -10.425 28.243  1.00  27.33 ? 215 TRP B HE1    1 
ATOM   4840 H HE3    . TRP B 2 215 ? 13.711  -10.720 29.035  1.00  32.02 ? 215 TRP B HE3    1 
ATOM   4841 H HZ2    . TRP B 2 215 ? 9.459   -13.212 28.564  1.00  31.38 ? 215 TRP B HZ2    1 
ATOM   4842 H HZ3    . TRP B 2 215 ? 13.711  -13.192 29.184  1.00  31.13 ? 215 TRP B HZ3    1 
ATOM   4843 H HH2    . TRP B 2 215 ? 11.590  -14.430 28.950  1.00  32.23 ? 215 TRP B HH2    1 
ATOM   4844 N N      . GLY B 2 216 ? 14.639  -9.039  27.273  1.00  24.08 ? 216 GLY B N      1 
ATOM   4845 C CA     . GLY B 2 216 ? 15.500  -10.106 26.694  1.00  23.95 ? 216 GLY B CA     1 
ATOM   4846 C C      . GLY B 2 216 ? 16.641  -10.408 27.685  1.00  24.73 ? 216 GLY B C      1 
ATOM   4847 O O      . GLY B 2 216 ? 16.879  -9.599  28.568  1.00  22.43 ? 216 GLY B O      1 
ATOM   4848 H H      . GLY B 2 216 ? 14.847  -8.729  28.181  1.00  23.62 ? 216 GLY B H      1 
ATOM   4849 H HA2    . GLY B 2 216 ? 14.906  -10.993 26.516  1.00  24.14 ? 216 GLY B HA2    1 
ATOM   4850 H HA3    . GLY B 2 216 ? 15.907  -9.743  25.767  1.00  24.40 ? 216 GLY B HA3    1 
ATOM   4851 N N      . THR B 2 217 ? 17.300  -11.524 27.533  1.00  23.20 ? 217 THR B N      1 
ATOM   4852 C CA     . THR B 2 217 ? 18.419  -11.869 28.455  1.00  23.41 ? 217 THR B CA     1 
ATOM   4853 C C      . THR B 2 217 ? 19.646  -11.406 27.702  1.00  18.80 ? 217 THR B C      1 
ATOM   4854 O O      . THR B 2 217 ? 19.914  -11.931 26.630  1.00  25.04 ? 217 THR B O      1 
ATOM   4855 C CB     . THR B 2 217 ? 18.410  -13.422 28.703  1.00  24.25 ? 217 THR B CB     1 
ATOM   4856 O OG1    . THR B 2 217 ? 17.313  -13.602 29.597  1.00  25.66 ? 217 THR B OG1    1 
ATOM   4857 C CG2    . THR B 2 217 ? 19.671  -13.914 29.475  1.00  25.32 ? 217 THR B CG2    1 
ATOM   4858 H H      . THR B 2 217 ? 17.061  -12.144 26.807  1.00  23.20 ? 217 THR B H      1 
ATOM   4859 H HA     . THR B 2 217 ? 18.325  -11.311 29.376  1.00  23.05 ? 217 THR B HA     1 
ATOM   4860 H HB     . THR B 2 217 ? 18.254  -13.973 27.785  1.00  23.99 ? 217 THR B HB     1 
ATOM   4861 H HG1    . THR B 2 217 ? 17.048  -14.538 29.595  1.00  25.62 ? 217 THR B HG1    1 
ATOM   4862 H HG21   . THR B 2 217 ? 19.618  -14.979 29.648  1.00  25.46 ? 217 THR B HG21   1 
ATOM   4863 H HG22   . THR B 2 217 ? 19.763  -13.408 30.426  1.00  24.81 ? 217 THR B HG22   1 
ATOM   4864 H HG23   . THR B 2 217 ? 20.553  -13.713 28.885  1.00  24.40 ? 217 THR B HG23   1 
ATOM   4865 N N      . GLY B 2 218 ? 20.338  -10.447 28.280  1.00  20.46 ? 219 GLY B N      1 
ATOM   4866 C CA     . GLY B 2 218 ? 21.564  -9.884  27.656  1.00  18.63 ? 219 GLY B CA     1 
ATOM   4867 C C      . GLY B 2 218 ? 21.053  -9.272  26.359  1.00  19.99 ? 219 GLY B C      1 
ATOM   4868 O O      . GLY B 2 218 ? 19.892  -8.901  26.305  1.00  21.57 ? 219 GLY B O      1 
ATOM   4869 H H      . GLY B 2 218 ? 20.031  -10.098 29.141  1.00  18.29 ? 219 GLY B H      1 
ATOM   4870 H HA2    . GLY B 2 218 ? 21.995  -9.128  28.294  1.00  19.09 ? 219 GLY B HA2    1 
ATOM   4871 H HA3    . GLY B 2 218 ? 22.271  -10.675 27.447  1.00  18.67 ? 219 GLY B HA3    1 
ATOM   4872 N N      . CYS B 2 219 ? 21.898  -9.167  25.385  1.00  19.39 ? 220 CYS B N      1 
ATOM   4873 C CA     . CYS B 2 219 ? 21.493  -8.610  24.081  1.00  17.62 ? 220 CYS B CA     1 
ATOM   4874 C C      . CYS B 2 219 ? 22.287  -9.329  23.027  1.00  19.42 ? 220 CYS B C      1 
ATOM   4875 O O      . CYS B 2 219 ? 23.486  -9.479  23.180  1.00  18.75 ? 220 CYS B O      1 
ATOM   4876 C CB     . CYS B 2 219 ? 21.809  -7.123  23.954  1.00  15.91 ? 220 CYS B CB     1 
ATOM   4877 S SG     . CYS B 2 219 ? 21.077  -6.082  25.201  1.00  17.48 ? 220 CYS B SG     1 
ATOM   4878 H H      . CYS B 2 219 ? 22.827  -9.461  25.501  1.00  20.75 ? 220 CYS B H      1 
ATOM   4879 H HA     . CYS B 2 219 ? 20.439  -8.798  23.941  1.00  17.68 ? 220 CYS B HA     1 
ATOM   4880 H HB2    . CYS B 2 219 ? 22.875  -6.960  23.978  1.00  17.96 ? 220 CYS B HB2    1 
ATOM   4881 H HB3    . CYS B 2 219 ? 21.453  -6.772  22.999  1.00  17.16 ? 220 CYS B HB3    1 
ATOM   4882 N N      . ALA B 2 220 ? 21.604  -9.737  21.992  1.00  16.21 ? 221 ALA B N      1 
ATOM   4883 C CA     . ALA B 2 220 ? 22.111  -10.462 20.790  1.00  17.35 ? 221 ALA B CA     1 
ATOM   4884 C C      . ALA B 2 220 ? 22.798  -11.830 21.054  1.00  18.62 ? 221 ALA B C      1 
ATOM   4885 O O      . ALA B 2 220 ? 23.578  -12.266 20.238  1.00  20.70 ? 221 ALA B O      1 
ATOM   4886 C CB     . ALA B 2 220 ? 23.089  -9.552  20.019  1.00  17.05 ? 221 ALA B CB     1 
ATOM   4887 H H      . ALA B 2 220 ? 20.654  -9.540  22.043  1.00  19.51 ? 221 ALA B H      1 
ATOM   4888 H HA     . ALA B 2 220 ? 21.272  -10.647 20.138  1.00  17.26 ? 221 ALA B HA     1 
ATOM   4889 H HB1    . ALA B 2 220 ? 23.464  -10.064 19.146  1.00  17.08 ? 221 ALA B HB1    1 
ATOM   4890 H HB2    . ALA B 2 220 ? 23.935  -9.317  20.646  1.00  17.44 ? 221 ALA B HB2    1 
ATOM   4891 H HB3    . ALA B 2 220 ? 22.610  -8.638  19.705  1.00  16.72 ? 221 ALA B HB3    1 
ATOM   4892 N N      . LEU B 2 221 A 22.487  -12.468 22.143  1.00  21.89 ? 221 LEU B N      1 
ATOM   4893 C CA     . LEU B 2 221 A 23.111  -13.796 22.434  1.00  25.10 ? 221 LEU B CA     1 
ATOM   4894 C C      . LEU B 2 221 A 22.332  -14.827 21.588  1.00  27.21 ? 221 LEU B C      1 
ATOM   4895 O O      . LEU B 2 221 A 21.172  -14.631 21.244  1.00  22.31 ? 221 LEU B O      1 
ATOM   4896 C CB     . LEU B 2 221 A 22.924  -14.204 23.894  1.00  28.02 ? 221 LEU B CB     1 
ATOM   4897 C CG     . LEU B 2 221 A 23.877  -13.510 24.887  1.00  32.01 ? 221 LEU B CG     1 
ATOM   4898 C CD1    . LEU B 2 221 A 23.790  -11.989 24.727  1.00  36.61 ? 221 LEU B CD1    1 
ATOM   4899 C CD2    . LEU B 2 221 A 23.399  -13.856 26.306  1.00  34.70 ? 221 LEU B CD2    1 
ATOM   4900 H H      . LEU B 2 221 A 21.842  -12.086 22.777  1.00  21.95 ? 221 LEU B H      1 
ATOM   4901 H HA     . LEU B 2 221 A 24.148  -13.785 22.133  1.00  25.85 ? 221 LEU B HA     1 
ATOM   4902 H HB2    . LEU B 2 221 A 21.900  -14.000 24.166  1.00  27.58 ? 221 LEU B HB2    1 
ATOM   4903 H HB3    . LEU B 2 221 A 23.063  -15.277 23.951  1.00  28.25 ? 221 LEU B HB3    1 
ATOM   4904 H HG     . LEU B 2 221 A 24.893  -13.857 24.742  1.00  31.74 ? 221 LEU B HG     1 
ATOM   4905 H HD11   . LEU B 2 221 A 22.768  -11.647 24.826  1.00  35.94 ? 221 LEU B HD11   1 
ATOM   4906 H HD12   . LEU B 2 221 A 24.166  -11.695 23.756  1.00  35.64 ? 221 LEU B HD12   1 
ATOM   4907 H HD13   . LEU B 2 221 A 24.372  -11.496 25.488  1.00  36.02 ? 221 LEU B HD13   1 
ATOM   4908 H HD21   . LEU B 2 221 A 24.038  -13.384 27.040  1.00  34.54 ? 221 LEU B HD21   1 
ATOM   4909 H HD22   . LEU B 2 221 A 23.436  -14.925 26.465  1.00  34.20 ? 221 LEU B HD22   1 
ATOM   4910 H HD23   . LEU B 2 221 A 22.383  -13.520 26.463  1.00  33.90 ? 221 LEU B HD23   1 
ATOM   4911 N N      . ALA B 2 222 ? 22.972  -15.910 21.280  1.00  25.83 ? 222 ALA B N      1 
ATOM   4912 C CA     . ALA B 2 222 ? 22.280  -16.935 20.478  1.00  25.62 ? 222 ALA B CA     1 
ATOM   4913 C C      . ALA B 2 222 ? 21.282  -17.539 21.438  1.00  24.59 ? 222 ALA B C      1 
ATOM   4914 O O      . ALA B 2 222 ? 21.536  -17.647 22.624  1.00  22.19 ? 222 ALA B O      1 
ATOM   4915 C CB     . ALA B 2 222 ? 23.241  -18.013 20.037  1.00  29.50 ? 222 ALA B CB     1 
ATOM   4916 H H      . ALA B 2 222 ? 23.894  -16.045 21.583  1.00  27.64 ? 222 ALA B H      1 
ATOM   4917 H HA     . ALA B 2 222 ? 21.771  -16.463 19.648  1.00  26.73 ? 222 ALA B HA     1 
ATOM   4918 H HB1    . ALA B 2 222 ? 22.708  -18.763 19.471  1.00  28.80 ? 222 ALA B HB1    1 
ATOM   4919 H HB2    . ALA B 2 222 ? 23.675  -18.481 20.910  1.00  28.21 ? 222 ALA B HB2    1 
ATOM   4920 H HB3    . ALA B 2 222 ? 24.022  -17.590 19.423  1.00  28.52 ? 222 ALA B HB3    1 
ATOM   4921 N N      . GLN B 2 223 ? 20.178  -17.923 20.883  1.00  24.88 ? 223 GLN B N      1 
ATOM   4922 C CA     . GLN B 2 223 ? 19.042  -18.551 21.640  1.00  26.16 ? 223 GLN B CA     1 
ATOM   4923 C C      . GLN B 2 223 ? 18.366  -17.724 22.741  1.00  22.46 ? 223 GLN B C      1 
ATOM   4924 O O      . GLN B 2 223 ? 17.636  -18.251 23.553  1.00  22.69 ? 223 GLN B O      1 
ATOM   4925 C CB     . GLN B 2 223 ? 19.539  -19.897 22.210  0.86  29.27 ? 223 GLN B CB     1 
ATOM   4926 C CG     . GLN B 2 223 ? 20.260  -20.624 21.033  0.86  33.12 ? 223 GLN B CG     1 
ATOM   4927 C CD     . GLN B 2 223 ? 20.227  -22.100 21.316  0.86  37.67 ? 223 GLN B CD     1 
ATOM   4928 O OE1    . GLN B 2 223 ? 20.546  -22.569 22.386  0.86  39.52 ? 223 GLN B OE1    1 
ATOM   4929 N NE2    . GLN B 2 223 ? 19.839  -22.896 20.374  1.00  42.59 ? 223 GLN B NE2    1 
ATOM   4930 H H      . GLN B 2 223 ? 20.090  -17.792 19.914  1.00  24.39 ? 223 GLN B H      1 
ATOM   4931 H HA     . GLN B 2 223 ? 18.270  -18.782 20.922  1.00  26.53 ? 223 GLN B HA     1 
ATOM   4932 H HB2    . GLN B 2 223 ? 20.210  -19.740 23.040  0.86  29.56 ? 223 GLN B HB2    1 
ATOM   4933 H HB3    . GLN B 2 223 ? 18.701  -20.476 22.575  0.86  29.13 ? 223 GLN B HB3    1 
ATOM   4934 H HG2    . GLN B 2 223 ? 19.770  -20.431 20.090  0.86  32.91 ? 223 GLN B HG2    1 
ATOM   4935 H HG3    . GLN B 2 223 ? 21.291  -20.314 20.972  0.86  32.96 ? 223 GLN B HG3    1 
ATOM   4936 H HE21   . GLN B 2 223 ? 19.588  -22.541 19.494  1.00  41.24 ? 223 GLN B HE21   1 
ATOM   4937 H HE22   . GLN B 2 223 ? 19.807  -23.855 20.559  1.00  41.40 ? 223 GLN B HE22   1 
ATOM   4938 N N      . LYS B 2 224 ? 18.604  -16.440 22.755  1.00  23.21 ? 224 LYS B N      1 
ATOM   4939 C CA     . LYS B 2 224 ? 17.977  -15.509 23.764  1.00  22.74 ? 224 LYS B CA     1 
ATOM   4940 C C      . LYS B 2 224 ? 17.555  -14.258 22.922  1.00  23.16 ? 224 LYS B C      1 
ATOM   4941 O O      . LYS B 2 224 ? 18.136  -13.184 23.014  1.00  19.17 ? 224 LYS B O      1 
ATOM   4942 C CB     A LYS B 2 224 ? 18.983  -15.105 24.857  0.69  23.72 ? 224 LYS B CB     1 
ATOM   4943 C CB     B LYS B 2 224 ? 19.014  -15.119 24.837  0.20  21.83 ? 224 LYS B CB     1 
ATOM   4944 C CG     A LYS B 2 224 ? 19.301  -16.365 25.694  0.69  25.00 ? 224 LYS B CG     1 
ATOM   4945 C CG     B LYS B 2 224 ? 19.514  -16.395 25.565  0.20  21.48 ? 224 LYS B CG     1 
ATOM   4946 C CD     A LYS B 2 224 ? 18.040  -16.865 26.493  0.69  26.16 ? 224 LYS B CD     1 
ATOM   4947 C CD     B LYS B 2 224 ? 18.371  -17.047 26.415  0.20  20.96 ? 224 LYS B CD     1 
ATOM   4948 C CE     A LYS B 2 224 ? 18.343  -18.229 27.153  0.69  28.61 ? 224 LYS B CE     1 
ATOM   4949 C CE     B LYS B 2 224 ? 18.868  -18.394 26.991  0.20  20.92 ? 224 LYS B CE     1 
ATOM   4950 N NZ     A LYS B 2 224 ? 18.656  -19.265 26.114  0.69  30.22 ? 224 LYS B NZ     1 
ATOM   4951 N NZ     B LYS B 2 224 ? 17.895  -18.919 27.991  0.20  20.20 ? 224 LYS B NZ     1 
ATOM   4952 H H      . LYS B 2 224 ? 19.213  -16.075 22.074  1.00  24.01 ? 224 LYS B H      1 
ATOM   4953 H HA     . LYS B 2 224 ? 17.096  -15.945 24.206  1.00  23.27 ? 224 LYS B HA     1 
ATOM   4954 H HB2    A LYS B 2 224 ? 19.876  -14.705 24.402  0.69  23.89 ? 224 LYS B HB2    1 
ATOM   4955 H HB2    B LYS B 2 224 ? 19.840  -14.611 24.361  0.20  21.77 ? 224 LYS B HB2    1 
ATOM   4956 H HB3    A LYS B 2 224 ? 18.534  -14.335 25.469  0.69  23.60 ? 224 LYS B HB3    1 
ATOM   4957 H HB3    B LYS B 2 224 ? 18.546  -14.432 25.529  0.20  21.66 ? 224 LYS B HB3    1 
ATOM   4958 H HG2    A LYS B 2 224 ? 19.648  -17.151 25.035  0.69  25.29 ? 224 LYS B HG2    1 
ATOM   4959 H HG2    B LYS B 2 224 ? 19.883  -17.107 24.836  0.20  21.28 ? 224 LYS B HG2    1 
ATOM   4960 H HG3    A LYS B 2 224 ? 20.099  -16.130 26.383  0.69  25.64 ? 224 LYS B HG3    1 
ATOM   4961 H HG3    B LYS B 2 224 ? 20.337  -16.126 26.211  0.20  21.35 ? 224 LYS B HG3    1 
ATOM   4962 H HD2    A LYS B 2 224 ? 17.753  -16.165 27.263  0.69  26.03 ? 224 LYS B HD2    1 
ATOM   4963 H HD2    B LYS B 2 224 ? 18.063  -16.409 27.231  0.20  21.08 ? 224 LYS B HD2    1 
ATOM   4964 H HD3    A LYS B 2 224 ? 17.187  -17.028 25.851  0.69  26.27 ? 224 LYS B HD3    1 
ATOM   4965 H HD3    B LYS B 2 224 ? 17.504  -17.264 25.807  0.20  21.26 ? 224 LYS B HD3    1 
ATOM   4966 H HE2    A LYS B 2 224 ? 19.185  -18.152 27.823  0.69  28.03 ? 224 LYS B HE2    1 
ATOM   4967 H HE2    B LYS B 2 224 ? 18.946  -19.124 26.194  0.20  21.03 ? 224 LYS B HE2    1 
ATOM   4968 H HE3    A LYS B 2 224 ? 17.482  -18.562 27.715  0.69  28.15 ? 224 LYS B HE3    1 
ATOM   4969 H HE3    B LYS B 2 224 ? 19.830  -18.291 27.468  0.20  20.95 ? 224 LYS B HE3    1 
ATOM   4970 H HZ1    A LYS B 2 224 ? 19.612  -19.644 26.272  0.69  29.77 ? 224 LYS B HZ1    1 
ATOM   4971 H HZ1    B LYS B 2 224 ? 17.564  -19.857 27.686  0.20  20.17 ? 224 LYS B HZ1    1 
ATOM   4972 H HZ2    A LYS B 2 224 ? 18.615  -18.838 25.168  0.69  30.09 ? 224 LYS B HZ2    1 
ATOM   4973 H HZ2    B LYS B 2 224 ? 17.085  -18.272 28.069  0.20  20.25 ? 224 LYS B HZ2    1 
ATOM   4974 H HZ3    A LYS B 2 224 ? 17.962  -20.039 26.172  0.69  29.89 ? 224 LYS B HZ3    1 
ATOM   4975 H HZ3    B LYS B 2 224 ? 18.361  -19.005 28.917  0.20  20.30 ? 224 LYS B HZ3    1 
ATOM   4976 N N      . PRO B 2 225 ? 16.555  -14.476 22.088  1.00  21.73 ? 225 PRO B N      1 
ATOM   4977 C CA     . PRO B 2 225 ? 16.013  -13.423 21.175  1.00  19.99 ? 225 PRO B CA     1 
ATOM   4978 C C      . PRO B 2 225 ? 15.286  -12.329 21.960  1.00  14.14 ? 225 PRO B C      1 
ATOM   4979 O O      . PRO B 2 225 ? 14.979  -12.514 23.117  1.00  16.33 ? 225 PRO B O      1 
ATOM   4980 C CB     . PRO B 2 225 ? 15.083  -14.233 20.186  1.00  19.66 ? 225 PRO B CB     1 
ATOM   4981 C CG     . PRO B 2 225 ? 14.548  -15.409 21.102  1.00  20.81 ? 225 PRO B CG     1 
ATOM   4982 C CD     . PRO B 2 225 ? 15.817  -15.793 21.912  1.00  21.92 ? 225 PRO B CD     1 
ATOM   4983 H HA     . PRO B 2 225 ? 16.839  -12.970 20.645  1.00  18.57 ? 225 PRO B HA     1 
ATOM   4984 H HB2    . PRO B 2 225 ? 14.265  -13.613 19.849  1.00  20.39 ? 225 PRO B HB2    1 
ATOM   4985 H HB3    . PRO B 2 225 ? 15.633  -14.599 19.330  1.00  19.93 ? 225 PRO B HB3    1 
ATOM   4986 H HG2    . PRO B 2 225 ? 13.759  -15.074 21.763  1.00  20.10 ? 225 PRO B HG2    1 
ATOM   4987 H HG3    . PRO B 2 225 ? 14.186  -16.236 20.508  1.00  20.49 ? 225 PRO B HG3    1 
ATOM   4988 H HD2    . PRO B 2 225 ? 15.548  -16.219 22.870  1.00  21.64 ? 225 PRO B HD2    1 
ATOM   4989 H HD3    . PRO B 2 225 ? 16.442  -16.482 21.360  1.00  20.81 ? 225 PRO B HD3    1 
ATOM   4990 N N      . GLY B 2 226 ? 14.998  -11.223 21.333  1.00  15.07 ? 226 GLY B N      1 
ATOM   4991 C CA     . GLY B 2 226 ? 14.290  -10.181 22.118  1.00  15.57 ? 226 GLY B CA     1 
ATOM   4992 C C      . GLY B 2 226 ? 12.796  -10.570 22.172  1.00  13.85 ? 226 GLY B C      1 
ATOM   4993 O O      . GLY B 2 226 ? 12.304  -11.227 21.264  1.00  16.69 ? 226 GLY B O      1 
ATOM   4994 H H      . GLY B 2 226 ? 15.226  -11.081 20.394  1.00  13.72 ? 226 GLY B H      1 
ATOM   4995 H HA2    . GLY B 2 226 ? 14.697  -10.149 23.121  1.00  14.75 ? 226 GLY B HA2    1 
ATOM   4996 H HA3    . GLY B 2 226 ? 14.407  -9.222  21.636  1.00  16.19 ? 226 GLY B HA3    1 
ATOM   4997 N N      . VAL B 2 227 ? 12.158  -10.141 23.233  1.00  13.56 ? 227 VAL B N      1 
ATOM   4998 C CA     . VAL B 2 227 ? 10.726  -10.403 23.483  1.00  15.73 ? 227 VAL B CA     1 
ATOM   4999 C C      . VAL B 2 227 ? 10.005  -9.050  23.363  1.00  18.26 ? 227 VAL B C      1 
ATOM   5000 O O      . VAL B 2 227 ? 10.446  -8.000  23.829  1.00  14.41 ? 227 VAL B O      1 
ATOM   5001 C CB     . VAL B 2 227 ? 10.572  -11.019 24.885  1.00  17.16 ? 227 VAL B CB     1 
ATOM   5002 C CG1    . VAL B 2 227 ? 9.153   -11.588 25.010  1.00  16.89 ? 227 VAL B CG1    1 
ATOM   5003 C CG2    . VAL B 2 227 ? 11.635  -12.171 25.110  1.00  18.91 ? 227 VAL B CG2    1 
ATOM   5004 H H      . VAL B 2 227 ? 12.645  -9.622  23.904  1.00  13.48 ? 227 VAL B H      1 
ATOM   5005 H HA     . VAL B 2 227 ? 10.370  -11.081 22.718  1.00  17.84 ? 227 VAL B HA     1 
ATOM   5006 H HB     . VAL B 2 227 ? 10.710  -10.264 25.648  1.00  17.11 ? 227 VAL B HB     1 
ATOM   5007 H HG11   . VAL B 2 227 ? 8.985   -12.344 24.255  1.00  17.11 ? 227 VAL B HG11   1 
ATOM   5008 H HG12   . VAL B 2 227 ? 8.414   -10.810 24.898  1.00  17.23 ? 227 VAL B HG12   1 
ATOM   5009 H HG13   . VAL B 2 227 ? 9.026   -12.038 25.984  1.00  17.22 ? 227 VAL B HG13   1 
ATOM   5010 H HG21   . VAL B 2 227 ? 11.522  -12.597 26.097  1.00  17.94 ? 227 VAL B HG21   1 
ATOM   5011 H HG22   . VAL B 2 227 ? 12.642  -11.782 25.045  1.00  17.90 ? 227 VAL B HG22   1 
ATOM   5012 H HG23   . VAL B 2 227 ? 11.536  -12.963 24.381  1.00  17.75 ? 227 VAL B HG23   1 
ATOM   5013 N N      . TYR B 2 228 ? 8.873   -9.144  22.725  1.00  17.14 ? 228 TYR B N      1 
ATOM   5014 C CA     . TYR B 2 228 ? 8.024   -7.971  22.471  1.00  14.89 ? 228 TYR B CA     1 
ATOM   5015 C C      . TYR B 2 228 ? 6.603   -8.180  22.938  1.00  16.43 ? 228 TYR B C      1 
ATOM   5016 O O      . TYR B 2 228 ? 6.123   -9.300  23.019  1.00  15.60 ? 228 TYR B O      1 
ATOM   5017 C CB     . TYR B 2 228 ? 8.019   -7.705  20.953  1.00  12.04 ? 228 TYR B CB     1 
ATOM   5018 C CG     . TYR B 2 228 ? 9.414   -7.478  20.383  1.00  13.78 ? 228 TYR B CG     1 
ATOM   5019 C CD1    . TYR B 2 228 ? 10.300  -8.537  20.218  1.00  13.82 ? 228 TYR B CD1    1 
ATOM   5020 C CD2    . TYR B 2 228 ? 9.830   -6.198  20.056  1.00  12.47 ? 228 TYR B CD2    1 
ATOM   5021 C CE1    . TYR B 2 228 ? 11.568  -8.328  19.750  1.00  14.15 ? 228 TYR B CE1    1 
ATOM   5022 C CE2    . TYR B 2 228 ? 11.110  -5.993  19.584  1.00  16.44 ? 228 TYR B CE2    1 
ATOM   5023 C CZ     . TYR B 2 228 ? 11.993  -7.056  19.430  1.00  13.77 ? 228 TYR B CZ     1 
ATOM   5024 O OH     . TYR B 2 228 ? 13.280  -6.851  18.979  1.00  15.92 ? 228 TYR B OH     1 
ATOM   5025 H H      . TYR B 2 228 ? 8.562   -10.015 22.411  1.00  16.57 ? 228 TYR B H      1 
ATOM   5026 H HA     . TYR B 2 228 ? 8.434   -7.117  22.988  1.00  15.21 ? 228 TYR B HA     1 
ATOM   5027 H HB2    . TYR B 2 228 ? 7.587   -8.561  20.453  1.00  13.98 ? 228 TYR B HB2    1 
ATOM   5028 H HB3    . TYR B 2 228 ? 7.396   -6.851  20.738  1.00  14.17 ? 228 TYR B HB3    1 
ATOM   5029 H HD1    . TYR B 2 228 ? 9.994   -9.549  20.454  1.00  13.84 ? 228 TYR B HD1    1 
ATOM   5030 H HD2    . TYR B 2 228 ? 9.161   -5.359  20.170  1.00  12.90 ? 228 TYR B HD2    1 
ATOM   5031 H HE1    . TYR B 2 228 ? 12.224  -9.179  19.639  1.00  13.70 ? 228 TYR B HE1    1 
ATOM   5032 H HE2    . TYR B 2 228 ? 11.412  -4.992  19.332  1.00  14.60 ? 228 TYR B HE2    1 
ATOM   5033 H HH     . TYR B 2 228 ? 13.293  -5.995  18.546  1.00  15.98 ? 228 TYR B HH     1 
ATOM   5034 N N      . THR B 2 229 ? 5.985   -7.068  23.217  1.00  15.04 ? 229 THR B N      1 
ATOM   5035 C CA     . THR B 2 229 ? 4.577   -7.070  23.671  1.00  17.13 ? 229 THR B CA     1 
ATOM   5036 C C      . THR B 2 229 ? 3.834   -7.226  22.298  1.00  14.77 ? 229 THR B C      1 
ATOM   5037 O O      . THR B 2 229 ? 4.222   -6.575  21.351  1.00  15.56 ? 229 THR B O      1 
ATOM   5038 C CB     . THR B 2 229 ? 4.257   -5.692  24.360  1.00  18.14 ? 229 THR B CB     1 
ATOM   5039 O OG1    . THR B 2 229 ? 5.058   -5.618  25.545  1.00  19.18 ? 229 THR B OG1    1 
ATOM   5040 C CG2    . THR B 2 229 ? 2.738   -5.637  24.765  1.00  17.66 ? 229 THR B CG2    1 
ATOM   5041 H H      . THR B 2 229 ? 6.456   -6.212  23.133  1.00  15.64 ? 229 THR B H      1 
ATOM   5042 H HA     . THR B 2 229 ? 4.402   -7.937  24.297  1.00  17.77 ? 229 THR B HA     1 
ATOM   5043 H HB     . THR B 2 229 ? 4.492   -4.866  23.705  1.00  17.46 ? 229 THR B HB     1 
ATOM   5044 H HG1    . THR B 2 229 ? 5.143   -4.668  25.763  1.00  18.85 ? 229 THR B HG1    1 
ATOM   5045 H HG21   . THR B 2 229 ? 2.509   -4.693  25.237  1.00  17.94 ? 229 THR B HG21   1 
ATOM   5046 H HG22   . THR B 2 229 ? 2.455   -6.430  25.444  1.00  17.76 ? 229 THR B HG22   1 
ATOM   5047 H HG23   . THR B 2 229 ? 2.112   -5.716  23.888  1.00  17.10 ? 229 THR B HG23   1 
ATOM   5048 N N      . LYS B 2 230 ? 2.808   -8.042  22.209  1.00  16.62 ? 230 LYS B N      1 
ATOM   5049 C CA     . LYS B 2 230 ? 2.085   -8.230  20.919  1.00  16.26 ? 230 LYS B CA     1 
ATOM   5050 C C      . LYS B 2 230 ? 0.956   -7.204  20.943  1.00  12.06 ? 230 LYS B C      1 
ATOM   5051 O O      . LYS B 2 230 ? -0.030  -7.377  21.628  1.00  16.05 ? 230 LYS B O      1 
ATOM   5052 C CB     . LYS B 2 230 ? 1.518   -9.648  20.856  1.00  20.47 ? 230 LYS B CB     1 
ATOM   5053 C CG     . LYS B 2 230 ? 1.130   -9.935  19.370  1.00  27.91 ? 230 LYS B CG     1 
ATOM   5054 C CD     . LYS B 2 230 ? 0.148   -11.072 19.247  1.00  32.49 ? 230 LYS B CD     1 
ATOM   5055 C CE     . LYS B 2 230 ? 0.673   -12.332 19.874  1.00  37.99 ? 230 LYS B CE     1 
ATOM   5056 N NZ     . LYS B 2 230 ? -0.345  -13.400 19.658  1.00  43.22 ? 230 LYS B NZ     1 
ATOM   5057 H H      . LYS B 2 230 ? 2.507   -8.532  23.007  1.00  17.52 ? 230 LYS B H      1 
ATOM   5058 H HA     . LYS B 2 230 ? 2.756   -8.030  20.098  1.00  15.22 ? 230 LYS B HA     1 
ATOM   5059 H HB2    . LYS B 2 230 ? 2.260   -10.359 21.182  1.00  21.47 ? 230 LYS B HB2    1 
ATOM   5060 H HB3    . LYS B 2 230 ? 0.657   -9.719  21.505  1.00  21.53 ? 230 LYS B HB3    1 
ATOM   5061 H HG2    . LYS B 2 230 ? 0.652   -9.072  18.925  1.00  28.07 ? 230 LYS B HG2    1 
ATOM   5062 H HG3    . LYS B 2 230 ? 2.010   -10.156 18.784  1.00  27.40 ? 230 LYS B HG3    1 
ATOM   5063 H HD2    . LYS B 2 230 ? -0.792  -10.801 19.699  1.00  32.96 ? 230 LYS B HD2    1 
ATOM   5064 H HD3    . LYS B 2 230 ? -0.030  -11.243 18.195  1.00  32.83 ? 230 LYS B HD3    1 
ATOM   5065 H HE2    . LYS B 2 230 ? 1.598   -12.634 19.405  1.00  38.20 ? 230 LYS B HE2    1 
ATOM   5066 H HE3    . LYS B 2 230 ? 0.831   -12.232 20.939  1.00  38.07 ? 230 LYS B HE3    1 
ATOM   5067 H HZ1    . LYS B 2 230 ? 0.084   -14.177 19.113  1.00  41.58 ? 230 LYS B HZ1    1 
ATOM   5068 H HZ2    . LYS B 2 230 ? -1.150  -13.009 19.126  1.00  41.63 ? 230 LYS B HZ2    1 
ATOM   5069 H HZ3    . LYS B 2 230 ? -0.678  -13.756 20.578  1.00  41.79 ? 230 LYS B HZ3    1 
ATOM   5070 N N      . VAL B 2 231 ? 1.163   -6.179  20.187  1.00  14.33 ? 231 VAL B N      1 
ATOM   5071 C CA     . VAL B 2 231 ? 0.178   -5.073  20.096  1.00  17.65 ? 231 VAL B CA     1 
ATOM   5072 C C      . VAL B 2 231 ? -1.255  -5.481  19.689  1.00  15.35 ? 231 VAL B C      1 
ATOM   5073 O O      . VAL B 2 231 ? -2.183  -4.923  20.244  1.00  16.74 ? 231 VAL B O      1 
ATOM   5074 C CB     . VAL B 2 231 ? 0.755   -4.015  19.099  1.00  17.65 ? 231 VAL B CB     1 
ATOM   5075 C CG1    . VAL B 2 231 ? -0.200  -2.801  18.979  1.00  13.70 ? 231 VAL B CG1    1 
ATOM   5076 C CG2    . VAL B 2 231 ? 2.169   -3.553  19.660  1.00  20.29 ? 231 VAL B CG2    1 
ATOM   5077 H H      . VAL B 2 231 ? 1.983   -6.133  19.650  1.00  12.98 ? 231 VAL B H      1 
ATOM   5078 H HA     . VAL B 2 231 ? 0.110   -4.633  21.080  1.00  15.78 ? 231 VAL B HA     1 
ATOM   5079 H HB     . VAL B 2 231 ? 0.869   -4.462  18.119  1.00  17.27 ? 231 VAL B HB     1 
ATOM   5080 H HG11   . VAL B 2 231 ? -0.332  -2.314  19.936  1.00  13.75 ? 231 VAL B HG11   1 
ATOM   5081 H HG12   . VAL B 2 231 ? -1.170  -3.113  18.626  1.00  14.52 ? 231 VAL B HG12   1 
ATOM   5082 H HG13   . VAL B 2 231 ? 0.204   -2.095  18.265  1.00  14.10 ? 231 VAL B HG13   1 
ATOM   5083 H HG21   . VAL B 2 231 ? 2.622   -2.831  18.998  1.00  19.81 ? 231 VAL B HG21   1 
ATOM   5084 H HG22   . VAL B 2 231 ? 2.842   -4.388  19.747  1.00  19.59 ? 231 VAL B HG22   1 
ATOM   5085 H HG23   . VAL B 2 231 ? 2.065   -3.099  20.634  1.00  19.46 ? 231 VAL B HG23   1 
ATOM   5086 N N      . SER B 2 232 ? -1.410  -6.393  18.780  1.00  17.18 ? 232 SER B N      1 
ATOM   5087 C CA     . SER B 2 232 ? -2.791  -6.793  18.366  1.00  21.20 ? 232 SER B CA     1 
ATOM   5088 C C      . SER B 2 232 ? -3.685  -7.164  19.552  1.00  21.42 ? 232 SER B C      1 
ATOM   5089 O O      . SER B 2 232 ? -4.871  -6.865  19.550  1.00  22.96 ? 232 SER B O      1 
ATOM   5090 C CB     . SER B 2 232 ? -2.671  -7.956  17.361  1.00  22.48 ? 232 SER B CB     1 
ATOM   5091 O OG     . SER B 2 232 ? -1.965  -8.988  18.042  1.00  27.29 ? 232 SER B OG     1 
ATOM   5092 H H      . SER B 2 232 ? -0.637  -6.825  18.363  1.00  15.29 ? 232 SER B H      1 
ATOM   5093 H HA     . SER B 2 232 ? -3.246  -5.959  17.854  1.00  21.09 ? 232 SER B HA     1 
ATOM   5094 H HB2    . SER B 2 232 ? -3.658  -8.303  17.088  1.00  23.94 ? 232 SER B HB2    1 
ATOM   5095 H HB3    . SER B 2 232 ? -2.142  -7.660  16.464  1.00  22.58 ? 232 SER B HB3    1 
ATOM   5096 H HG     . SER B 2 232 ? -2.373  -9.815  17.763  1.00  25.66 ? 232 SER B HG     1 
ATOM   5097 N N      . ASP B 2 233 ? -3.088  -7.777  20.543  1.00  19.45 ? 233 ASP B N      1 
ATOM   5098 C CA     . ASP B 2 233 ? -3.864  -8.189  21.735  1.00  21.42 ? 233 ASP B CA     1 
ATOM   5099 C C      . ASP B 2 233 ? -4.282  -7.044  22.609  1.00  20.88 ? 233 ASP B C      1 
ATOM   5100 O O      . ASP B 2 233 ? -5.062  -7.246  23.513  1.00  22.18 ? 233 ASP B O      1 
ATOM   5101 C CB     . ASP B 2 233 ? -3.036  -9.204  22.586  1.00  23.44 ? 233 ASP B CB     1 
ATOM   5102 C CG     . ASP B 2 233 ? -2.824  -10.581 21.862  1.00  28.20 ? 233 ASP B CG     1 
ATOM   5103 O OD1    . ASP B 2 233 ? -3.744  -11.043 21.224  1.00  32.94 ? 233 ASP B OD1    1 
ATOM   5104 O OD2    . ASP B 2 233 ? -1.756  -11.154 21.964  1.00  33.85 ? 233 ASP B OD2    1 
ATOM   5105 H H      . ASP B 2 233 ? -2.123  -7.949  20.470  1.00  19.66 ? 233 ASP B H      1 
ATOM   5106 H HA     . ASP B 2 233 ? -4.770  -8.666  21.393  1.00  21.49 ? 233 ASP B HA     1 
ATOM   5107 H HB2    . ASP B 2 233 ? -2.072  -8.771  22.818  1.00  24.69 ? 233 ASP B HB2    1 
ATOM   5108 H HB3    . ASP B 2 233 ? -3.553  -9.377  23.517  1.00  24.16 ? 233 ASP B HB3    1 
ATOM   5109 N N      . PHE B 2 234 ? -3.802  -5.872  22.350  1.00  20.53 ? 234 PHE B N      1 
ATOM   5110 C CA     . PHE B 2 234 ? -4.172  -4.679  23.197  1.00  17.32 ? 234 PHE B CA     1 
ATOM   5111 C C      . PHE B 2 234 ? -4.944  -3.610  22.440  1.00  16.05 ? 234 PHE B C      1 
ATOM   5112 O O      . PHE B 2 234 ? -5.166  -2.530  22.947  1.00  16.55 ? 234 PHE B O      1 
ATOM   5113 C CB     . PHE B 2 234 ? -2.857  -4.079  23.771  1.00  15.65 ? 234 PHE B CB     1 
ATOM   5114 C CG     . PHE B 2 234 ? -2.199  -5.121  24.684  1.00  14.67 ? 234 PHE B CG     1 
ATOM   5115 C CD1    . PHE B 2 234 ? -2.589  -5.241  25.999  1.00  15.71 ? 234 PHE B CD1    1 
ATOM   5116 C CD2    . PHE B 2 234 ? -1.222  -5.956  24.188  1.00  16.80 ? 234 PHE B CD2    1 
ATOM   5117 C CE1    . PHE B 2 234 ? -2.002  -6.194  26.807  1.00  19.96 ? 234 PHE B CE1    1 
ATOM   5118 C CE2    . PHE B 2 234 ? -0.630  -6.909  24.982  1.00  17.97 ? 234 PHE B CE2    1 
ATOM   5119 C CZ     . PHE B 2 234 ? -1.018  -7.030  26.292  1.00  18.46 ? 234 PHE B CZ     1 
ATOM   5120 H H      . PHE B 2 234 ? -3.187  -5.761  21.592  1.00  20.75 ? 234 PHE B H      1 
ATOM   5121 H HA     . PHE B 2 234 ? -4.787  -5.007  24.021  1.00  16.45 ? 234 PHE B HA     1 
ATOM   5122 H HB2    . PHE B 2 234 ? -2.181  -3.802  22.974  1.00  14.39 ? 234 PHE B HB2    1 
ATOM   5123 H HB3    . PHE B 2 234 ? -3.087  -3.194  24.348  1.00  15.55 ? 234 PHE B HB3    1 
ATOM   5124 H HD1    . PHE B 2 234 ? -3.349  -4.588  26.406  1.00  16.41 ? 234 PHE B HD1    1 
ATOM   5125 H HD2    . PHE B 2 234 ? -0.911  -5.871  23.157  1.00  15.63 ? 234 PHE B HD2    1 
ATOM   5126 H HE1    . PHE B 2 234 ? -2.306  -6.292  27.844  1.00  18.20 ? 234 PHE B HE1    1 
ATOM   5127 H HE2    . PHE B 2 234 ? 0.136   -7.556  24.576  1.00  16.80 ? 234 PHE B HE2    1 
ATOM   5128 H HZ     . PHE B 2 234 ? -0.556  -7.778  26.920  1.00  18.89 ? 234 PHE B HZ     1 
ATOM   5129 N N      . ARG B 2 235 ? -5.325  -3.929  21.238  1.00  21.13 ? 235 ARG B N      1 
ATOM   5130 C CA     . ARG B 2 235 ? -6.099  -2.958  20.388  1.00  23.10 ? 235 ARG B CA     1 
ATOM   5131 C C      . ARG B 2 235 ? -7.254  -2.284  21.150  1.00  19.37 ? 235 ARG B C      1 
ATOM   5132 O O      . ARG B 2 235 ? -7.361  -1.081  21.256  1.00  19.98 ? 235 ARG B O      1 
ATOM   5133 C CB     . ARG B 2 235 ? -6.696  -3.702  19.107  1.00  24.21 ? 235 ARG B CB     1 
ATOM   5134 C CG     . ARG B 2 235 ? -5.662  -3.904  17.959  1.00  26.38 ? 235 ARG B CG     1 
ATOM   5135 C CD     . ARG B 2 235 ? -6.344  -4.567  16.653  1.00  27.41 ? 235 ARG B CD     1 
ATOM   5136 N NE     . ARG B 2 235 ? -7.788  -4.143  16.561  1.00  27.63 ? 235 ARG B NE     1 
ATOM   5137 C CZ     . ARG B 2 235 ? -8.193  -3.189  15.777  1.00  27.72 ? 235 ARG B CZ     1 
ATOM   5138 N NH1    . ARG B 2 235 ? -7.354  -2.502  15.053  1.00  26.95 ? 235 ARG B NH1    1 
ATOM   5139 N NH2    . ARG B 2 235 ? -9.465  -2.949  15.756  1.00  30.24 ? 235 ARG B NH2    1 
ATOM   5140 H H      . ARG B 2 235 ? -5.097  -4.817  20.891  1.00  21.64 ? 235 ARG B H      1 
ATOM   5141 H HA     . ARG B 2 235 ? -5.423  -2.174  20.075  1.00  23.53 ? 235 ARG B HA     1 
ATOM   5142 H HB2    . ARG B 2 235 ? -7.102  -4.665  19.383  1.00  24.23 ? 235 ARG B HB2    1 
ATOM   5143 H HB3    . ARG B 2 235 ? -7.507  -3.094  18.730  1.00  25.05 ? 235 ARG B HB3    1 
ATOM   5144 H HG2    . ARG B 2 235 ? -5.226  -2.951  17.692  1.00  26.31 ? 235 ARG B HG2    1 
ATOM   5145 H HG3    . ARG B 2 235 ? -4.871  -4.550  18.308  1.00  26.52 ? 235 ARG B HG3    1 
ATOM   5146 H HD2    . ARG B 2 235 ? -5.826  -4.288  15.744  1.00  26.32 ? 235 ARG B HD2    1 
ATOM   5147 H HD3    . ARG B 2 235 ? -6.314  -5.649  16.723  1.00  27.74 ? 235 ARG B HD3    1 
ATOM   5148 H HE     . ARG B 2 235 ? -8.459  -4.594  17.112  1.00  26.36 ? 235 ARG B HE     1 
ATOM   5149 H HH11   . ARG B 2 235 ? -7.689  -1.772  14.462  1.00  27.73 ? 235 ARG B HH11   1 
ATOM   5150 H HH12   . ARG B 2 235 ? -6.377  -2.702  15.091  1.00  27.72 ? 235 ARG B HH12   1 
ATOM   5151 H HH21   . ARG B 2 235 ? -10.079 -3.493  16.328  1.00  29.86 ? 235 ARG B HH21   1 
ATOM   5152 H HH22   . ARG B 2 235 ? -9.828  -2.224  15.172  1.00  29.55 ? 235 ARG B HH22   1 
ATOM   5153 N N      . GLU B 2 236 ? -8.118  -3.093  21.687  1.00  24.18 ? 236 GLU B N      1 
ATOM   5154 C CA     . GLU B 2 236 ? -9.283  -2.533  22.429  1.00  26.01 ? 236 GLU B CA     1 
ATOM   5155 C C      . GLU B 2 236 ? -8.888  -1.765  23.666  1.00  24.28 ? 236 GLU B C      1 
ATOM   5156 O O      . GLU B 2 236 ? -9.550  -0.807  24.019  1.00  22.29 ? 236 GLU B O      1 
ATOM   5157 C CB     . GLU B 2 236 ? -10.255 -3.693  22.790  0.42  27.72 ? 236 GLU B CB     1 
ATOM   5158 C CG     . GLU B 2 236 ? -11.602 -3.071  23.272  0.42  33.22 ? 236 GLU B CG     1 
ATOM   5159 C CD     . GLU B 2 236 ? -12.108 -1.984  22.276  0.42  36.83 ? 236 GLU B CD     1 
ATOM   5160 O OE1    . GLU B 2 236 ? -12.335 -2.315  21.119  0.42  39.13 ? 236 GLU B OE1    1 
ATOM   5161 O OE2    . GLU B 2 236 ? -12.231 -0.865  22.751  1.00  43.77 ? 236 GLU B OE2    1 
ATOM   5162 H H      . GLU B 2 236 ? -7.986  -4.060  21.591  1.00  24.05 ? 236 GLU B H      1 
ATOM   5163 H HA     . GLU B 2 236 ? -9.749  -1.823  21.761  1.00  26.47 ? 236 GLU B HA     1 
ATOM   5164 H HB2    . GLU B 2 236 ? -10.440 -4.320  21.930  0.42  28.12 ? 236 GLU B HB2    1 
ATOM   5165 H HB3    . GLU B 2 236 ? -9.839  -4.297  23.582  0.42  28.18 ? 236 GLU B HB3    1 
ATOM   5166 H HG2    . GLU B 2 236 ? -12.355 -3.844  23.340  0.42  32.76 ? 236 GLU B HG2    1 
ATOM   5167 H HG3    . GLU B 2 236 ? -11.482 -2.630  24.253  0.42  32.35 ? 236 GLU B HG3    1 
ATOM   5168 N N      . TRP B 2 237 ? -7.838  -2.201  24.296  1.00  21.62 ? 237 TRP B N      1 
ATOM   5169 C CA     . TRP B 2 237 ? -7.366  -1.493  25.530  1.00  23.08 ? 237 TRP B CA     1 
ATOM   5170 C C      . TRP B 2 237 ? -6.926  -0.068  25.070  1.00  17.97 ? 237 TRP B C      1 
ATOM   5171 O O      . TRP B 2 237 ? -7.257  0.923   25.702  1.00  18.51 ? 237 TRP B O      1 
ATOM   5172 C CB     . TRP B 2 237 ? -6.139  -2.305  26.170  1.00  24.47 ? 237 TRP B CB     1 
ATOM   5173 C CG     . TRP B 2 237 ? -5.580  -1.634  27.449  1.00  26.54 ? 237 TRP B CG     1 
ATOM   5174 C CD1    . TRP B 2 237 ? -6.049  -1.779  28.736  1.00  28.07 ? 237 TRP B CD1    1 
ATOM   5175 C CD2    . TRP B 2 237 ? -4.536  -0.767  27.478  1.00  25.61 ? 237 TRP B CD2    1 
ATOM   5176 N NE1    . TRP B 2 237 ? -5.258  -0.988  29.445  1.00  26.37 ? 237 TRP B NE1    1 
ATOM   5177 C CE2    . TRP B 2 237 ? -4.315  -0.330  28.792  1.00  26.08 ? 237 TRP B CE2    1 
ATOM   5178 C CE3    . TRP B 2 237 ? -3.723  -0.306  26.439  1.00  23.02 ? 237 TRP B CE3    1 
ATOM   5179 C CZ2    . TRP B 2 237 ? -3.288  0.570   29.056  1.00  22.78 ? 237 TRP B CZ2    1 
ATOM   5180 C CZ3    . TRP B 2 237 ? -2.695  0.595   26.712  1.00  22.13 ? 237 TRP B CZ3    1 
ATOM   5181 C CH2    . TRP B 2 237 ? -2.486  1.028   28.016  1.00  20.56 ? 237 TRP B CH2    1 
ATOM   5182 H H      . TRP B 2 237 ? -7.360  -2.988  23.963  1.00  22.69 ? 237 TRP B H      1 
ATOM   5183 H HA     . TRP B 2 237 ? -8.188  -1.400  26.228  1.00  22.48 ? 237 TRP B HA     1 
ATOM   5184 H HB2    . TRP B 2 237 ? -6.459  -3.303  26.426  1.00  24.78 ? 237 TRP B HB2    1 
ATOM   5185 H HB3    . TRP B 2 237 ? -5.337  -2.390  25.451  1.00  25.02 ? 237 TRP B HB3    1 
ATOM   5186 H HD1    . TRP B 2 237 ? -6.865  -2.386  29.104  1.00  27.20 ? 237 TRP B HD1    1 
ATOM   5187 H HE1    . TRP B 2 237 ? -5.369  -0.918  30.436  1.00  25.80 ? 237 TRP B HE1    1 
ATOM   5188 H HE3    . TRP B 2 237 ? -3.889  -0.645  25.429  1.00  22.35 ? 237 TRP B HE3    1 
ATOM   5189 H HZ2    . TRP B 2 237 ? -3.121  0.906   30.069  1.00  23.32 ? 237 TRP B HZ2    1 
ATOM   5190 H HZ3    . TRP B 2 237 ? -2.063  0.952   25.911  1.00  21.40 ? 237 TRP B HZ3    1 
ATOM   5191 H HH2    . TRP B 2 237 ? -1.694  1.729   28.228  1.00  21.90 ? 237 TRP B HH2    1 
ATOM   5192 N N      . ILE B 2 238 ? -6.209  -0.020  23.980  1.00  17.15 ? 238 ILE B N      1 
ATOM   5193 C CA     . ILE B 2 238 ? -5.726  1.289   23.465  1.00  18.31 ? 238 ILE B CA     1 
ATOM   5194 C C      . ILE B 2 238 ? -6.904  2.185   23.071  1.00  20.94 ? 238 ILE B C      1 
ATOM   5195 O O      . ILE B 2 238 ? -6.965  3.323   23.490  1.00  19.97 ? 238 ILE B O      1 
ATOM   5196 C CB     . ILE B 2 238 ? -4.775  1.011   22.252  1.00  19.18 ? 238 ILE B CB     1 
ATOM   5197 C CG1    . ILE B 2 238 ? -3.467  0.286   22.770  1.00  22.10 ? 238 ILE B CG1    1 
ATOM   5198 C CG2    . ILE B 2 238 ? -4.365  2.323   21.585  1.00  22.07 ? 238 ILE B CG2    1 
ATOM   5199 C CD1    . ILE B 2 238 ? -2.569  -0.153  21.597  1.00  22.11 ? 238 ILE B CD1    1 
ATOM   5200 H H      . ILE B 2 238 ? -5.995  -0.847  23.498  1.00  17.09 ? 238 ILE B H      1 
ATOM   5201 H HA     . ILE B 2 238 ? -5.187  1.780   24.262  1.00  18.75 ? 238 ILE B HA     1 
ATOM   5202 H HB     . ILE B 2 238 ? -5.292  0.400   21.525  1.00  19.49 ? 238 ILE B HB     1 
ATOM   5203 H HG12   . ILE B 2 238 ? -2.919  0.938   23.437  1.00  20.62 ? 238 ILE B HG12   1 
ATOM   5204 H HG13   . ILE B 2 238 ? -3.735  -0.607  23.318  1.00  21.58 ? 238 ILE B HG13   1 
ATOM   5205 H HG21   . ILE B 2 238 ? -3.829  2.954   22.279  1.00  21.68 ? 238 ILE B HG21   1 
ATOM   5206 H HG22   . ILE B 2 238 ? -5.238  2.861   21.240  1.00  21.04 ? 238 ILE B HG22   1 
ATOM   5207 H HG23   . ILE B 2 238 ? -3.735  2.130   20.731  1.00  21.14 ? 238 ILE B HG23   1 
ATOM   5208 H HD11   . ILE B 2 238 ? -1.701  -0.668  21.979  1.00  22.24 ? 238 ILE B HD11   1 
ATOM   5209 H HD12   . ILE B 2 238 ? -2.230  0.695   21.024  1.00  22.19 ? 238 ILE B HD12   1 
ATOM   5210 H HD13   . ILE B 2 238 ? -3.100  -0.827  20.942  1.00  21.90 ? 238 ILE B HD13   1 
ATOM   5211 N N      . PHE B 2 239 ? -7.802  1.669   22.279  1.00  22.94 ? 239 PHE B N      1 
ATOM   5212 C CA     . PHE B 2 239 ? -8.975  2.501   21.856  1.00  23.29 ? 239 PHE B CA     1 
ATOM   5213 C C      . PHE B 2 239 ? -9.721  3.007   23.073  1.00  22.77 ? 239 PHE B C      1 
ATOM   5214 O O      . PHE B 2 239 ? -10.088 4.165   23.142  1.00  22.91 ? 239 PHE B O      1 
ATOM   5215 C CB     . PHE B 2 239 ? -9.921  1.660   20.941  1.00  20.78 ? 239 PHE B CB     1 
ATOM   5216 C CG     . PHE B 2 239 ? -9.258  1.367   19.579  1.00  19.52 ? 239 PHE B CG     1 
ATOM   5217 C CD1    . PHE B 2 239 ? -8.596  2.341   18.844  1.00  23.64 ? 239 PHE B CD1    1 
ATOM   5218 C CD2    . PHE B 2 239 ? -9.315  0.099   19.033  1.00  20.89 ? 239 PHE B CD2    1 
ATOM   5219 C CE1    . PHE B 2 239 ? -8.013  2.062   17.612  1.00  23.41 ? 239 PHE B CE1    1 
ATOM   5220 C CE2    . PHE B 2 239 ? -8.727  -0.177  17.794  1.00  21.22 ? 239 PHE B CE2    1 
ATOM   5221 C CZ     . PHE B 2 239 ? -8.076  0.803   17.083  1.00  22.52 ? 239 PHE B CZ     1 
ATOM   5222 H H      . PHE B 2 239 ? -7.701  0.742   21.965  1.00  22.87 ? 239 PHE B H      1 
ATOM   5223 H HA     . PHE B 2 239 ? -8.604  3.362   21.323  1.00  23.00 ? 239 PHE B HA     1 
ATOM   5224 H HB2    . PHE B 2 239 ? -10.176 0.730   21.429  1.00  20.67 ? 239 PHE B HB2    1 
ATOM   5225 H HB3    . PHE B 2 239 ? -10.839 2.203   20.769  1.00  21.02 ? 239 PHE B HB3    1 
ATOM   5226 H HD1    . PHE B 2 239 ? -8.523  3.350   19.227  1.00  23.25 ? 239 PHE B HD1    1 
ATOM   5227 H HD2    . PHE B 2 239 ? -9.820  -0.690  19.574  1.00  19.84 ? 239 PHE B HD2    1 
ATOM   5228 H HE1    . PHE B 2 239 ? -7.505  2.842   17.062  1.00  23.50 ? 239 PHE B HE1    1 
ATOM   5229 H HE2    . PHE B 2 239 ? -8.778  -1.173  17.381  1.00  21.25 ? 239 PHE B HE2    1 
ATOM   5230 H HZ     . PHE B 2 239 ? -7.622  0.585   16.123  1.00  22.51 ? 239 PHE B HZ     1 
ATOM   5231 N N      . GLN B 2 240 ? -9.930  2.137   24.014  1.00  25.31 ? 240 GLN B N      1 
ATOM   5232 C CA     . GLN B 2 240 ? -10.658 2.558   25.249  1.00  28.15 ? 240 GLN B CA     1 
ATOM   5233 C C      . GLN B 2 240 ? -9.882  3.641   26.010  1.00  31.00 ? 240 GLN B C      1 
ATOM   5234 O O      . GLN B 2 240 ? -10.394 4.719   26.244  1.00  32.95 ? 240 GLN B O      1 
ATOM   5235 C CB     . GLN B 2 240 ? -10.855 1.323   26.167  1.00  28.52 ? 240 GLN B CB     1 
ATOM   5236 C CG     . GLN B 2 240 ? -11.604 1.636   27.508  0.13  28.07 ? 240 GLN B CG     1 
ATOM   5237 C CD     . GLN B 2 240 ? -11.594 0.399   28.424  0.13  27.81 ? 240 GLN B CD     1 
ATOM   5238 O OE1    . GLN B 2 240 ? -12.162 0.384   29.495  0.13  27.59 ? 240 GLN B OE1    1 
ATOM   5239 N NE2    . GLN B 2 240 ? -10.969 -0.686  28.072  0.13  27.64 ? 240 GLN B NE2    1 
ATOM   5240 H H      . GLN B 2 240 ? -9.607  1.216   23.897  1.00  23.18 ? 240 GLN B H      1 
ATOM   5241 H HA     . GLN B 2 240 ? -11.610 2.972   24.953  1.00  28.50 ? 240 GLN B HA     1 
ATOM   5242 H HB2    . GLN B 2 240 ? -11.396 0.559   25.627  1.00  28.90 ? 240 GLN B HB2    1 
ATOM   5243 H HB3    . GLN B 2 240 ? -9.878  0.941   26.428  1.00  29.13 ? 240 GLN B HB3    1 
ATOM   5244 H HG2    . GLN B 2 240 ? -11.117 2.434   28.051  0.13  27.87 ? 240 GLN B HG2    1 
ATOM   5245 H HG3    . GLN B 2 240 ? -12.628 1.925   27.337  0.13  27.84 ? 240 GLN B HG3    1 
ATOM   5246 H HE21   . GLN B 2 240 ? -10.490 -0.734  27.223  0.13  27.76 ? 240 GLN B HE21   1 
ATOM   5247 H HE22   . GLN B 2 240 ? -10.990 -1.451  28.680  0.13  27.77 ? 240 GLN B HE22   1 
ATOM   5248 N N      . ALA B 2 241 ? -8.675  3.315   26.377  1.00  30.66 ? 241 ALA B N      1 
ATOM   5249 C CA     . ALA B 2 241 ? -7.807  4.266   27.136  1.00  30.01 ? 241 ALA B CA     1 
ATOM   5250 C C      . ALA B 2 241 ? -7.792  5.666   26.585  1.00  29.75 ? 241 ALA B C      1 
ATOM   5251 O O      . ALA B 2 241 ? -7.890  6.630   27.313  1.00  32.47 ? 241 ALA B O      1 
ATOM   5252 C CB     . ALA B 2 241 ? -6.355  3.756   27.165  1.00  29.74 ? 241 ALA B CB     1 
ATOM   5253 H H      . ALA B 2 241 ? -8.340  2.424   26.147  1.00  30.72 ? 241 ALA B H      1 
ATOM   5254 H HA     . ALA B 2 241 ? -8.196  4.309   28.144  1.00  30.13 ? 241 ALA B HA     1 
ATOM   5255 H HB1    . ALA B 2 241 ? -5.741  4.466   27.700  1.00  30.41 ? 241 ALA B HB1    1 
ATOM   5256 H HB2    . ALA B 2 241 ? -5.968  3.651   26.163  1.00  29.95 ? 241 ALA B HB2    1 
ATOM   5257 H HB3    . ALA B 2 241 ? -6.290  2.806   27.665  1.00  29.83 ? 241 ALA B HB3    1 
ATOM   5258 N N      . ILE B 2 242 ? -7.657  5.753   25.303  1.00  32.12 ? 242 ILE B N      1 
ATOM   5259 C CA     . ILE B 2 242 ? -7.623  7.092   24.715  1.00  35.09 ? 242 ILE B CA     1 
ATOM   5260 C C      . ILE B 2 242 ? -8.958  7.762   24.948  1.00  38.51 ? 242 ILE B C      1 
ATOM   5261 O O      . ILE B 2 242 ? -8.977  8.889   25.406  1.00  41.22 ? 242 ILE B O      1 
ATOM   5262 C CB     . ILE B 2 242 ? -7.272  6.953   23.194  1.00  37.04 ? 242 ILE B CB     1 
ATOM   5263 C CG1    . ILE B 2 242 ? -5.784  6.448   23.113  1.00  34.58 ? 242 ILE B CG1    1 
ATOM   5264 C CG2    . ILE B 2 242 ? -7.370  8.338   22.490  1.00  40.28 ? 242 ILE B CG2    1 
ATOM   5265 C CD1    . ILE B 2 242 ? -5.256  6.445   21.683  1.00  33.26 ? 242 ILE B CD1    1 
ATOM   5266 H H      . ILE B 2 242 ? -7.584  4.942   24.752  1.00  32.55 ? 242 ILE B H      1 
ATOM   5267 H HA     . ILE B 2 242 ? -6.862  7.664   25.229  1.00  36.67 ? 242 ILE B HA     1 
ATOM   5268 H HB     . ILE B 2 242 ? -7.945  6.248   22.720  1.00  37.06 ? 242 ILE B HB     1 
ATOM   5269 H HG12   . ILE B 2 242 ? -5.153  7.092   23.714  1.00  35.08 ? 242 ILE B HG12   1 
ATOM   5270 H HG13   . ILE B 2 242 ? -5.718  5.447   23.517  1.00  35.06 ? 242 ILE B HG13   1 
ATOM   5271 H HG21   . ILE B 2 242 ? -6.662  9.029   22.926  1.00  39.87 ? 242 ILE B HG21   1 
ATOM   5272 H HG22   . ILE B 2 242 ? -8.363  8.753   22.599  1.00  40.02 ? 242 ILE B HG22   1 
ATOM   5273 H HG23   . ILE B 2 242 ? -7.161  8.238   21.435  1.00  39.70 ? 242 ILE B HG23   1 
ATOM   5274 H HD11   . ILE B 2 242 ? -4.253  6.045   21.667  1.00  33.54 ? 242 ILE B HD11   1 
ATOM   5275 H HD12   . ILE B 2 242 ? -5.222  7.449   21.289  1.00  33.37 ? 242 ILE B HD12   1 
ATOM   5276 H HD13   . ILE B 2 242 ? -5.892  5.831   21.065  1.00  33.60 ? 242 ILE B HD13   1 
ATOM   5277 N N      . LYS B 2 243 ? -10.038 7.097   24.651  1.00  39.34 ? 243 LYS B N      1 
ATOM   5278 C CA     . LYS B 2 243 ? -11.361 7.760   24.874  1.00  42.45 ? 243 LYS B CA     1 
ATOM   5279 C C      . LYS B 2 243 ? -11.438 8.150   26.347  1.00  46.69 ? 243 LYS B C      1 
ATOM   5280 O O      . LYS B 2 243 ? -11.498 9.322   26.684  1.00  51.75 ? 243 LYS B O      1 
ATOM   5281 C CB     . LYS B 2 243 ? -12.445 6.735   24.385  1.00  39.78 ? 243 LYS B CB     1 
ATOM   5282 C CG     . LYS B 2 243 ? -12.159 6.683   22.817  1.00  39.70 ? 243 LYS B CG     1 
ATOM   5283 C CD     . LYS B 2 243 ? -13.196 5.979   21.894  0.52  38.30 ? 243 LYS B CD     1 
ATOM   5284 C CE     . LYS B 2 243 ? -12.905 4.486   21.738  0.52  36.82 ? 243 LYS B CE     1 
ATOM   5285 N NZ     . LYS B 2 243 ? -13.706 3.937   20.603  0.52  34.68 ? 243 LYS B NZ     1 
ATOM   5286 H H      . LYS B 2 243 ? -9.969  6.181   24.299  1.00  40.09 ? 243 LYS B H      1 
ATOM   5287 H HA     . LYS B 2 243 ? -11.398 8.670   24.292  1.00  42.31 ? 243 LYS B HA     1 
ATOM   5288 H HB2    . LYS B 2 243 ? -12.310 5.772   24.857  1.00  40.33 ? 243 LYS B HB2    1 
ATOM   5289 H HB3    . LYS B 2 243 ? -13.434 7.109   24.611  1.00  40.52 ? 243 LYS B HB3    1 
ATOM   5290 H HG2    . LYS B 2 243 ? -12.054 7.693   22.446  1.00  39.87 ? 243 LYS B HG2    1 
ATOM   5291 H HG3    . LYS B 2 243 ? -11.204 6.201   22.658  1.00  40.11 ? 243 LYS B HG3    1 
ATOM   5292 H HD2    . LYS B 2 243 ? -14.195 6.101   22.286  0.52  38.25 ? 243 LYS B HD2    1 
ATOM   5293 H HD3    . LYS B 2 243 ? -13.164 6.431   20.912  0.52  37.91 ? 243 LYS B HD3    1 
ATOM   5294 H HE2    . LYS B 2 243 ? -11.861 4.325   21.513  0.52  36.78 ? 243 LYS B HE2    1 
ATOM   5295 H HE3    . LYS B 2 243 ? -13.150 3.950   22.643  0.52  36.61 ? 243 LYS B HE3    1 
ATOM   5296 H HZ1    . LYS B 2 243 ? -13.062 3.489   19.924  0.52  35.12 ? 243 LYS B HZ1    1 
ATOM   5297 H HZ2    . LYS B 2 243 ? -14.229 4.705   20.137  0.52  35.29 ? 243 LYS B HZ2    1 
ATOM   5298 H HZ3    . LYS B 2 243 ? -14.382 3.228   20.949  0.52  35.20 ? 243 LYS B HZ3    1 
ATOM   5299 N N      . THR B 2 244 ? -11.415 7.157   27.166  1.00  50.52 ? 244 THR B N      1 
ATOM   5300 C CA     . THR B 2 244 ? -11.473 7.304   28.646  1.00  51.52 ? 244 THR B CA     1 
ATOM   5301 C C      . THR B 2 244 ? -10.607 8.409   29.317  1.00  51.22 ? 244 THR B C      1 
ATOM   5302 O O      . THR B 2 244 ? -11.092 9.222   30.092  1.00  51.23 ? 244 THR B O      1 
ATOM   5303 C CB     . THR B 2 244 ? -11.097 5.905   29.217  1.00  51.97 ? 244 THR B CB     1 
ATOM   5304 O OG1    . THR B 2 244 ? -11.877 5.038   28.412  1.00  52.53 ? 244 THR B OG1    1 
ATOM   5305 C CG2    . THR B 2 244 ? -11.639 5.623   30.625  1.00  54.39 ? 244 THR B CG2    1 
ATOM   5306 H H      . THR B 2 244 ? -11.356 6.242   26.815  1.00  51.09 ? 244 THR B H      1 
ATOM   5307 H HA     . THR B 2 244 ? -12.500 7.516   28.896  1.00  51.88 ? 244 THR B HA     1 
ATOM   5308 H HB     . THR B 2 244 ? -10.046 5.662   29.124  1.00  51.92 ? 244 THR B HB     1 
ATOM   5309 H HG1    . THR B 2 244 ? -11.221 4.448   28.008  1.00  51.69 ? 244 THR B HG1    1 
ATOM   5310 H HG21   . THR B 2 244 ? -11.327 4.630   30.926  1.00  53.74 ? 244 THR B HG21   1 
ATOM   5311 H HG22   . THR B 2 244 ? -12.717 5.676   30.654  1.00  53.93 ? 244 THR B HG22   1 
ATOM   5312 H HG23   . THR B 2 244 ? -11.229 6.333   31.329  1.00  53.94 ? 244 THR B HG23   1 
ATOM   5313 N N      . HIS B 2 245 ? -9.345  8.406   28.989  1.00  50.73 ? 245 HIS B N      1 
ATOM   5314 C CA     . HIS B 2 245 ? -8.395  9.387   29.588  1.00  50.62 ? 245 HIS B CA     1 
ATOM   5315 C C      . HIS B 2 245 ? -7.910  10.559  28.794  1.00  50.56 ? 245 HIS B C      1 
ATOM   5316 O O      . HIS B 2 245 ? -6.962  11.192  29.211  1.00  50.80 ? 245 HIS B O      1 
ATOM   5317 C CB     . HIS B 2 245 ? -7.199  8.590   30.060  1.00  50.18 ? 245 HIS B CB     1 
ATOM   5318 C CG     . HIS B 2 245 ? -7.658  7.404   30.908  1.00  51.43 ? 245 HIS B CG     1 
ATOM   5319 N ND1    . HIS B 2 245 ? -8.012  7.458   32.148  1.00  53.23 ? 245 HIS B ND1    1 
ATOM   5320 C CD2    . HIS B 2 245 ? -7.798  6.065   30.575  1.00  52.84 ? 245 HIS B CD2    1 
ATOM   5321 C CE1    . HIS B 2 245 ? -8.340  6.268   32.566  1.00  53.58 ? 245 HIS B CE1    1 
ATOM   5322 N NE2    . HIS B 2 245 ? -8.218  5.372   31.618  1.00  54.03 ? 245 HIS B NE2    1 
ATOM   5323 H H      . HIS B 2 245 ? -9.020  7.747   28.336  1.00  51.46 ? 245 HIS B H      1 
ATOM   5324 H HA     . HIS B 2 245 ? -8.856  9.809   30.460  1.00  50.13 ? 245 HIS B HA     1 
ATOM   5325 H HB2    . HIS B 2 245 ? -6.637  8.229   29.211  1.00  50.50 ? 245 HIS B HB2    1 
ATOM   5326 H HB3    . HIS B 2 245 ? -6.552  9.217   30.656  1.00  50.68 ? 245 HIS B HB3    1 
ATOM   5327 H HD1    . HIS B 2 245 ? -8.040  8.285   32.692  1.00  53.34 ? 245 HIS B HD1    1 
ATOM   5328 H HD2    . HIS B 2 245 ? -7.593  5.641   29.605  1.00  52.50 ? 245 HIS B HD2    1 
ATOM   5329 H HE1    . HIS B 2 245 ? -8.667  6.032   33.571  1.00  53.46 ? 245 HIS B HE1    1 
ATOM   5330 N N      . SER B 2 246 ? -8.515  10.850  27.695  1.00  51.56 ? 246 SER B N      1 
ATOM   5331 C CA     . SER B 2 246 ? -8.057  12.028  26.886  1.00  51.41 ? 246 SER B CA     1 
ATOM   5332 C C      . SER B 2 246 ? -7.832  13.328  27.701  1.00  52.51 ? 246 SER B C      1 
ATOM   5333 O O      . SER B 2 246 ? -6.970  14.138  27.385  1.00  52.34 ? 246 SER B O      1 
ATOM   5334 C CB     A SER B 2 246 ? -9.135  12.209  25.833  0.27  51.31 ? 246 SER B CB     1 
ATOM   5335 C CB     B SER B 2 246 ? -9.075  12.318  25.758  0.32  51.34 ? 246 SER B CB     1 
ATOM   5336 O OG     A SER B 2 246 ? -10.331 12.155  26.620  0.27  50.93 ? 246 SER B OG     1 
ATOM   5337 O OG     B SER B 2 246 ? -8.705  11.397  24.736  0.32  51.00 ? 246 SER B OG     1 
ATOM   5338 H H      . SER B 2 246 ? -9.269  10.300  27.392  1.00  51.58 ? 246 SER B H      1 
ATOM   5339 H HA     . SER B 2 246 ? -7.110  11.773  26.436  1.00  51.28 ? 246 SER B HA     1 
ATOM   5340 H HB2    A SER B 2 246 ? -9.057  13.167  25.336  0.27  51.33 ? 246 SER B HB2    1 
ATOM   5341 H HB2    B SER B 2 246 ? -10.099 12.141  26.061  0.32  51.39 ? 246 SER B HB2    1 
ATOM   5342 H HB3    A SER B 2 246 ? -9.135  11.399  25.117  0.27  51.30 ? 246 SER B HB3    1 
ATOM   5343 H HB3    B SER B 2 246 ? -8.965  13.326  25.383  0.32  51.44 ? 246 SER B HB3    1 
ATOM   5344 H HG     A SER B 2 246 ? -10.814 11.342  26.386  0.27  50.78 ? 246 SER B HG     1 
ATOM   5345 H HG     B SER B 2 246 ? -9.188  10.571  24.906  0.32  51.83 ? 246 SER B HG     1 
ATOM   5346 N N      . GLU B 2 247 ? -8.640  13.457  28.722  1.00  55.66 ? 247 GLU B N      1 
ATOM   5347 C CA     . GLU B 2 247 ? -8.598  14.650  29.633  1.00  58.18 ? 247 GLU B CA     1 
ATOM   5348 C C      . GLU B 2 247 ? -8.048  14.271  31.017  1.00  59.83 ? 247 GLU B C      1 
ATOM   5349 O O      . GLU B 2 247 ? -8.445  14.877  31.996  1.00  62.50 ? 247 GLU B O      1 
ATOM   5350 C CB     . GLU B 2 247 ? -10.040 15.231  29.836  0.29  57.65 ? 247 GLU B CB     1 
ATOM   5351 C CG     . GLU B 2 247 ? -10.970 15.120  28.587  0.29  57.53 ? 247 GLU B CG     1 
ATOM   5352 C CD     . GLU B 2 247 ? -10.451 15.942  27.391  1.00  57.59 ? 247 GLU B CD     1 
ATOM   5353 O OE1    . GLU B 2 247 ? -10.376 17.151  27.550  0.29  57.24 ? 247 GLU B OE1    1 
ATOM   5354 O OE2    . GLU B 2 247 ? -10.160 15.316  26.385  0.29  57.02 ? 247 GLU B OE2    1 
ATOM   5355 H H      . GLU B 2 247 ? -9.285  12.735  28.879  1.00  55.13 ? 247 GLU B H      1 
ATOM   5356 H HA     . GLU B 2 247 ? -7.947  15.404  29.209  1.00  57.81 ? 247 GLU B HA     1 
ATOM   5357 H HB2    . GLU B 2 247 ? -10.508 14.722  30.668  0.29  57.96 ? 247 GLU B HB2    1 
ATOM   5358 H HB3    . GLU B 2 247 ? -9.940  16.267  30.124  0.29  57.94 ? 247 GLU B HB3    1 
ATOM   5359 H HG2    . GLU B 2 247 ? -11.082 14.084  28.292  0.29  57.72 ? 247 GLU B HG2    1 
ATOM   5360 H HG3    . GLU B 2 247 ? -11.948 15.494  28.857  0.29  57.82 ? 247 GLU B HG3    1 
ATOM   5361 N N      . ALA B 2 248 ? -7.166  13.312  31.074  1.00  60.55 ? 248 ALA B N      1 
ATOM   5362 C CA     . ALA B 2 248 ? -6.601  12.907  32.402  1.00  59.36 ? 248 ALA B CA     1 
ATOM   5363 C C      . ALA B 2 248 ? -5.219  13.580  32.541  1.00  59.08 ? 248 ALA B C      1 
ATOM   5364 O O      . ALA B 2 248 ? -4.652  14.040  31.558  1.00  53.74 ? 248 ALA B O      1 
ATOM   5365 C CB     . ALA B 2 248 ? -6.462  11.360  32.457  1.00  58.74 ? 248 ALA B CB     1 
ATOM   5366 H H      . ALA B 2 248 ? -6.887  12.871  30.248  1.00  60.54 ? 248 ALA B H      1 
ATOM   5367 H HA     . ALA B 2 248 ? -7.251  13.251  33.197  1.00  59.80 ? 248 ALA B HA     1 
ATOM   5368 H HB1    . ALA B 2 248 ? -6.062  11.064  33.415  1.00  58.54 ? 248 ALA B HB1    1 
ATOM   5369 H HB2    . ALA B 2 248 ? -5.795  10.988  31.698  1.00  58.72 ? 248 ALA B HB2    1 
ATOM   5370 H HB3    . ALA B 2 248 ? -7.429  10.900  32.341  1.00  58.40 ? 248 ALA B HB3    1 
ATOM   5371 N N      . SER B 2 249 ? -4.732  13.617  33.746  1.00  58.46 ? 249 SER B N      1 
ATOM   5372 C CA     . SER B 2 249 ? -3.407  14.232  34.042  1.00  58.36 ? 249 SER B CA     1 
ATOM   5373 C C      . SER B 2 249 ? -2.815  13.268  35.112  1.00  56.87 ? 249 SER B C      1 
ATOM   5374 O O      . SER B 2 249 ? -3.538  12.884  36.014  1.00  58.12 ? 249 SER B O      1 
ATOM   5375 C CB     . SER B 2 249 ? -3.711  15.655  34.569  0.51  58.53 ? 249 SER B CB     1 
ATOM   5376 O OG     . SER B 2 249 ? -2.550  16.484  34.519  0.51  60.09 ? 249 SER B OG     1 
ATOM   5377 H H      . SER B 2 249 ? -5.240  13.218  34.492  1.00  57.66 ? 249 SER B H      1 
ATOM   5378 H HA     . SER B 2 249 ? -2.807  14.233  33.146  1.00  58.86 ? 249 SER B HA     1 
ATOM   5379 H HB2    . SER B 2 249 ? -4.480  16.111  33.965  0.51  58.62 ? 249 SER B HB2    1 
ATOM   5380 H HB3    . SER B 2 249 ? -4.058  15.588  35.592  0.51  58.72 ? 249 SER B HB3    1 
ATOM   5381 H HG     . SER B 2 249 ? -1.752  16.045  34.177  0.51  59.57 ? 249 SER B HG     1 
ATOM   5382 N N      . GLY B 2 250 ? -1.569  12.878  35.032  1.00  53.76 ? 250 GLY B N      1 
ATOM   5383 C CA     . GLY B 2 250 ? -1.002  11.944  36.084  1.00  51.73 ? 250 GLY B CA     1 
ATOM   5384 C C      . GLY B 2 250 ? -0.745  10.515  35.565  1.00  48.93 ? 250 GLY B C      1 
ATOM   5385 O O      . GLY B 2 250 ? -0.818  10.271  34.378  1.00  47.31 ? 250 GLY B O      1 
ATOM   5386 H H      . GLY B 2 250 ? -1.019  13.196  34.280  1.00  54.64 ? 250 GLY B H      1 
ATOM   5387 H HA2    . GLY B 2 250 ? -0.076  12.356  36.450  1.00  51.22 ? 250 GLY B HA2    1 
ATOM   5388 H HA3    . GLY B 2 250 ? -1.698  11.881  36.910  1.00  51.49 ? 250 GLY B HA3    1 
ATOM   5389 N N      . MET B 2 251 ? -0.455  9.634   36.481  1.00  47.99 ? 251 MET B N      1 
ATOM   5390 C CA     . MET B 2 251 ? -0.177  8.187   36.175  1.00  50.75 ? 251 MET B CA     1 
ATOM   5391 C C      . MET B 2 251 ? -1.525  7.521   36.450  1.00  51.21 ? 251 MET B C      1 
ATOM   5392 O O      . MET B 2 251 ? -2.051  7.662   37.540  1.00  54.98 ? 251 MET B O      1 
ATOM   5393 C CB     . MET B 2 251 ? 0.824   7.526   37.155  1.00  52.50 ? 251 MET B CB     1 
ATOM   5394 C CG     . MET B 2 251 ? 2.229   8.104   37.061  1.00  52.81 ? 251 MET B CG     1 
ATOM   5395 S SD     . MET B 2 251 ? 3.090   7.702   35.531  1.00  56.00 ? 251 MET B SD     1 
ATOM   5396 C CE     . MET B 2 251 ? 2.939   5.894   35.641  1.00  54.01 ? 251 MET B CE     1 
ATOM   5397 H H      . MET B 2 251 ? -0.426  9.914   37.415  1.00  48.98 ? 251 MET B H      1 
ATOM   5398 H HA     . MET B 2 251 ? 0.095   8.070   35.136  1.00  50.44 ? 251 MET B HA     1 
ATOM   5399 H HB2    . MET B 2 251 ? 0.460   7.636   38.168  1.00  52.78 ? 251 MET B HB2    1 
ATOM   5400 H HB3    . MET B 2 251 ? 0.840   6.467   36.944  1.00  52.29 ? 251 MET B HB3    1 
ATOM   5401 H HG2    . MET B 2 251 ? 2.178   9.182   37.132  1.00  53.59 ? 251 MET B HG2    1 
ATOM   5402 H HG3    . MET B 2 251 ? 2.820   7.754   37.894  1.00  53.27 ? 251 MET B HG3    1 
ATOM   5403 H HE1    . MET B 2 251 ? 2.019   5.571   35.180  1.00  54.43 ? 251 MET B HE1    1 
ATOM   5404 H HE2    . MET B 2 251 ? 2.973   5.574   36.672  1.00  54.42 ? 251 MET B HE2    1 
ATOM   5405 H HE3    . MET B 2 251 ? 3.772   5.434   35.130  1.00  54.50 ? 251 MET B HE3    1 
ATOM   5406 N N      . VAL B 2 252 ? -2.067  6.822   35.518  1.00  50.48 ? 252 VAL B N      1 
ATOM   5407 C CA     . VAL B 2 252 ? -3.367  6.180   35.780  1.00  50.17 ? 252 VAL B CA     1 
ATOM   5408 C C      . VAL B 2 252 ? -3.200  4.779   35.214  1.00  51.42 ? 252 VAL B C      1 
ATOM   5409 O O      . VAL B 2 252 ? -2.228  4.530   34.521  1.00  50.52 ? 252 VAL B O      1 
ATOM   5410 C CB     . VAL B 2 252 ? -4.478  7.106   35.059  1.00  49.40 ? 252 VAL B CB     1 
ATOM   5411 C CG1    . VAL B 2 252 ? -3.861  8.314   34.278  1.00  49.53 ? 252 VAL B CG1    1 
ATOM   5412 C CG2    . VAL B 2 252 ? -5.380  6.342   34.067  1.00  49.96 ? 252 VAL B CG2    1 
ATOM   5413 H H      . VAL B 2 252 ? -1.640  6.700   34.645  1.00  49.46 ? 252 VAL B H      1 
ATOM   5414 H HA     . VAL B 2 252 ? -3.536  6.108   36.848  1.00  50.19 ? 252 VAL B HA     1 
ATOM   5415 H HB     . VAL B 2 252 ? -5.105  7.520   35.835  1.00  49.94 ? 252 VAL B HB     1 
ATOM   5416 H HG11   . VAL B 2 252 ? -3.192  7.963   33.506  1.00  49.99 ? 252 VAL B HG11   1 
ATOM   5417 H HG12   . VAL B 2 252 ? -3.302  8.954   34.945  1.00  49.49 ? 252 VAL B HG12   1 
ATOM   5418 H HG13   . VAL B 2 252 ? -4.637  8.903   33.812  1.00  49.66 ? 252 VAL B HG13   1 
ATOM   5419 H HG21   . VAL B 2 252 ? -6.086  7.021   33.616  1.00  50.39 ? 252 VAL B HG21   1 
ATOM   5420 H HG22   . VAL B 2 252 ? -5.942  5.558   34.556  1.00  50.47 ? 252 VAL B HG22   1 
ATOM   5421 H HG23   . VAL B 2 252 ? -4.791  5.899   33.282  1.00  50.24 ? 252 VAL B HG23   1 
ATOM   5422 N N      . THR B 2 253 ? -4.115  3.907   35.520  1.00  55.17 ? 253 THR B N      1 
ATOM   5423 C CA     . THR B 2 253 ? -4.037  2.528   34.991  1.00  57.53 ? 253 THR B CA     1 
ATOM   5424 C C      . THR B 2 253 ? -5.387  2.247   34.347  1.00  58.91 ? 253 THR B C      1 
ATOM   5425 O O      . THR B 2 253 ? -6.393  2.842   34.705  1.00  62.03 ? 253 THR B O      1 
ATOM   5426 C CB     . THR B 2 253 ? -3.800  1.478   36.109  1.00  55.24 ? 253 THR B CB     1 
ATOM   5427 O OG1    . THR B 2 253 ? -4.819  1.629   37.089  1.00  54.87 ? 253 THR B OG1    1 
ATOM   5428 C CG2    . THR B 2 253 ? -2.578  1.866   36.849  1.00  55.65 ? 253 THR B CG2    1 
ATOM   5429 H H      . THR B 2 253 ? -4.873  4.123   36.098  1.00  55.06 ? 253 THR B H      1 
ATOM   5430 H HA     . THR B 2 253 ? -3.270  2.484   34.236  1.00  58.72 ? 253 THR B HA     1 
ATOM   5431 H HB     . THR B 2 253 ? -3.766  0.463   35.734  1.00  55.00 ? 253 THR B HB     1 
ATOM   5432 H HG1    . THR B 2 253 ? -5.643  1.293   36.706  1.00  54.71 ? 253 THR B HG1    1 
ATOM   5433 H HG21   . THR B 2 253 ? -2.340  1.141   37.614  1.00  55.55 ? 253 THR B HG21   1 
ATOM   5434 H HG22   . THR B 2 253 ? -2.676  2.838   37.307  1.00  55.75 ? 253 THR B HG22   1 
ATOM   5435 H HG23   . THR B 2 253 ? -1.780  1.906   36.128  1.00  55.45 ? 253 THR B HG23   1 
ATOM   5436 N N      . GLN B 2 254 ? -5.328  1.356   33.417  1.00  58.45 ? 254 GLN B N      1 
ATOM   5437 C CA     . GLN B 2 254 ? -6.507  0.902   32.664  1.00  57.73 ? 254 GLN B CA     1 
ATOM   5438 C C      . GLN B 2 254 ? -6.141  -0.593  32.508  1.00  59.82 ? 254 GLN B C      1 
ATOM   5439 O O      . GLN B 2 254 ? -4.966  -0.843  32.276  1.00  58.99 ? 254 GLN B O      1 
ATOM   5440 C CB     A GLN B 2 254 ? -6.549  1.621   31.286  0.18  57.07 ? 254 GLN B CB     1 
ATOM   5441 C CB     B GLN B 2 254 ? -6.608  1.549   31.279  0.31  55.63 ? 254 GLN B CB     1 
ATOM   5442 C CG     A GLN B 2 254 ? -7.477  0.911   30.272  0.18  56.57 ? 254 GLN B CG     1 
ATOM   5443 C CG     B GLN B 2 254 ? -8.035  1.221   30.780  0.31  53.83 ? 254 GLN B CG     1 
ATOM   5444 C CD     A GLN B 2 254 ? -8.925  1.336   30.418  0.18  56.47 ? 254 GLN B CD     1 
ATOM   5445 C CD     B GLN B 2 254 ? -8.135  1.478   29.300  0.31  53.21 ? 254 GLN B CD     1 
ATOM   5446 O OE1    A GLN B 2 254 ? -9.311  2.395   29.964  0.18  57.45 ? 254 GLN B OE1    1 
ATOM   5447 O OE1    B GLN B 2 254 ? -8.982  2.207   28.835  0.31  51.96 ? 254 GLN B OE1    1 
ATOM   5448 N NE2    A GLN B 2 254 ? -9.756  0.553   31.029  0.18  56.60 ? 254 GLN B NE2    1 
ATOM   5449 N NE2    B GLN B 2 254 ? -7.293  0.906   28.506  0.31  53.37 ? 254 GLN B NE2    1 
ATOM   5450 H H      . GLN B 2 254 ? -4.468  0.934   33.185  1.00  58.07 ? 254 GLN B H      1 
ATOM   5451 H HA     . GLN B 2 254 ? -7.406  1.041   33.253  1.00  57.03 ? 254 GLN B HA     1 
ATOM   5452 H HB2    A GLN B 2 254 ? -6.895  2.635   31.427  0.18  56.86 ? 254 GLN B HB2    1 
ATOM   5453 H HB2    B GLN B 2 254 ? -6.487  2.618   31.354  0.31  55.24 ? 254 GLN B HB2    1 
ATOM   5454 H HB3    A GLN B 2 254 ? -5.556  1.641   30.867  0.18  56.87 ? 254 GLN B HB3    1 
ATOM   5455 H HB3    B GLN B 2 254 ? -5.859  1.144   30.616  0.31  55.34 ? 254 GLN B HB3    1 
ATOM   5456 H HG2    A GLN B 2 254 ? -7.152  1.122   29.264  0.18  56.41 ? 254 GLN B HG2    1 
ATOM   5457 H HG2    B GLN B 2 254 ? -8.281  0.183   30.971  0.31  53.81 ? 254 GLN B HG2    1 
ATOM   5458 H HG3    A GLN B 2 254 ? -7.422  -0.157  30.416  0.18  56.41 ? 254 GLN B HG3    1 
ATOM   5459 H HG3    B GLN B 2 254 ? -8.759  1.842   31.289  0.31  53.79 ? 254 GLN B HG3    1 
ATOM   5460 H HE21   A GLN B 2 254 ? -9.420  -0.284  31.421  0.18  55.80 ? 254 GLN B HE21   1 
ATOM   5461 H HE21   B GLN B 2 254 ? -6.602  0.314   28.874  0.31  53.27 ? 254 GLN B HE21   1 
ATOM   5462 H HE22   A GLN B 2 254 ? -10.705 0.795   31.099  0.18  55.85 ? 254 GLN B HE22   1 
ATOM   5463 H HE22   B GLN B 2 254 ? -7.332  1.056   27.542  0.31  53.16 ? 254 GLN B HE22   1 
HETATM 5464 C C1     . CR4 C 3 .   ? 16.370  -6.158  25.267  1.00  19.34 ? 346 CR4 B C1     1 
HETATM 5465 C C2     . CR4 C 3 .   ? 15.410  -5.181  24.818  1.00  21.79 ? 346 CR4 B C2     1 
HETATM 5466 C C3     . CR4 C 3 .   ? 15.009  -4.092  25.618  1.00  22.14 ? 346 CR4 B C3     1 
HETATM 5467 C C4     . CR4 C 3 .   ? 15.591  -4.025  26.849  1.00  21.88 ? 346 CR4 B C4     1 
HETATM 5468 C C5     . CR4 C 3 .   ? 16.499  -4.917  27.308  1.00  19.90 ? 346 CR4 B C5     1 
HETATM 5469 C C6     . CR4 C 3 .   ? 16.919  -5.994  26.561  1.00  18.97 ? 346 CR4 B C6     1 
HETATM 5470 C C7     . CR4 C 3 .   ? 16.752  -7.237  24.451  1.00  17.52 ? 346 CR4 B C7     1 
HETATM 5471 N N1     . CR4 C 3 .   ? 17.835  -7.911  24.685  1.00  17.11 ? 346 CR4 B N1     1 
HETATM 5472 N N2     . CR4 C 3 .   ? 16.036  -7.598  23.434  1.00  16.87 ? 346 CR4 B N2     1 
HETATM 5473 N N3     . CR4 C 3 .   ? 15.426  -3.165  27.785  1.00  23.44 ? 346 CR4 B N3     1 
HETATM 5474 N N4     . CR4 C 3 .   ? 16.924  -4.645  28.528  1.00  19.75 ? 346 CR4 B N4     1 
HETATM 5475 C C8     . CR4 C 3 .   ? 16.216  -3.553  28.752  1.00  24.62 ? 346 CR4 B C8     1 
HETATM 5476 C "C1'"  . CR4 C 3 .   ? 16.296  -2.869  29.973  1.00  27.58 ? 346 CR4 B "C1'"  1 
HETATM 5477 C "C2'"  . CR4 C 3 .   ? 17.284  -3.124  30.947  1.00  27.92 ? 346 CR4 B "C2'"  1 
HETATM 5478 C "C3'"  . CR4 C 3 .   ? 17.293  -2.450  32.155  1.00  29.52 ? 346 CR4 B "C3'"  1 
HETATM 5479 C "C4'"  . CR4 C 3 .   ? 16.311  -1.495  32.427  1.00  32.47 ? 346 CR4 B "C4'"  1 
HETATM 5480 C "C5'"  . CR4 C 3 .   ? 15.326  -1.221  31.480  1.00  30.32 ? 346 CR4 B "C5'"  1 
HETATM 5481 C "C6'"  . CR4 C 3 .   ? 15.325  -1.902  30.267  1.00  27.69 ? 346 CR4 B "C6'"  1 
HETATM 5482 O "O6'"  . CR4 C 3 .   ? 14.368  -1.637  29.300  1.00  22.64 ? 346 CR4 B "O6'"  1 
HETATM 5483 H HC2    . CR4 C 3 .   ? 14.974  -5.275  23.836  1.00  21.14 ? 346 CR4 B HC2    1 
HETATM 5484 H HC3    . CR4 C 3 .   ? 14.294  -3.355  25.292  1.00  22.05 ? 346 CR4 B HC3    1 
HETATM 5485 H HC6    . CR4 C 3 .   ? 17.641  -6.695  26.954  1.00  19.72 ? 346 CR4 B HC6    1 
HETATM 5486 H HH11   . CR4 C 3 .   ? 18.416  -7.665  25.459  1.00  17.41 ? 346 CR4 B HH11   1 
HETATM 5487 H HH12   . CR4 C 3 .   ? 18.108  -8.646  24.067  1.00  16.76 ? 346 CR4 B HH12   1 
HETATM 5488 H HH21   . CR4 C 3 .   ? 15.214  -7.089  23.206  1.00  17.61 ? 346 CR4 B HH21   1 
HETATM 5489 H HH22   . CR4 C 3 .   ? 16.322  -8.365  22.862  1.00  17.68 ? 346 CR4 B HH22   1 
HETATM 5490 H HN3    . CR4 C 3 .   ? 14.827  -2.398  27.773  1.00  21.71 ? 346 CR4 B HN3    1 
HETATM 5491 H "HC2'" . CR4 C 3 .   ? 18.053  -3.857  30.756  1.00  28.92 ? 346 CR4 B "HC2'" 1 
HETATM 5492 H "HC3'" . CR4 C 3 .   ? 18.059  -2.666  32.885  1.00  29.90 ? 346 CR4 B "HC3'" 1 
HETATM 5493 H "HC4'" . CR4 C 3 .   ? 16.313  -0.968  33.370  1.00  31.03 ? 346 CR4 B "HC4'" 1 
HETATM 5494 H "HC5'" . CR4 C 3 .   ? 14.567  -0.485  31.686  1.00  30.39 ? 346 CR4 B "HC5'" 1 
HETATM 5495 O O      . HOH D 4 .   ? 8.878   8.695   0.912   1.00  43.21 ? 115 HOH A O      1 
HETATM 5496 H H1     . HOH D 4 .   ? 8.805   9.617   0.573   1.00  43.81 ? 115 HOH A H1     1 
HETATM 5497 H H2     . HOH D 4 .   ? 9.603   8.422   0.338   1.00  43.57 ? 115 HOH A H2     1 
HETATM 5498 O O      . HOH D 4 .   ? -19.726 3.984   1.751   1.00  18.17 ? 116 HOH A O      1 
HETATM 5499 H H1     . HOH D 4 .   ? -18.934 3.461   1.520   1.00  17.54 ? 116 HOH A H1     1 
HETATM 5500 H H2     . HOH D 4 .   ? -19.371 4.752   2.229   1.00  17.27 ? 116 HOH A H2     1 
HETATM 5501 O O      . HOH D 4 .   ? -8.255  1.163   2.867   1.00  17.78 ? 117 HOH A O      1 
HETATM 5502 H H1     . HOH D 4 .   ? -7.446  1.631   2.593   1.00  18.69 ? 117 HOH A H1     1 
HETATM 5503 H H2     . HOH D 4 .   ? -8.218  1.258   3.827   1.00  17.31 ? 117 HOH A H2     1 
HETATM 5504 O O      . HOH D 4 .   ? -24.054 4.566   8.504   1.00  27.59 ? 118 HOH A O      1 
HETATM 5505 H H1     . HOH D 4 .   ? -24.162 4.315   7.581   1.00  27.22 ? 118 HOH A H1     1 
HETATM 5506 H H2     . HOH D 4 .   ? -23.816 5.512   8.437   1.00  27.36 ? 118 HOH A H2     1 
HETATM 5507 O O      . HOH D 4 .   ? -8.104  -1.211  4.823   1.00  16.19 ? 119 HOH A O      1 
HETATM 5508 H H1     . HOH D 4 .   ? -8.970  -1.661  4.890   1.00  17.28 ? 119 HOH A H1     1 
HETATM 5509 H H2     . HOH D 4 .   ? -8.144  -0.903  3.907   1.00  16.01 ? 119 HOH A H2     1 
HETATM 5510 O O      . HOH D 4 .   ? -4.078  6.542   12.496  1.00  27.61 ? 120 HOH A O      1 
HETATM 5511 H H1     . HOH D 4 .   ? -3.830  6.339   11.582  1.00  26.96 ? 120 HOH A H1     1 
HETATM 5512 H H2     . HOH D 4 .   ? -3.347  6.121   13.002  1.00  28.18 ? 120 HOH A H2     1 
HETATM 5513 O O      . HOH D 4 .   ? -9.728  7.803   5.047   1.00  30.38 ? 121 HOH A O      1 
HETATM 5514 H H1     . HOH D 4 .   ? -9.792  6.966   5.517   1.00  30.63 ? 121 HOH A H1     1 
HETATM 5515 H H2     . HOH D 4 .   ? -10.662 8.005   4.880   1.00  31.82 ? 121 HOH A H2     1 
HETATM 5516 O O      . HOH D 4 .   ? -6.783  4.858   0.815   1.00  33.07 ? 122 HOH A O      1 
HETATM 5517 H H1     . HOH D 4 .   ? -6.348  4.165   1.336   1.00  33.93 ? 122 HOH A H1     1 
HETATM 5518 H H2     . HOH D 4 .   ? -7.610  4.432   0.564   1.00  33.86 ? 122 HOH A H2     1 
HETATM 5519 O O      . HOH D 4 .   ? -6.122  -1.762  6.814   1.00  21.11 ? 123 HOH A O      1 
HETATM 5520 H H1     . HOH D 4 .   ? -6.903  -1.506  6.295   1.00  22.95 ? 123 HOH A H1     1 
HETATM 5521 H H2     . HOH D 4 .   ? -6.270  -1.383  7.696   1.00  20.93 ? 123 HOH A H2     1 
HETATM 5522 O O      . HOH D 4 .   ? -8.470  1.328   -0.179  1.00  51.60 ? 124 HOH A O      1 
HETATM 5523 H H1     . HOH D 4 .   ? -8.244  0.784   0.600   1.00  50.16 ? 124 HOH A H1     1 
HETATM 5524 H H2     . HOH D 4 .   ? -8.771  2.165   0.218   1.00  50.37 ? 124 HOH A H2     1 
HETATM 5525 O O      . HOH D 4 .   ? -1.397  10.471  -3.360  1.00  81.63 ? 125 HOH A O      1 
HETATM 5526 H H1     . HOH D 4 .   ? -1.584  10.075  -4.215  1.00  81.84 ? 125 HOH A H1     1 
HETATM 5527 H H2     . HOH D 4 .   ? -0.963  9.764   -2.875  1.00  81.99 ? 125 HOH A H2     1 
HETATM 5528 O O      . HOH D 4 .   ? -12.868 -1.202  17.345  1.00  33.73 ? 126 HOH A O      1 
HETATM 5529 H H1     . HOH D 4 .   ? -12.596 -0.400  17.799  1.00  33.86 ? 126 HOH A H1     1 
HETATM 5530 H H2     . HOH D 4 .   ? -13.642 -1.475  17.855  1.00  34.04 ? 126 HOH A H2     1 
HETATM 5531 O O      . HOH D 4 .   ? -12.430 -3.021  15.353  1.00  35.97 ? 127 HOH A O      1 
HETATM 5532 H H1     . HOH D 4 .   ? -13.319 -3.355  15.552  1.00  36.18 ? 127 HOH A H1     1 
HETATM 5533 H H2     . HOH D 4 .   ? -12.373 -2.311  16.021  1.00  35.24 ? 127 HOH A H2     1 
HETATM 5534 O O      . HOH D 4 .   ? -23.959 10.100  13.356  1.00  36.31 ? 128 HOH A O      1 
HETATM 5535 H H1     . HOH D 4 .   ? -24.056 11.016  13.635  1.00  36.67 ? 128 HOH A H1     1 
HETATM 5536 H H2     . HOH D 4 .   ? -24.887 9.786   13.386  1.00  37.35 ? 128 HOH A H2     1 
HETATM 5537 O O      . HOH D 4 .   ? -22.550 0.456   -4.899  1.00  34.61 ? 129 HOH A O      1 
HETATM 5538 H H1     . HOH D 4 .   ? -21.586 0.650   -5.017  1.00  34.68 ? 129 HOH A H1     1 
HETATM 5539 H H2     . HOH D 4 .   ? -22.610 0.210   -3.964  1.00  34.50 ? 129 HOH A H2     1 
HETATM 5540 O O      . HOH D 4 .   ? -1.812  11.572  10.557  1.00  47.14 ? 130 HOH A O      1 
HETATM 5541 H H1     . HOH D 4 .   ? -1.867  10.604  10.415  1.00  46.77 ? 130 HOH A H1     1 
HETATM 5542 H H2     . HOH D 4 .   ? -2.604  11.757  11.069  1.00  46.06 ? 130 HOH A H2     1 
HETATM 5543 O O      . HOH D 4 .   ? -26.855 2.067   7.184   1.00  27.97 ? 131 HOH A O      1 
HETATM 5544 H H1     . HOH D 4 .   ? -27.585 2.172   6.556   1.00  28.15 ? 131 HOH A H1     1 
HETATM 5545 H H2     . HOH D 4 .   ? -26.207 2.699   6.809   1.00  27.53 ? 131 HOH A H2     1 
HETATM 5546 O O      . HOH D 4 .   ? -18.943 -10.117 3.478   1.00  60.51 ? 132 HOH A O      1 
HETATM 5547 H H1     . HOH D 4 .   ? -18.305 -10.388 4.153   1.00  59.28 ? 132 HOH A H1     1 
HETATM 5548 H H2     . HOH D 4 .   ? -18.603 -9.220  3.262   1.00  59.32 ? 132 HOH A H2     1 
HETATM 5549 O O      . HOH D 4 .   ? -21.628 -11.052 3.151   1.00  69.13 ? 133 HOH A O      1 
HETATM 5550 H H1     . HOH D 4 .   ? -22.083 -10.426 3.712   1.00  68.91 ? 133 HOH A H1     1 
HETATM 5551 H H2     . HOH D 4 .   ? -20.690 -10.835 3.318   1.00  69.07 ? 133 HOH A H2     1 
HETATM 5552 O O      . HOH D 4 .   ? -13.917 14.825  3.751   1.00  64.79 ? 134 HOH A O      1 
HETATM 5553 H H1     . HOH D 4 .   ? -13.018 14.683  3.417   1.00  65.59 ? 134 HOH A H1     1 
HETATM 5554 H H2     . HOH D 4 .   ? -14.306 15.352  3.045   1.00  65.46 ? 134 HOH A H2     1 
HETATM 5555 O O      . HOH D 4 .   ? -24.925 -10.149 5.811   1.00  79.70 ? 135 HOH A O      1 
HETATM 5556 H H1     . HOH D 4 .   ? -24.875 -9.465  6.501   1.00  77.80 ? 135 HOH A H1     1 
HETATM 5557 H H2     . HOH D 4 .   ? -24.053 -10.555 5.884   1.00  77.79 ? 135 HOH A H2     1 
HETATM 5558 O O      . HOH D 4 .   ? -26.170 3.191   16.667  1.00  62.41 ? 136 HOH A O      1 
HETATM 5559 H H1     . HOH D 4 .   ? -26.426 3.614   15.826  1.00  61.62 ? 136 HOH A H1     1 
HETATM 5560 H H2     . HOH D 4 .   ? -26.679 2.371   16.691  1.00  61.90 ? 136 HOH A H2     1 
HETATM 5561 O O      . HOH D 4 .   ? 12.331  0.199   4.648   1.00  39.30 ? 137 HOH A O      1 
HETATM 5562 H H1     . HOH D 4 .   ? 12.203  0.081   5.591   1.00  38.96 ? 137 HOH A H1     1 
HETATM 5563 H H2     . HOH D 4 .   ? 12.333  -0.723  4.339   1.00  39.65 ? 137 HOH A H2     1 
HETATM 5564 O O      . HOH D 4 .   ? -29.003 1.812   9.143   1.00  55.10 ? 138 HOH A O      1 
HETATM 5565 H H1     . HOH D 4 .   ? -28.277 1.937   8.511   1.00  55.77 ? 138 HOH A H1     1 
HETATM 5566 H H2     . HOH D 4 .   ? -28.639 1.128   9.731   1.00  56.16 ? 138 HOH A H2     1 
HETATM 5567 O O      . HOH D 4 .   ? -27.877 -3.241  -2.311  1.00  32.41 ? 139 HOH A O      1 
HETATM 5568 H H1     . HOH D 4 .   ? -28.404 -2.907  -1.555  1.00  32.15 ? 139 HOH A H1     1 
HETATM 5569 H H2     . HOH D 4 .   ? -28.177 -4.149  -2.381  1.00  32.81 ? 139 HOH A H2     1 
HETATM 5570 O O      . HOH D 4 .   ? -13.005 7.902   15.928  1.00  32.14 ? 140 HOH A O      1 
HETATM 5571 H H1     . HOH D 4 .   ? -12.972 8.121   16.862  1.00  31.84 ? 140 HOH A H1     1 
HETATM 5572 H H2     . HOH D 4 .   ? -13.657 8.535   15.588  1.00  31.21 ? 140 HOH A H2     1 
HETATM 5573 O O      . HOH D 4 .   ? -5.487  7.402   5.203   1.00  47.00 ? 141 HOH A O      1 
HETATM 5574 H H1     . HOH D 4 .   ? -5.357  7.528   4.252   1.00  46.23 ? 141 HOH A H1     1 
HETATM 5575 H H2     . HOH D 4 .   ? -6.436  7.263   5.278   1.00  45.75 ? 141 HOH A H2     1 
HETATM 5576 O O      . HOH D 4 .   ? -11.361 13.876  1.099   1.00  69.65 ? 142 HOH A O      1 
HETATM 5577 H H1     . HOH D 4 .   ? -11.744 13.897  0.220   1.00  67.67 ? 142 HOH A H1     1 
HETATM 5578 H H2     . HOH D 4 .   ? -10.730 13.134  1.008   1.00  67.75 ? 142 HOH A H2     1 
HETATM 5579 O O      . HOH D 4 .   ? -15.302 12.903  5.054   1.00  57.36 ? 143 HOH A O      1 
HETATM 5580 H H1     . HOH D 4 .   ? -14.777 13.665  4.721   1.00  57.73 ? 143 HOH A H1     1 
HETATM 5581 H H2     . HOH D 4 .   ? -15.012 12.199  4.469   1.00  57.67 ? 143 HOH A H2     1 
HETATM 5582 O O      . HOH D 4 .   ? -4.777  7.923   1.708   1.00  62.11 ? 144 HOH A O      1 
HETATM 5583 H H1     . HOH D 4 .   ? -4.281  8.128   0.893   1.00  61.03 ? 144 HOH A H1     1 
HETATM 5584 H H2     . HOH D 4 .   ? -5.506  7.391   1.379   1.00  60.98 ? 144 HOH A H2     1 
HETATM 5585 O O      . HOH D 4 .   ? -3.737  8.983   -0.690  1.00  73.47 ? 145 HOH A O      1 
HETATM 5586 H H1     . HOH D 4 .   ? -3.166  9.733   -0.486  1.00  70.90 ? 145 HOH A H1     1 
HETATM 5587 H H2     . HOH D 4 .   ? -4.081  9.218   -1.556  1.00  70.95 ? 145 HOH A H2     1 
HETATM 5588 O O      . HOH D 4 .   ? -20.900 -17.523 1.635   1.00  69.59 ? 146 HOH A O      1 
HETATM 5589 H H1     . HOH D 4 .   ? -20.947 -18.412 1.235   1.00  68.89 ? 146 HOH A H1     1 
HETATM 5590 H H2     . HOH D 4 .   ? -19.955 -17.378 1.632   1.00  68.90 ? 146 HOH A H2     1 
HETATM 5591 O O      . HOH D 4 .   ? 6.181   4.654   3.479   1.00  31.07 ? 147 HOH A O      1 
HETATM 5592 H H1     . HOH D 4 .   ? 6.385   5.027   2.598   1.00  30.38 ? 147 HOH A H1     1 
HETATM 5593 H H2     . HOH D 4 .   ? 5.828   3.772   3.266   1.00  32.00 ? 147 HOH A H2     1 
HETATM 5594 O O      . HOH D 4 .   ? -15.842 12.101  13.382  1.00  57.46 ? 148 HOH A O      1 
HETATM 5595 H H1     . HOH D 4 .   ? -16.131 12.936  13.001  1.00  57.25 ? 148 HOH A H1     1 
HETATM 5596 H H2     . HOH D 4 .   ? -14.893 12.233  13.511  1.00  57.18 ? 148 HOH A H2     1 
HETATM 5597 O O      . HOH D 4 .   ? -24.590 0.602   -6.686  1.00  61.79 ? 149 HOH A O      1 
HETATM 5598 H H1     . HOH D 4 .   ? -24.888 1.491   -6.493  1.00  60.07 ? 149 HOH A H1     1 
HETATM 5599 H H2     . HOH D 4 .   ? -23.774 0.551   -6.143  1.00  60.30 ? 149 HOH A H2     1 
HETATM 5600 O O      . HOH D 4 .   ? -29.576 3.854   6.271   1.00  45.77 ? 150 HOH A O      1 
HETATM 5601 H H1     . HOH D 4 .   ? -28.991 4.603   6.025   1.00  46.99 ? 150 HOH A H1     1 
HETATM 5602 H H2     . HOH D 4 .   ? -29.721 3.433   5.414   1.00  46.65 ? 150 HOH A H2     1 
HETATM 5603 O O      . HOH D 4 .   ? -31.991 -0.527  7.784   1.00  67.01 ? 151 HOH A O      1 
HETATM 5604 H H1     . HOH D 4 .   ? -31.419 -0.507  7.010   1.00  67.65 ? 151 HOH A H1     1 
HETATM 5605 H H2     . HOH D 4 .   ? -31.389 -0.297  8.497   1.00  67.35 ? 151 HOH A H2     1 
HETATM 5606 O O      . HOH D 4 .   ? -10.173 0.891   -2.212  1.00  65.45 ? 152 HOH A O      1 
HETATM 5607 H H1     . HOH D 4 .   ? -9.540  0.974   -1.469  1.00  64.98 ? 152 HOH A H1     1 
HETATM 5608 H H2     . HOH D 4 .   ? -10.635 0.053   -2.035  1.00  64.88 ? 152 HOH A H2     1 
HETATM 5609 O O      . HOH D 4 .   ? -13.797 6.123   -4.943  1.00  39.09 ? 153 HOH A O      1 
HETATM 5610 H H1     . HOH D 4 .   ? -13.573 5.446   -5.591  1.00  38.28 ? 153 HOH A H1     1 
HETATM 5611 H H2     . HOH D 4 .   ? -14.259 6.771   -5.511  1.00  38.90 ? 153 HOH A H2     1 
HETATM 5612 O O      . HOH D 4 .   ? -27.283 -9.497  4.375   1.00  68.37 ? 154 HOH A O      1 
HETATM 5613 H H1     . HOH D 4 .   ? -27.708 -10.276 4.005   1.00  67.39 ? 154 HOH A H1     1 
HETATM 5614 H H2     . HOH D 4 .   ? -26.483 -9.858  4.801   1.00  67.48 ? 154 HOH A H2     1 
HETATM 5615 O O      . HOH D 4 .   ? -16.169 9.193   14.655  1.00  49.76 ? 155 HOH A O      1 
HETATM 5616 H H1     . HOH D 4 .   ? -16.982 8.761   14.351  1.00  49.15 ? 155 HOH A H1     1 
HETATM 5617 H H2     . HOH D 4 .   ? -16.205 10.065  14.227  1.00  49.05 ? 155 HOH A H2     1 
HETATM 5618 O O      . HOH D 4 .   ? -34.178 2.169   4.559   1.00  95.20 ? 156 HOH A O      1 
HETATM 5619 H H1     . HOH D 4 .   ? -34.662 2.692   5.206   1.00  92.26 ? 156 HOH A H1     1 
HETATM 5620 H H2     . HOH D 4 .   ? -34.310 1.269   4.864   1.00  92.26 ? 156 HOH A H2     1 
HETATM 5621 O O      . HOH D 4 .   ? -12.525 2.333   -6.768  1.00  68.32 ? 157 HOH A O      1 
HETATM 5622 H H1     . HOH D 4 .   ? -13.478 2.161   -6.854  1.00  68.05 ? 157 HOH A H1     1 
HETATM 5623 H H2     . HOH D 4 .   ? -12.204 2.167   -7.659  1.00  67.84 ? 157 HOH A H2     1 
HETATM 5624 O O      . HOH D 4 .   ? -24.014 -16.021 -3.997  1.00  88.95 ? 158 HOH A O      1 
HETATM 5625 H H1     . HOH D 4 .   ? -23.094 -15.719 -3.938  1.00  87.63 ? 158 HOH A H1     1 
HETATM 5626 H H2     . HOH D 4 .   ? -24.046 -16.393 -4.883  1.00  87.67 ? 158 HOH A H2     1 
HETATM 5627 O O      . HOH D 4 .   ? -33.644 -2.998  2.133   1.00  56.12 ? 159 HOH A O      1 
HETATM 5628 H H1     . HOH D 4 .   ? -34.421 -2.910  2.696   1.00  56.41 ? 159 HOH A H1     1 
HETATM 5629 H H2     . HOH D 4 .   ? -33.441 -3.937  2.237   1.00  56.03 ? 159 HOH A H2     1 
HETATM 5630 O O      . HOH D 4 .   ? -29.662 3.748   -4.047  1.00  50.21 ? 160 HOH A O      1 
HETATM 5631 H H1     . HOH D 4 .   ? -29.833 2.815   -3.901  1.00  49.12 ? 160 HOH A H1     1 
HETATM 5632 H H2     . HOH D 4 .   ? -29.941 4.107   -3.193  1.00  49.22 ? 160 HOH A H2     1 
HETATM 5633 O O      . HOH D 4 .   ? -15.445 -1.908  20.300  1.00  71.31 ? 161 HOH A O      1 
HETATM 5634 H H1     . HOH D 4 .   ? -16.359 -2.129  20.056  1.00  71.44 ? 161 HOH A H1     1 
HETATM 5635 H H2     . HOH D 4 .   ? -15.573 -1.357  21.075  1.00  70.99 ? 161 HOH A H2     1 
HETATM 5636 O O      . HOH D 4 .   ? -10.309 4.890   -6.368  1.00  67.20 ? 162 HOH A O      1 
HETATM 5637 H H1     . HOH D 4 .   ? -9.404  4.720   -6.085  1.00  66.29 ? 162 HOH A H1     1 
HETATM 5638 H H2     . HOH D 4 .   ? -10.756 4.049   -6.198  1.00  66.41 ? 162 HOH A H2     1 
HETATM 5639 O O      . HOH D 4 .   ? -4.314  6.650   -4.946  1.00  76.78 ? 163 HOH A O      1 
HETATM 5640 H H1     . HOH D 4 .   ? -3.378  6.727   -5.143  1.00  75.99 ? 163 HOH A H1     1 
HETATM 5641 H H2     . HOH D 4 .   ? -4.618  6.030   -5.618  1.00  75.95 ? 163 HOH A H2     1 
HETATM 5642 O O      . HOH D 4 .   ? 6.949   6.127   1.138   1.00  69.34 ? 164 HOH A O      1 
HETATM 5643 H H1     . HOH D 4 .   ? 7.023   6.425   0.227   1.00  68.72 ? 164 HOH A H1     1 
HETATM 5644 H H2     . HOH D 4 .   ? 7.124   6.967   1.590   1.00  69.17 ? 164 HOH A H2     1 
HETATM 5645 O O      . HOH D 4 .   ? 11.188  5.793   1.770   1.00  64.56 ? 165 HOH A O      1 
HETATM 5646 H H1     . HOH D 4 .   ? 11.670  5.015   1.471   1.00  64.73 ? 165 HOH A H1     1 
HETATM 5647 H H2     . HOH D 4 .   ? 10.508  5.904   1.099   1.00  64.87 ? 165 HOH A H2     1 
HETATM 5648 O O      . HOH D 4 .   ? -15.056 -11.062 4.725   1.00  66.10 ? 166 HOH A O      1 
HETATM 5649 H H1     . HOH D 4 .   ? -14.504 -11.473 4.046   1.00  66.30 ? 166 HOH A H1     1 
HETATM 5650 H H2     . HOH D 4 .   ? -14.592 -11.302 5.532   1.00  65.87 ? 166 HOH A H2     1 
HETATM 5651 O O      . HOH D 4 .   ? 13.512  9.374   -0.207  1.00  65.43 ? 167 HOH A O      1 
HETATM 5652 H H1     . HOH D 4 .   ? 13.019  9.845   -0.934  1.00  65.40 ? 167 HOH A H1     1 
HETATM 5653 H H2     . HOH D 4 .   ? 12.782  9.330   0.412   1.00  65.29 ? 167 HOH A H2     1 
HETATM 5654 O O      . HOH D 4 .   ? -23.338 -7.786  17.830  1.00  67.28 ? 168 HOH A O      1 
HETATM 5655 H H1     . HOH D 4 .   ? -22.997 -6.909  18.037  1.00  67.33 ? 168 HOH A H1     1 
HETATM 5656 H H2     . HOH D 4 .   ? -22.861 -8.030  17.035  1.00  67.57 ? 168 HOH A H2     1 
HETATM 5657 O O      . HOH D 4 .   ? -27.776 -5.417  10.311  1.00  63.14 ? 169 HOH A O      1 
HETATM 5658 H H1     . HOH D 4 .   ? -28.142 -5.634  9.423   1.00  63.86 ? 169 HOH A H1     1 
HETATM 5659 H H2     . HOH D 4 .   ? -26.959 -4.961  10.101  1.00  64.37 ? 169 HOH A H2     1 
HETATM 5660 O O      . HOH D 4 .   ? -20.660 -20.033 0.383   1.00  70.25 ? 170 HOH A O      1 
HETATM 5661 H H1     . HOH D 4 .   ? -20.222 -20.488 -0.344  1.00  69.55 ? 170 HOH A H1     1 
HETATM 5662 H H2     . HOH D 4 .   ? -21.176 -20.730 0.797   1.00  69.69 ? 170 HOH A H2     1 
HETATM 5663 O O      . HOH D 4 .   ? -21.914 13.473  -3.450  1.00  40.22 ? 171 HOH A O      1 
HETATM 5664 H H1     . HOH D 4 .   ? -22.029 14.232  -2.870  1.00  39.95 ? 171 HOH A H1     1 
HETATM 5665 H H2     . HOH D 4 .   ? -22.674 13.539  -4.053  1.00  41.07 ? 171 HOH A H2     1 
HETATM 5666 O O      . HOH D 4 .   ? -22.060 -9.126  -7.871  1.00  66.98 ? 172 HOH A O      1 
HETATM 5667 H H1     . HOH D 4 .   ? -22.267 -8.857  -6.969  1.00  66.55 ? 172 HOH A H1     1 
HETATM 5668 H H2     . HOH D 4 .   ? -22.610 -8.536  -8.390  1.00  66.86 ? 172 HOH A H2     1 
HETATM 5669 O O      . HOH D 4 .   ? -36.610 -5.904  4.689   1.00  89.11 ? 173 HOH A O      1 
HETATM 5670 H H1     . HOH D 4 .   ? -37.352 -5.981  5.295   1.00  87.05 ? 173 HOH A H1     1 
HETATM 5671 H H2     . HOH D 4 .   ? -37.012 -5.694  3.844   1.00  87.05 ? 173 HOH A H2     1 
HETATM 5672 O O      . HOH D 4 .   ? -15.031 7.918   -7.206  1.00  59.21 ? 174 HOH A O      1 
HETATM 5673 H H1     . HOH D 4 .   ? -15.577 8.671   -7.465  1.00  58.65 ? 174 HOH A H1     1 
HETATM 5674 H H2     . HOH D 4 .   ? -14.221 8.087   -7.720  1.00  58.95 ? 174 HOH A H2     1 
HETATM 5675 O O      . HOH D 4 .   ? -9.747  11.670  0.522   1.00  62.25 ? 175 HOH A O      1 
HETATM 5676 H H1     . HOH D 4 .   ? -9.401  11.137  1.247   1.00  62.02 ? 175 HOH A H1     1 
HETATM 5677 H H2     . HOH D 4 .   ? -9.145  11.471  -0.205  1.00  62.39 ? 175 HOH A H2     1 
HETATM 5678 O O      . HOH D 4 .   ? -10.542 5.576   18.336  1.00  44.36 ? 176 HOH A O      1 
HETATM 5679 H H1     . HOH D 4 .   ? -11.166 4.915   18.044  1.00  44.15 ? 176 HOH A H1     1 
HETATM 5680 H H2     . HOH D 4 .   ? -9.834  5.501   17.665  1.00  44.87 ? 176 HOH A H2     1 
HETATM 5681 O O      . HOH D 4 .   ? -16.208 5.766   17.629  1.00  67.32 ? 177 HOH A O      1 
HETATM 5682 H H1     . HOH D 4 .   ? -16.466 6.364   16.926  1.00  66.95 ? 177 HOH A H1     1 
HETATM 5683 H H2     . HOH D 4 .   ? -15.249 5.815   17.613  1.00  66.80 ? 177 HOH A H2     1 
HETATM 5684 O O      . HOH D 4 .   ? -6.846  11.070  -4.948  1.00  43.24 ? 178 HOH A O      1 
HETATM 5685 H H1     . HOH D 4 .   ? -6.822  10.625  -4.092  1.00  43.46 ? 178 HOH A H1     1 
HETATM 5686 H H2     . HOH D 4 .   ? -6.428  10.437  -5.539  1.00  43.24 ? 178 HOH A H2     1 
HETATM 5687 O O      . HOH D 4 .   ? -26.726 -12.878 6.143   1.00  85.10 ? 179 HOH A O      1 
HETATM 5688 H H1     . HOH D 4 .   ? -26.418 -13.335 5.353   1.00  84.24 ? 179 HOH A H1     1 
HETATM 5689 H H2     . HOH D 4 .   ? -26.173 -12.086 6.170   1.00  84.44 ? 179 HOH A H2     1 
HETATM 5690 O O      . HOH D 4 .   ? -12.624 13.661  -3.169  1.00  63.86 ? 180 HOH A O      1 
HETATM 5691 H H1     . HOH D 4 .   ? -11.924 12.995  -3.305  1.00  64.19 ? 180 HOH A H1     1 
HETATM 5692 H H2     . HOH D 4 .   ? -12.146 14.489  -3.243  1.00  64.01 ? 180 HOH A H2     1 
HETATM 5693 O O      . HOH D 4 .   ? -4.512  12.506  8.921   1.00  60.50 ? 181 HOH A O      1 
HETATM 5694 H H1     . HOH D 4 .   ? -4.060  12.743  8.104   1.00  60.73 ? 181 HOH A H1     1 
HETATM 5695 H H2     . HOH D 4 .   ? -4.834  13.355  9.236   1.00  60.81 ? 181 HOH A H2     1 
HETATM 5696 O O      . HOH D 4 .   ? -20.184 -13.410 18.776  1.00  68.88 ? 182 HOH A O      1 
HETATM 5697 H H1     . HOH D 4 .   ? -20.872 -13.884 18.307  1.00  67.55 ? 182 HOH A H1     1 
HETATM 5698 H H2     . HOH D 4 .   ? -20.665 -12.742 19.265  1.00  67.52 ? 182 HOH A H2     1 
HETATM 5699 O O      . HOH E 4 .   ? 8.652   10.532  6.407   1.00  15.70 ? 347 HOH B O      1 
HETATM 5700 H H1     . HOH E 4 .   ? 9.409   9.951   6.595   1.00  17.86 ? 347 HOH B H1     1 
HETATM 5701 H H2     . HOH E 4 .   ? 8.880   11.345  6.892   1.00  17.47 ? 347 HOH B H2     1 
HETATM 5702 O O      . HOH E 4 .   ? 15.662  9.365   4.981   1.00  43.36 ? 348 HOH B O      1 
HETATM 5703 H H1     . HOH E 4 .   ? 15.536  9.714   4.078   1.00  43.26 ? 348 HOH B H1     1 
HETATM 5704 H H2     . HOH E 4 .   ? 15.275  10.055  5.551   1.00  42.87 ? 348 HOH B H2     1 
HETATM 5705 O O      . HOH E 4 .   ? 20.637  1.665   19.233  1.00  12.23 ? 349 HOH B O      1 
HETATM 5706 H H1     . HOH E 4 .   ? 21.214  2.034   19.935  1.00  12.06 ? 349 HOH B H1     1 
HETATM 5707 H H2     . HOH E 4 .   ? 20.377  2.447   18.724  1.00  11.18 ? 349 HOH B H2     1 
HETATM 5708 O O      . HOH E 4 .   ? 6.185   1.597   20.767  1.00  14.12 ? 350 HOH B O      1 
HETATM 5709 H H1     . HOH E 4 .   ? 6.927   1.327   21.331  1.00  14.88 ? 350 HOH B H1     1 
HETATM 5710 H H2     . HOH E 4 .   ? 5.691   2.150   21.385  1.00  13.77 ? 350 HOH B H2     1 
HETATM 5711 O O      . HOH E 4 .   ? 10.413  2.161   13.410  1.00  13.10 ? 351 HOH B O      1 
HETATM 5712 H H1     . HOH E 4 .   ? 10.976  1.911   12.671  1.00  12.64 ? 351 HOH B H1     1 
HETATM 5713 H H2     . HOH E 4 .   ? 11.048  2.100   14.150  1.00  14.86 ? 351 HOH B H2     1 
HETATM 5714 O O      . HOH E 4 .   ? 13.382  2.077   20.597  1.00  11.68 ? 352 HOH B O      1 
HETATM 5715 H H1     . HOH E 4 .   ? 13.511  1.743   19.677  1.00  9.46  ? 352 HOH B H1     1 
HETATM 5716 H H2     . HOH E 4 .   ? 13.004  1.293   21.027  1.00  9.36  ? 352 HOH B H2     1 
HETATM 5717 O O      . HOH E 4 .   ? 9.698   11.483  15.359  1.00  18.24 ? 353 HOH B O      1 
HETATM 5718 H H1     . HOH E 4 .   ? 10.178  10.770  15.826  1.00  19.34 ? 353 HOH B H1     1 
HETATM 5719 H H2     . HOH E 4 .   ? 9.006   10.985  14.897  1.00  19.62 ? 353 HOH B H2     1 
HETATM 5720 O O      . HOH E 4 .   ? 18.677  14.426  13.503  1.00  20.14 ? 354 HOH B O      1 
HETATM 5721 H H1     . HOH E 4 .   ? 19.372  14.259  12.837  1.00  20.13 ? 354 HOH B H1     1 
HETATM 5722 H H2     . HOH E 4 .   ? 18.447  15.350  13.278  1.00  20.67 ? 354 HOH B H2     1 
HETATM 5723 O O      . HOH E 4 .   ? 12.152  11.338  11.246  1.00  22.57 ? 355 HOH B O      1 
HETATM 5724 H H1     . HOH E 4 .   ? 12.454  10.770  11.980  1.00  23.81 ? 355 HOH B H1     1 
HETATM 5725 H H2     . HOH E 4 .   ? 11.383  11.763  11.661  1.00  22.79 ? 355 HOH B H2     1 
HETATM 5726 O O      . HOH E 4 .   ? 12.893  10.317  15.677  1.00  28.50 ? 356 HOH B O      1 
HETATM 5727 H H1     . HOH E 4 .   ? 12.882  9.947   14.776  1.00  28.30 ? 356 HOH B H1     1 
HETATM 5728 H H2     . HOH E 4 .   ? 13.753  10.752  15.707  1.00  29.58 ? 356 HOH B H2     1 
HETATM 5729 O O      . HOH E 4 .   ? 15.194  3.892   21.895  1.00  13.37 ? 357 HOH B O      1 
HETATM 5730 H H1     . HOH E 4 .   ? 14.948  3.364   22.664  1.00  11.37 ? 357 HOH B H1     1 
HETATM 5731 H H2     . HOH E 4 .   ? 14.566  3.527   21.241  1.00  13.67 ? 357 HOH B H2     1 
HETATM 5732 O O      . HOH E 4 .   ? -1.579  -1.605  4.069   1.00  15.54 ? 358 HOH B O      1 
HETATM 5733 H H1     . HOH E 4 .   ? -0.708  -1.956  4.297   1.00  16.55 ? 358 HOH B H1     1 
HETATM 5734 H H2     . HOH E 4 .   ? -1.320  -0.966  3.368   1.00  15.65 ? 358 HOH B H2     1 
HETATM 5735 O O      . HOH E 4 .   ? 15.207  -7.016  29.997  1.00  36.75 ? 359 HOH B O      1 
HETATM 5736 H H1     . HOH E 4 .   ? 16.085  -7.009  29.585  1.00  37.58 ? 359 HOH B H1     1 
HETATM 5737 H H2     . HOH E 4 .   ? 15.458  -7.097  30.929  1.00  37.41 ? 359 HOH B H2     1 
HETATM 5738 O O      . HOH E 4 .   ? 17.368  -10.707 24.210  1.00  50.26 ? 360 HOH B O      1 
HETATM 5739 H H1     . HOH E 4 .   ? 17.563  -9.769  24.153  1.00  51.17 ? 360 HOH B H1     1 
HETATM 5740 H H2     . HOH E 4 .   ? 18.247  -11.080 24.359  1.00  51.10 ? 360 HOH B H2     1 
HETATM 5741 O O      . HOH E 4 .   ? 19.622  -12.415 20.441  1.00  21.98 ? 361 HOH B O      1 
HETATM 5742 H H1     . HOH E 4 .   ? 20.208  -13.190 20.567  1.00  21.65 ? 361 HOH B H1     1 
HETATM 5743 H H2     . HOH E 4 .   ? 19.119  -12.452 21.274  1.00  20.06 ? 361 HOH B H2     1 
HETATM 5744 O O      . HOH E 4 .   ? 15.158  -8.741  18.573  1.00  18.13 ? 362 HOH B O      1 
HETATM 5745 H H1     . HOH E 4 .   ? 14.658  -9.561  18.445  1.00  17.53 ? 362 HOH B H1     1 
HETATM 5746 H H2     . HOH E 4 .   ? 14.454  -8.089  18.762  1.00  18.24 ? 362 HOH B H2     1 
HETATM 5747 O O      . HOH E 4 .   ? 0.697   -7.378  17.024  1.00  14.35 ? 363 HOH B O      1 
HETATM 5748 H H1     . HOH E 4 .   ? 0.661   -7.656  16.094  1.00  14.28 ? 363 HOH B H1     1 
HETATM 5749 H H2     . HOH E 4 .   ? 1.643   -7.285  17.207  1.00  16.93 ? 363 HOH B H2     1 
HETATM 5750 O O      . HOH E 4 .   ? 26.731  -7.320  34.045  1.00  47.42 ? 364 HOH B O      1 
HETATM 5751 H H1     . HOH E 4 .   ? 25.978  -6.744  34.301  1.00  47.11 ? 364 HOH B H1     1 
HETATM 5752 H H2     . HOH E 4 .   ? 27.474  -6.825  34.449  1.00  47.07 ? 364 HOH B H2     1 
HETATM 5753 O O      . HOH E 4 .   ? 26.535  -16.412 18.274  1.00  74.95 ? 365 HOH B O      1 
HETATM 5754 H H1     . HOH E 4 .   ? 25.713  -16.202 17.796  1.00  73.43 ? 365 HOH B H1     1 
HETATM 5755 H H2     . HOH E 4 .   ? 26.569  -15.692 18.910  1.00  73.09 ? 365 HOH B H2     1 
HETATM 5756 O O      . HOH E 4 .   ? 13.229  -5.122  30.178  1.00  30.20 ? 366 HOH B O      1 
HETATM 5757 H H1     . HOH E 4 .   ? 13.959  -5.774  30.079  1.00  30.17 ? 366 HOH B H1     1 
HETATM 5758 H H2     . HOH E 4 .   ? 12.811  -5.171  29.303  1.00  30.74 ? 366 HOH B H2     1 
HETATM 5759 O O      . HOH E 4 .   ? 18.731  -6.659  29.543  1.00  39.90 ? 367 HOH B O      1 
HETATM 5760 H H1     . HOH E 4 .   ? 18.915  -6.451  28.622  1.00  39.74 ? 367 HOH B H1     1 
HETATM 5761 H H2     . HOH E 4 .   ? 18.761  -7.623  29.543  1.00  39.72 ? 367 HOH B H2     1 
HETATM 5762 O O      . HOH E 4 .   ? 23.420  3.715   29.503  1.00  85.84 ? 368 HOH B O      1 
HETATM 5763 H H1     . HOH E 4 .   ? 23.340  4.666   29.654  1.00  85.09 ? 368 HOH B H1     1 
HETATM 5764 H H2     . HOH E 4 .   ? 24.354  3.554   29.694  1.00  85.19 ? 368 HOH B H2     1 
HETATM 5765 O O      . HOH E 4 .   ? 20.060  -11.764 23.963  1.00  21.64 ? 369 HOH B O      1 
HETATM 5766 H H1     . HOH E 4 .   ? 19.376  -12.415 23.690  1.00  22.37 ? 369 HOH B H1     1 
HETATM 5767 H H2     . HOH E 4 .   ? 20.104  -11.902 24.932  1.00  22.37 ? 369 HOH B H2     1 
HETATM 5768 O O      . HOH E 4 .   ? 18.700  -12.196 17.707  1.00  29.41 ? 370 HOH B O      1 
HETATM 5769 H H1     . HOH E 4 .   ? 18.967  -12.186 18.646  1.00  30.17 ? 370 HOH B H1     1 
HETATM 5770 H H2     . HOH E 4 .   ? 18.867  -11.275 17.432  1.00  29.56 ? 370 HOH B H2     1 
HETATM 5771 O O      . HOH E 4 .   ? 25.382  -7.258  23.367  1.00  19.04 ? 371 HOH B O      1 
HETATM 5772 H H1     . HOH E 4 .   ? 24.680  -7.916  23.238  1.00  19.24 ? 371 HOH B H1     1 
HETATM 5773 H H2     . HOH E 4 .   ? 25.796  -7.203  22.495  1.00  16.93 ? 371 HOH B H2     1 
HETATM 5774 O O      . HOH E 4 .   ? 26.963  -8.628  16.873  1.00  64.05 ? 372 HOH B O      1 
HETATM 5775 H H1     . HOH E 4 .   ? 26.083  -8.500  16.494  1.00  63.27 ? 372 HOH B H1     1 
HETATM 5776 H H2     . HOH E 4 .   ? 27.317  -7.721  16.878  1.00  63.33 ? 372 HOH B H2     1 
HETATM 5777 O O      . HOH E 4 .   ? 26.376  -3.298  17.285  1.00  25.24 ? 373 HOH B O      1 
HETATM 5778 H H1     . HOH E 4 .   ? 26.295  -3.128  18.249  1.00  24.24 ? 373 HOH B H1     1 
HETATM 5779 H H2     . HOH E 4 .   ? 26.348  -2.392  16.901  1.00  25.61 ? 373 HOH B H2     1 
HETATM 5780 O O      . HOH E 4 .   ? 23.393  -0.971  15.947  1.00  21.42 ? 374 HOH B O      1 
HETATM 5781 H H1     . HOH E 4 .   ? 23.034  -1.010  16.852  1.00  19.08 ? 374 HOH B H1     1 
HETATM 5782 H H2     . HOH E 4 .   ? 23.127  -0.106  15.599  1.00  19.67 ? 374 HOH B H2     1 
HETATM 5783 O O      . HOH E 4 .   ? 13.246  -3.818  33.054  1.00  54.97 ? 375 HOH B O      1 
HETATM 5784 H H1     . HOH E 4 .   ? 13.866  -3.444  33.685  1.00  54.64 ? 375 HOH B H1     1 
HETATM 5785 H H2     . HOH E 4 .   ? 13.820  -4.296  32.438  1.00  54.72 ? 375 HOH B H2     1 
HETATM 5786 O O      . HOH E 4 .   ? 25.926  -15.891 21.981  1.00  48.61 ? 376 HOH B O      1 
HETATM 5787 H H1     . HOH E 4 .   ? 26.541  -16.352 22.559  1.00  48.65 ? 376 HOH B H1     1 
HETATM 5788 H H2     . HOH E 4 .   ? 26.358  -15.029 21.837  1.00  48.57 ? 376 HOH B H2     1 
HETATM 5789 O O      . HOH E 4 .   ? 21.201  -21.689 17.848  1.00  70.30 ? 377 HOH B O      1 
HETATM 5790 H H1     . HOH E 4 .   ? 22.027  -22.158 17.698  1.00  69.59 ? 377 HOH B H1     1 
HETATM 5791 H H2     . HOH E 4 .   ? 21.485  -20.855 18.237  1.00  69.67 ? 377 HOH B H2     1 
HETATM 5792 O O      . HOH E 4 .   ? -2.048  5.708   14.135  1.00  21.11 ? 378 HOH B O      1 
HETATM 5793 H H1     . HOH E 4 .   ? -1.866  6.354   14.833  1.00  20.98 ? 378 HOH B H1     1 
HETATM 5794 H H2     . HOH E 4 .   ? -1.207  5.204   14.085  1.00  21.08 ? 378 HOH B H2     1 
HETATM 5795 O O      . HOH E 4 .   ? 22.647  -14.175 12.694  1.00  49.59 ? 379 HOH B O      1 
HETATM 5796 H H1     . HOH E 4 .   ? 22.690  -13.706 13.539  1.00  50.13 ? 379 HOH B H1     1 
HETATM 5797 H H2     . HOH E 4 .   ? 23.113  -13.581 12.101  1.00  49.94 ? 379 HOH B H2     1 
HETATM 5798 O O      . HOH E 4 .   ? 6.521   16.672  31.219  1.00  25.51 ? 380 HOH B O      1 
HETATM 5799 H H1     . HOH E 4 .   ? 7.319   16.114  31.173  1.00  26.44 ? 380 HOH B H1     1 
HETATM 5800 H H2     . HOH E 4 .   ? 6.857   17.543  30.962  1.00  26.33 ? 380 HOH B H2     1 
HETATM 5801 O O      . HOH E 4 .   ? 12.959  9.196   13.065  1.00  17.17 ? 381 HOH B O      1 
HETATM 5802 H H1     . HOH E 4 .   ? 13.419  8.747   12.325  1.00  14.17 ? 381 HOH B H1     1 
HETATM 5803 H H2     . HOH E 4 .   ? 12.182  8.624   13.192  1.00  16.41 ? 381 HOH B H2     1 
HETATM 5804 O O      . HOH E 4 .   ? 8.107   -5.572  7.169   1.00  18.26 ? 382 HOH B O      1 
HETATM 5805 H H1     . HOH E 4 .   ? 8.387   -6.391  7.612   1.00  18.16 ? 382 HOH B H1     1 
HETATM 5806 H H2     . HOH E 4 .   ? 7.994   -5.857  6.256   1.00  19.10 ? 382 HOH B H2     1 
HETATM 5807 O O      . HOH E 4 .   ? 14.152  7.982   10.865  1.00  22.21 ? 383 HOH B O      1 
HETATM 5808 H H1     . HOH E 4 .   ? 14.794  8.374   10.234  1.00  20.30 ? 383 HOH B H1     1 
HETATM 5809 H H2     . HOH E 4 .   ? 14.453  7.067   10.867  1.00  20.10 ? 383 HOH B H2     1 
HETATM 5810 O O      . HOH E 4 .   ? 1.831   8.628   7.539   1.00  22.38 ? 384 HOH B O      1 
HETATM 5811 H H1     . HOH E 4 .   ? 1.756   9.444   8.059   1.00  22.53 ? 384 HOH B H1     1 
HETATM 5812 H H2     . HOH E 4 .   ? 2.761   8.640   7.272   1.00  23.44 ? 384 HOH B H2     1 
HETATM 5813 O O      . HOH E 4 .   ? 11.746  -2.620  4.550   1.00  70.96 ? 385 HOH B O      1 
HETATM 5814 H H1     . HOH E 4 .   ? 11.438  -3.430  4.966   1.00  69.75 ? 385 HOH B H1     1 
HETATM 5815 H H2     . HOH E 4 .   ? 11.015  -2.412  3.930   1.00  69.89 ? 385 HOH B H2     1 
HETATM 5816 O O      . HOH E 4 .   ? -5.623  2.589   2.296   1.00  23.08 ? 386 HOH B O      1 
HETATM 5817 H H1     . HOH E 4 .   ? -5.472  1.759   1.787   1.00  23.29 ? 386 HOH B H1     1 
HETATM 5818 H H2     . HOH E 4 .   ? -4.762  3.001   2.149   1.00  22.55 ? 386 HOH B H2     1 
HETATM 5819 O O      . HOH E 4 .   ? 11.017  -4.860  7.736   1.00  25.84 ? 387 HOH B O      1 
HETATM 5820 H H1     . HOH E 4 .   ? 11.151  -5.818  7.746   1.00  26.50 ? 387 HOH B H1     1 
HETATM 5821 H H2     . HOH E 4 .   ? 10.063  -4.797  7.572   1.00  26.81 ? 387 HOH B H2     1 
HETATM 5822 O O      . HOH E 4 .   ? 2.053   -5.256  9.059   1.00  17.18 ? 388 HOH B O      1 
HETATM 5823 H H1     . HOH E 4 .   ? 2.628   -4.475  9.092   1.00  16.91 ? 388 HOH B H1     1 
HETATM 5824 H H2     . HOH E 4 .   ? 1.541   -5.182  9.883   1.00  15.31 ? 388 HOH B H2     1 
HETATM 5825 O O      . HOH E 4 .   ? 19.805  11.954  8.522   1.00  27.49 ? 389 HOH B O      1 
HETATM 5826 H H1     . HOH E 4 .   ? 20.395  12.720  8.470   1.00  28.25 ? 389 HOH B H1     1 
HETATM 5827 H H2     . HOH E 4 .   ? 19.375  12.034  7.641   1.00  27.99 ? 389 HOH B H2     1 
HETATM 5828 O O      . HOH E 4 .   ? 3.486   -9.755  11.051  1.00  28.80 ? 390 HOH B O      1 
HETATM 5829 H H1     . HOH E 4 .   ? 3.222   -9.111  10.362  1.00  29.30 ? 390 HOH B H1     1 
HETATM 5830 H H2     . HOH E 4 .   ? 4.338   -9.398  11.328  1.00  29.60 ? 390 HOH B H2     1 
HETATM 5831 O O      . HOH E 4 .   ? 4.492   -7.589  27.178  1.00  22.57 ? 391 HOH B O      1 
HETATM 5832 H H1     . HOH E 4 .   ? 5.345   -8.048  27.334  1.00  21.53 ? 391 HOH B H1     1 
HETATM 5833 H H2     . HOH E 4 .   ? 4.774   -6.896  26.531  1.00  21.57 ? 391 HOH B H2     1 
HETATM 5834 O O      . HOH E 4 .   ? 7.532   -15.965 19.733  1.00  24.27 ? 392 HOH B O      1 
HETATM 5835 H H1     . HOH E 4 .   ? 6.642   -16.308 19.915  1.00  23.82 ? 392 HOH B H1     1 
HETATM 5836 H H2     . HOH E 4 .   ? 7.718   -16.237 18.816  1.00  22.05 ? 392 HOH B H2     1 
HETATM 5837 O O      . HOH E 4 .   ? 9.425   -11.151 5.328   1.00  25.96 ? 393 HOH B O      1 
HETATM 5838 H H1     . HOH E 4 .   ? 10.032  -11.479 4.648   1.00  26.46 ? 393 HOH B H1     1 
HETATM 5839 H H2     . HOH E 4 .   ? 8.580   -11.531 5.042   1.00  27.32 ? 393 HOH B H2     1 
HETATM 5840 O O      . HOH E 4 .   ? -0.414  12.067  8.219   1.00  70.45 ? 394 HOH B O      1 
HETATM 5841 H H1     . HOH E 4 .   ? 0.477   11.786  8.474   1.00  70.55 ? 394 HOH B H1     1 
HETATM 5842 H H2     . HOH E 4 .   ? -0.879  12.058  9.081   1.00  70.16 ? 394 HOH B H2     1 
HETATM 5843 O O      . HOH E 4 .   ? 10.792  -0.699  35.702  1.00  52.40 ? 395 HOH B O      1 
HETATM 5844 H H1     . HOH E 4 .   ? 11.649  -1.072  35.490  1.00  53.26 ? 395 HOH B H1     1 
HETATM 5845 H H2     . HOH E 4 .   ? 10.561  -0.228  34.885  1.00  53.57 ? 395 HOH B H2     1 
HETATM 5846 O O      . HOH E 4 .   ? 23.577  12.724  18.648  1.00  31.31 ? 396 HOH B O      1 
HETATM 5847 H H1     . HOH E 4 .   ? 23.350  11.850  18.298  1.00  33.13 ? 396 HOH B H1     1 
HETATM 5848 H H2     . HOH E 4 .   ? 24.263  13.028  18.049  1.00  32.44 ? 396 HOH B H2     1 
HETATM 5849 O O      . HOH E 4 .   ? 27.981  6.057   10.611  1.00  24.99 ? 397 HOH B O      1 
HETATM 5850 H H1     . HOH E 4 .   ? 27.686  5.984   9.675   1.00  24.23 ? 397 HOH B H1     1 
HETATM 5851 H H2     . HOH E 4 .   ? 27.793  5.170   10.929  1.00  24.07 ? 397 HOH B H2     1 
HETATM 5852 O O      . HOH E 4 .   ? 12.001  -17.000 12.246  1.00  48.79 ? 398 HOH B O      1 
HETATM 5853 H H1     . HOH E 4 .   ? 11.393  -16.334 12.613  1.00  49.15 ? 398 HOH B H1     1 
HETATM 5854 H H2     . HOH E 4 .   ? 12.296  -16.603 11.418  1.00  48.80 ? 398 HOH B H2     1 
HETATM 5855 O O      . HOH E 4 .   ? 2.717   -8.877  34.149  1.00  33.72 ? 399 HOH B O      1 
HETATM 5856 H H1     . HOH E 4 .   ? 2.444   -8.293  33.412  1.00  33.21 ? 399 HOH B H1     1 
HETATM 5857 H H2     . HOH E 4 .   ? 1.872   -9.184  34.499  1.00  32.79 ? 399 HOH B H2     1 
HETATM 5858 O O      . HOH E 4 .   ? 4.813   2.236   3.643   1.00  28.66 ? 400 HOH B O      1 
HETATM 5859 H H1     . HOH E 4 .   ? 4.602   2.584   4.518   1.00  29.13 ? 400 HOH B H1     1 
HETATM 5860 H H2     . HOH E 4 .   ? 3.927   2.078   3.278   1.00  29.80 ? 400 HOH B H2     1 
HETATM 5861 O O      . HOH E 4 .   ? 18.333  -18.017 11.013  1.00  46.19 ? 401 HOH B O      1 
HETATM 5862 H H1     . HOH E 4 .   ? 17.436  -17.768 10.746  1.00  46.88 ? 401 HOH B H1     1 
HETATM 5863 H H2     . HOH E 4 .   ? 18.779  -17.168 11.083  1.00  46.76 ? 401 HOH B H2     1 
HETATM 5864 O O      . HOH E 4 .   ? 12.435  -15.716 8.571   1.00  38.26 ? 402 HOH B O      1 
HETATM 5865 H H1     . HOH E 4 .   ? 11.985  -16.443 8.123   1.00  38.59 ? 402 HOH B H1     1 
HETATM 5866 H H2     . HOH E 4 .   ? 11.760  -15.011 8.516   1.00  39.07 ? 402 HOH B H2     1 
HETATM 5867 O O      . HOH E 4 .   ? 2.213   -9.084  27.148  1.00  25.34 ? 403 HOH B O      1 
HETATM 5868 H H1     . HOH E 4 .   ? 3.046   -8.557  27.167  1.00  25.78 ? 403 HOH B H1     1 
HETATM 5869 H H2     . HOH E 4 .   ? 2.206   -9.346  26.213  1.00  25.90 ? 403 HOH B H2     1 
HETATM 5870 O O      . HOH E 4 .   ? -10.018 18.330  32.909  1.00  40.94 ? 404 HOH B O      1 
HETATM 5871 H H1     . HOH E 4 .   ? -9.406  18.354  33.657  1.00  40.88 ? 404 HOH B H1     1 
HETATM 5872 H H2     . HOH E 4 .   ? -9.474  18.707  32.204  1.00  40.63 ? 404 HOH B H2     1 
HETATM 5873 O O      . HOH E 4 .   ? 9.725   18.140  11.710  1.00  31.60 ? 405 HOH B O      1 
HETATM 5874 H H1     . HOH E 4 .   ? 9.102   17.996  12.430  1.00  30.89 ? 405 HOH B H1     1 
HETATM 5875 H H2     . HOH E 4 .   ? 10.578  18.137  12.203  1.00  31.59 ? 405 HOH B H2     1 
HETATM 5876 O O      . HOH E 4 .   ? 3.801   -18.322 17.662  1.00  36.13 ? 406 HOH B O      1 
HETATM 5877 H H1     . HOH E 4 .   ? 3.063   -18.003 18.194  1.00  36.11 ? 406 HOH B H1     1 
HETATM 5878 H H2     . HOH E 4 .   ? 4.152   -17.459 17.340  1.00  36.70 ? 406 HOH B H2     1 
HETATM 5879 O O      . HOH E 4 .   ? 29.607  -13.448 17.204  1.00  86.50 ? 407 HOH B O      1 
HETATM 5880 H H1     . HOH E 4 .   ? 29.528  -14.290 16.738  1.00  85.32 ? 407 HOH B H1     1 
HETATM 5881 H H2     . HOH E 4 .   ? 30.239  -13.649 17.901  1.00  85.46 ? 407 HOH B H2     1 
HETATM 5882 O O      . HOH E 4 .   ? 14.828  -16.656 13.288  1.00  27.96 ? 408 HOH B O      1 
HETATM 5883 H H1     . HOH E 4 .   ? 14.696  -15.853 13.818  1.00  28.10 ? 408 HOH B H1     1 
HETATM 5884 H H2     . HOH E 4 .   ? 13.911  -16.910 13.085  1.00  28.47 ? 408 HOH B H2     1 
HETATM 5885 O O      . HOH E 4 .   ? 18.222  17.204  22.527  1.00  49.52 ? 409 HOH B O      1 
HETATM 5886 H H1     . HOH E 4 .   ? 18.705  16.396  22.290  1.00  49.73 ? 409 HOH B H1     1 
HETATM 5887 H H2     . HOH E 4 .   ? 17.704  17.340  21.734  1.00  49.80 ? 409 HOH B H2     1 
HETATM 5888 O O      . HOH E 4 .   ? 4.761   -15.678 17.185  1.00  42.82 ? 410 HOH B O      1 
HETATM 5889 H H1     . HOH E 4 .   ? 4.568   -14.924 16.617  1.00  42.87 ? 410 HOH B H1     1 
HETATM 5890 H H2     . HOH E 4 .   ? 5.287   -15.285 17.892  1.00  42.89 ? 410 HOH B H2     1 
HETATM 5891 O O      . HOH E 4 .   ? -7.282  -5.240  24.688  1.00  31.89 ? 411 HOH B O      1 
HETATM 5892 H H1     . HOH E 4 .   ? -6.623  -5.918  24.917  1.00  32.22 ? 411 HOH B H1     1 
HETATM 5893 H H2     . HOH E 4 .   ? -7.560  -5.564  23.819  1.00  31.94 ? 411 HOH B H2     1 
HETATM 5894 O O      . HOH E 4 .   ? -0.630  17.282  15.131  1.00  36.64 ? 412 HOH B O      1 
HETATM 5895 H H1     . HOH E 4 .   ? 0.299   17.154  15.441  1.00  36.46 ? 412 HOH B H1     1 
HETATM 5896 H H2     . HOH E 4 .   ? -0.957  17.848  15.832  1.00  36.19 ? 412 HOH B H2     1 
HETATM 5897 O O      . HOH E 4 .   ? 1.439   4.540   43.342  1.00  73.33 ? 413 HOH B O      1 
HETATM 5898 H H1     . HOH E 4 .   ? 0.737   4.221   42.764  1.00  71.79 ? 413 HOH B H1     1 
HETATM 5899 H H2     . HOH E 4 .   ? 1.388   3.931   44.086  1.00  71.56 ? 413 HOH B H2     1 
HETATM 5900 O O      . HOH E 4 .   ? 18.346  -15.362 19.462  1.00  40.15 ? 414 HOH B O      1 
HETATM 5901 H H1     . HOH E 4 .   ? 18.648  -15.496 18.542  1.00  40.38 ? 414 HOH B H1     1 
HETATM 5902 H H2     . HOH E 4 .   ? 18.304  -14.404 19.502  1.00  40.09 ? 414 HOH B H2     1 
HETATM 5903 O O      . HOH E 4 .   ? 25.032  8.709   10.357  1.00  24.82 ? 415 HOH B O      1 
HETATM 5904 H H1     . HOH E 4 .   ? 24.311  9.110   9.858   1.00  25.97 ? 415 HOH B H1     1 
HETATM 5905 H H2     . HOH E 4 .   ? 25.409  8.079   9.738   1.00  23.28 ? 415 HOH B H2     1 
HETATM 5906 O O      . HOH E 4 .   ? -10.892 16.113  34.325  1.00  50.22 ? 416 HOH B O      1 
HETATM 5907 H H1     . HOH E 4 .   ? -10.621 16.691  33.590  1.00  49.25 ? 416 HOH B H1     1 
HETATM 5908 H H2     . HOH E 4 .   ? -11.836 16.295  34.370  1.00  49.45 ? 416 HOH B H2     1 
HETATM 5909 O O      . HOH E 4 .   ? 15.054  19.705  21.332  1.00  51.08 ? 417 HOH B O      1 
HETATM 5910 H H1     . HOH E 4 .   ? 14.519  19.829  20.527  1.00  50.46 ? 417 HOH B H1     1 
HETATM 5911 H H2     . HOH E 4 .   ? 15.938  19.581  20.966  1.00  49.76 ? 417 HOH B H2     1 
HETATM 5912 O O      . HOH E 4 .   ? 21.959  -5.497  10.525  1.00  65.58 ? 418 HOH B O      1 
HETATM 5913 H H1     . HOH E 4 .   ? 22.295  -5.501  11.451  1.00  65.93 ? 418 HOH B H1     1 
HETATM 5914 H H2     . HOH E 4 .   ? 21.883  -4.550  10.361  1.00  65.62 ? 418 HOH B H2     1 
HETATM 5915 O O      . HOH E 4 .   ? 26.395  7.258   24.002  1.00  59.95 ? 419 HOH B O      1 
HETATM 5916 H H1     . HOH E 4 .   ? 26.427  8.061   23.476  1.00  59.22 ? 419 HOH B H1     1 
HETATM 5917 H H2     . HOH E 4 .   ? 26.047  6.615   23.361  1.00  59.68 ? 419 HOH B H2     1 
HETATM 5918 O O      . HOH E 4 .   ? 6.881   -8.457  28.103  1.00  28.77 ? 420 HOH B O      1 
HETATM 5919 H H1     . HOH E 4 .   ? 7.429   -7.691  27.815  1.00  29.76 ? 420 HOH B H1     1 
HETATM 5920 H H2     . HOH E 4 .   ? 6.485   -8.130  28.925  1.00  28.76 ? 420 HOH B H2     1 
HETATM 5921 O O      . HOH E 4 .   ? -4.676  12.065  29.804  1.00  63.73 ? 421 HOH B O      1 
HETATM 5922 H H1     . HOH E 4 .   ? -4.768  12.810  30.429  1.00  61.61 ? 421 HOH B H1     1 
HETATM 5923 H H2     . HOH E 4 .   ? -5.579  11.718  29.678  1.00  61.69 ? 421 HOH B H2     1 
HETATM 5924 O O      . HOH E 4 .   ? 16.646  -16.441 30.409  1.00  41.93 ? 422 HOH B O      1 
HETATM 5925 H H1     . HOH E 4 .   ? 15.927  -16.992 30.744  1.00  42.79 ? 422 HOH B H1     1 
HETATM 5926 H H2     . HOH E 4 .   ? 17.387  -16.630 31.020  1.00  42.66 ? 422 HOH B H2     1 
HETATM 5927 O O      . HOH E 4 .   ? 13.918  22.730  18.124  1.00  37.77 ? 423 HOH B O      1 
HETATM 5928 H H1     . HOH E 4 .   ? 14.759  22.255  18.191  1.00  36.36 ? 423 HOH B H1     1 
HETATM 5929 H H2     . HOH E 4 .   ? 13.614  22.745  19.044  1.00  35.67 ? 423 HOH B H2     1 
HETATM 5930 O O      . HOH E 4 .   ? 10.769  21.888  21.447  1.00  23.93 ? 424 HOH B O      1 
HETATM 5931 H H1     . HOH E 4 .   ? 10.073  22.557  21.305  1.00  25.59 ? 424 HOH B H1     1 
HETATM 5932 H H2     . HOH E 4 .   ? 10.525  21.574  22.332  1.00  25.10 ? 424 HOH B H2     1 
HETATM 5933 O O      . HOH E 4 .   ? 5.305   20.968  26.724  1.00  49.39 ? 425 HOH B O      1 
HETATM 5934 H H1     . HOH E 4 .   ? 4.885   21.096  25.867  1.00  49.34 ? 425 HOH B H1     1 
HETATM 5935 H H2     . HOH E 4 .   ? 6.204   21.320  26.555  1.00  49.60 ? 425 HOH B H2     1 
HETATM 5936 O O      . HOH E 4 .   ? 24.904  -5.437  34.930  1.00  47.38 ? 426 HOH B O      1 
HETATM 5937 H H1     . HOH E 4 .   ? 24.470  -5.220  35.770  1.00  46.92 ? 426 HOH B H1     1 
HETATM 5938 H H2     . HOH E 4 .   ? 24.125  -5.462  34.350  1.00  47.56 ? 426 HOH B H2     1 
HETATM 5939 O O      . HOH E 4 .   ? 16.439  6.143   35.783  1.00  72.26 ? 427 HOH B O      1 
HETATM 5940 H H1     . HOH E 4 .   ? 16.178  5.399   35.222  1.00  71.43 ? 427 HOH B H1     1 
HETATM 5941 H H2     . HOH E 4 .   ? 17.346  5.914   36.000  1.00  71.28 ? 427 HOH B H2     1 
HETATM 5942 O O      . HOH E 4 .   ? 15.384  24.807  15.918  1.00  63.64 ? 428 HOH B O      1 
HETATM 5943 H H1     . HOH E 4 .   ? 14.729  24.285  16.410  1.00  64.37 ? 428 HOH B H1     1 
HETATM 5944 H H2     . HOH E 4 .   ? 16.192  24.339  16.149  1.00  64.25 ? 428 HOH B H2     1 
HETATM 5945 O O      . HOH E 4 .   ? 14.277  -2.152  7.635   1.00  27.82 ? 429 HOH B O      1 
HETATM 5946 H H1     . HOH E 4 .   ? 13.633  -1.955  6.953   1.00  26.46 ? 429 HOH B H1     1 
HETATM 5947 H H2     . HOH E 4 .   ? 13.688  -2.398  8.389   1.00  27.43 ? 429 HOH B H2     1 
HETATM 5948 O O      . HOH E 4 .   ? 0.996   -7.263  2.538   1.00  29.14 ? 430 HOH B O      1 
HETATM 5949 H H1     . HOH E 4 .   ? 1.874   -7.663  2.567   1.00  28.95 ? 430 HOH B H1     1 
HETATM 5950 H H2     . HOH E 4 .   ? 0.459   -7.974  2.174   1.00  29.82 ? 430 HOH B H2     1 
HETATM 5951 O O      . HOH E 4 .   ? -6.405  -9.796  7.632   1.00  62.56 ? 431 HOH B O      1 
HETATM 5952 H H1     . HOH E 4 .   ? -5.952  -9.365  6.897   1.00  62.54 ? 431 HOH B H1     1 
HETATM 5953 H H2     . HOH E 4 .   ? -7.154  -10.226 7.197   1.00  62.70 ? 431 HOH B H2     1 
HETATM 5954 O O      . HOH E 4 .   ? 2.923   -12.044 39.994  1.00  78.11 ? 432 HOH B O      1 
HETATM 5955 H H1     . HOH E 4 .   ? 2.884   -12.953 40.295  1.00  76.91 ? 432 HOH B H1     1 
HETATM 5956 H H2     . HOH E 4 .   ? 3.699   -11.682 40.421  1.00  77.12 ? 432 HOH B H2     1 
HETATM 5957 O O      . HOH E 4 .   ? -0.225  -8.148  14.161  1.00  41.16 ? 433 HOH B O      1 
HETATM 5958 H H1     . HOH E 4 .   ? 0.033   -8.378  13.247  1.00  40.16 ? 433 HOH B H1     1 
HETATM 5959 H H2     . HOH E 4 .   ? -0.752  -8.906  14.426  1.00  39.99 ? 433 HOH B H2     1 
HETATM 5960 O O      . HOH E 4 .   ? 23.834  6.958   28.983  1.00  59.94 ? 434 HOH B O      1 
HETATM 5961 H H1     . HOH E 4 .   ? 23.023  7.322   28.614  1.00  59.29 ? 434 HOH B H1     1 
HETATM 5962 H H2     . HOH E 4 .   ? 24.267  6.580   28.190  1.00  60.05 ? 434 HOH B H2     1 
HETATM 5963 O O      . HOH E 4 .   ? 21.013  10.229  27.676  1.00  70.94 ? 435 HOH B O      1 
HETATM 5964 H H1     . HOH E 4 .   ? 20.862  10.877  26.976  1.00  69.82 ? 435 HOH B H1     1 
HETATM 5965 H H2     . HOH E 4 .   ? 21.912  9.942   27.503  1.00  69.72 ? 435 HOH B H2     1 
HETATM 5966 O O      . HOH E 4 .   ? 12.754  4.295   32.709  1.00  41.15 ? 436 HOH B O      1 
HETATM 5967 H H1     . HOH E 4 .   ? 12.605  3.341   32.780  1.00  42.01 ? 436 HOH B H1     1 
HETATM 5968 H H2     . HOH E 4 .   ? 12.503  4.467   31.800  1.00  41.48 ? 436 HOH B H2     1 
HETATM 5969 O O      . HOH E 4 .   ? 19.044  -8.508  9.239   1.00  40.82 ? 437 HOH B O      1 
HETATM 5970 H H1     . HOH E 4 .   ? 18.341  -8.867  9.817   1.00  40.39 ? 437 HOH B H1     1 
HETATM 5971 H H2     . HOH E 4 .   ? 19.604  -9.295  9.163   1.00  40.83 ? 437 HOH B H2     1 
HETATM 5972 O O      . HOH E 4 .   ? 1.136   24.527  16.513  1.00  74.06 ? 438 HOH B O      1 
HETATM 5973 H H1     . HOH E 4 .   ? 1.374   25.143  17.209  1.00  72.57 ? 438 HOH B H1     1 
HETATM 5974 H H2     . HOH E 4 .   ? 1.524   24.933  15.737  1.00  72.53 ? 438 HOH B H2     1 
HETATM 5975 O O      . HOH E 4 .   ? 1.932   -15.730 14.345  1.00  53.77 ? 439 HOH B O      1 
HETATM 5976 H H1     . HOH E 4 .   ? 1.370   -15.343 15.014  1.00  53.32 ? 439 HOH B H1     1 
HETATM 5977 H H2     . HOH E 4 .   ? 1.656   -15.245 13.538  1.00  53.31 ? 439 HOH B H2     1 
HETATM 5978 O O      . HOH E 4 .   ? -1.051  -10.418 4.484   1.00  69.90 ? 440 HOH B O      1 
HETATM 5979 H H1     . HOH E 4 .   ? -0.455  -11.100 4.151   1.00  67.85 ? 440 HOH B H1     1 
HETATM 5980 H H2     . HOH E 4 .   ? -1.915  -10.808 4.326   1.00  67.56 ? 440 HOH B H2     1 
HETATM 5981 O O      . HOH E 4 .   ? 16.984  2.767   33.922  1.00  69.32 ? 441 HOH B O      1 
HETATM 5982 H H1     . HOH E 4 .   ? 17.147  1.896   34.290  1.00  68.18 ? 441 HOH B H1     1 
HETATM 5983 H H2     . HOH E 4 .   ? 17.260  2.650   32.996  1.00  68.18 ? 441 HOH B H2     1 
HETATM 5984 O O      . HOH E 4 .   ? 15.267  17.134  12.428  1.00  45.05 ? 442 HOH B O      1 
HETATM 5985 H H1     . HOH E 4 .   ? 14.618  17.703  12.000  1.00  45.27 ? 442 HOH B H1     1 
HETATM 5986 H H2     . HOH E 4 .   ? 14.682  16.447  12.805  1.00  45.56 ? 442 HOH B H2     1 
HETATM 5987 O O      . HOH E 4 .   ? 6.544   19.550  30.891  1.00  71.35 ? 443 HOH B O      1 
HETATM 5988 H H1     . HOH E 4 .   ? 5.635   19.604  30.577  1.00  71.24 ? 443 HOH B H1     1 
HETATM 5989 H H2     . HOH E 4 .   ? 6.466   19.775  31.823  1.00  71.33 ? 443 HOH B H2     1 
HETATM 5990 O O      . HOH E 4 .   ? 24.759  -17.252 10.919  1.00  64.66 ? 444 HOH B O      1 
HETATM 5991 H H1     . HOH E 4 .   ? 24.738  -16.701 10.131  1.00  63.59 ? 444 HOH B H1     1 
HETATM 5992 H H2     . HOH E 4 .   ? 25.104  -16.650 11.586  1.00  63.58 ? 444 HOH B H2     1 
HETATM 5993 O O      . HOH E 4 .   ? 20.342  -2.954  9.621   1.00  57.67 ? 445 HOH B O      1 
HETATM 5994 H H1     . HOH E 4 .   ? 19.925  -3.834  9.533   1.00  58.56 ? 445 HOH B H1     1 
HETATM 5995 H H2     . HOH E 4 .   ? 19.582  -2.377  9.726   1.00  57.97 ? 445 HOH B H2     1 
HETATM 5996 O O      . HOH E 4 .   ? -4.241  -11.419 8.779   1.00  44.87 ? 446 HOH B O      1 
HETATM 5997 H H1     . HOH E 4 .   ? -4.996  -10.864 8.517   1.00  45.83 ? 446 HOH B H1     1 
HETATM 5998 H H2     . HOH E 4 .   ? -4.657  -12.275 8.913   1.00  45.58 ? 446 HOH B H2     1 
HETATM 5999 O O      . HOH E 4 .   ? 9.809   0.599   42.216  1.00  78.80 ? 447 HOH B O      1 
HETATM 6000 H H1     . HOH E 4 .   ? 9.327   -0.206  42.447  1.00  78.89 ? 447 HOH B H1     1 
HETATM 6001 H H2     . HOH E 4 .   ? 10.348  0.742   43.004  1.00  78.69 ? 447 HOH B H2     1 
HETATM 6002 O O      . HOH E 4 .   ? 2.731   4.259   1.078   1.00  35.61 ? 448 HOH B O      1 
HETATM 6003 H H1     . HOH E 4 .   ? 2.653   3.451   1.605   1.00  35.60 ? 448 HOH B H1     1 
HETATM 6004 H H2     . HOH E 4 .   ? 3.677   4.344   0.927   1.00  35.17 ? 448 HOH B H2     1 
HETATM 6005 O O      . HOH E 4 .   ? 21.309  2.374   28.003  1.00  48.86 ? 449 HOH B O      1 
HETATM 6006 H H1     . HOH E 4 .   ? 21.985  2.726   28.618  1.00  48.94 ? 449 HOH B H1     1 
HETATM 6007 H H2     . HOH E 4 .   ? 21.910  2.024   27.313  1.00  48.54 ? 449 HOH B H2     1 
HETATM 6008 O O      . HOH E 4 .   ? 8.693   -6.265  31.349  1.00  41.36 ? 450 HOH B O      1 
HETATM 6009 H H1     . HOH E 4 .   ? 9.658   -6.253  31.547  1.00  40.40 ? 450 HOH B H1     1 
HETATM 6010 H H2     . HOH E 4 .   ? 8.365   -5.816  32.154  1.00  40.54 ? 450 HOH B H2     1 
HETATM 6011 O O      . HOH E 4 .   ? 14.609  -12.398 32.366  1.00  77.16 ? 451 HOH B O      1 
HETATM 6012 H H1     . HOH E 4 .   ? 14.737  -13.292 32.696  1.00  76.61 ? 451 HOH B H1     1 
HETATM 6013 H H2     . HOH E 4 .   ? 15.253  -12.346 31.648  1.00  76.43 ? 451 HOH B H2     1 
HETATM 6014 O O      . HOH E 4 .   ? 26.039  2.525   10.682  1.00  31.71 ? 452 HOH B O      1 
HETATM 6015 H H1     . HOH E 4 .   ? 26.365  2.393   9.785   1.00  31.98 ? 452 HOH B H1     1 
HETATM 6016 H H2     . HOH E 4 .   ? 26.577  1.860   11.150  1.00  32.75 ? 452 HOH B H2     1 
HETATM 6017 O O      . HOH E 4 .   ? -12.416 -1.192  -5.194  1.00  76.24 ? 453 HOH B O      1 
HETATM 6018 H H1     . HOH E 4 .   ? -12.223 -0.267  -5.394  1.00  74.30 ? 453 HOH B H1     1 
HETATM 6019 H H2     . HOH E 4 .   ? -13.328 -1.280  -5.490  1.00  74.72 ? 453 HOH B H2     1 
HETATM 6020 O O      . HOH E 4 .   ? 3.792   -12.388 32.508  1.00  87.53 ? 454 HOH B O      1 
HETATM 6021 H H1     . HOH E 4 .   ? 3.281   -12.275 31.657  1.00  85.70 ? 454 HOH B H1     1 
HETATM 6022 H H2     . HOH E 4 .   ? 3.351   -13.178 32.846  1.00  85.55 ? 454 HOH B H2     1 
HETATM 6023 O O      . HOH E 4 .   ? -0.073  18.666  12.819  1.00  55.15 ? 455 HOH B O      1 
HETATM 6024 H H1     . HOH E 4 .   ? -0.322  18.123  13.596  1.00  54.99 ? 455 HOH B H1     1 
HETATM 6025 H H2     . HOH E 4 .   ? -0.809  18.529  12.221  1.00  55.31 ? 455 HOH B H2     1 
HETATM 6026 O O      . HOH E 4 .   ? 6.455   -11.351 35.738  1.00  74.25 ? 456 HOH B O      1 
HETATM 6027 H H1     . HOH E 4 .   ? 5.896   -11.858 36.345  1.00  73.93 ? 456 HOH B H1     1 
HETATM 6028 H H2     . HOH E 4 .   ? 7.287   -11.322 36.231  1.00  74.08 ? 456 HOH B H2     1 
HETATM 6029 O O      . HOH E 4 .   ? -2.266  16.921  23.628  1.00  42.83 ? 457 HOH B O      1 
HETATM 6030 H H1     . HOH E 4 .   ? -2.897  17.592  23.906  1.00  42.89 ? 457 HOH B H1     1 
HETATM 6031 H H2     . HOH E 4 .   ? -1.711  16.823  24.421  1.00  43.37 ? 457 HOH B H2     1 
HETATM 6032 O O      . HOH E 4 .   ? 25.570  5.844   26.826  1.00  46.18 ? 458 HOH B O      1 
HETATM 6033 H H1     . HOH E 4 .   ? 25.932  6.346   26.076  1.00  46.28 ? 458 HOH B H1     1 
HETATM 6034 H H2     . HOH E 4 .   ? 26.408  5.559   27.261  1.00  46.35 ? 458 HOH B H2     1 
HETATM 6035 O O      . HOH E 4 .   ? 9.296   21.055  34.014  1.00  65.06 ? 459 HOH B O      1 
HETATM 6036 H H1     . HOH E 4 .   ? 9.443   20.197  33.589  1.00  65.55 ? 459 HOH B H1     1 
HETATM 6037 H H2     . HOH E 4 .   ? 10.128  21.184  34.488  1.00  65.66 ? 459 HOH B H2     1 
HETATM 6038 O O      . HOH E 4 .   ? -13.461 1.542   21.979  1.00  60.79 ? 460 HOH B O      1 
HETATM 6039 H H1     . HOH E 4 .   ? -13.546 1.528   22.953  1.00  60.01 ? 460 HOH B H1     1 
HETATM 6040 H H2     . HOH E 4 .   ? -14.356 1.735   21.703  1.00  60.25 ? 460 HOH B H2     1 
HETATM 6041 O O      . HOH E 4 .   ? 2.362   -7.943  9.209   1.00  30.46 ? 461 HOH B O      1 
HETATM 6042 H H1     . HOH E 4 .   ? 1.826   -8.143  8.423   1.00  30.38 ? 461 HOH B H1     1 
HETATM 6043 H H2     . HOH E 4 .   ? 2.384   -6.961  9.147   1.00  29.99 ? 461 HOH B H2     1 
HETATM 6044 O O      . HOH E 4 .   ? 13.067  -10.144 33.139  1.00  59.97 ? 462 HOH B O      1 
HETATM 6045 H H1     . HOH E 4 .   ? 13.317  -9.684  32.340  1.00  60.57 ? 462 HOH B H1     1 
HETATM 6046 H H2     . HOH E 4 .   ? 13.510  -11.006 33.012  1.00  60.56 ? 462 HOH B H2     1 
HETATM 6047 O O      . HOH E 4 .   ? 17.975  17.011  12.807  1.00  61.03 ? 463 HOH B O      1 
HETATM 6048 H H1     . HOH E 4 .   ? 18.230  17.725  12.213  1.00  60.27 ? 463 HOH B H1     1 
HETATM 6049 H H2     . HOH E 4 .   ? 16.990  17.054  12.737  1.00  60.12 ? 463 HOH B H2     1 
HETATM 6050 O O      . HOH E 4 .   ? -11.666 -1.606  -2.270  1.00  36.22 ? 464 HOH B O      1 
HETATM 6051 H H1     . HOH E 4 .   ? -12.308 -2.303  -2.094  1.00  36.97 ? 464 HOH B H1     1 
HETATM 6052 H H2     . HOH E 4 .   ? -11.816 -1.449  -3.222  1.00  37.37 ? 464 HOH B H2     1 
HETATM 6053 O O      . HOH E 4 .   ? 25.811  -9.793  12.969  1.00  67.81 ? 465 HOH B O      1 
HETATM 6054 H H1     . HOH E 4 .   ? 25.591  -9.038  12.419  1.00  67.74 ? 465 HOH B H1     1 
HETATM 6055 H H2     . HOH E 4 .   ? 25.691  -10.543 12.382  1.00  67.80 ? 465 HOH B H2     1 
HETATM 6056 O O      . HOH E 4 .   ? 3.014   -14.468 20.413  1.00  53.06 ? 466 HOH B O      1 
HETATM 6057 H H1     . HOH E 4 .   ? 3.598   -15.235 20.413  1.00  53.47 ? 466 HOH B H1     1 
HETATM 6058 H H2     . HOH E 4 .   ? 3.188   -14.093 21.298  1.00  52.99 ? 466 HOH B H2     1 
HETATM 6059 O O      . HOH E 4 .   ? -8.847  -6.683  17.478  1.00  59.51 ? 467 HOH B O      1 
HETATM 6060 H H1     . HOH E 4 .   ? -9.563  -6.151  17.856  1.00  59.17 ? 467 HOH B H1     1 
HETATM 6061 H H2     . HOH E 4 .   ? -8.968  -7.527  17.913  1.00  59.33 ? 467 HOH B H2     1 
HETATM 6062 O O      . HOH E 4 .   ? -9.665  9.801   32.662  1.00  70.07 ? 468 HOH B O      1 
HETATM 6063 H H1     . HOH E 4 .   ? -10.223 9.501   31.925  1.00  69.96 ? 468 HOH B H1     1 
HETATM 6064 H H2     . HOH E 4 .   ? -10.282 9.921   33.385  1.00  70.08 ? 468 HOH B H2     1 
HETATM 6065 O O      . HOH E 4 .   ? 26.950  6.221   18.792  1.00  50.78 ? 469 HOH B O      1 
HETATM 6066 H H1     . HOH E 4 .   ? 27.827  6.593   18.679  1.00  51.09 ? 469 HOH B H1     1 
HETATM 6067 H H2     . HOH E 4 .   ? 27.125  5.502   19.434  1.00  51.02 ? 469 HOH B H2     1 
HETATM 6068 O O      . HOH E 4 .   ? -1.427  -13.227 30.444  1.00  95.59 ? 470 HOH B O      1 
HETATM 6069 H H1     . HOH E 4 .   ? -2.286  -12.856 30.687  1.00  95.04 ? 470 HOH B H1     1 
HETATM 6070 H H2     . HOH E 4 .   ? -1.379  -13.986 31.039  1.00  94.98 ? 470 HOH B H2     1 
HETATM 6071 O O      . HOH E 4 .   ? 13.208  -6.879  22.799  1.00  17.82 ? 471 HOH B O      1 
HETATM 6072 H H1     . HOH E 4 .   ? 12.335  -7.285  22.776  1.00  18.63 ? 471 HOH B H1     1 
HETATM 6073 H H2     . HOH E 4 .   ? 13.612  -7.274  23.575  1.00  18.40 ? 471 HOH B H2     1 
HETATM 6074 O O      . HOH E 4 .   ? 18.667  -26.093 28.053  1.00  68.88 ? 472 HOH B O      1 
HETATM 6075 H H1     . HOH E 4 .   ? 18.361  -25.186 28.191  1.00  69.15 ? 472 HOH B H1     1 
HETATM 6076 H H2     . HOH E 4 .   ? 17.850  -26.596 28.035  1.00  68.78 ? 472 HOH B H2     1 
HETATM 6077 O O      . HOH E 4 .   ? 6.614   0.297   -0.326  1.00  71.37 ? 473 HOH B O      1 
HETATM 6078 H H1     . HOH E 4 .   ? 6.708   1.139   0.123   1.00  70.25 ? 473 HOH B H1     1 
HETATM 6079 H H2     . HOH E 4 .   ? 7.301   0.307   -0.996  1.00  70.18 ? 473 HOH B H2     1 
HETATM 6080 O O      . HOH E 4 .   ? 9.323   25.220  10.258  1.00  65.07 ? 474 HOH B O      1 
HETATM 6081 H H1     . HOH E 4 .   ? 8.979   25.591  9.438   1.00  65.04 ? 474 HOH B H1     1 
HETATM 6082 H H2     . HOH E 4 .   ? 9.220   24.273  10.108  1.00  64.77 ? 474 HOH B H2     1 
HETATM 6083 O O      . HOH E 4 .   ? 19.373  -5.768  9.789   1.00  42.84 ? 475 HOH B O      1 
HETATM 6084 H H1     . HOH E 4 .   ? 20.309  -5.888  10.065  1.00  41.71 ? 475 HOH B H1     1 
HETATM 6085 H H2     . HOH E 4 .   ? 19.177  -6.705  9.559   1.00  41.49 ? 475 HOH B H2     1 
HETATM 6086 O O      . HOH E 4 .   ? 4.718   16.658  38.036  1.00  54.08 ? 476 HOH B O      1 
HETATM 6087 H H1     . HOH E 4 .   ? 4.403   15.784  38.323  1.00  54.37 ? 476 HOH B H1     1 
HETATM 6088 H H2     . HOH E 4 .   ? 4.536   17.222  38.816  1.00  54.65 ? 476 HOH B H2     1 
HETATM 6089 O O      . HOH E 4 .   ? -9.303  -11.765 25.469  1.00  80.25 ? 477 HOH B O      1 
HETATM 6090 H H1     . HOH E 4 .   ? -9.520  -12.336 24.727  1.00  79.58 ? 477 HOH B H1     1 
HETATM 6091 H H2     . HOH E 4 .   ? -8.617  -11.178 25.098  1.00  79.82 ? 477 HOH B H2     1 
HETATM 6092 O O      . HOH E 4 .   ? -1.619  -0.719  43.273  1.00  85.85 ? 478 HOH B O      1 
HETATM 6093 H H1     . HOH E 4 .   ? -0.737  -1.094  43.166  1.00  84.72 ? 478 HOH B H1     1 
HETATM 6094 H H2     . HOH E 4 .   ? -2.055  -1.015  42.470  1.00  84.76 ? 478 HOH B H2     1 
HETATM 6095 O O      . HOH E 4 .   ? 27.456  4.303   20.818  1.00  63.27 ? 479 HOH B O      1 
HETATM 6096 H H1     . HOH E 4 .   ? 27.627  3.455   21.257  1.00  62.42 ? 479 HOH B H1     1 
HETATM 6097 H H2     . HOH E 4 .   ? 26.672  4.589   21.329  1.00  62.78 ? 479 HOH B H2     1 
HETATM 6098 O O      . HOH E 4 .   ? 28.574  2.214   18.813  1.00  78.92 ? 480 HOH B O      1 
HETATM 6099 H H1     . HOH E 4 .   ? 29.490  2.453   18.647  1.00  77.64 ? 480 HOH B H1     1 
HETATM 6100 H H2     . HOH E 4 .   ? 28.208  2.986   19.269  1.00  77.59 ? 480 HOH B H2     1 
HETATM 6101 O O      . HOH E 4 .   ? 13.655  1.712   32.459  1.00  37.69 ? 481 HOH B O      1 
HETATM 6102 H H1     . HOH E 4 .   ? 14.190  2.340   32.965  1.00  38.01 ? 481 HOH B H1     1 
HETATM 6103 H H2     . HOH E 4 .   ? 14.157  1.636   31.636  1.00  37.45 ? 481 HOH B H2     1 
HETATM 6104 O O      . HOH E 4 .   ? -0.887  -10.262 43.238  1.00  98.53 ? 482 HOH B O      1 
HETATM 6105 H H1     . HOH E 4 .   ? -0.865  -10.098 44.183  1.00  96.99 ? 482 HOH B H1     1 
HETATM 6106 H H2     . HOH E 4 .   ? 0.030   -10.225 42.960  1.00  97.18 ? 482 HOH B H2     1 
HETATM 6107 O O      . HOH E 4 .   ? 30.015  -1.091  30.116  1.00  38.39 ? 483 HOH B O      1 
HETATM 6108 H H1     . HOH E 4 .   ? 30.859  -0.921  29.637  1.00  38.58 ? 483 HOH B H1     1 
HETATM 6109 H H2     . HOH E 4 .   ? 29.382  -0.947  29.409  1.00  38.30 ? 483 HOH B H2     1 
HETATM 6110 O O      . HOH E 4 .   ? 4.390   -22.497 23.186  1.00  52.43 ? 484 HOH B O      1 
HETATM 6111 H H1     . HOH E 4 .   ? 4.557   -23.407 22.921  1.00  51.87 ? 484 HOH B H1     1 
HETATM 6112 H H2     . HOH E 4 .   ? 3.470   -22.527 23.462  1.00  52.59 ? 484 HOH B H2     1 
HETATM 6113 O O      . HOH E 4 .   ? 8.021   23.927  14.666  1.00  65.75 ? 485 HOH B O      1 
HETATM 6114 H H1     . HOH E 4 .   ? 8.025   24.780  14.199  1.00  65.01 ? 485 HOH B H1     1 
HETATM 6115 H H2     . HOH E 4 .   ? 8.955   23.773  14.833  1.00  65.33 ? 485 HOH B H2     1 
HETATM 6116 O O      . HOH E 4 .   ? 10.214  -19.797 14.071  1.00  37.63 ? 486 HOH B O      1 
HETATM 6117 H H1     . HOH E 4 .   ? 11.054  -20.193 14.397  1.00  37.18 ? 486 HOH B H1     1 
HETATM 6118 H H2     . HOH E 4 .   ? 10.598  -19.138 13.475  1.00  37.30 ? 486 HOH B H2     1 
HETATM 6119 O O      . HOH E 4 .   ? 12.793  -20.649 14.455  1.00  72.26 ? 487 HOH B O      1 
HETATM 6120 H H1     . HOH E 4 .   ? 13.601  -20.539 14.972  1.00  72.54 ? 487 HOH B H1     1 
HETATM 6121 H H2     . HOH E 4 .   ? 12.989  -21.448 13.954  1.00  72.32 ? 487 HOH B H2     1 
HETATM 6122 O O      . HOH E 4 .   ? 29.994  3.054   22.116  1.00  78.15 ? 488 HOH B O      1 
HETATM 6123 H H1     . HOH E 4 .   ? 30.758  2.670   21.677  1.00  76.95 ? 488 HOH B H1     1 
HETATM 6124 H H2     . HOH E 4 .   ? 29.909  3.916   21.694  1.00  76.94 ? 488 HOH B H2     1 
HETATM 6125 O O      . HOH E 4 .   ? -8.050  -6.189  21.377  1.00  38.15 ? 489 HOH B O      1 
HETATM 6126 H H1     . HOH E 4 .   ? -8.819  -6.520  20.896  1.00  37.82 ? 489 HOH B H1     1 
HETATM 6127 H H2     . HOH E 4 .   ? -7.326  -6.667  20.953  1.00  37.51 ? 489 HOH B H2     1 
HETATM 6128 O O      . HOH E 4 .   ? -6.268  0.852   -7.156  1.00  80.15 ? 490 HOH B O      1 
HETATM 6129 H H1     . HOH E 4 .   ? -5.615  0.193   -6.903  1.00  79.41 ? 490 HOH B H1     1 
HETATM 6130 H H2     . HOH E 4 .   ? -5.744  1.538   -7.571  1.00  79.65 ? 490 HOH B H2     1 
HETATM 6131 O O      . HOH E 4 .   ? 21.595  -8.342  36.541  1.00  75.66 ? 491 HOH B O      1 
HETATM 6132 H H1     . HOH E 4 .   ? 22.106  -7.723  36.009  1.00  74.28 ? 491 HOH B H1     1 
HETATM 6133 H H2     . HOH E 4 .   ? 22.274  -8.793  37.051  1.00  74.40 ? 491 HOH B H2     1 
HETATM 6134 O O      . HOH E 4 .   ? 16.369  -12.853 7.663   0.50  33.34 ? 492 HOH B O      1 
HETATM 6135 H H1     . HOH E 4 .   ? 17.129  -13.315 7.289   0.50  33.35 ? 492 HOH B H1     1 
HETATM 6136 H H2     . HOH E 4 .   ? 16.119  -12.211 6.993   0.50  33.17 ? 492 HOH B H2     1 
HETATM 6137 O O      . HOH E 4 .   ? 16.614  -12.074 5.217   0.50  23.41 ? 493 HOH B O      1 
HETATM 6138 H H1     . HOH E 4 .   ? 17.451  -12.237 4.781   0.50  22.63 ? 493 HOH B H1     1 
HETATM 6139 H H2     . HOH E 4 .   ? 16.391  -11.182 4.942   0.50  22.73 ? 493 HOH B H2     1 
HETATM 6140 O O      . HOH E 4 .   ? 9.885   -1.686  2.676   1.00  68.51 ? 494 HOH B O      1 
HETATM 6141 H H1     . HOH E 4 .   ? 9.013   -1.344  2.451   1.00  67.32 ? 494 HOH B H1     1 
HETATM 6142 H H2     . HOH E 4 .   ? 10.380  -1.561  1.859   1.00  67.65 ? 494 HOH B H2     1 
HETATM 6143 O O      . HOH E 4 .   ? -7.126  12.200  22.969  1.00  56.93 ? 495 HOH B O      1 
HETATM 6144 H H1     . HOH E 4 .   ? -7.768  12.543  22.342  1.00  57.48 ? 495 HOH B H1     1 
HETATM 6145 H H2     . HOH E 4 .   ? -7.717  11.811  23.660  1.00  56.83 ? 495 HOH B H2     1 
HETATM 6146 O O      . HOH E 4 .   ? -6.217  18.240  21.226  1.00  82.61 ? 496 HOH B O      1 
HETATM 6147 H H1     . HOH E 4 .   ? -5.995  18.196  20.295  1.00  79.77 ? 496 HOH B H1     1 
HETATM 6148 H H2     . HOH E 4 .   ? -7.174  18.304  21.236  1.00  79.76 ? 496 HOH B H2     1 
HETATM 6149 O O      . HOH E 4 .   ? 17.102  18.664  6.625   1.00  49.75 ? 497 HOH B O      1 
HETATM 6150 H H1     . HOH E 4 .   ? 16.373  18.296  7.136   1.00  49.46 ? 497 HOH B H1     1 
HETATM 6151 H H2     . HOH E 4 .   ? 17.741  18.928  7.295   1.00  49.47 ? 497 HOH B H2     1 
HETATM 6152 O O      . HOH E 4 .   ? 0.695   16.764  33.930  1.00  54.08 ? 498 HOH B O      1 
HETATM 6153 H H1     . HOH E 4 .   ? 0.911   16.411  34.791  1.00  53.69 ? 498 HOH B H1     1 
HETATM 6154 H H2     . HOH E 4 .   ? 1.488   17.290  33.737  1.00  53.84 ? 498 HOH B H2     1 
HETATM 6155 O O      . HOH E 4 .   ? 13.093  23.237  20.937  1.00  32.12 ? 499 HOH B O      1 
HETATM 6156 H H1     . HOH E 4 .   ? 12.256  22.728  20.996  1.00  32.54 ? 499 HOH B H1     1 
HETATM 6157 H H2     . HOH E 4 .   ? 12.786  24.159  20.964  1.00  32.69 ? 499 HOH B H2     1 
HETATM 6158 O O      . HOH E 4 .   ? -2.546  -5.592  -1.790  1.00  56.95 ? 500 HOH B O      1 
HETATM 6159 H H1     . HOH E 4 .   ? -2.664  -5.072  -0.982  1.00  57.43 ? 500 HOH B H1     1 
HETATM 6160 H H2     . HOH E 4 .   ? -1.928  -5.060  -2.296  1.00  57.08 ? 500 HOH B H2     1 
HETATM 6161 O O      . HOH E 4 .   ? 13.957  17.472  35.353  1.00  29.70 ? 501 HOH B O      1 
HETATM 6162 H H1     . HOH E 4 .   ? 13.156  17.995  35.589  1.00  28.16 ? 501 HOH B H1     1 
HETATM 6163 H H2     . HOH E 4 .   ? 14.219  17.131  36.212  1.00  28.54 ? 501 HOH B H2     1 
HETATM 6164 O O      . HOH E 4 .   ? 11.952  17.876  13.243  1.00  41.39 ? 502 HOH B O      1 
HETATM 6165 H H1     . HOH E 4 .   ? 12.463  17.054  13.325  1.00  42.91 ? 502 HOH B H1     1 
HETATM 6166 H H2     . HOH E 4 .   ? 12.411  18.464  13.870  1.00  43.23 ? 502 HOH B H2     1 
HETATM 6167 O O      . HOH E 4 .   ? 27.325  0.279   12.095  1.00  48.70 ? 503 HOH B O      1 
HETATM 6168 H H1     . HOH E 4 .   ? 26.795  -0.491  11.847  1.00  47.09 ? 503 HOH B H1     1 
HETATM 6169 H H2     . HOH E 4 .   ? 26.905  0.517   12.947  1.00  46.96 ? 503 HOH B H2     1 
HETATM 6170 O O      . HOH E 4 .   ? 27.398  5.493   8.065   1.00  60.04 ? 504 HOH B O      1 
HETATM 6171 H H1     . HOH E 4 .   ? 28.142  5.565   7.449   1.00  60.75 ? 504 HOH B H1     1 
HETATM 6172 H H2     . HOH E 4 .   ? 27.045  4.641   7.783   1.00  60.35 ? 504 HOH B H2     1 
HETATM 6173 O O      . HOH E 4 .   ? 20.359  13.976  11.206  1.00  64.39 ? 505 HOH B O      1 
HETATM 6174 H H1     . HOH E 4 .   ? 20.336  13.066  10.888  1.00  64.33 ? 505 HOH B H1     1 
HETATM 6175 H H2     . HOH E 4 .   ? 20.036  14.480  10.452  1.00  64.39 ? 505 HOH B H2     1 
HETATM 6176 O O      . HOH E 4 .   ? 27.200  -11.909 17.552  1.00  73.66 ? 506 HOH B O      1 
HETATM 6177 H H1     . HOH E 4 .   ? 27.340  -10.980 17.304  1.00  71.07 ? 506 HOH B H1     1 
HETATM 6178 H H2     . HOH E 4 .   ? 28.070  -12.316 17.380  1.00  71.22 ? 506 HOH B H2     1 
HETATM 6179 O O      . HOH E 4 .   ? 11.282  -5.635  32.008  1.00  49.03 ? 507 HOH B O      1 
HETATM 6180 H H1     . HOH E 4 .   ? 11.977  -5.525  31.327  1.00  48.05 ? 507 HOH B H1     1 
HETATM 6181 H H2     . HOH E 4 .   ? 11.707  -5.131  32.723  1.00  48.22 ? 507 HOH B H2     1 
HETATM 6182 O O      . HOH E 4 .   ? 0.124   -8.862  7.108   1.00  60.44 ? 508 HOH B O      1 
HETATM 6183 H H1     . HOH E 4 .   ? -0.040  -9.680  7.591   1.00  60.01 ? 508 HOH B H1     1 
HETATM 6184 H H2     . HOH E 4 .   ? -0.158  -9.113  6.214   1.00  59.86 ? 508 HOH B H2     1 
HETATM 6185 O O      . HOH E 4 .   ? -0.939  -13.276 15.938  1.00  58.23 ? 509 HOH B O      1 
HETATM 6186 H H1     . HOH E 4 .   ? -0.561  -13.631 16.747  1.00  57.71 ? 509 HOH B H1     1 
HETATM 6187 H H2     . HOH E 4 .   ? -1.713  -13.830 15.794  1.00  57.70 ? 509 HOH B H2     1 
HETATM 6188 O O      . HOH E 4 .   ? -0.975  -9.253  -3.201  1.00  81.68 ? 510 HOH B O      1 
HETATM 6189 H H1     . HOH E 4 .   ? -0.083  -9.184  -2.848  1.00  79.43 ? 510 HOH B H1     1 
HETATM 6190 H H2     . HOH E 4 .   ? -0.890  -8.802  -4.047  1.00  79.16 ? 510 HOH B H2     1 
HETATM 6191 O O      . HOH E 4 .   ? 22.075  -4.431  35.132  1.00  88.87 ? 511 HOH B O      1 
HETATM 6192 H H1     . HOH E 4 .   ? 21.181  -4.471  35.482  1.00  87.64 ? 511 HOH B H1     1 
HETATM 6193 H H2     . HOH E 4 .   ? 22.110  -3.571  34.693  1.00  87.61 ? 511 HOH B H2     1 
HETATM 6194 O O      . HOH E 4 .   ? 4.975   17.243  5.255   1.00  58.24 ? 512 HOH B O      1 
HETATM 6195 H H1     . HOH E 4 .   ? 4.815   17.946  4.618   1.00  57.72 ? 512 HOH B H1     1 
HETATM 6196 H H2     . HOH E 4 .   ? 4.233   16.654  5.098   1.00  57.66 ? 512 HOH B H2     1 
HETATM 6197 O O      . HOH E 4 .   ? 3.053   6.095   41.724  1.00  70.47 ? 513 HOH B O      1 
HETATM 6198 H H1     . HOH E 4 .   ? 2.511   5.530   42.317  1.00  69.42 ? 513 HOH B H1     1 
HETATM 6199 H H2     . HOH E 4 .   ? 2.949   6.956   42.141  1.00  69.13 ? 513 HOH B H2     1 
HETATM 6200 O O      . HOH E 4 .   ? 15.375  1.506   29.375  1.00  31.71 ? 514 HOH B O      1 
HETATM 6201 H H1     . HOH E 4 .   ? 16.301  1.790   29.496  1.00  31.10 ? 514 HOH B H1     1 
HETATM 6202 H H2     . HOH E 4 .   ? 14.990  2.356   29.061  1.00  31.75 ? 514 HOH B H2     1 
HETATM 6203 O O      . HOH E 4 .   ? 27.729  -5.709  16.763  1.00  35.76 ? 515 HOH B O      1 
HETATM 6204 H H1     . HOH E 4 .   ? 27.351  -5.284  15.990  1.00  34.24 ? 515 HOH B H1     1 
HETATM 6205 H H2     . HOH E 4 .   ? 27.440  -5.082  17.445  1.00  34.66 ? 515 HOH B H2     1 
HETATM 6206 O O      . HOH E 4 .   ? -7.190  -9.750  24.773  1.00  61.91 ? 516 HOH B O      1 
HETATM 6207 H H1     . HOH E 4 .   ? -6.663  -9.089  24.311  1.00  60.78 ? 516 HOH B H1     1 
HETATM 6208 H H2     . HOH E 4 .   ? -7.030  -9.496  25.693  1.00  60.78 ? 516 HOH B H2     1 
HETATM 6209 O O      . HOH E 4 .   ? 25.993  1.508   14.297  1.00  68.56 ? 517 HOH B O      1 
HETATM 6210 H H1     . HOH E 4 .   ? 26.087  2.397   13.936  1.00  68.28 ? 517 HOH B H1     1 
HETATM 6211 H H2     . HOH E 4 .   ? 25.021  1.459   14.428  1.00  68.58 ? 517 HOH B H2     1 
HETATM 6212 O O      . HOH E 4 .   ? 21.855  9.795   9.117   1.00  41.82 ? 518 HOH B O      1 
HETATM 6213 H H1     . HOH E 4 .   ? 21.246  10.488  8.824   1.00  41.91 ? 518 HOH B H1     1 
HETATM 6214 H H2     . HOH E 4 .   ? 21.259  9.163   9.550   1.00  42.27 ? 518 HOH B H2     1 
HETATM 6215 O O      . HOH E 4 .   ? 26.734  -13.145 21.323  1.00  57.29 ? 519 HOH B O      1 
HETATM 6216 H H1     . HOH E 4 .   ? 26.649  -13.033 20.365  1.00  57.62 ? 519 HOH B H1     1 
HETATM 6217 H H2     . HOH E 4 .   ? 26.376  -12.310 21.640  1.00  57.19 ? 519 HOH B H2     1 
HETATM 6218 O O      . HOH E 4 .   ? 26.161  -0.919  15.932  1.00  41.83 ? 520 HOH B O      1 
HETATM 6219 H H1     . HOH E 4 .   ? 25.196  -1.022  15.787  1.00  41.62 ? 520 HOH B H1     1 
HETATM 6220 H H2     . HOH E 4 .   ? 26.299  -0.050  15.514  1.00  41.61 ? 520 HOH B H2     1 
HETATM 6221 O O      . HOH E 4 .   ? 14.504  21.975  22.954  1.00  34.00 ? 521 HOH B O      1 
HETATM 6222 H H1     . HOH E 4 .   ? 14.599  21.110  22.513  1.00  33.43 ? 521 HOH B H1     1 
HETATM 6223 H H2     . HOH E 4 .   ? 14.054  22.485  22.246  1.00  34.12 ? 521 HOH B H2     1 
HETATM 6224 O O      . HOH E 4 .   ? 20.345  6.965   30.114  1.00  64.57 ? 522 HOH B O      1 
HETATM 6225 H H1     . HOH E 4 .   ? 20.613  7.574   29.422  1.00  63.72 ? 522 HOH B H1     1 
HETATM 6226 H H2     . HOH E 4 .   ? 19.403  6.855   29.923  1.00  64.01 ? 522 HOH B H2     1 
HETATM 6227 O O      . HOH E 4 .   ? 20.182  -10.038 31.213  1.00  58.68 ? 523 HOH B O      1 
HETATM 6228 H H1     . HOH E 4 .   ? 19.800  -9.981  32.093  1.00  59.05 ? 523 HOH B H1     1 
HETATM 6229 H H2     . HOH E 4 .   ? 21.131  -10.008 31.392  1.00  59.60 ? 523 HOH B H2     1 
HETATM 6230 O O      . HOH E 4 .   ? 15.835  10.054  2.242   1.00  47.25 ? 524 HOH B O      1 
HETATM 6231 H H1     . HOH E 4 .   ? 15.347  9.665   1.499   1.00  46.30 ? 524 HOH B H1     1 
HETATM 6232 H H2     . HOH E 4 .   ? 16.741  9.724   2.101   1.00  46.44 ? 524 HOH B H2     1 
HETATM 6233 O O      . HOH E 4 .   ? -2.975  14.238  15.918  1.00  49.06 ? 525 HOH B O      1 
HETATM 6234 H H1     . HOH E 4 .   ? -2.794  15.080  15.485  1.00  48.17 ? 525 HOH B H1     1 
HETATM 6235 H H2     . HOH E 4 .   ? -3.793  13.935  15.507  1.00  48.50 ? 525 HOH B H2     1 
HETATM 6236 O O      . HOH E 4 .   ? 0.624   -12.803 28.291  1.00  47.52 ? 526 HOH B O      1 
HETATM 6237 H H1     . HOH E 4 .   ? 0.186   -12.039 27.904  1.00  47.89 ? 526 HOH B H1     1 
HETATM 6238 H H2     . HOH E 4 .   ? 0.023   -13.023 29.032  1.00  47.95 ? 526 HOH B H2     1 
HETATM 6239 O O      . HOH E 4 .   ? 2.075   21.554  20.532  1.00  39.67 ? 527 HOH B O      1 
HETATM 6240 H H1     . HOH E 4 .   ? 2.040   20.657  20.130  1.00  40.43 ? 527 HOH B H1     1 
HETATM 6241 H H2     . HOH E 4 .   ? 1.841   22.084  19.767  1.00  40.27 ? 527 HOH B H2     1 
HETATM 6242 O O      . HOH E 4 .   ? -4.815  -7.517  14.966  1.00  37.99 ? 528 HOH B O      1 
HETATM 6243 H H1     . HOH E 4 .   ? -4.293  -8.205  14.511  1.00  38.97 ? 528 HOH B H1     1 
HETATM 6244 H H2     . HOH E 4 .   ? -5.255  -7.062  14.228  1.00  39.06 ? 528 HOH B H2     1 
HETATM 6245 O O      . HOH E 4 .   ? -9.136  -4.303  27.232  1.00  73.28 ? 529 HOH B O      1 
HETATM 6246 H H1     . HOH E 4 .   ? -8.841  -4.584  26.353  1.00  71.87 ? 529 HOH B H1     1 
HETATM 6247 H H2     . HOH E 4 .   ? -9.990  -4.737  27.328  1.00  71.96 ? 529 HOH B H2     1 
HETATM 6248 O O      . HOH E 4 .   ? 3.478   17.422  33.332  1.00  55.39 ? 530 HOH B O      1 
HETATM 6249 H H1     . HOH E 4 .   ? 3.128   16.781  32.674  1.00  56.56 ? 530 HOH B H1     1 
HETATM 6250 H H2     . HOH E 4 .   ? 4.415   17.357  33.125  1.00  56.12 ? 530 HOH B H2     1 
HETATM 6251 O O      . HOH E 4 .   ? 15.423  -0.522  27.588  1.00  24.53 ? 531 HOH B O      1 
HETATM 6252 H H1     . HOH E 4 .   ? 15.397  0.235   28.197  1.00  24.65 ? 531 HOH B H1     1 
HETATM 6253 H H2     . HOH E 4 .   ? 14.600  -0.971  27.766  1.00  24.47 ? 531 HOH B H2     1 
HETATM 6254 O O      . HOH E 4 .   ? 10.686  20.804  26.494  1.00  46.62 ? 532 HOH B O      1 
HETATM 6255 H H1     . HOH E 4 .   ? 9.727   20.797  26.399  1.00  46.34 ? 532 HOH B H1     1 
HETATM 6256 H H2     . HOH E 4 .   ? 10.793  21.254  27.370  1.00  46.32 ? 532 HOH B H2     1 
HETATM 6257 O O      . HOH E 4 .   ? 2.457   -19.059 26.384  1.00  63.62 ? 533 HOH B O      1 
HETATM 6258 H H1     . HOH E 4 .   ? 2.565   -20.009 26.409  1.00  62.74 ? 533 HOH B H1     1 
HETATM 6259 H H2     . HOH E 4 .   ? 3.357   -18.729 26.552  1.00  63.00 ? 533 HOH B H2     1 
HETATM 6260 O O      . HOH E 4 .   ? 18.072  2.005   31.279  0.66  35.65 ? 534 HOH B O      1 
HETATM 6261 H H1     . HOH E 4 .   ? 18.853  1.491   31.541  0.66  36.42 ? 534 HOH B H1     1 
HETATM 6262 H H2     . HOH E 4 .   ? 18.420  2.483   30.520  0.66  35.85 ? 534 HOH B H2     1 
HETATM 6263 O O      . HOH E 4 .   ? 18.459  2.466   29.140  0.33  28.65 ? 535 HOH B O      1 
HETATM 6264 H H1     . HOH E 4 .   ? 19.290  2.083   28.798  0.33  29.22 ? 535 HOH B H1     1 
HETATM 6265 H H2     . HOH E 4 .   ? 18.795  3.290   29.500  0.33  29.19 ? 535 HOH B H2     1 
HETATM 6266 O O      . HOH E 4 .   ? 22.410  16.793  14.384  1.00  75.00 ? 536 HOH B O      1 
HETATM 6267 H H1     . HOH E 4 .   ? 22.512  15.838  14.368  1.00  72.37 ? 536 HOH B H1     1 
HETATM 6268 H H2     . HOH E 4 .   ? 23.201  17.102  13.941  1.00  72.33 ? 536 HOH B H2     1 
HETATM 6269 O O      . HOH E 4 .   ? -9.802  -9.817  8.445   1.00  69.79 ? 537 HOH B O      1 
HETATM 6270 H H1     . HOH E 4 .   ? -10.432 -9.766  9.168   1.00  70.04 ? 537 HOH B H1     1 
HETATM 6271 H H2     . HOH E 4 .   ? -8.973  -9.595  8.878   1.00  70.10 ? 537 HOH B H2     1 
HETATM 6272 O O      . HOH E 4 .   ? -14.018 1.633   24.799  1.00  49.63 ? 538 HOH B O      1 
HETATM 6273 H H1     . HOH E 4 .   ? -13.959 2.333   25.460  1.00  49.58 ? 538 HOH B H1     1 
HETATM 6274 H H2     . HOH E 4 .   ? -14.400 0.900   25.295  1.00  49.60 ? 538 HOH B H2     1 
HETATM 6275 O O      . HOH E 4 .   ? 3.676   13.883  38.458  1.00  60.29 ? 539 HOH B O      1 
HETATM 6276 H H1     . HOH E 4 .   ? 3.755   13.187  39.124  1.00  59.88 ? 539 HOH B H1     1 
HETATM 6277 H H2     . HOH E 4 .   ? 2.725   13.999  38.389  1.00  60.02 ? 539 HOH B H2     1 
HETATM 6278 O O      . HOH E 4 .   ? 0.407   -8.692  11.503  1.00  65.11 ? 540 HOH B O      1 
HETATM 6279 H H1     . HOH E 4 .   ? 0.113   -9.603  11.290  1.00  66.16 ? 540 HOH B H1     1 
HETATM 6280 H H2     . HOH E 4 .   ? 1.206   -8.630  10.948  1.00  66.05 ? 540 HOH B H2     1 
HETATM 6281 O O      . HOH E 4 .   ? 3.364   -20.659 16.110  1.00  75.98 ? 541 HOH B O      1 
HETATM 6282 H H1     . HOH E 4 .   ? 3.394   -19.838 16.637  1.00  74.42 ? 541 HOH B H1     1 
HETATM 6283 H H2     . HOH E 4 .   ? 3.179   -20.317 15.232  1.00  74.39 ? 541 HOH B H2     1 
HETATM 6284 O O      . HOH E 4 .   ? 7.852   22.269  25.959  1.00  64.35 ? 542 HOH B O      1 
HETATM 6285 H H1     . HOH E 4 .   ? 8.761   22.461  26.231  1.00  64.22 ? 542 HOH B H1     1 
HETATM 6286 H H2     . HOH E 4 .   ? 7.492   23.143  26.153  1.00  64.41 ? 542 HOH B H2     1 
HETATM 6287 O O      . HOH E 4 .   ? 11.805  18.816  36.116  1.00  63.08 ? 543 HOH B O      1 
HETATM 6288 H H1     . HOH E 4 .   ? 10.988  18.645  35.628  1.00  62.47 ? 543 HOH B H1     1 
HETATM 6289 H H2     . HOH E 4 .   ? 11.457  19.232  36.923  1.00  62.17 ? 543 HOH B H2     1 
HETATM 6290 O O      . HOH E 4 .   ? 32.369  -0.678  28.697  1.00  59.16 ? 544 HOH B O      1 
HETATM 6291 H H1     . HOH E 4 .   ? 32.827  -1.340  28.148  1.00  57.96 ? 544 HOH B H1     1 
HETATM 6292 H H2     . HOH E 4 .   ? 32.798  0.148   28.457  1.00  57.96 ? 544 HOH B H2     1 
HETATM 6293 O O      . HOH E 4 .   ? 22.712  11.939  12.283  1.00  67.70 ? 545 HOH B O      1 
HETATM 6294 H H1     . HOH E 4 .   ? 22.647  11.202  11.669  1.00  66.60 ? 545 HOH B H1     1 
HETATM 6295 H H2     . HOH E 4 .   ? 23.003  12.665  11.730  1.00  66.73 ? 545 HOH B H2     1 
HETATM 6296 O O      . HOH E 4 .   ? 11.763  2.479   41.015  1.00  57.95 ? 546 HOH B O      1 
HETATM 6297 H H1     . HOH E 4 .   ? 12.442  2.194   40.395  1.00  57.63 ? 546 HOH B H1     1 
HETATM 6298 H H2     . HOH E 4 .   ? 11.225  1.681   41.140  1.00  58.08 ? 546 HOH B H2     1 
HETATM 6299 O O      . HOH E 4 .   ? 9.367   -7.829  35.958  1.00  74.07 ? 547 HOH B O      1 
HETATM 6300 H H1     . HOH E 4 .   ? 9.249   -8.236  35.088  1.00  73.94 ? 547 HOH B H1     1 
HETATM 6301 H H2     . HOH E 4 .   ? 10.324  -7.798  36.041  1.00  73.60 ? 547 HOH B H2     1 
HETATM 6302 O O      . HOH E 4 .   ? 5.779   23.212  15.904  1.00  62.13 ? 548 HOH B O      1 
HETATM 6303 H H1     . HOH E 4 .   ? 6.596   23.345  15.375  1.00  61.39 ? 548 HOH B H1     1 
HETATM 6304 H H2     . HOH E 4 .   ? 5.244   23.960  15.630  1.00  61.54 ? 548 HOH B H2     1 
HETATM 6305 O O      . HOH E 4 .   ? -0.907  -1.755  39.005  1.00  71.26 ? 549 HOH B O      1 
HETATM 6306 H H1     . HOH E 4 .   ? -0.804  -2.598  38.542  1.00  71.72 ? 549 HOH B H1     1 
HETATM 6307 H H2     . HOH E 4 .   ? -0.186  -1.923  39.649  1.00  71.76 ? 549 HOH B H2     1 
HETATM 6308 O O      . HOH E 4 .   ? 16.466  -5.709  33.781  1.00  81.58 ? 550 HOH B O      1 
HETATM 6309 H H1     . HOH E 4 .   ? 16.891  -6.428  34.255  1.00  81.14 ? 550 HOH B H1     1 
HETATM 6310 H H2     . HOH E 4 .   ? 16.815  -4.921  34.200  1.00  81.40 ? 550 HOH B H2     1 
HETATM 6311 O O      . HOH E 4 .   ? 8.187   26.504  12.953  1.00  71.90 ? 551 HOH B O      1 
HETATM 6312 H H1     . HOH E 4 .   ? 8.473   26.177  12.083  1.00  70.87 ? 551 HOH B H1     1 
HETATM 6313 H H2     . HOH E 4 .   ? 8.944   27.075  13.202  1.00  71.08 ? 551 HOH B H2     1 
HETATM 6314 O O      . HOH E 4 .   ? 0.056   -5.767  11.531  1.00  51.96 ? 552 HOH B O      1 
HETATM 6315 H H1     . HOH E 4 .   ? 0.259   -6.719  11.579  1.00  52.19 ? 552 HOH B H1     1 
HETATM 6316 H H2     . HOH E 4 .   ? -0.675  -5.699  12.150  1.00  52.17 ? 552 HOH B H2     1 
HETATM 6317 O O      . HOH E 4 .   ? 26.689  -13.997 15.297  1.00  63.79 ? 553 HOH B O      1 
HETATM 6318 H H1     . HOH E 4 .   ? 27.130  -13.207 14.979  1.00  63.57 ? 553 HOH B H1     1 
HETATM 6319 H H2     . HOH E 4 .   ? 26.393  -13.718 16.173  1.00  63.67 ? 553 HOH B H2     1 
HETATM 6320 O O      . HOH E 4 .   ? 31.814  -1.791  32.136  1.00  58.74 ? 554 HOH B O      1 
HETATM 6321 H H1     . HOH E 4 .   ? 31.228  -1.475  31.420  1.00  58.64 ? 554 HOH B H1     1 
HETATM 6322 H H2     . HOH E 4 .   ? 32.607  -1.214  32.045  1.00  58.70 ? 554 HOH B H2     1 
HETATM 6323 O O      . HOH E 4 .   ? 1.381   -2.254  -2.943  1.00  85.00 ? 555 HOH B O      1 
HETATM 6324 H H1     . HOH E 4 .   ? 1.430   -2.934  -3.621  1.00  83.48 ? 555 HOH B H1     1 
HETATM 6325 H H2     . HOH E 4 .   ? 1.982   -1.580  -3.269  1.00  83.56 ? 555 HOH B H2     1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'Chirality errors at several residues' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  MET 19  19  19  MET MET A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
B 2 1   ILE 1   16  16  ILE ILE B . n 
B 2 2   VAL 2   17  17  VAL VAL B . n 
B 2 3   GLY 3   18  18  GLY GLY B . n 
B 2 4   GLY 4   19  19  GLY GLY B . n 
B 2 5   ARG 5   20  20  ARG ARG B . n 
B 2 6   ASP 6   21  21  ASP ASP B . n 
B 2 7   THR 7   22  22  THR THR B . n 
B 2 8   SER 8   23  23  SER SER B . n 
B 2 9   LEU 9   24  24  LEU LEU B . n 
B 2 10  GLY 10  25  25  GLY GLY B . n 
B 2 11  ARG 11  26  26  ARG ARG B . n 
B 2 12  TRP 12  27  27  TRP TRP B . n 
B 2 13  PRO 13  28  28  PRO PRO B . n 
B 2 14  TRP 14  29  29  TRP TRP B . n 
B 2 15  GLN 15  30  30  GLN GLN B . n 
B 2 16  VAL 16  31  31  VAL VAL B . n 
B 2 17  SER 17  32  32  SER SER B . n 
B 2 18  LEU 18  33  33  LEU LEU B . n 
B 2 19  ARG 19  34  34  ARG ARG B . n 
B 2 20  TYR 20  35  35  TYR TYR B . n 
B 2 21  ASP 21  37  37  ASP ASP B . n 
B 2 22  GLY 22  38  38  GLY GLY B . n 
B 2 23  ALA 23  39  39  ALA ALA B . n 
B 2 24  HIS 24  40  40  HIS HIS B . n 
B 2 25  LEU 25  41  41  LEU LEU B . n 
B 2 26  CYS 26  42  42  CYS CYS B . n 
B 2 27  GLY 27  43  43  GLY GLY B . n 
B 2 28  GLY 28  44  44  GLY GLY B . n 
B 2 29  SER 29  45  45  SER SER B . n 
B 2 30  LEU 30  46  46  LEU LEU B . n 
B 2 31  LEU 31  47  47  LEU LEU B . n 
B 2 32  SER 32  48  48  SER SER B . n 
B 2 33  GLY 33  49  49  GLY GLY B . n 
B 2 34  ASP 34  50  50  ASP ASP B . n 
B 2 35  TRP 35  51  51  TRP TRP B . n 
B 2 36  VAL 36  52  52  VAL VAL B . n 
B 2 37  LEU 37  53  53  LEU LEU B . n 
B 2 38  THR 38  54  54  THR THR B . n 
B 2 39  ALA 39  55  55  ALA ALA B . n 
B 2 40  ALA 40  56  56  ALA ALA B . n 
B 2 41  HIS 41  57  57  HIS HIS B . n 
B 2 42  CYS 42  58  58  CYS CYS B . n 
B 2 43  PHE 43  59  59  PHE PHE B . n 
B 2 44  PRO 44  60  60  PRO PRO B . n 
B 2 45  GLU 45  61  61  GLU GLU B . n 
B 2 46  ARG 46  62  62  ARG ARG B . n 
B 2 47  ASN 47  63  63  ASN ASN B . n 
B 2 48  ARG 48  64  64  ARG ARG B . n 
B 2 49  VAL 49  65  65  VAL VAL B . n 
B 2 50  LEU 50  65  65  LEU LEU B A n 
B 2 51  SER 51  65  65  SER SER B B n 
B 2 52  ARG 52  65  65  ARG ARG B C n 
B 2 53  TRP 53  65  65  TRP TRP B D n 
B 2 54  ARG 54  65  65  ARG ARG B E n 
B 2 55  VAL 55  66  66  VAL VAL B . n 
B 2 56  PHE 56  67  67  PHE PHE B . n 
B 2 57  ALA 57  68  68  ALA ALA B . n 
B 2 58  GLY 58  69  69  GLY GLY B . n 
B 2 59  ALA 59  70  70  ALA ALA B . n 
B 2 60  VAL 60  71  71  VAL VAL B . n 
B 2 61  ALA 61  72  72  ALA ALA B . n 
B 2 62  GLN 62  73  73  GLN GLN B . n 
B 2 63  ALA 63  74  74  ALA ALA B . n 
B 2 64  SER 64  75  75  SER SER B . n 
B 2 65  PRO 65  76  76  PRO PRO B . n 
B 2 66  HIS 66  77  77  HIS HIS B . n 
B 2 67  GLY 67  78  78  GLY GLY B . n 
B 2 68  LEU 68  81  81  LEU LEU B . n 
B 2 69  GLN 69  82  82  GLN GLN B . n 
B 2 70  LEU 70  83  83  LEU LEU B . n 
B 2 71  GLY 71  84  84  GLY GLY B . n 
B 2 72  VAL 72  85  85  VAL VAL B . n 
B 2 73  GLN 73  86  86  GLN GLN B . n 
B 2 74  ALA 74  87  87  ALA ALA B . n 
B 2 75  VAL 75  88  88  VAL VAL B . n 
B 2 76  VAL 76  89  89  VAL VAL B . n 
B 2 77  TYR 77  90  90  TYR TYR B . n 
B 2 78  HIS 78  91  91  HIS HIS B . n 
B 2 79  GLY 79  92  92  GLY GLY B . n 
B 2 80  GLY 80  93  93  GLY GLY B . n 
B 2 81  TYR 81  94  94  TYR TYR B . n 
B 2 82  LEU 82  95  95  LEU LEU B . n 
B 2 83  PRO 83  96  96  PRO PRO B . n 
B 2 84  PHE 84  97  97  PHE PHE B . n 
B 2 85  ARG 85  97  ?   ?   ?   B A n 
B 2 86  ASP 86  97  ?   ?   ?   B B n 
B 2 87  PRO 87  97  ?   ?   ?   B C n 
B 2 88  ASN 88  97  ?   ?   ?   B D n 
B 2 89  SER 89  97  ?   ?   ?   B E n 
B 2 90  GLU 90  97  ?   ?   ?   B F n 
B 2 91  GLU 91  97  ?   ?   ?   B G n 
B 2 92  ASN 92  99  99  ASN ASN B . n 
B 2 93  SER 93  100 100 SER SER B . n 
B 2 94  ASN 94  101 101 ASN ASN B . n 
B 2 95  ASP 95  102 102 ASP ASP B . n 
B 2 96  ILE 96  103 103 ILE ILE B . n 
B 2 97  ALA 97  104 104 ALA ALA B . n 
B 2 98  LEU 98  105 105 LEU LEU B . n 
B 2 99  VAL 99  106 106 VAL VAL B . n 
B 2 100 HIS 100 107 107 HIS HIS B . n 
B 2 101 LEU 101 108 108 LEU LEU B . n 
B 2 102 SER 102 109 109 SER SER B . n 
B 2 103 SER 103 110 110 SER SER B . n 
B 2 104 PRO 104 111 111 PRO PRO B . n 
B 2 105 LEU 105 112 112 LEU LEU B . n 
B 2 106 PRO 106 113 113 PRO PRO B . n 
B 2 107 LEU 107 114 114 LEU LEU B . n 
B 2 108 THR 108 115 115 THR THR B . n 
B 2 109 GLU 109 116 116 GLU GLU B . n 
B 2 110 TYR 110 117 117 TYR TYR B . n 
B 2 111 ILE 111 118 118 ILE ILE B . n 
B 2 112 GLN 112 119 119 GLN GLN B . n 
B 2 113 PRO 113 120 120 PRO PRO B . n 
B 2 114 VAL 114 121 121 VAL VAL B . n 
B 2 115 CYS 115 122 122 CYS CYS B . n 
B 2 116 LEU 116 123 123 LEU LEU B . n 
B 2 117 PRO 117 124 124 PRO PRO B . n 
B 2 118 ALA 118 125 125 ALA ALA B . n 
B 2 119 ALA 119 126 126 ALA ALA B . n 
B 2 120 GLY 120 127 127 GLY GLY B . n 
B 2 121 GLN 121 128 128 GLN GLN B . n 
B 2 122 ALA 122 129 129 ALA ALA B . n 
B 2 123 LEU 123 130 130 LEU LEU B . n 
B 2 124 VAL 124 131 131 VAL VAL B . n 
B 2 125 ASP 125 132 132 ASP ASP B . n 
B 2 126 GLY 126 133 133 GLY GLY B . n 
B 2 127 LYS 127 134 134 LYS LYS B . n 
B 2 128 ILE 128 135 135 ILE ILE B . n 
B 2 129 CYS 129 136 136 CYS CYS B . n 
B 2 130 THR 130 137 137 THR THR B . n 
B 2 131 VAL 131 138 138 VAL VAL B . n 
B 2 132 THR 132 139 139 THR THR B . n 
B 2 133 GLY 133 140 140 GLY GLY B . n 
B 2 134 TRP 134 141 141 TRP TRP B . n 
B 2 135 GLY 135 142 142 GLY GLY B . n 
B 2 136 ASN 136 143 143 ASN ASN B . n 
B 2 137 THR 137 144 144 THR THR B . n 
B 2 138 GLN 138 145 145 GLN GLN B . n 
B 2 139 TYR 139 146 146 TYR TYR B . n 
B 2 140 TYR 140 147 147 TYR TYR B . n 
B 2 141 GLY 141 148 148 GLY GLY B . n 
B 2 142 GLN 142 150 150 GLN GLN B . n 
B 2 143 GLN 143 151 151 GLN GLN B . n 
B 2 144 ALA 144 152 152 ALA ALA B . n 
B 2 145 GLY 145 153 153 GLY GLY B . n 
B 2 146 VAL 146 154 154 VAL VAL B . n 
B 2 147 LEU 147 155 155 LEU LEU B . n 
B 2 148 GLN 148 156 156 GLN GLN B . n 
B 2 149 GLU 149 157 157 GLU GLU B . n 
B 2 150 ALA 150 158 158 ALA ALA B . n 
B 2 151 ARG 151 159 159 ARG ARG B . n 
B 2 152 VAL 152 160 160 VAL VAL B . n 
B 2 153 PRO 153 161 161 PRO PRO B . n 
B 2 154 ILE 154 162 162 ILE ILE B . n 
B 2 155 ILE 155 163 163 ILE ILE B . n 
B 2 156 SER 156 164 164 SER SER B . n 
B 2 157 ASN 157 165 165 ASN ASN B . n 
B 2 158 ASP 158 166 166 ASP ASP B . n 
B 2 159 VAL 159 167 167 VAL VAL B . n 
B 2 160 CYS 160 168 168 CYS CYS B . n 
B 2 161 ASN 161 169 169 ASN ASN B . n 
B 2 162 GLY 162 170 170 GLY GLY B . n 
B 2 163 ALA 163 171 171 ALA ALA B . n 
B 2 164 ASP 164 172 172 ASP ASP B . n 
B 2 165 PHE 165 173 173 PHE PHE B . n 
B 2 166 TYR 166 174 174 TYR TYR B . n 
B 2 167 GLY 167 175 175 GLY GLY B . n 
B 2 168 ASN 168 175 175 ASN ASN B A n 
B 2 169 GLN 169 175 175 GLN GLN B B n 
B 2 170 ILE 170 176 176 ILE ILE B . n 
B 2 171 LYS 171 177 177 LYS LYS B . n 
B 2 172 PRO 172 178 178 PRO PRO B . n 
B 2 173 LYS 173 179 179 LYS LYS B . n 
B 2 174 MET 174 180 180 MET MET B . n 
B 2 175 PHE 175 181 181 PHE PHE B . n 
B 2 176 CYS 176 182 182 CYS CYS B . n 
B 2 177 ALA 177 183 183 ALA ALA B . n 
B 2 178 GLY 178 184 184 GLY GLY B . n 
B 2 179 TYR 179 184 184 TYR TYR B A n 
B 2 180 PRO 180 185 185 PRO PRO B . n 
B 2 181 GLU 181 186 186 GLU GLU B . n 
B 2 182 GLY 182 186 186 GLY GLY B A n 
B 2 183 GLY 183 186 186 GLY GLY B B n 
B 2 184 ILE 184 186 186 ILE ILE B C n 
B 2 185 ASP 185 189 189 ASP ASP B . n 
B 2 186 ALA 186 190 190 ALA ALA B . n 
B 2 187 CYS 187 191 191 CYS CYS B . n 
B 2 188 GLN 188 192 192 GLN GLN B . n 
B 2 189 GLY 189 193 193 GLY GLY B . n 
B 2 190 ASP 190 194 194 ASP ASP B . n 
B 2 191 SER 191 195 195 SER SER B . n 
B 2 192 GLY 192 196 196 GLY GLY B . n 
B 2 193 GLY 193 197 197 GLY GLY B . n 
B 2 194 PRO 194 198 198 PRO PRO B . n 
B 2 195 PHE 195 199 199 PHE PHE B . n 
B 2 196 VAL 196 200 200 VAL VAL B . n 
B 2 197 CYS 197 201 201 CYS CYS B . n 
B 2 198 GLU 198 202 202 GLU GLU B . n 
B 2 199 ASP 199 203 203 ASP ASP B . n 
B 2 200 SER 200 204 204 SER SER B . n 
B 2 201 ILE 201 205 205 ILE ILE B . n 
B 2 202 SER 202 206 206 SER SER B . n 
B 2 203 ARG 203 207 207 ARG ARG B . n 
B 2 204 THR 204 208 208 THR THR B . n 
B 2 205 PRO 205 208 208 PRO PRO B A n 
B 2 206 ARG 206 208 208 ARG ARG B B n 
B 2 207 TRP 207 208 208 TRP TRP B C n 
B 2 208 ARG 208 208 208 ARG ARG B D n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 CYS 210 210 210 CYS CYS B . n 
B 2 211 GLY 211 211 211 GLY GLY B . n 
B 2 212 ILE 212 212 212 ILE ILE B . n 
B 2 213 VAL 213 213 213 VAL VAL B . n 
B 2 214 SER 214 214 214 SER SER B . n 
B 2 215 TRP 215 215 215 TRP TRP B . n 
B 2 216 GLY 216 216 216 GLY GLY B . n 
B 2 217 THR 217 217 217 THR THR B . n 
B 2 218 GLY 218 219 219 GLY GLY B . n 
B 2 219 CYS 219 220 220 CYS CYS B . n 
B 2 220 ALA 220 221 221 ALA ALA B . n 
B 2 221 LEU 221 221 221 LEU LEU B A n 
B 2 222 ALA 222 222 222 ALA ALA B . n 
B 2 223 GLN 223 223 223 GLN GLN B . n 
B 2 224 LYS 224 224 224 LYS LYS B . n 
B 2 225 PRO 225 225 225 PRO PRO B . n 
B 2 226 GLY 226 226 226 GLY GLY B . n 
B 2 227 VAL 227 227 227 VAL VAL B . n 
B 2 228 TYR 228 228 228 TYR TYR B . n 
B 2 229 THR 229 229 229 THR THR B . n 
B 2 230 LYS 230 230 230 LYS LYS B . n 
B 2 231 VAL 231 231 231 VAL VAL B . n 
B 2 232 SER 232 232 232 SER SER B . n 
B 2 233 ASP 233 233 233 ASP ASP B . n 
B 2 234 PHE 234 234 234 PHE PHE B . n 
B 2 235 ARG 235 235 235 ARG ARG B . n 
B 2 236 GLU 236 236 236 GLU GLU B . n 
B 2 237 TRP 237 237 237 TRP TRP B . n 
B 2 238 ILE 238 238 238 ILE ILE B . n 
B 2 239 PHE 239 239 239 PHE PHE B . n 
B 2 240 GLN 240 240 240 GLN GLN B . n 
B 2 241 ALA 241 241 241 ALA ALA B . n 
B 2 242 ILE 242 242 242 ILE ILE B . n 
B 2 243 LYS 243 243 243 LYS LYS B . n 
B 2 244 THR 244 244 244 THR THR B . n 
B 2 245 HIS 245 245 245 HIS HIS B . n 
B 2 246 SER 246 246 246 SER SER B . n 
B 2 247 GLU 247 247 247 GLU GLU B . n 
B 2 248 ALA 248 248 248 ALA ALA B . n 
B 2 249 SER 249 249 249 SER SER B . n 
B 2 250 GLY 250 250 250 GLY GLY B . n 
B 2 251 MET 251 251 251 MET MET B . n 
B 2 252 VAL 252 252 252 VAL VAL B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 GLN 254 254 254 GLN GLN B . n 
B 2 255 LEU 255 255 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-20 
2 'Structure model' 1 1 2007-10-21 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-07-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HG   B SER 195 ? ? HN3   B CR4 346 ? ? 0.82 
2  1 HG   B SER 195 ? ? H2    B HOH 531 ? ? 1.05 
3  1 HH12 B CR4 346 ? ? H1    B HOH 360 ? ? 1.25 
4  1 OG   B SER 100 ? ? H1    B HOH 454 ? ? 1.50 
5  1 OG   B SER 246 ? B H2    B HOH 495 ? ? 1.52 
6  1 OE1  B GLN 150 ? ? H2    B HOH 458 ? ? 1.53 
7  1 O    B LEU 112 ? ? H1    B HOH 412 ? ? 1.54 
8  1 O    B HIS 245 ? ? H2    B HOH 421 ? ? 1.55 
9  1 OG1  A THR 69  ? ? H1    A HOH 129 ? ? 1.55 
10 1 O    B GLY 18  ? ? H1    B HOH 418 ? ? 1.55 
11 1 O    B PRO 111 ? ? H1    B HOH 527 ? ? 1.58 
12 1 OG1  B THR 137 ? ? H2    B HOH 429 ? ? 1.58 
13 1 O    B LEU 130 ? ? H2    B HOH 439 ? ? 1.59 
14 1 OG   B SER 195 ? ? "O6'" B CR4 346 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 B HIS 40  ? ? CD2 B HIS 40  ? ? 1.307 1.373 -0.066 0.011 N 
2 1 NE2 B HIS 57  ? ? CD2 B HIS 57  ? ? 1.302 1.373 -0.071 0.011 N 
3 1 NE2 B HIS 91  ? ? CD2 B HIS 91  ? ? 1.293 1.373 -0.080 0.011 N 
4 1 NE2 B HIS 107 ? ? CD2 B HIS 107 ? ? 1.296 1.373 -0.077 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG  A TRP 28  ? ? CD1 A TRP 28  ? ? NE1 A TRP 28  ? ? 102.54 110.10 -7.56  1.00 N 
2  1 CD1 A TRP 28  ? ? NE1 A TRP 28  ? ? CE2 A TRP 28  ? ? 117.64 109.00 8.64   0.90 N 
3  1 NE1 A TRP 28  ? ? CE2 A TRP 28  ? ? CZ2 A TRP 28  ? ? 140.76 130.40 10.36  1.10 N 
4  1 NE1 A TRP 28  ? ? CE2 A TRP 28  ? ? CD2 A TRP 28  ? ? 100.17 107.30 -7.13  1.00 N 
5  1 NE  A ARG 35  ? ? CZ  A ARG 35  ? ? NH2 A ARG 35  ? ? 115.54 120.30 -4.76  0.50 N 
6  1 CB  A ASP 60  ? ? CG  A ASP 60  ? ? OD2 A ASP 60  ? ? 111.98 118.30 -6.32  0.90 N 
7  1 CB  A ASP 76  ? ? CG  A ASP 76  ? ? OD2 A ASP 76  ? ? 112.90 118.30 -5.40  0.90 N 
8  1 NE  A ARG 97  ? ? CZ  A ARG 97  ? ? NH2 A ARG 97  ? ? 116.99 120.30 -3.31  0.50 N 
9  1 NE  A ARG 99  ? ? CZ  A ARG 99  ? ? NH2 A ARG 99  ? ? 117.12 120.30 -3.18  0.50 N 
10 1 NE  B ARG 26  ? ? CZ  B ARG 26  ? ? NH2 B ARG 26  ? ? 117.14 120.30 -3.16  0.50 N 
11 1 CG  B TRP 27  ? ? CD1 B TRP 27  ? ? NE1 B TRP 27  ? ? 102.70 110.10 -7.40  1.00 N 
12 1 CD1 B TRP 27  ? ? NE1 B TRP 27  ? ? CE2 B TRP 27  ? ? 118.64 109.00 9.64   0.90 N 
13 1 NE1 B TRP 27  ? ? CE2 B TRP 27  ? ? CZ2 B TRP 27  ? ? 139.39 130.40 8.99   1.10 N 
14 1 NE1 B TRP 27  ? ? CE2 B TRP 27  ? ? CD2 B TRP 27  ? ? 100.34 107.30 -6.96  1.00 N 
15 1 CG  B TRP 29  ? ? CD1 B TRP 29  ? ? NE1 B TRP 29  ? ? 102.85 110.10 -7.25  1.00 N 
16 1 CD1 B TRP 29  ? ? NE1 B TRP 29  ? ? CE2 B TRP 29  ? ? 118.07 109.00 9.07   0.90 N 
17 1 NE1 B TRP 29  ? ? CE2 B TRP 29  ? ? CZ2 B TRP 29  ? ? 141.03 130.40 10.63  1.10 N 
18 1 NE1 B TRP 29  ? ? CE2 B TRP 29  ? ? CD2 B TRP 29  ? ? 100.43 107.30 -6.87  1.00 N 
19 1 NE  B ARG 34  ? ? CZ  B ARG 34  ? ? NH2 B ARG 34  ? ? 117.02 120.30 -3.28  0.50 N 
20 1 CB  B ASP 50  ? ? CG  B ASP 50  ? ? OD1 B ASP 50  ? ? 112.05 118.30 -6.25  0.90 N 
21 1 CG  B TRP 51  ? ? CD1 B TRP 51  ? ? NE1 B TRP 51  ? ? 102.36 110.10 -7.74  1.00 N 
22 1 CD1 B TRP 51  ? ? NE1 B TRP 51  ? ? CE2 B TRP 51  ? ? 117.99 109.00 8.99   0.90 N 
23 1 NE1 B TRP 51  ? ? CE2 B TRP 51  ? ? CZ2 B TRP 51  ? ? 138.21 130.40 7.81   1.10 N 
24 1 CG  B TRP 65  D ? CD1 B TRP 65  D ? NE1 B TRP 65  D ? 102.28 110.10 -7.82  1.00 N 
25 1 CD1 B TRP 65  D ? NE1 B TRP 65  D ? CE2 B TRP 65  D ? 117.27 109.00 8.27   0.90 N 
26 1 NE1 B TRP 65  D ? CE2 B TRP 65  D ? CZ2 B TRP 65  D ? 137.67 130.40 7.27   1.10 N 
27 1 CB  B PHE 97  ? ? CG  B PHE 97  ? ? CD2 B PHE 97  ? ? 125.43 120.80 4.63   0.70 N 
28 1 CB  B PHE 97  ? ? CG  B PHE 97  ? ? CD1 B PHE 97  ? ? 116.05 120.80 -4.75  0.70 N 
29 1 CG  B TRP 141 ? ? CD1 B TRP 141 ? ? NE1 B TRP 141 ? ? 103.07 110.10 -7.03  1.00 N 
30 1 CD1 B TRP 141 ? ? NE1 B TRP 141 ? ? CE2 B TRP 141 ? ? 117.13 109.00 8.13   0.90 N 
31 1 NE1 B TRP 141 ? ? CE2 B TRP 141 ? ? CZ2 B TRP 141 ? ? 138.28 130.40 7.88   1.10 N 
32 1 NE1 B TRP 141 ? ? CE2 B TRP 141 ? ? CD2 B TRP 141 ? ? 101.20 107.30 -6.10  1.00 N 
33 1 N   B PHE 199 ? ? CA  B PHE 199 ? ? C   B PHE 199 ? ? 94.04  111.00 -16.96 2.70 N 
34 1 CG  B TRP 208 C ? CD1 B TRP 208 C ? NE1 B TRP 208 C ? 102.76 110.10 -7.34  1.00 N 
35 1 CD1 B TRP 208 C ? NE1 B TRP 208 C ? CE2 B TRP 208 C ? 117.04 109.00 8.04   0.90 N 
36 1 NE1 B TRP 208 C ? CE2 B TRP 208 C ? CZ2 B TRP 208 C ? 139.38 130.40 8.98   1.10 N 
37 1 NE1 B TRP 208 C ? CE2 B TRP 208 C ? CD2 B TRP 208 C ? 101.24 107.30 -6.06  1.00 N 
38 1 NE  B ARG 208 D ? CZ  B ARG 208 D ? NH2 B ARG 208 D ? 116.77 120.30 -3.53  0.50 N 
39 1 CD1 B TRP 215 ? ? NE1 B TRP 215 ? ? CE2 B TRP 215 ? ? 117.39 109.00 8.39   0.90 N 
40 1 NE1 B TRP 215 ? ? CE2 B TRP 215 ? ? CZ2 B TRP 215 ? ? 139.18 130.40 8.78   1.10 N 
41 1 NE1 B TRP 215 ? ? CE2 B TRP 215 ? ? CD2 B TRP 215 ? ? 101.20 107.30 -6.10  1.00 N 
42 1 NE  B ARG 235 ? ? CZ  B ARG 235 ? ? NH2 B ARG 235 ? ? 116.88 120.30 -3.42  0.50 N 
43 1 CG  B TRP 237 ? ? CD1 B TRP 237 ? ? NE1 B TRP 237 ? ? 103.53 110.10 -6.57  1.00 N 
44 1 CD1 B TRP 237 ? ? NE1 B TRP 237 ? ? CE2 B TRP 237 ? ? 117.31 109.00 8.31   0.90 N 
45 1 NE1 B TRP 237 ? ? CE2 B TRP 237 ? ? CZ2 B TRP 237 ? ? 139.01 130.40 8.61   1.10 N 
46 1 NE1 B TRP 237 ? ? CE2 B TRP 237 ? ? CD2 B TRP 237 ? ? 101.26 107.30 -6.04  1.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU B 95  ? ? -37.29  -37.83  
2 1 PRO B 96  ? ? -55.59  -7.41   
3 1 TYR B 147 ? ? -103.07 51.95   
4 1 PHE B 173 ? ? -111.47 -103.98 
5 1 LYS B 179 ? ? -96.68  31.10   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 ARG A 17  ? ? 0.080 'SIDE CHAIN' 
2  1 ARG A 39  ? ? 0.185 'SIDE CHAIN' 
3  1 ARG A 62  ? ? 0.181 'SIDE CHAIN' 
4  1 ARG A 85  ? ? 0.096 'SIDE CHAIN' 
5  1 ARG A 97  ? ? 0.183 'SIDE CHAIN' 
6  1 ARG A 111 ? ? 0.084 'SIDE CHAIN' 
7  1 ARG B 20  ? ? 0.102 'SIDE CHAIN' 
8  1 ARG B 34  ? ? 0.112 'SIDE CHAIN' 
9  1 ARG B 62  ? ? 0.188 'SIDE CHAIN' 
10 1 ARG B 64  ? ? 0.283 'SIDE CHAIN' 
11 1 ARG B 65  C ? 0.116 'SIDE CHAIN' 
12 1 ARG B 207 ? ? 0.224 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1   ? A SER 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A GLN 3   ? A GLN 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 B ARG 97  A B ARG 85  
6  1 Y 1 B ASP 97  B B ASP 86  
7  1 Y 1 B PRO 97  C B PRO 87  
8  1 Y 1 B ASN 97  D B ASN 88  
9  1 Y 1 B SER 97  E B SER 89  
10 1 Y 1 B GLU 97  F B GLU 90  
11 1 Y 1 B GLU 97  G B GLU 91  
12 1 Y 1 B LEU 255 ? B LEU 255 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '2-{5-[AMINO(IMINIO)METHYL]-1H-BENZIMIDAZOL-2-YL}BENZENOLATE' CR4 
4 water                                                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CR4 1   346 346 CR4 CR4 B . 
D 4 HOH 1   115 9   HOH HOH A . 
D 4 HOH 2   116 35  HOH HOH A . 
D 4 HOH 3   117 36  HOH HOH A . 
D 4 HOH 4   118 40  HOH HOH A . 
D 4 HOH 5   119 43  HOH HOH A . 
D 4 HOH 6   120 46  HOH HOH A . 
D 4 HOH 7   121 52  HOH HOH A . 
D 4 HOH 8   122 53  HOH HOH A . 
D 4 HOH 9   123 60  HOH HOH A . 
D 4 HOH 10  124 69  HOH HOH A . 
D 4 HOH 11  125 71  HOH HOH A . 
D 4 HOH 12  126 73  HOH HOH A . 
D 4 HOH 13  127 78  HOH HOH A . 
D 4 HOH 14  128 80  HOH HOH A . 
D 4 HOH 15  129 87  HOH HOH A . 
D 4 HOH 16  130 92  HOH HOH A . 
D 4 HOH 17  131 93  HOH HOH A . 
D 4 HOH 18  132 95  HOH HOH A . 
D 4 HOH 19  133 102 HOH HOH A . 
D 4 HOH 20  134 104 HOH HOH A . 
D 4 HOH 21  135 107 HOH HOH A . 
D 4 HOH 22  136 110 HOH HOH A . 
D 4 HOH 23  137 111 HOH HOH A . 
D 4 HOH 24  138 112 HOH HOH A . 
D 4 HOH 25  139 113 HOH HOH A . 
D 4 HOH 26  140 117 HOH HOH A . 
D 4 HOH 27  141 122 HOH HOH A . 
D 4 HOH 28  142 125 HOH HOH A . 
D 4 HOH 29  143 126 HOH HOH A . 
D 4 HOH 30  144 128 HOH HOH A . 
D 4 HOH 31  145 129 HOH HOH A . 
D 4 HOH 32  146 130 HOH HOH A . 
D 4 HOH 33  147 141 HOH HOH A . 
D 4 HOH 34  148 142 HOH HOH A . 
D 4 HOH 35  149 144 HOH HOH A . 
D 4 HOH 36  150 147 HOH HOH A . 
D 4 HOH 37  151 148 HOH HOH A . 
D 4 HOH 38  152 165 HOH HOH A . 
D 4 HOH 39  153 166 HOH HOH A . 
D 4 HOH 40  154 171 HOH HOH A . 
D 4 HOH 41  155 172 HOH HOH A . 
D 4 HOH 42  156 179 HOH HOH A . 
D 4 HOH 43  157 185 HOH HOH A . 
D 4 HOH 44  158 187 HOH HOH A . 
D 4 HOH 45  159 189 HOH HOH A . 
D 4 HOH 46  160 199 HOH HOH A . 
D 4 HOH 47  161 205 HOH HOH A . 
D 4 HOH 48  162 208 HOH HOH A . 
D 4 HOH 49  163 210 HOH HOH A . 
D 4 HOH 50  164 215 HOH HOH A . 
D 4 HOH 51  165 216 HOH HOH A . 
D 4 HOH 52  166 218 HOH HOH A . 
D 4 HOH 53  167 219 HOH HOH A . 
D 4 HOH 54  168 221 HOH HOH A . 
D 4 HOH 55  169 223 HOH HOH A . 
D 4 HOH 56  170 249 HOH HOH A . 
D 4 HOH 57  171 253 HOH HOH A . 
D 4 HOH 58  172 258 HOH HOH A . 
D 4 HOH 59  173 271 HOH HOH A . 
D 4 HOH 60  174 306 HOH HOH A . 
D 4 HOH 61  175 308 HOH HOH A . 
D 4 HOH 62  176 328 HOH HOH A . 
D 4 HOH 63  177 331 HOH HOH A . 
D 4 HOH 64  178 347 HOH HOH A . 
D 4 HOH 65  179 384 HOH HOH A . 
D 4 HOH 66  180 440 HOH HOH A . 
D 4 HOH 67  181 592 HOH HOH A . 
D 4 HOH 68  182 593 HOH HOH A . 
E 4 HOH 1   347 1   HOH HOH B . 
E 4 HOH 2   348 2   HOH HOH B . 
E 4 HOH 3   349 3   HOH HOH B . 
E 4 HOH 4   350 4   HOH HOH B . 
E 4 HOH 5   351 5   HOH HOH B . 
E 4 HOH 6   352 6   HOH HOH B . 
E 4 HOH 7   353 8   HOH HOH B . 
E 4 HOH 8   354 10  HOH HOH B . 
E 4 HOH 9   355 11  HOH HOH B . 
E 4 HOH 10  356 12  HOH HOH B . 
E 4 HOH 11  357 13  HOH HOH B . 
E 4 HOH 12  358 14  HOH HOH B . 
E 4 HOH 13  359 15  HOH HOH B . 
E 4 HOH 14  360 16  HOH HOH B . 
E 4 HOH 15  361 17  HOH HOH B . 
E 4 HOH 16  362 18  HOH HOH B . 
E 4 HOH 17  363 19  HOH HOH B . 
E 4 HOH 18  364 20  HOH HOH B . 
E 4 HOH 19  365 21  HOH HOH B . 
E 4 HOH 20  366 22  HOH HOH B . 
E 4 HOH 21  367 23  HOH HOH B . 
E 4 HOH 22  368 24  HOH HOH B . 
E 4 HOH 23  369 25  HOH HOH B . 
E 4 HOH 24  370 26  HOH HOH B . 
E 4 HOH 25  371 27  HOH HOH B . 
E 4 HOH 26  372 28  HOH HOH B . 
E 4 HOH 27  373 29  HOH HOH B . 
E 4 HOH 28  374 30  HOH HOH B . 
E 4 HOH 29  375 31  HOH HOH B . 
E 4 HOH 30  376 32  HOH HOH B . 
E 4 HOH 31  377 33  HOH HOH B . 
E 4 HOH 32  378 37  HOH HOH B . 
E 4 HOH 33  379 38  HOH HOH B . 
E 4 HOH 34  380 39  HOH HOH B . 
E 4 HOH 35  381 41  HOH HOH B . 
E 4 HOH 36  382 44  HOH HOH B . 
E 4 HOH 37  383 47  HOH HOH B . 
E 4 HOH 38  384 48  HOH HOH B . 
E 4 HOH 39  385 50  HOH HOH B . 
E 4 HOH 40  386 51  HOH HOH B . 
E 4 HOH 41  387 55  HOH HOH B . 
E 4 HOH 42  388 56  HOH HOH B . 
E 4 HOH 43  389 57  HOH HOH B . 
E 4 HOH 44  390 58  HOH HOH B . 
E 4 HOH 45  391 61  HOH HOH B . 
E 4 HOH 46  392 62  HOH HOH B . 
E 4 HOH 47  393 63  HOH HOH B . 
E 4 HOH 48  394 64  HOH HOH B . 
E 4 HOH 49  395 65  HOH HOH B . 
E 4 HOH 50  396 66  HOH HOH B . 
E 4 HOH 51  397 67  HOH HOH B . 
E 4 HOH 52  398 68  HOH HOH B . 
E 4 HOH 53  399 70  HOH HOH B . 
E 4 HOH 54  400 72  HOH HOH B . 
E 4 HOH 55  401 74  HOH HOH B . 
E 4 HOH 56  402 75  HOH HOH B . 
E 4 HOH 57  403 76  HOH HOH B . 
E 4 HOH 58  404 77  HOH HOH B . 
E 4 HOH 59  405 79  HOH HOH B . 
E 4 HOH 60  406 81  HOH HOH B . 
E 4 HOH 61  407 82  HOH HOH B . 
E 4 HOH 62  408 83  HOH HOH B . 
E 4 HOH 63  409 84  HOH HOH B . 
E 4 HOH 64  410 85  HOH HOH B . 
E 4 HOH 65  411 86  HOH HOH B . 
E 4 HOH 66  412 88  HOH HOH B . 
E 4 HOH 67  413 89  HOH HOH B . 
E 4 HOH 68  414 90  HOH HOH B . 
E 4 HOH 69  415 91  HOH HOH B . 
E 4 HOH 70  416 94  HOH HOH B . 
E 4 HOH 71  417 96  HOH HOH B . 
E 4 HOH 72  418 97  HOH HOH B . 
E 4 HOH 73  419 98  HOH HOH B . 
E 4 HOH 74  420 99  HOH HOH B . 
E 4 HOH 75  421 100 HOH HOH B . 
E 4 HOH 76  422 101 HOH HOH B . 
E 4 HOH 77  423 103 HOH HOH B . 
E 4 HOH 78  424 105 HOH HOH B . 
E 4 HOH 79  425 106 HOH HOH B . 
E 4 HOH 80  426 108 HOH HOH B . 
E 4 HOH 81  427 109 HOH HOH B . 
E 4 HOH 82  428 114 HOH HOH B . 
E 4 HOH 83  429 115 HOH HOH B . 
E 4 HOH 84  430 116 HOH HOH B . 
E 4 HOH 85  431 118 HOH HOH B . 
E 4 HOH 86  432 119 HOH HOH B . 
E 4 HOH 87  433 120 HOH HOH B . 
E 4 HOH 88  434 121 HOH HOH B . 
E 4 HOH 89  435 123 HOH HOH B . 
E 4 HOH 90  436 124 HOH HOH B . 
E 4 HOH 91  437 127 HOH HOH B . 
E 4 HOH 92  438 131 HOH HOH B . 
E 4 HOH 93  439 132 HOH HOH B . 
E 4 HOH 94  440 133 HOH HOH B . 
E 4 HOH 95  441 134 HOH HOH B . 
E 4 HOH 96  442 135 HOH HOH B . 
E 4 HOH 97  443 136 HOH HOH B . 
E 4 HOH 98  444 137 HOH HOH B . 
E 4 HOH 99  445 138 HOH HOH B . 
E 4 HOH 100 446 140 HOH HOH B . 
E 4 HOH 101 447 143 HOH HOH B . 
E 4 HOH 102 448 145 HOH HOH B . 
E 4 HOH 103 449 146 HOH HOH B . 
E 4 HOH 104 450 149 HOH HOH B . 
E 4 HOH 105 451 150 HOH HOH B . 
E 4 HOH 106 452 151 HOH HOH B . 
E 4 HOH 107 453 152 HOH HOH B . 
E 4 HOH 108 454 153 HOH HOH B . 
E 4 HOH 109 455 154 HOH HOH B . 
E 4 HOH 110 456 156 HOH HOH B . 
E 4 HOH 111 457 158 HOH HOH B . 
E 4 HOH 112 458 160 HOH HOH B . 
E 4 HOH 113 459 161 HOH HOH B . 
E 4 HOH 114 460 162 HOH HOH B . 
E 4 HOH 115 461 164 HOH HOH B . 
E 4 HOH 116 462 168 HOH HOH B . 
E 4 HOH 117 463 169 HOH HOH B . 
E 4 HOH 118 464 170 HOH HOH B . 
E 4 HOH 119 465 173 HOH HOH B . 
E 4 HOH 120 466 174 HOH HOH B . 
E 4 HOH 121 467 175 HOH HOH B . 
E 4 HOH 122 468 176 HOH HOH B . 
E 4 HOH 123 469 177 HOH HOH B . 
E 4 HOH 124 470 180 HOH HOH B . 
E 4 HOH 125 471 181 HOH HOH B . 
E 4 HOH 126 472 182 HOH HOH B . 
E 4 HOH 127 473 183 HOH HOH B . 
E 4 HOH 128 474 184 HOH HOH B . 
E 4 HOH 129 475 186 HOH HOH B . 
E 4 HOH 130 476 188 HOH HOH B . 
E 4 HOH 131 477 191 HOH HOH B . 
E 4 HOH 132 478 192 HOH HOH B . 
E 4 HOH 133 479 194 HOH HOH B . 
E 4 HOH 134 480 195 HOH HOH B . 
E 4 HOH 135 481 196 HOH HOH B . 
E 4 HOH 136 482 197 HOH HOH B . 
E 4 HOH 137 483 198 HOH HOH B . 
E 4 HOH 138 484 200 HOH HOH B . 
E 4 HOH 139 485 201 HOH HOH B . 
E 4 HOH 140 486 202 HOH HOH B . 
E 4 HOH 141 487 203 HOH HOH B . 
E 4 HOH 142 488 204 HOH HOH B . 
E 4 HOH 143 489 206 HOH HOH B . 
E 4 HOH 144 490 209 HOH HOH B . 
E 4 HOH 145 491 211 HOH HOH B . 
E 4 HOH 146 492 212 HOH HOH B . 
E 4 HOH 147 493 213 HOH HOH B . 
E 4 HOH 148 494 220 HOH HOH B . 
E 4 HOH 149 495 250 HOH HOH B . 
E 4 HOH 150 496 254 HOH HOH B . 
E 4 HOH 151 497 267 HOH HOH B . 
E 4 HOH 152 498 270 HOH HOH B . 
E 4 HOH 153 499 274 HOH HOH B . 
E 4 HOH 154 500 281 HOH HOH B . 
E 4 HOH 155 501 283 HOH HOH B . 
E 4 HOH 156 502 294 HOH HOH B . 
E 4 HOH 157 503 295 HOH HOH B . 
E 4 HOH 158 504 296 HOH HOH B . 
E 4 HOH 159 505 298 HOH HOH B . 
E 4 HOH 160 506 299 HOH HOH B . 
E 4 HOH 161 507 307 HOH HOH B . 
E 4 HOH 162 508 310 HOH HOH B . 
E 4 HOH 163 509 311 HOH HOH B . 
E 4 HOH 164 510 312 HOH HOH B . 
E 4 HOH 165 511 314 HOH HOH B . 
E 4 HOH 166 512 316 HOH HOH B . 
E 4 HOH 167 513 318 HOH HOH B . 
E 4 HOH 168 514 320 HOH HOH B . 
E 4 HOH 169 515 321 HOH HOH B . 
E 4 HOH 170 516 332 HOH HOH B . 
E 4 HOH 171 517 334 HOH HOH B . 
E 4 HOH 172 518 336 HOH HOH B . 
E 4 HOH 173 519 338 HOH HOH B . 
E 4 HOH 174 520 342 HOH HOH B . 
E 4 HOH 175 521 343 HOH HOH B . 
E 4 HOH 176 522 344 HOH HOH B . 
E 4 HOH 177 523 351 HOH HOH B . 
E 4 HOH 178 524 352 HOH HOH B . 
E 4 HOH 179 525 354 HOH HOH B . 
E 4 HOH 180 526 355 HOH HOH B . 
E 4 HOH 181 527 360 HOH HOH B . 
E 4 HOH 182 528 361 HOH HOH B . 
E 4 HOH 183 529 368 HOH HOH B . 
E 4 HOH 184 530 376 HOH HOH B . 
E 4 HOH 185 531 383 HOH HOH B . 
E 4 HOH 186 532 392 HOH HOH B . 
E 4 HOH 187 533 401 HOH HOH B . 
E 4 HOH 188 534 402 HOH HOH B . 
E 4 HOH 189 535 403 HOH HOH B . 
E 4 HOH 190 536 421 HOH HOH B . 
E 4 HOH 191 537 443 HOH HOH B . 
E 4 HOH 192 538 444 HOH HOH B . 
E 4 HOH 193 539 449 HOH HOH B . 
E 4 HOH 194 540 477 HOH HOH B . 
E 4 HOH 195 541 479 HOH HOH B . 
E 4 HOH 196 542 483 HOH HOH B . 
E 4 HOH 197 543 494 HOH HOH B . 
E 4 HOH 198 544 505 HOH HOH B . 
E 4 HOH 199 545 514 HOH HOH B . 
E 4 HOH 200 546 522 HOH HOH B . 
E 4 HOH 201 547 531 HOH HOH B . 
E 4 HOH 202 548 536 HOH HOH B . 
E 4 HOH 203 549 540 HOH HOH B . 
E 4 HOH 204 550 550 HOH HOH B . 
E 4 HOH 205 551 556 HOH HOH B . 
E 4 HOH 206 552 561 HOH HOH B . 
E 4 HOH 207 553 566 HOH HOH B . 
E 4 HOH 208 554 588 HOH HOH B . 
E 4 HOH 209 555 602 HOH HOH B . 
#