data_1P7A
# 
_entry.id   1P7A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P7A         
RCSB  RCSB019096   
WWPDB D_1000019096 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1P7A 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Simpson, R.J.Y.' 1 
'Cram, E.D.'      2 
'Czolij, R.'      3 
'Matthews, J.M.'  4 
'Crossley, M.'    5 
'Mackay, J.P.'    6 
# 
_citation.id                        primary 
_citation.title                     
'CCHX zinc finger derivatives retain the ability to bind Zn(II) and mediate protein-DNA interactions.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                28011 
_citation.page_last                 28018 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12736264 
_citation.pdbx_database_id_DOI      10.1074/jbc.M211146200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Simpson, R.J.'  1 
primary 'Cram, E.D.'     2 
primary 'Czolij, R.'     3 
primary 'Matthews, J.M.' 4 
primary 'Crossley, M.'   5 
primary 'Mackay, J.P.'   6 
# 
_cell.entry_id           1P7A 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P7A 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kruppel-like factor 3' 4207.827 1 ? ? 'residues 9-37' ? 
2 non-polymer syn 'ZINC ION'              65.409   1 ? ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BF3, BKLF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSTRGSTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV 
_entity_poly.pdbx_seq_one_letter_code_can   GSTRGSTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  THR n 
1 4  ARG n 
1 5  GLY n 
1 6  SER n 
1 7  THR n 
1 8  GLY n 
1 9  ILE n 
1 10 LYS n 
1 11 PRO n 
1 12 PHE n 
1 13 GLN n 
1 14 CYS n 
1 15 PRO n 
1 16 ASP n 
1 17 CYS n 
1 18 ASP n 
1 19 ARG n 
1 20 SER n 
1 21 PHE n 
1 22 SER n 
1 23 ARG n 
1 24 SER n 
1 25 ASP n 
1 26 HIS n 
1 27 LEU n 
1 28 ALA n 
1 29 LEU n 
1 30 HIS n 
1 31 ARG n 
1 32 LYS n 
1 33 ARG n 
1 34 HIS n 
1 35 MET n 
1 36 LEU n 
1 37 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 BKLF 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KLF3_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   TGIKPFQCPDCDRSFSRSDHLALHRKRHMLV 
_struct_ref.pdbx_align_begin           314 
_struct_ref.pdbx_db_accession          Q60980 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1P7A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 7 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 37 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q60980 
_struct_ref_seq.db_align_beg                  314 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  344 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       7 
_struct_ref_seq.pdbx_auth_seq_align_end       37 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P7A GLY A 1 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 1 1 
1 1P7A SER A 2 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 2 2 
1 1P7A THR A 3 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 3 3 
1 1P7A ARG A 4 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 4 4 
1 1P7A GLY A 5 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 5 5 
1 1P7A SER A 6 ? UNP Q60980 ? ? 'CLONING ARTIFACT' 6 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY' 
2 1 1 '2D TOCSY' 
3 1 1 DQF-COSY   
4 2 2 HNHA       
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 280 ambient 5.5 ? ? K 
2 280 ambient 5.5 ? ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '3mM BF3; 4.5mM TCEP; 4.5mM ZnSO4'       '90% H2O/10% D2O' 
2 '1mM BF3 U-15N; 1.5mM TCEP; 1.5mM ZnSO4' '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1P7A 
_pdbx_nmr_refine.method             'simulated annealing molecular dynamics torsion angle dynamics' 
_pdbx_nmr_refine.details            
;Structure calculations were performed using the package ARIA 1.1 (Ambiguous Restraints in Iterative Assignment)> Final structures are based on 719 unambiguous NOE-derived distance consraints, 6 sets of ambiguous NOE-derived distance constraints and 28 additional dihedral angle restraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1P7A 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques' 
# 
_pdbx_nmr_ensemble.entry_id                                      1P7A 
_pdbx_nmr_ensemble.conformers_calculated_total_number            35 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.5    processing           Bruker          1 
DYANA   1.5    'structure solution' ?               2 
XEASY   1.3.13 'data analysis'      'Bartels et al' 3 
ARIA    1.1.2  refinement           'Linge et al'   4 
ARIA    1.1.2  'structure solution' 'Linge et al'   5 
# 
_exptl.entry_id          1P7A 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_struct.entry_id                  1P7A 
_struct.title                     'Solution Structure of the Third Zinc Finger from BKLF' 
_struct.pdbx_descriptor           'Kruppel-like factor 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P7A 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'CLASSICAL ZINC FINGER, KRUPPEL-LIKE, TRANSCRIPTION FACTOR, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 23 ? LYS A 32 ? ARG A 23 LYS A 32 1 ? 10 
HELX_P HELX_P2 2 ARG A 33 ? MET A 35 ? ARG A 33 MET A 35 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 30 NE2 ? ? A ZN 38 A HIS 30 1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 34 NE2 ? ? A ZN 38 A HIS 34 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 14 SG  ? ? A ZN 38 A CYS 14 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 17 SG  ? ? A ZN 38 A CYS 17 1_555 ? ? ? ? ? ? ? 2.317 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 38' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 
2 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 
3 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 
4 AC1 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1P7A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1P7A 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 7.977   3.850   3.372   1.00 0.00 ? 1  GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 9.427   4.138   3.458   1.00 0.00 ? 1  GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 10.116  3.955   2.123   1.00 0.00 ? 1  GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 9.620   4.414   1.093   1.00 0.00 ? 1  GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 7.748   3.460   2.430   1.00 0.00 ? 1  GLY A H1   1  
ATOM   6     H  H2   . GLY A 1 1  ? 7.430   4.724   3.510   1.00 0.00 ? 1  GLY A H2   1  
ATOM   7     H  H3   . GLY A 1 1  ? 7.698   3.159   4.098   1.00 0.00 ? 1  GLY A H3   1  
ATOM   8     H  HA2  . GLY A 1 1  ? 9.563   5.157   3.787   1.00 0.00 ? 1  GLY A HA2  1  
ATOM   9     H  HA3  . GLY A 1 1  ? 9.875   3.470   4.181   1.00 0.00 ? 1  GLY A HA3  1  
ATOM   10    N  N    . SER A 1 2  ? 11.260  3.290   2.133   1.00 0.00 ? 2  SER A N    1  
ATOM   11    C  CA   . SER A 1 2  ? 12.014  3.036   0.914   1.00 0.00 ? 2  SER A CA   1  
ATOM   12    C  C    . SER A 1 2  ? 12.907  1.810   1.079   1.00 0.00 ? 2  SER A C    1  
ATOM   13    O  O    . SER A 1 2  ? 13.899  1.838   1.811   1.00 0.00 ? 2  SER A O    1  
ATOM   14    C  CB   . SER A 1 2  ? 12.856  4.262   0.544   1.00 0.00 ? 2  SER A CB   1  
ATOM   15    O  OG   . SER A 1 2  ? 12.031  5.343   0.128   1.00 0.00 ? 2  SER A OG   1  
ATOM   16    H  H    . SER A 1 2  ? 11.612  2.953   2.987   1.00 0.00 ? 2  SER A H    1  
ATOM   17    H  HA   . SER A 1 2  ? 11.305  2.844   0.123   1.00 0.00 ? 2  SER A HA   1  
ATOM   18    H  HB2  . SER A 1 2  ? 13.430  4.573   1.402   1.00 0.00 ? 2  SER A HB2  1  
ATOM   19    H  HB3  . SER A 1 2  ? 13.525  4.005   -0.265  1.00 0.00 ? 2  SER A HB3  1  
ATOM   20    H  HG   . SER A 1 2  ? 11.129  5.198   0.449   1.00 0.00 ? 2  SER A HG   1  
ATOM   21    N  N    . THR A 1 3  ? 12.522  0.723   0.434   1.00 0.00 ? 3  THR A N    1  
ATOM   22    C  CA   . THR A 1 3  ? 13.267  -0.521  0.515   1.00 0.00 ? 3  THR A CA   1  
ATOM   23    C  C    . THR A 1 3  ? 13.890  -0.854  -0.824  1.00 0.00 ? 3  THR A C    1  
ATOM   24    O  O    . THR A 1 3  ? 15.061  -1.221  -0.924  1.00 0.00 ? 3  THR A O    1  
ATOM   25    C  CB   . THR A 1 3  ? 12.359  -1.681  0.969   1.00 0.00 ? 3  THR A CB   1  
ATOM   26    O  OG1  . THR A 1 3  ? 11.216  -1.162  1.665   1.00 0.00 ? 3  THR A OG1  1  
ATOM   27    C  CG2  . THR A 1 3  ? 13.112  -2.646  1.869   1.00 0.00 ? 3  THR A CG2  1  
ATOM   28    H  H    . THR A 1 3  ? 11.699  0.753   -0.111  1.00 0.00 ? 3  THR A H    1  
ATOM   29    H  HA   . THR A 1 3  ? 14.041  -0.394  1.227   1.00 0.00 ? 3  THR A HA   1  
ATOM   30    H  HB   . THR A 1 3  ? 12.024  -2.218  0.094   1.00 0.00 ? 3  THR A HB   1  
ATOM   31    H  HG1  . THR A 1 3  ? 10.469  -1.088  1.046   1.00 0.00 ? 3  THR A HG1  1  
ATOM   32    H  HG21 . THR A 1 3  ? 13.605  -2.096  2.656   1.00 0.00 ? 3  THR A HG21 1  
ATOM   33    H  HG22 . THR A 1 3  ? 13.850  -3.181  1.287   1.00 0.00 ? 3  THR A HG22 1  
ATOM   34    H  HG23 . THR A 1 3  ? 12.418  -3.350  2.304   1.00 0.00 ? 3  THR A HG23 1  
ATOM   35    N  N    . ARG A 1 4  ? 13.111  -0.619  -1.845  1.00 0.00 ? 4  ARG A N    1  
ATOM   36    C  CA   . ARG A 1 4  ? 13.533  -0.786  -3.229  1.00 0.00 ? 4  ARG A CA   1  
ATOM   37    C  C    . ARG A 1 4  ? 12.754  0.184   -4.103  1.00 0.00 ? 4  ARG A C    1  
ATOM   38    O  O    . ARG A 1 4  ? 11.997  -0.228  -4.985  1.00 0.00 ? 4  ARG A O    1  
ATOM   39    C  CB   . ARG A 1 4  ? 13.294  -2.222  -3.706  1.00 0.00 ? 4  ARG A CB   1  
ATOM   40    C  CG   . ARG A 1 4  ? 14.427  -3.180  -3.384  1.00 0.00 ? 4  ARG A CG   1  
ATOM   41    C  CD   . ARG A 1 4  ? 14.290  -4.483  -4.158  1.00 0.00 ? 4  ARG A CD   1  
ATOM   42    N  NE   . ARG A 1 4  ? 13.236  -5.342  -3.615  1.00 0.00 ? 4  ARG A NE   1  
ATOM   43    C  CZ   . ARG A 1 4  ? 13.426  -6.608  -3.230  1.00 0.00 ? 4  ARG A CZ   1  
ATOM   44    N  NH1  . ARG A 1 4  ? 14.609  -7.188  -3.391  1.00 0.00 ? 4  ARG A NH1  1  
ATOM   45    N  NH2  . ARG A 1 4  ? 12.424  -7.301  -2.700  1.00 0.00 ? 4  ARG A NH2  1  
ATOM   46    H  H    . ARG A 1 4  ? 12.223  -0.254  -1.656  1.00 0.00 ? 4  ARG A H    1  
ATOM   47    H  HA   . ARG A 1 4  ? 14.586  -0.554  -3.293  1.00 0.00 ? 4  ARG A HA   1  
ATOM   48    H  HB2  . ARG A 1 4  ? 12.395  -2.598  -3.240  1.00 0.00 ? 4  ARG A HB2  1  
ATOM   49    H  HB3  . ARG A 1 4  ? 13.154  -2.211  -4.778  1.00 0.00 ? 4  ARG A HB3  1  
ATOM   50    H  HG2  . ARG A 1 4  ? 15.365  -2.711  -3.645  1.00 0.00 ? 4  ARG A HG2  1  
ATOM   51    H  HG3  . ARG A 1 4  ? 14.411  -3.393  -2.325  1.00 0.00 ? 4  ARG A HG3  1  
ATOM   52    H  HD2  . ARG A 1 4  ? 14.056  -4.251  -5.186  1.00 0.00 ? 4  ARG A HD2  1  
ATOM   53    H  HD3  . ARG A 1 4  ? 15.231  -5.011  -4.115  1.00 0.00 ? 4  ARG A HD3  1  
ATOM   54    H  HE   . ARG A 1 4  ? 12.335  -4.945  -3.522  1.00 0.00 ? 4  ARG A HE   1  
ATOM   55    H  HH11 . ARG A 1 4  ? 15.372  -6.679  -3.810  1.00 0.00 ? 4  ARG A HH11 1  
ATOM   56    H  HH12 . ARG A 1 4  ? 14.754  -8.140  -3.088  1.00 0.00 ? 4  ARG A HH12 1  
ATOM   57    H  HH21 . ARG A 1 4  ? 11.522  -6.874  -2.582  1.00 0.00 ? 4  ARG A HH21 1  
ATOM   58    H  HH22 . ARG A 1 4  ? 12.562  -8.259  -2.414  1.00 0.00 ? 4  ARG A HH22 1  
ATOM   59    N  N    . GLY A 1 5  ? 12.809  1.456   -3.737  1.00 0.00 ? 5  GLY A N    1  
ATOM   60    C  CA   . GLY A 1 5  ? 11.991  2.452   -4.397  1.00 0.00 ? 5  GLY A CA   1  
ATOM   61    C  C    . GLY A 1 5  ? 10.579  2.446   -3.859  1.00 0.00 ? 5  GLY A C    1  
ATOM   62    O  O    . GLY A 1 5  ? 10.205  3.309   -3.057  1.00 0.00 ? 5  GLY A O    1  
ATOM   63    H  H    . GLY A 1 5  ? 13.330  1.705   -2.939  1.00 0.00 ? 5  GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 5  ? 12.427  3.429   -4.240  1.00 0.00 ? 5  GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 5  ? 11.966  2.242   -5.456  1.00 0.00 ? 5  GLY A HA3  1  
ATOM   66    N  N    . SER A 1 6  ? 9.818   1.439   -4.253  1.00 0.00 ? 6  SER A N    1  
ATOM   67    C  CA   . SER A 1 6  ? 8.462   1.269   -3.772  1.00 0.00 ? 6  SER A CA   1  
ATOM   68    C  C    . SER A 1 6  ? 8.092   -0.209  -3.720  1.00 0.00 ? 6  SER A C    1  
ATOM   69    O  O    . SER A 1 6  ? 6.918   -0.565  -3.642  1.00 0.00 ? 6  SER A O    1  
ATOM   70    C  CB   . SER A 1 6  ? 7.496   2.010   -4.684  1.00 0.00 ? 6  SER A CB   1  
ATOM   71    O  OG   . SER A 1 6  ? 8.122   2.385   -5.903  1.00 0.00 ? 6  SER A OG   1  
ATOM   72    H  H    . SER A 1 6  ? 10.184  0.780   -4.877  1.00 0.00 ? 6  SER A H    1  
ATOM   73    H  HA   . SER A 1 6  ? 8.405   1.685   -2.778  1.00 0.00 ? 6  SER A HA   1  
ATOM   74    H  HB2  . SER A 1 6  ? 6.659   1.370   -4.907  1.00 0.00 ? 6  SER A HB2  1  
ATOM   75    H  HB3  . SER A 1 6  ? 7.151   2.897   -4.183  1.00 0.00 ? 6  SER A HB3  1  
ATOM   76    H  HG   . SER A 1 6  ? 8.422   3.307   -5.840  1.00 0.00 ? 6  SER A HG   1  
ATOM   77    N  N    . THR A 1 7  ? 9.087   -1.061  -3.887  1.00 0.00 ? 7  THR A N    1  
ATOM   78    C  CA   . THR A 1 7  ? 8.848   -2.495  -3.979  1.00 0.00 ? 7  THR A CA   1  
ATOM   79    C  C    . THR A 1 7  ? 9.854   -3.290  -3.162  1.00 0.00 ? 7  THR A C    1  
ATOM   80    O  O    . THR A 1 7  ? 10.758  -3.928  -3.704  1.00 0.00 ? 7  THR A O    1  
ATOM   81    C  CB   . THR A 1 7  ? 8.897   -2.946  -5.453  1.00 0.00 ? 7  THR A CB   1  
ATOM   82    O  OG1  . THR A 1 7  ? 9.874   -2.171  -6.163  1.00 0.00 ? 7  THR A OG1  1  
ATOM   83    C  CG2  . THR A 1 7  ? 7.547   -2.772  -6.125  1.00 0.00 ? 7  THR A CG2  1  
ATOM   84    H  H    . THR A 1 7  ? 9.991   -0.715  -4.023  1.00 0.00 ? 7  THR A H    1  
ATOM   85    H  HA   . THR A 1 7  ? 7.862   -2.698  -3.585  1.00 0.00 ? 7  THR A HA   1  
ATOM   86    H  HB   . THR A 1 7  ? 9.172   -3.990  -5.490  1.00 0.00 ? 7  THR A HB   1  
ATOM   87    H  HG1  . THR A 1 7  ? 10.710  -2.665  -6.197  1.00 0.00 ? 7  THR A HG1  1  
ATOM   88    H  HG21 . THR A 1 7  ? 7.482   -3.431  -6.978  1.00 0.00 ? 7  THR A HG21 1  
ATOM   89    H  HG22 . THR A 1 7  ? 7.440   -1.749  -6.452  1.00 0.00 ? 7  THR A HG22 1  
ATOM   90    H  HG23 . THR A 1 7  ? 6.762   -3.011  -5.424  1.00 0.00 ? 7  THR A HG23 1  
ATOM   91    N  N    . GLY A 1 8  ? 9.691   -3.255  -1.853  1.00 0.00 ? 8  GLY A N    1  
ATOM   92    C  CA   . GLY A 1 8  ? 10.597  -3.962  -0.986  1.00 0.00 ? 8  GLY A CA   1  
ATOM   93    C  C    . GLY A 1 8  ? 10.073  -5.316  -0.551  1.00 0.00 ? 8  GLY A C    1  
ATOM   94    O  O    . GLY A 1 8  ? 10.252  -6.317  -1.250  1.00 0.00 ? 8  GLY A O    1  
ATOM   95    H  H    . GLY A 1 8  ? 8.972   -2.706  -1.467  1.00 0.00 ? 8  GLY A H    1  
ATOM   96    H  HA2  . GLY A 1 8  ? 11.535  -4.103  -1.506  1.00 0.00 ? 8  GLY A HA2  1  
ATOM   97    H  HA3  . GLY A 1 8  ? 10.776  -3.361  -0.106  1.00 0.00 ? 8  GLY A HA3  1  
ATOM   98    N  N    . ILE A 1 9  ? 9.486   -5.349  0.633   1.00 0.00 ? 9  ILE A N    1  
ATOM   99    C  CA   . ILE A 1 9  ? 9.026   -6.594  1.249   1.00 0.00 ? 9  ILE A CA   1  
ATOM   100   C  C    . ILE A 1 9  ? 7.696   -7.069  0.662   1.00 0.00 ? 9  ILE A C    1  
ATOM   101   O  O    . ILE A 1 9  ? 6.903   -6.252  0.192   1.00 0.00 ? 9  ILE A O    1  
ATOM   102   C  CB   . ILE A 1 9  ? 8.874   -6.411  2.780   1.00 0.00 ? 9  ILE A CB   1  
ATOM   103   C  CG1  . ILE A 1 9  ? 9.944   -5.461  3.319   1.00 0.00 ? 9  ILE A CG1  1  
ATOM   104   C  CG2  . ILE A 1 9  ? 8.956   -7.747  3.503   1.00 0.00 ? 9  ILE A CG2  1  
ATOM   105   C  CD1  . ILE A 1 9  ? 9.629   -4.921  4.696   1.00 0.00 ? 9  ILE A CD1  1  
ATOM   106   H  H    . ILE A 1 9  ? 9.343   -4.500  1.108   1.00 0.00 ? 9  ILE A H    1  
ATOM   107   H  HA   . ILE A 1 9  ? 9.777   -7.350  1.074   1.00 0.00 ? 9  ILE A HA   1  
ATOM   108   H  HB   . ILE A 1 9  ? 7.901   -5.985  2.968   1.00 0.00 ? 9  ILE A HB   1  
ATOM   109   H  HG12 . ILE A 1 9  ? 10.887  -5.985  3.376   1.00 0.00 ? 9  ILE A HG12 1  
ATOM   110   H  HG13 . ILE A 1 9  ? 10.044  -4.621  2.646   1.00 0.00 ? 9  ILE A HG13 1  
ATOM   111   H  HG21 . ILE A 1 9  ? 9.090   -8.539  2.781   1.00 0.00 ? 9  ILE A HG21 1  
ATOM   112   H  HG22 . ILE A 1 9  ? 9.795   -7.737  4.186   1.00 0.00 ? 9  ILE A HG22 1  
ATOM   113   H  HG23 . ILE A 1 9  ? 8.045   -7.915  4.057   1.00 0.00 ? 9  ILE A HG23 1  
ATOM   114   H  HD11 . ILE A 1 9  ? 9.945   -3.891  4.761   1.00 0.00 ? 9  ILE A HD11 1  
ATOM   115   H  HD12 . ILE A 1 9  ? 8.565   -4.984  4.871   1.00 0.00 ? 9  ILE A HD12 1  
ATOM   116   H  HD13 . ILE A 1 9  ? 10.151  -5.506  5.439   1.00 0.00 ? 9  ILE A HD13 1  
ATOM   117   N  N    . LYS A 1 10 ? 7.398   -8.363  0.866   1.00 0.00 ? 10 LYS A N    1  
ATOM   118   C  CA   . LYS A 1 10 ? 6.112   -8.974  0.497   1.00 0.00 ? 10 LYS A CA   1  
ATOM   119   C  C    . LYS A 1 10 ? 5.807   -8.860  -1.001  1.00 0.00 ? 10 LYS A C    1  
ATOM   120   O  O    . LYS A 1 10 ? 6.224   -7.919  -1.671  1.00 0.00 ? 10 LYS A O    1  
ATOM   121   C  CB   . LYS A 1 10 ? 4.975   -8.381  1.331   1.00 0.00 ? 10 LYS A CB   1  
ATOM   122   C  CG   . LYS A 1 10 ? 4.481   -9.332  2.409   1.00 0.00 ? 10 LYS A CG   1  
ATOM   123   C  CD   . LYS A 1 10 ? 4.531   -8.700  3.790   1.00 0.00 ? 10 LYS A CD   1  
ATOM   124   C  CE   . LYS A 1 10 ? 4.188   -9.710  4.872   1.00 0.00 ? 10 LYS A CE   1  
ATOM   125   N  NZ   . LYS A 1 10 ? 4.062   -9.075  6.210   1.00 0.00 ? 10 LYS A NZ   1  
ATOM   126   H  H    . LYS A 1 10 ? 8.040   -8.914  1.365   1.00 0.00 ? 10 LYS A H    1  
ATOM   127   H  HA   . LYS A 1 10 ? 6.182   -10.025 0.738   1.00 0.00 ? 10 LYS A HA   1  
ATOM   128   H  HB2  . LYS A 1 10 ? 5.320   -7.474  1.807   1.00 0.00 ? 10 LYS A HB2  1  
ATOM   129   H  HB3  . LYS A 1 10 ? 4.145   -8.148  0.679   1.00 0.00 ? 10 LYS A HB3  1  
ATOM   130   H  HG2  . LYS A 1 10 ? 3.460   -9.606  2.189   1.00 0.00 ? 10 LYS A HG2  1  
ATOM   131   H  HG3  . LYS A 1 10 ? 5.100   -10.216 2.405   1.00 0.00 ? 10 LYS A HG3  1  
ATOM   132   H  HD2  . LYS A 1 10 ? 5.529   -8.325  3.967   1.00 0.00 ? 10 LYS A HD2  1  
ATOM   133   H  HD3  . LYS A 1 10 ? 3.823   -7.885  3.831   1.00 0.00 ? 10 LYS A HD3  1  
ATOM   134   H  HE2  . LYS A 1 10 ? 3.252   -10.186 4.619   1.00 0.00 ? 10 LYS A HE2  1  
ATOM   135   H  HE3  . LYS A 1 10 ? 4.971   -10.454 4.910   1.00 0.00 ? 10 LYS A HE3  1  
ATOM   136   H  HZ1  . LYS A 1 10 ? 4.223   -8.044  6.140   1.00 0.00 ? 10 LYS A HZ1  1  
ATOM   137   H  HZ2  . LYS A 1 10 ? 4.762   -9.479  6.868   1.00 0.00 ? 10 LYS A HZ2  1  
ATOM   138   H  HZ3  . LYS A 1 10 ? 3.107   -9.240  6.599   1.00 0.00 ? 10 LYS A HZ3  1  
ATOM   139   N  N    . PRO A 1 11 ? 5.130   -9.865  -1.571  1.00 0.00 ? 11 PRO A N    1  
ATOM   140   C  CA   . PRO A 1 11 ? 4.802   -9.876  -2.998  1.00 0.00 ? 11 PRO A CA   1  
ATOM   141   C  C    . PRO A 1 11 ? 3.823   -8.765  -3.365  1.00 0.00 ? 11 PRO A C    1  
ATOM   142   O  O    . PRO A 1 11 ? 3.718   -8.369  -4.527  1.00 0.00 ? 11 PRO A O    1  
ATOM   143   C  CB   . PRO A 1 11 ? 4.158   -11.247 -3.214  1.00 0.00 ? 11 PRO A CB   1  
ATOM   144   C  CG   . PRO A 1 11 ? 3.681   -11.662 -1.866  1.00 0.00 ? 11 PRO A CG   1  
ATOM   145   C  CD   . PRO A 1 11 ? 4.667   -11.087 -0.891  1.00 0.00 ? 11 PRO A CD   1  
ATOM   146   H  HA   . PRO A 1 11 ? 5.689   -9.792  -3.609  1.00 0.00 ? 11 PRO A HA   1  
ATOM   147   H  HB2  . PRO A 1 11 ? 3.338   -11.156 -3.912  1.00 0.00 ? 11 PRO A HB2  1  
ATOM   148   H  HB3  . PRO A 1 11 ? 4.893   -11.938 -3.602  1.00 0.00 ? 11 PRO A HB3  1  
ATOM   149   H  HG2  . PRO A 1 11 ? 2.697   -11.257 -1.687  1.00 0.00 ? 11 PRO A HG2  1  
ATOM   150   H  HG3  . PRO A 1 11 ? 3.667   -12.739 -1.794  1.00 0.00 ? 11 PRO A HG3  1  
ATOM   151   H  HD2  . PRO A 1 11 ? 4.182   -10.848 0.044   1.00 0.00 ? 11 PRO A HD2  1  
ATOM   152   H  HD3  . PRO A 1 11 ? 5.486   -11.773 -0.730  1.00 0.00 ? 11 PRO A HD3  1  
ATOM   153   N  N    . PHE A 1 12 ? 3.111   -8.264  -2.362  1.00 0.00 ? 12 PHE A N    1  
ATOM   154   C  CA   . PHE A 1 12 ? 2.130   -7.213  -2.562  1.00 0.00 ? 12 PHE A CA   1  
ATOM   155   C  C    . PHE A 1 12 ? 2.445   -6.008  -1.688  1.00 0.00 ? 12 PHE A C    1  
ATOM   156   O  O    . PHE A 1 12 ? 1.885   -5.841  -0.611  1.00 0.00 ? 12 PHE A O    1  
ATOM   157   C  CB   . PHE A 1 12 ? 0.728   -7.731  -2.248  1.00 0.00 ? 12 PHE A CB   1  
ATOM   158   C  CG   . PHE A 1 12 ? 0.335   -8.921  -3.075  1.00 0.00 ? 12 PHE A CG   1  
ATOM   159   C  CD1  . PHE A 1 12 ? 0.287   -8.836  -4.457  1.00 0.00 ? 12 PHE A CD1  1  
ATOM   160   C  CD2  . PHE A 1 12 ? 0.019   -10.125 -2.473  1.00 0.00 ? 12 PHE A CD2  1  
ATOM   161   C  CE1  . PHE A 1 12 ? -0.068  -9.929  -5.222  1.00 0.00 ? 12 PHE A CE1  1  
ATOM   162   C  CE2  . PHE A 1 12 ? -0.336  -11.222 -3.232  1.00 0.00 ? 12 PHE A CE2  1  
ATOM   163   C  CZ   . PHE A 1 12 ? -0.380  -11.126 -4.608  1.00 0.00 ? 12 PHE A CZ   1  
ATOM   164   H  H    . PHE A 1 12 ? 3.246   -8.620  -1.458  1.00 0.00 ? 12 PHE A H    1  
ATOM   165   H  HA   . PHE A 1 12 ? 2.170   -6.913  -3.598  1.00 0.00 ? 12 PHE A HA   1  
ATOM   166   H  HB2  . PHE A 1 12 ? 0.686   -8.016  -1.205  1.00 0.00 ? 12 PHE A HB2  1  
ATOM   167   H  HB3  . PHE A 1 12 ? 0.010   -6.945  -2.431  1.00 0.00 ? 12 PHE A HB3  1  
ATOM   168   H  HD1  . PHE A 1 12 ? 0.531   -7.899  -4.938  1.00 0.00 ? 12 PHE A HD1  1  
ATOM   169   H  HD2  . PHE A 1 12 ? 0.052   -10.205 -1.396  1.00 0.00 ? 12 PHE A HD2  1  
ATOM   170   H  HE1  . PHE A 1 12 ? -0.100  -9.849  -6.298  1.00 0.00 ? 12 PHE A HE1  1  
ATOM   171   H  HE2  . PHE A 1 12 ? -0.582  -12.156 -2.748  1.00 0.00 ? 12 PHE A HE2  1  
ATOM   172   H  HZ   . PHE A 1 12 ? -0.657  -11.983 -5.203  1.00 0.00 ? 12 PHE A HZ   1  
ATOM   173   N  N    . GLN A 1 13 ? 3.365   -5.186  -2.145  1.00 0.00 ? 13 GLN A N    1  
ATOM   174   C  CA   . GLN A 1 13 ? 3.754   -3.992  -1.428  1.00 0.00 ? 13 GLN A CA   1  
ATOM   175   C  C    . GLN A 1 13 ? 3.127   -2.762  -2.077  1.00 0.00 ? 13 GLN A C    1  
ATOM   176   O  O    . GLN A 1 13 ? 2.765   -2.798  -3.254  1.00 0.00 ? 13 GLN A O    1  
ATOM   177   C  CB   . GLN A 1 13 ? 5.266   -3.896  -1.446  1.00 0.00 ? 13 GLN A CB   1  
ATOM   178   C  CG   . GLN A 1 13 ? 5.814   -3.480  -2.790  1.00 0.00 ? 13 GLN A CG   1  
ATOM   179   C  CD   . GLN A 1 13 ? 6.109   -4.667  -3.688  1.00 0.00 ? 13 GLN A CD   1  
ATOM   180   O  OE1  . GLN A 1 13 ? 5.485   -4.840  -4.738  1.00 0.00 ? 13 GLN A OE1  1  
ATOM   181   N  NE2  . GLN A 1 13 ? 7.046   -5.504  -3.276  1.00 0.00 ? 13 GLN A NE2  1  
ATOM   182   H  H    . GLN A 1 13 ? 3.815   -5.390  -2.986  1.00 0.00 ? 13 GLN A H    1  
ATOM   183   H  HA   . GLN A 1 13 ? 3.413   -4.073  -0.411  1.00 0.00 ? 13 GLN A HA   1  
ATOM   184   H  HB2  . GLN A 1 13 ? 5.589   -3.184  -0.703  1.00 0.00 ? 13 GLN A HB2  1  
ATOM   185   H  HB3  . GLN A 1 13 ? 5.669   -4.868  -1.209  1.00 0.00 ? 13 GLN A HB3  1  
ATOM   186   H  HG2  . GLN A 1 13 ? 5.085   -2.851  -3.278  1.00 0.00 ? 13 GLN A HG2  1  
ATOM   187   H  HG3  . GLN A 1 13 ? 6.719   -2.923  -2.630  1.00 0.00 ? 13 GLN A HG3  1  
ATOM   188   H  HE21 . GLN A 1 13 ? 7.489   -5.321  -2.422  1.00 0.00 ? 13 GLN A HE21 1  
ATOM   189   H  HE22 . GLN A 1 13 ? 7.262   -6.280  -3.846  1.00 0.00 ? 13 GLN A HE22 1  
ATOM   190   N  N    . CYS A 1 14 ? 3.033   -1.669  -1.331  1.00 0.00 ? 14 CYS A N    1  
ATOM   191   C  CA   . CYS A 1 14 ? 2.493   -0.436  -1.877  1.00 0.00 ? 14 CYS A CA   1  
ATOM   192   C  C    . CYS A 1 14 ? 3.508   0.221   -2.797  1.00 0.00 ? 14 CYS A C    1  
ATOM   193   O  O    . CYS A 1 14 ? 4.583   0.612   -2.352  1.00 0.00 ? 14 CYS A O    1  
ATOM   194   C  CB   . CYS A 1 14 ? 2.093   0.552   -0.773  1.00 0.00 ? 14 CYS A CB   1  
ATOM   195   S  SG   . CYS A 1 14 ? 1.503   2.144   -1.444  1.00 0.00 ? 14 CYS A SG   1  
ATOM   196   H  H    . CYS A 1 14 ? 3.384   -1.681  -0.422  1.00 0.00 ? 14 CYS A H    1  
ATOM   197   H  HA   . CYS A 1 14 ? 1.614   -0.687  -2.452  1.00 0.00 ? 14 CYS A HA   1  
ATOM   198   H  HB2  . CYS A 1 14 ? 1.303   0.119   -0.177  1.00 0.00 ? 14 CYS A HB2  1  
ATOM   199   H  HB3  . CYS A 1 14 ? 2.948   0.751   -0.144  1.00 0.00 ? 14 CYS A HB3  1  
ATOM   200   N  N    . PRO A 1 15 ? 3.147   0.432   -4.069  1.00 0.00 ? 15 PRO A N    1  
ATOM   201   C  CA   . PRO A 1 15 ? 4.010   1.113   -5.033  1.00 0.00 ? 15 PRO A CA   1  
ATOM   202   C  C    . PRO A 1 15 ? 4.048   2.622   -4.806  1.00 0.00 ? 15 PRO A C    1  
ATOM   203   O  O    . PRO A 1 15 ? 4.662   3.365   -5.575  1.00 0.00 ? 15 PRO A O    1  
ATOM   204   C  CB   . PRO A 1 15 ? 3.357   0.786   -6.375  1.00 0.00 ? 15 PRO A CB   1  
ATOM   205   C  CG   . PRO A 1 15 ? 1.913   0.611   -6.060  1.00 0.00 ? 15 PRO A CG   1  
ATOM   206   C  CD   . PRO A 1 15 ? 1.845   0.061   -4.657  1.00 0.00 ? 15 PRO A CD   1  
ATOM   207   H  HA   . PRO A 1 15 ? 5.015   0.719   -5.011  1.00 0.00 ? 15 PRO A HA   1  
ATOM   208   H  HB2  . PRO A 1 15 ? 3.516   1.603   -7.063  1.00 0.00 ? 15 PRO A HB2  1  
ATOM   209   H  HB3  . PRO A 1 15 ? 3.786   -0.120  -6.776  1.00 0.00 ? 15 PRO A HB3  1  
ATOM   210   H  HG2  . PRO A 1 15 ? 1.409   1.565   -6.110  1.00 0.00 ? 15 PRO A HG2  1  
ATOM   211   H  HG3  . PRO A 1 15 ? 1.466   -0.084  -6.755  1.00 0.00 ? 15 PRO A HG3  1  
ATOM   212   H  HD2  . PRO A 1 15 ? 1.034   0.519   -4.112  1.00 0.00 ? 15 PRO A HD2  1  
ATOM   213   H  HD3  . PRO A 1 15 ? 1.726   -1.012  -4.679  1.00 0.00 ? 15 PRO A HD3  1  
ATOM   214   N  N    . ASP A 1 16 ? 3.377   3.075   -3.752  1.00 0.00 ? 16 ASP A N    1  
ATOM   215   C  CA   . ASP A 1 16 ? 3.324   4.488   -3.428  1.00 0.00 ? 16 ASP A CA   1  
ATOM   216   C  C    . ASP A 1 16 ? 4.146   4.787   -2.179  1.00 0.00 ? 16 ASP A C    1  
ATOM   217   O  O    . ASP A 1 16 ? 4.619   5.910   -1.991  1.00 0.00 ? 16 ASP A O    1  
ATOM   218   C  CB   . ASP A 1 16 ? 1.876   4.916   -3.204  1.00 0.00 ? 16 ASP A CB   1  
ATOM   219   C  CG   . ASP A 1 16 ? 1.315   5.720   -4.357  1.00 0.00 ? 16 ASP A CG   1  
ATOM   220   O  OD1  . ASP A 1 16 ? 1.829   6.826   -4.622  1.00 0.00 ? 16 ASP A OD1  1  
ATOM   221   O  OD2  . ASP A 1 16 ? 0.354   5.245   -5.001  1.00 0.00 ? 16 ASP A OD2  1  
ATOM   222   H  H    . ASP A 1 16 ? 2.892   2.438   -3.180  1.00 0.00 ? 16 ASP A H    1  
ATOM   223   H  HA   . ASP A 1 16 ? 3.732   5.039   -4.262  1.00 0.00 ? 16 ASP A HA   1  
ATOM   224   H  HB2  . ASP A 1 16 ? 1.266   4.035   -3.078  1.00 0.00 ? 16 ASP A HB2  1  
ATOM   225   H  HB3  . ASP A 1 16 ? 1.822   5.514   -2.309  1.00 0.00 ? 16 ASP A HB3  1  
ATOM   226   N  N    . CYS A 1 17 ? 4.242   3.801   -1.292  1.00 0.00 ? 17 CYS A N    1  
ATOM   227   C  CA   . CYS A 1 17 ? 4.929   3.977   -0.017  1.00 0.00 ? 17 CYS A CA   1  
ATOM   228   C  C    . CYS A 1 17 ? 6.143   3.070   0.116   1.00 0.00 ? 17 CYS A C    1  
ATOM   229   O  O    . CYS A 1 17 ? 7.004   3.329   0.953   1.00 0.00 ? 17 CYS A O    1  
ATOM   230   C  CB   . CYS A 1 17 ? 3.986   3.685   1.146   1.00 0.00 ? 17 CYS A CB   1  
ATOM   231   S  SG   . CYS A 1 17 ? 2.511   4.734   1.198   1.00 0.00 ? 17 CYS A SG   1  
ATOM   232   H  H    . CYS A 1 17 ? 3.779   2.954   -1.472  1.00 0.00 ? 17 CYS A H    1  
ATOM   233   H  HA   . CYS A 1 17 ? 5.251   5.004   0.044   1.00 0.00 ? 17 CYS A HA   1  
ATOM   234   H  HB2  . CYS A 1 17 ? 3.656   2.661   1.080   1.00 0.00 ? 17 CYS A HB2  1  
ATOM   235   H  HB3  . CYS A 1 17 ? 4.520   3.825   2.075   1.00 0.00 ? 17 CYS A HB3  1  
ATOM   236   N  N    . ASP A 1 18 ? 6.042   1.889   -0.489  1.00 0.00 ? 18 ASP A N    1  
ATOM   237   C  CA   . ASP A 1 18 ? 6.975   0.786   -0.245  1.00 0.00 ? 18 ASP A CA   1  
ATOM   238   C  C    . ASP A 1 18 ? 6.588   0.087   1.056   1.00 0.00 ? 18 ASP A C    1  
ATOM   239   O  O    . ASP A 1 18 ? 7.422   -0.154  1.930   1.00 0.00 ? 18 ASP A O    1  
ATOM   240   C  CB   . ASP A 1 18 ? 8.441   1.253   -0.203  1.00 0.00 ? 18 ASP A CB   1  
ATOM   241   C  CG   . ASP A 1 18 ? 9.426   0.149   -0.544  1.00 0.00 ? 18 ASP A CG   1  
ATOM   242   O  OD1  . ASP A 1 18 ? 9.201   -1.007  -0.138  1.00 0.00 ? 18 ASP A OD1  1  
ATOM   243   O  OD2  . ASP A 1 18 ? 10.449  0.440   -1.198  1.00 0.00 ? 18 ASP A OD2  1  
ATOM   244   H  H    . ASP A 1 18 ? 5.226   1.698   -1.000  1.00 0.00 ? 18 ASP A H    1  
ATOM   245   H  HA   . ASP A 1 18 ? 6.857   0.080   -1.055  1.00 0.00 ? 18 ASP A HA   1  
ATOM   246   H  HB2  . ASP A 1 18 ? 8.574   2.058   -0.911  1.00 0.00 ? 18 ASP A HB2  1  
ATOM   247   H  HB3  . ASP A 1 18 ? 8.665   1.615   0.790   1.00 0.00 ? 18 ASP A HB3  1  
ATOM   248   N  N    . ARG A 1 19 ? 5.303   -0.241  1.162   1.00 0.00 ? 19 ARG A N    1  
ATOM   249   C  CA   . ARG A 1 19 ? 4.777   -0.966  2.315   1.00 0.00 ? 19 ARG A CA   1  
ATOM   250   C  C    . ARG A 1 19 ? 5.000   -2.463  2.116   1.00 0.00 ? 19 ARG A C    1  
ATOM   251   O  O    . ARG A 1 19 ? 5.855   -2.860  1.329   1.00 0.00 ? 19 ARG A O    1  
ATOM   252   C  CB   . ARG A 1 19 ? 3.279   -0.688  2.497   1.00 0.00 ? 19 ARG A CB   1  
ATOM   253   C  CG   . ARG A 1 19 ? 2.933   0.783   2.661   1.00 0.00 ? 19 ARG A CG   1  
ATOM   254   C  CD   . ARG A 1 19 ? 2.342   1.074   4.031   1.00 0.00 ? 19 ARG A CD   1  
ATOM   255   N  NE   . ARG A 1 19 ? 0.918   0.729   4.118   1.00 0.00 ? 19 ARG A NE   1  
ATOM   256   C  CZ   . ARG A 1 19 ? 0.311   0.386   5.261   1.00 0.00 ? 19 ARG A CZ   1  
ATOM   257   N  NH1  . ARG A 1 19 ? 1.000   0.347   6.393   1.00 0.00 ? 19 ARG A NH1  1  
ATOM   258   N  NH2  . ARG A 1 19 ? -0.982  0.090   5.271   1.00 0.00 ? 19 ARG A NH2  1  
ATOM   259   H  H    . ARG A 1 19 ? 4.704   -0.031  0.418   1.00 0.00 ? 19 ARG A H    1  
ATOM   260   H  HA   . ARG A 1 19 ? 5.310   -0.640  3.193   1.00 0.00 ? 19 ARG A HA   1  
ATOM   261   H  HB2  . ARG A 1 19 ? 2.751   -1.060  1.632   1.00 0.00 ? 19 ARG A HB2  1  
ATOM   262   H  HB3  . ARG A 1 19 ? 2.933   -1.216  3.373   1.00 0.00 ? 19 ARG A HB3  1  
ATOM   263   H  HG2  . ARG A 1 19 ? 3.832   1.367   2.535   1.00 0.00 ? 19 ARG A HG2  1  
ATOM   264   H  HG3  . ARG A 1 19 ? 2.214   1.057   1.903   1.00 0.00 ? 19 ARG A HG3  1  
ATOM   265   H  HD2  . ARG A 1 19 ? 2.883   0.501   4.770   1.00 0.00 ? 19 ARG A HD2  1  
ATOM   266   H  HD3  . ARG A 1 19 ? 2.459   2.128   4.241   1.00 0.00 ? 19 ARG A HD3  1  
ATOM   267   H  HE   . ARG A 1 19 ? 0.381   0.762   3.282   1.00 0.00 ? 19 ARG A HE   1  
ATOM   268   H  HH11 . ARG A 1 19 ? 1.981   0.576   6.403   1.00 0.00 ? 19 ARG A HH11 1  
ATOM   269   H  HH12 . ARG A 1 19 ? 0.540   0.095   7.257   1.00 0.00 ? 19 ARG A HH12 1  
ATOM   270   H  HH21 . ARG A 1 19 ? -1.510  0.119   4.425   1.00 0.00 ? 19 ARG A HH21 1  
ATOM   271   H  HH22 . ARG A 1 19 ? -1.442  -0.158  6.132   1.00 0.00 ? 19 ARG A HH22 1  
ATOM   272   N  N    . SER A 1 20 ? 4.181   -3.290  2.752   1.00 0.00 ? 20 SER A N    1  
ATOM   273   C  CA   . SER A 1 20 ? 4.257   -4.728  2.532   1.00 0.00 ? 20 SER A CA   1  
ATOM   274   C  C    . SER A 1 20 ? 2.997   -5.434  3.019   1.00 0.00 ? 20 SER A C    1  
ATOM   275   O  O    . SER A 1 20 ? 2.611   -5.319  4.185   1.00 0.00 ? 20 SER A O    1  
ATOM   276   C  CB   . SER A 1 20 ? 5.485   -5.319  3.220   1.00 0.00 ? 20 SER A CB   1  
ATOM   277   O  OG   . SER A 1 20 ? 5.842   -4.576  4.374   1.00 0.00 ? 20 SER A OG   1  
ATOM   278   H  H    . SER A 1 20 ? 3.481   -2.928  3.342   1.00 0.00 ? 20 SER A H    1  
ATOM   279   H  HA   . SER A 1 20 ? 4.344   -4.887  1.469   1.00 0.00 ? 20 SER A HA   1  
ATOM   280   H  HB2  . SER A 1 20 ? 5.267   -6.334  3.513   1.00 0.00 ? 20 SER A HB2  1  
ATOM   281   H  HB3  . SER A 1 20 ? 6.316   -5.314  2.530   1.00 0.00 ? 20 SER A HB3  1  
ATOM   282   H  HG   . SER A 1 20 ? 6.212   -3.729  4.108   1.00 0.00 ? 20 SER A HG   1  
ATOM   283   N  N    . PHE A 1 21 ? 2.353   -6.147  2.108   1.00 0.00 ? 21 PHE A N    1  
ATOM   284   C  CA   . PHE A 1 21 ? 1.147   -6.894  2.421   1.00 0.00 ? 21 PHE A CA   1  
ATOM   285   C  C    . PHE A 1 21 ? 1.254   -8.289  1.829   1.00 0.00 ? 21 PHE A C    1  
ATOM   286   O  O    . PHE A 1 21 ? 1.699   -8.455  0.694   1.00 0.00 ? 21 PHE A O    1  
ATOM   287   C  CB   . PHE A 1 21 ? -0.093  -6.194  1.856   1.00 0.00 ? 21 PHE A CB   1  
ATOM   288   C  CG   . PHE A 1 21 ? -0.158  -4.724  2.161   1.00 0.00 ? 21 PHE A CG   1  
ATOM   289   C  CD1  . PHE A 1 21 ? 0.556   -3.813  1.400   1.00 0.00 ? 21 PHE A CD1  1  
ATOM   290   C  CD2  . PHE A 1 21 ? -0.933  -4.255  3.208   1.00 0.00 ? 21 PHE A CD2  1  
ATOM   291   C  CE1  . PHE A 1 21 ? 0.502   -2.466  1.680   1.00 0.00 ? 21 PHE A CE1  1  
ATOM   292   C  CE2  . PHE A 1 21 ? -0.990  -2.906  3.492   1.00 0.00 ? 21 PHE A CE2  1  
ATOM   293   C  CZ   . PHE A 1 21 ? -0.273  -2.012  2.724   1.00 0.00 ? 21 PHE A CZ   1  
ATOM   294   H  H    . PHE A 1 21 ? 2.698   -6.175  1.186   1.00 0.00 ? 21 PHE A H    1  
ATOM   295   H  HA   . PHE A 1 21 ? 1.064   -6.967  3.495   1.00 0.00 ? 21 PHE A HA   1  
ATOM   296   H  HB2  . PHE A 1 21 ? -0.101  -6.309  0.783   1.00 0.00 ? 21 PHE A HB2  1  
ATOM   297   H  HB3  . PHE A 1 21 ? -0.977  -6.661  2.268   1.00 0.00 ? 21 PHE A HB3  1  
ATOM   298   H  HD1  . PHE A 1 21 ? 1.169   -4.171  0.582   1.00 0.00 ? 21 PHE A HD1  1  
ATOM   299   H  HD2  . PHE A 1 21 ? -1.497  -4.955  3.810   1.00 0.00 ? 21 PHE A HD2  1  
ATOM   300   H  HE1  . PHE A 1 21 ? 1.063   -1.765  1.079   1.00 0.00 ? 21 PHE A HE1  1  
ATOM   301   H  HE2  . PHE A 1 21 ? -1.598  -2.550  4.312   1.00 0.00 ? 21 PHE A HE2  1  
ATOM   302   H  HZ   . PHE A 1 21 ? -0.315  -0.956  2.946   1.00 0.00 ? 21 PHE A HZ   1  
ATOM   303   N  N    . SER A 1 22 ? 0.869   -9.286  2.600   1.00 0.00 ? 22 SER A N    1  
ATOM   304   C  CA   . SER A 1 22 ? 0.912   -10.657 2.132   1.00 0.00 ? 22 SER A CA   1  
ATOM   305   C  C    . SER A 1 22 ? -0.300  -10.938 1.246   1.00 0.00 ? 22 SER A C    1  
ATOM   306   O  O    . SER A 1 22 ? -0.323  -11.901 0.477   1.00 0.00 ? 22 SER A O    1  
ATOM   307   C  CB   . SER A 1 22 ? 0.927   -11.605 3.329   1.00 0.00 ? 22 SER A CB   1  
ATOM   308   O  OG   . SER A 1 22 ? 0.838   -10.876 4.545   1.00 0.00 ? 22 SER A OG   1  
ATOM   309   H  H    . SER A 1 22 ? 0.539   -9.102  3.508   1.00 0.00 ? 22 SER A H    1  
ATOM   310   H  HA   . SER A 1 22 ? 1.822   -10.789 1.556   1.00 0.00 ? 22 SER A HA   1  
ATOM   311   H  HB2  . SER A 1 22 ? 0.086   -12.280 3.264   1.00 0.00 ? 22 SER A HB2  1  
ATOM   312   H  HB3  . SER A 1 22 ? 1.845   -12.171 3.328   1.00 0.00 ? 22 SER A HB3  1  
ATOM   313   H  HG   . SER A 1 22 ? 0.355   -11.401 5.200   1.00 0.00 ? 22 SER A HG   1  
ATOM   314   N  N    . ARG A 1 23 ? -1.306  -10.078 1.369   1.00 0.00 ? 23 ARG A N    1  
ATOM   315   C  CA   . ARG A 1 23 ? -2.532  -10.193 0.594   1.00 0.00 ? 23 ARG A CA   1  
ATOM   316   C  C    . ARG A 1 23 ? -2.734  -8.974  -0.272  1.00 0.00 ? 23 ARG A C    1  
ATOM   317   O  O    . ARG A 1 23 ? -2.724  -7.837  0.203   1.00 0.00 ? 23 ARG A O    1  
ATOM   318   C  CB   . ARG A 1 23 ? -3.740  -10.371 1.515   1.00 0.00 ? 23 ARG A CB   1  
ATOM   319   C  CG   . ARG A 1 23 ? -3.515  -11.364 2.643   1.00 0.00 ? 23 ARG A CG   1  
ATOM   320   C  CD   . ARG A 1 23 ? -4.594  -11.259 3.709   1.00 0.00 ? 23 ARG A CD   1  
ATOM   321   N  NE   . ARG A 1 23 ? -5.809  -10.611 3.211   1.00 0.00 ? 23 ARG A NE   1  
ATOM   322   C  CZ   . ARG A 1 23 ? -6.956  -11.249 2.988   1.00 0.00 ? 23 ARG A CZ   1  
ATOM   323   N  NH1  . ARG A 1 23 ? -7.055  -12.552 3.214   1.00 0.00 ? 23 ARG A NH1  1  
ATOM   324   N  NH2  . ARG A 1 23 ? -8.008  -10.579 2.540   1.00 0.00 ? 23 ARG A NH2  1  
ATOM   325   H  H    . ARG A 1 23 ? -1.215  -9.333  2.003   1.00 0.00 ? 23 ARG A H    1  
ATOM   326   H  HA   . ARG A 1 23 ? -2.453  -11.049 -0.061  1.00 0.00 ? 23 ARG A HA   1  
ATOM   327   H  HB2  . ARG A 1 23 ? -3.988  -9.415  1.953   1.00 0.00 ? 23 ARG A HB2  1  
ATOM   328   H  HB3  . ARG A 1 23 ? -4.578  -10.712 0.925   1.00 0.00 ? 23 ARG A HB3  1  
ATOM   329   H  HG2  . ARG A 1 23 ? -3.523  -12.364 2.237   1.00 0.00 ? 23 ARG A HG2  1  
ATOM   330   H  HG3  . ARG A 1 23 ? -2.552  -11.165 3.097   1.00 0.00 ? 23 ARG A HG3  1  
ATOM   331   H  HD2  . ARG A 1 23 ? -4.843  -12.254 4.048   1.00 0.00 ? 23 ARG A HD2  1  
ATOM   332   H  HD3  . ARG A 1 23 ? -4.207  -10.685 4.538   1.00 0.00 ? 23 ARG A HD3  1  
ATOM   333   H  HE   . ARG A 1 23 ? -5.765  -9.650  3.036   1.00 0.00 ? 23 ARG A HE   1  
ATOM   334   H  HH11 . ARG A 1 23 ? -6.262  -13.070 3.555   1.00 0.00 ? 23 ARG A HH11 1  
ATOM   335   H  HH12 . ARG A 1 23 ? -7.930  -13.029 3.052   1.00 0.00 ? 23 ARG A HH12 1  
ATOM   336   H  HH21 . ARG A 1 23 ? -7.947  -9.582  2.371   1.00 0.00 ? 23 ARG A HH21 1  
ATOM   337   H  HH22 . ARG A 1 23 ? -8.874  -11.058 2.352   1.00 0.00 ? 23 ARG A HH22 1  
ATOM   338   N  N    . SER A 1 24 ? -2.977  -9.241  -1.538  1.00 0.00 ? 24 SER A N    1  
ATOM   339   C  CA   . SER A 1 24 ? -3.245  -8.212  -2.521  1.00 0.00 ? 24 SER A CA   1  
ATOM   340   C  C    . SER A 1 24 ? -4.466  -7.380  -2.128  1.00 0.00 ? 24 SER A C    1  
ATOM   341   O  O    . SER A 1 24 ? -4.551  -6.187  -2.428  1.00 0.00 ? 24 SER A O    1  
ATOM   342   C  CB   . SER A 1 24 ? -3.469  -8.892  -3.861  1.00 0.00 ? 24 SER A CB   1  
ATOM   343   O  OG   . SER A 1 24 ? -3.771  -10.271 -3.683  1.00 0.00 ? 24 SER A OG   1  
ATOM   344   H  H    . SER A 1 24 ? -2.992  -10.183 -1.831  1.00 0.00 ? 24 SER A H    1  
ATOM   345   H  HA   . SER A 1 24 ? -2.380  -7.569  -2.587  1.00 0.00 ? 24 SER A HA   1  
ATOM   346   H  HB2  . SER A 1 24 ? -4.289  -8.420  -4.367  1.00 0.00 ? 24 SER A HB2  1  
ATOM   347   H  HB3  . SER A 1 24 ? -2.574  -8.813  -4.455  1.00 0.00 ? 24 SER A HB3  1  
ATOM   348   H  HG   . SER A 1 24 ? -4.061  -10.643 -4.531  1.00 0.00 ? 24 SER A HG   1  
ATOM   349   N  N    . ASP A 1 25 ? -5.383  -8.019  -1.417  1.00 0.00 ? 25 ASP A N    1  
ATOM   350   C  CA   . ASP A 1 25 ? -6.590  -7.363  -0.932  1.00 0.00 ? 25 ASP A CA   1  
ATOM   351   C  C    . ASP A 1 25 ? -6.245  -6.260  0.059   1.00 0.00 ? 25 ASP A C    1  
ATOM   352   O  O    . ASP A 1 25 ? -6.738  -5.135  -0.043  1.00 0.00 ? 25 ASP A O    1  
ATOM   353   C  CB   . ASP A 1 25 ? -7.495  -8.396  -0.265  1.00 0.00 ? 25 ASP A CB   1  
ATOM   354   C  CG   . ASP A 1 25 ? -8.371  -7.809  0.822   1.00 0.00 ? 25 ASP A CG   1  
ATOM   355   O  OD1  . ASP A 1 25 ? -9.398  -7.184  0.493   1.00 0.00 ? 25 ASP A OD1  1  
ATOM   356   O  OD2  . ASP A 1 25 ? -8.035  -7.980  2.015   1.00 0.00 ? 25 ASP A OD2  1  
ATOM   357   H  H    . ASP A 1 25 ? -5.239  -8.968  -1.200  1.00 0.00 ? 25 ASP A H    1  
ATOM   358   H  HA   . ASP A 1 25 ? -7.102  -6.931  -1.778  1.00 0.00 ? 25 ASP A HA   1  
ATOM   359   H  HB2  . ASP A 1 25 ? -8.129  -8.837  -1.012  1.00 0.00 ? 25 ASP A HB2  1  
ATOM   360   H  HB3  . ASP A 1 25 ? -6.880  -9.170  0.174   1.00 0.00 ? 25 ASP A HB3  1  
ATOM   361   N  N    . HIS A 1 26 ? -5.379  -6.596  1.003   1.00 0.00 ? 26 HIS A N    1  
ATOM   362   C  CA   . HIS A 1 26 ? -4.950  -5.647  2.028   1.00 0.00 ? 26 HIS A CA   1  
ATOM   363   C  C    . HIS A 1 26 ? -4.179  -4.491  1.405   1.00 0.00 ? 26 HIS A C    1  
ATOM   364   O  O    . HIS A 1 26 ? -4.306  -3.349  1.842   1.00 0.00 ? 26 HIS A O    1  
ATOM   365   C  CB   . HIS A 1 26 ? -4.100  -6.344  3.091   1.00 0.00 ? 26 HIS A CB   1  
ATOM   366   C  CG   . HIS A 1 26 ? -4.879  -6.751  4.307   1.00 0.00 ? 26 HIS A CG   1  
ATOM   367   N  ND1  . HIS A 1 26 ? -4.347  -6.750  5.576   1.00 0.00 ? 26 HIS A ND1  1  
ATOM   368   C  CD2  . HIS A 1 26 ? -6.154  -7.182  4.437   1.00 0.00 ? 26 HIS A CD2  1  
ATOM   369   C  CE1  . HIS A 1 26 ? -5.261  -7.161  6.435   1.00 0.00 ? 26 HIS A CE1  1  
ATOM   370   N  NE2  . HIS A 1 26 ? -6.368  -7.430  5.768   1.00 0.00 ? 26 HIS A NE2  1  
ATOM   371   H  H    . HIS A 1 26 ? -5.016  -7.506  1.003   1.00 0.00 ? 26 HIS A H    1  
ATOM   372   H  HA   . HIS A 1 26 ? -5.839  -5.253  2.499   1.00 0.00 ? 26 HIS A HA   1  
ATOM   373   H  HB2  . HIS A 1 26 ? -3.662  -7.233  2.663   1.00 0.00 ? 26 HIS A HB2  1  
ATOM   374   H  HB3  . HIS A 1 26 ? -3.312  -5.677  3.408   1.00 0.00 ? 26 HIS A HB3  1  
ATOM   375   H  HD1  . HIS A 1 26 ? -3.422  -6.493  5.815   1.00 0.00 ? 26 HIS A HD1  1  
ATOM   376   H  HD2  . HIS A 1 26 ? -6.868  -7.314  3.637   1.00 0.00 ? 26 HIS A HD2  1  
ATOM   377   H  HE1  . HIS A 1 26 ? -5.127  -7.255  7.503   1.00 0.00 ? 26 HIS A HE1  1  
ATOM   378   H  HE2  . HIS A 1 26 ? -7.250  -7.594  6.182   1.00 0.00 ? 26 HIS A HE2  1  
ATOM   379   N  N    . LEU A 1 27 ? -3.470  -4.780  0.312   1.00 0.00 ? 27 LEU A N    1  
ATOM   380   C  CA   . LEU A 1 27 ? -2.795  -3.745  -0.465  1.00 0.00 ? 27 LEU A CA   1  
ATOM   381   C  C    . LEU A 1 27 ? -3.800  -2.679  -0.886  1.00 0.00 ? 27 LEU A C    1  
ATOM   382   O  O    . LEU A 1 27 ? -3.667  -1.505  -0.532  1.00 0.00 ? 27 LEU A O    1  
ATOM   383   C  CB   . LEU A 1 27 ? -2.161  -4.349  -1.726  1.00 0.00 ? 27 LEU A CB   1  
ATOM   384   C  CG   . LEU A 1 27 ? -1.192  -3.440  -2.500  1.00 0.00 ? 27 LEU A CG   1  
ATOM   385   C  CD1  . LEU A 1 27 ? -0.678  -2.294  -1.638  1.00 0.00 ? 27 LEU A CD1  1  
ATOM   386   C  CD2  . LEU A 1 27 ? -0.038  -4.243  -3.064  1.00 0.00 ? 27 LEU A CD2  1  
ATOM   387   H  H    . LEU A 1 27 ? -3.470  -5.702  -0.021  1.00 0.00 ? 27 LEU A H    1  
ATOM   388   H  HA   . LEU A 1 27 ? -2.028  -3.298  0.150   1.00 0.00 ? 27 LEU A HA   1  
ATOM   389   H  HB2  . LEU A 1 27 ? -1.624  -5.240  -1.436  1.00 0.00 ? 27 LEU A HB2  1  
ATOM   390   H  HB3  . LEU A 1 27 ? -2.959  -4.636  -2.396  1.00 0.00 ? 27 LEU A HB3  1  
ATOM   391   H  HG   . LEU A 1 27 ? -1.725  -3.005  -3.335  1.00 0.00 ? 27 LEU A HG   1  
ATOM   392   H  HD11 . LEU A 1 27 ? -1.495  -1.878  -1.064  1.00 0.00 ? 27 LEU A HD11 1  
ATOM   393   H  HD12 . LEU A 1 27 ? 0.083   -2.664  -0.964  1.00 0.00 ? 27 LEU A HD12 1  
ATOM   394   H  HD13 . LEU A 1 27 ? -0.256  -1.525  -2.269  1.00 0.00 ? 27 LEU A HD13 1  
ATOM   395   H  HD21 . LEU A 1 27 ? -0.417  -5.132  -3.546  1.00 0.00 ? 27 LEU A HD21 1  
ATOM   396   H  HD22 . LEU A 1 27 ? 0.497   -3.641  -3.785  1.00 0.00 ? 27 LEU A HD22 1  
ATOM   397   H  HD23 . LEU A 1 27 ? 0.630   -4.523  -2.264  1.00 0.00 ? 27 LEU A HD23 1  
ATOM   398   N  N    . ALA A 1 28 ? -4.803  -3.113  -1.645  1.00 0.00 ? 28 ALA A N    1  
ATOM   399   C  CA   . ALA A 1 28 ? -5.843  -2.226  -2.145  1.00 0.00 ? 28 ALA A CA   1  
ATOM   400   C  C    . ALA A 1 28 ? -6.538  -1.480  -1.011  1.00 0.00 ? 28 ALA A C    1  
ATOM   401   O  O    . ALA A 1 28 ? -6.891  -0.313  -1.160  1.00 0.00 ? 28 ALA A O    1  
ATOM   402   C  CB   . ALA A 1 28 ? -6.853  -3.015  -2.964  1.00 0.00 ? 28 ALA A CB   1  
ATOM   403   H  H    . ALA A 1 28 ? -4.841  -4.067  -1.879  1.00 0.00 ? 28 ALA A H    1  
ATOM   404   H  HA   . ALA A 1 28 ? -5.376  -1.504  -2.799  1.00 0.00 ? 28 ALA A HA   1  
ATOM   405   H  HB1  . ALA A 1 28 ? -6.532  -3.052  -3.995  1.00 0.00 ? 28 ALA A HB1  1  
ATOM   406   H  HB2  . ALA A 1 28 ? -6.926  -4.020  -2.573  1.00 0.00 ? 28 ALA A HB2  1  
ATOM   407   H  HB3  . ALA A 1 28 ? -7.817  -2.534  -2.904  1.00 0.00 ? 28 ALA A HB3  1  
ATOM   408   N  N    . LEU A 1 29 ? -6.714  -2.155  0.124   1.00 0.00 ? 29 LEU A N    1  
ATOM   409   C  CA   . LEU A 1 29 ? -7.362  -1.554  1.287   1.00 0.00 ? 29 LEU A CA   1  
ATOM   410   C  C    . LEU A 1 29 ? -6.580  -0.347  1.790   1.00 0.00 ? 29 LEU A C    1  
ATOM   411   O  O    . LEU A 1 29 ? -7.158  0.701   2.078   1.00 0.00 ? 29 LEU A O    1  
ATOM   412   C  CB   . LEU A 1 29 ? -7.517  -2.581  2.404   1.00 0.00 ? 29 LEU A CB   1  
ATOM   413   C  CG   . LEU A 1 29 ? -8.552  -3.671  2.135   1.00 0.00 ? 29 LEU A CG   1  
ATOM   414   C  CD1  . LEU A 1 29 ? -8.603  -4.652  3.294   1.00 0.00 ? 29 LEU A CD1  1  
ATOM   415   C  CD2  . LEU A 1 29 ? -9.920  -3.053  1.888   1.00 0.00 ? 29 LEU A CD2  1  
ATOM   416   H  H    . LEU A 1 29 ? -6.402  -3.086  0.181   1.00 0.00 ? 29 LEU A H    1  
ATOM   417   H  HA   . LEU A 1 29 ? -8.342  -1.226  0.985   1.00 0.00 ? 29 LEU A HA   1  
ATOM   418   H  HB2  . LEU A 1 29 ? -6.559  -3.048  2.571   1.00 0.00 ? 29 LEU A HB2  1  
ATOM   419   H  HB3  . LEU A 1 29 ? -7.807  -2.056  3.301   1.00 0.00 ? 29 LEU A HB3  1  
ATOM   420   H  HG   . LEU A 1 29 ? -8.266  -4.219  1.247   1.00 0.00 ? 29 LEU A HG   1  
ATOM   421   H  HD11 . LEU A 1 29 ? -7.742  -5.305  3.251   1.00 0.00 ? 29 LEU A HD11 1  
ATOM   422   H  HD12 . LEU A 1 29 ? -8.595  -4.108  4.227   1.00 0.00 ? 29 LEU A HD12 1  
ATOM   423   H  HD13 . LEU A 1 29 ? -9.506  -5.241  3.228   1.00 0.00 ? 29 LEU A HD13 1  
ATOM   424   H  HD21 . LEU A 1 29 ? -10.618 -3.825  1.598   1.00 0.00 ? 29 LEU A HD21 1  
ATOM   425   H  HD22 . LEU A 1 29 ? -10.268 -2.575  2.792   1.00 0.00 ? 29 LEU A HD22 1  
ATOM   426   H  HD23 . LEU A 1 29 ? -9.845  -2.320  1.100   1.00 0.00 ? 29 LEU A HD23 1  
ATOM   427   N  N    . HIS A 1 30 ? -5.261  -0.474  1.842   1.00 0.00 ? 30 HIS A N    1  
ATOM   428   C  CA   . HIS A 1 30 ? -4.415  0.641   2.243   1.00 0.00 ? 30 HIS A CA   1  
ATOM   429   C  C    . HIS A 1 30 ? -4.375  1.687   1.134   1.00 0.00 ? 30 HIS A C    1  
ATOM   430   O  O    . HIS A 1 30 ? -4.301  2.891   1.391   1.00 0.00 ? 30 HIS A O    1  
ATOM   431   C  CB   . HIS A 1 30 ? -2.990  0.159   2.572   1.00 0.00 ? 30 HIS A CB   1  
ATOM   432   C  CG   . HIS A 1 30 ? -1.932  1.211   2.384   1.00 0.00 ? 30 HIS A CG   1  
ATOM   433   N  ND1  . HIS A 1 30 ? -1.788  2.306   3.201   1.00 0.00 ? 30 HIS A ND1  1  
ATOM   434   C  CD2  . HIS A 1 30 ? -0.990  1.343   1.415   1.00 0.00 ? 30 HIS A CD2  1  
ATOM   435   C  CE1  . HIS A 1 30 ? -0.791  3.056   2.710   1.00 0.00 ? 30 HIS A CE1  1  
ATOM   436   N  NE2  . HIS A 1 30 ? -0.268  2.517   1.622   1.00 0.00 ? 30 HIS A NE2  1  
ATOM   437   H  H    . HIS A 1 30 ? -4.848  -1.325  1.572   1.00 0.00 ? 30 HIS A H    1  
ATOM   438   H  HA   . HIS A 1 30 ? -4.848  1.087   3.126   1.00 0.00 ? 30 HIS A HA   1  
ATOM   439   H  HB2  . HIS A 1 30 ? -2.957  -0.162  3.602   1.00 0.00 ? 30 HIS A HB2  1  
ATOM   440   H  HB3  . HIS A 1 30 ? -2.741  -0.676  1.935   1.00 0.00 ? 30 HIS A HB3  1  
ATOM   441   H  HD1  . HIS A 1 30 ? -2.337  2.517   3.997   1.00 0.00 ? 30 HIS A HD1  1  
ATOM   442   H  HD2  . HIS A 1 30 ? -0.819  0.649   0.603   1.00 0.00 ? 30 HIS A HD2  1  
ATOM   443   H  HE1  . HIS A 1 30 ? -0.452  3.982   3.151   1.00 0.00 ? 30 HIS A HE1  1  
ATOM   444   N  N    . ARG A 1 31 ? -4.384  1.218   -0.103  1.00 0.00 ? 31 ARG A N    1  
ATOM   445   C  CA   . ARG A 1 31 ? -4.257  2.101   -1.250  1.00 0.00 ? 31 ARG A CA   1  
ATOM   446   C  C    . ARG A 1 31 ? -5.547  2.873   -1.500  1.00 0.00 ? 31 ARG A C    1  
ATOM   447   O  O    . ARG A 1 31 ? -5.588  3.771   -2.342  1.00 0.00 ? 31 ARG A O    1  
ATOM   448   C  CB   . ARG A 1 31 ? -3.860  1.313   -2.491  1.00 0.00 ? 31 ARG A CB   1  
ATOM   449   C  CG   . ARG A 1 31 ? -2.464  0.723   -2.395  1.00 0.00 ? 31 ARG A CG   1  
ATOM   450   C  CD   . ARG A 1 31 ? -1.844  0.509   -3.765  1.00 0.00 ? 31 ARG A CD   1  
ATOM   451   N  NE   . ARG A 1 31 ? -1.366  1.760   -4.349  1.00 0.00 ? 31 ARG A NE   1  
ATOM   452   C  CZ   . ARG A 1 31 ? -1.913  2.330   -5.422  1.00 0.00 ? 31 ARG A CZ   1  
ATOM   453   N  NH1  . ARG A 1 31 ? -2.970  1.778   -6.005  1.00 0.00 ? 31 ARG A NH1  1  
ATOM   454   N  NH2  . ARG A 1 31 ? -1.413  3.462   -5.899  1.00 0.00 ? 31 ARG A NH2  1  
ATOM   455   H  H    . ARG A 1 31 ? -4.445  0.245   -0.249  1.00 0.00 ? 31 ARG A H    1  
ATOM   456   H  HA   . ARG A 1 31 ? -3.466  2.805   -1.022  1.00 0.00 ? 31 ARG A HA   1  
ATOM   457   H  HB2  . ARG A 1 31 ? -4.563  0.504   -2.635  1.00 0.00 ? 31 ARG A HB2  1  
ATOM   458   H  HB3  . ARG A 1 31 ? -3.896  1.972   -3.345  1.00 0.00 ? 31 ARG A HB3  1  
ATOM   459   H  HG2  . ARG A 1 31 ? -1.838  1.398   -1.830  1.00 0.00 ? 31 ARG A HG2  1  
ATOM   460   H  HG3  . ARG A 1 31 ? -2.523  -0.227  -1.884  1.00 0.00 ? 31 ARG A HG3  1  
ATOM   461   H  HD2  . ARG A 1 31 ? -1.010  -0.170  -3.666  1.00 0.00 ? 31 ARG A HD2  1  
ATOM   462   H  HD3  . ARG A 1 31 ? -2.585  0.076   -4.420  1.00 0.00 ? 31 ARG A HD3  1  
ATOM   463   H  HE   . ARG A 1 31 ? -0.593  2.188   -3.919  1.00 0.00 ? 31 ARG A HE   1  
ATOM   464   H  HH11 . ARG A 1 31 ? -3.367  0.929   -5.639  1.00 0.00 ? 31 ARG A HH11 1  
ATOM   465   H  HH12 . ARG A 1 31 ? -3.384  2.206   -6.820  1.00 0.00 ? 31 ARG A HH12 1  
ATOM   466   H  HH21 . ARG A 1 31 ? -0.620  3.901   -5.453  1.00 0.00 ? 31 ARG A HH21 1  
ATOM   467   H  HH22 . ARG A 1 31 ? -1.819  3.889   -6.720  1.00 0.00 ? 31 ARG A HH22 1  
ATOM   468   N  N    . LYS A 1 32 ? -6.560  2.590   -0.688  1.00 0.00 ? 32 LYS A N    1  
ATOM   469   C  CA   . LYS A 1 32 ? -7.812  3.330   -0.727  1.00 0.00 ? 32 LYS A CA   1  
ATOM   470   C  C    . LYS A 1 32 ? -7.567  4.784   -0.350  1.00 0.00 ? 32 LYS A C    1  
ATOM   471   O  O    . LYS A 1 32 ? -8.286  5.684   -0.781  1.00 0.00 ? 32 LYS A O    1  
ATOM   472   C  CB   . LYS A 1 32 ? -8.824  2.713   0.236   1.00 0.00 ? 32 LYS A CB   1  
ATOM   473   C  CG   . LYS A 1 32 ? -10.039 2.124   -0.454  1.00 0.00 ? 32 LYS A CG   1  
ATOM   474   C  CD   . LYS A 1 32 ? -9.715  0.796   -1.111  1.00 0.00 ? 32 LYS A CD   1  
ATOM   475   C  CE   . LYS A 1 32 ? -10.142 0.777   -2.568  1.00 0.00 ? 32 LYS A CE   1  
ATOM   476   N  NZ   . LYS A 1 32 ? -9.365  -0.211  -3.359  1.00 0.00 ? 32 LYS A NZ   1  
ATOM   477   H  H    . LYS A 1 32 ? -6.441  1.899   -0.002  1.00 0.00 ? 32 LYS A H    1  
ATOM   478   H  HA   . LYS A 1 32 ? -8.201  3.285   -1.731  1.00 0.00 ? 32 LYS A HA   1  
ATOM   479   H  HB2  . LYS A 1 32 ? -8.338  1.928   0.796   1.00 0.00 ? 32 LYS A HB2  1  
ATOM   480   H  HB3  . LYS A 1 32 ? -9.160  3.477   0.922   1.00 0.00 ? 32 LYS A HB3  1  
ATOM   481   H  HG2  . LYS A 1 32 ? -10.819 1.971   0.278   1.00 0.00 ? 32 LYS A HG2  1  
ATOM   482   H  HG3  . LYS A 1 32 ? -10.383 2.815   -1.210  1.00 0.00 ? 32 LYS A HG3  1  
ATOM   483   H  HD2  . LYS A 1 32 ? -8.647  0.630   -1.057  1.00 0.00 ? 32 LYS A HD2  1  
ATOM   484   H  HD3  . LYS A 1 32 ? -10.231 0.008   -0.582  1.00 0.00 ? 32 LYS A HD3  1  
ATOM   485   H  HE2  . LYS A 1 32 ? -11.190 0.519   -2.619  1.00 0.00 ? 32 LYS A HE2  1  
ATOM   486   H  HE3  . LYS A 1 32 ? -9.993  1.760   -2.989  1.00 0.00 ? 32 LYS A HE3  1  
ATOM   487   H  HZ1  . LYS A 1 32 ? -9.241  -1.088  -2.809  1.00 0.00 ? 32 LYS A HZ1  1  
ATOM   488   H  HZ2  . LYS A 1 32 ? -8.425  0.175   -3.597  1.00 0.00 ? 32 LYS A HZ2  1  
ATOM   489   H  HZ3  . LYS A 1 32 ? -9.870  -0.438  -4.246  1.00 0.00 ? 32 LYS A HZ3  1  
ATOM   490   N  N    . ARG A 1 33 ? -6.514  5.004   0.425   1.00 0.00 ? 33 ARG A N    1  
ATOM   491   C  CA   . ARG A 1 33 ? -6.133  6.344   0.847   1.00 0.00 ? 33 ARG A CA   1  
ATOM   492   C  C    . ARG A 1 33 ? -5.356  7.057   -0.251  1.00 0.00 ? 33 ARG A C    1  
ATOM   493   O  O    . ARG A 1 33 ? -5.054  8.245   -0.141  1.00 0.00 ? 33 ARG A O    1  
ATOM   494   C  CB   . ARG A 1 33 ? -5.285  6.275   2.118   1.00 0.00 ? 33 ARG A CB   1  
ATOM   495   C  CG   . ARG A 1 33 ? -6.017  5.698   3.314   1.00 0.00 ? 33 ARG A CG   1  
ATOM   496   C  CD   . ARG A 1 33 ? -5.546  6.336   4.609   1.00 0.00 ? 33 ARG A CD   1  
ATOM   497   N  NE   . ARG A 1 33 ? -6.097  7.677   4.796   1.00 0.00 ? 33 ARG A NE   1  
ATOM   498   C  CZ   . ARG A 1 33 ? -6.818  8.045   5.857   1.00 0.00 ? 33 ARG A CZ   1  
ATOM   499   N  NH1  . ARG A 1 33 ? -7.045  7.187   6.846   1.00 0.00 ? 33 ARG A NH1  1  
ATOM   500   N  NH2  . ARG A 1 33 ? -7.299  9.281   5.934   1.00 0.00 ? 33 ARG A NH2  1  
ATOM   501   H  H    . ARG A 1 33 ? -5.971  4.241   0.715   1.00 0.00 ? 33 ARG A H    1  
ATOM   502   H  HA   . ARG A 1 33 ? -7.035  6.897   1.052   1.00 0.00 ? 33 ARG A HA   1  
ATOM   503   H  HB2  . ARG A 1 33 ? -4.419  5.660   1.924   1.00 0.00 ? 33 ARG A HB2  1  
ATOM   504   H  HB3  . ARG A 1 33 ? -4.957  7.272   2.371   1.00 0.00 ? 33 ARG A HB3  1  
ATOM   505   H  HG2  . ARG A 1 33 ? -7.075  5.878   3.198   1.00 0.00 ? 33 ARG A HG2  1  
ATOM   506   H  HG3  . ARG A 1 33 ? -5.832  4.635   3.359   1.00 0.00 ? 33 ARG A HG3  1  
ATOM   507   H  HD2  . ARG A 1 33 ? -5.857  5.713   5.435   1.00 0.00 ? 33 ARG A HD2  1  
ATOM   508   H  HD3  . ARG A 1 33 ? -4.468  6.398   4.594   1.00 0.00 ? 33 ARG A HD3  1  
ATOM   509   H  HE   . ARG A 1 33 ? -5.923  8.338   4.083   1.00 0.00 ? 33 ARG A HE   1  
ATOM   510   H  HH11 . ARG A 1 33 ? -6.670  6.250   6.804   1.00 0.00 ? 33 ARG A HH11 1  
ATOM   511   H  HH12 . ARG A 1 33 ? -7.595  7.467   7.647   1.00 0.00 ? 33 ARG A HH12 1  
ATOM   512   H  HH21 . ARG A 1 33 ? -7.126  9.943   5.194   1.00 0.00 ? 33 ARG A HH21 1  
ATOM   513   H  HH22 . ARG A 1 33 ? -7.841  9.566   6.736   1.00 0.00 ? 33 ARG A HH22 1  
ATOM   514   N  N    . HIS A 1 34 ? -5.018  6.321   -1.303  1.00 0.00 ? 34 HIS A N    1  
ATOM   515   C  CA   . HIS A 1 34 ? -4.247  6.871   -2.410  1.00 0.00 ? 34 HIS A CA   1  
ATOM   516   C  C    . HIS A 1 34 ? -5.158  7.252   -3.567  1.00 0.00 ? 34 HIS A C    1  
ATOM   517   O  O    . HIS A 1 34 ? -4.690  7.640   -4.639  1.00 0.00 ? 34 HIS A O    1  
ATOM   518   C  CB   . HIS A 1 34 ? -3.202  5.860   -2.880  1.00 0.00 ? 34 HIS A CB   1  
ATOM   519   C  CG   . HIS A 1 34 ? -2.104  5.635   -1.888  1.00 0.00 ? 34 HIS A CG   1  
ATOM   520   N  ND1  . HIS A 1 34 ? -1.355  6.646   -1.340  1.00 0.00 ? 34 HIS A ND1  1  
ATOM   521   C  CD2  . HIS A 1 34 ? -1.639  4.484   -1.338  1.00 0.00 ? 34 HIS A CD2  1  
ATOM   522   C  CE1  . HIS A 1 34 ? -0.476  6.094   -0.496  1.00 0.00 ? 34 HIS A CE1  1  
ATOM   523   N  NE2  . HIS A 1 34 ? -0.605  4.779   -0.458  1.00 0.00 ? 34 HIS A NE2  1  
ATOM   524   H  H    . HIS A 1 34 ? -5.281  5.374   -1.329  1.00 0.00 ? 34 HIS A H    1  
ATOM   525   H  HA   . HIS A 1 34 ? -3.743  7.761   -2.057  1.00 0.00 ? 34 HIS A HA   1  
ATOM   526   H  HB2  . HIS A 1 34 ? -3.685  4.912   -3.063  1.00 0.00 ? 34 HIS A HB2  1  
ATOM   527   H  HB3  . HIS A 1 34 ? -2.756  6.215   -3.798  1.00 0.00 ? 34 HIS A HB3  1  
ATOM   528   H  HD1  . HIS A 1 34 ? -1.452  7.614   -1.532  1.00 0.00 ? 34 HIS A HD1  1  
ATOM   529   H  HD2  . HIS A 1 34 ? -2.007  3.490   -1.540  1.00 0.00 ? 34 HIS A HD2  1  
ATOM   530   H  HE1  . HIS A 1 34 ? 0.249   6.653   0.082   1.00 0.00 ? 34 HIS A HE1  1  
ATOM   531   N  N    . MET A 1 35 ? -6.458  7.144   -3.343  1.00 0.00 ? 35 MET A N    1  
ATOM   532   C  CA   . MET A 1 35 ? -7.433  7.477   -4.368  1.00 0.00 ? 35 MET A CA   1  
ATOM   533   C  C    . MET A 1 35 ? -7.654  8.984   -4.420  1.00 0.00 ? 35 MET A C    1  
ATOM   534   O  O    . MET A 1 35 ? -7.172  9.662   -5.331  1.00 0.00 ? 35 MET A O    1  
ATOM   535   C  CB   . MET A 1 35 ? -8.754  6.751   -4.101  1.00 0.00 ? 35 MET A CB   1  
ATOM   536   C  CG   . MET A 1 35 ? -8.650  5.240   -4.224  1.00 0.00 ? 35 MET A CG   1  
ATOM   537   S  SD   . MET A 1 35 ? -10.249 4.418   -4.097  1.00 0.00 ? 35 MET A SD   1  
ATOM   538   C  CE   . MET A 1 35 ? -10.187 3.361   -5.541  1.00 0.00 ? 35 MET A CE   1  
ATOM   539   H  H    . MET A 1 35 ? -6.769  6.850   -2.460  1.00 0.00 ? 35 MET A H    1  
ATOM   540   H  HA   . MET A 1 35 ? -7.038  7.151   -5.316  1.00 0.00 ? 35 MET A HA   1  
ATOM   541   H  HB2  . MET A 1 35 ? -9.083  6.988   -3.100  1.00 0.00 ? 35 MET A HB2  1  
ATOM   542   H  HB3  . MET A 1 35 ? -9.495  7.099   -4.806  1.00 0.00 ? 35 MET A HB3  1  
ATOM   543   H  HG2  . MET A 1 35 ? -8.216  5.001   -5.183  1.00 0.00 ? 35 MET A HG2  1  
ATOM   544   H  HG3  . MET A 1 35 ? -8.008  4.873   -3.438  1.00 0.00 ? 35 MET A HG3  1  
ATOM   545   H  HE1  . MET A 1 35 ? -10.134 3.971   -6.432  1.00 0.00 ? 35 MET A HE1  1  
ATOM   546   H  HE2  . MET A 1 35 ? -9.312  2.730   -5.486  1.00 0.00 ? 35 MET A HE2  1  
ATOM   547   H  HE3  . MET A 1 35 ? -11.073 2.746   -5.576  1.00 0.00 ? 35 MET A HE3  1  
ATOM   548   N  N    . LEU A 1 36 ? -8.306  9.513   -3.393  1.00 0.00 ? 36 LEU A N    1  
ATOM   549   C  CA   . LEU A 1 36 ? -8.531  10.947  -3.276  1.00 0.00 ? 36 LEU A CA   1  
ATOM   550   C  C    . LEU A 1 36 ? -8.364  11.369  -1.826  1.00 0.00 ? 36 LEU A C    1  
ATOM   551   O  O    . LEU A 1 36 ? -9.248  12.003  -1.246  1.00 0.00 ? 36 LEU A O    1  
ATOM   552   C  CB   . LEU A 1 36 ? -9.932  11.326  -3.772  1.00 0.00 ? 36 LEU A CB   1  
ATOM   553   C  CG   . LEU A 1 36 ? -10.670 10.238  -4.549  1.00 0.00 ? 36 LEU A CG   1  
ATOM   554   C  CD1  . LEU A 1 36 ? -11.909 9.792   -3.789  1.00 0.00 ? 36 LEU A CD1  1  
ATOM   555   C  CD2  . LEU A 1 36 ? -11.035 10.734  -5.938  1.00 0.00 ? 36 LEU A CD2  1  
ATOM   556   H  H    . LEU A 1 36 ? -8.596  8.927   -2.654  1.00 0.00 ? 36 LEU A H    1  
ATOM   557   H  HA   . LEU A 1 36 ? -7.790  11.452  -3.878  1.00 0.00 ? 36 LEU A HA   1  
ATOM   558   H  HB2  . LEU A 1 36 ? -10.532 11.593  -2.916  1.00 0.00 ? 36 LEU A HB2  1  
ATOM   559   H  HB3  . LEU A 1 36 ? -9.841  12.193  -4.410  1.00 0.00 ? 36 LEU A HB3  1  
ATOM   560   H  HG   . LEU A 1 36 ? -10.020 9.383   -4.661  1.00 0.00 ? 36 LEU A HG   1  
ATOM   561   H  HD11 . LEU A 1 36 ? -11.621 9.112   -3.001  1.00 0.00 ? 36 LEU A HD11 1  
ATOM   562   H  HD12 . LEU A 1 36 ? -12.398 10.653  -3.360  1.00 0.00 ? 36 LEU A HD12 1  
ATOM   563   H  HD13 . LEU A 1 36 ? -12.587 9.291   -4.466  1.00 0.00 ? 36 LEU A HD13 1  
ATOM   564   H  HD21 . LEU A 1 36 ? -10.198 10.585  -6.604  1.00 0.00 ? 36 LEU A HD21 1  
ATOM   565   H  HD22 . LEU A 1 36 ? -11.890 10.184  -6.302  1.00 0.00 ? 36 LEU A HD22 1  
ATOM   566   H  HD23 . LEU A 1 36 ? -11.278 11.786  -5.893  1.00 0.00 ? 36 LEU A HD23 1  
ATOM   567   N  N    . VAL A 1 37 ? -7.216  11.007  -1.258  1.00 0.00 ? 37 VAL A N    1  
ATOM   568   C  CA   . VAL A 1 37 ? -6.895  11.295  0.139   1.00 0.00 ? 37 VAL A CA   1  
ATOM   569   C  C    . VAL A 1 37 ? -8.028  10.842  1.066   1.00 0.00 ? 37 VAL A C    1  
ATOM   570   O  O    . VAL A 1 37 ? -8.309  11.531  2.069   1.00 0.00 ? 37 VAL A O    1  
ATOM   571   C  CB   . VAL A 1 37 ? -6.578  12.793  0.375   1.00 0.00 ? 37 VAL A CB   1  
ATOM   572   C  CG1  . VAL A 1 37 ? -5.612  12.957  1.539   1.00 0.00 ? 37 VAL A CG1  1  
ATOM   573   C  CG2  . VAL A 1 37 ? -6.003  13.440  -0.877  1.00 0.00 ? 37 VAL A CG2  1  
ATOM   574   O  OXT  . VAL A 1 37 ? -8.634  9.787   0.783   1.00 0.00 ? 37 VAL A OXT  1  
ATOM   575   H  H    . VAL A 1 37 ? -6.565  10.508  -1.796  1.00 0.00 ? 37 VAL A H    1  
ATOM   576   H  HA   . VAL A 1 37 ? -6.012  10.725  0.382   1.00 0.00 ? 37 VAL A HA   1  
ATOM   577   H  HB   . VAL A 1 37 ? -7.498  13.300  0.626   1.00 0.00 ? 37 VAL A HB   1  
ATOM   578   H  HG11 . VAL A 1 37 ? -4.686  12.449  1.312   1.00 0.00 ? 37 VAL A HG11 1  
ATOM   579   H  HG12 . VAL A 1 37 ? -5.416  14.007  1.701   1.00 0.00 ? 37 VAL A HG12 1  
ATOM   580   H  HG13 . VAL A 1 37 ? -6.047  12.529  2.432   1.00 0.00 ? 37 VAL A HG13 1  
ATOM   581   H  HG21 . VAL A 1 37 ? -5.018  13.040  -1.069  1.00 0.00 ? 37 VAL A HG21 1  
ATOM   582   H  HG22 . VAL A 1 37 ? -6.647  13.232  -1.718  1.00 0.00 ? 37 VAL A HG22 1  
ATOM   583   H  HG23 . VAL A 1 37 ? -5.934  14.508  -0.733  1.00 0.00 ? 37 VAL A HG23 1  
HETATM 584   ZN ZN   . ZN  B 2 .  ? 0.757   3.548   0.258   1.00 0.00 ? 38 ZN  A ZN   1  
ATOM   585   N  N    . GLY A 1 1  ? 8.384   5.595   -2.596  1.00 0.00 ? 1  GLY A N    2  
ATOM   586   C  CA   . GLY A 1 1  ? 9.147   4.326   -2.588  1.00 0.00 ? 1  GLY A CA   2  
ATOM   587   C  C    . GLY A 1 1  ? 10.631  4.574   -2.465  1.00 0.00 ? 1  GLY A C    2  
ATOM   588   O  O    . GLY A 1 1  ? 11.094  5.693   -2.687  1.00 0.00 ? 1  GLY A O    2  
ATOM   589   H  H1   . GLY A 1 1  ? 7.958   5.759   -1.660  1.00 0.00 ? 1  GLY A H1   2  
ATOM   590   H  H2   . GLY A 1 1  ? 7.630   5.555   -3.313  1.00 0.00 ? 1  GLY A H2   2  
ATOM   591   H  H3   . GLY A 1 1  ? 9.022   6.390   -2.820  1.00 0.00 ? 1  GLY A H3   2  
ATOM   592   H  HA2  . GLY A 1 1  ? 8.822   3.725   -1.753  1.00 0.00 ? 1  GLY A HA2  2  
ATOM   593   H  HA3  . GLY A 1 1  ? 8.953   3.791   -3.506  1.00 0.00 ? 1  GLY A HA3  2  
ATOM   594   N  N    . SER A 1 2  ? 11.367  3.557   -2.050  1.00 0.00 ? 2  SER A N    2  
ATOM   595   C  CA   . SER A 1 2  ? 12.798  3.694   -1.836  1.00 0.00 ? 2  SER A CA   2  
ATOM   596   C  C    . SER A 1 2  ? 13.545  2.422   -2.235  1.00 0.00 ? 2  SER A C    2  
ATOM   597   O  O    . SER A 1 2  ? 14.682  2.489   -2.703  1.00 0.00 ? 2  SER A O    2  
ATOM   598   C  CB   . SER A 1 2  ? 13.076  4.031   -0.369  1.00 0.00 ? 2  SER A CB   2  
ATOM   599   O  OG   . SER A 1 2  ? 11.882  3.987   0.401   1.00 0.00 ? 2  SER A OG   2  
ATOM   600   H  H    . SER A 1 2  ? 10.927  2.698   -1.836  1.00 0.00 ? 2  SER A H    2  
ATOM   601   H  HA   . SER A 1 2  ? 13.147  4.509   -2.453  1.00 0.00 ? 2  SER A HA   2  
ATOM   602   H  HB2  . SER A 1 2  ? 13.776  3.315   0.037   1.00 0.00 ? 2  SER A HB2  2  
ATOM   603   H  HB3  . SER A 1 2  ? 13.496  5.023   -0.302  1.00 0.00 ? 2  SER A HB3  2  
ATOM   604   H  HG   . SER A 1 2  ? 11.762  3.089   0.749   1.00 0.00 ? 2  SER A HG   2  
ATOM   605   N  N    . THR A 1 3  ? 12.915  1.266   -2.035  1.00 0.00 ? 3  THR A N    2  
ATOM   606   C  CA   . THR A 1 3  ? 13.547  -0.012  -2.350  1.00 0.00 ? 3  THR A CA   2  
ATOM   607   C  C    . THR A 1 3  ? 13.615  -0.234  -3.858  1.00 0.00 ? 3  THR A C    2  
ATOM   608   O  O    . THR A 1 3  ? 12.678  -0.763  -4.458  1.00 0.00 ? 3  THR A O    2  
ATOM   609   C  CB   . THR A 1 3  ? 12.799  -1.189  -1.693  1.00 0.00 ? 3  THR A CB   2  
ATOM   610   O  OG1  . THR A 1 3  ? 12.135  -0.746  -0.501  1.00 0.00 ? 3  THR A OG1  2  
ATOM   611   C  CG2  . THR A 1 3  ? 13.762  -2.317  -1.352  1.00 0.00 ? 3  THR A CG2  2  
ATOM   612   H  H    . THR A 1 3  ? 12.008  1.269   -1.648  1.00 0.00 ? 3  THR A H    2  
ATOM   613   H  HA   . THR A 1 3  ? 14.552  0.012   -1.957  1.00 0.00 ? 3  THR A HA   2  
ATOM   614   H  HB   . THR A 1 3  ? 12.062  -1.562  -2.391  1.00 0.00 ? 3  THR A HB   2  
ATOM   615   H  HG1  . THR A 1 3  ? 11.190  -0.602  -0.695  1.00 0.00 ? 3  THR A HG1  2  
ATOM   616   H  HG21 . THR A 1 3  ? 14.504  -2.408  -2.131  1.00 0.00 ? 3  THR A HG21 2  
ATOM   617   H  HG22 . THR A 1 3  ? 13.214  -3.244  -1.269  1.00 0.00 ? 3  THR A HG22 2  
ATOM   618   H  HG23 . THR A 1 3  ? 14.251  -2.104  -0.411  1.00 0.00 ? 3  THR A HG23 2  
ATOM   619   N  N    . ARG A 1 4  ? 14.716  0.217   -4.462  1.00 0.00 ? 4  ARG A N    2  
ATOM   620   C  CA   . ARG A 1 4  ? 14.928  0.123   -5.904  1.00 0.00 ? 4  ARG A CA   2  
ATOM   621   C  C    . ARG A 1 4  ? 13.793  0.809   -6.662  1.00 0.00 ? 4  ARG A C    2  
ATOM   622   O  O    . ARG A 1 4  ? 13.674  2.032   -6.624  1.00 0.00 ? 4  ARG A O    2  
ATOM   623   C  CB   . ARG A 1 4  ? 15.070  -1.338  -6.335  1.00 0.00 ? 4  ARG A CB   2  
ATOM   624   C  CG   . ARG A 1 4  ? 16.502  -1.840  -6.306  1.00 0.00 ? 4  ARG A CG   2  
ATOM   625   C  CD   . ARG A 1 4  ? 16.895  -2.477  -7.625  1.00 0.00 ? 4  ARG A CD   2  
ATOM   626   N  NE   . ARG A 1 4  ? 16.364  -3.832  -7.760  1.00 0.00 ? 4  ARG A NE   2  
ATOM   627   C  CZ   . ARG A 1 4  ? 15.627  -4.247  -8.790  1.00 0.00 ? 4  ARG A CZ   2  
ATOM   628   N  NH1  . ARG A 1 4  ? 15.334  -3.414  -9.782  1.00 0.00 ? 4  ARG A NH1  2  
ATOM   629   N  NH2  . ARG A 1 4  ? 15.184  -5.496  -8.829  1.00 0.00 ? 4  ARG A NH2  2  
ATOM   630   H  H    . ARG A 1 4  ? 15.397  0.662   -3.916  1.00 0.00 ? 4  ARG A H    2  
ATOM   631   H  HA   . ARG A 1 4  ? 15.848  0.640   -6.129  1.00 0.00 ? 4  ARG A HA   2  
ATOM   632   H  HB2  . ARG A 1 4  ? 14.481  -1.956  -5.674  1.00 0.00 ? 4  ARG A HB2  2  
ATOM   633   H  HB3  . ARG A 1 4  ? 14.694  -1.444  -7.344  1.00 0.00 ? 4  ARG A HB3  2  
ATOM   634   H  HG2  . ARG A 1 4  ? 17.160  -1.006  -6.112  1.00 0.00 ? 4  ARG A HG2  2  
ATOM   635   H  HG3  . ARG A 1 4  ? 16.601  -2.572  -5.518  1.00 0.00 ? 4  ARG A HG3  2  
ATOM   636   H  HD2  . ARG A 1 4  ? 16.513  -1.869  -8.431  1.00 0.00 ? 4  ARG A HD2  2  
ATOM   637   H  HD3  . ARG A 1 4  ? 17.972  -2.516  -7.683  1.00 0.00 ? 4  ARG A HD3  2  
ATOM   638   H  HE   . ARG A 1 4  ? 16.577  -4.473  -7.038  1.00 0.00 ? 4  ARG A HE   2  
ATOM   639   H  HH11 . ARG A 1 4  ? 15.663  -2.461  -9.762  1.00 0.00 ? 4  ARG A HH11 2  
ATOM   640   H  HH12 . ARG A 1 4  ? 14.793  -3.734  -10.571 1.00 0.00 ? 4  ARG A HH12 2  
ATOM   641   H  HH21 . ARG A 1 4  ? 15.403  -6.135  -8.083  1.00 0.00 ? 4  ARG A HH21 2  
ATOM   642   H  HH22 . ARG A 1 4  ? 14.618  -5.813  -9.604  1.00 0.00 ? 4  ARG A HH22 2  
ATOM   643   N  N    . GLY A 1 5  ? 12.904  0.021   -7.250  1.00 0.00 ? 5  GLY A N    2  
ATOM   644   C  CA   . GLY A 1 5  ? 11.746  0.578   -7.920  1.00 0.00 ? 5  GLY A CA   2  
ATOM   645   C  C    . GLY A 1 5  ? 10.498  0.484   -7.066  1.00 0.00 ? 5  GLY A C    2  
ATOM   646   O  O    . GLY A 1 5  ? 9.418   0.166   -7.567  1.00 0.00 ? 5  GLY A O    2  
ATOM   647   H  H    . GLY A 1 5  ? 13.000  -0.955  -7.175  1.00 0.00 ? 5  GLY A H    2  
ATOM   648   H  HA2  . GLY A 1 5  ? 11.939  1.616   -8.149  1.00 0.00 ? 5  GLY A HA2  2  
ATOM   649   H  HA3  . GLY A 1 5  ? 11.580  0.041   -8.843  1.00 0.00 ? 5  GLY A HA3  2  
ATOM   650   N  N    . SER A 1 6  ? 10.662  0.755   -5.772  1.00 0.00 ? 6  SER A N    2  
ATOM   651   C  CA   . SER A 1 6  ? 9.581   0.697   -4.803  1.00 0.00 ? 6  SER A CA   2  
ATOM   652   C  C    . SER A 1 6  ? 8.995   -0.711  -4.698  1.00 0.00 ? 6  SER A C    2  
ATOM   653   O  O    . SER A 1 6  ? 7.784   -0.886  -4.534  1.00 0.00 ? 6  SER A O    2  
ATOM   654   C  CB   . SER A 1 6  ? 8.507   1.712   -5.162  1.00 0.00 ? 6  SER A CB   2  
ATOM   655   O  OG   . SER A 1 6  ? 9.061   3.009   -5.305  1.00 0.00 ? 6  SER A OG   2  
ATOM   656   H  H    . SER A 1 6  ? 11.542  1.005   -5.456  1.00 0.00 ? 6  SER A H    2  
ATOM   657   H  HA   . SER A 1 6  ? 9.996   0.961   -3.841  1.00 0.00 ? 6  SER A HA   2  
ATOM   658   H  HB2  . SER A 1 6  ? 8.047   1.428   -6.093  1.00 0.00 ? 6  SER A HB2  2  
ATOM   659   H  HB3  . SER A 1 6  ? 7.772   1.733   -4.383  1.00 0.00 ? 6  SER A HB3  2  
ATOM   660   H  HG   . SER A 1 6  ? 9.655   3.025   -6.069  1.00 0.00 ? 6  SER A HG   2  
ATOM   661   N  N    . THR A 1 7  ? 9.858   -1.707  -4.836  1.00 0.00 ? 7  THR A N    2  
ATOM   662   C  CA   . THR A 1 7  ? 9.461   -3.098  -4.744  1.00 0.00 ? 7  THR A CA   2  
ATOM   663   C  C    . THR A 1 7  ? 10.469  -3.892  -3.925  1.00 0.00 ? 7  THR A C    2  
ATOM   664   O  O    . THR A 1 7  ? 11.520  -4.292  -4.431  1.00 0.00 ? 7  THR A O    2  
ATOM   665   C  CB   . THR A 1 7  ? 9.309   -3.716  -6.142  1.00 0.00 ? 7  THR A CB   2  
ATOM   666   O  OG1  . THR A 1 7  ? 10.047  -2.942  -7.104  1.00 0.00 ? 7  THR A OG1  2  
ATOM   667   C  CG2  . THR A 1 7  ? 7.851   -3.751  -6.546  1.00 0.00 ? 7  THR A CG2  2  
ATOM   668   H  H    . THR A 1 7  ? 10.794  -1.500  -5.022  1.00 0.00 ? 7  THR A H    2  
ATOM   669   H  HA   . THR A 1 7  ? 8.502   -3.140  -4.241  1.00 0.00 ? 7  THR A HA   2  
ATOM   670   H  HB   . THR A 1 7  ? 9.692   -4.727  -6.124  1.00 0.00 ? 7  THR A HB   2  
ATOM   671   H  HG1  . THR A 1 7  ? 9.655   -3.059  -7.981  1.00 0.00 ? 7  THR A HG1  2  
ATOM   672   H  HG21 . THR A 1 7  ? 7.550   -2.765  -6.864  1.00 0.00 ? 7  THR A HG21 2  
ATOM   673   H  HG22 . THR A 1 7  ? 7.251   -4.055  -5.700  1.00 0.00 ? 7  THR A HG22 2  
ATOM   674   H  HG23 . THR A 1 7  ? 7.717   -4.450  -7.355  1.00 0.00 ? 7  THR A HG23 2  
ATOM   675   N  N    . GLY A 1 8  ? 10.179  -4.056  -2.646  1.00 0.00 ? 8  GLY A N    2  
ATOM   676   C  CA   . GLY A 1 8  ? 11.085  -4.750  -1.766  1.00 0.00 ? 8  GLY A CA   2  
ATOM   677   C  C    . GLY A 1 8  ? 10.460  -5.969  -1.121  1.00 0.00 ? 8  GLY A C    2  
ATOM   678   O  O    . GLY A 1 8  ? 10.540  -7.075  -1.660  1.00 0.00 ? 8  GLY A O    2  
ATOM   679   H  H    . GLY A 1 8  ? 9.343   -3.678  -2.286  1.00 0.00 ? 8  GLY A H    2  
ATOM   680   H  HA2  . GLY A 1 8  ? 11.947  -5.062  -2.335  1.00 0.00 ? 8  GLY A HA2  2  
ATOM   681   H  HA3  . GLY A 1 8  ? 11.407  -4.071  -0.990  1.00 0.00 ? 8  GLY A HA3  2  
ATOM   682   N  N    . ILE A 1 9  ? 9.892   -5.779  0.062   1.00 0.00 ? 9  ILE A N    2  
ATOM   683   C  CA   . ILE A 1 9  ? 9.321   -6.893  0.819   1.00 0.00 ? 9  ILE A CA   2  
ATOM   684   C  C    . ILE A 1 9  ? 7.934   -7.281  0.299   1.00 0.00 ? 9  ILE A C    2  
ATOM   685   O  O    . ILE A 1 9  ? 7.198   -6.418  -0.178  1.00 0.00 ? 9  ILE A O    2  
ATOM   686   C  CB   . ILE A 1 9  ? 9.227   -6.536  2.321   1.00 0.00 ? 9  ILE A CB   2  
ATOM   687   C  CG1  . ILE A 1 9  ? 10.442  -5.708  2.751   1.00 0.00 ? 9  ILE A CG1  2  
ATOM   688   C  CG2  . ILE A 1 9  ? 9.120   -7.797  3.171   1.00 0.00 ? 9  ILE A CG2  2  
ATOM   689   C  CD1  . ILE A 1 9  ? 10.349  -5.188  4.169   1.00 0.00 ? 9  ILE A CD1  2  
ATOM   690   H  H    . ILE A 1 9  ? 9.834   -4.863  0.425   1.00 0.00 ? 9  ILE A H    2  
ATOM   691   H  HA   . ILE A 1 9  ? 9.983   -7.741  0.714   1.00 0.00 ? 9  ILE A HA   2  
ATOM   692   H  HB   . ILE A 1 9  ? 8.335   -5.951  2.471   1.00 0.00 ? 9  ILE A HB   2  
ATOM   693   H  HG12 . ILE A 1 9  ? 11.329  -6.317  2.679   1.00 0.00 ? 9  ILE A HG12 2  
ATOM   694   H  HG13 . ILE A 1 9  ? 10.539  -4.858  2.092   1.00 0.00 ? 9  ILE A HG13 2  
ATOM   695   H  HG21 . ILE A 1 9  ? 10.104  -8.214  3.326   1.00 0.00 ? 9  ILE A HG21 2  
ATOM   696   H  HG22 . ILE A 1 9  ? 8.679   -7.550  4.125   1.00 0.00 ? 9  ILE A HG22 2  
ATOM   697   H  HG23 . ILE A 1 9  ? 8.498   -8.521  2.664   1.00 0.00 ? 9  ILE A HG23 2  
ATOM   698   H  HD11 . ILE A 1 9  ? 9.416   -4.661  4.298   1.00 0.00 ? 9  ILE A HD11 2  
ATOM   699   H  HD12 . ILE A 1 9  ? 10.394  -6.015  4.861   1.00 0.00 ? 9  ILE A HD12 2  
ATOM   700   H  HD13 . ILE A 1 9  ? 11.172  -4.514  4.360   1.00 0.00 ? 9  ILE A HD13 2  
ATOM   701   N  N    . LYS A 1 10 ? 7.516   -8.520  0.613   1.00 0.00 ? 10 LYS A N    2  
ATOM   702   C  CA   . LYS A 1 10 ? 6.155   -9.020  0.346   1.00 0.00 ? 10 LYS A CA   2  
ATOM   703   C  C    . LYS A 1 10 ? 5.744   -8.899  -1.132  1.00 0.00 ? 10 LYS A C    2  
ATOM   704   O  O    . LYS A 1 10 ? 6.243   -8.056  -1.873  1.00 0.00 ? 10 LYS A O    2  
ATOM   705   C  CB   . LYS A 1 10 ? 5.142   -8.323  1.258   1.00 0.00 ? 10 LYS A CB   2  
ATOM   706   C  CG   . LYS A 1 10 ? 4.819   -9.123  2.513   1.00 0.00 ? 10 LYS A CG   2  
ATOM   707   C  CD   . LYS A 1 10 ? 5.063   -8.316  3.779   1.00 0.00 ? 10 LYS A CD   2  
ATOM   708   C  CE   . LYS A 1 10 ? 5.120   -9.206  5.010   1.00 0.00 ? 10 LYS A CE   2  
ATOM   709   N  NZ   . LYS A 1 10 ? 4.393   -8.613  6.167   1.00 0.00 ? 10 LYS A NZ   2  
ATOM   710   H  H    . LYS A 1 10 ? 8.120   -9.091  1.136   1.00 0.00 ? 10 LYS A H    2  
ATOM   711   H  HA   . LYS A 1 10 ? 6.152   -10.071 0.598   1.00 0.00 ? 10 LYS A HA   2  
ATOM   712   H  HB2  . LYS A 1 10 ? 5.541   -7.365  1.558   1.00 0.00 ? 10 LYS A HB2  2  
ATOM   713   H  HB3  . LYS A 1 10 ? 4.225   -8.169  0.710   1.00 0.00 ? 10 LYS A HB3  2  
ATOM   714   H  HG2  . LYS A 1 10 ? 3.781   -9.418  2.482   1.00 0.00 ? 10 LYS A HG2  2  
ATOM   715   H  HG3  . LYS A 1 10 ? 5.443   -10.004 2.535   1.00 0.00 ? 10 LYS A HG3  2  
ATOM   716   H  HD2  . LYS A 1 10 ? 6.001   -7.790  3.683   1.00 0.00 ? 10 LYS A HD2  2  
ATOM   717   H  HD3  . LYS A 1 10 ? 4.260   -7.604  3.899   1.00 0.00 ? 10 LYS A HD3  2  
ATOM   718   H  HE2  . LYS A 1 10 ? 4.677   -10.160 4.769   1.00 0.00 ? 10 LYS A HE2  2  
ATOM   719   H  HE3  . LYS A 1 10 ? 6.155   -9.351  5.284   1.00 0.00 ? 10 LYS A HE3  2  
ATOM   720   H  HZ1  . LYS A 1 10 ? 4.644   -9.116  7.047   1.00 0.00 ? 10 LYS A HZ1  2  
ATOM   721   H  HZ2  . LYS A 1 10 ? 3.364   -8.686  6.020   1.00 0.00 ? 10 LYS A HZ2  2  
ATOM   722   H  HZ3  . LYS A 1 10 ? 4.642   -7.606  6.275   1.00 0.00 ? 10 LYS A HZ3  2  
ATOM   723   N  N    . PRO A 1 11 ? 4.924   -9.838  -1.624  1.00 0.00 ? 11 PRO A N    2  
ATOM   724   C  CA   . PRO A 1 11 ? 4.532   -9.872  -3.037  1.00 0.00 ? 11 PRO A CA   2  
ATOM   725   C  C    . PRO A 1 11 ? 3.535   -8.768  -3.392  1.00 0.00 ? 11 PRO A C    2  
ATOM   726   O  O    . PRO A 1 11 ? 3.362   -8.423  -4.561  1.00 0.00 ? 11 PRO A O    2  
ATOM   727   C  CB   . PRO A 1 11 ? 3.885   -11.249 -3.196  1.00 0.00 ? 11 PRO A CB   2  
ATOM   728   C  CG   . PRO A 1 11 ? 3.398   -11.594 -1.830  1.00 0.00 ? 11 PRO A CG   2  
ATOM   729   C  CD   . PRO A 1 11 ? 4.389   -10.989 -0.875  1.00 0.00 ? 11 PRO A CD   2  
ATOM   730   H  HA   . PRO A 1 11 ? 5.390   -9.801  -3.685  1.00 0.00 ? 11 PRO A HA   2  
ATOM   731   H  HB2  . PRO A 1 11 ? 3.073   -11.189 -3.904  1.00 0.00 ? 11 PRO A HB2  2  
ATOM   732   H  HB3  . PRO A 1 11 ? 4.621   -11.959 -3.540  1.00 0.00 ? 11 PRO A HB3  2  
ATOM   733   H  HG2  . PRO A 1 11 ? 2.419   -11.168 -1.674  1.00 0.00 ? 11 PRO A HG2  2  
ATOM   734   H  HG3  . PRO A 1 11 ? 3.367   -12.667 -1.710  1.00 0.00 ? 11 PRO A HG3  2  
ATOM   735   H  HD2  . PRO A 1 11 ? 3.893   -10.664 0.028   1.00 0.00 ? 11 PRO A HD2  2  
ATOM   736   H  HD3  . PRO A 1 11 ? 5.171   -11.697 -0.643  1.00 0.00 ? 11 PRO A HD3  2  
ATOM   737   N  N    . PHE A 1 12 ? 2.863   -8.237  -2.380  1.00 0.00 ? 12 PHE A N    2  
ATOM   738   C  CA   . PHE A 1 12 ? 1.860   -7.204  -2.583  1.00 0.00 ? 12 PHE A CA   2  
ATOM   739   C  C    . PHE A 1 12 ? 2.156   -5.999  -1.712  1.00 0.00 ? 12 PHE A C    2  
ATOM   740   O  O    . PHE A 1 12 ? 1.628   -5.875  -0.614  1.00 0.00 ? 12 PHE A O    2  
ATOM   741   C  CB   . PHE A 1 12 ? 0.471   -7.740  -2.246  1.00 0.00 ? 12 PHE A CB   2  
ATOM   742   C  CG   . PHE A 1 12 ? 0.110   -8.994  -2.986  1.00 0.00 ? 12 PHE A CG   2  
ATOM   743   C  CD1  . PHE A 1 12 ? 0.014   -8.998  -4.367  1.00 0.00 ? 12 PHE A CD1  2  
ATOM   744   C  CD2  . PHE A 1 12 ? -0.133  -10.168 -2.297  1.00 0.00 ? 12 PHE A CD2  2  
ATOM   745   C  CE1  . PHE A 1 12 ? -0.318  -10.153 -5.047  1.00 0.00 ? 12 PHE A CE1  2  
ATOM   746   C  CE2  . PHE A 1 12 ? -0.464  -11.326 -2.971  1.00 0.00 ? 12 PHE A CE2  2  
ATOM   747   C  CZ   . PHE A 1 12 ? -0.557  -11.319 -4.348  1.00 0.00 ? 12 PHE A CZ   2  
ATOM   748   H  H    . PHE A 1 12 ? 3.033   -8.562  -1.471  1.00 0.00 ? 12 PHE A H    2  
ATOM   749   H  HA   . PHE A 1 12 ? 1.883   -6.908  -3.620  1.00 0.00 ? 12 PHE A HA   2  
ATOM   750   H  HB2  . PHE A 1 12 ? 0.430   -7.951  -1.187  1.00 0.00 ? 12 PHE A HB2  2  
ATOM   751   H  HB3  . PHE A 1 12 ? -0.266  -6.988  -2.485  1.00 0.00 ? 12 PHE A HB3  2  
ATOM   752   H  HD1  . PHE A 1 12 ? 0.201   -8.085  -4.915  1.00 0.00 ? 12 PHE A HD1  2  
ATOM   753   H  HD2  . PHE A 1 12 ? -0.060  -10.174 -1.220  1.00 0.00 ? 12 PHE A HD2  2  
ATOM   754   H  HE1  . PHE A 1 12 ? -0.391  -10.144 -6.125  1.00 0.00 ? 12 PHE A HE1  2  
ATOM   755   H  HE2  . PHE A 1 12 ? -0.654  -12.233 -2.420  1.00 0.00 ? 12 PHE A HE2  2  
ATOM   756   H  HZ   . PHE A 1 12 ? -0.816  -12.224 -4.876  1.00 0.00 ? 12 PHE A HZ   2  
ATOM   757   N  N    . GLN A 1 13 ? 3.038   -5.140  -2.171  1.00 0.00 ? 13 GLN A N    2  
ATOM   758   C  CA   . GLN A 1 13 ? 3.427   -3.979  -1.396  1.00 0.00 ? 13 GLN A CA   2  
ATOM   759   C  C    . GLN A 1 13 ? 2.953   -2.699  -2.073  1.00 0.00 ? 13 GLN A C    2  
ATOM   760   O  O    . GLN A 1 13 ? 2.697   -2.691  -3.277  1.00 0.00 ? 13 GLN A O    2  
ATOM   761   C  CB   . GLN A 1 13 ? 4.938   -3.972  -1.239  1.00 0.00 ? 13 GLN A CB   2  
ATOM   762   C  CG   . GLN A 1 13 ? 5.660   -3.110  -2.253  1.00 0.00 ? 13 GLN A CG   2  
ATOM   763   C  CD   . GLN A 1 13 ? 7.052   -2.758  -1.801  1.00 0.00 ? 13 GLN A CD   2  
ATOM   764   O  OE1  . GLN A 1 13 ? 7.849   -3.632  -1.484  1.00 0.00 ? 13 GLN A OE1  2  
ATOM   765   N  NE2  . GLN A 1 13 ? 7.351   -1.476  -1.770  1.00 0.00 ? 13 GLN A NE2  2  
ATOM   766   H  H    . GLN A 1 13 ? 3.471   -5.309  -3.031  1.00 0.00 ? 13 GLN A H    2  
ATOM   767   H  HA   . GLN A 1 13 ? 2.968   -4.055  -0.422  1.00 0.00 ? 13 GLN A HA   2  
ATOM   768   H  HB2  . GLN A 1 13 ? 5.185   -3.613  -0.250  1.00 0.00 ? 13 GLN A HB2  2  
ATOM   769   H  HB3  . GLN A 1 13 ? 5.296   -4.985  -1.344  1.00 0.00 ? 13 GLN A HB3  2  
ATOM   770   H  HG2  . GLN A 1 13 ? 5.718   -3.642  -3.185  1.00 0.00 ? 13 GLN A HG2  2  
ATOM   771   H  HG3  . GLN A 1 13 ? 5.100   -2.197  -2.394  1.00 0.00 ? 13 GLN A HG3  2  
ATOM   772   H  HE21 . GLN A 1 13 ? 6.663   -0.833  -2.044  1.00 0.00 ? 13 GLN A HE21 2  
ATOM   773   H  HE22 . GLN A 1 13 ? 8.251   -1.214  -1.456  1.00 0.00 ? 13 GLN A HE22 2  
ATOM   774   N  N    . CYS A 1 14 ? 2.919   -1.602  -1.324  1.00 0.00 ? 14 CYS A N    2  
ATOM   775   C  CA   . CYS A 1 14 ? 2.561   -0.318  -1.900  1.00 0.00 ? 14 CYS A CA   2  
ATOM   776   C  C    . CYS A 1 14 ? 3.714   0.236   -2.725  1.00 0.00 ? 14 CYS A C    2  
ATOM   777   O  O    . CYS A 1 14 ? 4.816   0.440   -2.208  1.00 0.00 ? 14 CYS A O    2  
ATOM   778   C  CB   . CYS A 1 14 ? 2.166   0.711   -0.838  1.00 0.00 ? 14 CYS A CB   2  
ATOM   779   S  SG   . CYS A 1 14 ? 1.751   2.328   -1.574  1.00 0.00 ? 14 CYS A SG   2  
ATOM   780   H  H    . CYS A 1 14 ? 3.224   -1.646  -0.403  1.00 0.00 ? 14 CYS A H    2  
ATOM   781   H  HA   . CYS A 1 14 ? 1.717   -0.480  -2.551  1.00 0.00 ? 14 CYS A HA   2  
ATOM   782   H  HB2  . CYS A 1 14 ? 1.306   0.353   -0.294  1.00 0.00 ? 14 CYS A HB2  2  
ATOM   783   H  HB3  . CYS A 1 14 ? 2.990   0.857   -0.155  1.00 0.00 ? 14 CYS A HB3  2  
ATOM   784   N  N    . PRO A 1 15 ? 3.467   0.521   -4.006  1.00 0.00 ? 15 PRO A N    2  
ATOM   785   C  CA   . PRO A 1 15 ? 4.474   1.094   -4.896  1.00 0.00 ? 15 PRO A CA   2  
ATOM   786   C  C    . PRO A 1 15 ? 4.654   2.599   -4.686  1.00 0.00 ? 15 PRO A C    2  
ATOM   787   O  O    . PRO A 1 15 ? 5.502   3.227   -5.321  1.00 0.00 ? 15 PRO A O    2  
ATOM   788   C  CB   . PRO A 1 15 ? 3.909   0.804   -6.284  1.00 0.00 ? 15 PRO A CB   2  
ATOM   789   C  CG   . PRO A 1 15 ? 2.430   0.780   -6.095  1.00 0.00 ? 15 PRO A CG   2  
ATOM   790   C  CD   . PRO A 1 15 ? 2.185   0.282   -4.696  1.00 0.00 ? 15 PRO A CD   2  
ATOM   791   H  HA   . PRO A 1 15 ? 5.428   0.601   -4.782  1.00 0.00 ? 15 PRO A HA   2  
ATOM   792   H  HB2  . PRO A 1 15 ? 4.208   1.585   -6.969  1.00 0.00 ? 15 PRO A HB2  2  
ATOM   793   H  HB3  . PRO A 1 15 ? 4.277   -0.149  -6.633  1.00 0.00 ? 15 PRO A HB3  2  
ATOM   794   H  HG2  . PRO A 1 15 ? 2.029   1.776   -6.210  1.00 0.00 ? 15 PRO A HG2  2  
ATOM   795   H  HG3  . PRO A 1 15 ? 1.980   0.109   -6.811  1.00 0.00 ? 15 PRO A HG3  2  
ATOM   796   H  HD2  . PRO A 1 15 ? 1.388   0.842   -4.229  1.00 0.00 ? 15 PRO A HD2  2  
ATOM   797   H  HD3  . PRO A 1 15 ? 1.946   -0.770  -4.709  1.00 0.00 ? 15 PRO A HD3  2  
ATOM   798   N  N    . ASP A 1 16 ? 3.875   3.177   -3.778  1.00 0.00 ? 16 ASP A N    2  
ATOM   799   C  CA   . ASP A 1 16 ? 3.983   4.606   -3.494  1.00 0.00 ? 16 ASP A CA   2  
ATOM   800   C  C    . ASP A 1 16 ? 4.707   4.841   -2.177  1.00 0.00 ? 16 ASP A C    2  
ATOM   801   O  O    . ASP A 1 16 ? 5.523   5.757   -2.051  1.00 0.00 ? 16 ASP A O    2  
ATOM   802   C  CB   . ASP A 1 16 ? 2.594   5.253   -3.444  1.00 0.00 ? 16 ASP A CB   2  
ATOM   803   C  CG   . ASP A 1 16 ? 2.657   6.768   -3.379  1.00 0.00 ? 16 ASP A CG   2  
ATOM   804   O  OD1  . ASP A 1 16 ? 2.831   7.320   -2.272  1.00 0.00 ? 16 ASP A OD1  2  
ATOM   805   O  OD2  . ASP A 1 16 ? 2.524   7.417   -4.435  1.00 0.00 ? 16 ASP A OD2  2  
ATOM   806   H  H    . ASP A 1 16 ? 3.223   2.629   -3.276  1.00 0.00 ? 16 ASP A H    2  
ATOM   807   H  HA   . ASP A 1 16 ? 4.554   5.058   -4.290  1.00 0.00 ? 16 ASP A HA   2  
ATOM   808   H  HB2  . ASP A 1 16 ? 2.041   4.973   -4.328  1.00 0.00 ? 16 ASP A HB2  2  
ATOM   809   H  HB3  . ASP A 1 16 ? 2.073   4.896   -2.569  1.00 0.00 ? 16 ASP A HB3  2  
ATOM   810   N  N    . CYS A 1 17 ? 4.365   4.039   -1.184  1.00 0.00 ? 17 CYS A N    2  
ATOM   811   C  CA   . CYS A 1 17 ? 4.916   4.205   0.149   1.00 0.00 ? 17 CYS A CA   2  
ATOM   812   C  C    . CYS A 1 17 ? 6.105   3.289   0.396   1.00 0.00 ? 17 CYS A C    2  
ATOM   813   O  O    . CYS A 1 17 ? 6.930   3.577   1.266   1.00 0.00 ? 17 CYS A O    2  
ATOM   814   C  CB   . CYS A 1 17 ? 3.849   3.943   1.202   1.00 0.00 ? 17 CYS A CB   2  
ATOM   815   S  SG   . CYS A 1 17 ? 2.372   4.983   1.030   1.00 0.00 ? 17 CYS A SG   2  
ATOM   816   H  H    . CYS A 1 17 ? 3.683   3.349   -1.342  1.00 0.00 ? 17 CYS A H    2  
ATOM   817   H  HA   . CYS A 1 17 ? 5.244   5.225   0.235   1.00 0.00 ? 17 CYS A HA   2  
ATOM   818   H  HB2  . CYS A 1 17 ? 3.538   2.911   1.135   1.00 0.00 ? 17 CYS A HB2  2  
ATOM   819   H  HB3  . CYS A 1 17 ? 4.269   4.127   2.180   1.00 0.00 ? 17 CYS A HB3  2  
ATOM   820   N  N    . ASP A 1 18 ? 6.065   2.115   -0.233  1.00 0.00 ? 18 ASP A N    2  
ATOM   821   C  CA   . ASP A 1 18 ? 7.028   1.039   0.016   1.00 0.00 ? 18 ASP A CA   2  
ATOM   822   C  C    . ASP A 1 18 ? 6.628   0.275   1.268   1.00 0.00 ? 18 ASP A C    2  
ATOM   823   O  O    . ASP A 1 18 ? 7.468   -0.136  2.071   1.00 0.00 ? 18 ASP A O    2  
ATOM   824   C  CB   . ASP A 1 18 ? 8.469   1.552   0.129   1.00 0.00 ? 18 ASP A CB   2  
ATOM   825   C  CG   . ASP A 1 18 ? 9.448   0.709   -0.664  1.00 0.00 ? 18 ASP A CG   2  
ATOM   826   O  OD1  . ASP A 1 18 ? 9.498   -0.520  -0.450  1.00 0.00 ? 18 ASP A OD1  2  
ATOM   827   O  OD2  . ASP A 1 18 ? 10.175  1.272   -1.506  1.00 0.00 ? 18 ASP A OD2  2  
ATOM   828   H  H    . ASP A 1 18 ? 5.302   1.928   -0.820  1.00 0.00 ? 18 ASP A H    2  
ATOM   829   H  HA   . ASP A 1 18 ? 6.971   0.354   -0.822  1.00 0.00 ? 18 ASP A HA   2  
ATOM   830   H  HB2  . ASP A 1 18 ? 8.513   2.564   -0.243  1.00 0.00 ? 18 ASP A HB2  2  
ATOM   831   H  HB3  . ASP A 1 18 ? 8.770   1.539   1.166   1.00 0.00 ? 18 ASP A HB3  2  
ATOM   832   N  N    . ARG A 1 19 ? 5.333   0.003   1.363   1.00 0.00 ? 19 ARG A N    2  
ATOM   833   C  CA   . ARG A 1 19 ? 4.800   -0.845  2.420   1.00 0.00 ? 19 ARG A CA   2  
ATOM   834   C  C    . ARG A 1 19 ? 5.009   -2.299  2.029   1.00 0.00 ? 19 ARG A C    2  
ATOM   835   O  O    . ARG A 1 19 ? 5.834   -2.585  1.167   1.00 0.00 ? 19 ARG A O    2  
ATOM   836   C  CB   . ARG A 1 19 ? 3.308   -0.575  2.639   1.00 0.00 ? 19 ARG A CB   2  
ATOM   837   C  CG   . ARG A 1 19 ? 2.935   0.895   2.580   1.00 0.00 ? 19 ARG A CG   2  
ATOM   838   C  CD   . ARG A 1 19 ? 2.293   1.358   3.874   1.00 0.00 ? 19 ARG A CD   2  
ATOM   839   N  NE   . ARG A 1 19 ? 0.908   0.901   4.003   1.00 0.00 ? 19 ARG A NE   2  
ATOM   840   C  CZ   . ARG A 1 19 ? 0.379   0.471   5.155   1.00 0.00 ? 19 ARG A CZ   2  
ATOM   841   N  NH1  . ARG A 1 19 ? 1.145   0.337   6.231   1.00 0.00 ? 19 ARG A NH1  2  
ATOM   842   N  NH2  . ARG A 1 19 ? -0.909  0.151   5.223   1.00 0.00 ? 19 ARG A NH2  2  
ATOM   843   H  H    . ARG A 1 19 ? 4.739   0.289   0.641   1.00 0.00 ? 19 ARG A H    2  
ATOM   844   H  HA   . ARG A 1 19 ? 5.342   -0.638  3.330   1.00 0.00 ? 19 ARG A HA   2  
ATOM   845   H  HB2  . ARG A 1 19 ? 2.747   -1.097  1.880   1.00 0.00 ? 19 ARG A HB2  2  
ATOM   846   H  HB3  . ARG A 1 19 ? 3.027   -0.957  3.609   1.00 0.00 ? 19 ARG A HB3  2  
ATOM   847   H  HG2  . ARG A 1 19 ? 3.828   1.475   2.406   1.00 0.00 ? 19 ARG A HG2  2  
ATOM   848   H  HG3  . ARG A 1 19 ? 2.239   1.047   1.767   1.00 0.00 ? 19 ARG A HG3  2  
ATOM   849   H  HD2  . ARG A 1 19 ? 2.867   0.972   4.703   1.00 0.00 ? 19 ARG A HD2  2  
ATOM   850   H  HD3  . ARG A 1 19 ? 2.308   2.438   3.899   1.00 0.00 ? 19 ARG A HD3  2  
ATOM   851   H  HE   . ARG A 1 19 ? 0.339   0.942   3.195   1.00 0.00 ? 19 ARG A HE   2  
ATOM   852   H  HH11 . ARG A 1 19 ? 2.130   0.546   6.184   1.00 0.00 ? 19 ARG A HH11 2  
ATOM   853   H  HH12 . ARG A 1 19 ? 0.742   0.041   7.107   1.00 0.00 ? 19 ARG A HH12 2  
ATOM   854   H  HH21 . ARG A 1 19 ? -1.493  0.234   4.416   1.00 0.00 ? 19 ARG A HH21 2  
ATOM   855   H  HH22 . ARG A 1 19 ? -1.303  -0.190  6.088   1.00 0.00 ? 19 ARG A HH22 2  
ATOM   856   N  N    . SER A 1 20 ? 4.236   -3.210  2.605   1.00 0.00 ? 20 SER A N    2  
ATOM   857   C  CA   . SER A 1 20 ? 4.330   -4.616  2.229   1.00 0.00 ? 20 SER A CA   2  
ATOM   858   C  C    . SER A 1 20 ? 3.194   -5.437  2.834   1.00 0.00 ? 20 SER A C    2  
ATOM   859   O  O    . SER A 1 20 ? 2.972   -5.415  4.043   1.00 0.00 ? 20 SER A O    2  
ATOM   860   C  CB   . SER A 1 20 ? 5.682   -5.201  2.654   1.00 0.00 ? 20 SER A CB   2  
ATOM   861   O  OG   . SER A 1 20 ? 6.327   -4.393  3.634   1.00 0.00 ? 20 SER A OG   2  
ATOM   862   H  H    . SER A 1 20 ? 3.568   -2.931  3.274   1.00 0.00 ? 20 SER A H    2  
ATOM   863   H  HA   . SER A 1 20 ? 4.250   -4.669  1.153   1.00 0.00 ? 20 SER A HA   2  
ATOM   864   H  HB2  . SER A 1 20 ? 5.521   -6.186  3.064   1.00 0.00 ? 20 SER A HB2  2  
ATOM   865   H  HB3  . SER A 1 20 ? 6.325   -5.276  1.788   1.00 0.00 ? 20 SER A HB3  2  
ATOM   866   H  HG   . SER A 1 20 ? 6.985   -3.823  3.199   1.00 0.00 ? 20 SER A HG   2  
ATOM   867   N  N    . PHE A 1 21 ? 2.470   -6.150  1.984   1.00 0.00 ? 21 PHE A N    2  
ATOM   868   C  CA   . PHE A 1 21 ? 1.357   -6.976  2.421   1.00 0.00 ? 21 PHE A CA   2  
ATOM   869   C  C    . PHE A 1 21 ? 1.448   -8.349  1.769   1.00 0.00 ? 21 PHE A C    2  
ATOM   870   O  O    . PHE A 1 21 ? 2.028   -8.494  0.688   1.00 0.00 ? 21 PHE A O    2  
ATOM   871   C  CB   . PHE A 1 21 ? 0.014   -6.323  2.062   1.00 0.00 ? 21 PHE A CB   2  
ATOM   872   C  CG   . PHE A 1 21 ? -0.059  -4.849  2.358   1.00 0.00 ? 21 PHE A CG   2  
ATOM   873   C  CD1  . PHE A 1 21 ? 0.474   -3.921  1.475   1.00 0.00 ? 21 PHE A CD1  2  
ATOM   874   C  CD2  . PHE A 1 21 ? -0.663  -4.394  3.518   1.00 0.00 ? 21 PHE A CD2  2  
ATOM   875   C  CE1  . PHE A 1 21 ? 0.405   -2.570  1.745   1.00 0.00 ? 21 PHE A CE1  2  
ATOM   876   C  CE2  . PHE A 1 21 ? -0.734  -3.043  3.791   1.00 0.00 ? 21 PHE A CE2  2  
ATOM   877   C  CZ   . PHE A 1 21 ? -0.198  -2.131  2.904   1.00 0.00 ? 21 PHE A CZ   2  
ATOM   878   H  H    . PHE A 1 21 ? 2.685   -6.123  1.024   1.00 0.00 ? 21 PHE A H    2  
ATOM   879   H  HA   . PHE A 1 21 ? 1.424   -7.091  3.493   1.00 0.00 ? 21 PHE A HA   2  
ATOM   880   H  HB2  . PHE A 1 21 ? -0.167  -6.454  1.007   1.00 0.00 ? 21 PHE A HB2  2  
ATOM   881   H  HB3  . PHE A 1 21 ? -0.773  -6.810  2.619   1.00 0.00 ? 21 PHE A HB3  2  
ATOM   882   H  HD1  . PHE A 1 21 ? 0.954   -4.264  0.571   1.00 0.00 ? 21 PHE A HD1  2  
ATOM   883   H  HD2  . PHE A 1 21 ? -1.081  -5.108  4.211   1.00 0.00 ? 21 PHE A HD2  2  
ATOM   884   H  HE1  . PHE A 1 21 ? 0.824   -1.859  1.049   1.00 0.00 ? 21 PHE A HE1  2  
ATOM   885   H  HE2  . PHE A 1 21 ? -1.205  -2.700  4.701   1.00 0.00 ? 21 PHE A HE2  2  
ATOM   886   H  HZ   . PHE A 1 21 ? -0.252  -1.073  3.118   1.00 0.00 ? 21 PHE A HZ   2  
ATOM   887   N  N    . SER A 1 22 ? 0.899   -9.353  2.427   1.00 0.00 ? 22 SER A N    2  
ATOM   888   C  CA   . SER A 1 22 ? 0.924   -10.706 1.906   1.00 0.00 ? 22 SER A CA   2  
ATOM   889   C  C    . SER A 1 22 ? -0.347  -10.987 1.109   1.00 0.00 ? 22 SER A C    2  
ATOM   890   O  O    . SER A 1 22 ? -0.403  -11.921 0.307   1.00 0.00 ? 22 SER A O    2  
ATOM   891   C  CB   . SER A 1 22 ? 1.060   -11.697 3.058   1.00 0.00 ? 22 SER A CB   2  
ATOM   892   O  OG   . SER A 1 22 ? 1.025   -11.028 4.308   1.00 0.00 ? 22 SER A OG   2  
ATOM   893   H  H    . SER A 1 22 ? 0.466   -9.182  3.294   1.00 0.00 ? 22 SER A H    2  
ATOM   894   H  HA   . SER A 1 22 ? 1.785   -10.799 1.252   1.00 0.00 ? 22 SER A HA   2  
ATOM   895   H  HB2  . SER A 1 22 ? 0.247   -12.406 3.020   1.00 0.00 ? 22 SER A HB2  2  
ATOM   896   H  HB3  . SER A 1 22 ? 1.999   -12.220 2.970   1.00 0.00 ? 22 SER A HB3  2  
ATOM   897   H  HG   . SER A 1 22 ? 0.782   -11.664 5.003   1.00 0.00 ? 22 SER A HG   2  
ATOM   898   N  N    . ARG A 1 23 ? -1.359  -10.154 1.333   1.00 0.00 ? 23 ARG A N    2  
ATOM   899   C  CA   . ARG A 1 23 ? -2.632  -10.263 0.633   1.00 0.00 ? 23 ARG A CA   2  
ATOM   900   C  C    . ARG A 1 23 ? -2.855  -9.059  -0.246  1.00 0.00 ? 23 ARG A C    2  
ATOM   901   O  O    . ARG A 1 23 ? -2.722  -7.913  0.187   1.00 0.00 ? 23 ARG A O    2  
ATOM   902   C  CB   . ARG A 1 23 ? -3.786  -10.402 1.631   1.00 0.00 ? 23 ARG A CB   2  
ATOM   903   C  CG   . ARG A 1 23 ? -3.663  -11.615 2.537   1.00 0.00 ? 23 ARG A CG   2  
ATOM   904   C  CD   . ARG A 1 23 ? -4.867  -11.768 3.461   1.00 0.00 ? 23 ARG A CD   2  
ATOM   905   N  NE   . ARG A 1 23 ? -6.099  -11.203 2.901   1.00 0.00 ? 23 ARG A NE   2  
ATOM   906   C  CZ   . ARG A 1 23 ? -7.197  -11.915 2.637   1.00 0.00 ? 23 ARG A CZ   2  
ATOM   907   N  NH1  . ARG A 1 23 ? -7.222  -13.225 2.860   1.00 0.00 ? 23 ARG A NH1  2  
ATOM   908   N  NH2  . ARG A 1 23 ? -8.273  -11.304 2.159   1.00 0.00 ? 23 ARG A NH2  2  
ATOM   909   H  H    . ARG A 1 23 ? -1.238  -9.426  1.977   1.00 0.00 ? 23 ARG A H    2  
ATOM   910   H  HA   . ARG A 1 23 ? -2.606  -11.132 -0.010  1.00 0.00 ? 23 ARG A HA   2  
ATOM   911   H  HB2  . ARG A 1 23 ? -3.820  -9.518  2.250   1.00 0.00 ? 23 ARG A HB2  2  
ATOM   912   H  HB3  . ARG A 1 23 ? -4.713  -10.482 1.083   1.00 0.00 ? 23 ARG A HB3  2  
ATOM   913   H  HG2  . ARG A 1 23 ? -3.579  -12.498 1.924   1.00 0.00 ? 23 ARG A HG2  2  
ATOM   914   H  HG3  . ARG A 1 23 ? -2.771  -11.509 3.140   1.00 0.00 ? 23 ARG A HG3  2  
ATOM   915   H  HD2  . ARG A 1 23 ? -5.024  -12.821 3.648   1.00 0.00 ? 23 ARG A HD2  2  
ATOM   916   H  HD3  . ARG A 1 23 ? -4.649  -11.271 4.395   1.00 0.00 ? 23 ARG A HD3  2  
ATOM   917   H  HE   . ARG A 1 23 ? -6.114  -10.234 2.723   1.00 0.00 ? 23 ARG A HE   2  
ATOM   918   H  HH11 . ARG A 1 23 ? -6.408  -13.694 3.231   1.00 0.00 ? 23 ARG A HH11 2  
ATOM   919   H  HH12 . ARG A 1 23 ? -8.053  -13.758 2.657   1.00 0.00 ? 23 ARG A HH12 2  
ATOM   920   H  HH21 . ARG A 1 23 ? -8.255  -10.309 1.999   1.00 0.00 ? 23 ARG A HH21 2  
ATOM   921   H  HH22 . ARG A 1 23 ? -9.107  -11.828 1.944   1.00 0.00 ? 23 ARG A HH22 2  
ATOM   922   N  N    . SER A 1 24 ? -3.188  -9.342  -1.487  1.00 0.00 ? 24 SER A N    2  
ATOM   923   C  CA   . SER A 1 24 ? -3.445  -8.321  -2.476  1.00 0.00 ? 24 SER A CA   2  
ATOM   924   C  C    . SER A 1 24 ? -4.646  -7.473  -2.067  1.00 0.00 ? 24 SER A C    2  
ATOM   925   O  O    . SER A 1 24 ? -4.699  -6.271  -2.329  1.00 0.00 ? 24 SER A O    2  
ATOM   926   C  CB   . SER A 1 24 ? -3.684  -8.998  -3.815  1.00 0.00 ? 24 SER A CB   2  
ATOM   927   O  OG   . SER A 1 24 ? -3.894  -10.396 -3.656  1.00 0.00 ? 24 SER A OG   2  
ATOM   928   H  H    . SER A 1 24 ? -3.253  -10.285 -1.759  1.00 0.00 ? 24 SER A H    2  
ATOM   929   H  HA   . SER A 1 24 ? -2.573  -7.690  -2.543  1.00 0.00 ? 24 SER A HA   2  
ATOM   930   H  HB2  . SER A 1 24 ? -4.549  -8.569  -4.286  1.00 0.00 ? 24 SER A HB2  2  
ATOM   931   H  HB3  . SER A 1 24 ? -2.818  -8.853  -4.437  1.00 0.00 ? 24 SER A HB3  2  
ATOM   932   H  HG   . SER A 1 24 ? -3.615  -10.853 -4.469  1.00 0.00 ? 24 SER A HG   2  
ATOM   933   N  N    . ASP A 1 25 ? -5.555  -8.097  -1.328  1.00 0.00 ? 25 ASP A N    2  
ATOM   934   C  CA   . ASP A 1 25 ? -6.705  -7.410  -0.765  1.00 0.00 ? 25 ASP A CA   2  
ATOM   935   C  C    . ASP A 1 25 ? -6.248  -6.362  0.240   1.00 0.00 ? 25 ASP A C    2  
ATOM   936   O  O    . ASP A 1 25 ? -6.728  -5.226  0.244   1.00 0.00 ? 25 ASP A O    2  
ATOM   937   C  CB   . ASP A 1 25 ? -7.622  -8.438  -0.098  1.00 0.00 ? 25 ASP A CB   2  
ATOM   938   C  CG   . ASP A 1 25 ? -7.982  -8.108  1.338   1.00 0.00 ? 25 ASP A CG   2  
ATOM   939   O  OD1  . ASP A 1 25 ? -8.913  -7.311  1.557   1.00 0.00 ? 25 ASP A OD1  2  
ATOM   940   O  OD2  . ASP A 1 25 ? -7.347  -8.673  2.255   1.00 0.00 ? 25 ASP A OD2  2  
ATOM   941   H  H    . ASP A 1 25 ? -5.422  -9.051  -1.117  1.00 0.00 ? 25 ASP A H    2  
ATOM   942   H  HA   . ASP A 1 25 ? -7.234  -6.925  -1.570  1.00 0.00 ? 25 ASP A HA   2  
ATOM   943   H  HB2  . ASP A 1 25 ? -8.524  -8.504  -0.663  1.00 0.00 ? 25 ASP A HB2  2  
ATOM   944   H  HB3  . ASP A 1 25 ? -7.132  -9.400  -0.108  1.00 0.00 ? 25 ASP A HB3  2  
ATOM   945   N  N    . HIS A 1 26 ? -5.292  -6.757  1.062   1.00 0.00 ? 26 HIS A N    2  
ATOM   946   C  CA   . HIS A 1 26 ? -4.726  -5.879  2.080   1.00 0.00 ? 26 HIS A CA   2  
ATOM   947   C  C    . HIS A 1 26 ? -4.037  -4.678  1.441   1.00 0.00 ? 26 HIS A C    2  
ATOM   948   O  O    . HIS A 1 26 ? -4.136  -3.558  1.952   1.00 0.00 ? 26 HIS A O    2  
ATOM   949   C  CB   . HIS A 1 26 ? -3.742  -6.647  2.964   1.00 0.00 ? 26 HIS A CB   2  
ATOM   950   C  CG   . HIS A 1 26 ? -4.314  -7.042  4.290   1.00 0.00 ? 26 HIS A CG   2  
ATOM   951   N  ND1  . HIS A 1 26 ? -3.577  -7.078  5.450   1.00 0.00 ? 26 HIS A ND1  2  
ATOM   952   C  CD2  . HIS A 1 26 ? -5.568  -7.420  4.634   1.00 0.00 ? 26 HIS A CD2  2  
ATOM   953   C  CE1  . HIS A 1 26 ? -4.348  -7.462  6.448   1.00 0.00 ? 26 HIS A CE1  2  
ATOM   954   N  NE2  . HIS A 1 26 ? -5.564  -7.675  5.983   1.00 0.00 ? 26 HIS A NE2  2  
ATOM   955   H  H    . HIS A 1 26 ? -4.966  -7.677  0.986   1.00 0.00 ? 26 HIS A H    2  
ATOM   956   H  HA   . HIS A 1 26 ? -5.542  -5.523  2.692   1.00 0.00 ? 26 HIS A HA   2  
ATOM   957   H  HB2  . HIS A 1 26 ? -3.436  -7.548  2.452   1.00 0.00 ? 26 HIS A HB2  2  
ATOM   958   H  HB3  . HIS A 1 26 ? -2.872  -6.032  3.146   1.00 0.00 ? 26 HIS A HB3  2  
ATOM   959   H  HD1  . HIS A 1 26 ? -2.619  -6.844  5.535   1.00 0.00 ? 26 HIS A HD1  2  
ATOM   960   H  HD2  . HIS A 1 26 ? -6.414  -7.510  3.969   1.00 0.00 ? 26 HIS A HD2  2  
ATOM   961   H  HE1  . HIS A 1 26 ? -4.038  -7.575  7.477   1.00 0.00 ? 26 HIS A HE1  2  
ATOM   962   H  HE2  . HIS A 1 26 ? -6.372  -7.728  6.547   1.00 0.00 ? 26 HIS A HE2  2  
ATOM   963   N  N    . LEU A 1 27 ? -3.414  -4.897  0.284   1.00 0.00 ? 27 LEU A N    2  
ATOM   964   C  CA   . LEU A 1 27 ? -2.820  -3.807  -0.484  1.00 0.00 ? 27 LEU A CA   2  
ATOM   965   C  C    . LEU A 1 27 ? -3.874  -2.746  -0.783  1.00 0.00 ? 27 LEU A C    2  
ATOM   966   O  O    . LEU A 1 27 ? -3.726  -1.577  -0.414  1.00 0.00 ? 27 LEU A O    2  
ATOM   967   C  CB   . LEU A 1 27 ? -2.248  -4.320  -1.812  1.00 0.00 ? 27 LEU A CB   2  
ATOM   968   C  CG   . LEU A 1 27 ? -1.340  -3.341  -2.568  1.00 0.00 ? 27 LEU A CG   2  
ATOM   969   C  CD1  . LEU A 1 27 ? -0.796  -2.251  -1.654  1.00 0.00 ? 27 LEU A CD1  2  
ATOM   970   C  CD2  . LEU A 1 27 ? -0.209  -4.068  -3.263  1.00 0.00 ? 27 LEU A CD2  2  
ATOM   971   H  H    . LEU A 1 27 ? -3.421  -5.803  -0.098  1.00 0.00 ? 27 LEU A H    2  
ATOM   972   H  HA   . LEU A 1 27 ? -2.028  -3.367  0.102   1.00 0.00 ? 27 LEU A HA   2  
ATOM   973   H  HB2  . LEU A 1 27 ? -1.682  -5.219  -1.611  1.00 0.00 ? 27 LEU A HB2  2  
ATOM   974   H  HB3  . LEU A 1 27 ? -3.075  -4.576  -2.457  1.00 0.00 ? 27 LEU A HB3  2  
ATOM   975   H  HG   . LEU A 1 27 ? -1.929  -2.853  -3.331  1.00 0.00 ? 27 LEU A HG   2  
ATOM   976   H  HD11 . LEU A 1 27 ? 0.047   -2.634  -1.097  1.00 0.00 ? 27 LEU A HD11 2  
ATOM   977   H  HD12 . LEU A 1 27 ? -0.481  -1.406  -2.249  1.00 0.00 ? 27 LEU A HD12 2  
ATOM   978   H  HD13 . LEU A 1 27 ? -1.569  -1.939  -0.967  1.00 0.00 ? 27 LEU A HD13 2  
ATOM   979   H  HD21 . LEU A 1 27 ? -0.616  -4.769  -3.977  1.00 0.00 ? 27 LEU A HD21 2  
ATOM   980   H  HD22 . LEU A 1 27 ? 0.414   -3.349  -3.779  1.00 0.00 ? 27 LEU A HD22 2  
ATOM   981   H  HD23 . LEU A 1 27 ? 0.383   -4.598  -2.532  1.00 0.00 ? 27 LEU A HD23 2  
ATOM   982   N  N    . ALA A 1 28 ? -4.917  -3.166  -1.491  1.00 0.00 ? 28 ALA A N    2  
ATOM   983   C  CA   . ALA A 1 28 ? -5.978  -2.267  -1.919  1.00 0.00 ? 28 ALA A CA   2  
ATOM   984   C  C    . ALA A 1 28 ? -6.599  -1.523  -0.744  1.00 0.00 ? 28 ALA A C    2  
ATOM   985   O  O    . ALA A 1 28 ? -6.920  -0.345  -0.864  1.00 0.00 ? 28 ALA A O    2  
ATOM   986   C  CB   . ALA A 1 28 ? -7.047  -3.035  -2.680  1.00 0.00 ? 28 ALA A CB   2  
ATOM   987   H  H    . ALA A 1 28 ? -4.952  -4.107  -1.768  1.00 0.00 ? 28 ALA A H    2  
ATOM   988   H  HA   . ALA A 1 28 ? -5.539  -1.542  -2.596  1.00 0.00 ? 28 ALA A HA   2  
ATOM   989   H  HB1  . ALA A 1 28 ? -7.959  -3.049  -2.106  1.00 0.00 ? 28 ALA A HB1  2  
ATOM   990   H  HB2  . ALA A 1 28 ? -7.225  -2.552  -3.631  1.00 0.00 ? 28 ALA A HB2  2  
ATOM   991   H  HB3  . ALA A 1 28 ? -6.710  -4.048  -2.849  1.00 0.00 ? 28 ALA A HB3  2  
ATOM   992   N  N    . LEU A 1 29 ? -6.736  -2.204  0.396   1.00 0.00 ? 29 LEU A N    2  
ATOM   993   C  CA   . LEU A 1 29 ? -7.288  -1.587  1.601   1.00 0.00 ? 29 LEU A CA   2  
ATOM   994   C  C    . LEU A 1 29 ? -6.522  -0.319  1.962   1.00 0.00 ? 29 LEU A C    2  
ATOM   995   O  O    . LEU A 1 29 ? -7.118  0.734   2.199   1.00 0.00 ? 29 LEU A O    2  
ATOM   996   C  CB   . LEU A 1 29 ? -7.243  -2.562  2.774   1.00 0.00 ? 29 LEU A CB   2  
ATOM   997   C  CG   . LEU A 1 29 ? -8.296  -3.666  2.739   1.00 0.00 ? 29 LEU A CG   2  
ATOM   998   C  CD1  . LEU A 1 29 ? -7.921  -4.784  3.694   1.00 0.00 ? 29 LEU A CD1  2  
ATOM   999   C  CD2  . LEU A 1 29 ? -9.670  -3.107  3.079   1.00 0.00 ? 29 LEU A CD2  2  
ATOM   1000  H  H    . LEU A 1 29 ? -6.445  -3.141  0.432   1.00 0.00 ? 29 LEU A H    2  
ATOM   1001  H  HA   . LEU A 1 29 ? -8.315  -1.329  1.405   1.00 0.00 ? 29 LEU A HA   2  
ATOM   1002  H  HB2  . LEU A 1 29 ? -6.267  -3.021  2.796   1.00 0.00 ? 29 LEU A HB2  2  
ATOM   1003  H  HB3  . LEU A 1 29 ? -7.378  -1.996  3.682   1.00 0.00 ? 29 LEU A HB3  2  
ATOM   1004  H  HG   . LEU A 1 29 ? -8.341  -4.080  1.743   1.00 0.00 ? 29 LEU A HG   2  
ATOM   1005  H  HD11 . LEU A 1 29 ? -8.668  -5.562  3.646   1.00 0.00 ? 29 LEU A HD11 2  
ATOM   1006  H  HD12 . LEU A 1 29 ? -6.959  -5.189  3.412   1.00 0.00 ? 29 LEU A HD12 2  
ATOM   1007  H  HD13 . LEU A 1 29 ? -7.868  -4.397  4.701   1.00 0.00 ? 29 LEU A HD13 2  
ATOM   1008  H  HD21 . LEU A 1 29 ? -10.195 -3.802  3.717   1.00 0.00 ? 29 LEU A HD21 2  
ATOM   1009  H  HD22 . LEU A 1 29 ? -9.558  -2.163  3.590   1.00 0.00 ? 29 LEU A HD22 2  
ATOM   1010  H  HD23 . LEU A 1 29 ? -10.232 -2.958  2.168   1.00 0.00 ? 29 LEU A HD23 2  
ATOM   1011  N  N    . HIS A 1 30 ? -5.199  -0.404  1.921   1.00 0.00 ? 30 HIS A N    2  
ATOM   1012  C  CA   . HIS A 1 30 ? -4.354  0.749   2.195   1.00 0.00 ? 30 HIS A CA   2  
ATOM   1013  C  C    . HIS A 1 30 ? -4.411  1.741   1.038   1.00 0.00 ? 30 HIS A C    2  
ATOM   1014  O  O    . HIS A 1 30 ? -4.359  2.955   1.238   1.00 0.00 ? 30 HIS A O    2  
ATOM   1015  C  CB   . HIS A 1 30 ? -2.899  0.306   2.435   1.00 0.00 ? 30 HIS A CB   2  
ATOM   1016  C  CG   . HIS A 1 30 ? -1.886  1.386   2.179   1.00 0.00 ? 30 HIS A CG   2  
ATOM   1017  N  ND1  . HIS A 1 30 ? -1.721  2.484   2.988   1.00 0.00 ? 30 HIS A ND1  2  
ATOM   1018  C  CD2  . HIS A 1 30 ? -1.009  1.539   1.153   1.00 0.00 ? 30 HIS A CD2  2  
ATOM   1019  C  CE1  . HIS A 1 30 ? -0.774  3.257   2.441   1.00 0.00 ? 30 HIS A CE1  2  
ATOM   1020  N  NE2  . HIS A 1 30 ? -0.306  2.729   1.325   1.00 0.00 ? 30 HIS A NE2  2  
ATOM   1021  H  H    . HIS A 1 30 ? -4.784  -1.255  1.656   1.00 0.00 ? 30 HIS A H    2  
ATOM   1022  H  HA   . HIS A 1 30 ? -4.728  1.230   3.085   1.00 0.00 ? 30 HIS A HA   2  
ATOM   1023  H  HB2  . HIS A 1 30 ? -2.792  -0.011  3.461   1.00 0.00 ? 30 HIS A HB2  2  
ATOM   1024  H  HB3  . HIS A 1 30 ? -2.671  -0.523  1.783   1.00 0.00 ? 30 HIS A HB3  2  
ATOM   1025  H  HD1  . HIS A 1 30 ? -2.236  2.693   3.810   1.00 0.00 ? 30 HIS A HD1  2  
ATOM   1026  H  HD2  . HIS A 1 30 ? -0.872  0.853   0.330   1.00 0.00 ? 30 HIS A HD2  2  
ATOM   1027  H  HE1  . HIS A 1 30 ? -0.436  4.193   2.859   1.00 0.00 ? 30 HIS A HE1  2  
ATOM   1028  N  N    . ARG A 1 31 ? -4.425  1.217   -0.178  1.00 0.00 ? 31 ARG A N    2  
ATOM   1029  C  CA   . ARG A 1 31 ? -4.333  2.056   -1.360  1.00 0.00 ? 31 ARG A CA   2  
ATOM   1030  C  C    . ARG A 1 31 ? -5.635  2.801   -1.627  1.00 0.00 ? 31 ARG A C    2  
ATOM   1031  O  O    . ARG A 1 31 ? -5.699  3.644   -2.519  1.00 0.00 ? 31 ARG A O    2  
ATOM   1032  C  CB   . ARG A 1 31 ? -3.929  1.228   -2.575  1.00 0.00 ? 31 ARG A CB   2  
ATOM   1033  C  CG   . ARG A 1 31 ? -2.505  0.696   -2.484  1.00 0.00 ? 31 ARG A CG   2  
ATOM   1034  C  CD   . ARG A 1 31 ? -1.918  0.373   -3.849  1.00 0.00 ? 31 ARG A CD   2  
ATOM   1035  N  NE   . ARG A 1 31 ? -1.955  1.517   -4.756  1.00 0.00 ? 31 ARG A NE   2  
ATOM   1036  C  CZ   . ARG A 1 31 ? -2.730  1.594   -5.838  1.00 0.00 ? 31 ARG A CZ   2  
ATOM   1037  N  NH1  . ARG A 1 31 ? -3.559  0.600   -6.143  1.00 0.00 ? 31 ARG A NH1  2  
ATOM   1038  N  NH2  . ARG A 1 31 ? -2.680  2.672   -6.613  1.00 0.00 ? 31 ARG A NH2  2  
ATOM   1039  H  H    . ARG A 1 31 ? -4.425  0.238   -0.282  1.00 0.00 ? 31 ARG A H    2  
ATOM   1040  H  HA   . ARG A 1 31 ? -3.555  2.783   -1.168  1.00 0.00 ? 31 ARG A HA   2  
ATOM   1041  H  HB2  . ARG A 1 31 ? -4.603  0.390   -2.668  1.00 0.00 ? 31 ARG A HB2  2  
ATOM   1042  H  HB3  . ARG A 1 31 ? -4.009  1.846   -3.459  1.00 0.00 ? 31 ARG A HB3  2  
ATOM   1043  H  HG2  . ARG A 1 31 ? -1.887  1.440   -2.008  1.00 0.00 ? 31 ARG A HG2  2  
ATOM   1044  H  HG3  . ARG A 1 31 ? -2.509  -0.202  -1.886  1.00 0.00 ? 31 ARG A HG3  2  
ATOM   1045  H  HD2  . ARG A 1 31 ? -0.883  0.071   -3.719  1.00 0.00 ? 31 ARG A HD2  2  
ATOM   1046  H  HD3  . ARG A 1 31 ? -2.482  -0.441  -4.284  1.00 0.00 ? 31 ARG A HD3  2  
ATOM   1047  H  HE   . ARG A 1 31 ? -1.347  2.268   -4.549  1.00 0.00 ? 31 ARG A HE   2  
ATOM   1048  H  HH11 . ARG A 1 31 ? -3.609  -0.219  -5.556  1.00 0.00 ? 31 ARG A HH11 2  
ATOM   1049  H  HH12 . ARG A 1 31 ? -4.144  0.659   -6.962  1.00 0.00 ? 31 ARG A HH12 2  
ATOM   1050  H  HH21 . ARG A 1 31 ? -2.063  3.436   -6.381  1.00 0.00 ? 31 ARG A HH21 2  
ATOM   1051  H  HH22 . ARG A 1 31 ? -3.245  2.728   -7.442  1.00 0.00 ? 31 ARG A HH22 2  
ATOM   1052  N  N    . LYS A 1 32 ? -6.634  2.570   -0.785  1.00 0.00 ? 32 LYS A N    2  
ATOM   1053  C  CA   . LYS A 1 32 ? -7.883  3.308   -0.871  1.00 0.00 ? 32 LYS A CA   2  
ATOM   1054  C  C    . LYS A 1 32 ? -7.636  4.769   -0.520  1.00 0.00 ? 32 LYS A C    2  
ATOM   1055  O  O    . LYS A 1 32 ? -8.305  5.665   -1.034  1.00 0.00 ? 32 LYS A O    2  
ATOM   1056  C  CB   . LYS A 1 32 ? -8.938  2.709   0.068   1.00 0.00 ? 32 LYS A CB   2  
ATOM   1057  C  CG   . LYS A 1 32 ? -9.582  1.428   -0.449  1.00 0.00 ? 32 LYS A CG   2  
ATOM   1058  C  CD   . LYS A 1 32 ? -9.305  1.211   -1.929  1.00 0.00 ? 32 LYS A CD   2  
ATOM   1059  C  CE   . LYS A 1 32 ? -10.120 0.062   -2.494  1.00 0.00 ? 32 LYS A CE   2  
ATOM   1060  N  NZ   . LYS A 1 32 ? -10.213 0.132   -3.975  1.00 0.00 ? 32 LYS A NZ   2  
ATOM   1061  H  H    . LYS A 1 32 ? -6.508  1.924   -0.058  1.00 0.00 ? 32 LYS A H    2  
ATOM   1062  H  HA   . LYS A 1 32 ? -8.236  3.245   -1.890  1.00 0.00 ? 32 LYS A HA   2  
ATOM   1063  H  HB2  . LYS A 1 32 ? -8.472  2.493   1.018   1.00 0.00 ? 32 LYS A HB2  2  
ATOM   1064  H  HB3  . LYS A 1 32 ? -9.719  3.441   0.223   1.00 0.00 ? 32 LYS A HB3  2  
ATOM   1065  H  HG2  . LYS A 1 32 ? -9.186  0.590   0.106   1.00 0.00 ? 32 LYS A HG2  2  
ATOM   1066  H  HG3  . LYS A 1 32 ? -10.649 1.488   -0.299  1.00 0.00 ? 32 LYS A HG3  2  
ATOM   1067  H  HD2  . LYS A 1 32 ? -9.550  2.114   -2.467  1.00 0.00 ? 32 LYS A HD2  2  
ATOM   1068  H  HD3  . LYS A 1 32 ? -8.252  0.990   -2.054  1.00 0.00 ? 32 LYS A HD3  2  
ATOM   1069  H  HE2  . LYS A 1 32 ? -9.650  -0.870  -2.216  1.00 0.00 ? 32 LYS A HE2  2  
ATOM   1070  H  HE3  . LYS A 1 32 ? -11.115 0.101   -2.077  1.00 0.00 ? 32 LYS A HE3  2  
ATOM   1071  H  HZ1  . LYS A 1 32 ? -10.719 -0.702  -4.348  1.00 0.00 ? 32 LYS A HZ1  2  
ATOM   1072  H  HZ2  . LYS A 1 32 ? -9.258  0.162   -4.394  1.00 0.00 ? 32 LYS A HZ2  2  
ATOM   1073  H  HZ3  . LYS A 1 32 ? -10.730 0.992   -4.260  1.00 0.00 ? 32 LYS A HZ3  2  
ATOM   1074  N  N    . ARG A 1 33 ? -6.606  5.002   0.286   1.00 0.00 ? 33 ARG A N    2  
ATOM   1075  C  CA   . ARG A 1 33 ? -6.210  6.351   0.652   1.00 0.00 ? 33 ARG A CA   2  
ATOM   1076  C  C    . ARG A 1 33 ? -5.467  7.021   -0.499  1.00 0.00 ? 33 ARG A C    2  
ATOM   1077  O  O    . ARG A 1 33 ? -5.345  8.241   -0.547  1.00 0.00 ? 33 ARG A O    2  
ATOM   1078  C  CB   . ARG A 1 33 ? -5.331  6.334   1.903   1.00 0.00 ? 33 ARG A CB   2  
ATOM   1079  C  CG   . ARG A 1 33 ? -5.908  7.133   3.058   1.00 0.00 ? 33 ARG A CG   2  
ATOM   1080  C  CD   . ARG A 1 33 ? -5.241  6.773   4.375   1.00 0.00 ? 33 ARG A CD   2  
ATOM   1081  N  NE   . ARG A 1 33 ? -6.207  6.658   5.464   1.00 0.00 ? 33 ARG A NE   2  
ATOM   1082  C  CZ   . ARG A 1 33 ? -5.870  6.571   6.750   1.00 0.00 ? 33 ARG A CZ   2  
ATOM   1083  N  NH1  . ARG A 1 33 ? -4.599  6.680   7.115   1.00 0.00 ? 33 ARG A NH1  2  
ATOM   1084  N  NH2  . ARG A 1 33 ? -6.810  6.405   7.672   1.00 0.00 ? 33 ARG A NH2  2  
ATOM   1085  H  H    . ARG A 1 33 ? -6.077  4.243   0.614   1.00 0.00 ? 33 ARG A H    2  
ATOM   1086  H  HA   . ARG A 1 33 ? -7.105  6.911   0.857   1.00 0.00 ? 33 ARG A HA   2  
ATOM   1087  H  HB2  . ARG A 1 33 ? -5.206  5.311   2.228   1.00 0.00 ? 33 ARG A HB2  2  
ATOM   1088  H  HB3  . ARG A 1 33 ? -4.366  6.745   1.655   1.00 0.00 ? 33 ARG A HB3  2  
ATOM   1089  H  HG2  . ARG A 1 33 ? -5.757  8.186   2.867   1.00 0.00 ? 33 ARG A HG2  2  
ATOM   1090  H  HG3  . ARG A 1 33 ? -6.965  6.929   3.133   1.00 0.00 ? 33 ARG A HG3  2  
ATOM   1091  H  HD2  . ARG A 1 33 ? -4.730  5.829   4.260   1.00 0.00 ? 33 ARG A HD2  2  
ATOM   1092  H  HD3  . ARG A 1 33 ? -4.525  7.541   4.623   1.00 0.00 ? 33 ARG A HD3  2  
ATOM   1093  H  HE   . ARG A 1 33 ? -7.163  6.630   5.218   1.00 0.00 ? 33 ARG A HE   2  
ATOM   1094  H  HH11 . ARG A 1 33 ? -3.886  6.830   6.424   1.00 0.00 ? 33 ARG A HH11 2  
ATOM   1095  H  HH12 . ARG A 1 33 ? -4.345  6.630   8.087   1.00 0.00 ? 33 ARG A HH12 2  
ATOM   1096  H  HH21 . ARG A 1 33 ? -7.781  6.350   7.402   1.00 0.00 ? 33 ARG A HH21 2  
ATOM   1097  H  HH22 . ARG A 1 33 ? -6.558  6.318   8.641   1.00 0.00 ? 33 ARG A HH22 2  
ATOM   1098  N  N    . HIS A 1 34 ? -5.057  6.216   -1.469  1.00 0.00 ? 34 HIS A N    2  
ATOM   1099  C  CA   . HIS A 1 34 ? -4.408  6.732   -2.665  1.00 0.00 ? 34 HIS A CA   2  
ATOM   1100  C  C    . HIS A 1 34 ? -5.451  7.014   -3.734  1.00 0.00 ? 34 HIS A C    2  
ATOM   1101  O  O    . HIS A 1 34 ? -5.169  7.653   -4.745  1.00 0.00 ? 34 HIS A O    2  
ATOM   1102  C  CB   . HIS A 1 34 ? -3.363  5.737   -3.181  1.00 0.00 ? 34 HIS A CB   2  
ATOM   1103  C  CG   . HIS A 1 34 ? -2.178  5.606   -2.277  1.00 0.00 ? 34 HIS A CG   2  
ATOM   1104  N  ND1  . HIS A 1 34 ? -1.359  6.656   -1.939  1.00 0.00 ? 34 HIS A ND1  2  
ATOM   1105  C  CD2  . HIS A 1 34 ? -1.689  4.521   -1.622  1.00 0.00 ? 34 HIS A CD2  2  
ATOM   1106  C  CE1  . HIS A 1 34 ? -0.416  6.190   -1.109  1.00 0.00 ? 34 HIS A CE1  2  
ATOM   1107  N  NE2  . HIS A 1 34 ? -0.574  4.898   -0.882  1.00 0.00 ? 34 HIS A NE2  2  
ATOM   1108  H  H    . HIS A 1 34 ? -5.263  5.257   -1.413  1.00 0.00 ? 34 HIS A H    2  
ATOM   1109  H  HA   . HIS A 1 34 ? -3.918  7.657   -2.403  1.00 0.00 ? 34 HIS A HA   2  
ATOM   1110  H  HB2  . HIS A 1 34 ? -3.817  4.762   -3.275  1.00 0.00 ? 34 HIS A HB2  2  
ATOM   1111  H  HB3  . HIS A 1 34 ? -3.011  6.060   -4.149  1.00 0.00 ? 34 HIS A HB3  2  
ATOM   1112  H  HD1  . HIS A 1 34 ? -1.455  7.593   -2.244  1.00 0.00 ? 34 HIS A HD1  2  
ATOM   1113  H  HD2  . HIS A 1 34 ? -2.088  3.519   -1.669  1.00 0.00 ? 34 HIS A HD2  2  
ATOM   1114  H  HE1  . HIS A 1 34 ? 0.372   6.792   -0.683  1.00 0.00 ? 34 HIS A HE1  2  
ATOM   1115  N  N    . MET A 1 35 ? -6.687  6.623   -3.447  1.00 0.00 ? 35 MET A N    2  
ATOM   1116  C  CA   . MET A 1 35 ? -7.806  6.893   -4.339  1.00 0.00 ? 35 MET A CA   2  
ATOM   1117  C  C    . MET A 1 35 ? -8.487  8.197   -3.942  1.00 0.00 ? 35 MET A C    2  
ATOM   1118  O  O    . MET A 1 35 ? -9.600  8.493   -4.374  1.00 0.00 ? 35 MET A O    2  
ATOM   1119  C  CB   . MET A 1 35 ? -8.811  5.740   -4.302  1.00 0.00 ? 35 MET A CB   2  
ATOM   1120  C  CG   . MET A 1 35 ? -8.317  4.474   -4.981  1.00 0.00 ? 35 MET A CG   2  
ATOM   1121  S  SD   . MET A 1 35 ? -9.323  4.009   -6.400  1.00 0.00 ? 35 MET A SD   2  
ATOM   1122  C  CE   . MET A 1 35 ? -8.671  5.115   -7.652  1.00 0.00 ? 35 MET A CE   2  
ATOM   1123  H  H    . MET A 1 35 ? -6.862  6.193   -2.580  1.00 0.00 ? 35 MET A H    2  
ATOM   1124  H  HA   . MET A 1 35 ? -7.414  6.990   -5.341  1.00 0.00 ? 35 MET A HA   2  
ATOM   1125  H  HB2  . MET A 1 35 ? -9.032  5.505   -3.271  1.00 0.00 ? 35 MET A HB2  2  
ATOM   1126  H  HB3  . MET A 1 35 ? -9.722  6.055   -4.792  1.00 0.00 ? 35 MET A HB3  2  
ATOM   1127  H  HG2  . MET A 1 35 ? -7.303  4.634   -5.316  1.00 0.00 ? 35 MET A HG2  2  
ATOM   1128  H  HG3  . MET A 1 35 ? -8.335  3.665   -4.264  1.00 0.00 ? 35 MET A HG3  2  
ATOM   1129  H  HE1  . MET A 1 35 ? -7.593  5.079   -7.637  1.00 0.00 ? 35 MET A HE1  2  
ATOM   1130  H  HE2  . MET A 1 35 ? -9.027  4.811   -8.626  1.00 0.00 ? 35 MET A HE2  2  
ATOM   1131  H  HE3  . MET A 1 35 ? -9.001  6.123   -7.444  1.00 0.00 ? 35 MET A HE3  2  
ATOM   1132  N  N    . LEU A 1 36 ? -7.769  9.007   -3.179  1.00 0.00 ? 36 LEU A N    2  
ATOM   1133  C  CA   . LEU A 1 36 ? -8.250  10.312  -2.777  1.00 0.00 ? 36 LEU A CA   2  
ATOM   1134  C  C    . LEU A 1 36 ? -7.443  11.370  -3.503  1.00 0.00 ? 36 LEU A C    2  
ATOM   1135  O  O    . LEU A 1 36 ? -6.744  12.180  -2.891  1.00 0.00 ? 36 LEU A O    2  
ATOM   1136  C  CB   . LEU A 1 36 ? -8.117  10.487  -1.262  1.00 0.00 ? 36 LEU A CB   2  
ATOM   1137  C  CG   . LEU A 1 36 ? -8.744  9.379   -0.416  1.00 0.00 ? 36 LEU A CG   2  
ATOM   1138  C  CD1  . LEU A 1 36 ? -8.229  9.451   1.013   1.00 0.00 ? 36 LEU A CD1  2  
ATOM   1139  C  CD2  . LEU A 1 36 ? -10.262 9.478   -0.443  1.00 0.00 ? 36 LEU A CD2  2  
ATOM   1140  H  H    . LEU A 1 36 ? -6.848  8.758   -2.959  1.00 0.00 ? 36 LEU A H    2  
ATOM   1141  H  HA   . LEU A 1 36 ? -9.286  10.394  -3.062  1.00 0.00 ? 36 LEU A HA   2  
ATOM   1142  H  HB2  . LEU A 1 36 ? -7.066  10.543  -1.020  1.00 0.00 ? 36 LEU A HB2  2  
ATOM   1143  H  HB3  . LEU A 1 36 ? -8.581  11.423  -0.988  1.00 0.00 ? 36 LEU A HB3  2  
ATOM   1144  H  HG   . LEU A 1 36 ? -8.463  8.418   -0.824  1.00 0.00 ? 36 LEU A HG   2  
ATOM   1145  H  HD11 . LEU A 1 36 ? -8.041  10.481  1.276   1.00 0.00 ? 36 LEU A HD11 2  
ATOM   1146  H  HD12 . LEU A 1 36 ? -8.967  9.037   1.684   1.00 0.00 ? 36 LEU A HD12 2  
ATOM   1147  H  HD13 . LEU A 1 36 ? -7.311  8.887   1.093   1.00 0.00 ? 36 LEU A HD13 2  
ATOM   1148  H  HD21 . LEU A 1 36 ? -10.645 9.423   0.566   1.00 0.00 ? 36 LEU A HD21 2  
ATOM   1149  H  HD22 . LEU A 1 36 ? -10.552 10.419  -0.887  1.00 0.00 ? 36 LEU A HD22 2  
ATOM   1150  H  HD23 . LEU A 1 36 ? -10.665 8.664   -1.027  1.00 0.00 ? 36 LEU A HD23 2  
ATOM   1151  N  N    . VAL A 1 37 ? -7.427  11.253  -4.817  1.00 0.00 ? 37 VAL A N    2  
ATOM   1152  C  CA   . VAL A 1 37 ? -6.611  12.113  -5.647  1.00 0.00 ? 37 VAL A CA   2  
ATOM   1153  C  C    . VAL A 1 37 ? -7.464  13.192  -6.298  1.00 0.00 ? 37 VAL A C    2  
ATOM   1154  O  O    . VAL A 1 37 ? -6.899  14.076  -6.971  1.00 0.00 ? 37 VAL A O    2  
ATOM   1155  C  CB   . VAL A 1 37 ? -5.864  11.320  -6.743  1.00 0.00 ? 37 VAL A CB   2  
ATOM   1156  C  CG1  . VAL A 1 37 ? -4.590  10.706  -6.184  1.00 0.00 ? 37 VAL A CG1  2  
ATOM   1157  C  CG2  . VAL A 1 37 ? -6.759  10.243  -7.340  1.00 0.00 ? 37 VAL A CG2  2  
ATOM   1158  O  OXT  . VAL A 1 37 ? -8.705  13.139  -6.144  1.00 0.00 ? 37 VAL A OXT  2  
ATOM   1159  H  H    . VAL A 1 37 ? -7.936  10.528  -5.235  1.00 0.00 ? 37 VAL A H    2  
ATOM   1160  H  HA   . VAL A 1 37 ? -5.877  12.577  -5.006  1.00 0.00 ? 37 VAL A HA   2  
ATOM   1161  H  HB   . VAL A 1 37 ? -5.588  12.006  -7.531  1.00 0.00 ? 37 VAL A HB   2  
ATOM   1162  H  HG11 . VAL A 1 37 ? -4.274  11.261  -5.313  1.00 0.00 ? 37 VAL A HG11 2  
ATOM   1163  H  HG12 . VAL A 1 37 ? -4.776  9.678   -5.908  1.00 0.00 ? 37 VAL A HG12 2  
ATOM   1164  H  HG13 . VAL A 1 37 ? -3.814  10.741  -6.935  1.00 0.00 ? 37 VAL A HG13 2  
ATOM   1165  H  HG21 . VAL A 1 37 ? -6.768  9.381   -6.690  1.00 0.00 ? 37 VAL A HG21 2  
ATOM   1166  H  HG22 . VAL A 1 37 ? -7.763  10.628  -7.445  1.00 0.00 ? 37 VAL A HG22 2  
ATOM   1167  H  HG23 . VAL A 1 37 ? -6.381  9.956   -8.311  1.00 0.00 ? 37 VAL A HG23 2  
HETATM 1168  ZN ZN   . ZN  B 2 .  ? 0.766   3.739   -0.010  1.00 0.00 ? 38 ZN  A ZN   2  
ATOM   1169  N  N    . GLY A 1 1  ? 11.246  3.495   -1.526  1.00 0.00 ? 1  GLY A N    3  
ATOM   1170  C  CA   . GLY A 1 1  ? 11.480  4.294   -2.751  1.00 0.00 ? 1  GLY A CA   3  
ATOM   1171  C  C    . GLY A 1 1  ? 11.833  3.418   -3.932  1.00 0.00 ? 1  GLY A C    3  
ATOM   1172  O  O    . GLY A 1 1  ? 13.007  3.296   -4.288  1.00 0.00 ? 1  GLY A O    3  
ATOM   1173  H  H1   . GLY A 1 1  ? 10.666  2.655   -1.752  1.00 0.00 ? 1  GLY A H1   3  
ATOM   1174  H  H2   . GLY A 1 1  ? 10.748  4.067   -0.812  1.00 0.00 ? 1  GLY A H2   3  
ATOM   1175  H  H3   . GLY A 1 1  ? 12.154  3.178   -1.128  1.00 0.00 ? 1  GLY A H3   3  
ATOM   1176  H  HA2  . GLY A 1 1  ? 10.584  4.852   -2.984  1.00 0.00 ? 1  GLY A HA2  3  
ATOM   1177  H  HA3  . GLY A 1 1  ? 12.290  4.986   -2.570  1.00 0.00 ? 1  GLY A HA3  3  
ATOM   1178  N  N    . SER A 1 2  ? 10.816  2.796   -4.525  1.00 0.00 ? 2  SER A N    3  
ATOM   1179  C  CA   . SER A 1 2  ? 10.995  1.914   -5.675  1.00 0.00 ? 2  SER A CA   3  
ATOM   1180  C  C    . SER A 1 2  ? 11.940  0.757   -5.350  1.00 0.00 ? 2  SER A C    3  
ATOM   1181  O  O    . SER A 1 2  ? 12.820  0.412   -6.148  1.00 0.00 ? 2  SER A O    3  
ATOM   1182  C  CB   . SER A 1 2  ? 11.518  2.700   -6.881  1.00 0.00 ? 2  SER A CB   3  
ATOM   1183  O  OG   . SER A 1 2  ? 10.625  3.741   -7.246  1.00 0.00 ? 2  SER A OG   3  
ATOM   1184  H  H    . SER A 1 2  ? 9.907   2.949   -4.181  1.00 0.00 ? 2  SER A H    3  
ATOM   1185  H  HA   . SER A 1 2  ? 10.027  1.505   -5.924  1.00 0.00 ? 2  SER A HA   3  
ATOM   1186  H  HB2  . SER A 1 2  ? 12.474  3.136   -6.637  1.00 0.00 ? 2  SER A HB2  3  
ATOM   1187  H  HB3  . SER A 1 2  ? 11.632  2.031   -7.723  1.00 0.00 ? 2  SER A HB3  3  
ATOM   1188  H  HG   . SER A 1 2  ? 10.331  4.210   -6.445  1.00 0.00 ? 2  SER A HG   3  
ATOM   1189  N  N    . THR A 1 3  ? 11.739  0.139   -4.193  1.00 0.00 ? 3  THR A N    3  
ATOM   1190  C  CA   . THR A 1 3  ? 12.544  -1.004  -3.798  1.00 0.00 ? 3  THR A CA   3  
ATOM   1191  C  C    . THR A 1 3  ? 12.195  -2.221  -4.647  1.00 0.00 ? 3  THR A C    3  
ATOM   1192  O  O    . THR A 1 3  ? 11.035  -2.623  -4.711  1.00 0.00 ? 3  THR A O    3  
ATOM   1193  C  CB   . THR A 1 3  ? 12.337  -1.347  -2.312  1.00 0.00 ? 3  THR A CB   3  
ATOM   1194  O  OG1  . THR A 1 3  ? 12.226  -0.141  -1.547  1.00 0.00 ? 3  THR A OG1  3  
ATOM   1195  C  CG2  . THR A 1 3  ? 13.489  -2.186  -1.782  1.00 0.00 ? 3  THR A CG2  3  
ATOM   1196  H  H    . THR A 1 3  ? 11.004  0.433   -3.609  1.00 0.00 ? 3  THR A H    3  
ATOM   1197  H  HA   . THR A 1 3  ? 13.583  -0.753  -3.951  1.00 0.00 ? 3  THR A HA   3  
ATOM   1198  H  HB   . THR A 1 3  ? 11.421  -1.913  -2.213  1.00 0.00 ? 3  THR A HB   3  
ATOM   1199  H  HG1  . THR A 1 3  ? 11.319  -0.068  -1.200  1.00 0.00 ? 3  THR A HG1  3  
ATOM   1200  H  HG21 . THR A 1 3  ? 13.809  -2.881  -2.544  1.00 0.00 ? 3  THR A HG21 3  
ATOM   1201  H  HG22 . THR A 1 3  ? 13.165  -2.734  -0.909  1.00 0.00 ? 3  THR A HG22 3  
ATOM   1202  H  HG23 . THR A 1 3  ? 14.311  -1.539  -1.517  1.00 0.00 ? 3  THR A HG23 3  
ATOM   1203  N  N    . ARG A 1 4  ? 13.200  -2.760  -5.339  1.00 0.00 ? 4  ARG A N    3  
ATOM   1204  C  CA   . ARG A 1 4  ? 13.013  -3.907  -6.228  1.00 0.00 ? 4  ARG A CA   3  
ATOM   1205  C  C    . ARG A 1 4  ? 11.910  -3.620  -7.244  1.00 0.00 ? 4  ARG A C    3  
ATOM   1206  O  O    . ARG A 1 4  ? 10.909  -4.338  -7.314  1.00 0.00 ? 4  ARG A O    3  
ATOM   1207  C  CB   . ARG A 1 4  ? 12.676  -5.175  -5.431  1.00 0.00 ? 4  ARG A CB   3  
ATOM   1208  C  CG   . ARG A 1 4  ? 13.458  -5.322  -4.136  1.00 0.00 ? 4  ARG A CG   3  
ATOM   1209  C  CD   . ARG A 1 4  ? 14.633  -6.270  -4.299  1.00 0.00 ? 4  ARG A CD   3  
ATOM   1210  N  NE   . ARG A 1 4  ? 14.205  -7.651  -4.517  1.00 0.00 ? 4  ARG A NE   3  
ATOM   1211  C  CZ   . ARG A 1 4  ? 14.316  -8.621  -3.606  1.00 0.00 ? 4  ARG A CZ   3  
ATOM   1212  N  NH1  . ARG A 1 4  ? 14.808  -8.354  -2.401  1.00 0.00 ? 4  ARG A NH1  3  
ATOM   1213  N  NH2  . ARG A 1 4  ? 13.936  -9.856  -3.906  1.00 0.00 ? 4  ARG A NH2  3  
ATOM   1214  H  H    . ARG A 1 4  ? 14.092  -2.347  -5.279  1.00 0.00 ? 4  ARG A H    3  
ATOM   1215  H  HA   . ARG A 1 4  ? 13.940  -4.063  -6.758  1.00 0.00 ? 4  ARG A HA   3  
ATOM   1216  H  HB2  . ARG A 1 4  ? 11.625  -5.162  -5.187  1.00 0.00 ? 4  ARG A HB2  3  
ATOM   1217  H  HB3  . ARG A 1 4  ? 12.882  -6.038  -6.048  1.00 0.00 ? 4  ARG A HB3  3  
ATOM   1218  H  HG2  . ARG A 1 4  ? 13.829  -4.352  -3.839  1.00 0.00 ? 4  ARG A HG2  3  
ATOM   1219  H  HG3  . ARG A 1 4  ? 12.799  -5.708  -3.373  1.00 0.00 ? 4  ARG A HG3  3  
ATOM   1220  H  HD2  . ARG A 1 4  ? 15.221  -5.950  -5.147  1.00 0.00 ? 4  ARG A HD2  3  
ATOM   1221  H  HD3  . ARG A 1 4  ? 15.238  -6.227  -3.406  1.00 0.00 ? 4  ARG A HD3  3  
ATOM   1222  H  HE   . ARG A 1 4  ? 13.829  -7.872  -5.403  1.00 0.00 ? 4  ARG A HE   3  
ATOM   1223  H  HH11 . ARG A 1 4  ? 15.108  -7.420  -2.169  1.00 0.00 ? 4  ARG A HH11 3  
ATOM   1224  H  HH12 . ARG A 1 4  ? 14.878  -9.085  -1.708  1.00 0.00 ? 4  ARG A HH12 3  
ATOM   1225  H  HH21 . ARG A 1 4  ? 13.559  -10.063 -4.822  1.00 0.00 ? 4  ARG A HH21 3  
ATOM   1226  H  HH22 . ARG A 1 4  ? 14.027  -10.595 -3.229  1.00 0.00 ? 4  ARG A HH22 3  
ATOM   1227  N  N    . GLY A 1 5  ? 12.047  -2.501  -7.944  1.00 0.00 ? 5  GLY A N    3  
ATOM   1228  C  CA   . GLY A 1 5  ? 11.007  -2.065  -8.845  1.00 0.00 ? 5  GLY A CA   3  
ATOM   1229  C  C    . GLY A 1 5  ? 9.823   -1.517  -8.083  1.00 0.00 ? 5  GLY A C    3  
ATOM   1230  O  O    . GLY A 1 5  ? 9.876   -0.406  -7.562  1.00 0.00 ? 5  GLY A O    3  
ATOM   1231  H  H    . GLY A 1 5  ? 12.820  -1.920  -7.778  1.00 0.00 ? 5  GLY A H    3  
ATOM   1232  H  HA2  . GLY A 1 5  ? 11.401  -1.294  -9.490  1.00 0.00 ? 5  GLY A HA2  3  
ATOM   1233  H  HA3  . GLY A 1 5  ? 10.683  -2.901  -9.446  1.00 0.00 ? 5  GLY A HA3  3  
ATOM   1234  N  N    . SER A 1 6  ? 8.800   -2.335  -7.937  1.00 0.00 ? 6  SER A N    3  
ATOM   1235  C  CA   . SER A 1 6  ? 7.637   -1.972  -7.152  1.00 0.00 ? 6  SER A CA   3  
ATOM   1236  C  C    . SER A 1 6  ? 7.237   -3.131  -6.244  1.00 0.00 ? 6  SER A C    3  
ATOM   1237  O  O    . SER A 1 6  ? 6.098   -3.211  -5.783  1.00 0.00 ? 6  SER A O    3  
ATOM   1238  C  CB   . SER A 1 6  ? 6.480   -1.593  -8.074  1.00 0.00 ? 6  SER A CB   3  
ATOM   1239  O  OG   . SER A 1 6  ? 6.926   -0.786  -9.155  1.00 0.00 ? 6  SER A OG   3  
ATOM   1240  H  H    . SER A 1 6  ? 8.845   -3.233  -8.329  1.00 0.00 ? 6  SER A H    3  
ATOM   1241  H  HA   . SER A 1 6  ? 7.897   -1.119  -6.541  1.00 0.00 ? 6  SER A HA   3  
ATOM   1242  H  HB2  . SER A 1 6  ? 6.030   -2.491  -8.472  1.00 0.00 ? 6  SER A HB2  3  
ATOM   1243  H  HB3  . SER A 1 6  ? 5.745   -1.045  -7.512  1.00 0.00 ? 6  SER A HB3  3  
ATOM   1244  H  HG   . SER A 1 6  ? 7.303   0.036   -8.805  1.00 0.00 ? 6  SER A HG   3  
ATOM   1245  N  N    . THR A 1 7  ? 8.166   -4.055  -6.036  1.00 0.00 ? 7  THR A N    3  
ATOM   1246  C  CA   . THR A 1 7  ? 7.916   -5.216  -5.201  1.00 0.00 ? 7  THR A CA   3  
ATOM   1247  C  C    . THR A 1 7  ? 9.103   -5.503  -4.299  1.00 0.00 ? 7  THR A C    3  
ATOM   1248  O  O    . THR A 1 7  ? 9.852   -6.453  -4.528  1.00 0.00 ? 7  THR A O    3  
ATOM   1249  C  CB   . THR A 1 7  ? 7.614   -6.457  -6.059  1.00 0.00 ? 7  THR A CB   3  
ATOM   1250  O  OG1  . THR A 1 7  ? 8.335   -6.378  -7.298  1.00 0.00 ? 7  THR A OG1  3  
ATOM   1251  C  CG2  . THR A 1 7  ? 6.125   -6.569  -6.343  1.00 0.00 ? 7  THR A CG2  3  
ATOM   1252  H  H    . THR A 1 7  ? 9.048   -3.944  -6.442  1.00 0.00 ? 7  THR A H    3  
ATOM   1253  H  HA   . THR A 1 7  ? 7.058   -5.009  -4.575  1.00 0.00 ? 7  THR A HA   3  
ATOM   1254  H  HB   . THR A 1 7  ? 7.931   -7.339  -5.520  1.00 0.00 ? 7  THR A HB   3  
ATOM   1255  H  HG1  . THR A 1 7  ? 9.269   -6.590  -7.135  1.00 0.00 ? 7  THR A HG1  3  
ATOM   1256  H  HG21 . THR A 1 7  ? 5.942   -7.425  -6.975  1.00 0.00 ? 7  THR A HG21 3  
ATOM   1257  H  HG22 . THR A 1 7  ? 5.789   -5.673  -6.841  1.00 0.00 ? 7  THR A HG22 3  
ATOM   1258  H  HG23 . THR A 1 7  ? 5.588   -6.687  -5.412  1.00 0.00 ? 7  THR A HG23 3  
ATOM   1259  N  N    . GLY A 1 8  ? 9.262   -4.683  -3.276  1.00 0.00 ? 8  GLY A N    3  
ATOM   1260  C  CA   . GLY A 1 8  ? 10.331  -4.881  -2.326  1.00 0.00 ? 8  GLY A CA   3  
ATOM   1261  C  C    . GLY A 1 8  ? 10.053  -6.057  -1.415  1.00 0.00 ? 8  GLY A C    3  
ATOM   1262  O  O    . GLY A 1 8  ? 10.180  -7.217  -1.822  1.00 0.00 ? 8  GLY A O    3  
ATOM   1263  H  H    . GLY A 1 8  ? 8.645   -3.930  -3.164  1.00 0.00 ? 8  GLY A H    3  
ATOM   1264  H  HA2  . GLY A 1 8  ? 11.252  -5.060  -2.864  1.00 0.00 ? 8  GLY A HA2  3  
ATOM   1265  H  HA3  . GLY A 1 8  ? 10.440  -3.991  -1.726  1.00 0.00 ? 8  GLY A HA3  3  
ATOM   1266  N  N    . ILE A 1 9  ? 9.604   -5.772  -0.205  1.00 0.00 ? 9  ILE A N    3  
ATOM   1267  C  CA   . ILE A 1 9  ? 9.206   -6.828  0.708   1.00 0.00 ? 9  ILE A CA   3  
ATOM   1268  C  C    . ILE A 1 9  ? 7.810   -7.327  0.338   1.00 0.00 ? 9  ILE A C    3  
ATOM   1269  O  O    . ILE A 1 9  ? 7.005   -6.550  -0.178  1.00 0.00 ? 9  ILE A O    3  
ATOM   1270  C  CB   . ILE A 1 9  ? 9.206   -6.326  2.169   1.00 0.00 ? 9  ILE A CB   3  
ATOM   1271  C  CG1  . ILE A 1 9  ? 10.316  -5.293  2.385   1.00 0.00 ? 9  ILE A CG1  3  
ATOM   1272  C  CG2  . ILE A 1 9  ? 9.373   -7.488  3.138   1.00 0.00 ? 9  ILE A CG2  3  
ATOM   1273  C  CD1  . ILE A 1 9  ? 9.939   -4.193  3.355   1.00 0.00 ? 9  ILE A CD1  3  
ATOM   1274  H  H    . ILE A 1 9  ? 9.424   -4.838  0.029   1.00 0.00 ? 9  ILE A H    3  
ATOM   1275  H  HA   . ILE A 1 9  ? 9.911   -7.642  0.621   1.00 0.00 ? 9  ILE A HA   3  
ATOM   1276  H  HB   . ILE A 1 9  ? 8.253   -5.860  2.359   1.00 0.00 ? 9  ILE A HB   3  
ATOM   1277  H  HG12 . ILE A 1 9  ? 11.190  -5.790  2.777   1.00 0.00 ? 9  ILE A HG12 3  
ATOM   1278  H  HG13 . ILE A 1 9  ? 10.563  -4.833  1.439   1.00 0.00 ? 9  ILE A HG13 3  
ATOM   1279  H  HG21 . ILE A 1 9  ? 8.450   -8.048  3.189   1.00 0.00 ? 9  ILE A HG21 3  
ATOM   1280  H  HG22 . ILE A 1 9  ? 10.168  -8.134  2.796   1.00 0.00 ? 9  ILE A HG22 3  
ATOM   1281  H  HG23 . ILE A 1 9  ? 9.616   -7.107  4.120   1.00 0.00 ? 9  ILE A HG23 3  
ATOM   1282  H  HD11 . ILE A 1 9  ? 9.837   -3.259  2.820   1.00 0.00 ? 9  ILE A HD11 3  
ATOM   1283  H  HD12 . ILE A 1 9  ? 9.002   -4.439  3.832   1.00 0.00 ? 9  ILE A HD12 3  
ATOM   1284  H  HD13 . ILE A 1 9  ? 10.710  -4.094  4.104   1.00 0.00 ? 9  ILE A HD13 3  
ATOM   1285  N  N    . LYS A 1 10 ? 7.478   -8.558  0.752   1.00 0.00 ? 10 LYS A N    3  
ATOM   1286  C  CA   . LYS A 1 10 ? 6.155   -9.150  0.522   1.00 0.00 ? 10 LYS A CA   3  
ATOM   1287  C  C    . LYS A 1 10 ? 5.780   -9.191  -0.970  1.00 0.00 ? 10 LYS A C    3  
ATOM   1288  O  O    . LYS A 1 10 ? 6.242   -8.384  -1.774  1.00 0.00 ? 10 LYS A O    3  
ATOM   1289  C  CB   . LYS A 1 10 ? 5.080   -8.422  1.334   1.00 0.00 ? 10 LYS A CB   3  
ATOM   1290  C  CG   . LYS A 1 10 ? 4.566   -9.244  2.508   1.00 0.00 ? 10 LYS A CG   3  
ATOM   1291  C  CD   . LYS A 1 10 ? 4.703   -8.503  3.825   1.00 0.00 ? 10 LYS A CD   3  
ATOM   1292  C  CE   . LYS A 1 10 ? 6.145   -8.477  4.291   1.00 0.00 ? 10 LYS A CE   3  
ATOM   1293  N  NZ   . LYS A 1 10 ? 6.433   -9.548  5.276   1.00 0.00 ? 10 LYS A NZ   3  
ATOM   1294  H  H    . LYS A 1 10 ? 8.137   -9.076  1.264   1.00 0.00 ? 10 LYS A H    3  
ATOM   1295  H  HA   . LYS A 1 10 ? 6.203   -10.170 0.877   1.00 0.00 ? 10 LYS A HA   3  
ATOM   1296  H  HB2  . LYS A 1 10 ? 5.490   -7.499  1.715   1.00 0.00 ? 10 LYS A HB2  3  
ATOM   1297  H  HB3  . LYS A 1 10 ? 4.245   -8.200  0.687   1.00 0.00 ? 10 LYS A HB3  3  
ATOM   1298  H  HG2  . LYS A 1 10 ? 3.527   -9.472  2.347   1.00 0.00 ? 10 LYS A HG2  3  
ATOM   1299  H  HG3  . LYS A 1 10 ? 5.131   -10.163 2.565   1.00 0.00 ? 10 LYS A HG3  3  
ATOM   1300  H  HD2  . LYS A 1 10 ? 4.357   -7.488  3.696   1.00 0.00 ? 10 LYS A HD2  3  
ATOM   1301  H  HD3  . LYS A 1 10 ? 4.101   -8.998  4.573   1.00 0.00 ? 10 LYS A HD3  3  
ATOM   1302  H  HE2  . LYS A 1 10 ? 6.786   -8.612  3.433   1.00 0.00 ? 10 LYS A HE2  3  
ATOM   1303  H  HE3  . LYS A 1 10 ? 6.349   -7.517  4.743   1.00 0.00 ? 10 LYS A HE3  3  
ATOM   1304  H  HZ1  . LYS A 1 10 ? 5.947   -9.347  6.176   1.00 0.00 ? 10 LYS A HZ1  3  
ATOM   1305  H  HZ2  . LYS A 1 10 ? 7.460   -9.607  5.457   1.00 0.00 ? 10 LYS A HZ2  3  
ATOM   1306  H  HZ3  . LYS A 1 10 ? 6.107   -10.470 4.913   1.00 0.00 ? 10 LYS A HZ3  3  
ATOM   1307  N  N    . PRO A 1 11 ? 5.003   -10.201 -1.388  1.00 0.00 ? 11 PRO A N    3  
ATOM   1308  C  CA   . PRO A 1 11 ? 4.610   -10.355 -2.793  1.00 0.00 ? 11 PRO A CA   3  
ATOM   1309  C  C    . PRO A 1 11 ? 3.811   -9.157  -3.308  1.00 0.00 ? 11 PRO A C    3  
ATOM   1310  O  O    . PRO A 1 11 ? 3.787   -8.881  -4.508  1.00 0.00 ? 11 PRO A O    3  
ATOM   1311  C  CB   . PRO A 1 11 ? 3.745   -11.622 -2.795  1.00 0.00 ? 11 PRO A CB   3  
ATOM   1312  C  CG   . PRO A 1 11 ? 3.334   -11.814 -1.376  1.00 0.00 ? 11 PRO A CG   3  
ATOM   1313  C  CD   . PRO A 1 11 ? 4.466   -11.281 -0.546  1.00 0.00 ? 11 PRO A CD   3  
ATOM   1314  H  HA   . PRO A 1 11 ? 5.470   -10.506 -3.425  1.00 0.00 ? 11 PRO A HA   3  
ATOM   1315  H  HB2  . PRO A 1 11 ? 2.888   -11.473 -3.438  1.00 0.00 ? 11 PRO A HB2  3  
ATOM   1316  H  HB3  . PRO A 1 11 ? 4.329   -12.457 -3.153  1.00 0.00 ? 11 PRO A HB3  3  
ATOM   1317  H  HG2  . PRO A 1 11 ? 2.432   -11.258 -1.179  1.00 0.00 ? 11 PRO A HG2  3  
ATOM   1318  H  HG3  . PRO A 1 11 ? 3.185   -12.864 -1.175  1.00 0.00 ? 11 PRO A HG3  3  
ATOM   1319  H  HD2  . PRO A 1 11 ? 4.098   -10.894 0.392   1.00 0.00 ? 11 PRO A HD2  3  
ATOM   1320  H  HD3  . PRO A 1 11 ? 5.208   -12.046 -0.379  1.00 0.00 ? 11 PRO A HD3  3  
ATOM   1321  N  N    . PHE A 1 12 ? 3.181   -8.434  -2.390  1.00 0.00 ? 12 PHE A N    3  
ATOM   1322  C  CA   . PHE A 1 12 ? 2.380   -7.274  -2.736  1.00 0.00 ? 12 PHE A CA   3  
ATOM   1323  C  C    . PHE A 1 12 ? 2.751   -6.089  -1.859  1.00 0.00 ? 12 PHE A C    3  
ATOM   1324  O  O    . PHE A 1 12 ? 2.209   -5.919  -0.770  1.00 0.00 ? 12 PHE A O    3  
ATOM   1325  C  CB   . PHE A 1 12 ? 0.895   -7.595  -2.558  1.00 0.00 ? 12 PHE A CB   3  
ATOM   1326  C  CG   . PHE A 1 12 ? 0.438   -8.800  -3.328  1.00 0.00 ? 12 PHE A CG   3  
ATOM   1327  C  CD1  . PHE A 1 12 ? 0.430   -8.794  -4.714  1.00 0.00 ? 12 PHE A CD1  3  
ATOM   1328  C  CD2  . PHE A 1 12 ? 0.020   -9.941  -2.665  1.00 0.00 ? 12 PHE A CD2  3  
ATOM   1329  C  CE1  . PHE A 1 12 ? 0.013   -9.905  -5.423  1.00 0.00 ? 12 PHE A CE1  3  
ATOM   1330  C  CE2  . PHE A 1 12 ? -0.399  -11.052 -3.366  1.00 0.00 ? 12 PHE A CE2  3  
ATOM   1331  C  CZ   . PHE A 1 12 ? -0.404  -11.036 -4.747  1.00 0.00 ? 12 PHE A CZ   3  
ATOM   1332  H  H    . PHE A 1 12 ? 3.263   -8.683  -1.449  1.00 0.00 ? 12 PHE A H    3  
ATOM   1333  H  HA   . PHE A 1 12 ? 2.572   -7.026  -3.769  1.00 0.00 ? 12 PHE A HA   3  
ATOM   1334  H  HB2  . PHE A 1 12 ? 0.705   -7.782  -1.510  1.00 0.00 ? 12 PHE A HB2  3  
ATOM   1335  H  HB3  . PHE A 1 12 ? 0.308   -6.745  -2.881  1.00 0.00 ? 12 PHE A HB3  3  
ATOM   1336  H  HD1  . PHE A 1 12 ? 0.754   -7.909  -5.242  1.00 0.00 ? 12 PHE A HD1  3  
ATOM   1337  H  HD2  . PHE A 1 12 ? 0.021   -9.955  -1.585  1.00 0.00 ? 12 PHE A HD2  3  
ATOM   1338  H  HE1  . PHE A 1 12 ? 0.010   -9.889  -6.502  1.00 0.00 ? 12 PHE A HE1  3  
ATOM   1339  H  HE2  . PHE A 1 12 ? -0.726  -11.934 -2.834  1.00 0.00 ? 12 PHE A HE2  3  
ATOM   1340  H  HZ   . PHE A 1 12 ? -0.732  -11.905 -5.297  1.00 0.00 ? 12 PHE A HZ   3  
ATOM   1341  N  N    . GLN A 1 13 ? 3.656   -5.259  -2.331  1.00 0.00 ? 13 GLN A N    3  
ATOM   1342  C  CA   . GLN A 1 13 ? 4.042   -4.072  -1.591  1.00 0.00 ? 13 GLN A CA   3  
ATOM   1343  C  C    . GLN A 1 13 ? 3.320   -2.855  -2.166  1.00 0.00 ? 13 GLN A C    3  
ATOM   1344  O  O    . GLN A 1 13 ? 2.901   -2.871  -3.325  1.00 0.00 ? 13 GLN A O    3  
ATOM   1345  C  CB   . GLN A 1 13 ? 5.560   -3.867  -1.655  1.00 0.00 ? 13 GLN A CB   3  
ATOM   1346  C  CG   . GLN A 1 13 ? 6.000   -2.872  -2.713  1.00 0.00 ? 13 GLN A CG   3  
ATOM   1347  C  CD   . GLN A 1 13 ? 7.348   -2.261  -2.422  1.00 0.00 ? 13 GLN A CD   3  
ATOM   1348  O  OE1  . GLN A 1 13 ? 8.116   -1.960  -3.332  1.00 0.00 ? 13 GLN A OE1  3  
ATOM   1349  N  NE2  . GLN A 1 13 ? 7.643   -2.067  -1.152  1.00 0.00 ? 13 GLN A NE2  3  
ATOM   1350  H  H    . GLN A 1 13 ? 4.051   -5.427  -3.208  1.00 0.00 ? 13 GLN A H    3  
ATOM   1351  H  HA   . GLN A 1 13 ? 3.744   -4.207  -0.562  1.00 0.00 ? 13 GLN A HA   3  
ATOM   1352  H  HB2  . GLN A 1 13 ? 5.906   -3.514  -0.694  1.00 0.00 ? 13 GLN A HB2  3  
ATOM   1353  H  HB3  . GLN A 1 13 ? 6.027   -4.816  -1.870  1.00 0.00 ? 13 GLN A HB3  3  
ATOM   1354  H  HG2  . GLN A 1 13 ? 6.041   -3.372  -3.664  1.00 0.00 ? 13 GLN A HG2  3  
ATOM   1355  H  HG3  . GLN A 1 13 ? 5.276   -2.076  -2.757  1.00 0.00 ? 13 GLN A HG3  3  
ATOM   1356  H  HE21 . GLN A 1 13 ? 6.984   -2.332  -0.473  1.00 0.00 ? 13 GLN A HE21 3  
ATOM   1357  H  HE22 . GLN A 1 13 ? 8.504   -1.658  -0.936  1.00 0.00 ? 13 GLN A HE22 3  
ATOM   1358  N  N    . CYS A 1 14 ? 3.275   -1.766  -1.410  1.00 0.00 ? 14 CYS A N    3  
ATOM   1359  C  CA   . CYS A 1 14 ? 2.742   -0.527  -1.939  1.00 0.00 ? 14 CYS A CA   3  
ATOM   1360  C  C    . CYS A 1 14 ? 3.754   0.119   -2.869  1.00 0.00 ? 14 CYS A C    3  
ATOM   1361  O  O    . CYS A 1 14 ? 4.884   0.386   -2.463  1.00 0.00 ? 14 CYS A O    3  
ATOM   1362  C  CB   . CYS A 1 14 ? 2.402   0.470   -0.846  1.00 0.00 ? 14 CYS A CB   3  
ATOM   1363  S  SG   . CYS A 1 14 ? 1.767   2.036   -1.533  1.00 0.00 ? 14 CYS A SG   3  
ATOM   1364  H  H    . CYS A 1 14 ? 3.726   -1.767  -0.548  1.00 0.00 ? 14 CYS A H    3  
ATOM   1365  H  HA   . CYS A 1 14 ? 1.842   -0.755  -2.487  1.00 0.00 ? 14 CYS A HA   3  
ATOM   1366  H  HB2  . CYS A 1 14 ? 1.650   0.048   -0.192  1.00 0.00 ? 14 CYS A HB2  3  
ATOM   1367  H  HB3  . CYS A 1 14 ? 3.291   0.692   -0.275  1.00 0.00 ? 14 CYS A HB3  3  
ATOM   1368  N  N    . PRO A 1 15 ? 3.342   0.481   -4.085  1.00 0.00 ? 15 PRO A N    3  
ATOM   1369  C  CA   . PRO A 1 15 ? 4.205   1.203   -5.007  1.00 0.00 ? 15 PRO A CA   3  
ATOM   1370  C  C    . PRO A 1 15 ? 4.288   2.690   -4.668  1.00 0.00 ? 15 PRO A C    3  
ATOM   1371  O  O    . PRO A 1 15 ? 5.004   3.445   -5.325  1.00 0.00 ? 15 PRO A O    3  
ATOM   1372  C  CB   . PRO A 1 15 ? 3.514   0.994   -6.353  1.00 0.00 ? 15 PRO A CB   3  
ATOM   1373  C  CG   . PRO A 1 15 ? 2.064   0.886   -6.014  1.00 0.00 ? 15 PRO A CG   3  
ATOM   1374  C  CD   . PRO A 1 15 ? 1.993   0.260   -4.644  1.00 0.00 ? 15 PRO A CD   3  
ATOM   1375  H  HA   . PRO A 1 15 ? 5.199   0.783   -5.033  1.00 0.00 ? 15 PRO A HA   3  
ATOM   1376  H  HB2  . PRO A 1 15 ? 3.710   1.840   -6.995  1.00 0.00 ? 15 PRO A HB2  3  
ATOM   1377  H  HB3  . PRO A 1 15 ? 3.880   0.089   -6.813  1.00 0.00 ? 15 PRO A HB3  3  
ATOM   1378  H  HG2  . PRO A 1 15 ? 1.617   1.870   -5.999  1.00 0.00 ? 15 PRO A HG2  3  
ATOM   1379  H  HG3  . PRO A 1 15 ? 1.565   0.258   -6.737  1.00 0.00 ? 15 PRO A HG3  3  
ATOM   1380  H  HD2  . PRO A 1 15 ? 1.242   0.751   -4.044  1.00 0.00 ? 15 PRO A HD2  3  
ATOM   1381  H  HD3  . PRO A 1 15 ? 1.779   -0.796  -4.724  1.00 0.00 ? 15 PRO A HD3  3  
ATOM   1382  N  N    . ASP A 1 16 ? 3.528   3.114   -3.663  1.00 0.00 ? 16 ASP A N    3  
ATOM   1383  C  CA   . ASP A 1 16 ? 3.469   4.515   -3.286  1.00 0.00 ? 16 ASP A CA   3  
ATOM   1384  C  C    . ASP A 1 16 ? 4.157   4.754   -1.946  1.00 0.00 ? 16 ASP A C    3  
ATOM   1385  O  O    . ASP A 1 16 ? 4.853   5.752   -1.762  1.00 0.00 ? 16 ASP A O    3  
ATOM   1386  C  CB   . ASP A 1 16 ? 2.012   4.954   -3.202  1.00 0.00 ? 16 ASP A CB   3  
ATOM   1387  C  CG   . ASP A 1 16 ? 1.516   5.608   -4.474  1.00 0.00 ? 16 ASP A CG   3  
ATOM   1388  O  OD1  . ASP A 1 16 ? 2.110   6.622   -4.902  1.00 0.00 ? 16 ASP A OD1  3  
ATOM   1389  O  OD2  . ASP A 1 16 ? 0.523   5.109   -5.048  1.00 0.00 ? 16 ASP A OD2  3  
ATOM   1390  H  H    . ASP A 1 16 ? 2.955   2.470   -3.180  1.00 0.00 ? 16 ASP A H    3  
ATOM   1391  H  HA   . ASP A 1 16 ? 3.967   5.088   -4.048  1.00 0.00 ? 16 ASP A HA   3  
ATOM   1392  H  HB2  . ASP A 1 16 ? 1.400   4.088   -3.009  1.00 0.00 ? 16 ASP A HB2  3  
ATOM   1393  H  HB3  . ASP A 1 16 ? 1.903   5.650   -2.391  1.00 0.00 ? 16 ASP A HB3  3  
ATOM   1394  N  N    . CYS A 1 17 ? 3.955   3.831   -1.014  1.00 0.00 ? 17 CYS A N    3  
ATOM   1395  C  CA   . CYS A 1 17 ? 4.539   3.939   0.317   1.00 0.00 ? 17 CYS A CA   3  
ATOM   1396  C  C    . CYS A 1 17 ? 5.858   3.187   0.397   1.00 0.00 ? 17 CYS A C    3  
ATOM   1397  O  O    . CYS A 1 17 ? 6.648   3.423   1.315   1.00 0.00 ? 17 CYS A O    3  
ATOM   1398  C  CB   . CYS A 1 17 ? 3.601   3.358   1.386   1.00 0.00 ? 17 CYS A CB   3  
ATOM   1399  S  SG   . CYS A 1 17 ? 1.973   4.158   1.519   1.00 0.00 ? 17 CYS A SG   3  
ATOM   1400  H  H    . CYS A 1 17 ? 3.401   3.047   -1.234  1.00 0.00 ? 17 CYS A H    3  
ATOM   1401  H  HA   . CYS A 1 17 ? 4.711   4.981   0.520   1.00 0.00 ? 17 CYS A HA   3  
ATOM   1402  H  HB2  . CYS A 1 17 ? 3.429   2.316   1.164   1.00 0.00 ? 17 CYS A HB2  3  
ATOM   1403  H  HB3  . CYS A 1 17 ? 4.082   3.436   2.349   1.00 0.00 ? 17 CYS A HB3  3  
ATOM   1404  N  N    . ASP A 1 18 ? 5.917   2.097   -0.365  1.00 0.00 ? 18 ASP A N    3  
ATOM   1405  C  CA   . ASP A 1 18 ? 6.945   1.069   -0.208  1.00 0.00 ? 18 ASP A CA   3  
ATOM   1406  C  C    . ASP A 1 18 ? 6.579   0.203   0.989   1.00 0.00 ? 18 ASP A C    3  
ATOM   1407  O  O    . ASP A 1 18 ? 7.428   -0.198  1.788   1.00 0.00 ? 18 ASP A O    3  
ATOM   1408  C  CB   . ASP A 1 18 ? 8.356   1.651   -0.049  1.00 0.00 ? 18 ASP A CB   3  
ATOM   1409  C  CG   . ASP A 1 18 ? 9.402   0.844   -0.789  1.00 0.00 ? 18 ASP A CG   3  
ATOM   1410  O  OD1  . ASP A 1 18 ? 9.838   -0.201  -0.269  1.00 0.00 ? 18 ASP A OD1  3  
ATOM   1411  O  OD2  . ASP A 1 18 ? 9.814   1.269   -1.891  1.00 0.00 ? 18 ASP A OD2  3  
ATOM   1412  H  H    . ASP A 1 18 ? 5.142   1.888   -0.928  1.00 0.00 ? 18 ASP A H    3  
ATOM   1413  H  HA   . ASP A 1 18 ? 6.917   0.448   -1.094  1.00 0.00 ? 18 ASP A HA   3  
ATOM   1414  H  HB2  . ASP A 1 18 ? 8.367   2.659   -0.435  1.00 0.00 ? 18 ASP A HB2  3  
ATOM   1415  H  HB3  . ASP A 1 18 ? 8.616   1.669   1.000   1.00 0.00 ? 18 ASP A HB3  3  
ATOM   1416  N  N    . ARG A 1 19 ? 5.281   -0.059  1.103   1.00 0.00 ? 19 ARG A N    3  
ATOM   1417  C  CA   . ARG A 1 19 ? 4.736   -0.885  2.173   1.00 0.00 ? 19 ARG A CA   3  
ATOM   1418  C  C    . ARG A 1 19 ? 4.967   -2.358  1.856   1.00 0.00 ? 19 ARG A C    3  
ATOM   1419  O  O    . ARG A 1 19 ? 5.803   -2.686  1.017   1.00 0.00 ? 19 ARG A O    3  
ATOM   1420  C  CB   . ARG A 1 19 ? 3.241   -0.611  2.332   1.00 0.00 ? 19 ARG A CB   3  
ATOM   1421  C  CG   . ARG A 1 19 ? 2.932   0.551   3.254   1.00 0.00 ? 19 ARG A CG   3  
ATOM   1422  C  CD   . ARG A 1 19 ? 1.799   0.211   4.204   1.00 0.00 ? 19 ARG A CD   3  
ATOM   1423  N  NE   . ARG A 1 19 ? 0.611   1.030   3.971   1.00 0.00 ? 19 ARG A NE   3  
ATOM   1424  C  CZ   . ARG A 1 19 ? 0.305   2.104   4.717   1.00 0.00 ? 19 ARG A CZ   3  
ATOM   1425  N  NH1  . ARG A 1 19 ? 1.132   2.513   5.669   1.00 0.00 ? 19 ARG A NH1  3  
ATOM   1426  N  NH2  . ARG A 1 19 ? -0.819  2.777   4.513   1.00 0.00 ? 19 ARG A NH2  3  
ATOM   1427  H  H    . ARG A 1 19 ? 4.671   0.309   0.432   1.00 0.00 ? 19 ARG A H    3  
ATOM   1428  H  HA   . ARG A 1 19 ? 5.243   -0.635  3.092   1.00 0.00 ? 19 ARG A HA   3  
ATOM   1429  H  HB2  . ARG A 1 19 ? 2.823   -0.394  1.361   1.00 0.00 ? 19 ARG A HB2  3  
ATOM   1430  H  HB3  . ARG A 1 19 ? 2.764   -1.496  2.729   1.00 0.00 ? 19 ARG A HB3  3  
ATOM   1431  H  HG2  . ARG A 1 19 ? 3.814   0.786   3.831   1.00 0.00 ? 19 ARG A HG2  3  
ATOM   1432  H  HG3  . ARG A 1 19 ? 2.648   1.407   2.659   1.00 0.00 ? 19 ARG A HG3  3  
ATOM   1433  H  HD2  . ARG A 1 19 ? 1.539   -0.829  4.072   1.00 0.00 ? 19 ARG A HD2  3  
ATOM   1434  H  HD3  . ARG A 1 19 ? 2.140   0.368   5.217   1.00 0.00 ? 19 ARG A HD3  3  
ATOM   1435  H  HE   . ARG A 1 19 ? -0.003  0.745   3.238   1.00 0.00 ? 19 ARG A HE   3  
ATOM   1436  H  HH11 . ARG A 1 19 ? 1.996   2.022   5.844   1.00 0.00 ? 19 ARG A HH11 3  
ATOM   1437  H  HH12 . ARG A 1 19 ? 0.898   3.320   6.228   1.00 0.00 ? 19 ARG A HH12 3  
ATOM   1438  H  HH21 . ARG A 1 19 ? -1.459  2.489   3.806   1.00 0.00 ? 19 ARG A HH21 3  
ATOM   1439  H  HH22 . ARG A 1 19 ? -1.029  3.592   5.069   1.00 0.00 ? 19 ARG A HH22 3  
ATOM   1440  N  N    . SER A 1 20 ? 4.213   -3.242  2.493   1.00 0.00 ? 20 SER A N    3  
ATOM   1441  C  CA   . SER A 1 20 ? 4.345   -4.669  2.227   1.00 0.00 ? 20 SER A CA   3  
ATOM   1442  C  C    . SER A 1 20 ? 3.162   -5.457  2.785   1.00 0.00 ? 20 SER A C    3  
ATOM   1443  O  O    . SER A 1 20 ? 2.848   -5.379  3.977   1.00 0.00 ? 20 SER A O    3  
ATOM   1444  C  CB   . SER A 1 20 ? 5.656   -5.202  2.811   1.00 0.00 ? 20 SER A CB   3  
ATOM   1445  O  OG   . SER A 1 20 ? 6.011   -4.523  4.007   1.00 0.00 ? 20 SER A OG   3  
ATOM   1446  H  H    . SER A 1 20 ? 3.540   -2.930  3.150   1.00 0.00 ? 20 SER A H    3  
ATOM   1447  H  HA   . SER A 1 20 ? 4.365   -4.798  1.156   1.00 0.00 ? 20 SER A HA   3  
ATOM   1448  H  HB2  . SER A 1 20 ? 5.545   -6.254  3.029   1.00 0.00 ? 20 SER A HB2  3  
ATOM   1449  H  HB3  . SER A 1 20 ? 6.449   -5.068  2.087   1.00 0.00 ? 20 SER A HB3  3  
ATOM   1450  H  HG   . SER A 1 20 ? 6.222   -3.600  3.802   1.00 0.00 ? 20 SER A HG   3  
ATOM   1451  N  N    . PHE A 1 21 ? 2.481   -6.181  1.908   1.00 0.00 ? 21 PHE A N    3  
ATOM   1452  C  CA   . PHE A 1 21 ? 1.316   -6.964  2.286   1.00 0.00 ? 21 PHE A CA   3  
ATOM   1453  C  C    . PHE A 1 21 ? 1.392   -8.350  1.674   1.00 0.00 ? 21 PHE A C    3  
ATOM   1454  O  O    . PHE A 1 21 ? 1.818   -8.514  0.530   1.00 0.00 ? 21 PHE A O    3  
ATOM   1455  C  CB   . PHE A 1 21 ? 0.028   -6.273  1.831   1.00 0.00 ? 21 PHE A CB   3  
ATOM   1456  C  CG   . PHE A 1 21 ? -0.092  -4.863  2.318   1.00 0.00 ? 21 PHE A CG   3  
ATOM   1457  C  CD1  . PHE A 1 21 ? 0.527   -3.830  1.638   1.00 0.00 ? 21 PHE A CD1  3  
ATOM   1458  C  CD2  . PHE A 1 21 ? -0.817  -4.573  3.460   1.00 0.00 ? 21 PHE A CD2  3  
ATOM   1459  C  CE1  . PHE A 1 21 ? 0.428   -2.534  2.089   1.00 0.00 ? 21 PHE A CE1  3  
ATOM   1460  C  CE2  . PHE A 1 21 ? -0.920  -3.277  3.917   1.00 0.00 ? 21 PHE A CE2  3  
ATOM   1461  C  CZ   . PHE A 1 21 ? -0.296  -2.256  3.230   1.00 0.00 ? 21 PHE A CZ   3  
ATOM   1462  H  H    . PHE A 1 21 ? 2.756   -6.173  0.962   1.00 0.00 ? 21 PHE A H    3  
ATOM   1463  H  HA   . PHE A 1 21 ? 1.308   -7.056  3.362   1.00 0.00 ? 21 PHE A HA   3  
ATOM   1464  H  HB2  . PHE A 1 21 ? -0.003  -6.257  0.752   1.00 0.00 ? 21 PHE A HB2  3  
ATOM   1465  H  HB3  . PHE A 1 21 ? -0.822  -6.827  2.203   1.00 0.00 ? 21 PHE A HB3  3  
ATOM   1466  H  HD1  . PHE A 1 21 ? 1.100   -4.049  0.747   1.00 0.00 ? 21 PHE A HD1  3  
ATOM   1467  H  HD2  . PHE A 1 21 ? -1.302  -5.374  3.998   1.00 0.00 ? 21 PHE A HD2  3  
ATOM   1468  H  HE1  . PHE A 1 21 ? 0.913   -1.736  1.551   1.00 0.00 ? 21 PHE A HE1  3  
ATOM   1469  H  HE2  . PHE A 1 21 ? -1.488  -3.061  4.811   1.00 0.00 ? 21 PHE A HE2  3  
ATOM   1470  H  HZ   . PHE A 1 21 ? -0.369  -1.239  3.587   1.00 0.00 ? 21 PHE A HZ   3  
ATOM   1471  N  N    . SER A 1 22 ? 0.986   -9.344  2.442   1.00 0.00 ? 22 SER A N    3  
ATOM   1472  C  CA   . SER A 1 22 ? 0.975   -10.711 1.965   1.00 0.00 ? 22 SER A CA   3  
ATOM   1473  C  C    . SER A 1 22 ? -0.239  -10.932 1.072   1.00 0.00 ? 22 SER A C    3  
ATOM   1474  O  O    . SER A 1 22 ? -0.227  -11.770 0.172   1.00 0.00 ? 22 SER A O    3  
ATOM   1475  C  CB   . SER A 1 22 ? 0.943   -11.669 3.154   1.00 0.00 ? 22 SER A CB   3  
ATOM   1476  O  OG   . SER A 1 22 ? 0.875   -10.953 4.381   1.00 0.00 ? 22 SER A OG   3  
ATOM   1477  H  H    . SER A 1 22 ? 0.677   -9.154  3.353   1.00 0.00 ? 22 SER A H    3  
ATOM   1478  H  HA   . SER A 1 22 ? 1.876   -10.876 1.392   1.00 0.00 ? 22 SER A HA   3  
ATOM   1479  H  HB2  . SER A 1 22 ? 0.076   -12.309 3.077   1.00 0.00 ? 22 SER A HB2  3  
ATOM   1480  H  HB3  . SER A 1 22 ? 1.838   -12.273 3.155   1.00 0.00 ? 22 SER A HB3  3  
ATOM   1481  H  HG   . SER A 1 22 ? 1.235   -11.503 5.090   1.00 0.00 ? 22 SER A HG   3  
ATOM   1482  N  N    . ARG A 1 23 ? -1.266  -10.122 1.300   1.00 0.00 ? 23 ARG A N    3  
ATOM   1483  C  CA   . ARG A 1 23 ? -2.482  -10.171 0.506   1.00 0.00 ? 23 ARG A CA   3  
ATOM   1484  C  C    . ARG A 1 23 ? -2.664  -8.872  -0.260  1.00 0.00 ? 23 ARG A C    3  
ATOM   1485  O  O    . ARG A 1 23 ? -2.602  -7.784  0.318   1.00 0.00 ? 23 ARG A O    3  
ATOM   1486  C  CB   . ARG A 1 23 ? -3.701  -10.417 1.396   1.00 0.00 ? 23 ARG A CB   3  
ATOM   1487  C  CG   . ARG A 1 23 ? -3.553  -11.602 2.332   1.00 0.00 ? 23 ARG A CG   3  
ATOM   1488  C  CD   . ARG A 1 23 ? -4.879  -12.315 2.527   1.00 0.00 ? 23 ARG A CD   3  
ATOM   1489  N  NE   . ARG A 1 23 ? -5.957  -11.384 2.856   1.00 0.00 ? 23 ARG A NE   3  
ATOM   1490  C  CZ   . ARG A 1 23 ? -6.901  -11.615 3.763   1.00 0.00 ? 23 ARG A CZ   3  
ATOM   1491  N  NH1  . ARG A 1 23 ? -6.927  -12.758 4.438   1.00 0.00 ? 23 ARG A NH1  3  
ATOM   1492  N  NH2  . ARG A 1 23 ? -7.831  -10.693 3.975   1.00 0.00 ? 23 ARG A NH2  3  
ATOM   1493  H  H    . ARG A 1 23 ? -1.188  -9.442  2.001   1.00 0.00 ? 23 ARG A H    3  
ATOM   1494  H  HA   . ARG A 1 23 ? -2.391  -10.978 -0.202  1.00 0.00 ? 23 ARG A HA   3  
ATOM   1495  H  HB2  . ARG A 1 23 ? -3.879  -9.537  1.994   1.00 0.00 ? 23 ARG A HB2  3  
ATOM   1496  H  HB3  . ARG A 1 23 ? -4.561  -10.591 0.767   1.00 0.00 ? 23 ARG A HB3  3  
ATOM   1497  H  HG2  . ARG A 1 23 ? -2.838  -12.296 1.912   1.00 0.00 ? 23 ARG A HG2  3  
ATOM   1498  H  HG3  . ARG A 1 23 ? -3.200  -11.248 3.292   1.00 0.00 ? 23 ARG A HG3  3  
ATOM   1499  H  HD2  . ARG A 1 23 ? -5.130  -12.828 1.613   1.00 0.00 ? 23 ARG A HD2  3  
ATOM   1500  H  HD3  . ARG A 1 23 ? -4.777  -13.031 3.328   1.00 0.00 ? 23 ARG A HD3  3  
ATOM   1501  H  HE   . ARG A 1 23 ? -5.977  -10.525 2.369   1.00 0.00 ? 23 ARG A HE   3  
ATOM   1502  H  HH11 . ARG A 1 23 ? -6.233  -13.463 4.266   1.00 0.00 ? 23 ARG A HH11 3  
ATOM   1503  H  HH12 . ARG A 1 23 ? -7.635  -12.919 5.137   1.00 0.00 ? 23 ARG A HH12 3  
ATOM   1504  H  HH21 . ARG A 1 23 ? -7.810  -9.830  3.452   1.00 0.00 ? 23 ARG A HH21 3  
ATOM   1505  H  HH22 . ARG A 1 23 ? -8.569  -10.851 4.646   1.00 0.00 ? 23 ARG A HH22 3  
ATOM   1506  N  N    . SER A 1 24 ? -2.970  -9.000  -1.541  1.00 0.00 ? 24 SER A N    3  
ATOM   1507  C  CA   . SER A 1 24 ? -3.251  -7.852  -2.389  1.00 0.00 ? 24 SER A CA   3  
ATOM   1508  C  C    . SER A 1 24 ? -4.513  -7.146  -1.908  1.00 0.00 ? 24 SER A C    3  
ATOM   1509  O  O    . SER A 1 24 ? -4.675  -5.939  -2.084  1.00 0.00 ? 24 SER A O    3  
ATOM   1510  C  CB   . SER A 1 24 ? -3.418  -8.306  -3.837  1.00 0.00 ? 24 SER A CB   3  
ATOM   1511  O  OG   . SER A 1 24 ? -2.595  -7.556  -4.716  1.00 0.00 ? 24 SER A OG   3  
ATOM   1512  H  H    . SER A 1 24 ? -3.068  -9.902  -1.918  1.00 0.00 ? 24 SER A H    3  
ATOM   1513  H  HA   . SER A 1 24 ? -2.415  -7.171  -2.321  1.00 0.00 ? 24 SER A HA   3  
ATOM   1514  H  HB2  . SER A 1 24 ? -3.148  -9.347  -3.917  1.00 0.00 ? 24 SER A HB2  3  
ATOM   1515  H  HB3  . SER A 1 24 ? -4.449  -8.181  -4.133  1.00 0.00 ? 24 SER A HB3  3  
ATOM   1516  H  HG   . SER A 1 24 ? -2.921  -6.638  -4.760  1.00 0.00 ? 24 SER A HG   3  
ATOM   1517  N  N    . ASP A 1 25 ? -5.383  -7.912  -1.267  1.00 0.00 ? 25 ASP A N    3  
ATOM   1518  C  CA   . ASP A 1 25 ? -6.610  -7.392  -0.705  1.00 0.00 ? 25 ASP A CA   3  
ATOM   1519  C  C    . ASP A 1 25 ? -6.313  -6.337  0.360   1.00 0.00 ? 25 ASP A C    3  
ATOM   1520  O  O    . ASP A 1 25 ? -6.909  -5.262  0.357   1.00 0.00 ? 25 ASP A O    3  
ATOM   1521  C  CB   . ASP A 1 25 ? -7.416  -8.565  -0.135  1.00 0.00 ? 25 ASP A CB   3  
ATOM   1522  C  CG   . ASP A 1 25 ? -7.722  -8.448  1.345   1.00 0.00 ? 25 ASP A CG   3  
ATOM   1523  O  OD1  . ASP A 1 25 ? -6.869  -8.853  2.164   1.00 0.00 ? 25 ASP A OD1  3  
ATOM   1524  O  OD2  . ASP A 1 25 ? -8.824  -7.979  1.696   1.00 0.00 ? 25 ASP A OD2  3  
ATOM   1525  H  H    . ASP A 1 25 ? -5.198  -8.872  -1.176  1.00 0.00 ? 25 ASP A H    3  
ATOM   1526  H  HA   . ASP A 1 25 ? -7.171  -6.933  -1.503  1.00 0.00 ? 25 ASP A HA   3  
ATOM   1527  H  HB2  . ASP A 1 25 ? -8.341  -8.636  -0.668  1.00 0.00 ? 25 ASP A HB2  3  
ATOM   1528  H  HB3  . ASP A 1 25 ? -6.856  -9.474  -0.291  1.00 0.00 ? 25 ASP A HB3  3  
ATOM   1529  N  N    . HIS A 1 26 ? -5.311  -6.606  1.191   1.00 0.00 ? 26 HIS A N    3  
ATOM   1530  C  CA   . HIS A 1 26 ? -4.886  -5.657  2.213   1.00 0.00 ? 26 HIS A CA   3  
ATOM   1531  C  C    . HIS A 1 26 ? -4.203  -4.460  1.571   1.00 0.00 ? 26 HIS A C    3  
ATOM   1532  O  O    . HIS A 1 26 ? -4.386  -3.321  2.003   1.00 0.00 ? 26 HIS A O    3  
ATOM   1533  C  CB   . HIS A 1 26 ? -3.941  -6.328  3.212   1.00 0.00 ? 26 HIS A CB   3  
ATOM   1534  C  CG   . HIS A 1 26 ? -4.617  -6.752  4.474   1.00 0.00 ? 26 HIS A CG   3  
ATOM   1535  N  ND1  . HIS A 1 26 ? -4.042  -6.623  5.720   1.00 0.00 ? 26 HIS A ND1  3  
ATOM   1536  C  CD2  . HIS A 1 26 ? -5.831  -7.311  4.678   1.00 0.00 ? 26 HIS A CD2  3  
ATOM   1537  C  CE1  . HIS A 1 26 ? -4.872  -7.086  6.635   1.00 0.00 ? 26 HIS A CE1  3  
ATOM   1538  N  NE2  . HIS A 1 26 ? -5.965  -7.509  6.028   1.00 0.00 ? 26 HIS A NE2  3  
ATOM   1539  H  H    . HIS A 1 26 ? -4.824  -7.450  1.091   1.00 0.00 ? 26 HIS A H    3  
ATOM   1540  H  HA   . HIS A 1 26 ? -5.768  -5.315  2.734   1.00 0.00 ? 26 HIS A HA   3  
ATOM   1541  H  HB2  . HIS A 1 26 ? -3.512  -7.207  2.756   1.00 0.00 ? 26 HIS A HB2  3  
ATOM   1542  H  HB3  . HIS A 1 26 ? -3.152  -5.640  3.470   1.00 0.00 ? 26 HIS A HB3  3  
ATOM   1543  H  HD1  . HIS A 1 26 ? -3.147  -6.240  5.911   1.00 0.00 ? 26 HIS A HD1  3  
ATOM   1544  H  HD2  . HIS A 1 26 ? -6.561  -7.556  3.915   1.00 0.00 ? 26 HIS A HD2  3  
ATOM   1545  H  HE1  . HIS A 1 26 ? -4.687  -7.117  7.698   1.00 0.00 ? 26 HIS A HE1  3  
ATOM   1546  H  HE2  . HIS A 1 26 ? -6.708  -7.992  6.464   1.00 0.00 ? 26 HIS A HE2  3  
ATOM   1547  N  N    . LEU A 1 27 ? -3.481  -4.726  0.490   1.00 0.00 ? 27 LEU A N    3  
ATOM   1548  C  CA   . LEU A 1 27 ? -2.852  -3.676  -0.297  1.00 0.00 ? 27 LEU A CA   3  
ATOM   1549  C  C    . LEU A 1 27 ? -3.899  -2.664  -0.752  1.00 0.00 ? 27 LEU A C    3  
ATOM   1550  O  O    . LEU A 1 27 ? -3.814  -1.477  -0.430  1.00 0.00 ? 27 LEU A O    3  
ATOM   1551  C  CB   . LEU A 1 27 ? -2.161  -4.279  -1.526  1.00 0.00 ? 27 LEU A CB   3  
ATOM   1552  C  CG   . LEU A 1 27 ? -1.187  -3.361  -2.274  1.00 0.00 ? 27 LEU A CG   3  
ATOM   1553  C  CD1  . LEU A 1 27 ? -0.739  -2.195  -1.413  1.00 0.00 ? 27 LEU A CD1  3  
ATOM   1554  C  CD2  . LEU A 1 27 ? 0.013   -4.138  -2.771  1.00 0.00 ? 27 LEU A CD2  3  
ATOM   1555  H  H    . LEU A 1 27 ? -3.432  -5.651  0.169   1.00 0.00 ? 27 LEU A H    3  
ATOM   1556  H  HA   . LEU A 1 27 ? -2.118  -3.178  0.320   1.00 0.00 ? 27 LEU A HA   3  
ATOM   1557  H  HB2  . LEU A 1 27 ? -1.615  -5.156  -1.207  1.00 0.00 ? 27 LEU A HB2  3  
ATOM   1558  H  HB3  . LEU A 1 27 ? -2.926  -4.591  -2.222  1.00 0.00 ? 27 LEU A HB3  3  
ATOM   1559  H  HG   . LEU A 1 27 ? -1.693  -2.953  -3.136  1.00 0.00 ? 27 LEU A HG   3  
ATOM   1560  H  HD11 . LEU A 1 27 ? -0.143  -1.518  -2.007  1.00 0.00 ? 27 LEU A HD11 3  
ATOM   1561  H  HD12 . LEU A 1 27 ? -1.605  -1.675  -1.032  1.00 0.00 ? 27 LEU A HD12 3  
ATOM   1562  H  HD13 . LEU A 1 27 ? -0.147  -2.564  -0.587  1.00 0.00 ? 27 LEU A HD13 3  
ATOM   1563  H  HD21 . LEU A 1 27 ? 0.543   -4.560  -1.929  1.00 0.00 ? 27 LEU A HD21 3  
ATOM   1564  H  HD22 . LEU A 1 27 ? -0.315  -4.930  -3.426  1.00 0.00 ? 27 LEU A HD22 3  
ATOM   1565  H  HD23 . LEU A 1 27 ? 0.669   -3.471  -3.313  1.00 0.00 ? 27 LEU A HD23 3  
ATOM   1566  N  N    . ALA A 1 28 ? -4.871  -3.152  -1.518  1.00 0.00 ? 28 ALA A N    3  
ATOM   1567  C  CA   . ALA A 1 28 ? -5.926  -2.314  -2.075  1.00 0.00 ? 28 ALA A CA   3  
ATOM   1568  C  C    . ALA A 1 28 ? -6.666  -1.532  -0.993  1.00 0.00 ? 28 ALA A C    3  
ATOM   1569  O  O    . ALA A 1 28 ? -7.024  -0.374  -1.199  1.00 0.00 ? 28 ALA A O    3  
ATOM   1570  C  CB   . ALA A 1 28 ? -6.905  -3.164  -2.874  1.00 0.00 ? 28 ALA A CB   3  
ATOM   1571  H  H    . ALA A 1 28 ? -4.860  -4.112  -1.741  1.00 0.00 ? 28 ALA A H    3  
ATOM   1572  H  HA   . ALA A 1 28 ? -5.462  -1.613  -2.756  1.00 0.00 ? 28 ALA A HA   3  
ATOM   1573  H  HB1  . ALA A 1 28 ? -7.707  -3.491  -2.228  1.00 0.00 ? 28 ALA A HB1  3  
ATOM   1574  H  HB2  . ALA A 1 28 ? -7.311  -2.578  -3.684  1.00 0.00 ? 28 ALA A HB2  3  
ATOM   1575  H  HB3  . ALA A 1 28 ? -6.391  -4.025  -3.276  1.00 0.00 ? 28 ALA A HB3  3  
ATOM   1576  N  N    . LEU A 1 29 ? -6.897  -2.169  0.156   1.00 0.00 ? 29 LEU A N    3  
ATOM   1577  C  CA   . LEU A 1 29 ? -7.602  -1.525  1.261   1.00 0.00 ? 29 LEU A CA   3  
ATOM   1578  C  C    . LEU A 1 29 ? -6.892  -0.248  1.695   1.00 0.00 ? 29 LEU A C    3  
ATOM   1579  O  O    . LEU A 1 29 ? -7.501  0.818   1.769   1.00 0.00 ? 29 LEU A O    3  
ATOM   1580  C  CB   . LEU A 1 29 ? -7.721  -2.476  2.448   1.00 0.00 ? 29 LEU A CB   3  
ATOM   1581  C  CG   . LEU A 1 29 ? -8.650  -3.671  2.233   1.00 0.00 ? 29 LEU A CG   3  
ATOM   1582  C  CD1  . LEU A 1 29 ? -8.425  -4.718  3.312   1.00 0.00 ? 29 LEU A CD1  3  
ATOM   1583  C  CD2  . LEU A 1 29 ? -10.102 -3.223  2.217   1.00 0.00 ? 29 LEU A CD2  3  
ATOM   1584  H  H    . LEU A 1 29 ? -6.596  -3.101  0.257   1.00 0.00 ? 29 LEU A H    3  
ATOM   1585  H  HA   . LEU A 1 29 ? -8.592  -1.271  0.921   1.00 0.00 ? 29 LEU A HA   3  
ATOM   1586  H  HB2  . LEU A 1 29 ? -6.736  -2.850  2.684   1.00 0.00 ? 29 LEU A HB2  3  
ATOM   1587  H  HB3  . LEU A 1 29 ? -8.087  -1.913  3.290   1.00 0.00 ? 29 LEU A HB3  3  
ATOM   1588  H  HG   . LEU A 1 29 ? -8.427  -4.124  1.278   1.00 0.00 ? 29 LEU A HG   3  
ATOM   1589  H  HD11 . LEU A 1 29 ? -9.339  -5.269  3.474   1.00 0.00 ? 29 LEU A HD11 3  
ATOM   1590  H  HD12 . LEU A 1 29 ? -7.646  -5.396  2.998   1.00 0.00 ? 29 LEU A HD12 3  
ATOM   1591  H  HD13 . LEU A 1 29 ? -8.130  -4.231  4.230   1.00 0.00 ? 29 LEU A HD13 3  
ATOM   1592  H  HD21 . LEU A 1 29 ? -10.460 -3.118  3.231   1.00 0.00 ? 29 LEU A HD21 3  
ATOM   1593  H  HD22 . LEU A 1 29 ? -10.179 -2.274  1.709   1.00 0.00 ? 29 LEU A HD22 3  
ATOM   1594  H  HD23 . LEU A 1 29 ? -10.700 -3.959  1.698   1.00 0.00 ? 29 LEU A HD23 3  
ATOM   1595  N  N    . HIS A 1 30 ? -5.589  -0.346  1.919   1.00 0.00 ? 30 HIS A N    3  
ATOM   1596  C  CA   . HIS A 1 30 ? -4.796  0.814   2.300   1.00 0.00 ? 30 HIS A CA   3  
ATOM   1597  C  C    . HIS A 1 30 ? -4.655  1.776   1.119   1.00 0.00 ? 30 HIS A C    3  
ATOM   1598  O  O    . HIS A 1 30 ? -4.524  2.985   1.303   1.00 0.00 ? 30 HIS A O    3  
ATOM   1599  C  CB   . HIS A 1 30 ? -3.421  0.378   2.843   1.00 0.00 ? 30 HIS A CB   3  
ATOM   1600  C  CG   . HIS A 1 30 ? -2.251  0.745   1.988   1.00 0.00 ? 30 HIS A CG   3  
ATOM   1601  N  ND1  . HIS A 1 30 ? -1.574  -0.158  1.219   1.00 0.00 ? 30 HIS A ND1  3  
ATOM   1602  C  CD2  . HIS A 1 30 ? -1.633  1.941   1.801   1.00 0.00 ? 30 HIS A CD2  3  
ATOM   1603  C  CE1  . HIS A 1 30 ? -0.585  0.493   0.605   1.00 0.00 ? 30 HIS A CE1  3  
ATOM   1604  N  NE2  . HIS A 1 30 ? -0.577  1.768   0.924   1.00 0.00 ? 30 HIS A NE2  3  
ATOM   1605  H  H    . HIS A 1 30 ? -5.148  -1.218  1.801   1.00 0.00 ? 30 HIS A H    3  
ATOM   1606  H  HA   . HIS A 1 30 ? -5.323  1.325   3.090   1.00 0.00 ? 30 HIS A HA   3  
ATOM   1607  H  HB2  . HIS A 1 30 ? -3.270  0.832   3.810   1.00 0.00 ? 30 HIS A HB2  3  
ATOM   1608  H  HB3  . HIS A 1 30 ? -3.412  -0.695  2.959   1.00 0.00 ? 30 HIS A HB3  3  
ATOM   1609  H  HD1  . HIS A 1 30 ? -1.789  -1.114  1.122   1.00 0.00 ? 30 HIS A HD1  3  
ATOM   1610  H  HD2  . HIS A 1 30 ? -1.912  2.878   2.262   1.00 0.00 ? 30 HIS A HD2  3  
ATOM   1611  H  HE1  . HIS A 1 30 ? 0.118   0.032   -0.069  1.00 0.00 ? 30 HIS A HE1  3  
ATOM   1612  N  N    . ARG A 1 31 ? -4.663  1.236   -0.094  1.00 0.00 ? 31 ARG A N    3  
ATOM   1613  C  CA   . ARG A 1 31 ? -4.479  2.056   -1.283  1.00 0.00 ? 31 ARG A CA   3  
ATOM   1614  C  C    . ARG A 1 31 ? -5.732  2.862   -1.604  1.00 0.00 ? 31 ARG A C    3  
ATOM   1615  O  O    . ARG A 1 31 ? -5.709  3.723   -2.481  1.00 0.00 ? 31 ARG A O    3  
ATOM   1616  C  CB   . ARG A 1 31 ? -4.055  1.210   -2.484  1.00 0.00 ? 31 ARG A CB   3  
ATOM   1617  C  CG   . ARG A 1 31 ? -2.624  0.700   -2.376  1.00 0.00 ? 31 ARG A CG   3  
ATOM   1618  C  CD   . ARG A 1 31 ? -1.964  0.544   -3.737  1.00 0.00 ? 31 ARG A CD   3  
ATOM   1619  N  NE   . ARG A 1 31 ? -1.507  1.820   -4.286  1.00 0.00 ? 31 ARG A NE   3  
ATOM   1620  C  CZ   . ARG A 1 31 ? -2.027  2.392   -5.373  1.00 0.00 ? 31 ARG A CZ   3  
ATOM   1621  N  NH1  . ARG A 1 31 ? -2.984  1.777   -6.059  1.00 0.00 ? 31 ARG A NH1  3  
ATOM   1622  N  NH2  . ARG A 1 31 ? -1.571  3.568   -5.792  1.00 0.00 ? 31 ARG A NH2  3  
ATOM   1623  H  H    . ARG A 1 31 ? -4.773  0.263   -0.188  1.00 0.00 ? 31 ARG A H    3  
ATOM   1624  H  HA   . ARG A 1 31 ? -3.684  2.754   -1.064  1.00 0.00 ? 31 ARG A HA   3  
ATOM   1625  H  HB2  . ARG A 1 31 ? -4.719  0.362   -2.571  1.00 0.00 ? 31 ARG A HB2  3  
ATOM   1626  H  HB3  . ARG A 1 31 ? -4.133  1.816   -3.374  1.00 0.00 ? 31 ARG A HB3  3  
ATOM   1627  H  HG2  . ARG A 1 31 ? -2.050  1.400   -1.789  1.00 0.00 ? 31 ARG A HG2  3  
ATOM   1628  H  HG3  . ARG A 1 31 ? -2.633  -0.260  -1.880  1.00 0.00 ? 31 ARG A HG3  3  
ATOM   1629  H  HD2  . ARG A 1 31 ? -1.105  -0.107  -3.630  1.00 0.00 ? 31 ARG A HD2  3  
ATOM   1630  H  HD3  . ARG A 1 31 ? -2.677  0.097   -4.416  1.00 0.00 ? 31 ARG A HD3  3  
ATOM   1631  H  HE   . ARG A 1 31 ? -0.770  2.270   -3.821  1.00 0.00 ? 31 ARG A HE   3  
ATOM   1632  H  HH11 . ARG A 1 31 ? -3.325  0.873   -5.765  1.00 0.00 ? 31 ARG A HH11 3  
ATOM   1633  H  HH12 . ARG A 1 31 ? -3.370  2.208   -6.882  1.00 0.00 ? 31 ARG A HH12 3  
ATOM   1634  H  HH21 . ARG A 1 31 ? -0.825  4.038   -5.294  1.00 0.00 ? 31 ARG A HH21 3  
ATOM   1635  H  HH22 . ARG A 1 31 ? -1.962  3.997   -6.608  1.00 0.00 ? 31 ARG A HH22 3  
ATOM   1636  N  N    . LYS A 1 32 ? -6.758  2.714   -0.775  1.00 0.00 ? 32 LYS A N    3  
ATOM   1637  C  CA   . LYS A 1 32 ? -7.930  3.572   -0.865  1.00 0.00 ? 32 LYS A CA   3  
ATOM   1638  C  C    . LYS A 1 32 ? -7.552  4.986   -0.454  1.00 0.00 ? 32 LYS A C    3  
ATOM   1639  O  O    . LYS A 1 32 ? -8.113  5.969   -0.942  1.00 0.00 ? 32 LYS A O    3  
ATOM   1640  C  CB   . LYS A 1 32 ? -9.050  3.051   0.033   1.00 0.00 ? 32 LYS A CB   3  
ATOM   1641  C  CG   . LYS A 1 32 ? -10.161 2.357   -0.728  1.00 0.00 ? 32 LYS A CG   3  
ATOM   1642  C  CD   . LYS A 1 32 ? -9.985  0.849   -0.708  1.00 0.00 ? 32 LYS A CD   3  
ATOM   1643  C  CE   . LYS A 1 32 ? -10.302 0.234   -2.059  1.00 0.00 ? 32 LYS A CE   3  
ATOM   1644  N  NZ   . LYS A 1 32 ? -11.757 -0.020  -2.223  1.00 0.00 ? 32 LYS A NZ   3  
ATOM   1645  H  H    . LYS A 1 32 ? -6.681  2.087   -0.023  1.00 0.00 ? 32 LYS A H    3  
ATOM   1646  H  HA   . LYS A 1 32 ? -8.266  3.579   -1.891  1.00 0.00 ? 32 LYS A HA   3  
ATOM   1647  H  HB2  . LYS A 1 32 ? -8.632  2.348   0.738   1.00 0.00 ? 32 LYS A HB2  3  
ATOM   1648  H  HB3  . LYS A 1 32 ? -9.477  3.881   0.575   1.00 0.00 ? 32 LYS A HB3  3  
ATOM   1649  H  HG2  . LYS A 1 32 ? -11.108 2.605   -0.273  1.00 0.00 ? 32 LYS A HG2  3  
ATOM   1650  H  HG3  . LYS A 1 32 ? -10.150 2.698   -1.753  1.00 0.00 ? 32 LYS A HG3  3  
ATOM   1651  H  HD2  . LYS A 1 32 ? -8.959  0.619   -0.452  1.00 0.00 ? 32 LYS A HD2  3  
ATOM   1652  H  HD3  . LYS A 1 32 ? -10.646 0.429   0.036   1.00 0.00 ? 32 LYS A HD3  3  
ATOM   1653  H  HE2  . LYS A 1 32 ? -9.975  0.911   -2.834  1.00 0.00 ? 32 LYS A HE2  3  
ATOM   1654  H  HE3  . LYS A 1 32 ? -9.768  -0.702  -2.150  1.00 0.00 ? 32 LYS A HE3  3  
ATOM   1655  H  HZ1  . LYS A 1 32 ? -11.984 -0.159  -3.229  1.00 0.00 ? 32 LYS A HZ1  3  
ATOM   1656  H  HZ2  . LYS A 1 32 ? -12.308 0.793   -1.865  1.00 0.00 ? 32 LYS A HZ2  3  
ATOM   1657  H  HZ3  . LYS A 1 32 ? -12.033 -0.874  -1.692  1.00 0.00 ? 32 LYS A HZ3  3  
ATOM   1658  N  N    . ARG A 1 33 ? -6.515  5.078   0.371   1.00 0.00 ? 33 ARG A N    3  
ATOM   1659  C  CA   . ARG A 1 33 ? -5.981  6.359   0.798   1.00 0.00 ? 33 ARG A CA   3  
ATOM   1660  C  C    . ARG A 1 33 ? -5.132  6.976   -0.307  1.00 0.00 ? 33 ARG A C    3  
ATOM   1661  O  O    . ARG A 1 33 ? -4.714  8.124   -0.212  1.00 0.00 ? 33 ARG A O    3  
ATOM   1662  C  CB   . ARG A 1 33 ? -5.149  6.198   2.074   1.00 0.00 ? 33 ARG A CB   3  
ATOM   1663  C  CG   . ARG A 1 33 ? -5.772  5.263   3.100   1.00 0.00 ? 33 ARG A CG   3  
ATOM   1664  C  CD   . ARG A 1 33 ? -6.934  5.924   3.820   1.00 0.00 ? 33 ARG A CD   3  
ATOM   1665  N  NE   . ARG A 1 33 ? -8.225  5.402   3.374   1.00 0.00 ? 33 ARG A NE   3  
ATOM   1666  C  CZ   . ARG A 1 33 ? -8.825  4.334   3.901   1.00 0.00 ? 33 ARG A CZ   3  
ATOM   1667  N  NH1  . ARG A 1 33 ? -8.254  3.668   4.898   1.00 0.00 ? 33 ARG A NH1  3  
ATOM   1668  N  NH2  . ARG A 1 33 ? -9.998  3.934   3.432   1.00 0.00 ? 33 ARG A NH2  3  
ATOM   1669  H  H    . ARG A 1 33 ? -6.068  4.255   0.667   1.00 0.00 ? 33 ARG A H    3  
ATOM   1670  H  HA   . ARG A 1 33 ? -6.815  7.014   1.001   1.00 0.00 ? 33 ARG A HA   3  
ATOM   1671  H  HB2  . ARG A 1 33 ? -4.178  5.808   1.809   1.00 0.00 ? 33 ARG A HB2  3  
ATOM   1672  H  HB3  . ARG A 1 33 ? -5.024  7.169   2.533   1.00 0.00 ? 33 ARG A HB3  3  
ATOM   1673  H  HG2  . ARG A 1 33 ? -6.131  4.377   2.598   1.00 0.00 ? 33 ARG A HG2  3  
ATOM   1674  H  HG3  . ARG A 1 33 ? -5.022  4.987   3.828   1.00 0.00 ? 33 ARG A HG3  3  
ATOM   1675  H  HD2  . ARG A 1 33 ? -6.832  5.747   4.881   1.00 0.00 ? 33 ARG A HD2  3  
ATOM   1676  H  HD3  . ARG A 1 33 ? -6.900  6.987   3.628   1.00 0.00 ? 33 ARG A HD3  3  
ATOM   1677  H  HE   . ARG A 1 33 ? -8.674  5.887   2.637   1.00 0.00 ? 33 ARG A HE   3  
ATOM   1678  H  HH11 . ARG A 1 33 ? -7.362  3.963   5.266   1.00 0.00 ? 33 ARG A HH11 3  
ATOM   1679  H  HH12 . ARG A 1 33 ? -8.708  2.855   5.291   1.00 0.00 ? 33 ARG A HH12 3  
ATOM   1680  H  HH21 . ARG A 1 33 ? -10.439 4.431   2.672   1.00 0.00 ? 33 ARG A HH21 3  
ATOM   1681  H  HH22 . ARG A 1 33 ? -10.467 3.141   3.844   1.00 0.00 ? 33 ARG A HH22 3  
ATOM   1682  N  N    . HIS A 1 34 ? -4.934  6.223   -1.385  1.00 0.00 ? 34 HIS A N    3  
ATOM   1683  C  CA   . HIS A 1 34 ? -4.210  6.727   -2.542  1.00 0.00 ? 34 HIS A CA   3  
ATOM   1684  C  C    . HIS A 1 34 ? -5.201  7.189   -3.602  1.00 0.00 ? 34 HIS A C    3  
ATOM   1685  O  O    . HIS A 1 34 ? -4.840  7.878   -4.557  1.00 0.00 ? 34 HIS A O    3  
ATOM   1686  C  CB   . HIS A 1 34 ? -3.265  5.655   -3.092  1.00 0.00 ? 34 HIS A CB   3  
ATOM   1687  C  CG   . HIS A 1 34 ? -2.144  5.339   -2.152  1.00 0.00 ? 34 HIS A CG   3  
ATOM   1688  N  ND1  . HIS A 1 34 ? -1.336  6.299   -1.594  1.00 0.00 ? 34 HIS A ND1  3  
ATOM   1689  C  CD2  . HIS A 1 34 ? -1.732  4.153   -1.629  1.00 0.00 ? 34 HIS A CD2  3  
ATOM   1690  C  CE1  . HIS A 1 34 ? -0.485  5.689   -0.766  1.00 0.00 ? 34 HIS A CE1  3  
ATOM   1691  N  NE2  . HIS A 1 34 ? -0.681  4.386   -0.749  1.00 0.00 ? 34 HIS A NE2  3  
ATOM   1692  H  H    . HIS A 1 34 ? -5.323  5.320   -1.422  1.00 0.00 ? 34 HIS A H    3  
ATOM   1693  H  HA   . HIS A 1 34 ? -3.628  7.576   -2.219  1.00 0.00 ? 34 HIS A HA   3  
ATOM   1694  H  HB2  . HIS A 1 34 ? -3.821  4.745   -3.271  1.00 0.00 ? 34 HIS A HB2  3  
ATOM   1695  H  HB3  . HIS A 1 34 ? -2.836  6.001   -4.020  1.00 0.00 ? 34 HIS A HB3  3  
ATOM   1696  H  HD1  . HIS A 1 34 ? -1.362  7.266   -1.786  1.00 0.00 ? 34 HIS A HD1  3  
ATOM   1697  H  HD2  . HIS A 1 34 ? -2.144  3.181   -1.854  1.00 0.00 ? 34 HIS A HD2  3  
ATOM   1698  H  HE1  . HIS A 1 34 ? 0.269   6.199   -0.182  1.00 0.00 ? 34 HIS A HE1  3  
ATOM   1699  N  N    . MET A 1 35 ? -6.475  6.954   -3.324  1.00 0.00 ? 35 MET A N    3  
ATOM   1700  C  CA   . MET A 1 35 ? -7.543  7.498   -4.144  1.00 0.00 ? 35 MET A CA   3  
ATOM   1701  C  C    . MET A 1 35 ? -7.913  8.870   -3.612  1.00 0.00 ? 35 MET A C    3  
ATOM   1702  O  O    . MET A 1 35 ? -7.993  9.848   -4.356  1.00 0.00 ? 35 MET A O    3  
ATOM   1703  C  CB   . MET A 1 35 ? -8.769  6.584   -4.125  1.00 0.00 ? 35 MET A CB   3  
ATOM   1704  C  CG   . MET A 1 35 ? -8.513  5.199   -4.693  1.00 0.00 ? 35 MET A CG   3  
ATOM   1705  S  SD   . MET A 1 35 ? -10.002 4.184   -4.738  1.00 0.00 ? 35 MET A SD   3  
ATOM   1706  C  CE   . MET A 1 35 ? -10.366 4.202   -6.492  1.00 0.00 ? 35 MET A CE   3  
ATOM   1707  H  H    . MET A 1 35 ? -6.703  6.512   -2.475  1.00 0.00 ? 35 MET A H    3  
ATOM   1708  H  HA   . MET A 1 35 ? -7.179  7.593   -5.154  1.00 0.00 ? 35 MET A HA   3  
ATOM   1709  H  HB2  . MET A 1 35 ? -9.102  6.473   -3.106  1.00 0.00 ? 35 MET A HB2  3  
ATOM   1710  H  HB3  . MET A 1 35 ? -9.554  7.046   -4.703  1.00 0.00 ? 35 MET A HB3  3  
ATOM   1711  H  HG2  . MET A 1 35 ? -8.133  5.300   -5.700  1.00 0.00 ? 35 MET A HG2  3  
ATOM   1712  H  HG3  . MET A 1 35 ? -7.774  4.704   -4.080  1.00 0.00 ? 35 MET A HG3  3  
ATOM   1713  H  HE1  . MET A 1 35 ? -9.779  3.444   -6.990  1.00 0.00 ? 35 MET A HE1  3  
ATOM   1714  H  HE2  . MET A 1 35 ? -11.416 4.002   -6.644  1.00 0.00 ? 35 MET A HE2  3  
ATOM   1715  H  HE3  . MET A 1 35 ? -10.121 5.172   -6.901  1.00 0.00 ? 35 MET A HE3  3  
ATOM   1716  N  N    . LEU A 1 36 ? -8.024  8.947   -2.295  1.00 0.00 ? 36 LEU A N    3  
ATOM   1717  C  CA   . LEU A 1 36 ? -8.274  10.203  -1.612  1.00 0.00 ? 36 LEU A CA   3  
ATOM   1718  C  C    . LEU A 1 36 ? -7.171  10.448  -0.592  1.00 0.00 ? 36 LEU A C    3  
ATOM   1719  O  O    . LEU A 1 36 ? -7.291  10.057  0.569   1.00 0.00 ? 36 LEU A O    3  
ATOM   1720  C  CB   . LEU A 1 36 ? -9.642  10.176  -0.922  1.00 0.00 ? 36 LEU A CB   3  
ATOM   1721  C  CG   . LEU A 1 36 ? -10.645 9.173   -1.499  1.00 0.00 ? 36 LEU A CG   3  
ATOM   1722  C  CD1  . LEU A 1 36 ? -11.513 8.584   -0.399  1.00 0.00 ? 36 LEU A CD1  3  
ATOM   1723  C  CD2  . LEU A 1 36 ? -11.509 9.836   -2.560  1.00 0.00 ? 36 LEU A CD2  3  
ATOM   1724  H  H    . LEU A 1 36 ? -7.867  8.143   -1.758  1.00 0.00 ? 36 LEU A H    3  
ATOM   1725  H  HA   . LEU A 1 36 ? -8.260  10.995  -2.347  1.00 0.00 ? 36 LEU A HA   3  
ATOM   1726  H  HB2  . LEU A 1 36 ? -9.488  9.941   0.121   1.00 0.00 ? 36 LEU A HB2  3  
ATOM   1727  H  HB3  . LEU A 1 36 ? -10.073 11.163  -0.990  1.00 0.00 ? 36 LEU A HB3  3  
ATOM   1728  H  HG   . LEU A 1 36 ? -10.103 8.363   -1.968  1.00 0.00 ? 36 LEU A HG   3  
ATOM   1729  H  HD11 . LEU A 1 36 ? -11.247 7.548   -0.246  1.00 0.00 ? 36 LEU A HD11 3  
ATOM   1730  H  HD12 . LEU A 1 36 ? -11.356 9.135   0.517   1.00 0.00 ? 36 LEU A HD12 3  
ATOM   1731  H  HD13 . LEU A 1 36 ? -12.552 8.650   -0.687  1.00 0.00 ? 36 LEU A HD13 3  
ATOM   1732  H  HD21 . LEU A 1 36 ? -10.883 10.393  -3.240  1.00 0.00 ? 36 LEU A HD21 3  
ATOM   1733  H  HD22 . LEU A 1 36 ? -12.051 9.078   -3.108  1.00 0.00 ? 36 LEU A HD22 3  
ATOM   1734  H  HD23 . LEU A 1 36 ? -12.211 10.507  -2.085  1.00 0.00 ? 36 LEU A HD23 3  
ATOM   1735  N  N    . VAL A 1 37 ? -6.046  10.969  -1.066  1.00 0.00 ? 37 VAL A N    3  
ATOM   1736  C  CA   . VAL A 1 37 ? -4.874  11.146  -0.217  1.00 0.00 ? 37 VAL A CA   3  
ATOM   1737  C  C    . VAL A 1 37 ? -5.059  12.324  0.730   1.00 0.00 ? 37 VAL A C    3  
ATOM   1738  O  O    . VAL A 1 37 ? -5.136  13.470  0.244   1.00 0.00 ? 37 VAL A O    3  
ATOM   1739  C  CB   . VAL A 1 37 ? -3.585  11.356  -1.043  1.00 0.00 ? 37 VAL A CB   3  
ATOM   1740  C  CG1  . VAL A 1 37 ? -2.354  11.082  -0.192  1.00 0.00 ? 37 VAL A CG1  3  
ATOM   1741  C  CG2  . VAL A 1 37 ? -3.583  10.472  -2.285  1.00 0.00 ? 37 VAL A CG2  3  
ATOM   1742  O  OXT  . VAL A 1 37 ? -5.128  12.101  1.959   1.00 0.00 ? 37 VAL A OXT  3  
ATOM   1743  H  H    . VAL A 1 37 ? -5.981  11.179  -2.021  1.00 0.00 ? 37 VAL A H    3  
ATOM   1744  H  HA   . VAL A 1 37 ? -4.758  10.246  0.370   1.00 0.00 ? 37 VAL A HA   3  
ATOM   1745  H  HB   . VAL A 1 37 ? -3.550  12.388  -1.363  1.00 0.00 ? 37 VAL A HB   3  
ATOM   1746  H  HG11 . VAL A 1 37 ? -1.470  11.398  -0.726  1.00 0.00 ? 37 VAL A HG11 3  
ATOM   1747  H  HG12 . VAL A 1 37 ? -2.427  11.630  0.737   1.00 0.00 ? 37 VAL A HG12 3  
ATOM   1748  H  HG13 . VAL A 1 37 ? -2.288  10.024  0.018   1.00 0.00 ? 37 VAL A HG13 3  
ATOM   1749  H  HG21 . VAL A 1 37 ? -2.579  10.406  -2.677  1.00 0.00 ? 37 VAL A HG21 3  
ATOM   1750  H  HG22 . VAL A 1 37 ? -3.934  9.485   -2.023  1.00 0.00 ? 37 VAL A HG22 3  
ATOM   1751  H  HG23 . VAL A 1 37 ? -4.234  10.900  -3.032  1.00 0.00 ? 37 VAL A HG23 3  
HETATM 1752  ZN ZN   . ZN  B 2 .  ? 0.572   3.104   0.056   1.00 0.00 ? 38 ZN  A ZN   3  
ATOM   1753  N  N    . GLY A 1 1  ? 7.280   7.205   -1.281  1.00 0.00 ? 1  GLY A N    4  
ATOM   1754  C  CA   . GLY A 1 1  ? 8.063   6.207   -0.511  1.00 0.00 ? 1  GLY A CA   4  
ATOM   1755  C  C    . GLY A 1 1  ? 8.688   5.158   -1.408  1.00 0.00 ? 1  GLY A C    4  
ATOM   1756  O  O    . GLY A 1 1  ? 8.003   4.538   -2.226  1.00 0.00 ? 1  GLY A O    4  
ATOM   1757  H  H1   . GLY A 1 1  ? 6.303   6.869   -1.412  1.00 0.00 ? 1  GLY A H1   4  
ATOM   1758  H  H2   . GLY A 1 1  ? 7.713   7.351   -2.217  1.00 0.00 ? 1  GLY A H2   4  
ATOM   1759  H  H3   . GLY A 1 1  ? 7.260   8.117   -0.774  1.00 0.00 ? 1  GLY A H3   4  
ATOM   1760  H  HA2  . GLY A 1 1  ? 8.848   6.717   0.028   1.00 0.00 ? 1  GLY A HA2  4  
ATOM   1761  H  HA3  . GLY A 1 1  ? 7.411   5.719   0.198   1.00 0.00 ? 1  GLY A HA3  4  
ATOM   1762  N  N    . SER A 1 2  ? 9.998   4.988   -1.290  1.00 0.00 ? 2  SER A N    4  
ATOM   1763  C  CA   . SER A 1 2  ? 10.721  4.029   -2.110  1.00 0.00 ? 2  SER A CA   4  
ATOM   1764  C  C    . SER A 1 2  ? 11.961  3.512   -1.380  1.00 0.00 ? 2  SER A C    4  
ATOM   1765  O  O    . SER A 1 2  ? 12.991  4.185   -1.334  1.00 0.00 ? 2  SER A O    4  
ATOM   1766  C  CB   . SER A 1 2  ? 11.126  4.666   -3.445  1.00 0.00 ? 2  SER A CB   4  
ATOM   1767  O  OG   . SER A 1 2  ? 10.945  6.078   -3.422  1.00 0.00 ? 2  SER A OG   4  
ATOM   1768  H  H    . SER A 1 2  ? 10.499  5.539   -0.644  1.00 0.00 ? 2  SER A H    4  
ATOM   1769  H  HA   . SER A 1 2  ? 10.061  3.196   -2.305  1.00 0.00 ? 2  SER A HA   4  
ATOM   1770  H  HB2  . SER A 1 2  ? 12.167  4.456   -3.639  1.00 0.00 ? 2  SER A HB2  4  
ATOM   1771  H  HB3  . SER A 1 2  ? 10.521  4.251   -4.237  1.00 0.00 ? 2  SER A HB3  4  
ATOM   1772  H  HG   . SER A 1 2  ? 11.665  6.484   -2.911  1.00 0.00 ? 2  SER A HG   4  
ATOM   1773  N  N    . THR A 1 3  ? 11.873  2.299   -0.855  1.00 0.00 ? 3  THR A N    4  
ATOM   1774  C  CA   . THR A 1 3  ? 13.008  1.672   -0.196  1.00 0.00 ? 3  THR A CA   4  
ATOM   1775  C  C    . THR A 1 3  ? 13.680  0.694   -1.139  1.00 0.00 ? 3  THR A C    4  
ATOM   1776  O  O    . THR A 1 3  ? 14.891  0.485   -1.101  1.00 0.00 ? 3  THR A O    4  
ATOM   1777  C  CB   . THR A 1 3  ? 12.592  0.946   1.103   1.00 0.00 ? 3  THR A CB   4  
ATOM   1778  O  OG1  . THR A 1 3  ? 11.570  -0.027  0.832   1.00 0.00 ? 3  THR A OG1  4  
ATOM   1779  C  CG2  . THR A 1 3  ? 12.082  1.935   2.138   1.00 0.00 ? 3  THR A CG2  4  
ATOM   1780  H  H    . THR A 1 3  ? 11.036  1.788   -0.959  1.00 0.00 ? 3  THR A H    4  
ATOM   1781  H  HA   . THR A 1 3  ? 13.704  2.440   0.047   1.00 0.00 ? 3  THR A HA   4  
ATOM   1782  H  HB   . THR A 1 3  ? 13.456  0.442   1.506   1.00 0.00 ? 3  THR A HB   4  
ATOM   1783  H  HG1  . THR A 1 3  ? 11.181  0.140   -0.040  1.00 0.00 ? 3  THR A HG1  4  
ATOM   1784  H  HG21 . THR A 1 3  ? 12.445  2.924   1.903   1.00 0.00 ? 3  THR A HG21 4  
ATOM   1785  H  HG22 . THR A 1 3  ? 12.436  1.646   3.117   1.00 0.00 ? 3  THR A HG22 4  
ATOM   1786  H  HG23 . THR A 1 3  ? 11.001  1.937   2.132   1.00 0.00 ? 3  THR A HG23 4  
ATOM   1787  N  N    . ARG A 1 4  ? 12.877  0.174   -2.037  1.00 0.00 ? 4  ARG A N    4  
ATOM   1788  C  CA   . ARG A 1 4  ? 13.338  -0.742  -3.073  1.00 0.00 ? 4  ARG A CA   4  
ATOM   1789  C  C    . ARG A 1 4  ? 12.554  -0.499  -4.357  1.00 0.00 ? 4  ARG A C    4  
ATOM   1790  O  O    . ARG A 1 4  ? 11.928  -1.412  -4.897  1.00 0.00 ? 4  ARG A O    4  
ATOM   1791  C  CB   . ARG A 1 4  ? 13.159  -2.197  -2.626  1.00 0.00 ? 4  ARG A CB   4  
ATOM   1792  C  CG   . ARG A 1 4  ? 14.128  -2.628  -1.538  1.00 0.00 ? 4  ARG A CG   4  
ATOM   1793  C  CD   . ARG A 1 4  ? 15.249  -3.484  -2.097  1.00 0.00 ? 4  ARG A CD   4  
ATOM   1794  N  NE   . ARG A 1 4  ? 15.926  -4.243  -1.048  1.00 0.00 ? 4  ARG A NE   4  
ATOM   1795  C  CZ   . ARG A 1 4  ? 17.050  -3.852  -0.454  1.00 0.00 ? 4  ARG A CZ   4  
ATOM   1796  N  NH1  . ARG A 1 4  ? 17.638  -2.721  -0.825  1.00 0.00 ? 4  ARG A NH1  4  
ATOM   1797  N  NH2  . ARG A 1 4  ? 17.579  -4.590  0.516   1.00 0.00 ? 4  ARG A NH2  4  
ATOM   1798  H  H    . ARG A 1 4  ? 11.937  0.446   -2.019  1.00 0.00 ? 4  ARG A H    4  
ATOM   1799  H  HA   . ARG A 1 4  ? 14.385  -0.549  -3.255  1.00 0.00 ? 4  ARG A HA   4  
ATOM   1800  H  HB2  . ARG A 1 4  ? 12.153  -2.324  -2.251  1.00 0.00 ? 4  ARG A HB2  4  
ATOM   1801  H  HB3  . ARG A 1 4  ? 13.299  -2.843  -3.480  1.00 0.00 ? 4  ARG A HB3  4  
ATOM   1802  H  HG2  . ARG A 1 4  ? 14.555  -1.746  -1.082  1.00 0.00 ? 4  ARG A HG2  4  
ATOM   1803  H  HG3  . ARG A 1 4  ? 13.590  -3.195  -0.794  1.00 0.00 ? 4  ARG A HG3  4  
ATOM   1804  H  HD2  . ARG A 1 4  ? 14.834  -4.176  -2.815  1.00 0.00 ? 4  ARG A HD2  4  
ATOM   1805  H  HD3  . ARG A 1 4  ? 15.967  -2.844  -2.586  1.00 0.00 ? 4  ARG A HD3  4  
ATOM   1806  H  HE   . ARG A 1 4  ? 15.504  -5.088  -0.762  1.00 0.00 ? 4  ARG A HE   4  
ATOM   1807  H  HH11 . ARG A 1 4  ? 17.237  -2.159  -1.555  1.00 0.00 ? 4  ARG A HH11 4  
ATOM   1808  H  HH12 . ARG A 1 4  ? 18.482  -2.413  -0.367  1.00 0.00 ? 4  ARG A HH12 4  
ATOM   1809  H  HH21 . ARG A 1 4  ? 17.127  -5.441  0.813   1.00 0.00 ? 4  ARG A HH21 4  
ATOM   1810  H  HH22 . ARG A 1 4  ? 18.442  -4.310  0.950   1.00 0.00 ? 4  ARG A HH22 4  
ATOM   1811  N  N    . GLY A 1 5  ? 12.517  0.754   -4.793  1.00 0.00 ? 5  GLY A N    4  
ATOM   1812  C  CA   . GLY A 1 5  ? 11.748  1.105   -5.973  1.00 0.00 ? 5  GLY A CA   4  
ATOM   1813  C  C    . GLY A 1 5  ? 10.258  1.007   -5.727  1.00 0.00 ? 5  GLY A C    4  
ATOM   1814  O  O    . GLY A 1 5  ? 9.487   0.741   -6.649  1.00 0.00 ? 5  GLY A O    4  
ATOM   1815  H  H    . GLY A 1 5  ? 12.995  1.455   -4.294  1.00 0.00 ? 5  GLY A H    4  
ATOM   1816  H  HA2  . GLY A 1 5  ? 11.989  2.115   -6.263  1.00 0.00 ? 5  GLY A HA2  4  
ATOM   1817  H  HA3  . GLY A 1 5  ? 12.015  0.434   -6.778  1.00 0.00 ? 5  GLY A HA3  4  
ATOM   1818  N  N    . SER A 1 6  ? 9.871   1.182   -4.465  1.00 0.00 ? 6  SER A N    4  
ATOM   1819  C  CA   . SER A 1 6  ? 8.489   1.087   -4.033  1.00 0.00 ? 6  SER A CA   4  
ATOM   1820  C  C    . SER A 1 6  ? 7.958   -0.342  -4.169  1.00 0.00 ? 6  SER A C    4  
ATOM   1821  O  O    . SER A 1 6  ? 6.765   -0.589  -4.009  1.00 0.00 ? 6  SER A O    4  
ATOM   1822  C  CB   . SER A 1 6  ? 7.634   2.075   -4.805  1.00 0.00 ? 6  SER A CB   4  
ATOM   1823  O  OG   . SER A 1 6  ? 8.176   3.386   -4.727  1.00 0.00 ? 6  SER A OG   4  
ATOM   1824  H  H    . SER A 1 6  ? 10.537  1.379   -3.798  1.00 0.00 ? 6  SER A H    4  
ATOM   1825  H  HA   . SER A 1 6  ? 8.462   1.356   -2.987  1.00 0.00 ? 6  SER A HA   4  
ATOM   1826  H  HB2  . SER A 1 6  ? 7.594   1.777   -5.839  1.00 0.00 ? 6  SER A HB2  4  
ATOM   1827  H  HB3  . SER A 1 6  ? 6.646   2.082   -4.389  1.00 0.00 ? 6  SER A HB3  4  
ATOM   1828  H  HG   . SER A 1 6  ? 8.022   3.742   -3.837  1.00 0.00 ? 6  SER A HG   4  
ATOM   1829  N  N    . THR A 1 7  ? 8.866   -1.284  -4.388  1.00 0.00 ? 7  THR A N    4  
ATOM   1830  C  CA   . THR A 1 7  ? 8.512   -2.689  -4.442  1.00 0.00 ? 7  THR A CA   4  
ATOM   1831  C  C    . THR A 1 7  ? 9.535   -3.519  -3.681  1.00 0.00 ? 7  THR A C    4  
ATOM   1832  O  O    . THR A 1 7  ? 10.392  -4.177  -4.272  1.00 0.00 ? 7  THR A O    4  
ATOM   1833  C  CB   . THR A 1 7  ? 8.420   -3.180  -5.901  1.00 0.00 ? 7  THR A CB   4  
ATOM   1834  O  OG1  . THR A 1 7  ? 9.438   -2.550  -6.694  1.00 0.00 ? 7  THR A OG1  4  
ATOM   1835  C  CG2  . THR A 1 7  ? 7.059   -2.863  -6.499  1.00 0.00 ? 7  THR A CG2  4  
ATOM   1836  H  H    . THR A 1 7  ? 9.808   -1.031  -4.458  1.00 0.00 ? 7  THR A H    4  
ATOM   1837  H  HA   . THR A 1 7  ? 7.551   -2.817  -3.964  1.00 0.00 ? 7  THR A HA   4  
ATOM   1838  H  HB   . THR A 1 7  ? 8.567   -4.250  -5.920  1.00 0.00 ? 7  THR A HB   4  
ATOM   1839  H  HG1  . THR A 1 7  ? 10.290  -2.980  -6.523  1.00 0.00 ? 7  THR A HG1  4  
ATOM   1840  H  HG21 . THR A 1 7  ? 6.532   -2.184  -5.848  1.00 0.00 ? 7  THR A HG21 4  
ATOM   1841  H  HG22 . THR A 1 7  ? 6.491   -3.775  -6.607  1.00 0.00 ? 7  THR A HG22 4  
ATOM   1842  H  HG23 . THR A 1 7  ? 7.190   -2.404  -7.468  1.00 0.00 ? 7  THR A HG23 4  
ATOM   1843  N  N    . GLY A 1 8  ? 9.479   -3.426  -2.364  1.00 0.00 ? 8  GLY A N    4  
ATOM   1844  C  CA   . GLY A 1 8  ? 10.443  -4.113  -1.543  1.00 0.00 ? 8  GLY A CA   4  
ATOM   1845  C  C    . GLY A 1 8  ? 9.959   -5.459  -1.054  1.00 0.00 ? 8  GLY A C    4  
ATOM   1846  O  O    . GLY A 1 8  ? 10.120  -6.474  -1.735  1.00 0.00 ? 8  GLY A O    4  
ATOM   1847  H  H    . GLY A 1 8  ? 8.825   -2.818  -1.949  1.00 0.00 ? 8  GLY A H    4  
ATOM   1848  H  HA2  . GLY A 1 8  ? 11.348  -4.258  -2.116  1.00 0.00 ? 8  GLY A HA2  4  
ATOM   1849  H  HA3  . GLY A 1 8  ? 10.670  -3.496  -0.688  1.00 0.00 ? 8  GLY A HA3  4  
ATOM   1850  N  N    . ILE A 1 9  ? 9.462   -5.475  0.169   1.00 0.00 ? 9  ILE A N    4  
ATOM   1851  C  CA   . ILE A 1 9  ? 9.054   -6.714  0.830   1.00 0.00 ? 9  ILE A CA   4  
ATOM   1852  C  C    . ILE A 1 9  ? 7.677   -7.178  0.357   1.00 0.00 ? 9  ILE A C    4  
ATOM   1853  O  O    . ILE A 1 9  ? 6.855   -6.350  -0.041  1.00 0.00 ? 9  ILE A O    4  
ATOM   1854  C  CB   . ILE A 1 9  ? 9.036   -6.532  2.367   1.00 0.00 ? 9  ILE A CB   4  
ATOM   1855  C  CG1  . ILE A 1 9  ? 10.206  -5.654  2.813   1.00 0.00 ? 9  ILE A CG1  4  
ATOM   1856  C  CG2  . ILE A 1 9  ? 9.090   -7.878  3.079   1.00 0.00 ? 9  ILE A CG2  4  
ATOM   1857  C  CD1  . ILE A 1 9  ? 10.105  -5.197  4.251   1.00 0.00 ? 9  ILE A CD1  4  
ATOM   1858  H  H    . ILE A 1 9  ? 9.352   -4.618  0.641   1.00 0.00 ? 9  ILE A H    4  
ATOM   1859  H  HA   . ILE A 1 9  ? 9.782   -7.473  0.588   1.00 0.00 ? 9  ILE A HA   4  
ATOM   1860  H  HB   . ILE A 1 9  ? 8.111   -6.047  2.637   1.00 0.00 ? 9  ILE A HB   4  
ATOM   1861  H  HG12 . ILE A 1 9  ? 11.124  -6.210  2.705   1.00 0.00 ? 9  ILE A HG12 4  
ATOM   1862  H  HG13 . ILE A 1 9  ? 10.247  -4.774  2.187   1.00 0.00 ? 9  ILE A HG13 4  
ATOM   1863  H  HG21 . ILE A 1 9  ? 8.701   -8.647  2.426   1.00 0.00 ? 9  ILE A HG21 4  
ATOM   1864  H  HG22 . ILE A 1 9  ? 10.112  -8.107  3.338   1.00 0.00 ? 9  ILE A HG22 4  
ATOM   1865  H  HG23 . ILE A 1 9  ? 8.493   -7.833  3.977   1.00 0.00 ? 9  ILE A HG23 4  
ATOM   1866  H  HD11 . ILE A 1 9  ? 11.040  -5.389  4.757   1.00 0.00 ? 9  ILE A HD11 4  
ATOM   1867  H  HD12 . ILE A 1 9  ? 9.893   -4.138  4.278   1.00 0.00 ? 9  ILE A HD12 4  
ATOM   1868  H  HD13 . ILE A 1 9  ? 9.309   -5.736  4.745   1.00 0.00 ? 9  ILE A HD13 4  
ATOM   1869  N  N    . LYS A 1 10 ? 7.386   -8.472  0.573   1.00 0.00 ? 10 LYS A N    4  
ATOM   1870  C  CA   . LYS A 1 10 ? 6.073   -9.063  0.292   1.00 0.00 ? 10 LYS A CA   4  
ATOM   1871  C  C    . LYS A 1 10 ? 5.687   -8.945  -1.184  1.00 0.00 ? 10 LYS A C    4  
ATOM   1872  O  O    . LYS A 1 10 ? 6.119   -8.036  -1.890  1.00 0.00 ? 10 LYS A O    4  
ATOM   1873  C  CB   . LYS A 1 10 ? 5.002   -8.449  1.195   1.00 0.00 ? 10 LYS A CB   4  
ATOM   1874  C  CG   . LYS A 1 10 ? 4.563   -9.391  2.304   1.00 0.00 ? 10 LYS A CG   4  
ATOM   1875  C  CD   . LYS A 1 10 ? 4.737   -8.764  3.675   1.00 0.00 ? 10 LYS A CD   4  
ATOM   1876  C  CE   . LYS A 1 10 ? 5.893   -9.399  4.431   1.00 0.00 ? 10 LYS A CE   4  
ATOM   1877  N  NZ   . LYS A 1 10 ? 5.857   -9.076  5.882   1.00 0.00 ? 10 LYS A NZ   4  
ATOM   1878  H  H    . LYS A 1 10 ? 8.069   -9.041  0.997   1.00 0.00 ? 10 LYS A H    4  
ATOM   1879  H  HA   . LYS A 1 10 ? 6.139   -10.116 0.528   1.00 0.00 ? 10 LYS A HA   4  
ATOM   1880  H  HB2  . LYS A 1 10 ? 5.392   -7.546  1.644   1.00 0.00 ? 10 LYS A HB2  4  
ATOM   1881  H  HB3  . LYS A 1 10 ? 4.135   -8.202  0.598   1.00 0.00 ? 10 LYS A HB3  4  
ATOM   1882  H  HG2  . LYS A 1 10 ? 3.521   -9.636  2.163   1.00 0.00 ? 10 LYS A HG2  4  
ATOM   1883  H  HG3  . LYS A 1 10 ? 5.156   -10.292 2.253   1.00 0.00 ? 10 LYS A HG3  4  
ATOM   1884  H  HD2  . LYS A 1 10 ? 4.931   -7.708  3.557   1.00 0.00 ? 10 LYS A HD2  4  
ATOM   1885  H  HD3  . LYS A 1 10 ? 3.829   -8.904  4.244   1.00 0.00 ? 10 LYS A HD3  4  
ATOM   1886  H  HE2  . LYS A 1 10 ? 5.839   -10.471 4.310   1.00 0.00 ? 10 LYS A HE2  4  
ATOM   1887  H  HE3  . LYS A 1 10 ? 6.821   -9.037  4.013   1.00 0.00 ? 10 LYS A HE3  4  
ATOM   1888  H  HZ1  . LYS A 1 10 ? 6.127   -9.911  6.442   1.00 0.00 ? 10 LYS A HZ1  4  
ATOM   1889  H  HZ2  . LYS A 1 10 ? 4.894   -8.780  6.162   1.00 0.00 ? 10 LYS A HZ2  4  
ATOM   1890  H  HZ3  . LYS A 1 10 ? 6.520   -8.297  6.092   1.00 0.00 ? 10 LYS A HZ3  4  
ATOM   1891  N  N    . PRO A 1 11 ? 4.950   -9.934  -1.704  1.00 0.00 ? 11 PRO A N    4  
ATOM   1892  C  CA   . PRO A 1 11 ? 4.543   -9.952  -3.111  1.00 0.00 ? 11 PRO A CA   4  
ATOM   1893  C  C    . PRO A 1 11 ? 3.591   -8.805  -3.439  1.00 0.00 ? 11 PRO A C    4  
ATOM   1894  O  O    . PRO A 1 11 ? 3.406   -8.446  -4.602  1.00 0.00 ? 11 PRO A O    4  
ATOM   1895  C  CB   . PRO A 1 11 ? 3.834   -11.301 -3.267  1.00 0.00 ? 11 PRO A CB   4  
ATOM   1896  C  CG   . PRO A 1 11 ? 3.429   -11.683 -1.887  1.00 0.00 ? 11 PRO A CG   4  
ATOM   1897  C  CD   . PRO A 1 11 ? 4.493   -11.135 -0.984  1.00 0.00 ? 11 PRO A CD   4  
ATOM   1898  H  HA   . PRO A 1 11 ? 5.395   -9.911  -3.769  1.00 0.00 ? 11 PRO A HA   4  
ATOM   1899  H  HB2  . PRO A 1 11 ? 2.979   -11.189 -3.914  1.00 0.00 ? 11 PRO A HB2  4  
ATOM   1900  H  HB3  . PRO A 1 11 ? 4.519   -12.024 -3.689  1.00 0.00 ? 11 PRO A HB3  4  
ATOM   1901  H  HG2  . PRO A 1 11 ? 2.473   -11.240 -1.651  1.00 0.00 ? 11 PRO A HG2  4  
ATOM   1902  H  HG3  . PRO A 1 11 ? 3.379   -12.758 -1.799  1.00 0.00 ? 11 PRO A HG3  4  
ATOM   1903  H  HD2  . PRO A 1 11 ? 4.075   -10.875 -0.022  1.00 0.00 ? 11 PRO A HD2  4  
ATOM   1904  H  HD3  . PRO A 1 11 ? 5.296   -11.846 -0.869  1.00 0.00 ? 11 PRO A HD3  4  
ATOM   1905  N  N    . PHE A 1 12 ? 2.957   -8.260  -2.409  1.00 0.00 ? 12 PHE A N    4  
ATOM   1906  C  CA   . PHE A 1 12 ? 1.985   -7.195  -2.586  1.00 0.00 ? 12 PHE A CA   4  
ATOM   1907  C  C    . PHE A 1 12 ? 2.292   -6.010  -1.679  1.00 0.00 ? 12 PHE A C    4  
ATOM   1908  O  O    . PHE A 1 12 ? 1.747   -5.898  -0.588  1.00 0.00 ? 12 PHE A O    4  
ATOM   1909  C  CB   . PHE A 1 12 ? 0.584   -7.715  -2.281  1.00 0.00 ? 12 PHE A CB   4  
ATOM   1910  C  CG   . PHE A 1 12 ? 0.228   -8.969  -3.033  1.00 0.00 ? 12 PHE A CG   4  
ATOM   1911  C  CD1  . PHE A 1 12 ? 0.184   -8.975  -4.418  1.00 0.00 ? 12 PHE A CD1  4  
ATOM   1912  C  CD2  . PHE A 1 12 ? -0.065  -10.138 -2.354  1.00 0.00 ? 12 PHE A CD2  4  
ATOM   1913  C  CE1  . PHE A 1 12 ? -0.142  -10.128 -5.110  1.00 0.00 ? 12 PHE A CE1  4  
ATOM   1914  C  CE2  . PHE A 1 12 ? -0.392  -11.292 -3.038  1.00 0.00 ? 12 PHE A CE2  4  
ATOM   1915  C  CZ   . PHE A 1 12 ? -0.431  -11.287 -4.418  1.00 0.00 ? 12 PHE A CZ   4  
ATOM   1916  H  H    . PHE A 1 12 ? 3.124   -8.607  -1.508  1.00 0.00 ? 12 PHE A H    4  
ATOM   1917  H  HA   . PHE A 1 12 ? 2.027   -6.872  -3.616  1.00 0.00 ? 12 PHE A HA   4  
ATOM   1918  H  HB2  . PHE A 1 12 ? 0.517   -7.927  -1.222  1.00 0.00 ? 12 PHE A HB2  4  
ATOM   1919  H  HB3  . PHE A 1 12 ? -0.139  -6.954  -2.537  1.00 0.00 ? 12 PHE A HB3  4  
ATOM   1920  H  HD1  . PHE A 1 12 ? 0.409   -8.068  -4.960  1.00 0.00 ? 12 PHE A HD1  4  
ATOM   1921  H  HD2  . PHE A 1 12 ? -0.035  -10.145 -1.275  1.00 0.00 ? 12 PHE A HD2  4  
ATOM   1922  H  HE1  . PHE A 1 12 ? -0.172  -10.120 -6.190  1.00 0.00 ? 12 PHE A HE1  4  
ATOM   1923  H  HE2  . PHE A 1 12 ? -0.622  -12.196 -2.493  1.00 0.00 ? 12 PHE A HE2  4  
ATOM   1924  H  HZ   . PHE A 1 12 ? -0.686  -12.189 -4.956  1.00 0.00 ? 12 PHE A HZ   4  
ATOM   1925  N  N    . GLN A 1 13 ? 3.179   -5.142  -2.120  1.00 0.00 ? 13 GLN A N    4  
ATOM   1926  C  CA   . GLN A 1 13 ? 3.548   -3.973  -1.353  1.00 0.00 ? 13 GLN A CA   4  
ATOM   1927  C  C    . GLN A 1 13 ? 2.986   -2.712  -2.004  1.00 0.00 ? 13 GLN A C    4  
ATOM   1928  O  O    . GLN A 1 13 ? 2.655   -2.721  -3.191  1.00 0.00 ? 13 GLN A O    4  
ATOM   1929  C  CB   . GLN A 1 13 ? 5.058   -3.907  -1.274  1.00 0.00 ? 13 GLN A CB   4  
ATOM   1930  C  CG   . GLN A 1 13 ? 5.699   -3.438  -2.554  1.00 0.00 ? 13 GLN A CG   4  
ATOM   1931  C  CD   . GLN A 1 13 ? 5.890   -4.564  -3.547  1.00 0.00 ? 13 GLN A CD   4  
ATOM   1932  O  OE1  . GLN A 1 13 ? 5.175   -4.657  -4.544  1.00 0.00 ? 13 GLN A OE1  4  
ATOM   1933  N  NE2  . GLN A 1 13 ? 6.836   -5.443  -3.271  1.00 0.00 ? 13 GLN A NE2  4  
ATOM   1934  H  H    . GLN A 1 13 ? 3.628   -5.301  -2.974  1.00 0.00 ? 13 GLN A H    4  
ATOM   1935  H  HA   . GLN A 1 13 ? 3.144   -4.073  -0.360  1.00 0.00 ? 13 GLN A HA   4  
ATOM   1936  H  HB2  . GLN A 1 13 ? 5.348   -3.239  -0.476  1.00 0.00 ? 13 GLN A HB2  4  
ATOM   1937  H  HB3  . GLN A 1 13 ? 5.427   -4.898  -1.062  1.00 0.00 ? 13 GLN A HB3  4  
ATOM   1938  H  HG2  . GLN A 1 13 ? 5.065   -2.687  -3.001  1.00 0.00 ? 13 GLN A HG2  4  
ATOM   1939  H  HG3  . GLN A 1 13 ? 6.655   -3.009  -2.321  1.00 0.00 ? 13 GLN A HG3  4  
ATOM   1940  H  HE21 . GLN A 1 13 ? 7.350   -5.326  -2.446  1.00 0.00 ? 13 GLN A HE21 4  
ATOM   1941  H  HE22 . GLN A 1 13 ? 6.990   -6.177  -3.910  1.00 0.00 ? 13 GLN A HE22 4  
ATOM   1942  N  N    . CYS A 1 14 ? 2.899   -1.624  -1.245  1.00 0.00 ? 14 CYS A N    4  
ATOM   1943  C  CA   . CYS A 1 14 ? 2.400   -0.372  -1.790  1.00 0.00 ? 14 CYS A CA   4  
ATOM   1944  C  C    . CYS A 1 14 ? 3.436   0.255   -2.715  1.00 0.00 ? 14 CYS A C    4  
ATOM   1945  O  O    . CYS A 1 14 ? 4.548   0.544   -2.293  1.00 0.00 ? 14 CYS A O    4  
ATOM   1946  C  CB   . CYS A 1 14 ? 2.041   0.630   -0.686  1.00 0.00 ? 14 CYS A CB   4  
ATOM   1947  S  SG   . CYS A 1 14 ? 1.555   2.262   -1.347  1.00 0.00 ? 14 CYS A SG   4  
ATOM   1948  H  H    . CYS A 1 14 ? 3.218   -1.656  -0.325  1.00 0.00 ? 14 CYS A H    4  
ATOM   1949  H  HA   . CYS A 1 14 ? 1.511   -0.593  -2.360  1.00 0.00 ? 14 CYS A HA   4  
ATOM   1950  H  HB2  . CYS A 1 14 ? 1.218   0.239   -0.106  1.00 0.00 ? 14 CYS A HB2  4  
ATOM   1951  H  HB3  . CYS A 1 14 ? 2.898   0.773   -0.043  1.00 0.00 ? 14 CYS A HB3  4  
ATOM   1952  N  N    . PRO A 1 15 ? 3.065   0.527   -3.971  1.00 0.00 ? 15 PRO A N    4  
ATOM   1953  C  CA   . PRO A 1 15 ? 3.958   1.174   -4.927  1.00 0.00 ? 15 PRO A CA   4  
ATOM   1954  C  C    . PRO A 1 15 ? 4.070   2.682   -4.690  1.00 0.00 ? 15 PRO A C    4  
ATOM   1955  O  O    . PRO A 1 15 ? 4.711   3.399   -5.462  1.00 0.00 ? 15 PRO A O    4  
ATOM   1956  C  CB   . PRO A 1 15 ? 3.288   0.888   -6.270  1.00 0.00 ? 15 PRO A CB   4  
ATOM   1957  C  CG   . PRO A 1 15 ? 1.835   0.788   -5.951  1.00 0.00 ? 15 PRO A CG   4  
ATOM   1958  C  CD   . PRO A 1 15 ? 1.744   0.234   -4.554  1.00 0.00 ? 15 PRO A CD   4  
ATOM   1959  H  HA   . PRO A 1 15 ? 4.943   0.732   -4.910  1.00 0.00 ? 15 PRO A HA   4  
ATOM   1960  H  HB2  . PRO A 1 15 ? 3.489   1.698   -6.957  1.00 0.00 ? 15 PRO A HB2  4  
ATOM   1961  H  HB3  . PRO A 1 15 ? 3.666   -0.039  -6.675  1.00 0.00 ? 15 PRO A HB3  4  
ATOM   1962  H  HG2  . PRO A 1 15 ? 1.383   1.767   -5.996  1.00 0.00 ? 15 PRO A HG2  4  
ATOM   1963  H  HG3  . PRO A 1 15 ? 1.351   0.119   -6.649  1.00 0.00 ? 15 PRO A HG3  4  
ATOM   1964  H  HD2  . PRO A 1 15 ? 0.961   0.735   -4.002  1.00 0.00 ? 15 PRO A HD2  4  
ATOM   1965  H  HD3  . PRO A 1 15 ? 1.564   -0.831  -4.581  1.00 0.00 ? 15 PRO A HD3  4  
ATOM   1966  N  N    . ASP A 1 16 ? 3.417   3.165   -3.640  1.00 0.00 ? 16 ASP A N    4  
ATOM   1967  C  CA   . ASP A 1 16 ? 3.422   4.579   -3.323  1.00 0.00 ? 16 ASP A CA   4  
ATOM   1968  C  C    . ASP A 1 16 ? 4.251   4.840   -2.073  1.00 0.00 ? 16 ASP A C    4  
ATOM   1969  O  O    . ASP A 1 16 ? 5.025   5.799   -2.013  1.00 0.00 ? 16 ASP A O    4  
ATOM   1970  C  CB   . ASP A 1 16 ? 1.991   5.063   -3.107  1.00 0.00 ? 16 ASP A CB   4  
ATOM   1971  C  CG   . ASP A 1 16 ? 1.399   5.717   -4.335  1.00 0.00 ? 16 ASP A CG   4  
ATOM   1972  O  OD1  . ASP A 1 16 ? 0.805   4.998   -5.163  1.00 0.00 ? 16 ASP A OD1  4  
ATOM   1973  O  OD2  . ASP A 1 16 ? 1.512   6.952   -4.474  1.00 0.00 ? 16 ASP A OD2  4  
ATOM   1974  H  H    . ASP A 1 16 ? 2.895   2.553   -3.072  1.00 0.00 ? 16 ASP A H    4  
ATOM   1975  H  HA   . ASP A 1 16 ? 3.854   5.109   -4.154  1.00 0.00 ? 16 ASP A HA   4  
ATOM   1976  H  HB2  . ASP A 1 16 ? 1.374   4.218   -2.845  1.00 0.00 ? 16 ASP A HB2  4  
ATOM   1977  H  HB3  . ASP A 1 16 ? 1.981   5.771   -2.299  1.00 0.00 ? 16 ASP A HB3  4  
ATOM   1978  N  N    . CYS A 1 17 ? 4.078   3.979   -1.080  1.00 0.00 ? 17 CYS A N    4  
ATOM   1979  C  CA   . CYS A 1 17 ? 4.791   4.107   0.183   1.00 0.00 ? 17 CYS A CA   4  
ATOM   1980  C  C    . CYS A 1 17 ? 5.959   3.126   0.272   1.00 0.00 ? 17 CYS A C    4  
ATOM   1981  O  O    . CYS A 1 17 ? 6.907   3.361   1.020   1.00 0.00 ? 17 CYS A O    4  
ATOM   1982  C  CB   . CYS A 1 17 ? 3.839   3.877   1.359   1.00 0.00 ? 17 CYS A CB   4  
ATOM   1983  S  SG   . CYS A 1 17 ? 2.326   4.887   1.318   1.00 0.00 ? 17 CYS A SG   4  
ATOM   1984  H  H    . CYS A 1 17 ? 3.449   3.233   -1.204  1.00 0.00 ? 17 CYS A H    4  
ATOM   1985  H  HA   . CYS A 1 17 ? 5.176   5.110   0.237   1.00 0.00 ? 17 CYS A HA   4  
ATOM   1986  H  HB2  . CYS A 1 17 ? 3.539   2.839   1.367   1.00 0.00 ? 17 CYS A HB2  4  
ATOM   1987  H  HB3  . CYS A 1 17 ? 4.359   4.102   2.280   1.00 0.00 ? 17 CYS A HB3  4  
ATOM   1988  N  N    . ASP A 1 18 ? 5.783   1.966   -0.359  1.00 0.00 ? 18 ASP A N    4  
ATOM   1989  C  CA   . ASP A 1 18 ? 6.721   0.842   -0.267  1.00 0.00 ? 18 ASP A CA   4  
ATOM   1990  C  C    . ASP A 1 18 ? 6.532   0.115   1.055   1.00 0.00 ? 18 ASP A C    4  
ATOM   1991  O  O    . ASP A 1 18 ? 7.484   -0.134  1.801   1.00 0.00 ? 18 ASP A O    4  
ATOM   1992  C  CB   . ASP A 1 18 ? 8.183   1.276   -0.446  1.00 0.00 ? 18 ASP A CB   4  
ATOM   1993  C  CG   . ASP A 1 18 ? 9.068   0.147   -0.943  1.00 0.00 ? 18 ASP A CG   4  
ATOM   1994  O  OD1  . ASP A 1 18 ? 8.676   -1.031  -0.824  1.00 0.00 ? 18 ASP A OD1  4  
ATOM   1995  O  OD2  . ASP A 1 18 ? 10.173  0.441   -1.454  1.00 0.00 ? 18 ASP A OD2  4  
ATOM   1996  H  H    . ASP A 1 18 ? 4.947   1.829   -0.852  1.00 0.00 ? 18 ASP A H    4  
ATOM   1997  H  HA   . ASP A 1 18 ? 6.468   0.153   -1.063  1.00 0.00 ? 18 ASP A HA   4  
ATOM   1998  H  HB2  . ASP A 1 18 ? 8.228   2.083   -1.162  1.00 0.00 ? 18 ASP A HB2  4  
ATOM   1999  H  HB3  . ASP A 1 18 ? 8.569   1.621   0.504   1.00 0.00 ? 18 ASP A HB3  4  
ATOM   2000  N  N    . ARG A 1 19 ? 5.285   -0.250  1.320   1.00 0.00 ? 19 ARG A N    4  
ATOM   2001  C  CA   . ARG A 1 19 ? 4.941   -1.029  2.499   1.00 0.00 ? 19 ARG A CA   4  
ATOM   2002  C  C    . ARG A 1 19 ? 5.117   -2.513  2.189   1.00 0.00 ? 19 ARG A C    4  
ATOM   2003  O  O    . ARG A 1 19 ? 5.972   -2.880  1.385   1.00 0.00 ? 19 ARG A O    4  
ATOM   2004  C  CB   . ARG A 1 19 ? 3.501   -0.738  2.936   1.00 0.00 ? 19 ARG A CB   4  
ATOM   2005  C  CG   . ARG A 1 19 ? 2.995   0.635   2.524   1.00 0.00 ? 19 ARG A CG   4  
ATOM   2006  C  CD   . ARG A 1 19 ? 2.392   1.387   3.697   1.00 0.00 ? 19 ARG A CD   4  
ATOM   2007  N  NE   . ARG A 1 19 ? 1.109   0.821   4.118   1.00 0.00 ? 19 ARG A NE   4  
ATOM   2008  C  CZ   . ARG A 1 19 ? 0.883   0.345   5.350   1.00 0.00 ? 19 ARG A CZ   4  
ATOM   2009  N  NH1  . ARG A 1 19 ? 1.865   0.317   6.244   1.00 0.00 ? 19 ARG A NH1  4  
ATOM   2010  N  NH2  . ARG A 1 19 ? -0.318  -0.110  5.689   1.00 0.00 ? 19 ARG A NH2  4  
ATOM   2011  H  H    . ARG A 1 19 ? 4.589   -0.047  0.666   1.00 0.00 ? 19 ARG A H    4  
ATOM   2012  H  HA   . ARG A 1 19 ? 5.617   -0.753  3.294   1.00 0.00 ? 19 ARG A HA   4  
ATOM   2013  H  HB2  . ARG A 1 19 ? 2.849   -1.480  2.501   1.00 0.00 ? 19 ARG A HB2  4  
ATOM   2014  H  HB3  . ARG A 1 19 ? 3.444   -0.809  4.013   1.00 0.00 ? 19 ARG A HB3  4  
ATOM   2015  H  HG2  . ARG A 1 19 ? 3.821   1.208   2.130   1.00 0.00 ? 19 ARG A HG2  4  
ATOM   2016  H  HG3  . ARG A 1 19 ? 2.241   0.514   1.759   1.00 0.00 ? 19 ARG A HG3  4  
ATOM   2017  H  HD2  . ARG A 1 19 ? 3.082   1.340   4.528   1.00 0.00 ? 19 ARG A HD2  4  
ATOM   2018  H  HD3  . ARG A 1 19 ? 2.244   2.418   3.411   1.00 0.00 ? 19 ARG A HD3  4  
ATOM   2019  H  HE   . ARG A 1 19 ? 0.372   0.815   3.452   1.00 0.00 ? 19 ARG A HE   4  
ATOM   2020  H  HH11 . ARG A 1 19 ? 2.779   0.662   6.007   1.00 0.00 ? 19 ARG A HH11 4  
ATOM   2021  H  HH12 . ARG A 1 19 ? 1.702   -0.061  7.167   1.00 0.00 ? 19 ARG A HH12 4  
ATOM   2022  H  HH21 . ARG A 1 19 ? -1.072  -0.101  5.031   1.00 0.00 ? 19 ARG A HH21 4  
ATOM   2023  H  HH22 . ARG A 1 19 ? -0.482  -0.452  6.622   1.00 0.00 ? 19 ARG A HH22 4  
ATOM   2024  N  N    . SER A 1 20 ? 4.286   -3.362  2.776   1.00 0.00 ? 20 SER A N    4  
ATOM   2025  C  CA   . SER A 1 20 ? 4.339   -4.789  2.488   1.00 0.00 ? 20 SER A CA   4  
ATOM   2026  C  C    . SER A 1 20 ? 3.102   -5.506  3.016   1.00 0.00 ? 20 SER A C    4  
ATOM   2027  O  O    . SER A 1 20 ? 2.789   -5.430  4.203   1.00 0.00 ? 20 SER A O    4  
ATOM   2028  C  CB   . SER A 1 20 ? 5.600   -5.410  3.091   1.00 0.00 ? 20 SER A CB   4  
ATOM   2029  O  OG   . SER A 1 20 ? 6.049   -4.680  4.228   1.00 0.00 ? 20 SER A OG   4  
ATOM   2030  H  H    . SER A 1 20 ? 3.610   -3.024  3.408   1.00 0.00 ? 20 SER A H    4  
ATOM   2031  H  HA   . SER A 1 20 ? 4.368   -4.904  1.414   1.00 0.00 ? 20 SER A HA   4  
ATOM   2032  H  HB2  . SER A 1 20 ? 5.384   -6.424  3.391   1.00 0.00 ? 20 SER A HB2  4  
ATOM   2033  H  HB3  . SER A 1 20 ? 6.387   -5.416  2.350   1.00 0.00 ? 20 SER A HB3  4  
ATOM   2034  H  HG   . SER A 1 20 ? 6.545   -3.902  3.933   1.00 0.00 ? 20 SER A HG   4  
ATOM   2035  N  N    . PHE A 1 21 ? 2.396   -6.189  2.125   1.00 0.00 ? 21 PHE A N    4  
ATOM   2036  C  CA   . PHE A 1 21 ? 1.201   -6.930  2.494   1.00 0.00 ? 21 PHE A CA   4  
ATOM   2037  C  C    . PHE A 1 21 ? 1.253   -8.316  1.867   1.00 0.00 ? 21 PHE A C    4  
ATOM   2038  O  O    . PHE A 1 21 ? 1.673   -8.469  0.719   1.00 0.00 ? 21 PHE A O    4  
ATOM   2039  C  CB   . PHE A 1 21 ? -0.066  -6.200  2.029   1.00 0.00 ? 21 PHE A CB   4  
ATOM   2040  C  CG   . PHE A 1 21 ? -0.044  -4.712  2.247   1.00 0.00 ? 21 PHE A CG   4  
ATOM   2041  C  CD1  . PHE A 1 21 ? 0.637   -3.879  1.371   1.00 0.00 ? 21 PHE A CD1  4  
ATOM   2042  C  CD2  . PHE A 1 21 ? -0.706  -4.147  3.322   1.00 0.00 ? 21 PHE A CD2  4  
ATOM   2043  C  CE1  . PHE A 1 21 ? 0.655   -2.515  1.562   1.00 0.00 ? 21 PHE A CE1  4  
ATOM   2044  C  CE2  . PHE A 1 21 ? -0.692  -2.780  3.519   1.00 0.00 ? 21 PHE A CE2  4  
ATOM   2045  C  CZ   . PHE A 1 21 ? -0.009  -1.965  2.637   1.00 0.00 ? 21 PHE A CZ   4  
ATOM   2046  H  H    . PHE A 1 21 ? 2.685   -6.200  1.182   1.00 0.00 ? 21 PHE A H    4  
ATOM   2047  H  HA   . PHE A 1 21 ? 1.183   -7.029  3.569   1.00 0.00 ? 21 PHE A HA   4  
ATOM   2048  H  HB2  . PHE A 1 21 ? -0.200  -6.373  0.972   1.00 0.00 ? 21 PHE A HB2  4  
ATOM   2049  H  HB3  . PHE A 1 21 ? -0.917  -6.600  2.562   1.00 0.00 ? 21 PHE A HB3  4  
ATOM   2050  H  HD1  . PHE A 1 21 ? 1.163   -4.312  0.530   1.00 0.00 ? 21 PHE A HD1  4  
ATOM   2051  H  HD2  . PHE A 1 21 ? -1.240  -4.784  4.011   1.00 0.00 ? 21 PHE A HD2  4  
ATOM   2052  H  HE1  . PHE A 1 21 ? 1.188   -1.880  0.871   1.00 0.00 ? 21 PHE A HE1  4  
ATOM   2053  H  HE2  . PHE A 1 21 ? -1.214  -2.349  4.360   1.00 0.00 ? 21 PHE A HE2  4  
ATOM   2054  H  HZ   . PHE A 1 21 ? 0.007   -0.898  2.789   1.00 0.00 ? 21 PHE A HZ   4  
ATOM   2055  N  N    . SER A 1 22 ? 0.868   -9.328  2.624   1.00 0.00 ? 22 SER A N    4  
ATOM   2056  C  CA   . SER A 1 22 ? 0.881   -10.689 2.122   1.00 0.00 ? 22 SER A CA   4  
ATOM   2057  C  C    . SER A 1 22 ? -0.285  -10.900 1.157   1.00 0.00 ? 22 SER A C    4  
ATOM   2058  O  O    . SER A 1 22 ? -0.243  -11.771 0.287   1.00 0.00 ? 22 SER A O    4  
ATOM   2059  C  CB   . SER A 1 22 ? 0.789   -11.673 3.288   1.00 0.00 ? 22 SER A CB   4  
ATOM   2060  O  OG   . SER A 1 22 ? 0.989   -11.011 4.529   1.00 0.00 ? 22 SER A OG   4  
ATOM   2061  H  H    . SER A 1 22 ? 0.574   -9.163  3.544   1.00 0.00 ? 22 SER A H    4  
ATOM   2062  H  HA   . SER A 1 22 ? 1.819   -10.842 1.595   1.00 0.00 ? 22 SER A HA   4  
ATOM   2063  H  HB2  . SER A 1 22 ? -0.188  -12.133 3.295   1.00 0.00 ? 22 SER A HB2  4  
ATOM   2064  H  HB3  . SER A 1 22 ? 1.546   -12.435 3.176   1.00 0.00 ? 22 SER A HB3  4  
ATOM   2065  H  HG   . SER A 1 22 ? 1.921   -11.118 4.798   1.00 0.00 ? 22 SER A HG   4  
ATOM   2066  N  N    . ARG A 1 23 ? -1.326  -10.088 1.328   1.00 0.00 ? 23 ARG A N    4  
ATOM   2067  C  CA   . ARG A 1 23 ? -2.515  -10.150 0.488   1.00 0.00 ? 23 ARG A CA   4  
ATOM   2068  C  C    . ARG A 1 23 ? -2.650  -8.908  -0.357  1.00 0.00 ? 23 ARG A C    4  
ATOM   2069  O  O    . ARG A 1 23 ? -2.538  -7.781  0.130   1.00 0.00 ? 23 ARG A O    4  
ATOM   2070  C  CB   . ARG A 1 23 ? -3.775  -10.313 1.340   1.00 0.00 ? 23 ARG A CB   4  
ATOM   2071  C  CG   . ARG A 1 23 ? -3.746  -11.517 2.260   1.00 0.00 ? 23 ARG A CG   4  
ATOM   2072  C  CD   . ARG A 1 23 ? -5.006  -11.602 3.111   1.00 0.00 ? 23 ARG A CD   4  
ATOM   2073  N  NE   . ARG A 1 23 ? -6.227  -11.393 2.329   1.00 0.00 ? 23 ARG A NE   4  
ATOM   2074  C  CZ   . ARG A 1 23 ? -6.847  -12.352 1.641   1.00 0.00 ? 23 ARG A CZ   4  
ATOM   2075  N  NH1  . ARG A 1 23 ? -6.300  -13.556 1.536   1.00 0.00 ? 23 ARG A NH1  4  
ATOM   2076  N  NH2  . ARG A 1 23 ? -8.003  -12.102 1.041   1.00 0.00 ? 23 ARG A NH2  4  
ATOM   2077  H  H    . ARG A 1 23 ? -1.294  -9.427  2.054   1.00 0.00 ? 23 ARG A H    4  
ATOM   2078  H  HA   . ARG A 1 23 ? -2.426  -10.992 -0.185  1.00 0.00 ? 23 ARG A HA   4  
ATOM   2079  H  HB2  . ARG A 1 23 ? -3.900  -9.428  1.948   1.00 0.00 ? 23 ARG A HB2  4  
ATOM   2080  H  HB3  . ARG A 1 23 ? -4.629  -10.410 0.685   1.00 0.00 ? 23 ARG A HB3  4  
ATOM   2081  H  HG2  . ARG A 1 23 ? -3.667  -12.413 1.662   1.00 0.00 ? 23 ARG A HG2  4  
ATOM   2082  H  HG3  . ARG A 1 23 ? -2.887  -11.439 2.913   1.00 0.00 ? 23 ARG A HG3  4  
ATOM   2083  H  HD2  . ARG A 1 23 ? -5.050  -12.578 3.569   1.00 0.00 ? 23 ARG A HD2  4  
ATOM   2084  H  HD3  . ARG A 1 23 ? -4.952  -10.847 3.884   1.00 0.00 ? 23 ARG A HD3  4  
ATOM   2085  H  HE   . ARG A 1 23 ? -6.624  -10.483 2.345   1.00 0.00 ? 23 ARG A HE   4  
ATOM   2086  H  HH11 . ARG A 1 23 ? -5.413  -13.750 1.966   1.00 0.00 ? 23 ARG A HH11 4  
ATOM   2087  H  HH12 . ARG A 1 23 ? -6.772  -14.286 1.028   1.00 0.00 ? 23 ARG A HH12 4  
ATOM   2088  H  HH21 . ARG A 1 23 ? -8.422  -11.190 1.107   1.00 0.00 ? 23 ARG A HH21 4  
ATOM   2089  H  HH22 . ARG A 1 23 ? -8.466  -12.823 0.514   1.00 0.00 ? 23 ARG A HH22 4  
ATOM   2090  N  N    . SER A 1 24 ? -2.987  -9.134  -1.607  1.00 0.00 ? 24 SER A N    4  
ATOM   2091  C  CA   . SER A 1 24 ? -3.245  -8.070  -2.546  1.00 0.00 ? 24 SER A CA   4  
ATOM   2092  C  C    . SER A 1 24 ? -4.481  -7.287  -2.114  1.00 0.00 ? 24 SER A C    4  
ATOM   2093  O  O    . SER A 1 24 ? -4.593  -6.083  -2.346  1.00 0.00 ? 24 SER A O    4  
ATOM   2094  C  CB   . SER A 1 24 ? -3.442  -8.691  -3.916  1.00 0.00 ? 24 SER A CB   4  
ATOM   2095  O  OG   . SER A 1 24 ? -3.697  -10.083 -3.801  1.00 0.00 ? 24 SER A OG   4  
ATOM   2096  H  H    . SER A 1 24 ? -3.111  -10.064 -1.906  1.00 0.00 ? 24 SER A H    4  
ATOM   2097  H  HA   . SER A 1 24 ? -2.390  -7.414  -2.565  1.00 0.00 ? 24 SER A HA   4  
ATOM   2098  H  HB2  . SER A 1 24 ? -4.276  -8.225  -4.403  1.00 0.00 ? 24 SER A HB2  4  
ATOM   2099  H  HB3  . SER A 1 24 ? -2.549  -8.554  -4.497  1.00 0.00 ? 24 SER A HB3  4  
ATOM   2100  H  HG   . SER A 1 24 ? -4.492  -10.304 -4.311  1.00 0.00 ? 24 SER A HG   4  
ATOM   2101  N  N    . ASP A 1 25 ? -5.356  -7.974  -1.392  1.00 0.00 ? 25 ASP A N    4  
ATOM   2102  C  CA   . ASP A 1 25 ? -6.529  -7.364  -0.812  1.00 0.00 ? 25 ASP A CA   4  
ATOM   2103  C  C    . ASP A 1 25 ? -6.132  -6.339  0.249   1.00 0.00 ? 25 ASP A C    4  
ATOM   2104  O  O    . ASP A 1 25 ? -6.656  -5.229  0.271   1.00 0.00 ? 25 ASP A O    4  
ATOM   2105  C  CB   . ASP A 1 25 ? -7.413  -8.465  -0.225  1.00 0.00 ? 25 ASP A CB   4  
ATOM   2106  C  CG   . ASP A 1 25 ? -7.757  -8.262  1.240   1.00 0.00 ? 25 ASP A CG   4  
ATOM   2107  O  OD1  . ASP A 1 25 ? -8.789  -7.627  1.539   1.00 0.00 ? 25 ASP A OD1  4  
ATOM   2108  O  OD2  . ASP A 1 25 ? -7.009  -8.772  2.098   1.00 0.00 ? 25 ASP A OD2  4  
ATOM   2109  H  H    . ASP A 1 25 ? -5.186  -8.918  -1.213  1.00 0.00 ? 25 ASP A H    4  
ATOM   2110  H  HA   . ASP A 1 25 ? -7.064  -6.863  -1.599  1.00 0.00 ? 25 ASP A HA   4  
ATOM   2111  H  HB2  . ASP A 1 25 ? -8.324  -8.509  -0.787  1.00 0.00 ? 25 ASP A HB2  4  
ATOM   2112  H  HB3  . ASP A 1 25 ? -6.900  -9.409  -0.323  1.00 0.00 ? 25 ASP A HB3  4  
ATOM   2113  N  N    . HIS A 1 26 ? -5.123  -6.680  1.049   1.00 0.00 ? 26 HIS A N    4  
ATOM   2114  C  CA   . HIS A 1 26 ? -4.605  -5.769  2.066   1.00 0.00 ? 26 HIS A CA   4  
ATOM   2115  C  C    . HIS A 1 26 ? -3.934  -4.570  1.413   1.00 0.00 ? 26 HIS A C    4  
ATOM   2116  O  O    . HIS A 1 26 ? -4.077  -3.439  1.881   1.00 0.00 ? 26 HIS A O    4  
ATOM   2117  C  CB   . HIS A 1 26 ? -3.611  -6.493  2.979   1.00 0.00 ? 26 HIS A CB   4  
ATOM   2118  C  CG   . HIS A 1 26 ? -4.226  -7.048  4.226   1.00 0.00 ? 26 HIS A CG   4  
ATOM   2119  N  ND1  . HIS A 1 26 ? -3.590  -7.045  5.447   1.00 0.00 ? 26 HIS A ND1  4  
ATOM   2120  C  CD2  . HIS A 1 26 ? -5.419  -7.651  4.431   1.00 0.00 ? 26 HIS A CD2  4  
ATOM   2121  C  CE1  . HIS A 1 26 ? -4.366  -7.620  6.346   1.00 0.00 ? 26 HIS A CE1  4  
ATOM   2122  N  NE2  . HIS A 1 26 ? -5.482  -8.000  5.757   1.00 0.00 ? 26 HIS A NE2  4  
ATOM   2123  H  H    . HIS A 1 26 ? -4.685  -7.547  0.917   1.00 0.00 ? 26 HIS A H    4  
ATOM   2124  H  HA   . HIS A 1 26 ? -5.439  -5.421  2.656   1.00 0.00 ? 26 HIS A HA   4  
ATOM   2125  H  HB2  . HIS A 1 26 ? -3.167  -7.313  2.436   1.00 0.00 ? 26 HIS A HB2  4  
ATOM   2126  H  HB3  . HIS A 1 26 ? -2.835  -5.801  3.272   1.00 0.00 ? 26 HIS A HB3  4  
ATOM   2127  H  HD1  . HIS A 1 26 ? -2.689  -6.683  5.629   1.00 0.00 ? 26 HIS A HD1  4  
ATOM   2128  H  HD2  . HIS A 1 26 ? -6.182  -7.829  3.686   1.00 0.00 ? 26 HIS A HD2  4  
ATOM   2129  H  HE1  . HIS A 1 26 ? -4.126  -7.757  7.390   1.00 0.00 ? 26 HIS A HE1  4  
ATOM   2130  H  HE2  . HIS A 1 26 ? -6.105  -8.667  6.132   1.00 0.00 ? 26 HIS A HE2  4  
ATOM   2131  N  N    . LEU A 1 27 ? -3.289  -4.819  0.275   1.00 0.00 ? 27 LEU A N    4  
ATOM   2132  C  CA   . LEU A 1 27 ? -2.688  -3.758  -0.527  1.00 0.00 ? 27 LEU A CA   4  
ATOM   2133  C  C    . LEU A 1 27 ? -3.730  -2.700  -0.862  1.00 0.00 ? 27 LEU A C    4  
ATOM   2134  O  O    . LEU A 1 27 ? -3.600  -1.534  -0.480  1.00 0.00 ? 27 LEU A O    4  
ATOM   2135  C  CB   . LEU A 1 27 ? -2.135  -4.330  -1.838  1.00 0.00 ? 27 LEU A CB   4  
ATOM   2136  C  CG   . LEU A 1 27 ? -1.194  -3.416  -2.634  1.00 0.00 ? 27 LEU A CG   4  
ATOM   2137  C  CD1  . LEU A 1 27 ? -0.618  -2.308  -1.766  1.00 0.00 ? 27 LEU A CD1  4  
ATOM   2138  C  CD2  . LEU A 1 27 ? -0.090  -4.220  -3.285  1.00 0.00 ? 27 LEU A CD2  4  
ATOM   2139  H  H    . LEU A 1 27 ? -3.278  -5.738  -0.069  1.00 0.00 ? 27 LEU A H    4  
ATOM   2140  H  HA   . LEU A 1 27 ? -1.888  -3.309  0.040   1.00 0.00 ? 27 LEU A HA   4  
ATOM   2141  H  HB2  . LEU A 1 27 ? -1.600  -5.239  -1.606  1.00 0.00 ? 27 LEU A HB2  4  
ATOM   2142  H  HB3  . LEU A 1 27 ? -2.972  -4.582  -2.472  1.00 0.00 ? 27 LEU A HB3  4  
ATOM   2143  H  HG   . LEU A 1 27 ? -1.762  -2.946  -3.424  1.00 0.00 ? 27 LEU A HG   4  
ATOM   2144  H  HD11 . LEU A 1 27 ? 0.172   -2.711  -1.146  1.00 0.00 ? 27 LEU A HD11 4  
ATOM   2145  H  HD12 . LEU A 1 27 ? -0.219  -1.527  -2.396  1.00 0.00 ? 27 LEU A HD12 4  
ATOM   2146  H  HD13 . LEU A 1 27 ? -1.397  -1.903  -1.137  1.00 0.00 ? 27 LEU A HD13 4  
ATOM   2147  H  HD21 . LEU A 1 27 ? 0.309   -4.928  -2.573  1.00 0.00 ? 27 LEU A HD21 4  
ATOM   2148  H  HD22 . LEU A 1 27 ? -0.484  -4.750  -4.140  1.00 0.00 ? 27 LEU A HD22 4  
ATOM   2149  H  HD23 . LEU A 1 27 ? 0.697   -3.551  -3.608  1.00 0.00 ? 27 LEU A HD23 4  
ATOM   2150  N  N    . ALA A 1 28 ? -4.740  -3.119  -1.616  1.00 0.00 ? 28 ALA A N    4  
ATOM   2151  C  CA   . ALA A 1 28 ? -5.790  -2.221  -2.073  1.00 0.00 ? 28 ALA A CA   4  
ATOM   2152  C  C    . ALA A 1 28 ? -6.468  -1.506  -0.909  1.00 0.00 ? 28 ALA A C    4  
ATOM   2153  O  O    . ALA A 1 28 ? -6.822  -0.336  -1.024  1.00 0.00 ? 28 ALA A O    4  
ATOM   2154  C  CB   . ALA A 1 28 ? -6.816  -2.987  -2.893  1.00 0.00 ? 28 ALA A CB   4  
ATOM   2155  H  H    . ALA A 1 28 ? -4.761  -4.061  -1.901  1.00 0.00 ? 28 ALA A H    4  
ATOM   2156  H  HA   . ALA A 1 28 ? -5.332  -1.480  -2.715  1.00 0.00 ? 28 ALA A HA   4  
ATOM   2157  H  HB1  . ALA A 1 28 ? -6.889  -3.999  -2.526  1.00 0.00 ? 28 ALA A HB1  4  
ATOM   2158  H  HB2  . ALA A 1 28 ? -7.777  -2.502  -2.808  1.00 0.00 ? 28 ALA A HB2  4  
ATOM   2159  H  HB3  . ALA A 1 28 ? -6.511  -3.001  -3.930  1.00 0.00 ? 28 ALA A HB3  4  
ATOM   2160  N  N    . LEU A 1 29 ? -6.640  -2.211  0.208   1.00 0.00 ? 29 LEU A N    4  
ATOM   2161  C  CA   . LEU A 1 29 ? -7.276  -1.632  1.387   1.00 0.00 ? 29 LEU A CA   4  
ATOM   2162  C  C    . LEU A 1 29 ? -6.515  -0.399  1.868   1.00 0.00 ? 29 LEU A C    4  
ATOM   2163  O  O    . LEU A 1 29 ? -7.108  0.653   2.106   1.00 0.00 ? 29 LEU A O    4  
ATOM   2164  C  CB   . LEU A 1 29 ? -7.365  -2.660  2.514   1.00 0.00 ? 29 LEU A CB   4  
ATOM   2165  C  CG   . LEU A 1 29 ? -8.295  -3.842  2.242   1.00 0.00 ? 29 LEU A CG   4  
ATOM   2166  C  CD1  . LEU A 1 29 ? -8.329  -4.778  3.439   1.00 0.00 ? 29 LEU A CD1  4  
ATOM   2167  C  CD2  . LEU A 1 29 ? -9.694  -3.357  1.910   1.00 0.00 ? 29 LEU A CD2  4  
ATOM   2168  H  H    . LEU A 1 29 ? -6.339  -3.147  0.237   1.00 0.00 ? 29 LEU A H    4  
ATOM   2169  H  HA   . LEU A 1 29 ? -8.273  -1.334  1.110   1.00 0.00 ? 29 LEU A HA   4  
ATOM   2170  H  HB2  . LEU A 1 29 ? -6.374  -3.042  2.703   1.00 0.00 ? 29 LEU A HB2  4  
ATOM   2171  H  HB3  . LEU A 1 29 ? -7.715  -2.155  3.400   1.00 0.00 ? 29 LEU A HB3  4  
ATOM   2172  H  HG   . LEU A 1 29 ? -7.921  -4.399  1.393   1.00 0.00 ? 29 LEU A HG   4  
ATOM   2173  H  HD11 . LEU A 1 29 ? -7.906  -4.280  4.299   1.00 0.00 ? 29 LEU A HD11 4  
ATOM   2174  H  HD12 . LEU A 1 29 ? -9.351  -5.054  3.649   1.00 0.00 ? 29 LEU A HD12 4  
ATOM   2175  H  HD13 . LEU A 1 29 ? -7.754  -5.666  3.218   1.00 0.00 ? 29 LEU A HD13 4  
ATOM   2176  H  HD21 . LEU A 1 29 ? -10.109 -2.850  2.768   1.00 0.00 ? 29 LEU A HD21 4  
ATOM   2177  H  HD22 . LEU A 1 29 ? -9.650  -2.676  1.073   1.00 0.00 ? 29 LEU A HD22 4  
ATOM   2178  H  HD23 . LEU A 1 29 ? -10.318 -4.202  1.655   1.00 0.00 ? 29 LEU A HD23 4  
ATOM   2179  N  N    . HIS A 1 30 ? -5.196  -0.512  1.953   1.00 0.00 ? 30 HIS A N    4  
ATOM   2180  C  CA   . HIS A 1 30 ? -4.368  0.619   2.345   1.00 0.00 ? 30 HIS A CA   4  
ATOM   2181  C  C    . HIS A 1 30 ? -4.328  1.653   1.224   1.00 0.00 ? 30 HIS A C    4  
ATOM   2182  O  O    . HIS A 1 30 ? -4.258  2.858   1.472   1.00 0.00 ? 30 HIS A O    4  
ATOM   2183  C  CB   . HIS A 1 30 ? -2.939  0.164   2.699   1.00 0.00 ? 30 HIS A CB   4  
ATOM   2184  C  CG   . HIS A 1 30 ? -1.896  1.225   2.488   1.00 0.00 ? 30 HIS A CG   4  
ATOM   2185  N  ND1  . HIS A 1 30 ? -1.685  2.273   3.348   1.00 0.00 ? 30 HIS A ND1  4  
ATOM   2186  C  CD2  . HIS A 1 30 ? -1.051  1.417   1.445   1.00 0.00 ? 30 HIS A CD2  4  
ATOM   2187  C  CE1  . HIS A 1 30 ? -0.747  3.063   2.810   1.00 0.00 ? 30 HIS A CE1  4  
ATOM   2188  N  NE2  . HIS A 1 30 ? -0.326  2.586   1.649   1.00 0.00 ? 30 HIS A NE2  4  
ATOM   2189  H  H    . HIS A 1 30 ? -4.769  -1.365  1.709   1.00 0.00 ? 30 HIS A H    4  
ATOM   2190  H  HA   . HIS A 1 30 ? -4.819  1.072   3.217   1.00 0.00 ? 30 HIS A HA   4  
ATOM   2191  H  HB2  . HIS A 1 30 ? -2.909  -0.126  3.737   1.00 0.00 ? 30 HIS A HB2  4  
ATOM   2192  H  HB3  . HIS A 1 30 ? -2.673  -0.684  2.087   1.00 0.00 ? 30 HIS A HB3  4  
ATOM   2193  H  HD1  . HIS A 1 30 ? -2.151  2.423   4.214   1.00 0.00 ? 30 HIS A HD1  4  
ATOM   2194  H  HD2  . HIS A 1 30 ? -0.952  0.774   0.584   1.00 0.00 ? 30 HIS A HD2  4  
ATOM   2195  H  HE1  . HIS A 1 30 ? -0.380  3.971   3.265   1.00 0.00 ? 30 HIS A HE1  4  
ATOM   2196  N  N    . ARG A 1 31 ? -4.327  1.171   -0.009  1.00 0.00 ? 31 ARG A N    4  
ATOM   2197  C  CA   . ARG A 1 31 ? -4.203  2.045   -1.164  1.00 0.00 ? 31 ARG A CA   4  
ATOM   2198  C  C    . ARG A 1 31 ? -5.495  2.817   -1.427  1.00 0.00 ? 31 ARG A C    4  
ATOM   2199  O  O    . ARG A 1 31 ? -5.567  3.615   -2.359  1.00 0.00 ? 31 ARG A O    4  
ATOM   2200  C  CB   . ARG A 1 31 ? -3.797  1.245   -2.403  1.00 0.00 ? 31 ARG A CB   4  
ATOM   2201  C  CG   . ARG A 1 31 ? -2.352  0.771   -2.358  1.00 0.00 ? 31 ARG A CG   4  
ATOM   2202  C  CD   . ARG A 1 31 ? -1.777  0.556   -3.747  1.00 0.00 ? 31 ARG A CD   4  
ATOM   2203  N  NE   . ARG A 1 31 ? -1.255  1.793   -4.328  1.00 0.00 ? 31 ARG A NE   4  
ATOM   2204  C  CZ   . ARG A 1 31 ? -1.693  2.318   -5.475  1.00 0.00 ? 31 ARG A CZ   4  
ATOM   2205  N  NH1  . ARG A 1 31 ? -2.602  1.675   -6.195  1.00 0.00 ? 31 ARG A NH1  4  
ATOM   2206  N  NH2  . ARG A 1 31 ? -1.192  3.462   -5.926  1.00 0.00 ? 31 ARG A NH2  4  
ATOM   2207  H  H    . ARG A 1 31 ? -4.370  0.196   -0.145  1.00 0.00 ? 31 ARG A H    4  
ATOM   2208  H  HA   . ARG A 1 31 ? -3.414  2.753   -0.941  1.00 0.00 ? 31 ARG A HA   4  
ATOM   2209  H  HB2  . ARG A 1 31 ? -4.440  0.381   -2.488  1.00 0.00 ? 31 ARG A HB2  4  
ATOM   2210  H  HB3  . ARG A 1 31 ? -3.923  1.869   -3.276  1.00 0.00 ? 31 ARG A HB3  4  
ATOM   2211  H  HG2  . ARG A 1 31 ? -1.759  1.512   -1.847  1.00 0.00 ? 31 ARG A HG2  4  
ATOM   2212  H  HG3  . ARG A 1 31 ? -2.309  -0.161  -1.814  1.00 0.00 ? 31 ARG A HG3  4  
ATOM   2213  H  HD2  . ARG A 1 31 ? -0.970  -0.161  -3.680  1.00 0.00 ? 31 ARG A HD2  4  
ATOM   2214  H  HD3  . ARG A 1 31 ? -2.555  0.165   -4.388  1.00 0.00 ? 31 ARG A HD3  4  
ATOM   2215  H  HE   . ARG A 1 31 ? -0.542  2.255   -3.835  1.00 0.00 ? 31 ARG A HE   4  
ATOM   2216  H  HH11 . ARG A 1 31 ? -2.957  0.784   -5.887  1.00 0.00 ? 31 ARG A HH11 4  
ATOM   2217  H  HH12 . ARG A 1 31 ? -2.939  2.071   -7.058  1.00 0.00 ? 31 ARG A HH12 4  
ATOM   2218  H  HH21 . ARG A 1 31 ? -0.469  3.951   -5.410  1.00 0.00 ? 31 ARG A HH21 4  
ATOM   2219  H  HH22 . ARG A 1 31 ? -1.526  3.853   -6.797  1.00 0.00 ? 31 ARG A HH22 4  
ATOM   2220  N  N    . LYS A 1 32 ? -6.480  2.638   -0.554  1.00 0.00 ? 32 LYS A N    4  
ATOM   2221  C  CA   . LYS A 1 32 ? -7.738  3.371   -0.642  1.00 0.00 ? 32 LYS A CA   4  
ATOM   2222  C  C    . LYS A 1 32 ? -7.494  4.874   -0.513  1.00 0.00 ? 32 LYS A C    4  
ATOM   2223  O  O    . LYS A 1 32 ? -8.175  5.684   -1.144  1.00 0.00 ? 32 LYS A O    4  
ATOM   2224  C  CB   . LYS A 1 32 ? -8.700  2.907   0.456   1.00 0.00 ? 32 LYS A CB   4  
ATOM   2225  C  CG   . LYS A 1 32 ? -9.932  2.187   -0.070  1.00 0.00 ? 32 LYS A CG   4  
ATOM   2226  C  CD   . LYS A 1 32 ? -9.555  1.039   -0.989  1.00 0.00 ? 32 LYS A CD   4  
ATOM   2227  C  CE   . LYS A 1 32 ? -10.547 -0.107  -0.889  1.00 0.00 ? 32 LYS A CE   4  
ATOM   2228  N  NZ   . LYS A 1 32 ? -11.447 -0.163  -2.073  1.00 0.00 ? 32 LYS A NZ   4  
ATOM   2229  H  H    . LYS A 1 32 ? -6.349  2.009   0.186   1.00 0.00 ? 32 LYS A H    4  
ATOM   2230  H  HA   . LYS A 1 32 ? -8.180  3.167   -1.605  1.00 0.00 ? 32 LYS A HA   4  
ATOM   2231  H  HB2  . LYS A 1 32 ? -8.171  2.235   1.116   1.00 0.00 ? 32 LYS A HB2  4  
ATOM   2232  H  HB3  . LYS A 1 32 ? -9.025  3.767   1.019   1.00 0.00 ? 32 LYS A HB3  4  
ATOM   2233  H  HG2  . LYS A 1 32 ? -10.493 1.796   0.767   1.00 0.00 ? 32 LYS A HG2  4  
ATOM   2234  H  HG3  . LYS A 1 32 ? -10.540 2.891   -0.618  1.00 0.00 ? 32 LYS A HG3  4  
ATOM   2235  H  HD2  . LYS A 1 32 ? -9.536  1.398   -2.005  1.00 0.00 ? 32 LYS A HD2  4  
ATOM   2236  H  HD3  . LYS A 1 32 ? -8.571  0.679   -0.713  1.00 0.00 ? 32 LYS A HD3  4  
ATOM   2237  H  HE2  . LYS A 1 32 ? -9.999  -1.034  -0.822  1.00 0.00 ? 32 LYS A HE2  4  
ATOM   2238  H  HE3  . LYS A 1 32 ? -11.143 0.025   -0.001  1.00 0.00 ? 32 LYS A HE3  4  
ATOM   2239  H  HZ1  . LYS A 1 32 ? -11.038 0.386   -2.861  1.00 0.00 ? 32 LYS A HZ1  4  
ATOM   2240  H  HZ2  . LYS A 1 32 ? -12.380 0.238   -1.836  1.00 0.00 ? 32 LYS A HZ2  4  
ATOM   2241  H  HZ3  . LYS A 1 32 ? -11.573 -1.150  -2.385  1.00 0.00 ? 32 LYS A HZ3  4  
ATOM   2242  N  N    . ARG A 1 33 ? -6.484  5.234   0.272   1.00 0.00 ? 33 ARG A N    4  
ATOM   2243  C  CA   . ARG A 1 33 ? -6.122  6.635   0.472   1.00 0.00 ? 33 ARG A CA   4  
ATOM   2244  C  C    . ARG A 1 33 ? -5.328  7.166   -0.720  1.00 0.00 ? 33 ARG A C    4  
ATOM   2245  O  O    . ARG A 1 33 ? -5.020  8.355   -0.798  1.00 0.00 ? 33 ARG A O    4  
ATOM   2246  C  CB   . ARG A 1 33 ? -5.309  6.798   1.760   1.00 0.00 ? 33 ARG A CB   4  
ATOM   2247  C  CG   . ARG A 1 33 ? -3.943  6.128   1.721   1.00 0.00 ? 33 ARG A CG   4  
ATOM   2248  C  CD   . ARG A 1 33 ? -2.988  6.749   2.727   1.00 0.00 ? 33 ARG A CD   4  
ATOM   2249  N  NE   . ARG A 1 33 ? -3.146  6.179   4.065   1.00 0.00 ? 33 ARG A NE   4  
ATOM   2250  C  CZ   . ARG A 1 33 ? -2.189  6.179   4.992   1.00 0.00 ? 33 ARG A CZ   4  
ATOM   2251  N  NH1  . ARG A 1 33 ? -0.969  6.603   4.690   1.00 0.00 ? 33 ARG A NH1  4  
ATOM   2252  N  NH2  . ARG A 1 33 ? -2.444  5.724   6.212   1.00 0.00 ? 33 ARG A NH2  4  
ATOM   2253  H  H    . ARG A 1 33 ? -5.965  4.536   0.724   1.00 0.00 ? 33 ARG A H    4  
ATOM   2254  H  HA   . ARG A 1 33 ? -7.036  7.202   0.560   1.00 0.00 ? 33 ARG A HA   4  
ATOM   2255  H  HB2  . ARG A 1 33 ? -5.162  7.852   1.947   1.00 0.00 ? 33 ARG A HB2  4  
ATOM   2256  H  HB3  . ARG A 1 33 ? -5.870  6.373   2.580   1.00 0.00 ? 33 ARG A HB3  4  
ATOM   2257  H  HG2  . ARG A 1 33 ? -4.060  5.080   1.950   1.00 0.00 ? 33 ARG A HG2  4  
ATOM   2258  H  HG3  . ARG A 1 33 ? -3.528  6.237   0.729   1.00 0.00 ? 33 ARG A HG3  4  
ATOM   2259  H  HD2  . ARG A 1 33 ? -1.975  6.580   2.392   1.00 0.00 ? 33 ARG A HD2  4  
ATOM   2260  H  HD3  . ARG A 1 33 ? -3.178  7.811   2.773   1.00 0.00 ? 33 ARG A HD3  4  
ATOM   2261  H  HE   . ARG A 1 33 ? -4.030  5.795   4.293   1.00 0.00 ? 33 ARG A HE   4  
ATOM   2262  H  HH11 . ARG A 1 33 ? -0.759  6.926   3.759   1.00 0.00 ? 33 ARG A HH11 4  
ATOM   2263  H  HH12 . ARG A 1 33 ? -0.246  6.608   5.390   1.00 0.00 ? 33 ARG A HH12 4  
ATOM   2264  H  HH21 . ARG A 1 33 ? -3.363  5.376   6.444   1.00 0.00 ? 33 ARG A HH21 4  
ATOM   2265  H  HH22 . ARG A 1 33 ? -1.726  5.735   6.916   1.00 0.00 ? 33 ARG A HH22 4  
ATOM   2266  N  N    . HIS A 1 34 ? -5.015  6.280   -1.654  1.00 0.00 ? 34 HIS A N    4  
ATOM   2267  C  CA   . HIS A 1 34 ? -4.269  6.656   -2.845  1.00 0.00 ? 34 HIS A CA   4  
ATOM   2268  C  C    . HIS A 1 34 ? -5.210  6.802   -4.033  1.00 0.00 ? 34 HIS A C    4  
ATOM   2269  O  O    . HIS A 1 34 ? -4.783  7.079   -5.150  1.00 0.00 ? 34 HIS A O    4  
ATOM   2270  C  CB   . HIS A 1 34 ? -3.187  5.615   -3.147  1.00 0.00 ? 34 HIS A CB   4  
ATOM   2271  C  CG   . HIS A 1 34 ? -2.141  5.506   -2.076  1.00 0.00 ? 34 HIS A CG   4  
ATOM   2272  N  ND1  . HIS A 1 34 ? -1.379  6.563   -1.642  1.00 0.00 ? 34 HIS A ND1  4  
ATOM   2273  C  CD2  . HIS A 1 34 ? -1.736  4.432   -1.349  1.00 0.00 ? 34 HIS A CD2  4  
ATOM   2274  C  CE1  . HIS A 1 34 ? -0.551  6.108   -0.690  1.00 0.00 ? 34 HIS A CE1  4  
ATOM   2275  N  NE2  . HIS A 1 34 ? -0.723  4.813   -0.472  1.00 0.00 ? 34 HIS A NE2  4  
ATOM   2276  H  H    . HIS A 1 34 ? -5.308  5.348   -1.550  1.00 0.00 ? 34 HIS A H    4  
ATOM   2277  H  HA   . HIS A 1 34 ? -3.798  7.609   -2.652  1.00 0.00 ? 34 HIS A HA   4  
ATOM   2278  H  HB2  . HIS A 1 34 ? -3.650  4.646   -3.258  1.00 0.00 ? 34 HIS A HB2  4  
ATOM   2279  H  HB3  . HIS A 1 34 ? -2.692  5.881   -4.071  1.00 0.00 ? 34 HIS A HB3  4  
ATOM   2280  H  HD1  . HIS A 1 34 ? -1.421  7.491   -1.982  1.00 0.00 ? 34 HIS A HD1  4  
ATOM   2281  H  HD2  . HIS A 1 34 ? -2.132  3.428   -1.426  1.00 0.00 ? 34 HIS A HD2  4  
ATOM   2282  H  HE1  . HIS A 1 34 ? 0.164   6.722   -0.165  1.00 0.00 ? 34 HIS A HE1  4  
ATOM   2283  N  N    . MET A 1 35 ? -6.503  6.655   -3.772  1.00 0.00 ? 35 MET A N    4  
ATOM   2284  C  CA   . MET A 1 35 ? -7.515  6.804   -4.813  1.00 0.00 ? 35 MET A CA   4  
ATOM   2285  C  C    . MET A 1 35 ? -8.122  8.202   -4.766  1.00 0.00 ? 35 MET A C    4  
ATOM   2286  O  O    . MET A 1 35 ? -9.256  8.425   -5.198  1.00 0.00 ? 35 MET A O    4  
ATOM   2287  C  CB   . MET A 1 35 ? -8.609  5.743   -4.663  1.00 0.00 ? 35 MET A CB   4  
ATOM   2288  C  CG   . MET A 1 35 ? -8.078  4.339   -4.416  1.00 0.00 ? 35 MET A CG   4  
ATOM   2289  S  SD   . MET A 1 35 ? -7.499  3.533   -5.924  1.00 0.00 ? 35 MET A SD   4  
ATOM   2290  C  CE   . MET A 1 35 ? -5.733  3.483   -5.623  1.00 0.00 ? 35 MET A CE   4  
ATOM   2291  H  H    . MET A 1 35 ? -6.785  6.465   -2.853  1.00 0.00 ? 35 MET A H    4  
ATOM   2292  H  HA   . MET A 1 35 ? -7.027  6.671   -5.767  1.00 0.00 ? 35 MET A HA   4  
ATOM   2293  H  HB2  . MET A 1 35 ? -9.242  6.015   -3.832  1.00 0.00 ? 35 MET A HB2  4  
ATOM   2294  H  HB3  . MET A 1 35 ? -9.201  5.727   -5.564  1.00 0.00 ? 35 MET A HB3  4  
ATOM   2295  H  HG2  . MET A 1 35 ? -7.256  4.398   -3.718  1.00 0.00 ? 35 MET A HG2  4  
ATOM   2296  H  HG3  . MET A 1 35 ? -8.869  3.741   -3.987  1.00 0.00 ? 35 MET A HG3  4  
ATOM   2297  H  HE1  . MET A 1 35 ? -5.292  2.685   -6.202  1.00 0.00 ? 35 MET A HE1  4  
ATOM   2298  H  HE2  . MET A 1 35 ? -5.293  4.426   -5.912  1.00 0.00 ? 35 MET A HE2  4  
ATOM   2299  H  HE3  . MET A 1 35 ? -5.552  3.310   -4.572  1.00 0.00 ? 35 MET A HE3  4  
ATOM   2300  N  N    . LEU A 1 36 ? -7.355  9.139   -4.229  1.00 0.00 ? 36 LEU A N    4  
ATOM   2301  C  CA   . LEU A 1 36 ? -7.780  10.526  -4.122  1.00 0.00 ? 36 LEU A CA   4  
ATOM   2302  C  C    . LEU A 1 36 ? -6.601  11.441  -4.421  1.00 0.00 ? 36 LEU A C    4  
ATOM   2303  O  O    . LEU A 1 36 ? -5.990  11.999  -3.509  1.00 0.00 ? 36 LEU A O    4  
ATOM   2304  C  CB   . LEU A 1 36 ? -8.319  10.825  -2.717  1.00 0.00 ? 36 LEU A CB   4  
ATOM   2305  C  CG   . LEU A 1 36 ? -8.402  9.624   -1.769  1.00 0.00 ? 36 LEU A CG   4  
ATOM   2306  C  CD1  . LEU A 1 36 ? -7.911  10.007  -0.382  1.00 0.00 ? 36 LEU A CD1  4  
ATOM   2307  C  CD2  . LEU A 1 36 ? -9.826  9.094   -1.703  1.00 0.00 ? 36 LEU A CD2  4  
ATOM   2308  H  H    . LEU A 1 36 ? -6.466  8.893   -3.906  1.00 0.00 ? 36 LEU A H    4  
ATOM   2309  H  HA   . LEU A 1 36 ? -8.560  10.699  -4.849  1.00 0.00 ? 36 LEU A HA   4  
ATOM   2310  H  HB2  . LEU A 1 36 ? -7.677  11.566  -2.265  1.00 0.00 ? 36 LEU A HB2  4  
ATOM   2311  H  HB3  . LEU A 1 36 ? -9.309  11.245  -2.817  1.00 0.00 ? 36 LEU A HB3  4  
ATOM   2312  H  HG   . LEU A 1 36 ? -7.766  8.834   -2.142  1.00 0.00 ? 36 LEU A HG   4  
ATOM   2313  H  HD11 . LEU A 1 36 ? -8.587  9.613   0.363   1.00 0.00 ? 36 LEU A HD11 4  
ATOM   2314  H  HD12 . LEU A 1 36 ? -6.923  9.600   -0.223  1.00 0.00 ? 36 LEU A HD12 4  
ATOM   2315  H  HD13 . LEU A 1 36 ? -7.873  11.083  -0.298  1.00 0.00 ? 36 LEU A HD13 4  
ATOM   2316  H  HD21 . LEU A 1 36 ? -10.321 9.495   -0.831  1.00 0.00 ? 36 LEU A HD21 4  
ATOM   2317  H  HD22 . LEU A 1 36 ? -10.364 9.395   -2.590  1.00 0.00 ? 36 LEU A HD22 4  
ATOM   2318  H  HD23 . LEU A 1 36 ? -9.807  8.015   -1.641  1.00 0.00 ? 36 LEU A HD23 4  
ATOM   2319  N  N    . VAL A 1 37 ? -6.219  11.514  -5.686  1.00 0.00 ? 37 VAL A N    4  
ATOM   2320  C  CA   . VAL A 1 37 ? -5.069  12.313  -6.085  1.00 0.00 ? 37 VAL A CA   4  
ATOM   2321  C  C    . VAL A 1 37 ? -5.488  13.753  -6.354  1.00 0.00 ? 37 VAL A C    4  
ATOM   2322  O  O    . VAL A 1 37 ? -6.559  13.959  -6.968  1.00 0.00 ? 37 VAL A O    4  
ATOM   2323  C  CB   . VAL A 1 37 ? -4.379  11.731  -7.339  1.00 0.00 ? 37 VAL A CB   4  
ATOM   2324  C  CG1  . VAL A 1 37 ? -3.070  12.455  -7.622  1.00 0.00 ? 37 VAL A CG1  4  
ATOM   2325  C  CG2  . VAL A 1 37 ? -4.140  10.236  -7.178  1.00 0.00 ? 37 VAL A CG2  4  
ATOM   2326  O  OXT  . VAL A 1 37 ? -4.750  14.675  -5.949  1.00 0.00 ? 37 VAL A OXT  4  
ATOM   2327  H  H    . VAL A 1 37 ? -6.702  10.995  -6.371  1.00 0.00 ? 37 VAL A H    4  
ATOM   2328  H  HA   . VAL A 1 37 ? -4.358  12.302  -5.272  1.00 0.00 ? 37 VAL A HA   4  
ATOM   2329  H  HB   . VAL A 1 37 ? -5.034  11.878  -8.185  1.00 0.00 ? 37 VAL A HB   4  
ATOM   2330  H  HG11 . VAL A 1 37 ? -2.932  13.243  -6.897  1.00 0.00 ? 37 VAL A HG11 4  
ATOM   2331  H  HG12 . VAL A 1 37 ? -2.249  11.755  -7.555  1.00 0.00 ? 37 VAL A HG12 4  
ATOM   2332  H  HG13 . VAL A 1 37 ? -3.100  12.880  -8.614  1.00 0.00 ? 37 VAL A HG13 4  
ATOM   2333  H  HG21 . VAL A 1 37 ? -4.227  9.966   -6.136  1.00 0.00 ? 37 VAL A HG21 4  
ATOM   2334  H  HG22 . VAL A 1 37 ? -4.872  9.690   -7.754  1.00 0.00 ? 37 VAL A HG22 4  
ATOM   2335  H  HG23 . VAL A 1 37 ? -3.148  9.990   -7.530  1.00 0.00 ? 37 VAL A HG23 4  
HETATM 2336  ZN ZN   . ZN  B 2 .  ? 0.675   3.638   0.309   1.00 0.00 ? 38 ZN  A ZN   4  
ATOM   2337  N  N    . GLY A 1 1  ? 10.129  2.613   -4.705  1.00 0.00 ? 1  GLY A N    5  
ATOM   2338  C  CA   . GLY A 1 1  ? 11.579  2.690   -4.422  1.00 0.00 ? 1  GLY A CA   5  
ATOM   2339  C  C    . GLY A 1 1  ? 11.896  3.596   -3.250  1.00 0.00 ? 1  GLY A C    5  
ATOM   2340  O  O    . GLY A 1 1  ? 12.824  4.401   -3.319  1.00 0.00 ? 1  GLY A O    5  
ATOM   2341  H  H1   . GLY A 1 1  ? 9.959   2.004   -5.535  1.00 0.00 ? 1  GLY A H1   5  
ATOM   2342  H  H2   . GLY A 1 1  ? 9.751   3.564   -4.903  1.00 0.00 ? 1  GLY A H2   5  
ATOM   2343  H  H3   . GLY A 1 1  ? 9.626   2.212   -3.883  1.00 0.00 ? 1  GLY A H3   5  
ATOM   2344  H  HA2  . GLY A 1 1  ? 11.946  1.696   -4.205  1.00 0.00 ? 1  GLY A HA2  5  
ATOM   2345  H  HA3  . GLY A 1 1  ? 12.086  3.065   -5.299  1.00 0.00 ? 1  GLY A HA3  5  
ATOM   2346  N  N    . SER A 1 2  ? 11.151  3.448   -2.156  1.00 0.00 ? 2  SER A N    5  
ATOM   2347  C  CA   . SER A 1 2  ? 11.405  4.241   -0.958  1.00 0.00 ? 2  SER A CA   5  
ATOM   2348  C  C    . SER A 1 2  ? 12.548  3.634   -0.154  1.00 0.00 ? 2  SER A C    5  
ATOM   2349  O  O    . SER A 1 2  ? 13.373  4.359   0.405   1.00 0.00 ? 2  SER A O    5  
ATOM   2350  C  CB   . SER A 1 2  ? 10.146  4.339   -0.094  1.00 0.00 ? 2  SER A CB   5  
ATOM   2351  O  OG   . SER A 1 2  ? 8.975   4.138   -0.866  1.00 0.00 ? 2  SER A OG   5  
ATOM   2352  H  H    . SER A 1 2  ? 10.433  2.772   -2.144  1.00 0.00 ? 2  SER A H    5  
ATOM   2353  H  HA   . SER A 1 2  ? 11.690  5.232   -1.274  1.00 0.00 ? 2  SER A HA   5  
ATOM   2354  H  HB2  . SER A 1 2  ? 10.182  3.586   0.678   1.00 0.00 ? 2  SER A HB2  5  
ATOM   2355  H  HB3  . SER A 1 2  ? 10.100  5.317   0.361   1.00 0.00 ? 2  SER A HB3  5  
ATOM   2356  H  HG   . SER A 1 2  ? 8.300   3.717   -0.314  1.00 0.00 ? 2  SER A HG   5  
ATOM   2357  N  N    . THR A 1 3  ? 12.640  2.304   -0.177  1.00 0.00 ? 3  THR A N    5  
ATOM   2358  C  CA   . THR A 1 3  ? 13.726  1.592   0.489   1.00 0.00 ? 3  THR A CA   5  
ATOM   2359  C  C    . THR A 1 3  ? 13.774  1.931   1.985   1.00 0.00 ? 3  THR A C    5  
ATOM   2360  O  O    . THR A 1 3  ? 12.724  2.068   2.622   1.00 0.00 ? 3  THR A O    5  
ATOM   2361  C  CB   . THR A 1 3  ? 15.074  1.919   -0.192  1.00 0.00 ? 3  THR A CB   5  
ATOM   2362  O  OG1  . THR A 1 3  ? 14.843  2.273   -1.562  1.00 0.00 ? 3  THR A OG1  5  
ATOM   2363  C  CG2  . THR A 1 3  ? 16.023  0.733   -0.138  1.00 0.00 ? 3  THR A CG2  5  
ATOM   2364  H  H    . THR A 1 3  ? 11.991  1.793   -0.702  1.00 0.00 ? 3  THR A H    5  
ATOM   2365  H  HA   . THR A 1 3  ? 13.546  0.534   0.381   1.00 0.00 ? 3  THR A HA   5  
ATOM   2366  H  HB   . THR A 1 3  ? 15.528  2.755   0.318   1.00 0.00 ? 3  THR A HB   5  
ATOM   2367  H  HG1  . THR A 1 3  ? 14.103  1.744   -1.901  1.00 0.00 ? 3  THR A HG1  5  
ATOM   2368  H  HG21 . THR A 1 3  ? 16.720  0.864   0.676   1.00 0.00 ? 3  THR A HG21 5  
ATOM   2369  H  HG22 . THR A 1 3  ? 16.566  0.668   -1.069  1.00 0.00 ? 3  THR A HG22 5  
ATOM   2370  H  HG23 . THR A 1 3  ? 15.457  -0.173  0.013   1.00 0.00 ? 3  THR A HG23 5  
ATOM   2371  N  N    . ARG A 1 4  ? 14.982  2.055   2.536   1.00 0.00 ? 4  ARG A N    5  
ATOM   2372  C  CA   . ARG A 1 4  ? 15.177  2.383   3.948   1.00 0.00 ? 4  ARG A CA   5  
ATOM   2373  C  C    . ARG A 1 4  ? 14.541  1.329   4.847   1.00 0.00 ? 4  ARG A C    5  
ATOM   2374  O  O    . ARG A 1 4  ? 13.677  1.632   5.670   1.00 0.00 ? 4  ARG A O    5  
ATOM   2375  C  CB   . ARG A 1 4  ? 14.611  3.771   4.266   1.00 0.00 ? 4  ARG A CB   5  
ATOM   2376  C  CG   . ARG A 1 4  ? 15.682  4.820   4.514   1.00 0.00 ? 4  ARG A CG   5  
ATOM   2377  C  CD   . ARG A 1 4  ? 16.045  4.904   5.988   1.00 0.00 ? 4  ARG A CD   5  
ATOM   2378  N  NE   . ARG A 1 4  ? 17.268  4.162   6.294   1.00 0.00 ? 4  ARG A NE   5  
ATOM   2379  C  CZ   . ARG A 1 4  ? 17.341  3.171   7.183   1.00 0.00 ? 4  ARG A CZ   5  
ATOM   2380  N  NH1  . ARG A 1 4  ? 16.254  2.774   7.837   1.00 0.00 ? 4  ARG A NH1  5  
ATOM   2381  N  NH2  . ARG A 1 4  ? 18.503  2.573   7.413   1.00 0.00 ? 4  ARG A NH2  5  
ATOM   2382  H  H    . ARG A 1 4  ? 15.774  1.912   1.977   1.00 0.00 ? 4  ARG A H    5  
ATOM   2383  H  HA   . ARG A 1 4  ? 16.242  2.394   4.134   1.00 0.00 ? 4  ARG A HA   5  
ATOM   2384  H  HB2  . ARG A 1 4  ? 14.003  4.100   3.436   1.00 0.00 ? 4  ARG A HB2  5  
ATOM   2385  H  HB3  . ARG A 1 4  ? 13.993  3.704   5.149   1.00 0.00 ? 4  ARG A HB3  5  
ATOM   2386  H  HG2  . ARG A 1 4  ? 16.565  4.559   3.950   1.00 0.00 ? 4  ARG A HG2  5  
ATOM   2387  H  HG3  . ARG A 1 4  ? 15.314  5.780   4.186   1.00 0.00 ? 4  ARG A HG3  5  
ATOM   2388  H  HD2  . ARG A 1 4  ? 16.191  5.942   6.249   1.00 0.00 ? 4  ARG A HD2  5  
ATOM   2389  H  HD3  . ARG A 1 4  ? 15.231  4.497   6.569   1.00 0.00 ? 4  ARG A HD3  5  
ATOM   2390  H  HE   . ARG A 1 4  ? 18.089  4.428   5.809   1.00 0.00 ? 4  ARG A HE   5  
ATOM   2391  H  HH11 . ARG A 1 4  ? 15.367  3.224   7.668   1.00 0.00 ? 4  ARG A HH11 5  
ATOM   2392  H  HH12 . ARG A 1 4  ? 16.311  2.025   8.502   1.00 0.00 ? 4  ARG A HH12 5  
ATOM   2393  H  HH21 . ARG A 1 4  ? 19.333  2.864   6.920   1.00 0.00 ? 4  ARG A HH21 5  
ATOM   2394  H  HH22 . ARG A 1 4  ? 18.565  1.831   8.092   1.00 0.00 ? 4  ARG A HH22 5  
ATOM   2395  N  N    . GLY A 1 5  ? 14.951  0.085   4.656   1.00 0.00 ? 5  GLY A N    5  
ATOM   2396  C  CA   . GLY A 1 5  ? 14.407  -1.009  5.436   1.00 0.00 ? 5  GLY A CA   5  
ATOM   2397  C  C    . GLY A 1 5  ? 13.382  -1.804  4.659   1.00 0.00 ? 5  GLY A C    5  
ATOM   2398  O  O    . GLY A 1 5  ? 13.489  -3.026  4.533   1.00 0.00 ? 5  GLY A O    5  
ATOM   2399  H  H    . GLY A 1 5  ? 15.622  -0.099  3.957   1.00 0.00 ? 5  GLY A H    5  
ATOM   2400  H  HA2  . GLY A 1 5  ? 15.212  -1.666  5.731   1.00 0.00 ? 5  GLY A HA2  5  
ATOM   2401  H  HA3  . GLY A 1 5  ? 13.937  -0.608  6.321   1.00 0.00 ? 5  GLY A HA3  5  
ATOM   2402  N  N    . SER A 1 6  ? 12.390  -1.110  4.130   1.00 0.00 ? 6  SER A N    5  
ATOM   2403  C  CA   . SER A 1 6  ? 11.334  -1.748  3.367   1.00 0.00 ? 6  SER A CA   5  
ATOM   2404  C  C    . SER A 1 6  ? 11.735  -1.887  1.902   1.00 0.00 ? 6  SER A C    5  
ATOM   2405  O  O    . SER A 1 6  ? 11.253  -1.149  1.040   1.00 0.00 ? 6  SER A O    5  
ATOM   2406  C  CB   . SER A 1 6  ? 10.049  -0.935  3.490   1.00 0.00 ? 6  SER A CB   5  
ATOM   2407  O  OG   . SER A 1 6  ? 10.255  0.221   4.290   1.00 0.00 ? 6  SER A OG   5  
ATOM   2408  H  H    . SER A 1 6  ? 12.357  -0.138  4.265   1.00 0.00 ? 6  SER A H    5  
ATOM   2409  H  HA   . SER A 1 6  ? 11.170  -2.731  3.780   1.00 0.00 ? 6  SER A HA   5  
ATOM   2410  H  HB2  . SER A 1 6  ? 9.728   -0.625  2.506   1.00 0.00 ? 6  SER A HB2  5  
ATOM   2411  H  HB3  . SER A 1 6  ? 9.282   -1.542  3.945   1.00 0.00 ? 6  SER A HB3  5  
ATOM   2412  H  HG   . SER A 1 6  ? 9.824   0.979   3.866   1.00 0.00 ? 6  SER A HG   5  
ATOM   2413  N  N    . THR A 1 7  ? 12.629  -2.824  1.627   1.00 0.00 ? 7  THR A N    5  
ATOM   2414  C  CA   . THR A 1 7  ? 13.083  -3.064  0.270   1.00 0.00 ? 7  THR A CA   5  
ATOM   2415  C  C    . THR A 1 7  ? 12.134  -4.006  -0.464  1.00 0.00 ? 7  THR A C    5  
ATOM   2416  O  O    . THR A 1 7  ? 12.486  -5.149  -0.769  1.00 0.00 ? 7  THR A O    5  
ATOM   2417  C  CB   . THR A 1 7  ? 14.498  -3.661  0.272   1.00 0.00 ? 7  THR A CB   5  
ATOM   2418  O  OG1  . THR A 1 7  ? 14.835  -4.099  1.598   1.00 0.00 ? 7  THR A OG1  5  
ATOM   2419  C  CG2  . THR A 1 7  ? 15.516  -2.645  -0.212  1.00 0.00 ? 7  THR A CG2  5  
ATOM   2420  H  H    . THR A 1 7  ? 13.003  -3.362  2.358   1.00 0.00 ? 7  THR A H    5  
ATOM   2421  H  HA   . THR A 1 7  ? 13.111  -2.118  -0.247  1.00 0.00 ? 7  THR A HA   5  
ATOM   2422  H  HB   . THR A 1 7  ? 14.514  -4.512  -0.395  1.00 0.00 ? 7  THR A HB   5  
ATOM   2423  H  HG1  . THR A 1 7  ? 15.799  -4.097  1.699   1.00 0.00 ? 7  THR A HG1  5  
ATOM   2424  H  HG21 . THR A 1 7  ? 16.346  -2.608  0.479   1.00 0.00 ? 7  THR A HG21 5  
ATOM   2425  H  HG22 . THR A 1 7  ? 15.054  -1.671  -0.268  1.00 0.00 ? 7  THR A HG22 5  
ATOM   2426  H  HG23 . THR A 1 7  ? 15.874  -2.930  -1.190  1.00 0.00 ? 7  THR A HG23 5  
ATOM   2427  N  N    . GLY A 1 8  ? 10.960  -3.482  -0.803  1.00 0.00 ? 8  GLY A N    5  
ATOM   2428  C  CA   . GLY A 1 8  ? 9.970   -4.239  -1.543  1.00 0.00 ? 8  GLY A CA   5  
ATOM   2429  C  C    . GLY A 1 8  ? 9.702   -5.605  -0.952  1.00 0.00 ? 8  GLY A C    5  
ATOM   2430  O  O    . GLY A 1 8  ? 9.735   -6.612  -1.662  1.00 0.00 ? 8  GLY A O    5  
ATOM   2431  H  H    . GLY A 1 8  ? 10.770  -2.552  -0.562  1.00 0.00 ? 8  GLY A H    5  
ATOM   2432  H  HA2  . GLY A 1 8  ? 9.046   -3.683  -1.550  1.00 0.00 ? 8  GLY A HA2  5  
ATOM   2433  H  HA3  . GLY A 1 8  ? 10.310  -4.361  -2.561  1.00 0.00 ? 8  GLY A HA3  5  
ATOM   2434  N  N    . ILE A 1 9  ? 9.440   -5.639  0.344   1.00 0.00 ? 9  ILE A N    5  
ATOM   2435  C  CA   . ILE A 1 9  ? 9.144   -6.890  1.020   1.00 0.00 ? 9  ILE A CA   5  
ATOM   2436  C  C    . ILE A 1 9  ? 7.715   -7.327  0.708   1.00 0.00 ? 9  ILE A C    5  
ATOM   2437  O  O    . ILE A 1 9  ? 6.871   -6.486  0.382   1.00 0.00 ? 9  ILE A O    5  
ATOM   2438  C  CB   . ILE A 1 9  ? 9.317   -6.748  2.548   1.00 0.00 ? 9  ILE A CB   5  
ATOM   2439  C  CG1  . ILE A 1 9  ? 10.491  -5.821  2.871   1.00 0.00 ? 9  ILE A CG1  5  
ATOM   2440  C  CG2  . ILE A 1 9  ? 9.523   -8.109  3.201   1.00 0.00 ? 9  ILE A CG2  5  
ATOM   2441  C  CD1  . ILE A 1 9  ? 10.331  -5.077  4.179   1.00 0.00 ? 9  ILE A CD1  5  
ATOM   2442  H  H    . ILE A 1 9  ? 9.389   -4.796  0.846   1.00 0.00 ? 9  ILE A H    5  
ATOM   2443  H  HA   . ILE A 1 9  ? 9.833   -7.641  0.663   1.00 0.00 ? 9  ILE A HA   5  
ATOM   2444  H  HB   . ILE A 1 9  ? 8.413   -6.316  2.947   1.00 0.00 ? 9  ILE A HB   5  
ATOM   2445  H  HG12 . ILE A 1 9  ? 11.397  -6.406  2.930   1.00 0.00 ? 9  ILE A HG12 5  
ATOM   2446  H  HG13 . ILE A 1 9  ? 10.591  -5.089  2.083   1.00 0.00 ? 9  ILE A HG13 5  
ATOM   2447  H  HG21 . ILE A 1 9  ? 8.570   -8.504  3.522   1.00 0.00 ? 9  ILE A HG21 5  
ATOM   2448  H  HG22 . ILE A 1 9  ? 9.970   -8.784  2.486   1.00 0.00 ? 9  ILE A HG22 5  
ATOM   2449  H  HG23 . ILE A 1 9  ? 10.177  -8.004  4.054   1.00 0.00 ? 9  ILE A HG23 5  
ATOM   2450  H  HD11 . ILE A 1 9  ? 11.300  -4.749  4.527   1.00 0.00 ? 9  ILE A HD11 5  
ATOM   2451  H  HD12 . ILE A 1 9  ? 9.693   -4.219  4.029   1.00 0.00 ? 9  ILE A HD12 5  
ATOM   2452  H  HD13 . ILE A 1 9  ? 9.887   -5.732  4.914   1.00 0.00 ? 9  ILE A HD13 5  
ATOM   2453  N  N    . LYS A 1 10 ? 7.427   -8.615  0.912   1.00 0.00 ? 10 LYS A N    5  
ATOM   2454  C  CA   . LYS A 1 10 ? 6.087   -9.173  0.704   1.00 0.00 ? 10 LYS A CA   5  
ATOM   2455  C  C    . LYS A 1 10 ? 5.646   -9.067  -0.763  1.00 0.00 ? 10 LYS A C    5  
ATOM   2456  O  O    . LYS A 1 10 ? 6.103   -8.200  -1.505  1.00 0.00 ? 10 LYS A O    5  
ATOM   2457  C  CB   . LYS A 1 10 ? 5.071   -8.505  1.632   1.00 0.00 ? 10 LYS A CB   5  
ATOM   2458  C  CG   . LYS A 1 10 ? 4.793   -9.309  2.894   1.00 0.00 ? 10 LYS A CG   5  
ATOM   2459  C  CD   . LYS A 1 10 ? 4.934   -8.455  4.142   1.00 0.00 ? 10 LYS A CD   5  
ATOM   2460  C  CE   . LYS A 1 10 ? 5.547   -9.232  5.296   1.00 0.00 ? 10 LYS A CE   5  
ATOM   2461  N  NZ   . LYS A 1 10 ? 5.631   -8.410  6.531   1.00 0.00 ? 10 LYS A NZ   5  
ATOM   2462  H  H    . LYS A 1 10 ? 8.137   -9.212  1.236   1.00 0.00 ? 10 LYS A H    5  
ATOM   2463  H  HA   . LYS A 1 10 ? 6.140   -10.223 0.959   1.00 0.00 ? 10 LYS A HA   5  
ATOM   2464  H  HB2  . LYS A 1 10 ? 5.448   -7.535  1.923   1.00 0.00 ? 10 LYS A HB2  5  
ATOM   2465  H  HB3  . LYS A 1 10 ? 4.140   -8.378  1.098   1.00 0.00 ? 10 LYS A HB3  5  
ATOM   2466  H  HG2  . LYS A 1 10 ? 3.786   -9.698  2.849   1.00 0.00 ? 10 LYS A HG2  5  
ATOM   2467  H  HG3  . LYS A 1 10 ? 5.495   -10.128 2.949   1.00 0.00 ? 10 LYS A HG3  5  
ATOM   2468  H  HD2  . LYS A 1 10 ? 5.567   -7.610  3.915   1.00 0.00 ? 10 LYS A HD2  5  
ATOM   2469  H  HD3  . LYS A 1 10 ? 3.956   -8.104  4.437   1.00 0.00 ? 10 LYS A HD3  5  
ATOM   2470  H  HE2  . LYS A 1 10 ? 4.937   -10.102 5.492   1.00 0.00 ? 10 LYS A HE2  5  
ATOM   2471  H  HE3  . LYS A 1 10 ? 6.540   -9.546  5.014   1.00 0.00 ? 10 LYS A HE3  5  
ATOM   2472  H  HZ1  . LYS A 1 10 ? 4.694   -8.017  6.766   1.00 0.00 ? 10 LYS A HZ1  5  
ATOM   2473  H  HZ2  . LYS A 1 10 ? 6.297   -7.619  6.394   1.00 0.00 ? 10 LYS A HZ2  5  
ATOM   2474  H  HZ3  . LYS A 1 10 ? 5.963   -8.989  7.331   1.00 0.00 ? 10 LYS A HZ3  5  
ATOM   2475  N  N    . PRO A 1 11 ? 4.856   -10.040 -1.239  1.00 0.00 ? 11 PRO A N    5  
ATOM   2476  C  CA   . PRO A 1 11 ? 4.446   -10.115 -2.647  1.00 0.00 ? 11 PRO A CA   5  
ATOM   2477  C  C    . PRO A 1 11 ? 3.633   -8.904  -3.097  1.00 0.00 ? 11 PRO A C    5  
ATOM   2478  O  O    . PRO A 1 11 ? 3.512   -8.636  -4.293  1.00 0.00 ? 11 PRO A O    5  
ATOM   2479  C  CB   . PRO A 1 11 ? 3.589   -11.387 -2.710  1.00 0.00 ? 11 PRO A CB   5  
ATOM   2480  C  CG   . PRO A 1 11 ? 3.212   -11.669 -1.299  1.00 0.00 ? 11 PRO A CG   5  
ATOM   2481  C  CD   . PRO A 1 11 ? 4.366   -11.195 -0.470  1.00 0.00 ? 11 PRO A CD   5  
ATOM   2482  H  HA   . PRO A 1 11 ? 5.302   -10.230 -3.295  1.00 0.00 ? 11 PRO A HA   5  
ATOM   2483  H  HB2  . PRO A 1 11 ? 2.719   -11.208 -3.323  1.00 0.00 ? 11 PRO A HB2  5  
ATOM   2484  H  HB3  . PRO A 1 11 ? 4.170   -12.194 -3.130  1.00 0.00 ? 11 PRO A HB3  5  
ATOM   2485  H  HG2  . PRO A 1 11 ? 2.318   -11.122 -1.045  1.00 0.00 ? 11 PRO A HG2  5  
ATOM   2486  H  HG3  . PRO A 1 11 ? 3.059   -12.729 -1.161  1.00 0.00 ? 11 PRO A HG3  5  
ATOM   2487  H  HD2  . PRO A 1 11 ? 4.030   -10.893 0.511   1.00 0.00 ? 11 PRO A HD2  5  
ATOM   2488  H  HD3  . PRO A 1 11 ? 5.122   -11.962 -0.398  1.00 0.00 ? 11 PRO A HD3  5  
ATOM   2489  N  N    . PHE A 1 12 ? 3.050   -8.192  -2.143  1.00 0.00 ? 12 PHE A N    5  
ATOM   2490  C  CA   . PHE A 1 12 ? 2.226   -7.037  -2.456  1.00 0.00 ? 12 PHE A CA   5  
ATOM   2491  C  C    . PHE A 1 12 ? 2.628   -5.835  -1.618  1.00 0.00 ? 12 PHE A C    5  
ATOM   2492  O  O    . PHE A 1 12 ? 2.091   -5.607  -0.538  1.00 0.00 ? 12 PHE A O    5  
ATOM   2493  C  CB   . PHE A 1 12 ? 0.750   -7.365  -2.232  1.00 0.00 ? 12 PHE A CB   5  
ATOM   2494  C  CG   . PHE A 1 12 ? 0.239   -8.438  -3.149  1.00 0.00 ? 12 PHE A CG   5  
ATOM   2495  C  CD1  . PHE A 1 12 ? 0.051   -8.185  -4.499  1.00 0.00 ? 12 PHE A CD1  5  
ATOM   2496  C  CD2  . PHE A 1 12 ? -0.046  -9.700  -2.661  1.00 0.00 ? 12 PHE A CD2  5  
ATOM   2497  C  CE1  . PHE A 1 12 ? -0.413  -9.176  -5.343  1.00 0.00 ? 12 PHE A CE1  5  
ATOM   2498  C  CE2  . PHE A 1 12 ? -0.510  -10.693 -3.499  1.00 0.00 ? 12 PHE A CE2  5  
ATOM   2499  C  CZ   . PHE A 1 12 ? -0.694  -10.432 -4.842  1.00 0.00 ? 12 PHE A CZ   5  
ATOM   2500  H  H    . PHE A 1 12 ? 3.161   -8.458  -1.206  1.00 0.00 ? 12 PHE A H    5  
ATOM   2501  H  HA   . PHE A 1 12 ? 2.378   -6.798  -3.499  1.00 0.00 ? 12 PHE A HA   5  
ATOM   2502  H  HB2  . PHE A 1 12 ? 0.614   -7.699  -1.214  1.00 0.00 ? 12 PHE A HB2  5  
ATOM   2503  H  HB3  . PHE A 1 12 ? 0.162   -6.475  -2.398  1.00 0.00 ? 12 PHE A HB3  5  
ATOM   2504  H  HD1  . PHE A 1 12 ? 0.271   -7.204  -4.891  1.00 0.00 ? 12 PHE A HD1  5  
ATOM   2505  H  HD2  . PHE A 1 12 ? 0.097   -9.905  -1.610  1.00 0.00 ? 12 PHE A HD2  5  
ATOM   2506  H  HE1  . PHE A 1 12 ? -0.559  -8.970  -6.393  1.00 0.00 ? 12 PHE A HE1  5  
ATOM   2507  H  HE2  . PHE A 1 12 ? -0.732  -11.673 -3.103  1.00 0.00 ? 12 PHE A HE2  5  
ATOM   2508  H  HZ   . PHE A 1 12 ? -1.058  -11.209 -5.498  1.00 0.00 ? 12 PHE A HZ   5  
ATOM   2509  N  N    . GLN A 1 13 ? 3.565   -5.061  -2.128  1.00 0.00 ? 13 GLN A N    5  
ATOM   2510  C  CA   . GLN A 1 13 ? 4.006   -3.853  -1.464  1.00 0.00 ? 13 GLN A CA   5  
ATOM   2511  C  C    . GLN A 1 13 ? 3.364   -2.635  -2.123  1.00 0.00 ? 13 GLN A C    5  
ATOM   2512  O  O    . GLN A 1 13 ? 3.036   -2.671  -3.312  1.00 0.00 ? 13 GLN A O    5  
ATOM   2513  C  CB   . GLN A 1 13 ? 5.527   -3.774  -1.545  1.00 0.00 ? 13 GLN A CB   5  
ATOM   2514  C  CG   . GLN A 1 13 ? 6.041   -3.402  -2.920  1.00 0.00 ? 13 GLN A CG   5  
ATOM   2515  C  CD   . GLN A 1 13 ? 7.078   -4.376  -3.452  1.00 0.00 ? 13 GLN A CD   5  
ATOM   2516  O  OE1  . GLN A 1 13 ? 8.058   -3.970  -4.077  1.00 0.00 ? 13 GLN A OE1  5  
ATOM   2517  N  NE2  . GLN A 1 13 ? 6.881   -5.666  -3.210  1.00 0.00 ? 13 GLN A NE2  5  
ATOM   2518  H  H    . GLN A 1 13 ? 3.961   -5.293  -2.993  1.00 0.00 ? 13 GLN A H    5  
ATOM   2519  H  HA   . GLN A 1 13 ? 3.704   -3.903  -0.431  1.00 0.00 ? 13 GLN A HA   5  
ATOM   2520  H  HB2  . GLN A 1 13 ? 5.880   -3.040  -0.835  1.00 0.00 ? 13 GLN A HB2  5  
ATOM   2521  H  HB3  . GLN A 1 13 ? 5.928   -4.740  -1.288  1.00 0.00 ? 13 GLN A HB3  5  
ATOM   2522  H  HG2  . GLN A 1 13 ? 5.204   -3.380  -3.600  1.00 0.00 ? 13 GLN A HG2  5  
ATOM   2523  H  HG3  . GLN A 1 13 ? 6.485   -2.419  -2.867  1.00 0.00 ? 13 GLN A HG3  5  
ATOM   2524  H  HE21 . GLN A 1 13 ? 6.085   -5.930  -2.705  1.00 0.00 ? 13 GLN A HE21 5  
ATOM   2525  H  HE22 . GLN A 1 13 ? 7.545   -6.309  -3.543  1.00 0.00 ? 13 GLN A HE22 5  
ATOM   2526  N  N    . CYS A 1 14 ? 3.183   -1.556  -1.366  1.00 0.00 ? 14 CYS A N    5  
ATOM   2527  C  CA   . CYS A 1 14 ? 2.609   -0.344  -1.929  1.00 0.00 ? 14 CYS A CA   5  
ATOM   2528  C  C    . CYS A 1 14 ? 3.583   0.278   -2.918  1.00 0.00 ? 14 CYS A C    5  
ATOM   2529  O  O    . CYS A 1 14 ? 4.743   0.516   -2.584  1.00 0.00 ? 14 CYS A O    5  
ATOM   2530  C  CB   . CYS A 1 14 ? 2.249   0.691   -0.851  1.00 0.00 ? 14 CYS A CB   5  
ATOM   2531  S  SG   . CYS A 1 14 ? 1.670   2.270   -1.567  1.00 0.00 ? 14 CYS A SG   5  
ATOM   2532  H  H    . CYS A 1 14 ? 3.474   -1.570  -0.436  1.00 0.00 ? 14 CYS A H    5  
ATOM   2533  H  HA   . CYS A 1 14 ? 1.710   -0.624  -2.456  1.00 0.00 ? 14 CYS A HA   5  
ATOM   2534  H  HB2  . CYS A 1 14 ? 1.463   0.298   -0.225  1.00 0.00 ? 14 CYS A HB2  5  
ATOM   2535  H  HB3  . CYS A 1 14 ? 3.121   0.901   -0.247  1.00 0.00 ? 14 CYS A HB3  5  
ATOM   2536  N  N    . PRO A 1 15 ? 3.123   0.576   -4.137  1.00 0.00 ? 15 PRO A N    5  
ATOM   2537  C  CA   . PRO A 1 15 ? 3.963   1.192   -5.158  1.00 0.00 ? 15 PRO A CA   5  
ATOM   2538  C  C    . PRO A 1 15 ? 4.145   2.693   -4.937  1.00 0.00 ? 15 PRO A C    5  
ATOM   2539  O  O    . PRO A 1 15 ? 4.804   3.377   -5.725  1.00 0.00 ? 15 PRO A O    5  
ATOM   2540  C  CB   . PRO A 1 15 ? 3.195   0.923   -6.449  1.00 0.00 ? 15 PRO A CB   5  
ATOM   2541  C  CG   . PRO A 1 15 ? 1.764   0.848   -6.033  1.00 0.00 ? 15 PRO A CG   5  
ATOM   2542  C  CD   . PRO A 1 15 ? 1.753   0.322   -4.619  1.00 0.00 ? 15 PRO A CD   5  
ATOM   2543  H  HA   . PRO A 1 15 ? 4.931   0.721   -5.204  1.00 0.00 ? 15 PRO A HA   5  
ATOM   2544  H  HB2  . PRO A 1 15 ? 3.364   1.731   -7.146  1.00 0.00 ? 15 PRO A HB2  5  
ATOM   2545  H  HB3  . PRO A 1 15 ? 3.528   -0.009  -6.879  1.00 0.00 ? 15 PRO A HB3  5  
ATOM   2546  H  HG2  . PRO A 1 15 ? 1.322   1.834   -6.068  1.00 0.00 ? 15 PRO A HG2  5  
ATOM   2547  H  HG3  . PRO A 1 15 ? 1.229   0.176   -6.687  1.00 0.00 ? 15 PRO A HG3  5  
ATOM   2548  H  HD2  . PRO A 1 15 ? 1.031   0.862   -4.026  1.00 0.00 ? 15 PRO A HD2  5  
ATOM   2549  H  HD3  . PRO A 1 15 ? 1.532   -0.735  -4.613  1.00 0.00 ? 15 PRO A HD3  5  
ATOM   2550  N  N    . ASP A 1 16 ? 3.569   3.204   -3.858  1.00 0.00 ? 16 ASP A N    5  
ATOM   2551  C  CA   . ASP A 1 16 ? 3.707   4.613   -3.527  1.00 0.00 ? 16 ASP A CA   5  
ATOM   2552  C  C    . ASP A 1 16 ? 4.515   4.800   -2.251  1.00 0.00 ? 16 ASP A C    5  
ATOM   2553  O  O    . ASP A 1 16 ? 5.347   5.703   -2.159  1.00 0.00 ? 16 ASP A O    5  
ATOM   2554  C  CB   . ASP A 1 16 ? 2.338   5.270   -3.370  1.00 0.00 ? 16 ASP A CB   5  
ATOM   2555  C  CG   . ASP A 1 16 ? 2.432   6.780   -3.350  1.00 0.00 ? 16 ASP A CG   5  
ATOM   2556  O  OD1  . ASP A 1 16 ? 2.725   7.372   -4.408  1.00 0.00 ? 16 ASP A OD1  5  
ATOM   2557  O  OD2  . ASP A 1 16 ? 2.214   7.382   -2.278  1.00 0.00 ? 16 ASP A OD2  5  
ATOM   2558  H  H    . ASP A 1 16 ? 3.044   2.614   -3.264  1.00 0.00 ? 16 ASP A H    5  
ATOM   2559  H  HA   . ASP A 1 16 ? 4.231   5.091   -4.340  1.00 0.00 ? 16 ASP A HA   5  
ATOM   2560  H  HB2  . ASP A 1 16 ? 1.706   4.975   -4.195  1.00 0.00 ? 16 ASP A HB2  5  
ATOM   2561  H  HB3  . ASP A 1 16 ? 1.891   4.941   -2.443  1.00 0.00 ? 16 ASP A HB3  5  
ATOM   2562  N  N    . CYS A 1 17 ? 4.251   3.958   -1.264  1.00 0.00 ? 17 CYS A N    5  
ATOM   2563  C  CA   . CYS A 1 17 ? 4.909   4.066   0.035   1.00 0.00 ? 17 CYS A CA   5  
ATOM   2564  C  C    . CYS A 1 17 ? 6.039   3.055   0.183   1.00 0.00 ? 17 CYS A C    5  
ATOM   2565  O  O    . CYS A 1 17 ? 6.961   3.266   0.977   1.00 0.00 ? 17 CYS A O    5  
ATOM   2566  C  CB   . CYS A 1 17 ? 3.903   3.865   1.167   1.00 0.00 ? 17 CYS A CB   5  
ATOM   2567  S  SG   . CYS A 1 17 ? 2.418   4.908   1.043   1.00 0.00 ? 17 CYS A SG   5  
ATOM   2568  H  H    . CYS A 1 17 ? 3.577   3.255   -1.407  1.00 0.00 ? 17 CYS A H    5  
ATOM   2569  H  HA   . CYS A 1 17 ? 5.323   5.058   0.110   1.00 0.00 ? 17 CYS A HA   5  
ATOM   2570  H  HB2  . CYS A 1 17 ? 3.581   2.834   1.174   1.00 0.00 ? 17 CYS A HB2  5  
ATOM   2571  H  HB3  . CYS A 1 17 ? 4.383   4.091   2.108   1.00 0.00 ? 17 CYS A HB3  5  
ATOM   2572  N  N    . ASP A 1 18 ? 5.857   1.899   -0.447  1.00 0.00 ? 18 ASP A N    5  
ATOM   2573  C  CA   . ASP A 1 18 ? 6.750   0.750   -0.291  1.00 0.00 ? 18 ASP A CA   5  
ATOM   2574  C  C    . ASP A 1 18 ? 6.453   0.047   1.020   1.00 0.00 ? 18 ASP A C    5  
ATOM   2575  O  O    . ASP A 1 18 ? 7.357   -0.309  1.780   1.00 0.00 ? 18 ASP A O    5  
ATOM   2576  C  CB   . ASP A 1 18 ? 8.231   1.137   -0.369  1.00 0.00 ? 18 ASP A CB   5  
ATOM   2577  C  CG   . ASP A 1 18 ? 8.898   0.622   -1.625  1.00 0.00 ? 18 ASP A CG   5  
ATOM   2578  O  OD1  . ASP A 1 18 ? 9.031   -0.609  -1.776  1.00 0.00 ? 18 ASP A OD1  5  
ATOM   2579  O  OD2  . ASP A 1 18 ? 9.291   1.450   -2.474  1.00 0.00 ? 18 ASP A OD2  5  
ATOM   2580  H  H    . ASP A 1 18 ? 5.040   1.782   -0.983  1.00 0.00 ? 18 ASP A H    5  
ATOM   2581  H  HA   . ASP A 1 18 ? 6.532   0.064   -1.097  1.00 0.00 ? 18 ASP A HA   5  
ATOM   2582  H  HB2  . ASP A 1 18 ? 8.318   2.214   -0.354  1.00 0.00 ? 18 ASP A HB2  5  
ATOM   2583  H  HB3  . ASP A 1 18 ? 8.749   0.727   0.487   1.00 0.00 ? 18 ASP A HB3  5  
ATOM   2584  N  N    . ARG A 1 19 ? 5.169   -0.202  1.243   1.00 0.00 ? 19 ARG A N    5  
ATOM   2585  C  CA   . ARG A 1 19 ? 4.719   -0.962  2.401   1.00 0.00 ? 19 ARG A CA   5  
ATOM   2586  C  C    . ARG A 1 19 ? 4.948   -2.447  2.141   1.00 0.00 ? 19 ARG A C    5  
ATOM   2587  O  O    . ARG A 1 19 ? 5.777   -2.810  1.309   1.00 0.00 ? 19 ARG A O    5  
ATOM   2588  C  CB   . ARG A 1 19 ? 3.239   -0.687  2.680   1.00 0.00 ? 19 ARG A CB   5  
ATOM   2589  C  CG   . ARG A 1 19 ? 2.881   0.791   2.691   1.00 0.00 ? 19 ARG A CG   5  
ATOM   2590  C  CD   . ARG A 1 19 ? 2.260   1.205   4.013   1.00 0.00 ? 19 ARG A CD   5  
ATOM   2591  N  NE   . ARG A 1 19 ? 0.853   0.811   4.110   1.00 0.00 ? 19 ARG A NE   5  
ATOM   2592  C  CZ   . ARG A 1 19 ? 0.257   0.483   5.264   1.00 0.00 ? 19 ARG A CZ   5  
ATOM   2593  N  NH1  . ARG A 1 19 ? 0.915   0.588   6.412   1.00 0.00 ? 19 ARG A NH1  5  
ATOM   2594  N  NH2  . ARG A 1 19 ? -1.012  0.096   5.275   1.00 0.00 ? 19 ARG A NH2  5  
ATOM   2595  H  H    . ARG A 1 19 ? 4.514   0.072   0.570   1.00 0.00 ? 19 ARG A H    5  
ATOM   2596  H  HA   . ARG A 1 19 ? 5.306   -0.659  3.252   1.00 0.00 ? 19 ARG A HA   5  
ATOM   2597  H  HB2  . ARG A 1 19 ? 2.648   -1.172  1.919   1.00 0.00 ? 19 ARG A HB2  5  
ATOM   2598  H  HB3  . ARG A 1 19 ? 2.984   -1.106  3.642   1.00 0.00 ? 19 ARG A HB3  5  
ATOM   2599  H  HG2  . ARG A 1 19 ? 3.778   1.371   2.531   1.00 0.00 ? 19 ARG A HG2  5  
ATOM   2600  H  HG3  . ARG A 1 19 ? 2.176   0.985   1.896   1.00 0.00 ? 19 ARG A HG3  5  
ATOM   2601  H  HD2  . ARG A 1 19 ? 2.810   0.737   4.817   1.00 0.00 ? 19 ARG A HD2  5  
ATOM   2602  H  HD3  . ARG A 1 19 ? 2.330   2.278   4.107   1.00 0.00 ? 19 ARG A HD3  5  
ATOM   2603  H  HE   . ARG A 1 19 ? 0.328   0.782   3.271   1.00 0.00 ? 19 ARG A HE   5  
ATOM   2604  H  HH11 . ARG A 1 19 ? 1.869   0.919   6.425   1.00 0.00 ? 19 ARG A HH11 5  
ATOM   2605  H  HH12 . ARG A 1 19 ? 0.471   0.333   7.278   1.00 0.00 ? 19 ARG A HH12 5  
ATOM   2606  H  HH21 . ARG A 1 19 ? -1.531  0.048   4.425   1.00 0.00 ? 19 ARG A HH21 5  
ATOM   2607  H  HH22 . ARG A 1 19 ? -1.457  -0.158  6.150   1.00 0.00 ? 19 ARG A HH22 5  
ATOM   2608  N  N    . SER A 1 20 ? 4.195   -3.313  2.802   1.00 0.00 ? 20 SER A N    5  
ATOM   2609  C  CA   . SER A 1 20 ? 4.331   -4.739  2.552   1.00 0.00 ? 20 SER A CA   5  
ATOM   2610  C  C    . SER A 1 20 ? 3.123   -5.527  3.045   1.00 0.00 ? 20 SER A C    5  
ATOM   2611  O  O    . SER A 1 20 ? 2.783   -5.501  4.231   1.00 0.00 ? 20 SER A O    5  
ATOM   2612  C  CB   . SER A 1 20 ? 5.603   -5.269  3.203   1.00 0.00 ? 20 SER A CB   5  
ATOM   2613  O  OG   . SER A 1 20 ? 5.973   -4.476  4.322   1.00 0.00 ? 20 SER A OG   5  
ATOM   2614  H  H    . SER A 1 20 ? 3.512   -2.989  3.438   1.00 0.00 ? 20 SER A H    5  
ATOM   2615  H  HA   . SER A 1 20 ? 4.406   -4.872  1.485   1.00 0.00 ? 20 SER A HA   5  
ATOM   2616  H  HB2  . SER A 1 20 ? 5.432   -6.284  3.528   1.00 0.00 ? 20 SER A HB2  5  
ATOM   2617  H  HB3  . SER A 1 20 ? 6.407   -5.252  2.482   1.00 0.00 ? 20 SER A HB3  5  
ATOM   2618  H  HG   . SER A 1 20 ? 5.776   -3.551  4.133   1.00 0.00 ? 20 SER A HG   5  
ATOM   2619  N  N    . PHE A 1 21 ? 2.485   -6.221  2.118   1.00 0.00 ? 21 PHE A N    5  
ATOM   2620  C  CA   . PHE A 1 21 ? 1.322   -7.045  2.412   1.00 0.00 ? 21 PHE A CA   5  
ATOM   2621  C  C    . PHE A 1 21 ? 1.446   -8.384  1.687   1.00 0.00 ? 21 PHE A C    5  
ATOM   2622  O  O    . PHE A 1 21 ? 2.053   -8.468  0.618   1.00 0.00 ? 21 PHE A O    5  
ATOM   2623  C  CB   . PHE A 1 21 ? 0.026   -6.342  1.973   1.00 0.00 ? 21 PHE A CB   5  
ATOM   2624  C  CG   . PHE A 1 21 ? -0.059  -4.890  2.359   1.00 0.00 ? 21 PHE A CG   5  
ATOM   2625  C  CD1  . PHE A 1 21 ? 0.580   -3.920  1.601   1.00 0.00 ? 21 PHE A CD1  5  
ATOM   2626  C  CD2  . PHE A 1 21 ? -0.792  -4.494  3.466   1.00 0.00 ? 21 PHE A CD2  5  
ATOM   2627  C  CE1  . PHE A 1 21 ? 0.492   -2.587  1.942   1.00 0.00 ? 21 PHE A CE1  5  
ATOM   2628  C  CE2  . PHE A 1 21 ? -0.880  -3.160  3.812   1.00 0.00 ? 21 PHE A CE2  5  
ATOM   2629  C  CZ   . PHE A 1 21 ? -0.237  -2.207  3.050   1.00 0.00 ? 21 PHE A CZ   5  
ATOM   2630  H  H    . PHE A 1 21 ? 2.805   -6.177  1.191   1.00 0.00 ? 21 PHE A H    5  
ATOM   2631  H  HA   . PHE A 1 21 ? 1.292   -7.220  3.477   1.00 0.00 ? 21 PHE A HA   5  
ATOM   2632  H  HB2  . PHE A 1 21 ? -0.059  -6.401  0.899   1.00 0.00 ? 21 PHE A HB2  5  
ATOM   2633  H  HB3  . PHE A 1 21 ? -0.817  -6.852  2.420   1.00 0.00 ? 21 PHE A HB3  5  
ATOM   2634  H  HD1  . PHE A 1 21 ? 1.160   -4.217  0.739   1.00 0.00 ? 21 PHE A HD1  5  
ATOM   2635  H  HD2  . PHE A 1 21 ? -1.297  -5.240  4.063   1.00 0.00 ? 21 PHE A HD2  5  
ATOM   2636  H  HE1  . PHE A 1 21 ? 0.995   -1.842  1.344   1.00 0.00 ? 21 PHE A HE1  5  
ATOM   2637  H  HE2  . PHE A 1 21 ? -1.451  -2.863  4.681   1.00 0.00 ? 21 PHE A HE2  5  
ATOM   2638  H  HZ   . PHE A 1 21 ? -0.302  -1.162  3.319   1.00 0.00 ? 21 PHE A HZ   5  
ATOM   2639  N  N    . SER A 1 22 ? 0.872   -9.423  2.265   1.00 0.00 ? 22 SER A N    5  
ATOM   2640  C  CA   . SER A 1 22 ? 0.888   -10.739 1.658   1.00 0.00 ? 22 SER A CA   5  
ATOM   2641  C  C    . SER A 1 22 ? -0.371  -10.945 0.819   1.00 0.00 ? 22 SER A C    5  
ATOM   2642  O  O    . SER A 1 22 ? -0.441  -11.847 -0.021  1.00 0.00 ? 22 SER A O    5  
ATOM   2643  C  CB   . SER A 1 22 ? 0.979   -11.794 2.754   1.00 0.00 ? 22 SER A CB   5  
ATOM   2644  O  OG   . SER A 1 22 ? 1.251   -11.191 4.012   1.00 0.00 ? 22 SER A OG   5  
ATOM   2645  H  H    . SER A 1 22 ? 0.409   -9.306  3.122   1.00 0.00 ? 22 SER A H    5  
ATOM   2646  H  HA   . SER A 1 22 ? 1.759   -10.808 1.019   1.00 0.00 ? 22 SER A HA   5  
ATOM   2647  H  HB2  . SER A 1 22 ? 0.045   -12.330 2.817   1.00 0.00 ? 22 SER A HB2  5  
ATOM   2648  H  HB3  . SER A 1 22 ? 1.774   -12.479 2.521   1.00 0.00 ? 22 SER A HB3  5  
ATOM   2649  H  HG   . SER A 1 22 ? 2.142   -11.451 4.305   1.00 0.00 ? 22 SER A HG   5  
ATOM   2650  N  N    . ARG A 1 23 ? -1.353  -10.077 1.040   1.00 0.00 ? 23 ARG A N    5  
ATOM   2651  C  CA   . ARG A 1 23 ? -2.603  -10.103 0.293   1.00 0.00 ? 23 ARG A CA   5  
ATOM   2652  C  C    . ARG A 1 23 ? -2.751  -8.848  -0.525  1.00 0.00 ? 23 ARG A C    5  
ATOM   2653  O  O    . ARG A 1 23 ? -2.573  -7.734  -0.026  1.00 0.00 ? 23 ARG A O    5  
ATOM   2654  C  CB   . ARG A 1 23 ? -3.802  -10.231 1.235   1.00 0.00 ? 23 ARG A CB   5  
ATOM   2655  C  CG   . ARG A 1 23 ? -3.825  -11.512 2.047   1.00 0.00 ? 23 ARG A CG   5  
ATOM   2656  C  CD   . ARG A 1 23 ? -5.193  -12.164 1.991   1.00 0.00 ? 23 ARG A CD   5  
ATOM   2657  N  NE   . ARG A 1 23 ? -6.255  -11.267 2.450   1.00 0.00 ? 23 ARG A NE   5  
ATOM   2658  C  CZ   . ARG A 1 23 ? -7.325  -11.661 3.136   1.00 0.00 ? 23 ARG A CZ   5  
ATOM   2659  N  NH1  . ARG A 1 23 ? -7.472  -12.938 3.476   1.00 0.00 ? 23 ARG A NH1  5  
ATOM   2660  N  NH2  . ARG A 1 23 ? -8.245  -10.772 3.483   1.00 0.00 ? 23 ARG A NH2  5  
ATOM   2661  H  H    . ARG A 1 23 ? -1.220  -9.373  1.713   1.00 0.00 ? 23 ARG A H    5  
ATOM   2662  H  HA   . ARG A 1 23 ? -2.591  -10.939 -0.390  1.00 0.00 ? 23 ARG A HA   5  
ATOM   2663  H  HB2  . ARG A 1 23 ? -3.799  -9.400  1.919   1.00 0.00 ? 23 ARG A HB2  5  
ATOM   2664  H  HB3  . ARG A 1 23 ? -4.706  -10.192 0.647   1.00 0.00 ? 23 ARG A HB3  5  
ATOM   2665  H  HG2  . ARG A 1 23 ? -3.091  -12.198 1.645   1.00 0.00 ? 23 ARG A HG2  5  
ATOM   2666  H  HG3  . ARG A 1 23 ? -3.588  -11.283 3.075   1.00 0.00 ? 23 ARG A HG3  5  
ATOM   2667  H  HD2  . ARG A 1 23 ? -5.394  -12.442 0.970   1.00 0.00 ? 23 ARG A HD2  5  
ATOM   2668  H  HD3  . ARG A 1 23 ? -5.185  -13.047 2.612   1.00 0.00 ? 23 ARG A HD3  5  
ATOM   2669  H  HE   . ARG A 1 23 ? -6.169  -10.306 2.227   1.00 0.00 ? 23 ARG A HE   5  
ATOM   2670  H  HH11 . ARG A 1 23 ? -6.775  -13.617 3.213   1.00 0.00 ? 23 ARG A HH11 5  
ATOM   2671  H  HH12 . ARG A 1 23 ? -8.271  -13.231 4.006   1.00 0.00 ? 23 ARG A HH12 5  
ATOM   2672  H  HH21 . ARG A 1 23 ? -8.126  -9.799  3.238   1.00 0.00 ? 23 ARG A HH21 5  
ATOM   2673  H  HH22 . ARG A 1 23 ? -9.076  -11.061 3.973   1.00 0.00 ? 23 ARG A HH22 5  
ATOM   2674  N  N    . SER A 1 24 ? -3.165  -9.040  -1.758  1.00 0.00 ? 24 SER A N    5  
ATOM   2675  C  CA   . SER A 1 24 ? -3.445  -7.943  -2.649  1.00 0.00 ? 24 SER A CA   5  
ATOM   2676  C  C    . SER A 1 24 ? -4.631  -7.142  -2.121  1.00 0.00 ? 24 SER A C    5  
ATOM   2677  O  O    . SER A 1 24 ? -4.685  -5.918  -2.251  1.00 0.00 ? 24 SER A O    5  
ATOM   2678  C  CB   . SER A 1 24 ? -3.742  -8.506  -4.028  1.00 0.00 ? 24 SER A CB   5  
ATOM   2679  O  OG   . SER A 1 24 ? -4.170  -9.857  -3.945  1.00 0.00 ? 24 SER A OG   5  
ATOM   2680  H  H    . SER A 1 24 ? -3.346  -9.957  -2.065  1.00 0.00 ? 24 SER A H    5  
ATOM   2681  H  HA   . SER A 1 24 ? -2.572  -7.308  -2.697  1.00 0.00 ? 24 SER A HA   5  
ATOM   2682  H  HB2  . SER A 1 24 ? -4.517  -7.927  -4.483  1.00 0.00 ? 24 SER A HB2  5  
ATOM   2683  H  HB3  . SER A 1 24 ? -2.849  -8.464  -4.630  1.00 0.00 ? 24 SER A HB3  5  
ATOM   2684  H  HG   . SER A 1 24 ? -5.060  -9.930  -4.318  1.00 0.00 ? 24 SER A HG   5  
ATOM   2685  N  N    . ASP A 1 25 ? -5.526  -7.844  -1.431  1.00 0.00 ? 25 ASP A N    5  
ATOM   2686  C  CA   . ASP A 1 25 ? -6.669  -7.231  -0.783  1.00 0.00 ? 25 ASP A CA   5  
ATOM   2687  C  C    . ASP A 1 25 ? -6.219  -6.235  0.283   1.00 0.00 ? 25 ASP A C    5  
ATOM   2688  O  O    . ASP A 1 25 ? -6.746  -5.126  0.365   1.00 0.00 ? 25 ASP A O    5  
ATOM   2689  C  CB   . ASP A 1 25 ? -7.545  -8.333  -0.178  1.00 0.00 ? 25 ASP A CB   5  
ATOM   2690  C  CG   . ASP A 1 25 ? -7.799  -8.184  1.313   1.00 0.00 ? 25 ASP A CG   5  
ATOM   2691  O  OD1  . ASP A 1 25 ? -6.956  -8.649  2.107   1.00 0.00 ? 25 ASP A OD1  5  
ATOM   2692  O  OD2  . ASP A 1 25 ? -8.854  -7.637  1.693   1.00 0.00 ? 25 ASP A OD2  5  
ATOM   2693  H  H    . ASP A 1 25 ? -5.396  -8.813  -1.324  1.00 0.00 ? 25 ASP A H    5  
ATOM   2694  H  HA   . ASP A 1 25 ? -7.235  -6.705  -1.537  1.00 0.00 ? 25 ASP A HA   5  
ATOM   2695  H  HB2  . ASP A 1 25 ? -8.486  -8.339  -0.685  1.00 0.00 ? 25 ASP A HB2  5  
ATOM   2696  H  HB3  . ASP A 1 25 ? -7.058  -9.282  -0.341  1.00 0.00 ? 25 ASP A HB3  5  
ATOM   2697  N  N    . HIS A 1 26 ? -5.205  -6.620  1.056   1.00 0.00 ? 26 HIS A N    5  
ATOM   2698  C  CA   . HIS A 1 26 ? -4.668  -5.763  2.108   1.00 0.00 ? 26 HIS A CA   5  
ATOM   2699  C  C    . HIS A 1 26 ? -3.979  -4.547  1.505   1.00 0.00 ? 26 HIS A C    5  
ATOM   2700  O  O    . HIS A 1 26 ? -4.154  -3.427  1.987   1.00 0.00 ? 26 HIS A O    5  
ATOM   2701  C  CB   . HIS A 1 26 ? -3.696  -6.540  2.993   1.00 0.00 ? 26 HIS A CB   5  
ATOM   2702  C  CG   . HIS A 1 26 ? -4.317  -7.041  4.262   1.00 0.00 ? 26 HIS A CG   5  
ATOM   2703  N  ND1  . HIS A 1 26 ? -3.625  -7.164  5.449   1.00 0.00 ? 26 HIS A ND1  5  
ATOM   2704  C  CD2  . HIS A 1 26 ? -5.577  -7.458  4.521   1.00 0.00 ? 26 HIS A CD2  5  
ATOM   2705  C  CE1  . HIS A 1 26 ? -4.436  -7.630  6.381   1.00 0.00 ? 26 HIS A CE1  5  
ATOM   2706  N  NE2  . HIS A 1 26 ? -5.624  -7.816  5.842   1.00 0.00 ? 26 HIS A NE2  5  
ATOM   2707  H  H    . HIS A 1 26 ? -4.807  -7.503  0.912   1.00 0.00 ? 26 HIS A H    5  
ATOM   2708  H  HA   . HIS A 1 26 ? -5.497  -5.425  2.711   1.00 0.00 ? 26 HIS A HA   5  
ATOM   2709  H  HB2  . HIS A 1 26 ? -3.324  -7.395  2.447   1.00 0.00 ? 26 HIS A HB2  5  
ATOM   2710  H  HB3  . HIS A 1 26 ? -2.867  -5.899  3.256   1.00 0.00 ? 26 HIS A HB3  5  
ATOM   2711  H  HD1  . HIS A 1 26 ? -2.672  -6.952  5.586   1.00 0.00 ? 26 HIS A HD1  5  
ATOM   2712  H  HD2  . HIS A 1 26 ? -6.395  -7.504  3.813   1.00 0.00 ? 26 HIS A HD2  5  
ATOM   2713  H  HE1  . HIS A 1 26 ? -4.172  -7.818  7.412   1.00 0.00 ? 26 HIS A HE1  5  
ATOM   2714  H  HE2  . HIS A 1 26 ? -6.385  -8.264  6.286   1.00 0.00 ? 26 HIS A HE2  5  
ATOM   2715  N  N    . LEU A 1 27 ? -3.289  -4.766  0.387   1.00 0.00 ? 27 LEU A N    5  
ATOM   2716  C  CA   . LEU A 1 27 ? -2.689  -3.676  -0.375  1.00 0.00 ? 27 LEU A CA   5  
ATOM   2717  C  C    . LEU A 1 27 ? -3.760  -2.654  -0.737  1.00 0.00 ? 27 LEU A C    5  
ATOM   2718  O  O    . LEU A 1 27 ? -3.662  -1.477  -0.388  1.00 0.00 ? 27 LEU A O    5  
ATOM   2719  C  CB   . LEU A 1 27 ? -2.059  -4.199  -1.673  1.00 0.00 ? 27 LEU A CB   5  
ATOM   2720  C  CG   . LEU A 1 27 ? -1.113  -3.229  -2.395  1.00 0.00 ? 27 LEU A CG   5  
ATOM   2721  C  CD1  . LEU A 1 27 ? -0.598  -2.144  -1.459  1.00 0.00 ? 27 LEU A CD1  5  
ATOM   2722  C  CD2  . LEU A 1 27 ? 0.038   -3.965  -3.048  1.00 0.00 ? 27 LEU A CD2  5  
ATOM   2723  H  H    . LEU A 1 27 ? -3.247  -5.678  0.026   1.00 0.00 ? 27 LEU A H    5  
ATOM   2724  H  HA   . LEU A 1 27 ? -1.932  -3.205  0.234   1.00 0.00 ? 27 LEU A HA   5  
ATOM   2725  H  HB2  . LEU A 1 27 ? -1.505  -5.097  -1.442  1.00 0.00 ? 27 LEU A HB2  5  
ATOM   2726  H  HB3  . LEU A 1 27 ? -2.857  -4.457  -2.355  1.00 0.00 ? 27 LEU A HB3  5  
ATOM   2727  H  HG   . LEU A 1 27 ? -1.669  -2.738  -3.180  1.00 0.00 ? 27 LEU A HG   5  
ATOM   2728  H  HD11 . LEU A 1 27 ? -1.434  -1.651  -0.988  1.00 0.00 ? 27 LEU A HD11 5  
ATOM   2729  H  HD12 . LEU A 1 27 ? 0.032   -2.593  -0.703  1.00 0.00 ? 27 LEU A HD12 5  
ATOM   2730  H  HD13 . LEU A 1 27 ? -0.024  -1.422  -2.022  1.00 0.00 ? 27 LEU A HD13 5  
ATOM   2731  H  HD21 . LEU A 1 27 ? 0.654   -4.423  -2.289  1.00 0.00 ? 27 LEU A HD21 5  
ATOM   2732  H  HD22 . LEU A 1 27 ? -0.349  -4.727  -3.707  1.00 0.00 ? 27 LEU A HD22 5  
ATOM   2733  H  HD23 . LEU A 1 27 ? 0.630   -3.263  -3.619  1.00 0.00 ? 27 LEU A HD23 5  
ATOM   2734  N  N    . ALA A 1 28 ? -4.765  -3.126  -1.465  1.00 0.00 ? 28 ALA A N    5  
ATOM   2735  C  CA   . ALA A 1 28 ? -5.856  -2.286  -1.933  1.00 0.00 ? 28 ALA A CA   5  
ATOM   2736  C  C    . ALA A 1 28 ? -6.539  -1.555  -0.781  1.00 0.00 ? 28 ALA A C    5  
ATOM   2737  O  O    . ALA A 1 28 ? -6.910  -0.394  -0.923  1.00 0.00 ? 28 ALA A O    5  
ATOM   2738  C  CB   . ALA A 1 28 ? -6.863  -3.120  -2.710  1.00 0.00 ? 28 ALA A CB   5  
ATOM   2739  H  H    . ALA A 1 28 ? -4.750  -4.075  -1.731  1.00 0.00 ? 28 ALA A H    5  
ATOM   2740  H  HA   . ALA A 1 28 ? -5.437  -1.553  -2.608  1.00 0.00 ? 28 ALA A HA   5  
ATOM   2741  H  HB1  . ALA A 1 28 ? -7.609  -3.506  -2.033  1.00 0.00 ? 28 ALA A HB1  5  
ATOM   2742  H  HB2  . ALA A 1 28 ? -7.340  -2.503  -3.459  1.00 0.00 ? 28 ALA A HB2  5  
ATOM   2743  H  HB3  . ALA A 1 28 ? -6.354  -3.942  -3.192  1.00 0.00 ? 28 ALA A HB3  5  
ATOM   2744  N  N    . LEU A 1 29 ? -6.674  -2.221  0.365   1.00 0.00 ? 29 LEU A N    5  
ATOM   2745  C  CA   . LEU A 1 29 ? -7.281  -1.608  1.547   1.00 0.00 ? 29 LEU A CA   5  
ATOM   2746  C  C    . LEU A 1 29 ? -6.541  -0.333  1.933   1.00 0.00 ? 29 LEU A C    5  
ATOM   2747  O  O    . LEU A 1 29 ? -7.151  0.718   2.137   1.00 0.00 ? 29 LEU A O    5  
ATOM   2748  C  CB   . LEU A 1 29 ? -7.271  -2.578  2.725   1.00 0.00 ? 29 LEU A CB   5  
ATOM   2749  C  CG   . LEU A 1 29 ? -8.239  -3.752  2.612   1.00 0.00 ? 29 LEU A CG   5  
ATOM   2750  C  CD1  . LEU A 1 29 ? -7.874  -4.841  3.606   1.00 0.00 ? 29 LEU A CD1  5  
ATOM   2751  C  CD2  . LEU A 1 29 ? -9.664  -3.289  2.836   1.00 0.00 ? 29 LEU A CD2  5  
ATOM   2752  H  H    . LEU A 1 29 ? -6.345  -3.146  0.423   1.00 0.00 ? 29 LEU A H    5  
ATOM   2753  H  HA   . LEU A 1 29 ? -8.301  -1.359  1.309   1.00 0.00 ? 29 LEU A HA   5  
ATOM   2754  H  HB2  . LEU A 1 29 ? -6.272  -2.968  2.833   1.00 0.00 ? 29 LEU A HB2  5  
ATOM   2755  H  HB3  . LEU A 1 29 ? -7.522  -2.022  3.615   1.00 0.00 ? 29 LEU A HB3  5  
ATOM   2756  H  HG   . LEU A 1 29 ? -8.175  -4.171  1.618   1.00 0.00 ? 29 LEU A HG   5  
ATOM   2757  H  HD11 . LEU A 1 29 ? -6.983  -5.352  3.267   1.00 0.00 ? 29 LEU A HD11 5  
ATOM   2758  H  HD12 . LEU A 1 29 ? -7.688  -4.398  4.573   1.00 0.00 ? 29 LEU A HD12 5  
ATOM   2759  H  HD13 . LEU A 1 29 ? -8.688  -5.546  3.682   1.00 0.00 ? 29 LEU A HD13 5  
ATOM   2760  H  HD21 . LEU A 1 29 ? -9.744  -2.825  3.808   1.00 0.00 ? 29 LEU A HD21 5  
ATOM   2761  H  HD22 . LEU A 1 29 ? -9.935  -2.573  2.074   1.00 0.00 ? 29 LEU A HD22 5  
ATOM   2762  H  HD23 . LEU A 1 29 ? -10.331 -4.138  2.787   1.00 0.00 ? 29 LEU A HD23 5  
ATOM   2763  N  N    . HIS A 1 30 ? -5.219  -0.425  1.961   1.00 0.00 ? 30 HIS A N    5  
ATOM   2764  C  CA   . HIS A 1 30 ? -4.378  0.723   2.263   1.00 0.00 ? 30 HIS A CA   5  
ATOM   2765  C  C    . HIS A 1 30 ? -4.408  1.719   1.111   1.00 0.00 ? 30 HIS A C    5  
ATOM   2766  O  O    . HIS A 1 30 ? -4.338  2.932   1.317   1.00 0.00 ? 30 HIS A O    5  
ATOM   2767  C  CB   . HIS A 1 30 ? -2.930  0.265   2.528   1.00 0.00 ? 30 HIS A CB   5  
ATOM   2768  C  CG   . HIS A 1 30 ? -1.887  1.321   2.269   1.00 0.00 ? 30 HIS A CG   5  
ATOM   2769  N  ND1  . HIS A 1 30 ? -1.663  2.392   3.099   1.00 0.00 ? 30 HIS A ND1  5  
ATOM   2770  C  CD2  . HIS A 1 30 ? -1.019  1.466   1.231   1.00 0.00 ? 30 HIS A CD2  5  
ATOM   2771  C  CE1  . HIS A 1 30 ? -0.695  3.140   2.557   1.00 0.00 ? 30 HIS A CE1  5  
ATOM   2772  N  NE2  . HIS A 1 30 ? -0.266  2.625   1.419   1.00 0.00 ? 30 HIS A NE2  5  
ATOM   2773  H  H    . HIS A 1 30 ? -4.795  -1.283  1.732   1.00 0.00 ? 30 HIS A H    5  
ATOM   2774  H  HA   . HIS A 1 30 ? -4.765  1.199   3.152   1.00 0.00 ? 30 HIS A HA   5  
ATOM   2775  H  HB2  . HIS A 1 30 ? -2.840  -0.037  3.561   1.00 0.00 ? 30 HIS A HB2  5  
ATOM   2776  H  HB3  . HIS A 1 30 ? -2.708  -0.583  1.893   1.00 0.00 ? 30 HIS A HB3  5  
ATOM   2777  H  HD1  . HIS A 1 30 ? -2.139  2.584   3.950   1.00 0.00 ? 30 HIS A HD1  5  
ATOM   2778  H  HD2  . HIS A 1 30 ? -0.918  0.795   0.390   1.00 0.00 ? 30 HIS A HD2  5  
ATOM   2779  H  HE1  . HIS A 1 30 ? -0.310  4.048   2.998   1.00 0.00 ? 30 HIS A HE1  5  
ATOM   2780  N  N    . ARG A 1 31 ? -4.436  1.198   -0.108  1.00 0.00 ? 31 ARG A N    5  
ATOM   2781  C  CA   . ARG A 1 31 ? -4.328  2.031   -1.290  1.00 0.00 ? 31 ARG A CA   5  
ATOM   2782  C  C    . ARG A 1 31 ? -5.625  2.781   -1.563  1.00 0.00 ? 31 ARG A C    5  
ATOM   2783  O  O    . ARG A 1 31 ? -5.676  3.646   -2.433  1.00 0.00 ? 31 ARG A O    5  
ATOM   2784  C  CB   . ARG A 1 31 ? -3.937  1.198   -2.509  1.00 0.00 ? 31 ARG A CB   5  
ATOM   2785  C  CG   . ARG A 1 31 ? -2.489  0.736   -2.484  1.00 0.00 ? 31 ARG A CG   5  
ATOM   2786  C  CD   . ARG A 1 31 ? -1.942  0.497   -3.884  1.00 0.00 ? 31 ARG A CD   5  
ATOM   2787  N  NE   . ARG A 1 31 ? -1.823  1.739   -4.647  1.00 0.00 ? 31 ARG A NE   5  
ATOM   2788  C  CZ   . ARG A 1 31 ? -2.622  2.081   -5.659  1.00 0.00 ? 31 ARG A CZ   5  
ATOM   2789  N  NH1  . ARG A 1 31 ? -3.586  1.261   -6.067  1.00 0.00 ? 31 ARG A NH1  5  
ATOM   2790  N  NH2  . ARG A 1 31 ? -2.442  3.244   -6.268  1.00 0.00 ? 31 ARG A NH2  5  
ATOM   2791  H  H    . ARG A 1 31 ? -4.475  0.220   -0.212  1.00 0.00 ? 31 ARG A H    5  
ATOM   2792  H  HA   . ARG A 1 31 ? -3.543  2.751   -1.097  1.00 0.00 ? 31 ARG A HA   5  
ATOM   2793  H  HB2  . ARG A 1 31 ? -4.573  0.326   -2.556  1.00 0.00 ? 31 ARG A HB2  5  
ATOM   2794  H  HB3  . ARG A 1 31 ? -4.089  1.798   -3.394  1.00 0.00 ? 31 ARG A HB3  5  
ATOM   2795  H  HG2  . ARG A 1 31 ? -1.890  1.492   -2.002  1.00 0.00 ? 31 ARG A HG2  5  
ATOM   2796  H  HG3  . ARG A 1 31 ? -2.426  -0.187  -1.924  1.00 0.00 ? 31 ARG A HG3  5  
ATOM   2797  H  HD2  . ARG A 1 31 ? -0.960  0.049   -3.800  1.00 0.00 ? 31 ARG A HD2  5  
ATOM   2798  H  HD3  . ARG A 1 31 ? -2.604  -0.177  -4.406  1.00 0.00 ? 31 ARG A HD3  5  
ATOM   2799  H  HE   . ARG A 1 31 ? -1.105  2.356   -4.385  1.00 0.00 ? 31 ARG A HE   5  
ATOM   2800  H  HH11 . ARG A 1 31 ? -3.720  0.367   -5.619  1.00 0.00 ? 31 ARG A HH11 5  
ATOM   2801  H  HH12 . ARG A 1 31 ? -4.195  1.534   -6.822  1.00 0.00 ? 31 ARG A HH12 5  
ATOM   2802  H  HH21 . ARG A 1 31 ? -1.703  3.862   -5.968  1.00 0.00 ? 31 ARG A HH21 5  
ATOM   2803  H  HH22 . ARG A 1 31 ? -3.042  3.523   -7.032  1.00 0.00 ? 31 ARG A HH22 5  
ATOM   2804  N  N    . LYS A 1 32 ? -6.635  2.528   -0.746  1.00 0.00 ? 32 LYS A N    5  
ATOM   2805  C  CA   . LYS A 1 32 ? -7.886  3.264   -0.836  1.00 0.00 ? 32 LYS A CA   5  
ATOM   2806  C  C    . LYS A 1 32 ? -7.649  4.727   -0.485  1.00 0.00 ? 32 LYS A C    5  
ATOM   2807  O  O    . LYS A 1 32 ? -8.279  5.627   -1.043  1.00 0.00 ? 32 LYS A O    5  
ATOM   2808  C  CB   . LYS A 1 32 ? -8.932  2.663   0.096   1.00 0.00 ? 32 LYS A CB   5  
ATOM   2809  C  CG   . LYS A 1 32 ? -10.095 2.025   -0.637  1.00 0.00 ? 32 LYS A CG   5  
ATOM   2810  C  CD   . LYS A 1 32 ? -9.697  0.692   -1.239  1.00 0.00 ? 32 LYS A CD   5  
ATOM   2811  C  CE   . LYS A 1 32 ? -10.142 -0.463  -0.360  1.00 0.00 ? 32 LYS A CE   5  
ATOM   2812  N  NZ   . LYS A 1 32 ? -10.593 -1.631  -1.158  1.00 0.00 ? 32 LYS A NZ   5  
ATOM   2813  H  H    . LYS A 1 32 ? -6.513  1.876   -0.026  1.00 0.00 ? 32 LYS A H    5  
ATOM   2814  H  HA   . LYS A 1 32 ? -8.242  3.197   -1.853  1.00 0.00 ? 32 LYS A HA   5  
ATOM   2815  H  HB2  . LYS A 1 32 ? -8.461  1.908   0.707   1.00 0.00 ? 32 LYS A HB2  5  
ATOM   2816  H  HB3  . LYS A 1 32 ? -9.319  3.443   0.734   1.00 0.00 ? 32 LYS A HB3  5  
ATOM   2817  H  HG2  . LYS A 1 32 ? -10.908 1.869   0.056   1.00 0.00 ? 32 LYS A HG2  5  
ATOM   2818  H  HG3  . LYS A 1 32 ? -10.416 2.686   -1.430  1.00 0.00 ? 32 LYS A HG3  5  
ATOM   2819  H  HD2  . LYS A 1 32 ? -10.154 0.591   -2.212  1.00 0.00 ? 32 LYS A HD2  5  
ATOM   2820  H  HD3  . LYS A 1 32 ? -8.616  0.660   -1.337  1.00 0.00 ? 32 LYS A HD3  5  
ATOM   2821  H  HE2  . LYS A 1 32 ? -9.312  -0.762  0.262   1.00 0.00 ? 32 LYS A HE2  5  
ATOM   2822  H  HE3  . LYS A 1 32 ? -10.955 -0.127  0.265   1.00 0.00 ? 32 LYS A HE3  5  
ATOM   2823  H  HZ1  . LYS A 1 32 ? -10.287 -1.529  -2.150  1.00 0.00 ? 32 LYS A HZ1  5  
ATOM   2824  H  HZ2  . LYS A 1 32 ? -11.636 -1.704  -1.134  1.00 0.00 ? 32 LYS A HZ2  5  
ATOM   2825  H  HZ3  . LYS A 1 32 ? -10.186 -2.511  -0.772  1.00 0.00 ? 32 LYS A HZ3  5  
ATOM   2826  N  N    . ARG A 1 33 ? -6.648  4.956   0.358   1.00 0.00 ? 33 ARG A N    5  
ATOM   2827  C  CA   . ARG A 1 33 ? -6.254  6.306   0.730   1.00 0.00 ? 33 ARG A CA   5  
ATOM   2828  C  C    . ARG A 1 33 ? -5.439  6.956   -0.379  1.00 0.00 ? 33 ARG A C    5  
ATOM   2829  O  O    . ARG A 1 33 ? -5.144  8.147   -0.328  1.00 0.00 ? 33 ARG A O    5  
ATOM   2830  C  CB   . ARG A 1 33 ? -5.443  6.292   2.023   1.00 0.00 ? 33 ARG A CB   5  
ATOM   2831  C  CG   . ARG A 1 33 ? -6.245  5.875   3.241   1.00 0.00 ? 33 ARG A CG   5  
ATOM   2832  C  CD   . ARG A 1 33 ? -5.426  4.985   4.160   1.00 0.00 ? 33 ARG A CD   5  
ATOM   2833  N  NE   . ARG A 1 33 ? -4.567  5.761   5.053   1.00 0.00 ? 33 ARG A NE   5  
ATOM   2834  C  CZ   . ARG A 1 33 ? -4.738  5.839   6.373   1.00 0.00 ? 33 ARG A CZ   5  
ATOM   2835  N  NH1  . ARG A 1 33 ? -5.763  5.229   6.956   1.00 0.00 ? 33 ARG A NH1  5  
ATOM   2836  N  NH2  . ARG A 1 33 ? -3.893  6.540   7.115   1.00 0.00 ? 33 ARG A NH2  5  
ATOM   2837  H  H    . ARG A 1 33 ? -6.128  4.198   0.700   1.00 0.00 ? 33 ARG A H    5  
ATOM   2838  H  HA   . ARG A 1 33 ? -7.152  6.881   0.880   1.00 0.00 ? 33 ARG A HA   5  
ATOM   2839  H  HB2  . ARG A 1 33 ? -4.619  5.605   1.909   1.00 0.00 ? 33 ARG A HB2  5  
ATOM   2840  H  HB3  . ARG A 1 33 ? -5.051  7.283   2.199   1.00 0.00 ? 33 ARG A HB3  5  
ATOM   2841  H  HG2  . ARG A 1 33 ? -6.544  6.760   3.782   1.00 0.00 ? 33 ARG A HG2  5  
ATOM   2842  H  HG3  . ARG A 1 33 ? -7.121  5.334   2.915   1.00 0.00 ? 33 ARG A HG3  5  
ATOM   2843  H  HD2  . ARG A 1 33 ? -6.099  4.386   4.755   1.00 0.00 ? 33 ARG A HD2  5  
ATOM   2844  H  HD3  . ARG A 1 33 ? -4.807  4.337   3.555   1.00 0.00 ? 33 ARG A HD3  5  
ATOM   2845  H  HE   . ARG A 1 33 ? -3.810  6.250   4.641   1.00 0.00 ? 33 ARG A HE   5  
ATOM   2846  H  HH11 . ARG A 1 33 ? -6.424  4.707   6.407   1.00 0.00 ? 33 ARG A HH11 5  
ATOM   2847  H  HH12 . ARG A 1 33 ? -5.879  5.286   7.952   1.00 0.00 ? 33 ARG A HH12 5  
ATOM   2848  H  HH21 . ARG A 1 33 ? -3.117  7.026   6.689   1.00 0.00 ? 33 ARG A HH21 5  
ATOM   2849  H  HH22 . ARG A 1 33 ? -4.021  6.587   8.111   1.00 0.00 ? 33 ARG A HH22 5  
ATOM   2850  N  N    . HIS A 1 34 ? -5.121  6.181   -1.403  1.00 0.00 ? 34 HIS A N    5  
ATOM   2851  C  CA   . HIS A 1 34 ? -4.411  6.704   -2.556  1.00 0.00 ? 34 HIS A CA   5  
ATOM   2852  C  C    . HIS A 1 34 ? -5.406  7.053   -3.650  1.00 0.00 ? 34 HIS A C    5  
ATOM   2853  O  O    . HIS A 1 34 ? -5.088  7.779   -4.592  1.00 0.00 ? 34 HIS A O    5  
ATOM   2854  C  CB   . HIS A 1 34 ? -3.382  5.687   -3.057  1.00 0.00 ? 34 HIS A CB   5  
ATOM   2855  C  CG   . HIS A 1 34 ? -2.213  5.543   -2.134  1.00 0.00 ? 34 HIS A CG   5  
ATOM   2856  N  ND1  . HIS A 1 34 ? -1.439  6.599   -1.720  1.00 0.00 ? 34 HIS A ND1  5  
ATOM   2857  C  CD2  . HIS A 1 34 ? -1.703  4.441   -1.523  1.00 0.00 ? 34 HIS A CD2  5  
ATOM   2858  C  CE1  . HIS A 1 34 ? -0.502  6.122   -0.891  1.00 0.00 ? 34 HIS A CE1  5  
ATOM   2859  N  NE2  . HIS A 1 34 ? -0.618  4.817   -0.737  1.00 0.00 ? 34 HIS A NE2  5  
ATOM   2860  H  H    . HIS A 1 34 ? -5.415  5.242   -1.409  1.00 0.00 ? 34 HIS A H    5  
ATOM   2861  H  HA   . HIS A 1 34 ? -3.899  7.605   -2.252  1.00 0.00 ? 34 HIS A HA   5  
ATOM   2862  H  HB2  . HIS A 1 34 ? -3.854  4.721   -3.151  1.00 0.00 ? 34 HIS A HB2  5  
ATOM   2863  H  HB3  . HIS A 1 34 ? -3.011  6.000   -4.021  1.00 0.00 ? 34 HIS A HB3  5  
ATOM   2864  H  HD1  . HIS A 1 34 ? -1.559  7.545   -1.981  1.00 0.00 ? 34 HIS A HD1  5  
ATOM   2865  H  HD2  . HIS A 1 34 ? -2.072  3.431   -1.617  1.00 0.00 ? 34 HIS A HD2  5  
ATOM   2866  H  HE1  . HIS A 1 34 ? 0.253   6.729   -0.411  1.00 0.00 ? 34 HIS A HE1  5  
ATOM   2867  N  N    . MET A 1 35 ? -6.650  6.645   -3.437  1.00 0.00 ? 35 MET A N    5  
ATOM   2868  C  CA   . MET A 1 35 ? -7.735  7.001   -4.339  1.00 0.00 ? 35 MET A CA   5  
ATOM   2869  C  C    . MET A 1 35 ? -8.330  8.336   -3.922  1.00 0.00 ? 35 MET A C    5  
ATOM   2870  O  O    . MET A 1 35 ? -8.273  9.316   -4.669  1.00 0.00 ? 35 MET A O    5  
ATOM   2871  C  CB   . MET A 1 35 ? -8.812  5.914   -4.343  1.00 0.00 ? 35 MET A CB   5  
ATOM   2872  C  CG   . MET A 1 35 ? -8.445  4.705   -5.186  1.00 0.00 ? 35 MET A CG   5  
ATOM   2873  S  SD   . MET A 1 35 ? -9.884  3.745   -5.693  1.00 0.00 ? 35 MET A SD   5  
ATOM   2874  C  CE   . MET A 1 35 ? -9.273  2.078   -5.467  1.00 0.00 ? 35 MET A CE   5  
ATOM   2875  H  H    . MET A 1 35 ? -6.857  6.171   -2.603  1.00 0.00 ? 35 MET A H    5  
ATOM   2876  H  HA   . MET A 1 35 ? -7.324  7.096   -5.333  1.00 0.00 ? 35 MET A HA   5  
ATOM   2877  H  HB2  . MET A 1 35 ? -8.978  5.584   -3.329  1.00 0.00 ? 35 MET A HB2  5  
ATOM   2878  H  HB3  . MET A 1 35 ? -9.728  6.333   -4.732  1.00 0.00 ? 35 MET A HB3  5  
ATOM   2879  H  HG2  . MET A 1 35 ? -7.928  5.046   -6.072  1.00 0.00 ? 35 MET A HG2  5  
ATOM   2880  H  HG3  . MET A 1 35 ? -7.786  4.070   -4.612  1.00 0.00 ? 35 MET A HG3  5  
ATOM   2881  H  HE1  . MET A 1 35 ? -9.419  1.777   -4.441  1.00 0.00 ? 35 MET A HE1  5  
ATOM   2882  H  HE2  . MET A 1 35 ? -9.811  1.405   -6.120  1.00 0.00 ? 35 MET A HE2  5  
ATOM   2883  H  HE3  . MET A 1 35 ? -8.220  2.045   -5.706  1.00 0.00 ? 35 MET A HE3  5  
ATOM   2884  N  N    . LEU A 1 36 ? -8.742  8.410   -2.666  1.00 0.00 ? 36 LEU A N    5  
ATOM   2885  C  CA   . LEU A 1 36 ? -9.210  9.656   -2.082  1.00 0.00 ? 36 LEU A CA   5  
ATOM   2886  C  C    . LEU A 1 36 ? -8.408  9.960   -0.827  1.00 0.00 ? 36 LEU A C    5  
ATOM   2887  O  O    . LEU A 1 36 ? -8.692  9.427   0.247   1.00 0.00 ? 36 LEU A O    5  
ATOM   2888  C  CB   . LEU A 1 36 ? -10.700 9.570   -1.746  1.00 0.00 ? 36 LEU A CB   5  
ATOM   2889  C  CG   . LEU A 1 36 ? -11.618 9.278   -2.933  1.00 0.00 ? 36 LEU A CG   5  
ATOM   2890  C  CD1  . LEU A 1 36 ? -12.974 8.783   -2.452  1.00 0.00 ? 36 LEU A CD1  5  
ATOM   2891  C  CD2  . LEU A 1 36 ? -11.773 10.518  -3.800  1.00 0.00 ? 36 LEU A CD2  5  
ATOM   2892  H  H    . LEU A 1 36 ? -8.644  7.628   -2.087  1.00 0.00 ? 36 LEU A H    5  
ATOM   2893  H  HA   . LEU A 1 36 ? -9.052  10.445  -2.802  1.00 0.00 ? 36 LEU A HA   5  
ATOM   2894  H  HB2  . LEU A 1 36 ? -10.838 8.790   -1.010  1.00 0.00 ? 36 LEU A HB2  5  
ATOM   2895  H  HB3  . LEU A 1 36 ? -11.004 10.510  -1.310  1.00 0.00 ? 36 LEU A HB3  5  
ATOM   2896  H  HG   . LEU A 1 36 ? -11.172 8.498   -3.536  1.00 0.00 ? 36 LEU A HG   5  
ATOM   2897  H  HD11 . LEU A 1 36 ? -13.159 9.151   -1.453  1.00 0.00 ? 36 LEU A HD11 5  
ATOM   2898  H  HD12 . LEU A 1 36 ? -13.746 9.143   -3.117  1.00 0.00 ? 36 LEU A HD12 5  
ATOM   2899  H  HD13 . LEU A 1 36 ? -12.982 7.704   -2.445  1.00 0.00 ? 36 LEU A HD13 5  
ATOM   2900  H  HD21 . LEU A 1 36 ? -10.797 10.895  -4.067  1.00 0.00 ? 36 LEU A HD21 5  
ATOM   2901  H  HD22 . LEU A 1 36 ? -12.317 10.265  -4.698  1.00 0.00 ? 36 LEU A HD22 5  
ATOM   2902  H  HD23 . LEU A 1 36 ? -12.315 11.276  -3.253  1.00 0.00 ? 36 LEU A HD23 5  
ATOM   2903  N  N    . VAL A 1 37 ? -7.340  10.720  -0.991  1.00 0.00 ? 37 VAL A N    5  
ATOM   2904  C  CA   . VAL A 1 37 ? -6.448  11.018  0.113   1.00 0.00 ? 37 VAL A CA   5  
ATOM   2905  C  C    . VAL A 1 37 ? -7.059  12.081  1.026   1.00 0.00 ? 37 VAL A C    5  
ATOM   2906  O  O    . VAL A 1 37 ? -6.744  12.088  2.236   1.00 0.00 ? 37 VAL A O    5  
ATOM   2907  C  CB   . VAL A 1 37 ? -5.056  11.475  -0.397  1.00 0.00 ? 37 VAL A CB   5  
ATOM   2908  C  CG1  . VAL A 1 37 ? -5.100  12.890  -0.956  1.00 0.00 ? 37 VAL A CG1  5  
ATOM   2909  C  CG2  . VAL A 1 37 ? -4.016  11.366  0.707   1.00 0.00 ? 37 VAL A CG2  5  
ATOM   2910  O  OXT  . VAL A 1 37 ? -7.875  12.891  0.533   1.00 0.00 ? 37 VAL A OXT  5  
ATOM   2911  H  H    . VAL A 1 37 ? -7.119  11.049  -1.889  1.00 0.00 ? 37 VAL A H    5  
ATOM   2912  H  HA   . VAL A 1 37 ? -6.319  10.105  0.678   1.00 0.00 ? 37 VAL A HA   5  
ATOM   2913  H  HB   . VAL A 1 37 ? -4.760  10.812  -1.197  1.00 0.00 ? 37 VAL A HB   5  
ATOM   2914  H  HG11 . VAL A 1 37 ? -5.875  13.451  -0.457  1.00 0.00 ? 37 VAL A HG11 5  
ATOM   2915  H  HG12 . VAL A 1 37 ? -4.146  13.369  -0.794  1.00 0.00 ? 37 VAL A HG12 5  
ATOM   2916  H  HG13 . VAL A 1 37 ? -5.309  12.852  -2.016  1.00 0.00 ? 37 VAL A HG13 5  
ATOM   2917  H  HG21 . VAL A 1 37 ? -3.289  12.158  0.596   1.00 0.00 ? 37 VAL A HG21 5  
ATOM   2918  H  HG22 . VAL A 1 37 ? -4.499  11.452  1.668   1.00 0.00 ? 37 VAL A HG22 5  
ATOM   2919  H  HG23 . VAL A 1 37 ? -3.518  10.410  0.639   1.00 0.00 ? 37 VAL A HG23 5  
HETATM 2920  ZN ZN   . ZN  B 2 .  ? 0.763   3.658   0.059   1.00 0.00 ? 38 ZN  A ZN   5  
ATOM   2921  N  N    . GLY A 1 1  ? 4.348   6.996   0.373   1.00 0.00 ? 1  GLY A N    6  
ATOM   2922  C  CA   . GLY A 1 1  ? 5.106   7.560   1.517   1.00 0.00 ? 1  GLY A CA   6  
ATOM   2923  C  C    . GLY A 1 1  ? 5.815   6.480   2.302   1.00 0.00 ? 1  GLY A C    6  
ATOM   2924  O  O    . GLY A 1 1  ? 6.343   5.541   1.716   1.00 0.00 ? 1  GLY A O    6  
ATOM   2925  H  H1   . GLY A 1 1  ? 4.975   6.889   -0.452  1.00 0.00 ? 1  GLY A H1   6  
ATOM   2926  H  H2   . GLY A 1 1  ? 3.557   7.624   0.120   1.00 0.00 ? 1  GLY A H2   6  
ATOM   2927  H  H3   . GLY A 1 1  ? 3.963   6.059   0.627   1.00 0.00 ? 1  GLY A H3   6  
ATOM   2928  H  HA2  . GLY A 1 1  ? 5.839   8.260   1.143   1.00 0.00 ? 1  GLY A HA2  6  
ATOM   2929  H  HA3  . GLY A 1 1  ? 4.422   8.082   2.171   1.00 0.00 ? 1  GLY A HA3  6  
ATOM   2930  N  N    . SER A 1 2  ? 5.783   6.596   3.623   1.00 0.00 ? 2  SER A N    6  
ATOM   2931  C  CA   . SER A 1 2  ? 6.385   5.613   4.519   1.00 0.00 ? 2  SER A CA   6  
ATOM   2932  C  C    . SER A 1 2  ? 7.832   5.280   4.127   1.00 0.00 ? 2  SER A C    6  
ATOM   2933  O  O    . SER A 1 2  ? 8.727   6.114   4.285   1.00 0.00 ? 2  SER A O    6  
ATOM   2934  C  CB   . SER A 1 2  ? 5.527   4.348   4.568   1.00 0.00 ? 2  SER A CB   6  
ATOM   2935  O  OG   . SER A 1 2  ? 4.234   4.634   5.074   1.00 0.00 ? 2  SER A OG   6  
ATOM   2936  H  H    . SER A 1 2  ? 5.314   7.367   4.018   1.00 0.00 ? 2  SER A H    6  
ATOM   2937  H  HA   . SER A 1 2  ? 6.399   6.051   5.507   1.00 0.00 ? 2  SER A HA   6  
ATOM   2938  H  HB2  . SER A 1 2  ? 5.430   3.941   3.572   1.00 0.00 ? 2  SER A HB2  6  
ATOM   2939  H  HB3  . SER A 1 2  ? 5.999   3.619   5.210   1.00 0.00 ? 2  SER A HB3  6  
ATOM   2940  H  HG   . SER A 1 2  ? 4.197   5.560   5.366   1.00 0.00 ? 2  SER A HG   6  
ATOM   2941  N  N    . THR A 1 3  ? 8.061   4.039   3.672   1.00 0.00 ? 3  THR A N    6  
ATOM   2942  C  CA   . THR A 1 3  ? 9.400   3.560   3.323   1.00 0.00 ? 3  THR A CA   6  
ATOM   2943  C  C    . THR A 1 3  ? 10.333  3.584   4.541   1.00 0.00 ? 3  THR A C    6  
ATOM   2944  O  O    . THR A 1 3  ? 11.554  3.495   4.416   1.00 0.00 ? 3  THR A O    6  
ATOM   2945  C  CB   . THR A 1 3  ? 10.013  4.375   2.161   1.00 0.00 ? 3  THR A CB   6  
ATOM   2946  O  OG1  . THR A 1 3  ? 8.974   4.819   1.278   1.00 0.00 ? 3  THR A OG1  6  
ATOM   2947  C  CG2  . THR A 1 3  ? 11.010  3.539   1.372   1.00 0.00 ? 3  THR A CG2  6  
ATOM   2948  H  H    . THR A 1 3  ? 7.307   3.418   3.583   1.00 0.00 ? 3  THR A H    6  
ATOM   2949  H  HA   . THR A 1 3  ? 9.301   2.535   2.993   1.00 0.00 ? 3  THR A HA   6  
ATOM   2950  H  HB   . THR A 1 3  ? 10.526  5.234   2.568   1.00 0.00 ? 3  THR A HB   6  
ATOM   2951  H  HG1  . THR A 1 3  ? 8.159   4.323   1.470   1.00 0.00 ? 3  THR A HG1  6  
ATOM   2952  H  HG21 . THR A 1 3  ? 10.524  2.643   1.015   1.00 0.00 ? 3  THR A HG21 6  
ATOM   2953  H  HG22 . THR A 1 3  ? 11.838  3.270   2.009   1.00 0.00 ? 3  THR A HG22 6  
ATOM   2954  H  HG23 . THR A 1 3  ? 11.373  4.112   0.529   1.00 0.00 ? 3  THR A HG23 6  
ATOM   2955  N  N    . ARG A 1 4  ? 9.739   3.648   5.726   1.00 0.00 ? 4  ARG A N    6  
ATOM   2956  C  CA   . ARG A 1 4  ? 10.497  3.620   6.970   1.00 0.00 ? 4  ARG A CA   6  
ATOM   2957  C  C    . ARG A 1 4  ? 10.540  2.203   7.516   1.00 0.00 ? 4  ARG A C    6  
ATOM   2958  O  O    . ARG A 1 4  ? 9.578   1.734   8.125   1.00 0.00 ? 4  ARG A O    6  
ATOM   2959  C  CB   . ARG A 1 4  ? 9.879   4.566   8.006   1.00 0.00 ? 4  ARG A CB   6  
ATOM   2960  C  CG   . ARG A 1 4  ? 9.678   5.986   7.498   1.00 0.00 ? 4  ARG A CG   6  
ATOM   2961  C  CD   . ARG A 1 4  ? 10.992  6.743   7.411   1.00 0.00 ? 4  ARG A CD   6  
ATOM   2962  N  NE   . ARG A 1 4  ? 10.795  8.190   7.387   1.00 0.00 ? 4  ARG A NE   6  
ATOM   2963  C  CZ   . ARG A 1 4  ? 11.705  9.072   7.801   1.00 0.00 ? 4  ARG A CZ   6  
ATOM   2964  N  NH1  . ARG A 1 4  ? 12.875  8.651   8.272   1.00 0.00 ? 4  ARG A NH1  6  
ATOM   2965  N  NH2  . ARG A 1 4  ? 11.452  10.373  7.744   1.00 0.00 ? 4  ARG A NH2  6  
ATOM   2966  H  H    . ARG A 1 4  ? 8.760   3.660   5.764   1.00 0.00 ? 4  ARG A H    6  
ATOM   2967  H  HA   . ARG A 1 4  ? 11.505  3.942   6.753   1.00 0.00 ? 4  ARG A HA   6  
ATOM   2968  H  HB2  . ARG A 1 4  ? 8.916   4.175   8.302   1.00 0.00 ? 4  ARG A HB2  6  
ATOM   2969  H  HB3  . ARG A 1 4  ? 10.523  4.605   8.873   1.00 0.00 ? 4  ARG A HB3  6  
ATOM   2970  H  HG2  . ARG A 1 4  ? 9.233   5.946   6.515   1.00 0.00 ? 4  ARG A HG2  6  
ATOM   2971  H  HG3  . ARG A 1 4  ? 9.016   6.510   8.173   1.00 0.00 ? 4  ARG A HG3  6  
ATOM   2972  H  HD2  . ARG A 1 4  ? 11.599  6.487   8.266   1.00 0.00 ? 4  ARG A HD2  6  
ATOM   2973  H  HD3  . ARG A 1 4  ? 11.503  6.444   6.506   1.00 0.00 ? 4  ARG A HD3  6  
ATOM   2974  H  HE   . ARG A 1 4  ? 9.928   8.525   7.041   1.00 0.00 ? 4  ARG A HE   6  
ATOM   2975  H  HH11 . ARG A 1 4  ? 13.078  7.668   8.325   1.00 0.00 ? 4  ARG A HH11 6  
ATOM   2976  H  HH12 . ARG A 1 4  ? 13.568  9.316   8.571   1.00 0.00 ? 4  ARG A HH12 6  
ATOM   2977  H  HH21 . ARG A 1 4  ? 10.570  10.707  7.389   1.00 0.00 ? 4  ARG A HH21 6  
ATOM   2978  H  HH22 . ARG A 1 4  ? 12.142  11.037  8.070   1.00 0.00 ? 4  ARG A HH22 6  
ATOM   2979  N  N    . GLY A 1 5  ? 11.596  1.477   7.181   1.00 0.00 ? 5  GLY A N    6  
ATOM   2980  C  CA   . GLY A 1 5  ? 11.684  0.081   7.556   1.00 0.00 ? 5  GLY A CA   6  
ATOM   2981  C  C    . GLY A 1 5  ? 11.154  -0.816  6.458   1.00 0.00 ? 5  GLY A C    6  
ATOM   2982  O  O    . GLY A 1 5  ? 11.743  -1.855  6.149   1.00 0.00 ? 5  GLY A O    6  
ATOM   2983  H  H    . GLY A 1 5  ? 12.287  1.870   6.598   1.00 0.00 ? 5  GLY A H    6  
ATOM   2984  H  HA2  . GLY A 1 5  ? 12.717  -0.168  7.751   1.00 0.00 ? 5  GLY A HA2  6  
ATOM   2985  H  HA3  . GLY A 1 5  ? 11.105  -0.082  8.452   1.00 0.00 ? 5  GLY A HA3  6  
ATOM   2986  N  N    . SER A 1 6  ? 10.071  -0.373  5.829   1.00 0.00 ? 6  SER A N    6  
ATOM   2987  C  CA   . SER A 1 6  ? 9.471   -1.080  4.713   1.00 0.00 ? 6  SER A CA   6  
ATOM   2988  C  C    . SER A 1 6  ? 10.423  -1.107  3.521   1.00 0.00 ? 6  SER A C    6  
ATOM   2989  O  O    . SER A 1 6  ? 10.657  -0.083  2.882   1.00 0.00 ? 6  SER A O    6  
ATOM   2990  C  CB   . SER A 1 6  ? 8.160   -0.388  4.329   1.00 0.00 ? 6  SER A CB   6  
ATOM   2991  O  OG   . SER A 1 6  ? 7.819   0.609   5.283   1.00 0.00 ? 6  SER A OG   6  
ATOM   2992  H  H    . SER A 1 6  ? 9.676   0.480   6.106   1.00 0.00 ? 6  SER A H    6  
ATOM   2993  H  HA   . SER A 1 6  ? 9.262   -2.092  5.026   1.00 0.00 ? 6  SER A HA   6  
ATOM   2994  H  HB2  . SER A 1 6  ? 8.268   0.077   3.362   1.00 0.00 ? 6  SER A HB2  6  
ATOM   2995  H  HB3  . SER A 1 6  ? 7.365   -1.120  4.293   1.00 0.00 ? 6  SER A HB3  6  
ATOM   2996  H  HG   . SER A 1 6  ? 7.122   0.266   5.866   1.00 0.00 ? 6  SER A HG   6  
ATOM   2997  N  N    . THR A 1 7  ? 11.054  -2.254  3.301   1.00 0.00 ? 7  THR A N    6  
ATOM   2998  C  CA   . THR A 1 7  ? 12.028  -2.393  2.237   1.00 0.00 ? 7  THR A CA   6  
ATOM   2999  C  C    . THR A 1 7  ? 11.633  -3.520  1.288   1.00 0.00 ? 7  THR A C    6  
ATOM   3000  O  O    . THR A 1 7  ? 12.253  -4.589  1.283   1.00 0.00 ? 7  THR A O    6  
ATOM   3001  C  CB   . THR A 1 7  ? 13.426  -2.671  2.814   1.00 0.00 ? 7  THR A CB   6  
ATOM   3002  O  OG1  . THR A 1 7  ? 13.305  -3.145  4.164   1.00 0.00 ? 7  THR A OG1  6  
ATOM   3003  C  CG2  . THR A 1 7  ? 14.272  -1.409  2.796   1.00 0.00 ? 7  THR A CG2  6  
ATOM   3004  H  H    . THR A 1 7  ? 10.907  -3.006  3.910   1.00 0.00 ? 7  THR A H    6  
ATOM   3005  H  HA   . THR A 1 7  ? 12.064  -1.464  1.688   1.00 0.00 ? 7  THR A HA   6  
ATOM   3006  H  HB   . THR A 1 7  ? 13.912  -3.426  2.213   1.00 0.00 ? 7  THR A HB   6  
ATOM   3007  H  HG1  . THR A 1 7  ? 12.887  -2.463  4.707   1.00 0.00 ? 7  THR A HG1  6  
ATOM   3008  H  HG21 . THR A 1 7  ? 14.401  -1.074  1.776   1.00 0.00 ? 7  THR A HG21 6  
ATOM   3009  H  HG22 . THR A 1 7  ? 15.238  -1.616  3.232   1.00 0.00 ? 7  THR A HG22 6  
ATOM   3010  H  HG23 . THR A 1 7  ? 13.776  -0.639  3.367   1.00 0.00 ? 7  THR A HG23 6  
ATOM   3011  N  N    . GLY A 1 8  ? 10.615  -3.253  0.469   1.00 0.00 ? 8  GLY A N    6  
ATOM   3012  C  CA   . GLY A 1 8  ? 10.153  -4.211  -0.525  1.00 0.00 ? 8  GLY A CA   6  
ATOM   3013  C  C    . GLY A 1 8  ? 9.881   -5.591  0.030   1.00 0.00 ? 8  GLY A C    6  
ATOM   3014  O  O    . GLY A 1 8  ? 10.039  -6.592  -0.668  1.00 0.00 ? 8  GLY A O    6  
ATOM   3015  H  H    . GLY A 1 8  ? 10.203  -2.356  0.500   1.00 0.00 ? 8  GLY A H    6  
ATOM   3016  H  HA2  . GLY A 1 8  ? 9.240   -3.837  -0.953  1.00 0.00 ? 8  GLY A HA2  6  
ATOM   3017  H  HA3  . GLY A 1 8  ? 10.896  -4.288  -1.303  1.00 0.00 ? 8  GLY A HA3  6  
ATOM   3018  N  N    . ILE A 1 9  ? 9.384   -5.631  1.251   1.00 0.00 ? 9  ILE A N    6  
ATOM   3019  C  CA   . ILE A 1 9  ? 8.986   -6.883  1.881   1.00 0.00 ? 9  ILE A CA   6  
ATOM   3020  C  C    . ILE A 1 9  ? 7.634   -7.331  1.334   1.00 0.00 ? 9  ILE A C    6  
ATOM   3021  O  O    . ILE A 1 9  ? 6.877   -6.500  0.837   1.00 0.00 ? 9  ILE A O    6  
ATOM   3022  C  CB   . ILE A 1 9  ? 8.891   -6.719  3.415   1.00 0.00 ? 9  ILE A CB   6  
ATOM   3023  C  CG1  . ILE A 1 9  ? 9.922   -5.705  3.913   1.00 0.00 ? 9  ILE A CG1  6  
ATOM   3024  C  CG2  . ILE A 1 9  ? 9.078   -8.055  4.123   1.00 0.00 ? 9  ILE A CG2  6  
ATOM   3025  C  CD1  . ILE A 1 9  ? 9.440   -4.869  5.081   1.00 0.00 ? 9  ILE A CD1  6  
ATOM   3026  H  H    . ILE A 1 9  ? 9.175   -4.786  1.697   1.00 0.00 ? 9  ILE A H    6  
ATOM   3027  H  HA   . ILE A 1 9  ? 9.731   -7.631  1.657   1.00 0.00 ? 9  ILE A HA   6  
ATOM   3028  H  HB   . ILE A 1 9  ? 7.904   -6.350  3.645   1.00 0.00 ? 9  ILE A HB   6  
ATOM   3029  H  HG12 . ILE A 1 9  ? 10.811  -6.231  4.230   1.00 0.00 ? 9  ILE A HG12 6  
ATOM   3030  H  HG13 . ILE A 1 9  ? 10.175  -5.034  3.106   1.00 0.00 ? 9  ILE A HG13 6  
ATOM   3031  H  HG21 . ILE A 1 9  ? 8.243   -8.233  4.785   1.00 0.00 ? 9  ILE A HG21 6  
ATOM   3032  H  HG22 . ILE A 1 9  ? 9.132   -8.848  3.391   1.00 0.00 ? 9  ILE A HG22 6  
ATOM   3033  H  HG23 . ILE A 1 9  ? 9.994   -8.032  4.696   1.00 0.00 ? 9  ILE A HG23 6  
ATOM   3034  H  HD11 . ILE A 1 9  ? 10.163  -4.096  5.294   1.00 0.00 ? 9  ILE A HD11 6  
ATOM   3035  H  HD12 . ILE A 1 9  ? 8.492   -4.416  4.832   1.00 0.00 ? 9  ILE A HD12 6  
ATOM   3036  H  HD13 . ILE A 1 9  ? 9.321   -5.499  5.949   1.00 0.00 ? 9  ILE A HD13 6  
ATOM   3037  N  N    . LYS A 1 10 ? 7.288   -8.607  1.530   1.00 0.00 ? 10 LYS A N    6  
ATOM   3038  C  CA   . LYS A 1 10 ? 5.980   -9.128  1.140   1.00 0.00 ? 10 LYS A CA   6  
ATOM   3039  C  C    . LYS A 1 10 ? 5.770   -9.072  -0.382  1.00 0.00 ? 10 LYS A C    6  
ATOM   3040  O  O    . LYS A 1 10 ? 6.400   -8.286  -1.087  1.00 0.00 ? 10 LYS A O    6  
ATOM   3041  C  CB   . LYS A 1 10 ? 4.860   -8.403  1.893   1.00 0.00 ? 10 LYS A CB   6  
ATOM   3042  C  CG   . LYS A 1 10 ? 4.394   -9.150  3.135   1.00 0.00 ? 10 LYS A CG   6  
ATOM   3043  C  CD   . LYS A 1 10 ? 4.274   -8.231  4.340   1.00 0.00 ? 10 LYS A CD   6  
ATOM   3044  C  CE   . LYS A 1 10 ? 5.488   -8.337  5.248   1.00 0.00 ? 10 LYS A CE   6  
ATOM   3045  N  NZ   . LYS A 1 10 ? 5.111   -8.348  6.689   1.00 0.00 ? 10 LYS A NZ   6  
ATOM   3046  H  H    . LYS A 1 10 ? 7.910   -9.204  1.990   1.00 0.00 ? 10 LYS A H    6  
ATOM   3047  H  HA   . LYS A 1 10 ? 5.962   -10.168 1.434   1.00 0.00 ? 10 LYS A HA   6  
ATOM   3048  H  HB2  . LYS A 1 10 ? 5.214   -7.428  2.194   1.00 0.00 ? 10 LYS A HB2  6  
ATOM   3049  H  HB3  . LYS A 1 10 ? 4.013   -8.281  1.232   1.00 0.00 ? 10 LYS A HB3  6  
ATOM   3050  H  HG2  . LYS A 1 10 ? 3.430   -9.590  2.936   1.00 0.00 ? 10 LYS A HG2  6  
ATOM   3051  H  HG3  . LYS A 1 10 ? 5.107   -9.931  3.360   1.00 0.00 ? 10 LYS A HG3  6  
ATOM   3052  H  HD2  . LYS A 1 10 ? 4.185   -7.211  3.992   1.00 0.00 ? 10 LYS A HD2  6  
ATOM   3053  H  HD3  . LYS A 1 10 ? 3.390   -8.501  4.899   1.00 0.00 ? 10 LYS A HD3  6  
ATOM   3054  H  HE2  . LYS A 1 10 ? 6.015   -9.249  5.016   1.00 0.00 ? 10 LYS A HE2  6  
ATOM   3055  H  HE3  . LYS A 1 10 ? 6.133   -7.491  5.061   1.00 0.00 ? 10 LYS A HE3  6  
ATOM   3056  H  HZ1  . LYS A 1 10 ? 4.703   -9.275  6.945   1.00 0.00 ? 10 LYS A HZ1  6  
ATOM   3057  H  HZ2  . LYS A 1 10 ? 4.409   -7.604  6.889   1.00 0.00 ? 10 LYS A HZ2  6  
ATOM   3058  H  HZ3  . LYS A 1 10 ? 5.956   -8.180  7.282   1.00 0.00 ? 10 LYS A HZ3  6  
ATOM   3059  N  N    . PRO A 1 11 ? 4.988   -10.013 -0.925  1.00 0.00 ? 11 PRO A N    6  
ATOM   3060  C  CA   . PRO A 1 11 ? 4.782   -10.131 -2.364  1.00 0.00 ? 11 PRO A CA   6  
ATOM   3061  C  C    . PRO A 1 11 ? 4.052   -8.927  -2.953  1.00 0.00 ? 11 PRO A C    6  
ATOM   3062  O  O    . PRO A 1 11 ? 4.210   -8.597  -4.131  1.00 0.00 ? 11 PRO A O    6  
ATOM   3063  C  CB   . PRO A 1 11 ? 3.915   -11.380 -2.527  1.00 0.00 ? 11 PRO A CB   6  
ATOM   3064  C  CG   . PRO A 1 11 ? 3.457   -11.780 -1.171  1.00 0.00 ? 11 PRO A CG   6  
ATOM   3065  C  CD   . PRO A 1 11 ? 4.266   -11.030 -0.164  1.00 0.00 ? 11 PRO A CD   6  
ATOM   3066  H  HA   . PRO A 1 11 ? 5.717   -10.270 -2.886  1.00 0.00 ? 11 PRO A HA   6  
ATOM   3067  H  HB2  . PRO A 1 11 ? 3.070   -11.137 -3.140  1.00 0.00 ? 11 PRO A HB2  6  
ATOM   3068  H  HB3  . PRO A 1 11 ? 4.492   -12.163 -2.996  1.00 0.00 ? 11 PRO A HB3  6  
ATOM   3069  H  HG2  . PRO A 1 11 ? 2.412   -11.534 -1.057  1.00 0.00 ? 11 PRO A HG2  6  
ATOM   3070  H  HG3  . PRO A 1 11 ? 3.600   -12.837 -1.045  1.00 0.00 ? 11 PRO A HG3  6  
ATOM   3071  H  HD2  . PRO A 1 11 ? 3.614   -10.561 0.543   1.00 0.00 ? 11 PRO A HD2  6  
ATOM   3072  H  HD3  . PRO A 1 11 ? 4.948   -11.691 0.339   1.00 0.00 ? 11 PRO A HD3  6  
ATOM   3073  N  N    . PHE A 1 12 ? 3.205   -8.317  -2.145  1.00 0.00 ? 12 PHE A N    6  
ATOM   3074  C  CA   . PHE A 1 12 ? 2.376   -7.210  -2.596  1.00 0.00 ? 12 PHE A CA   6  
ATOM   3075  C  C    . PHE A 1 12 ? 2.685   -5.948  -1.815  1.00 0.00 ? 12 PHE A C    6  
ATOM   3076  O  O    . PHE A 1 12 ? 2.107   -5.701  -0.765  1.00 0.00 ? 12 PHE A O    6  
ATOM   3077  C  CB   . PHE A 1 12 ? 0.899   -7.557  -2.436  1.00 0.00 ? 12 PHE A CB   6  
ATOM   3078  C  CG   . PHE A 1 12 ? 0.498   -8.807  -3.161  1.00 0.00 ? 12 PHE A CG   6  
ATOM   3079  C  CD1  . PHE A 1 12 ? 0.438   -8.829  -4.544  1.00 0.00 ? 12 PHE A CD1  6  
ATOM   3080  C  CD2  . PHE A 1 12 ? 0.188   -9.961  -2.464  1.00 0.00 ? 12 PHE A CD2  6  
ATOM   3081  C  CE1  . PHE A 1 12 ? 0.076   -9.977  -5.218  1.00 0.00 ? 12 PHE A CE1  6  
ATOM   3082  C  CE2  . PHE A 1 12 ? -0.178  -11.114 -3.132  1.00 0.00 ? 12 PHE A CE2  6  
ATOM   3083  C  CZ   . PHE A 1 12 ? -0.233  -11.122 -4.512  1.00 0.00 ? 12 PHE A CZ   6  
ATOM   3084  H  H    . PHE A 1 12 ? 3.110   -8.641  -1.224  1.00 0.00 ? 12 PHE A H    6  
ATOM   3085  H  HA   . PHE A 1 12 ? 2.588   -7.037  -3.640  1.00 0.00 ? 12 PHE A HA   6  
ATOM   3086  H  HB2  . PHE A 1 12 ? 0.687   -7.694  -1.385  1.00 0.00 ? 12 PHE A HB2  6  
ATOM   3087  H  HB3  . PHE A 1 12 ? 0.301   -6.742  -2.816  1.00 0.00 ? 12 PHE A HB3  6  
ATOM   3088  H  HD1  . PHE A 1 12 ? 0.679   -7.934  -5.098  1.00 0.00 ? 12 PHE A HD1  6  
ATOM   3089  H  HD2  . PHE A 1 12 ? 0.230   -9.955  -1.384  1.00 0.00 ? 12 PHE A HD2  6  
ATOM   3090  H  HE1  . PHE A 1 12 ? 0.031   -9.980  -6.296  1.00 0.00 ? 12 PHE A HE1  6  
ATOM   3091  H  HE2  . PHE A 1 12 ? -0.422  -12.007 -2.575  1.00 0.00 ? 12 PHE A HE2  6  
ATOM   3092  H  HZ   . PHE A 1 12 ? -0.516  -12.021 -5.037  1.00 0.00 ? 12 PHE A HZ   6  
ATOM   3093  N  N    . GLN A 1 13 ? 3.607   -5.164  -2.323  1.00 0.00 ? 13 GLN A N    6  
ATOM   3094  C  CA   . GLN A 1 13 ? 3.979   -3.919  -1.676  1.00 0.00 ? 13 GLN A CA   6  
ATOM   3095  C  C    . GLN A 1 13 ? 3.119   -2.775  -2.167  1.00 0.00 ? 13 GLN A C    6  
ATOM   3096  O  O    . GLN A 1 13 ? 2.663   -2.788  -3.312  1.00 0.00 ? 13 GLN A O    6  
ATOM   3097  C  CB   . GLN A 1 13 ? 5.426   -3.573  -1.965  1.00 0.00 ? 13 GLN A CB   6  
ATOM   3098  C  CG   . GLN A 1 13 ? 6.400   -4.618  -1.516  1.00 0.00 ? 13 GLN A CG   6  
ATOM   3099  C  CD   . GLN A 1 13 ? 6.997   -5.384  -2.683  1.00 0.00 ? 13 GLN A CD   6  
ATOM   3100  O  OE1  . GLN A 1 13 ? 6.392   -6.324  -3.199  1.00 0.00 ? 13 GLN A OE1  6  
ATOM   3101  N  NE2  . GLN A 1 13 ? 8.174   -4.972  -3.132  1.00 0.00 ? 13 GLN A NE2  6  
ATOM   3102  H  H    . GLN A 1 13 ? 4.057   -5.434  -3.148  1.00 0.00 ? 13 GLN A H    6  
ATOM   3103  H  HA   . GLN A 1 13 ? 3.846   -4.035  -0.612  1.00 0.00 ? 13 GLN A HA   6  
ATOM   3104  H  HB2  . GLN A 1 13 ? 5.544   -3.433  -3.026  1.00 0.00 ? 13 GLN A HB2  6  
ATOM   3105  H  HB3  . GLN A 1 13 ? 5.664   -2.654  -1.455  1.00 0.00 ? 13 GLN A HB3  6  
ATOM   3106  H  HG2  . GLN A 1 13 ? 7.186   -4.128  -0.966  1.00 0.00 ? 13 GLN A HG2  6  
ATOM   3107  H  HG3  . GLN A 1 13 ? 5.881   -5.309  -0.868  1.00 0.00 ? 13 GLN A HG3  6  
ATOM   3108  H  HE21 . GLN A 1 13 ? 8.596   -4.200  -2.695  1.00 0.00 ? 13 GLN A HE21 6  
ATOM   3109  H  HE22 . GLN A 1 13 ? 8.579   -5.456  -3.883  1.00 0.00 ? 13 GLN A HE22 6  
ATOM   3110  N  N    . CYS A 1 14 ? 3.152   -1.681  -1.426  1.00 0.00 ? 14 CYS A N    6  
ATOM   3111  C  CA   . CYS A 1 14 ? 2.574   -0.448  -1.933  1.00 0.00 ? 14 CYS A CA   6  
ATOM   3112  C  C    . CYS A 1 14 ? 3.504   0.155   -2.973  1.00 0.00 ? 14 CYS A C    6  
ATOM   3113  O  O    . CYS A 1 14 ? 4.685   0.370   -2.701  1.00 0.00 ? 14 CYS A O    6  
ATOM   3114  C  CB   . CYS A 1 14 ? 2.307   0.589   -0.844  1.00 0.00 ? 14 CYS A CB   6  
ATOM   3115  S  SG   . CYS A 1 14 ? 1.435   2.049   -1.518  1.00 0.00 ? 14 CYS A SG   6  
ATOM   3116  H  H    . CYS A 1 14 ? 3.758   -1.660  -0.648  1.00 0.00 ? 14 CYS A H    6  
ATOM   3117  H  HA   . CYS A 1 14 ? 1.632   -0.694  -2.406  1.00 0.00 ? 14 CYS A HA   6  
ATOM   3118  H  HB2  . CYS A 1 14 ? 1.699   0.147   -0.070  1.00 0.00 ? 14 CYS A HB2  6  
ATOM   3119  H  HB3  . CYS A 1 14 ? 3.245   0.922   -0.425  1.00 0.00 ? 14 CYS A HB3  6  
ATOM   3120  N  N    . PRO A 1 15 ? 2.997   0.435   -4.175  1.00 0.00 ? 15 PRO A N    6  
ATOM   3121  C  CA   . PRO A 1 15 ? 3.802   1.029   -5.240  1.00 0.00 ? 15 PRO A CA   6  
ATOM   3122  C  C    . PRO A 1 15 ? 4.139   2.494   -4.964  1.00 0.00 ? 15 PRO A C    6  
ATOM   3123  O  O    . PRO A 1 15 ? 4.969   3.088   -5.653  1.00 0.00 ? 15 PRO A O    6  
ATOM   3124  C  CB   . PRO A 1 15 ? 2.911   0.902   -6.476  1.00 0.00 ? 15 PRO A CB   6  
ATOM   3125  C  CG   . PRO A 1 15 ? 1.519   0.836   -5.948  1.00 0.00 ? 15 PRO A CG   6  
ATOM   3126  C  CD   . PRO A 1 15 ? 1.608   0.186   -4.595  1.00 0.00 ? 15 PRO A CD   6  
ATOM   3127  H  HA   . PRO A 1 15 ? 4.716   0.477   -5.395  1.00 0.00 ? 15 PRO A HA   6  
ATOM   3128  H  HB2  . PRO A 1 15 ? 3.051   1.763   -7.111  1.00 0.00 ? 15 PRO A HB2  6  
ATOM   3129  H  HB3  . PRO A 1 15 ? 3.170   0.005   -7.018  1.00 0.00 ? 15 PRO A HB3  6  
ATOM   3130  H  HG2  . PRO A 1 15 ? 1.117   1.834   -5.856  1.00 0.00 ? 15 PRO A HG2  6  
ATOM   3131  H  HG3  . PRO A 1 15 ? 0.905   0.244   -6.609  1.00 0.00 ? 15 PRO A HG3  6  
ATOM   3132  H  HD2  . PRO A 1 15 ? 0.911   0.646   -3.911  1.00 0.00 ? 15 PRO A HD2  6  
ATOM   3133  H  HD3  . PRO A 1 15 ? 1.414   -0.875  -4.675  1.00 0.00 ? 15 PRO A HD3  6  
ATOM   3134  N  N    . ASP A 1 16 ? 3.498   3.075   -3.952  1.00 0.00 ? 16 ASP A N    6  
ATOM   3135  C  CA   . ASP A 1 16 ? 3.737   4.472   -3.610  1.00 0.00 ? 16 ASP A CA   6  
ATOM   3136  C  C    . ASP A 1 16 ? 4.518   4.597   -2.306  1.00 0.00 ? 16 ASP A C    6  
ATOM   3137  O  O    . ASP A 1 16 ? 5.252   5.562   -2.101  1.00 0.00 ? 16 ASP A O    6  
ATOM   3138  C  CB   . ASP A 1 16 ? 2.416   5.230   -3.491  1.00 0.00 ? 16 ASP A CB   6  
ATOM   3139  C  CG   . ASP A 1 16 ? 2.612   6.735   -3.452  1.00 0.00 ? 16 ASP A CG   6  
ATOM   3140  O  OD1  . ASP A 1 16 ? 3.344   7.270   -4.312  1.00 0.00 ? 16 ASP A OD1  6  
ATOM   3141  O  OD2  . ASP A 1 16 ? 2.030   7.393   -2.564  1.00 0.00 ? 16 ASP A OD2  6  
ATOM   3142  H  H    . ASP A 1 16 ? 2.848   2.552   -3.426  1.00 0.00 ? 16 ASP A H    6  
ATOM   3143  H  HA   . ASP A 1 16 ? 4.319   4.910   -4.406  1.00 0.00 ? 16 ASP A HA   6  
ATOM   3144  H  HB2  . ASP A 1 16 ? 1.792   4.987   -4.339  1.00 0.00 ? 16 ASP A HB2  6  
ATOM   3145  H  HB3  . ASP A 1 16 ? 1.915   4.927   -2.584  1.00 0.00 ? 16 ASP A HB3  6  
ATOM   3146  N  N    . CYS A 1 17 ? 4.301   3.665   -1.390  1.00 0.00 ? 17 CYS A N    6  
ATOM   3147  C  CA   . CYS A 1 17 ? 4.931   3.736   -0.078  1.00 0.00 ? 17 CYS A CA   6  
ATOM   3148  C  C    . CYS A 1 17 ? 6.121   2.793   0.042   1.00 0.00 ? 17 CYS A C    6  
ATOM   3149  O  O    . CYS A 1 17 ? 6.957   2.967   0.928   1.00 0.00 ? 17 CYS A O    6  
ATOM   3150  C  CB   . CYS A 1 17 ? 3.923   3.424   1.027   1.00 0.00 ? 17 CYS A CB   6  
ATOM   3151  S  SG   . CYS A 1 17 ? 2.513   4.567   1.087   1.00 0.00 ? 17 CYS A SG   6  
ATOM   3152  H  H    . CYS A 1 17 ? 3.655   2.948   -1.577  1.00 0.00 ? 17 CYS A H    6  
ATOM   3153  H  HA   . CYS A 1 17 ? 5.281   4.747   0.051   1.00 0.00 ? 17 CYS A HA   6  
ATOM   3154  H  HB2  . CYS A 1 17 ? 3.530   2.431   0.877   1.00 0.00 ? 17 CYS A HB2  6  
ATOM   3155  H  HB3  . CYS A 1 17 ? 4.423   3.465   1.985   1.00 0.00 ? 17 CYS A HB3  6  
ATOM   3156  N  N    . ASP A 1 18 ? 6.030   1.677   -0.666  1.00 0.00 ? 18 ASP A N    6  
ATOM   3157  C  CA   . ASP A 1 18 ? 6.940   0.547   -0.478  1.00 0.00 ? 18 ASP A CA   6  
ATOM   3158  C  C    . ASP A 1 18 ? 6.572   -0.172  0.804   1.00 0.00 ? 18 ASP A C    6  
ATOM   3159  O  O    . ASP A 1 18 ? 7.341   -0.974  1.338   1.00 0.00 ? 18 ASP A O    6  
ATOM   3160  C  CB   . ASP A 1 18 ? 8.417   0.961   -0.472  1.00 0.00 ? 18 ASP A CB   6  
ATOM   3161  C  CG   . ASP A 1 18 ? 9.298   -0.066  -1.159  1.00 0.00 ? 18 ASP A CG   6  
ATOM   3162  O  OD1  . ASP A 1 18 ? 9.164   -0.243  -2.390  1.00 0.00 ? 18 ASP A OD1  6  
ATOM   3163  O  OD2  . ASP A 1 18 ? 10.138  -0.694  -0.478  1.00 0.00 ? 18 ASP A OD2  6  
ATOM   3164  H  H    . ASP A 1 18 ? 5.241   1.549   -1.236  1.00 0.00 ? 18 ASP A H    6  
ATOM   3165  H  HA   . ASP A 1 18 ? 6.776   -0.133  -1.299  1.00 0.00 ? 18 ASP A HA   6  
ATOM   3166  H  HB2  . ASP A 1 18 ? 8.524   1.906   -0.985  1.00 0.00 ? 18 ASP A HB2  6  
ATOM   3167  H  HB3  . ASP A 1 18 ? 8.751   1.071   0.550   1.00 0.00 ? 18 ASP A HB3  6  
ATOM   3168  N  N    . ARG A 1 19 ? 5.307   0.008   1.190   1.00 0.00 ? 19 ARG A N    6  
ATOM   3169  C  CA   . ARG A 1 19 ? 4.716   -0.745  2.283   1.00 0.00 ? 19 ARG A CA   6  
ATOM   3170  C  C    . ARG A 1 19 ? 4.611   -2.197  1.869   1.00 0.00 ? 19 ARG A C    6  
ATOM   3171  O  O    . ARG A 1 19 ? 4.935   -2.535  0.738   1.00 0.00 ? 19 ARG A O    6  
ATOM   3172  C  CB   . ARG A 1 19 ? 3.335   -0.194  2.628   1.00 0.00 ? 19 ARG A CB   6  
ATOM   3173  C  CG   . ARG A 1 19 ? 3.346   0.758   3.805   1.00 0.00 ? 19 ARG A CG   6  
ATOM   3174  C  CD   . ARG A 1 19 ? 2.110   1.639   3.822   1.00 0.00 ? 19 ARG A CD   6  
ATOM   3175  N  NE   . ARG A 1 19 ? 0.898   0.882   4.129   1.00 0.00 ? 19 ARG A NE   6  
ATOM   3176  C  CZ   . ARG A 1 19 ? 0.581   0.454   5.358   1.00 0.00 ? 19 ARG A CZ   6  
ATOM   3177  N  NH1  . ARG A 1 19 ? 1.330   0.801   6.400   1.00 0.00 ? 19 ARG A NH1  6  
ATOM   3178  N  NH2  . ARG A 1 19 ? -0.504  -0.286  5.547   1.00 0.00 ? 19 ARG A NH2  6  
ATOM   3179  H  H    . ARG A 1 19 ? 4.727   0.572   0.640   1.00 0.00 ? 19 ARG A H    6  
ATOM   3180  H  HA   . ARG A 1 19 ? 5.365   -0.664  3.143   1.00 0.00 ? 19 ARG A HA   6  
ATOM   3181  H  HB2  . ARG A 1 19 ? 2.942   0.330   1.769   1.00 0.00 ? 19 ARG A HB2  6  
ATOM   3182  H  HB3  . ARG A 1 19 ? 2.681   -1.019  2.866   1.00 0.00 ? 19 ARG A HB3  6  
ATOM   3183  H  HG2  . ARG A 1 19 ? 3.379   0.185   4.718   1.00 0.00 ? 19 ARG A HG2  6  
ATOM   3184  H  HG3  . ARG A 1 19 ? 4.219   1.384   3.739   1.00 0.00 ? 19 ARG A HG3  6  
ATOM   3185  H  HD2  . ARG A 1 19 ? 2.241   2.408   4.569   1.00 0.00 ? 19 ARG A HD2  6  
ATOM   3186  H  HD3  . ARG A 1 19 ? 1.998   2.099   2.850   1.00 0.00 ? 19 ARG A HD3  6  
ATOM   3187  H  HE   . ARG A 1 19 ? 0.294   0.676   3.373   1.00 0.00 ? 19 ARG A HE   6  
ATOM   3188  H  HH11 . ARG A 1 19 ? 2.140   1.392   6.275   1.00 0.00 ? 19 ARG A HH11 6  
ATOM   3189  H  HH12 . ARG A 1 19 ? 1.095   0.478   7.326   1.00 0.00 ? 19 ARG A HH12 6  
ATOM   3190  H  HH21 . ARG A 1 19 ? -1.092  -0.527  4.776   1.00 0.00 ? 19 ARG A HH21 6  
ATOM   3191  H  HH22 . ARG A 1 19 ? -0.734  -0.620  6.474   1.00 0.00 ? 19 ARG A HH22 6  
ATOM   3192  N  N    . SER A 1 20 ? 4.226   -3.070  2.771   1.00 0.00 ? 20 SER A N    6  
ATOM   3193  C  CA   . SER A 1 20 ? 4.253   -4.484  2.445   1.00 0.00 ? 20 SER A CA   6  
ATOM   3194  C  C    . SER A 1 20 ? 3.004   -5.220  2.897   1.00 0.00 ? 20 SER A C    6  
ATOM   3195  O  O    . SER A 1 20 ? 2.604   -5.147  4.058   1.00 0.00 ? 20 SER A O    6  
ATOM   3196  C  CB   . SER A 1 20 ? 5.495   -5.113  3.056   1.00 0.00 ? 20 SER A CB   6  
ATOM   3197  O  OG   . SER A 1 20 ? 5.990   -4.327  4.132   1.00 0.00 ? 20 SER A OG   6  
ATOM   3198  H  H    . SER A 1 20 ? 3.992   -2.773  3.684   1.00 0.00 ? 20 SER A H    6  
ATOM   3199  H  HA   . SER A 1 20 ? 4.322   -4.565  1.370   1.00 0.00 ? 20 SER A HA   6  
ATOM   3200  H  HB2  . SER A 1 20 ? 5.252   -6.101  3.423   1.00 0.00 ? 20 SER A HB2  6  
ATOM   3201  H  HB3  . SER A 1 20 ? 6.262   -5.188  2.297   1.00 0.00 ? 20 SER A HB3  6  
ATOM   3202  H  HG   . SER A 1 20 ? 5.387   -3.587  4.288   1.00 0.00 ? 20 SER A HG   6  
ATOM   3203  N  N    . PHE A 1 21 ? 2.393   -5.926  1.959   1.00 0.00 ? 21 PHE A N    6  
ATOM   3204  C  CA   . PHE A 1 21 ? 1.194   -6.698  2.232   1.00 0.00 ? 21 PHE A CA   6  
ATOM   3205  C  C    . PHE A 1 21 ? 1.336   -8.105  1.665   1.00 0.00 ? 21 PHE A C    6  
ATOM   3206  O  O    . PHE A 1 21 ? 1.900   -8.302  0.587   1.00 0.00 ? 21 PHE A O    6  
ATOM   3207  C  CB   . PHE A 1 21 ? -0.042  -6.008  1.640   1.00 0.00 ? 21 PHE A CB   6  
ATOM   3208  C  CG   . PHE A 1 21 ? -0.033  -4.521  1.834   1.00 0.00 ? 21 PHE A CG   6  
ATOM   3209  C  CD1  . PHE A 1 21 ? 0.683   -3.703  0.976   1.00 0.00 ? 21 PHE A CD1  6  
ATOM   3210  C  CD2  . PHE A 1 21 ? -0.729  -3.940  2.881   1.00 0.00 ? 21 PHE A CD2  6  
ATOM   3211  C  CE1  . PHE A 1 21 ? 0.710   -2.340  1.157   1.00 0.00 ? 21 PHE A CE1  6  
ATOM   3212  C  CE2  . PHE A 1 21 ? -0.705  -2.574  3.066   1.00 0.00 ? 21 PHE A CE2  6  
ATOM   3213  C  CZ   . PHE A 1 21 ? 0.014   -1.774  2.199   1.00 0.00 ? 21 PHE A CZ   6  
ATOM   3214  H  H    . PHE A 1 21 ? 2.748   -5.908  1.034   1.00 0.00 ? 21 PHE A H    6  
ATOM   3215  H  HA   . PHE A 1 21 ? 1.079   -6.766  3.304   1.00 0.00 ? 21 PHE A HA   6  
ATOM   3216  H  HB2  . PHE A 1 21 ? -0.087  -6.206  0.578   1.00 0.00 ? 21 PHE A HB2  6  
ATOM   3217  H  HB3  . PHE A 1 21 ? -0.929  -6.402  2.113   1.00 0.00 ? 21 PHE A HB3  6  
ATOM   3218  H  HD1  . PHE A 1 21 ? 1.233   -4.147  0.158   1.00 0.00 ? 21 PHE A HD1  6  
ATOM   3219  H  HD2  . PHE A 1 21 ? -1.289  -4.566  3.558   1.00 0.00 ? 21 PHE A HD2  6  
ATOM   3220  H  HE1  . PHE A 1 21 ? 1.271   -1.714  0.480   1.00 0.00 ? 21 PHE A HE1  6  
ATOM   3221  H  HE2  . PHE A 1 21 ? -1.251  -2.130  3.885   1.00 0.00 ? 21 PHE A HE2  6  
ATOM   3222  H  HZ   . PHE A 1 21 ? 0.035   -0.709  2.338   1.00 0.00 ? 21 PHE A HZ   6  
ATOM   3223  N  N    . SER A 1 22 ? 0.866   -9.084  2.411   1.00 0.00 ? 22 SER A N    6  
ATOM   3224  C  CA   . SER A 1 22 ? 0.935   -10.465 1.983   1.00 0.00 ? 22 SER A CA   6  
ATOM   3225  C  C    . SER A 1 22 ? -0.213  -10.770 1.030   1.00 0.00 ? 22 SER A C    6  
ATOM   3226  O  O    . SER A 1 22 ? -0.157  -11.712 0.241   1.00 0.00 ? 22 SER A O    6  
ATOM   3227  C  CB   . SER A 1 22 ? 0.873   -11.377 3.204   1.00 0.00 ? 22 SER A CB   6  
ATOM   3228  O  OG   . SER A 1 22 ? 0.813   -10.609 4.398   1.00 0.00 ? 22 SER A OG   6  
ATOM   3229  H  H    . SER A 1 22 ? 0.450   -8.874  3.279   1.00 0.00 ? 22 SER A H    6  
ATOM   3230  H  HA   . SER A 1 22 ? 1.876   -10.615 1.470   1.00 0.00 ? 22 SER A HA   6  
ATOM   3231  H  HB2  . SER A 1 22 ? -0.009  -11.997 3.142   1.00 0.00 ? 22 SER A HB2  6  
ATOM   3232  H  HB3  . SER A 1 22 ? 1.754   -12.000 3.233   1.00 0.00 ? 22 SER A HB3  6  
ATOM   3233  H  HG   . SER A 1 22 ? 0.927   -11.190 5.162   1.00 0.00 ? 22 SER A HG   6  
ATOM   3234  N  N    . ARG A 1 23 ? -1.253  -9.950  1.107   1.00 0.00 ? 23 ARG A N    6  
ATOM   3235  C  CA   . ARG A 1 23 ? -2.425  -10.101 0.261   1.00 0.00 ? 23 ARG A CA   6  
ATOM   3236  C  C    . ARG A 1 23 ? -2.662  -8.851  -0.549  1.00 0.00 ? 23 ARG A C    6  
ATOM   3237  O  O    . ARG A 1 23 ? -2.637  -7.736  -0.031  1.00 0.00 ? 23 ARG A O    6  
ATOM   3238  C  CB   . ARG A 1 23 ? -3.659  -10.420 1.107   1.00 0.00 ? 23 ARG A CB   6  
ATOM   3239  C  CG   . ARG A 1 23 ? -3.450  -11.578 2.072   1.00 0.00 ? 23 ARG A CG   6  
ATOM   3240  C  CD   . ARG A 1 23 ? -4.677  -11.823 2.937   1.00 0.00 ? 23 ARG A CD   6  
ATOM   3241  N  NE   . ARG A 1 23 ? -5.916  -11.415 2.277   1.00 0.00 ? 23 ARG A NE   6  
ATOM   3242  C  CZ   . ARG A 1 23 ? -6.657  -12.218 1.515   1.00 0.00 ? 23 ARG A CZ   6  
ATOM   3243  N  NH1  . ARG A 1 23 ? -6.261  -13.461 1.265   1.00 0.00 ? 23 ARG A NH1  6  
ATOM   3244  N  NH2  . ARG A 1 23 ? -7.785  -11.768 0.992   1.00 0.00 ? 23 ARG A NH2  6  
ATOM   3245  H  H    . ARG A 1 23 ? -1.228  -9.214  1.756   1.00 0.00 ? 23 ARG A H    6  
ATOM   3246  H  HA   . ARG A 1 23 ? -2.252  -10.909 -0.435  1.00 0.00 ? 23 ARG A HA   6  
ATOM   3247  H  HB2  . ARG A 1 23 ? -3.924  -9.545  1.681   1.00 0.00 ? 23 ARG A HB2  6  
ATOM   3248  H  HB3  . ARG A 1 23 ? -4.478  -10.672 0.449   1.00 0.00 ? 23 ARG A HB3  6  
ATOM   3249  H  HG2  . ARG A 1 23 ? -3.239  -12.471 1.503   1.00 0.00 ? 23 ARG A HG2  6  
ATOM   3250  H  HG3  . ARG A 1 23 ? -2.609  -11.350 2.712   1.00 0.00 ? 23 ARG A HG3  6  
ATOM   3251  H  HD2  . ARG A 1 23 ? -4.736  -12.877 3.163   1.00 0.00 ? 23 ARG A HD2  6  
ATOM   3252  H  HD3  . ARG A 1 23 ? -4.569  -11.265 3.856   1.00 0.00 ? 23 ARG A HD3  6  
ATOM   3253  H  HE   . ARG A 1 23 ? -6.221  -10.486 2.419   1.00 0.00 ? 23 ARG A HE   6  
ATOM   3254  H  HH11 . ARG A 1 23 ? -5.397  -13.805 1.648   1.00 0.00 ? 23 ARG A HH11 6  
ATOM   3255  H  HH12 . ARG A 1 23 ? -6.822  -14.067 0.686   1.00 0.00 ? 23 ARG A HH12 6  
ATOM   3256  H  HH21 . ARG A 1 23 ? -8.080  -10.826 1.172   1.00 0.00 ? 23 ARG A HH21 6  
ATOM   3257  H  HH22 . ARG A 1 23 ? -8.353  -12.367 0.412   1.00 0.00 ? 23 ARG A HH22 6  
ATOM   3258  N  N    . SER A 1 24 ? -2.928  -9.065  -1.819  1.00 0.00 ? 24 SER A N    6  
ATOM   3259  C  CA   . SER A 1 24 ? -3.220  -7.996  -2.744  1.00 0.00 ? 24 SER A CA   6  
ATOM   3260  C  C    . SER A 1 24 ? -4.497  -7.271  -2.330  1.00 0.00 ? 24 SER A C    6  
ATOM   3261  O  O    . SER A 1 24 ? -4.652  -6.069  -2.548  1.00 0.00 ? 24 SER A O    6  
ATOM   3262  C  CB   . SER A 1 24 ? -3.361  -8.602  -4.131  1.00 0.00 ? 24 SER A CB   6  
ATOM   3263  O  OG   . SER A 1 24 ? -3.570  -10.005 -4.048  1.00 0.00 ? 24 SER A OG   6  
ATOM   3264  H  H    . SER A 1 24 ? -2.950  -9.989  -2.151  1.00 0.00 ? 24 SER A H    6  
ATOM   3265  H  HA   . SER A 1 24 ? -2.393  -7.303  -2.737  1.00 0.00 ? 24 SER A HA   6  
ATOM   3266  H  HB2  . SER A 1 24 ? -4.199  -8.156  -4.628  1.00 0.00 ? 24 SER A HB2  6  
ATOM   3267  H  HB3  . SER A 1 24 ? -2.457  -8.420  -4.689  1.00 0.00 ? 24 SER A HB3  6  
ATOM   3268  H  HG   . SER A 1 24 ? -4.450  -10.215 -4.401  1.00 0.00 ? 24 SER A HG   6  
ATOM   3269  N  N    . ASP A 1 25 ? -5.356  -7.998  -1.632  1.00 0.00 ? 25 ASP A N    6  
ATOM   3270  C  CA   . ASP A 1 25 ? -6.570  -7.439  -1.068  1.00 0.00 ? 25 ASP A CA   6  
ATOM   3271  C  C    . ASP A 1 25 ? -6.226  -6.394  -0.015  1.00 0.00 ? 25 ASP A C    6  
ATOM   3272  O  O    . ASP A 1 25 ? -6.739  -5.275  -0.032  1.00 0.00 ? 25 ASP A O    6  
ATOM   3273  C  CB   . ASP A 1 25 ? -7.408  -8.572  -0.470  1.00 0.00 ? 25 ASP A CB   6  
ATOM   3274  C  CG   . ASP A 1 25 ? -7.925  -8.292  0.927   1.00 0.00 ? 25 ASP A CG   6  
ATOM   3275  O  OD1  . ASP A 1 25 ? -8.929  -7.562  1.061   1.00 0.00 ? 25 ASP A OD1  6  
ATOM   3276  O  OD2  . ASP A 1 25 ? -7.347  -8.839  1.893   1.00 0.00 ? 25 ASP A OD2  6  
ATOM   3277  H  H    . ASP A 1 25 ? -5.138  -8.939  -1.445  1.00 0.00 ? 25 ASP A H    6  
ATOM   3278  H  HA   . ASP A 1 25 ? -7.122  -6.967  -1.865  1.00 0.00 ? 25 ASP A HA   6  
ATOM   3279  H  HB2  . ASP A 1 25 ? -8.248  -8.752  -1.106  1.00 0.00 ? 25 ASP A HB2  6  
ATOM   3280  H  HB3  . ASP A 1 25 ? -6.802  -9.465  -0.431  1.00 0.00 ? 25 ASP A HB3  6  
ATOM   3281  N  N    . HIS A 1 26 ? -5.293  -6.757  0.851   1.00 0.00 ? 26 HIS A N    6  
ATOM   3282  C  CA   . HIS A 1 26 ? -4.807  -5.860  1.892   1.00 0.00 ? 26 HIS A CA   6  
ATOM   3283  C  C    . HIS A 1 26 ? -4.130  -4.633  1.290   1.00 0.00 ? 26 HIS A C    6  
ATOM   3284  O  O    . HIS A 1 26 ? -4.262  -3.525  1.814   1.00 0.00 ? 26 HIS A O    6  
ATOM   3285  C  CB   . HIS A 1 26 ? -3.838  -6.590  2.820   1.00 0.00 ? 26 HIS A CB   6  
ATOM   3286  C  CG   . HIS A 1 26 ? -4.428  -6.884  4.157   1.00 0.00 ? 26 HIS A CG   6  
ATOM   3287  N  ND1  . HIS A 1 26 ? -3.780  -6.638  5.342   1.00 0.00 ? 26 HIS A ND1  6  
ATOM   3288  C  CD2  . HIS A 1 26 ? -5.636  -7.384  4.487   1.00 0.00 ? 26 HIS A CD2  6  
ATOM   3289  C  CE1  . HIS A 1 26 ? -4.564  -6.969  6.346   1.00 0.00 ? 26 HIS A CE1  6  
ATOM   3290  N  NE2  . HIS A 1 26 ? -5.703  -7.424  5.858   1.00 0.00 ? 26 HIS A NE2  6  
ATOM   3291  H  H    . HIS A 1 26 ? -4.914  -7.656  0.778   1.00 0.00 ? 26 HIS A H    6  
ATOM   3292  H  HA   . HIS A 1 26 ? -5.659  -5.535  2.469   1.00 0.00 ? 26 HIS A HA   6  
ATOM   3293  H  HB2  . HIS A 1 26 ? -3.554  -7.531  2.368   1.00 0.00 ? 26 HIS A HB2  6  
ATOM   3294  H  HB3  . HIS A 1 26 ? -2.958  -5.983  2.967   1.00 0.00 ? 26 HIS A HB3  6  
ATOM   3295  H  HD1  . HIS A 1 26 ? -2.863  -6.283  5.437   1.00 0.00 ? 26 HIS A HD1  6  
ATOM   3296  H  HD2  . HIS A 1 26 ? -6.404  -7.704  3.793   1.00 0.00 ? 26 HIS A HD2  6  
ATOM   3297  H  HE1  . HIS A 1 26 ? -4.319  -6.884  7.394   1.00 0.00 ? 26 HIS A HE1  6  
ATOM   3298  H  HE2  . HIS A 1 26 ? -6.541  -7.474  6.372   1.00 0.00 ? 26 HIS A HE2  6  
ATOM   3299  N  N    . LEU A 1 27 ? -3.463  -4.832  0.154   1.00 0.00 ? 27 LEU A N    6  
ATOM   3300  C  CA   . LEU A 1 27 ? -2.853  -3.734  -0.589  1.00 0.00 ? 27 LEU A CA   6  
ATOM   3301  C  C    . LEU A 1 27 ? -3.906  -2.682  -0.915  1.00 0.00 ? 27 LEU A C    6  
ATOM   3302  O  O    . LEU A 1 27 ? -3.785  -1.517  -0.526  1.00 0.00 ? 27 LEU A O    6  
ATOM   3303  C  CB   . LEU A 1 27 ? -2.240  -4.253  -1.895  1.00 0.00 ? 27 LEU A CB   6  
ATOM   3304  C  CG   . LEU A 1 27 ? -1.331  -3.277  -2.660  1.00 0.00 ? 27 LEU A CG   6  
ATOM   3305  C  CD1  . LEU A 1 27 ? -0.842  -2.143  -1.777  1.00 0.00 ? 27 LEU A CD1  6  
ATOM   3306  C  CD2  . LEU A 1 27 ? -0.158  -4.010  -3.279  1.00 0.00 ? 27 LEU A CD2  6  
ATOM   3307  H  H    . LEU A 1 27 ? -3.438  -5.735  -0.228  1.00 0.00 ? 27 LEU A H    6  
ATOM   3308  H  HA   . LEU A 1 27 ? -2.080  -3.294  0.024   1.00 0.00 ? 27 LEU A HA   6  
ATOM   3309  H  HB2  . LEU A 1 27 ? -1.662  -5.136  -1.666  1.00 0.00 ? 27 LEU A HB2  6  
ATOM   3310  H  HB3  . LEU A 1 27 ? -3.049  -4.539  -2.551  1.00 0.00 ? 27 LEU A HB3  6  
ATOM   3311  H  HG   . LEU A 1 27 ? -1.903  -2.836  -3.463  1.00 0.00 ? 27 LEU A HG   6  
ATOM   3312  H  HD11 . LEU A 1 27 ? -0.506  -1.325  -2.395  1.00 0.00 ? 27 LEU A HD11 6  
ATOM   3313  H  HD12 . LEU A 1 27 ? -1.649  -1.809  -1.142  1.00 0.00 ? 27 LEU A HD12 6  
ATOM   3314  H  HD13 . LEU A 1 27 ? -0.022  -2.492  -1.163  1.00 0.00 ? 27 LEU A HD13 6  
ATOM   3315  H  HD21 . LEU A 1 27 ? -0.497  -4.572  -4.135  1.00 0.00 ? 27 LEU A HD21 6  
ATOM   3316  H  HD22 . LEU A 1 27 ? 0.588   -3.293  -3.590  1.00 0.00 ? 27 LEU A HD22 6  
ATOM   3317  H  HD23 . LEU A 1 27 ? 0.272   -4.685  -2.552  1.00 0.00 ? 27 LEU A HD23 6  
ATOM   3318  N  N    . ALA A 1 28 ? -4.935  -3.110  -1.639  1.00 0.00 ? 28 ALA A N    6  
ATOM   3319  C  CA   . ALA A 1 28 ? -6.019  -2.228  -2.051  1.00 0.00 ? 28 ALA A CA   6  
ATOM   3320  C  C    . ALA A 1 28 ? -6.658  -1.532  -0.854  1.00 0.00 ? 28 ALA A C    6  
ATOM   3321  O  O    . ALA A 1 28 ? -6.991  -0.351  -0.928  1.00 0.00 ? 28 ALA A O    6  
ATOM   3322  C  CB   . ALA A 1 28 ? -7.068  -3.013  -2.827  1.00 0.00 ? 28 ALA A CB   6  
ATOM   3323  H  H    . ALA A 1 28 ? -4.953  -4.051  -1.929  1.00 0.00 ? 28 ALA A H    6  
ATOM   3324  H  HA   . ALA A 1 28 ? -5.603  -1.478  -2.709  1.00 0.00 ? 28 ALA A HA   6  
ATOM   3325  H  HB1  . ALA A 1 28 ? -6.649  -3.953  -3.152  1.00 0.00 ? 28 ALA A HB1  6  
ATOM   3326  H  HB2  . ALA A 1 28 ? -7.922  -3.200  -2.190  1.00 0.00 ? 28 ALA A HB2  6  
ATOM   3327  H  HB3  . ALA A 1 28 ? -7.378  -2.440  -3.688  1.00 0.00 ? 28 ALA A HB3  6  
ATOM   3328  N  N    . LEU A 1 29 ? -6.810  -2.262  0.247   1.00 0.00 ? 29 LEU A N    6  
ATOM   3329  C  CA   . LEU A 1 29 ? -7.402  -1.712  1.462   1.00 0.00 ? 29 LEU A CA   6  
ATOM   3330  C  C    . LEU A 1 29 ? -6.642  -0.476  1.939   1.00 0.00 ? 29 LEU A C    6  
ATOM   3331  O  O    . LEU A 1 29 ? -7.246  0.552   2.241   1.00 0.00 ? 29 LEU A O    6  
ATOM   3332  C  CB   . LEU A 1 29 ? -7.427  -2.761  2.570   1.00 0.00 ? 29 LEU A CB   6  
ATOM   3333  C  CG   . LEU A 1 29 ? -8.403  -3.919  2.354   1.00 0.00 ? 29 LEU A CG   6  
ATOM   3334  C  CD1  . LEU A 1 29 ? -8.187  -4.997  3.403   1.00 0.00 ? 29 LEU A CD1  6  
ATOM   3335  C  CD2  . LEU A 1 29 ? -9.840  -3.420  2.390   1.00 0.00 ? 29 LEU A CD2  6  
ATOM   3336  H  H    . LEU A 1 29 ? -6.527  -3.203  0.239   1.00 0.00 ? 29 LEU A H    6  
ATOM   3337  H  HA   . LEU A 1 29 ? -8.416  -1.427  1.234   1.00 0.00 ? 29 LEU A HA   6  
ATOM   3338  H  HB2  . LEU A 1 29 ? -6.433  -3.168  2.673   1.00 0.00 ? 29 LEU A HB2  6  
ATOM   3339  H  HB3  . LEU A 1 29 ? -7.693  -2.264  3.491   1.00 0.00 ? 29 LEU A HB3  6  
ATOM   3340  H  HG   . LEU A 1 29 ? -8.224  -4.357  1.384   1.00 0.00 ? 29 LEU A HG   6  
ATOM   3341  H  HD11 . LEU A 1 29 ? -8.308  -4.571  4.387   1.00 0.00 ? 29 LEU A HD11 6  
ATOM   3342  H  HD12 . LEU A 1 29 ? -8.908  -5.786  3.261   1.00 0.00 ? 29 LEU A HD12 6  
ATOM   3343  H  HD13 . LEU A 1 29 ? -7.189  -5.398  3.305   1.00 0.00 ? 29 LEU A HD13 6  
ATOM   3344  H  HD21 . LEU A 1 29 ? -9.925  -2.622  3.114   1.00 0.00 ? 29 LEU A HD21 6  
ATOM   3345  H  HD22 . LEU A 1 29 ? -10.117 -3.050  1.413   1.00 0.00 ? 29 LEU A HD22 6  
ATOM   3346  H  HD23 . LEU A 1 29 ? -10.498 -4.231  2.669   1.00 0.00 ? 29 LEU A HD23 6  
ATOM   3347  N  N    . HIS A 1 30 ? -5.317  -0.566  1.967   1.00 0.00 ? 30 HIS A N    6  
ATOM   3348  C  CA   . HIS A 1 30 ? -4.489  0.569   2.365   1.00 0.00 ? 30 HIS A CA   6  
ATOM   3349  C  C    . HIS A 1 30 ? -4.500  1.634   1.276   1.00 0.00 ? 30 HIS A C    6  
ATOM   3350  O  O    . HIS A 1 30 ? -4.415  2.831   1.554   1.00 0.00 ? 30 HIS A O    6  
ATOM   3351  C  CB   . HIS A 1 30 ? -3.039  0.120   2.655   1.00 0.00 ? 30 HIS A CB   6  
ATOM   3352  C  CG   . HIS A 1 30 ? -1.996  1.178   2.395   1.00 0.00 ? 30 HIS A CG   6  
ATOM   3353  N  ND1  . HIS A 1 30 ? -1.797  2.270   3.204   1.00 0.00 ? 30 HIS A ND1  6  
ATOM   3354  C  CD2  . HIS A 1 30 ? -1.113  1.310   1.367   1.00 0.00 ? 30 HIS A CD2  6  
ATOM   3355  C  CE1  . HIS A 1 30 ? -0.829  3.020   2.657   1.00 0.00 ? 30 HIS A CE1  6  
ATOM   3356  N  NE2  . HIS A 1 30 ? -0.374  2.480   1.537   1.00 0.00 ? 30 HIS A NE2  6  
ATOM   3357  H  H    . HIS A 1 30 ? -4.884  -1.401  1.683   1.00 0.00 ? 30 HIS A H    6  
ATOM   3358  H  HA   . HIS A 1 30 ? -4.911  0.988   3.267   1.00 0.00 ? 30 HIS A HA   6  
ATOM   3359  H  HB2  . HIS A 1 30 ? -2.962  -0.164  3.694   1.00 0.00 ? 30 HIS A HB2  6  
ATOM   3360  H  HB3  . HIS A 1 30 ? -2.801  -0.736  2.040   1.00 0.00 ? 30 HIS A HB3  6  
ATOM   3361  H  HD1  . HIS A 1 30 ? -2.283  2.469   4.045   1.00 0.00 ? 30 HIS A HD1  6  
ATOM   3362  H  HD2  . HIS A 1 30 ? -0.992  0.618   0.545   1.00 0.00 ? 30 HIS A HD2  6  
ATOM   3363  H  HE1  . HIS A 1 30 ? -0.463  3.944   3.077   1.00 0.00 ? 30 HIS A HE1  6  
ATOM   3364  N  N    . ARG A 1 31 ? -4.526  1.187   0.030   1.00 0.00 ? 31 ARG A N    6  
ATOM   3365  C  CA   . ARG A 1 31 ? -4.403  2.090   -1.102  1.00 0.00 ? 31 ARG A CA   6  
ATOM   3366  C  C    . ARG A 1 31 ? -5.664  2.927   -1.304  1.00 0.00 ? 31 ARG A C    6  
ATOM   3367  O  O    . ARG A 1 31 ? -5.688  3.819   -2.148  1.00 0.00 ? 31 ARG A O    6  
ATOM   3368  C  CB   . ARG A 1 31 ? -4.079  1.312   -2.370  1.00 0.00 ? 31 ARG A CB   6  
ATOM   3369  C  CG   . ARG A 1 31 ? -2.639  0.832   -2.415  1.00 0.00 ? 31 ARG A CG   6  
ATOM   3370  C  CD   . ARG A 1 31 ? -2.136  0.690   -3.842  1.00 0.00 ? 31 ARG A CD   6  
ATOM   3371  N  NE   . ARG A 1 31 ? -1.839  1.987   -4.445  1.00 0.00 ? 31 ARG A NE   6  
ATOM   3372  C  CZ   . ARG A 1 31 ? -2.625  2.605   -5.334  1.00 0.00 ? 31 ARG A CZ   6  
ATOM   3373  N  NH1  . ARG A 1 31 ? -3.764  2.041   -5.724  1.00 0.00 ? 31 ARG A NH1  6  
ATOM   3374  N  NH2  . ARG A 1 31 ? -2.264  3.784   -5.836  1.00 0.00 ? 31 ARG A NH2  6  
ATOM   3375  H  H    . ARG A 1 31 ? -4.564  0.216   -0.132  1.00 0.00 ? 31 ARG A H    6  
ATOM   3376  H  HA   . ARG A 1 31 ? -3.573  2.753   -0.890  1.00 0.00 ? 31 ARG A HA   6  
ATOM   3377  H  HB2  . ARG A 1 31 ? -4.730  0.453   -2.434  1.00 0.00 ? 31 ARG A HB2  6  
ATOM   3378  H  HB3  . ARG A 1 31 ? -4.252  1.956   -3.221  1.00 0.00 ? 31 ARG A HB3  6  
ATOM   3379  H  HG2  . ARG A 1 31 ? -2.020  1.547   -1.900  1.00 0.00 ? 31 ARG A HG2  6  
ATOM   3380  H  HG3  . ARG A 1 31 ? -2.571  -0.126  -1.918  1.00 0.00 ? 31 ARG A HG3  6  
ATOM   3381  H  HD2  . ARG A 1 31 ? -1.232  0.097   -3.832  1.00 0.00 ? 31 ARG A HD2  6  
ATOM   3382  H  HD3  . ARG A 1 31 ? -2.893  0.189   -4.429  1.00 0.00 ? 31 ARG A HD3  6  
ATOM   3383  H  HE   . ARG A 1 31 ? -1.003  2.423   -4.170  1.00 0.00 ? 31 ARG A HE   6  
ATOM   3384  H  HH11 . ARG A 1 31 ? -4.042  1.148   -5.356  1.00 0.00 ? 31 ARG A HH11 6  
ATOM   3385  H  HH12 . ARG A 1 31 ? -4.360  2.509   -6.393  1.00 0.00 ? 31 ARG A HH12 6  
ATOM   3386  H  HH21 . ARG A 1 31 ? -1.400  4.212   -5.551  1.00 0.00 ? 31 ARG A HH21 6  
ATOM   3387  H  HH22 . ARG A 1 31 ? -2.853  4.257   -6.505  1.00 0.00 ? 31 ARG A HH22 6  
ATOM   3388  N  N    . LYS A 1 32 ? -6.679  2.684   -0.484  1.00 0.00 ? 32 LYS A N    6  
ATOM   3389  C  CA   . LYS A 1 32 ? -7.902  3.477   -0.521  1.00 0.00 ? 32 LYS A CA   6  
ATOM   3390  C  C    . LYS A 1 32 ? -7.592  4.942   -0.242  1.00 0.00 ? 32 LYS A C    6  
ATOM   3391  O  O    . LYS A 1 32 ? -8.153  5.843   -0.867  1.00 0.00 ? 32 LYS A O    6  
ATOM   3392  C  CB   . LYS A 1 32 ? -8.901  2.962   0.512   1.00 0.00 ? 32 LYS A CB   6  
ATOM   3393  C  CG   . LYS A 1 32 ? -10.114 2.293   -0.102  1.00 0.00 ? 32 LYS A CG   6  
ATOM   3394  C  CD   . LYS A 1 32 ? -9.715  1.081   -0.921  1.00 0.00 ? 32 LYS A CD   6  
ATOM   3395  C  CE   . LYS A 1 32 ? -10.911 0.201   -1.229  1.00 0.00 ? 32 LYS A CE   6  
ATOM   3396  N  NZ   . LYS A 1 32 ? -11.210 -0.740  -0.121  1.00 0.00 ? 32 LYS A NZ   6  
ATOM   3397  H  H    . LYS A 1 32 ? -6.592  1.975   0.190   1.00 0.00 ? 32 LYS A H    6  
ATOM   3398  H  HA   . LYS A 1 32 ? -8.333  3.389   -1.506  1.00 0.00 ? 32 LYS A HA   6  
ATOM   3399  H  HB2  . LYS A 1 32 ? -8.405  2.246   1.149   1.00 0.00 ? 32 LYS A HB2  6  
ATOM   3400  H  HB3  . LYS A 1 32 ? -9.239  3.794   1.113   1.00 0.00 ? 32 LYS A HB3  6  
ATOM   3401  H  HG2  . LYS A 1 32 ? -10.782 1.980   0.689   1.00 0.00 ? 32 LYS A HG2  6  
ATOM   3402  H  HG3  . LYS A 1 32 ? -10.620 3.000   -0.743  1.00 0.00 ? 32 LYS A HG3  6  
ATOM   3403  H  HD2  . LYS A 1 32 ? -9.277  1.415   -1.851  1.00 0.00 ? 32 LYS A HD2  6  
ATOM   3404  H  HD3  . LYS A 1 32 ? -8.984  0.508   -0.364  1.00 0.00 ? 32 LYS A HD3  6  
ATOM   3405  H  HE2  . LYS A 1 32 ? -11.772 0.832   -1.393  1.00 0.00 ? 32 LYS A HE2  6  
ATOM   3406  H  HE3  . LYS A 1 32 ? -10.705 -0.365  -2.125  1.00 0.00 ? 32 LYS A HE3  6  
ATOM   3407  H  HZ1  . LYS A 1 32 ? -12.236 -0.929  -0.081  1.00 0.00 ? 32 LYS A HZ1  6  
ATOM   3408  H  HZ2  . LYS A 1 32 ? -10.907 -0.335  0.792   1.00 0.00 ? 32 LYS A HZ2  6  
ATOM   3409  H  HZ3  . LYS A 1 32 ? -10.709 -1.643  -0.275  1.00 0.00 ? 32 LYS A HZ3  6  
ATOM   3410  N  N    . ARG A 1 33 ? -6.645  5.169   0.657   1.00 0.00 ? 33 ARG A N    6  
ATOM   3411  C  CA   . ARG A 1 33 ? -6.241  6.522   1.010   1.00 0.00 ? 33 ARG A CA   6  
ATOM   3412  C  C    . ARG A 1 33 ? -5.381  7.141   -0.086  1.00 0.00 ? 33 ARG A C    6  
ATOM   3413  O  O    . ARG A 1 33 ? -5.076  8.332   -0.042  1.00 0.00 ? 33 ARG A O    6  
ATOM   3414  C  CB   . ARG A 1 33 ? -5.485  6.534   2.342   1.00 0.00 ? 33 ARG A CB   6  
ATOM   3415  C  CG   . ARG A 1 33 ? -6.205  5.813   3.473   1.00 0.00 ? 33 ARG A CG   6  
ATOM   3416  C  CD   . ARG A 1 33 ? -7.642  6.292   3.619   1.00 0.00 ? 33 ARG A CD   6  
ATOM   3417  N  NE   . ARG A 1 33 ? -7.794  7.253   4.710   1.00 0.00 ? 33 ARG A NE   6  
ATOM   3418  C  CZ   . ARG A 1 33 ? -8.969  7.714   5.140   1.00 0.00 ? 33 ARG A CZ   6  
ATOM   3419  N  NH1  . ARG A 1 33 ? -10.102 7.231   4.643   1.00 0.00 ? 33 ARG A NH1  6  
ATOM   3420  N  NH2  . ARG A 1 33 ? -9.010  8.634   6.095   1.00 0.00 ? 33 ARG A NH2  6  
ATOM   3421  H  H    . ARG A 1 33 ? -6.202  4.407   1.089   1.00 0.00 ? 33 ARG A H    6  
ATOM   3422  H  HA   . ARG A 1 33 ? -7.138  7.110   1.110   1.00 0.00 ? 33 ARG A HA   6  
ATOM   3423  H  HB2  . ARG A 1 33 ? -4.527  6.060   2.200   1.00 0.00 ? 33 ARG A HB2  6  
ATOM   3424  H  HB3  . ARG A 1 33 ? -5.327  7.559   2.641   1.00 0.00 ? 33 ARG A HB3  6  
ATOM   3425  H  HG2  . ARG A 1 33 ? -6.211  4.753   3.267   1.00 0.00 ? 33 ARG A HG2  6  
ATOM   3426  H  HG3  . ARG A 1 33 ? -5.679  5.999   4.398   1.00 0.00 ? 33 ARG A HG3  6  
ATOM   3427  H  HD2  . ARG A 1 33 ? -7.946  6.761   2.695   1.00 0.00 ? 33 ARG A HD2  6  
ATOM   3428  H  HD3  . ARG A 1 33 ? -8.275  5.438   3.814   1.00 0.00 ? 33 ARG A HD3  6  
ATOM   3429  H  HE   . ARG A 1 33 ? -6.967  7.590   5.131   1.00 0.00 ? 33 ARG A HE   6  
ATOM   3430  H  HH11 . ARG A 1 33 ? -10.080 6.507   3.948   1.00 0.00 ? 33 ARG A HH11 6  
ATOM   3431  H  HH12 . ARG A 1 33 ? -10.992 7.596   4.956   1.00 0.00 ? 33 ARG A HH12 6  
ATOM   3432  H  HH21 . ARG A 1 33 ? -8.156  8.982   6.499   1.00 0.00 ? 33 ARG A HH21 6  
ATOM   3433  H  HH22 . ARG A 1 33 ? -9.892  8.995   6.412   1.00 0.00 ? 33 ARG A HH22 6  
ATOM   3434  N  N    . HIS A 1 34 ? -5.049  6.353   -1.104  1.00 0.00 ? 34 HIS A N    6  
ATOM   3435  C  CA   . HIS A 1 34 ? -4.303  6.863   -2.244  1.00 0.00 ? 34 HIS A CA   6  
ATOM   3436  C  C    . HIS A 1 34 ? -5.259  7.331   -3.327  1.00 0.00 ? 34 HIS A C    6  
ATOM   3437  O  O    . HIS A 1 34 ? -4.874  8.047   -4.250  1.00 0.00 ? 34 HIS A O    6  
ATOM   3438  C  CB   . HIS A 1 34 ? -3.357  5.794   -2.794  1.00 0.00 ? 34 HIS A CB   6  
ATOM   3439  C  CG   . HIS A 1 34 ? -2.161  5.564   -1.925  1.00 0.00 ? 34 HIS A CG   6  
ATOM   3440  N  ND1  . HIS A 1 34 ? -1.274  6.555   -1.575  1.00 0.00 ? 34 HIS A ND1  6  
ATOM   3441  C  CD2  . HIS A 1 34 ? -1.726  4.434   -1.309  1.00 0.00 ? 34 HIS A CD2  6  
ATOM   3442  C  CE1  . HIS A 1 34 ? -0.352  6.009   -0.770  1.00 0.00 ? 34 HIS A CE1  6  
ATOM   3443  N  NE2  . HIS A 1 34 ? -0.583  4.725   -0.575  1.00 0.00 ? 34 HIS A NE2  6  
ATOM   3444  H  H    . HIS A 1 34 ? -5.367  5.420   -1.120  1.00 0.00 ? 34 HIS A H    6  
ATOM   3445  H  HA   . HIS A 1 34 ? -3.722  7.707   -1.906  1.00 0.00 ? 34 HIS A HA   6  
ATOM   3446  H  HB2  . HIS A 1 34 ? -3.890  4.861   -2.879  1.00 0.00 ? 34 HIS A HB2  6  
ATOM   3447  H  HB3  . HIS A 1 34 ? -3.009  6.097   -3.770  1.00 0.00 ? 34 HIS A HB3  6  
ATOM   3448  H  HD1  . HIS A 1 34 ? -1.291  7.488   -1.885  1.00 0.00 ? 34 HIS A HD1  6  
ATOM   3449  H  HD2  . HIS A 1 34 ? -2.168  3.450   -1.391  1.00 0.00 ? 34 HIS A HD2  6  
ATOM   3450  H  HE1  . HIS A 1 34 ? 0.477   6.551   -0.338  1.00 0.00 ? 34 HIS A HE1  6  
ATOM   3451  N  N    . MET A 1 35 ? -6.528  6.988   -3.161  1.00 0.00 ? 35 MET A N    6  
ATOM   3452  C  CA   . MET A 1 35 ? -7.559  7.426   -4.090  1.00 0.00 ? 35 MET A CA   6  
ATOM   3453  C  C    . MET A 1 35 ? -8.067  8.803   -3.694  1.00 0.00 ? 35 MET A C    6  
ATOM   3454  O  O    . MET A 1 35 ? -8.585  9.552   -4.520  1.00 0.00 ? 35 MET A O    6  
ATOM   3455  C  CB   . MET A 1 35 ? -8.720  6.431   -4.119  1.00 0.00 ? 35 MET A CB   6  
ATOM   3456  C  CG   . MET A 1 35 ? -8.317  5.022   -4.527  1.00 0.00 ? 35 MET A CG   6  
ATOM   3457  S  SD   . MET A 1 35 ? -9.552  3.788   -4.072  1.00 0.00 ? 35 MET A SD   6  
ATOM   3458  C  CE   . MET A 1 35 ? -8.642  2.276   -4.385  1.00 0.00 ? 35 MET A CE   6  
ATOM   3459  H  H    . MET A 1 35 ? -6.787  6.467   -2.367  1.00 0.00 ? 35 MET A H    6  
ATOM   3460  H  HA   . MET A 1 35 ? -7.119  7.484   -5.073  1.00 0.00 ? 35 MET A HA   6  
ATOM   3461  H  HB2  . MET A 1 35 ? -9.158  6.383   -3.133  1.00 0.00 ? 35 MET A HB2  6  
ATOM   3462  H  HB3  . MET A 1 35 ? -9.465  6.785   -4.815  1.00 0.00 ? 35 MET A HB3  6  
ATOM   3463  H  HG2  . MET A 1 35 ? -8.182  4.997   -5.597  1.00 0.00 ? 35 MET A HG2  6  
ATOM   3464  H  HG3  . MET A 1 35 ? -7.385  4.772   -4.042  1.00 0.00 ? 35 MET A HG3  6  
ATOM   3465  H  HE1  . MET A 1 35 ? -9.328  1.496   -4.681  1.00 0.00 ? 35 MET A HE1  6  
ATOM   3466  H  HE2  . MET A 1 35 ? -7.926  2.446   -5.177  1.00 0.00 ? 35 MET A HE2  6  
ATOM   3467  H  HE3  . MET A 1 35 ? -8.122  1.976   -3.487  1.00 0.00 ? 35 MET A HE3  6  
ATOM   3468  N  N    . LEU A 1 36 ? -7.873  9.147   -2.429  1.00 0.00 ? 36 LEU A N    6  
ATOM   3469  C  CA   . LEU A 1 36 ? -8.272  10.446  -1.914  1.00 0.00 ? 36 LEU A CA   6  
ATOM   3470  C  C    . LEU A 1 36 ? -7.091  11.103  -1.211  1.00 0.00 ? 36 LEU A C    6  
ATOM   3471  O  O    . LEU A 1 36 ? -7.086  11.262  0.012   1.00 0.00 ? 36 LEU A O    6  
ATOM   3472  C  CB   . LEU A 1 36 ? -9.453  10.306  -0.946  1.00 0.00 ? 36 LEU A CB   6  
ATOM   3473  C  CG   . LEU A 1 36 ? -10.323 9.063   -1.146  1.00 0.00 ? 36 LEU A CG   6  
ATOM   3474  C  CD1  . LEU A 1 36 ? -10.418 8.265   0.146   1.00 0.00 ? 36 LEU A CD1  6  
ATOM   3475  C  CD2  . LEU A 1 36 ? -11.711 9.453   -1.637  1.00 0.00 ? 36 LEU A CD2  6  
ATOM   3476  H  H    . LEU A 1 36 ? -7.415  8.522   -1.830  1.00 0.00 ? 36 LEU A H    6  
ATOM   3477  H  HA   . LEU A 1 36 ? -8.569  11.061  -2.750  1.00 0.00 ? 36 LEU A HA   6  
ATOM   3478  H  HB2  . LEU A 1 36 ? -9.062  10.285  0.062   1.00 0.00 ? 36 LEU A HB2  6  
ATOM   3479  H  HB3  . LEU A 1 36 ? -10.080 11.177  -1.051  1.00 0.00 ? 36 LEU A HB3  6  
ATOM   3480  H  HG   . LEU A 1 36 ? -9.869  8.432   -1.896  1.00 0.00 ? 36 LEU A HG   6  
ATOM   3481  H  HD11 . LEU A 1 36 ? -10.451 7.210   -0.085  1.00 0.00 ? 36 LEU A HD11 6  
ATOM   3482  H  HD12 . LEU A 1 36 ? -9.554  8.473   0.760   1.00 0.00 ? 36 LEU A HD12 6  
ATOM   3483  H  HD13 . LEU A 1 36 ? -11.316 8.544   0.679   1.00 0.00 ? 36 LEU A HD13 6  
ATOM   3484  H  HD21 . LEU A 1 36 ? -11.627 10.252  -2.358  1.00 0.00 ? 36 LEU A HD21 6  
ATOM   3485  H  HD22 . LEU A 1 36 ? -12.179 8.599   -2.101  1.00 0.00 ? 36 LEU A HD22 6  
ATOM   3486  H  HD23 . LEU A 1 36 ? -12.310 9.782   -0.802  1.00 0.00 ? 36 LEU A HD23 6  
ATOM   3487  N  N    . VAL A 1 37 ? -6.067  11.424  -1.985  1.00 0.00 ? 37 VAL A N    6  
ATOM   3488  C  CA   . VAL A 1 37 ? -4.857  12.014  -1.437  1.00 0.00 ? 37 VAL A CA   6  
ATOM   3489  C  C    . VAL A 1 37 ? -4.983  13.528  -1.353  1.00 0.00 ? 37 VAL A C    6  
ATOM   3490  O  O    . VAL A 1 37 ? -5.898  14.088  -1.996  1.00 0.00 ? 37 VAL A O    6  
ATOM   3491  C  CB   . VAL A 1 37 ? -3.610  11.657  -2.276  1.00 0.00 ? 37 VAL A CB   6  
ATOM   3492  C  CG1  . VAL A 1 37 ? -3.099  10.273  -1.918  1.00 0.00 ? 37 VAL A CG1  6  
ATOM   3493  C  CG2  . VAL A 1 37 ? -3.910  11.747  -3.764  1.00 0.00 ? 37 VAL A CG2  6  
ATOM   3494  O  OXT  . VAL A 1 37 ? -4.165  14.153  -0.656  1.00 0.00 ? 37 VAL A OXT  6  
ATOM   3495  H  H    . VAL A 1 37 ? -6.121  11.251  -2.948  1.00 0.00 ? 37 VAL A H    6  
ATOM   3496  H  HA   . VAL A 1 37 ? -4.720  11.619  -0.442  1.00 0.00 ? 37 VAL A HA   6  
ATOM   3497  H  HB   . VAL A 1 37 ? -2.833  12.371  -2.045  1.00 0.00 ? 37 VAL A HB   6  
ATOM   3498  H  HG11 . VAL A 1 37 ? -2.683  9.805   -2.797  1.00 0.00 ? 37 VAL A HG11 6  
ATOM   3499  H  HG12 . VAL A 1 37 ? -2.334  10.357  -1.159  1.00 0.00 ? 37 VAL A HG12 6  
ATOM   3500  H  HG13 . VAL A 1 37 ? -3.915  9.673   -1.542  1.00 0.00 ? 37 VAL A HG13 6  
ATOM   3501  H  HG21 . VAL A 1 37 ? -4.723  12.437  -3.926  1.00 0.00 ? 37 VAL A HG21 6  
ATOM   3502  H  HG22 . VAL A 1 37 ? -3.033  12.093  -4.288  1.00 0.00 ? 37 VAL A HG22 6  
ATOM   3503  H  HG23 . VAL A 1 37 ? -4.189  10.770  -4.133  1.00 0.00 ? 37 VAL A HG23 6  
HETATM 3504  ZN ZN   . ZN  B 2 .  ? 0.713   3.465   0.164   1.00 0.00 ? 38 ZN  A ZN   6  
ATOM   3505  N  N    . GLY A 1 1  ? 10.522  9.106   -4.374  1.00 0.00 ? 1  GLY A N    7  
ATOM   3506  C  CA   . GLY A 1 1  ? 9.962   8.912   -3.016  1.00 0.00 ? 1  GLY A CA   7  
ATOM   3507  C  C    . GLY A 1 1  ? 9.801   7.447   -2.678  1.00 0.00 ? 1  GLY A C    7  
ATOM   3508  O  O    . GLY A 1 1  ? 10.547  6.610   -3.184  1.00 0.00 ? 1  GLY A O    7  
ATOM   3509  H  H1   . GLY A 1 1  ? 9.751   9.261   -5.059  1.00 0.00 ? 1  GLY A H1   7  
ATOM   3510  H  H2   . GLY A 1 1  ? 11.063  8.261   -4.664  1.00 0.00 ? 1  GLY A H2   7  
ATOM   3511  H  H3   . GLY A 1 1  ? 11.155  9.935   -4.386  1.00 0.00 ? 1  GLY A H3   7  
ATOM   3512  H  HA2  . GLY A 1 1  ? 10.623  9.367   -2.297  1.00 0.00 ? 1  GLY A HA2  7  
ATOM   3513  H  HA3  . GLY A 1 1  ? 8.994   9.394   -2.961  1.00 0.00 ? 1  GLY A HA3  7  
ATOM   3514  N  N    . SER A 1 2  ? 8.821   7.140   -1.828  1.00 0.00 ? 2  SER A N    7  
ATOM   3515  C  CA   . SER A 1 2  ? 8.555   5.767   -1.404  1.00 0.00 ? 2  SER A CA   7  
ATOM   3516  C  C    . SER A 1 2  ? 9.780   5.169   -0.708  1.00 0.00 ? 2  SER A C    7  
ATOM   3517  O  O    . SER A 1 2  ? 10.590  5.903   -0.132  1.00 0.00 ? 2  SER A O    7  
ATOM   3518  C  CB   . SER A 1 2  ? 8.137   4.911   -2.605  1.00 0.00 ? 2  SER A CB   7  
ATOM   3519  O  OG   . SER A 1 2  ? 7.307   5.650   -3.488  1.00 0.00 ? 2  SER A OG   7  
ATOM   3520  H  H    . SER A 1 2  ? 8.262   7.866   -1.468  1.00 0.00 ? 2  SER A H    7  
ATOM   3521  H  HA   . SER A 1 2  ? 7.739   5.797   -0.697  1.00 0.00 ? 2  SER A HA   7  
ATOM   3522  H  HB2  . SER A 1 2  ? 9.019   4.590   -3.141  1.00 0.00 ? 2  SER A HB2  7  
ATOM   3523  H  HB3  . SER A 1 2  ? 7.592   4.046   -2.256  1.00 0.00 ? 2  SER A HB3  7  
ATOM   3524  H  HG   . SER A 1 2  ? 6.477   5.857   -3.038  1.00 0.00 ? 2  SER A HG   7  
ATOM   3525  N  N    . THR A 1 3  ? 9.911   3.842   -0.776  1.00 0.00 ? 3  THR A N    7  
ATOM   3526  C  CA   . THR A 1 3  ? 11.040  3.130   -0.173  1.00 0.00 ? 3  THR A CA   7  
ATOM   3527  C  C    . THR A 1 3  ? 11.167  3.436   1.321   1.00 0.00 ? 3  THR A C    7  
ATOM   3528  O  O    . THR A 1 3  ? 12.268  3.489   1.865   1.00 0.00 ? 3  THR A O    7  
ATOM   3529  C  CB   . THR A 1 3  ? 12.367  3.481   -0.885  1.00 0.00 ? 3  THR A CB   7  
ATOM   3530  O  OG1  . THR A 1 3  ? 12.104  3.999   -2.199  1.00 0.00 ? 3  THR A OG1  7  
ATOM   3531  C  CG2  . THR A 1 3  ? 13.267  2.260   -0.995  1.00 0.00 ? 3  THR A CG2  7  
ATOM   3532  H  H    . THR A 1 3  ? 9.236   3.323   -1.265  1.00 0.00 ? 3  THR A H    7  
ATOM   3533  H  HA   . THR A 1 3  ? 10.864  2.070   -0.296  1.00 0.00 ? 3  THR A HA   7  
ATOM   3534  H  HB   . THR A 1 3  ? 12.879  4.236   -0.305  1.00 0.00 ? 3  THR A HB   7  
ATOM   3535  H  HG1  . THR A 1 3  ? 11.442  3.437   -2.636  1.00 0.00 ? 3  THR A HG1  7  
ATOM   3536  H  HG21 . THR A 1 3  ? 13.547  2.112   -2.028  1.00 0.00 ? 3  THR A HG21 7  
ATOM   3537  H  HG22 . THR A 1 3  ? 12.740  1.390   -0.634  1.00 0.00 ? 3  THR A HG22 7  
ATOM   3538  H  HG23 . THR A 1 3  ? 14.156  2.415   -0.400  1.00 0.00 ? 3  THR A HG23 7  
ATOM   3539  N  N    . ARG A 1 4  ? 10.040  3.696   1.969   1.00 0.00 ? 4  ARG A N    7  
ATOM   3540  C  CA   . ARG A 1 4  ? 10.042  4.051   3.380   1.00 0.00 ? 4  ARG A CA   7  
ATOM   3541  C  C    . ARG A 1 4  ? 9.776   2.834   4.252   1.00 0.00 ? 4  ARG A C    7  
ATOM   3542  O  O    . ARG A 1 4  ? 8.732   2.193   4.132   1.00 0.00 ? 4  ARG A O    7  
ATOM   3543  C  CB   . ARG A 1 4  ? 9.004   5.135   3.664   1.00 0.00 ? 4  ARG A CB   7  
ATOM   3544  C  CG   . ARG A 1 4  ? 9.615   6.474   4.045   1.00 0.00 ? 4  ARG A CG   7  
ATOM   3545  C  CD   . ARG A 1 4  ? 8.550   7.531   4.287   1.00 0.00 ? 4  ARG A CD   7  
ATOM   3546  N  NE   . ARG A 1 4  ? 7.409   7.380   3.384   1.00 0.00 ? 4  ARG A NE   7  
ATOM   3547  C  CZ   . ARG A 1 4  ? 6.156   7.190   3.793   1.00 0.00 ? 4  ARG A CZ   7  
ATOM   3548  N  NH1  . ARG A 1 4  ? 5.860   7.210   5.085   1.00 0.00 ? 4  ARG A NH1  7  
ATOM   3549  N  NH2  . ARG A 1 4  ? 5.191   7.007   2.905   1.00 0.00 ? 4  ARG A NH2  7  
ATOM   3550  H  H    . ARG A 1 4  ? 9.190   3.668   1.481   1.00 0.00 ? 4  ARG A H    7  
ATOM   3551  H  HA   . ARG A 1 4  ? 11.022  4.434   3.619   1.00 0.00 ? 4  ARG A HA   7  
ATOM   3552  H  HB2  . ARG A 1 4  ? 8.397   5.277   2.781   1.00 0.00 ? 4  ARG A HB2  7  
ATOM   3553  H  HB3  . ARG A 1 4  ? 8.373   4.807   4.475   1.00 0.00 ? 4  ARG A HB3  7  
ATOM   3554  H  HG2  . ARG A 1 4  ? 10.194  6.350   4.946   1.00 0.00 ? 4  ARG A HG2  7  
ATOM   3555  H  HG3  . ARG A 1 4  ? 10.260  6.803   3.243   1.00 0.00 ? 4  ARG A HG3  7  
ATOM   3556  H  HD2  . ARG A 1 4  ? 8.204   7.447   5.306   1.00 0.00 ? 4  ARG A HD2  7  
ATOM   3557  H  HD3  . ARG A 1 4  ? 8.990   8.506   4.136   1.00 0.00 ? 4  ARG A HD3  7  
ATOM   3558  H  HE   . ARG A 1 4  ? 7.592   7.408   2.418   1.00 0.00 ? 4  ARG A HE   7  
ATOM   3559  H  HH11 . ARG A 1 4  ? 6.581   7.369   5.770   1.00 0.00 ? 4  ARG A HH11 7  
ATOM   3560  H  HH12 . ARG A 1 4  ? 4.911   7.080   5.387   1.00 0.00 ? 4  ARG A HH12 7  
ATOM   3561  H  HH21 . ARG A 1 4  ? 5.404   7.018   1.919   1.00 0.00 ? 4  ARG A HH21 7  
ATOM   3562  H  HH22 . ARG A 1 4  ? 4.245   6.841   3.210   1.00 0.00 ? 4  ARG A HH22 7  
ATOM   3563  N  N    . GLY A 1 5  ? 10.699  2.549   5.155   1.00 0.00 ? 5  GLY A N    7  
ATOM   3564  C  CA   . GLY A 1 5  ? 10.531  1.439   6.070   1.00 0.00 ? 5  GLY A CA   7  
ATOM   3565  C  C    . GLY A 1 5  ? 10.819  0.103   5.420   1.00 0.00 ? 5  GLY A C    7  
ATOM   3566  O  O    . GLY A 1 5  ? 11.961  -0.367  5.423   1.00 0.00 ? 5  GLY A O    7  
ATOM   3567  H  H    . GLY A 1 5  ? 11.501  3.118   5.216   1.00 0.00 ? 5  GLY A H    7  
ATOM   3568  H  HA2  . GLY A 1 5  ? 11.200  1.571   6.907   1.00 0.00 ? 5  GLY A HA2  7  
ATOM   3569  H  HA3  . GLY A 1 5  ? 9.514   1.438   6.432   1.00 0.00 ? 5  GLY A HA3  7  
ATOM   3570  N  N    . SER A 1 6  ? 9.797   -0.484  4.822   1.00 0.00 ? 6  SER A N    7  
ATOM   3571  C  CA   . SER A 1 6  ? 9.941   -1.754  4.136   1.00 0.00 ? 6  SER A CA   7  
ATOM   3572  C  C    . SER A 1 6  ? 10.639  -1.554  2.796   1.00 0.00 ? 6  SER A C    7  
ATOM   3573  O  O    . SER A 1 6  ? 10.457  -0.531  2.136   1.00 0.00 ? 6  SER A O    7  
ATOM   3574  C  CB   . SER A 1 6  ? 8.560   -2.405  3.959   1.00 0.00 ? 6  SER A CB   7  
ATOM   3575  O  OG   . SER A 1 6  ? 8.305   -2.779  2.614   1.00 0.00 ? 6  SER A OG   7  
ATOM   3576  H  H    . SER A 1 6  ? 8.928   -0.029  4.805   1.00 0.00 ? 6  SER A H    7  
ATOM   3577  H  HA   . SER A 1 6  ? 10.555  -2.395  4.753   1.00 0.00 ? 6  SER A HA   7  
ATOM   3578  H  HB2  . SER A 1 6  ? 8.501   -3.290  4.576   1.00 0.00 ? 6  SER A HB2  7  
ATOM   3579  H  HB3  . SER A 1 6  ? 7.799   -1.705  4.272   1.00 0.00 ? 6  SER A HB3  7  
ATOM   3580  H  HG   . SER A 1 6  ? 8.104   -1.985  2.090   1.00 0.00 ? 6  SER A HG   7  
ATOM   3581  N  N    . THR A 1 7  ? 11.496  -2.497  2.437   1.00 0.00 ? 7  THR A N    7  
ATOM   3582  C  CA   . THR A 1 7  ? 12.259  -2.402  1.209   1.00 0.00 ? 7  THR A CA   7  
ATOM   3583  C  C    . THR A 1 7  ? 11.850  -3.504  0.234   1.00 0.00 ? 7  THR A C    7  
ATOM   3584  O  O    . THR A 1 7  ? 12.570  -4.492  0.052   1.00 0.00 ? 7  THR A O    7  
ATOM   3585  C  CB   . THR A 1 7  ? 13.762  -2.495  1.504   1.00 0.00 ? 7  THR A CB   7  
ATOM   3586  O  OG1  . THR A 1 7  ? 13.961  -3.057  2.809   1.00 0.00 ? 7  THR A OG1  7  
ATOM   3587  C  CG2  . THR A 1 7  ? 14.406  -1.120  1.443   1.00 0.00 ? 7  THR A CG2  7  
ATOM   3588  H  H    . THR A 1 7  ? 11.641  -3.262  3.026   1.00 0.00 ? 7  THR A H    7  
ATOM   3589  H  HA   . THR A 1 7  ? 12.057  -1.441  0.761   1.00 0.00 ? 7  THR A HA   7  
ATOM   3590  H  HB   . THR A 1 7  ? 14.225  -3.133  0.765   1.00 0.00 ? 7  THR A HB   7  
ATOM   3591  H  HG1  . THR A 1 7  ? 13.554  -2.482  3.469   1.00 0.00 ? 7  THR A HG1  7  
ATOM   3592  H  HG21 . THR A 1 7  ? 13.812  -0.422  2.012   1.00 0.00 ? 7  THR A HG21 7  
ATOM   3593  H  HG22 . THR A 1 7  ? 14.462  -0.794  0.416   1.00 0.00 ? 7  THR A HG22 7  
ATOM   3594  H  HG23 . THR A 1 7  ? 15.401  -1.169  1.860   1.00 0.00 ? 7  THR A HG23 7  
ATOM   3595  N  N    . GLY A 1 8  ? 10.677  -3.334  -0.371  1.00 0.00 ? 8  GLY A N    7  
ATOM   3596  C  CA   . GLY A 1 8  ? 10.163  -4.304  -1.322  1.00 0.00 ? 8  GLY A CA   7  
ATOM   3597  C  C    . GLY A 1 8  ? 9.897   -5.657  -0.710  1.00 0.00 ? 8  GLY A C    7  
ATOM   3598  O  O    . GLY A 1 8  ? 10.001  -6.688  -1.380  1.00 0.00 ? 8  GLY A O    7  
ATOM   3599  H  H    . GLY A 1 8  ? 10.154  -2.518  -0.183  1.00 0.00 ? 8  GLY A H    7  
ATOM   3600  H  HA2  . GLY A 1 8  ? 9.235   -3.928  -1.715  1.00 0.00 ? 8  GLY A HA2  7  
ATOM   3601  H  HA3  . GLY A 1 8  ? 10.870  -4.415  -2.129  1.00 0.00 ? 8  GLY A HA3  7  
ATOM   3602  N  N    . ILE A 1 9  ? 9.500   -5.646  0.542   1.00 0.00 ? 9  ILE A N    7  
ATOM   3603  C  CA   . ILE A 1 9  ? 9.145   -6.875  1.236   1.00 0.00 ? 9  ILE A CA   7  
ATOM   3604  C  C    . ILE A 1 9  ? 7.743   -7.330  0.826   1.00 0.00 ? 9  ILE A C    7  
ATOM   3605  O  O    . ILE A 1 9  ? 6.940   -6.509  0.378   1.00 0.00 ? 9  ILE A O    7  
ATOM   3606  C  CB   . ILE A 1 9  ? 9.219   -6.683  2.770   1.00 0.00 ? 9  ILE A CB   7  
ATOM   3607  C  CG1  . ILE A 1 9  ? 10.453  -5.852  3.137   1.00 0.00 ? 9  ILE A CG1  7  
ATOM   3608  C  CG2  . ILE A 1 9  ? 9.252   -8.025  3.490   1.00 0.00 ? 9  ILE A CG2  7  
ATOM   3609  C  CD1  . ILE A 1 9  ? 10.541  -5.510  4.608   1.00 0.00 ? 9  ILE A CD1  7  
ATOM   3610  H  H    . ILE A 1 9  ? 9.354   -4.781  0.979   1.00 0.00 ? 9  ILE A H    7  
ATOM   3611  H  HA   . ILE A 1 9  ? 9.859   -7.635  0.952   1.00 0.00 ? 9  ILE A HA   7  
ATOM   3612  H  HB   . ILE A 1 9  ? 8.332   -6.154  3.085   1.00 0.00 ? 9  ILE A HB   7  
ATOM   3613  H  HG12 . ILE A 1 9  ? 11.343  -6.406  2.874   1.00 0.00 ? 9  ILE A HG12 7  
ATOM   3614  H  HG13 . ILE A 1 9  ? 10.433  -4.927  2.583   1.00 0.00 ? 9  ILE A HG13 7  
ATOM   3615  H  HG21 . ILE A 1 9  ? 9.643   -8.781  2.826   1.00 0.00 ? 9  ILE A HG21 7  
ATOM   3616  H  HG22 . ILE A 1 9  ? 9.886   -7.949  4.362   1.00 0.00 ? 9  ILE A HG22 7  
ATOM   3617  H  HG23 . ILE A 1 9  ? 8.252   -8.294  3.795   1.00 0.00 ? 9  ILE A HG23 7  
ATOM   3618  H  HD11 . ILE A 1 9  ? 10.390  -4.450  4.739   1.00 0.00 ? 9  ILE A HD11 7  
ATOM   3619  H  HD12 . ILE A 1 9  ? 9.781   -6.052  5.151   1.00 0.00 ? 9  ILE A HD12 7  
ATOM   3620  H  HD13 . ILE A 1 9  ? 11.516  -5.784  4.985   1.00 0.00 ? 9  ILE A HD13 7  
ATOM   3621  N  N    . LYS A 1 10 ? 7.435   -8.611  1.054   1.00 0.00 ? 10 LYS A N    7  
ATOM   3622  C  CA   . LYS A 1 10 ? 6.116   -9.177  0.756   1.00 0.00 ? 10 LYS A CA   7  
ATOM   3623  C  C    . LYS A 1 10 ? 5.787   -9.116  -0.741  1.00 0.00 ? 10 LYS A C    7  
ATOM   3624  O  O    . LYS A 1 10 ? 6.268   -8.247  -1.467  1.00 0.00 ? 10 LYS A O    7  
ATOM   3625  C  CB   . LYS A 1 10 ? 5.025   -8.487  1.578   1.00 0.00 ? 10 LYS A CB   7  
ATOM   3626  C  CG   . LYS A 1 10 ? 4.560   -9.312  2.768   1.00 0.00 ? 10 LYS A CG   7  
ATOM   3627  C  CD   . LYS A 1 10 ? 4.583   -8.506  4.058   1.00 0.00 ? 10 LYS A CD   7  
ATOM   3628  C  CE   . LYS A 1 10 ? 5.679   -8.985  4.997   1.00 0.00 ? 10 LYS A CE   7  
ATOM   3629  N  NZ   . LYS A 1 10 ? 5.608   -8.314  6.321   1.00 0.00 ? 10 LYS A NZ   7  
ATOM   3630  H  H    . LYS A 1 10 ? 8.121   -9.197  1.446   1.00 0.00 ? 10 LYS A H    7  
ATOM   3631  H  HA   . LYS A 1 10 ? 6.146   -10.219 1.043   1.00 0.00 ? 10 LYS A HA   7  
ATOM   3632  H  HB2  . LYS A 1 10 ? 5.403   -7.544  1.944   1.00 0.00 ? 10 LYS A HB2  7  
ATOM   3633  H  HB3  . LYS A 1 10 ? 4.172   -8.303  0.942   1.00 0.00 ? 10 LYS A HB3  7  
ATOM   3634  H  HG2  . LYS A 1 10 ? 3.551   -9.650  2.584   1.00 0.00 ? 10 LYS A HG2  7  
ATOM   3635  H  HG3  . LYS A 1 10 ? 5.213   -10.167 2.876   1.00 0.00 ? 10 LYS A HG3  7  
ATOM   3636  H  HD2  . LYS A 1 10 ? 4.758   -7.467  3.821   1.00 0.00 ? 10 LYS A HD2  7  
ATOM   3637  H  HD3  . LYS A 1 10 ? 3.627   -8.608  4.552   1.00 0.00 ? 10 LYS A HD3  7  
ATOM   3638  H  HE2  . LYS A 1 10 ? 5.573   -10.051 5.139   1.00 0.00 ? 10 LYS A HE2  7  
ATOM   3639  H  HE3  . LYS A 1 10 ? 6.638   -8.775  4.548   1.00 0.00 ? 10 LYS A HE3  7  
ATOM   3640  H  HZ1  . LYS A 1 10 ? 5.917   -8.968  7.074   1.00 0.00 ? 10 LYS A HZ1  7  
ATOM   3641  H  HZ2  . LYS A 1 10 ? 4.630   -8.012  6.522   1.00 0.00 ? 10 LYS A HZ2  7  
ATOM   3642  H  HZ3  . LYS A 1 10 ? 6.228   -7.474  6.333   1.00 0.00 ? 10 LYS A HZ3  7  
ATOM   3643  N  N    . PRO A 1 11 ? 5.035   -10.104 -1.249  1.00 0.00 ? 11 PRO A N    7  
ATOM   3644  C  CA   . PRO A 1 11 ? 4.712   -10.197 -2.679  1.00 0.00 ? 11 PRO A CA   7  
ATOM   3645  C  C    . PRO A 1 11 ? 3.855   -9.030  -3.177  1.00 0.00 ? 11 PRO A C    7  
ATOM   3646  O  O    . PRO A 1 11 ? 3.732   -8.807  -4.384  1.00 0.00 ? 11 PRO A O    7  
ATOM   3647  C  CB   . PRO A 1 11 ? 3.934   -11.516 -2.793  1.00 0.00 ? 11 PRO A CB   7  
ATOM   3648  C  CG   . PRO A 1 11 ? 3.453   -11.799 -1.410  1.00 0.00 ? 11 PRO A CG   7  
ATOM   3649  C  CD   . PRO A 1 11 ? 4.505   -11.251 -0.493  1.00 0.00 ? 11 PRO A CD   7  
ATOM   3650  H  HA   . PRO A 1 11 ? 5.607   -10.258 -3.277  1.00 0.00 ? 11 PRO A HA   7  
ATOM   3651  H  HB2  . PRO A 1 11 ? 3.109   -11.395 -3.480  1.00 0.00 ? 11 PRO A HB2  7  
ATOM   3652  H  HB3  . PRO A 1 11 ? 4.591   -12.296 -3.147  1.00 0.00 ? 11 PRO A HB3  7  
ATOM   3653  H  HG2  . PRO A 1 11 ? 2.514   -11.300 -1.241  1.00 0.00 ? 11 PRO A HG2  7  
ATOM   3654  H  HG3  . PRO A 1 11 ? 3.346   -12.865 -1.269  1.00 0.00 ? 11 PRO A HG3  7  
ATOM   3655  H  HD2  . PRO A 1 11 ? 4.064   -10.932 0.440   1.00 0.00 ? 11 PRO A HD2  7  
ATOM   3656  H  HD3  . PRO A 1 11 ? 5.276   -11.986 -0.316  1.00 0.00 ? 11 PRO A HD3  7  
ATOM   3657  N  N    . PHE A 1 12 ? 3.256   -8.297  -2.248  1.00 0.00 ? 12 PHE A N    7  
ATOM   3658  C  CA   . PHE A 1 12 ? 2.410   -7.171  -2.593  1.00 0.00 ? 12 PHE A CA   7  
ATOM   3659  C  C    . PHE A 1 12 ? 2.780   -5.946  -1.762  1.00 0.00 ? 12 PHE A C    7  
ATOM   3660  O  O    . PHE A 1 12 ? 2.340   -5.795  -0.625  1.00 0.00 ? 12 PHE A O    7  
ATOM   3661  C  CB   . PHE A 1 12 ? 0.937   -7.528  -2.377  1.00 0.00 ? 12 PHE A CB   7  
ATOM   3662  C  CG   . PHE A 1 12 ? 0.477   -8.703  -3.190  1.00 0.00 ? 12 PHE A CG   7  
ATOM   3663  C  CD1  . PHE A 1 12 ? 0.373   -8.612  -4.569  1.00 0.00 ? 12 PHE A CD1  7  
ATOM   3664  C  CD2  . PHE A 1 12 ? 0.142   -9.897  -2.574  1.00 0.00 ? 12 PHE A CD2  7  
ATOM   3665  C  CE1  . PHE A 1 12 ? -0.053  -9.691  -5.317  1.00 0.00 ? 12 PHE A CE1  7  
ATOM   3666  C  CE2  . PHE A 1 12 ? -0.286  -10.978 -3.316  1.00 0.00 ? 12 PHE A CE2  7  
ATOM   3667  C  CZ   . PHE A 1 12 ? -0.386  -10.876 -4.690  1.00 0.00 ? 12 PHE A CZ   7  
ATOM   3668  H  H    . PHE A 1 12 ? 3.394   -8.512  -1.305  1.00 0.00 ? 12 PHE A H    7  
ATOM   3669  H  HA   . PHE A 1 12 ? 2.567   -6.946  -3.636  1.00 0.00 ? 12 PHE A HA   7  
ATOM   3670  H  HB2  . PHE A 1 12 ? 0.782   -7.767  -1.335  1.00 0.00 ? 12 PHE A HB2  7  
ATOM   3671  H  HB3  . PHE A 1 12 ? 0.323   -6.677  -2.642  1.00 0.00 ? 12 PHE A HB3  7  
ATOM   3672  H  HD1  . PHE A 1 12 ? 0.632   -7.684  -5.059  1.00 0.00 ? 12 PHE A HD1  7  
ATOM   3673  H  HD2  . PHE A 1 12 ? 0.218   -9.978  -1.499  1.00 0.00 ? 12 PHE A HD2  7  
ATOM   3674  H  HE1  . PHE A 1 12 ? -0.130  -9.607  -6.391  1.00 0.00 ? 12 PHE A HE1  7  
ATOM   3675  H  HE2  . PHE A 1 12 ? -0.548  -11.902 -2.822  1.00 0.00 ? 12 PHE A HE2  7  
ATOM   3676  H  HZ   . PHE A 1 12 ? -0.722  -11.721 -5.273  1.00 0.00 ? 12 PHE A HZ   7  
ATOM   3677  N  N    . GLN A 1 13 ? 3.619   -5.096  -2.325  1.00 0.00 ? 13 GLN A N    7  
ATOM   3678  C  CA   . GLN A 1 13 ? 4.052   -3.879  -1.656  1.00 0.00 ? 13 GLN A CA   7  
ATOM   3679  C  C    . GLN A 1 13 ? 3.263   -2.686  -2.187  1.00 0.00 ? 13 GLN A C    7  
ATOM   3680  O  O    . GLN A 1 13 ? 2.812   -2.708  -3.333  1.00 0.00 ? 13 GLN A O    7  
ATOM   3681  C  CB   . GLN A 1 13 ? 5.549   -3.661  -1.887  1.00 0.00 ? 13 GLN A CB   7  
ATOM   3682  C  CG   . GLN A 1 13 ? 5.854   -2.706  -3.026  1.00 0.00 ? 13 GLN A CG   7  
ATOM   3683  C  CD   . GLN A 1 13 ? 7.154   -3.013  -3.731  1.00 0.00 ? 13 GLN A CD   7  
ATOM   3684  O  OE1  . GLN A 1 13 ? 7.159   -3.512  -4.859  1.00 0.00 ? 13 GLN A OE1  7  
ATOM   3685  N  NE2  . GLN A 1 13 ? 8.262   -2.706  -3.082  1.00 0.00 ? 13 GLN A NE2  7  
ATOM   3686  H  H    . GLN A 1 13 ? 3.967   -5.296  -3.220  1.00 0.00 ? 13 GLN A H    7  
ATOM   3687  H  HA   . GLN A 1 13 ? 3.869   -3.981  -0.603  1.00 0.00 ? 13 GLN A HA   7  
ATOM   3688  H  HB2  . GLN A 1 13 ? 5.985   -3.261  -0.984  1.00 0.00 ? 13 GLN A HB2  7  
ATOM   3689  H  HB3  . GLN A 1 13 ? 6.010   -4.613  -2.109  1.00 0.00 ? 13 GLN A HB3  7  
ATOM   3690  H  HG2  . GLN A 1 13 ? 5.054   -2.761  -3.747  1.00 0.00 ? 13 GLN A HG2  7  
ATOM   3691  H  HG3  . GLN A 1 13 ? 5.900   -1.709  -2.621  1.00 0.00 ? 13 GLN A HG3  7  
ATOM   3692  H  HE21 . GLN A 1 13 ? 8.184   -2.300  -2.182  1.00 0.00 ? 13 GLN A HE21 7  
ATOM   3693  H  HE22 . GLN A 1 13 ? 9.122   -2.891  -3.518  1.00 0.00 ? 13 GLN A HE22 7  
ATOM   3694  N  N    . CYS A 1 14 ? 3.176   -1.612  -1.405  1.00 0.00 ? 14 CYS A N    7  
ATOM   3695  C  CA   . CYS A 1 14 ? 2.557   -0.392  -1.898  1.00 0.00 ? 14 CYS A CA   7  
ATOM   3696  C  C    . CYS A 1 14 ? 3.479   0.277   -2.916  1.00 0.00 ? 14 CYS A C    7  
ATOM   3697  O  O    . CYS A 1 14 ? 4.645   0.534   -2.626  1.00 0.00 ? 14 CYS A O    7  
ATOM   3698  C  CB   . CYS A 1 14 ? 2.248   0.606   -0.773  1.00 0.00 ? 14 CYS A CB   7  
ATOM   3699  S  SG   . CYS A 1 14 ? 1.619   2.194   -1.426  1.00 0.00 ? 14 CYS A SG   7  
ATOM   3700  H  H    . CYS A 1 14 ? 3.610   -1.617  -0.531  1.00 0.00 ? 14 CYS A H    7  
ATOM   3701  H  HA   . CYS A 1 14 ? 1.633   -0.666  -2.385  1.00 0.00 ? 14 CYS A HA   7  
ATOM   3702  H  HB2  . CYS A 1 14 ? 1.506   0.185   -0.117  1.00 0.00 ? 14 CYS A HB2  7  
ATOM   3703  H  HB3  . CYS A 1 14 ? 3.150   0.808   -0.216  1.00 0.00 ? 14 CYS A HB3  7  
ATOM   3704  N  N    . PRO A 1 15 ? 2.964   0.602   -4.108  1.00 0.00 ? 15 PRO A N    7  
ATOM   3705  C  CA   . PRO A 1 15 ? 3.747   1.278   -5.141  1.00 0.00 ? 15 PRO A CA   7  
ATOM   3706  C  C    . PRO A 1 15 ? 3.876   2.781   -4.882  1.00 0.00 ? 15 PRO A C    7  
ATOM   3707  O  O    . PRO A 1 15 ? 4.424   3.522   -5.700  1.00 0.00 ? 15 PRO A O    7  
ATOM   3708  C  CB   . PRO A 1 15 ? 2.936   1.011   -6.406  1.00 0.00 ? 15 PRO A CB   7  
ATOM   3709  C  CG   . PRO A 1 15 ? 1.526   0.914   -5.934  1.00 0.00 ? 15 PRO A CG   7  
ATOM   3710  C  CD   . PRO A 1 15 ? 1.584   0.330   -4.547  1.00 0.00 ? 15 PRO A CD   7  
ATOM   3711  H  HA   . PRO A 1 15 ? 4.732   0.847   -5.239  1.00 0.00 ? 15 PRO A HA   7  
ATOM   3712  H  HB2  . PRO A 1 15 ? 3.067   1.829   -7.099  1.00 0.00 ? 15 PRO A HB2  7  
ATOM   3713  H  HB3  . PRO A 1 15 ? 3.265   0.090   -6.859  1.00 0.00 ? 15 PRO A HB3  7  
ATOM   3714  H  HG2  . PRO A 1 15 ? 1.079   1.896   -5.908  1.00 0.00 ? 15 PRO A HG2  7  
ATOM   3715  H  HG3  . PRO A 1 15 ? 0.966   0.264   -6.590  1.00 0.00 ? 15 PRO A HG3  7  
ATOM   3716  H  HD2  . PRO A 1 15 ? 0.873   0.821   -3.903  1.00 0.00 ? 15 PRO A HD2  7  
ATOM   3717  H  HD3  . PRO A 1 15 ? 1.394   -0.732  -4.579  1.00 0.00 ? 15 PRO A HD3  7  
ATOM   3718  N  N    . ASP A 1 16 ? 3.346   3.225   -3.752  1.00 0.00 ? 16 ASP A N    7  
ATOM   3719  C  CA   . ASP A 1 16 ? 3.385   4.635   -3.388  1.00 0.00 ? 16 ASP A CA   7  
ATOM   3720  C  C    . ASP A 1 16 ? 4.269   4.853   -2.169  1.00 0.00 ? 16 ASP A C    7  
ATOM   3721  O  O    . ASP A 1 16 ? 5.021   5.825   -2.097  1.00 0.00 ? 16 ASP A O    7  
ATOM   3722  C  CB   . ASP A 1 16 ? 1.971   5.140   -3.093  1.00 0.00 ? 16 ASP A CB   7  
ATOM   3723  C  CG   . ASP A 1 16 ? 1.833   6.639   -3.258  1.00 0.00 ? 16 ASP A CG   7  
ATOM   3724  O  OD1  . ASP A 1 16 ? 2.210   7.384   -2.331  1.00 0.00 ? 16 ASP A OD1  7  
ATOM   3725  O  OD2  . ASP A 1 16 ? 1.313   7.077   -4.306  1.00 0.00 ? 16 ASP A OD2  7  
ATOM   3726  H  H    . ASP A 1 16 ? 2.897   2.586   -3.149  1.00 0.00 ? 16 ASP A H    7  
ATOM   3727  H  HA   . ASP A 1 16 ? 3.792   5.187   -4.222  1.00 0.00 ? 16 ASP A HA   7  
ATOM   3728  H  HB2  . ASP A 1 16 ? 1.276   4.662   -3.767  1.00 0.00 ? 16 ASP A HB2  7  
ATOM   3729  H  HB3  . ASP A 1 16 ? 1.710   4.883   -2.077  1.00 0.00 ? 16 ASP A HB3  7  
ATOM   3730  N  N    . CYS A 1 17 ? 4.143   3.960   -1.198  1.00 0.00 ? 17 CYS A N    7  
ATOM   3731  C  CA   . CYS A 1 17 ? 4.883   4.070   0.052   1.00 0.00 ? 17 CYS A CA   7  
ATOM   3732  C  C    . CYS A 1 17 ? 6.025   3.061   0.123   1.00 0.00 ? 17 CYS A C    7  
ATOM   3733  O  O    . CYS A 1 17 ? 6.971   3.248   0.892   1.00 0.00 ? 17 CYS A O    7  
ATOM   3734  C  CB   . CYS A 1 17 ? 3.952   3.842   1.242   1.00 0.00 ? 17 CYS A CB   7  
ATOM   3735  S  SG   . CYS A 1 17 ? 2.429   4.832   1.212   1.00 0.00 ? 17 CYS A SG   7  
ATOM   3736  H  H    . CYS A 1 17 ? 3.507   3.219   -1.315  1.00 0.00 ? 17 CYS A H    7  
ATOM   3737  H  HA   . CYS A 1 17 ? 5.292   5.064   0.109   1.00 0.00 ? 17 CYS A HA   7  
ATOM   3738  H  HB2  . CYS A 1 17 ? 3.661   2.804   1.267   1.00 0.00 ? 17 CYS A HB2  7  
ATOM   3739  H  HB3  . CYS A 1 17 ? 4.481   4.083   2.154   1.00 0.00 ? 17 CYS A HB3  7  
ATOM   3740  N  N    . ASP A 1 18 ? 5.790   1.908   -0.497  1.00 0.00 ? 18 ASP A N    7  
ATOM   3741  C  CA   . ASP A 1 18 ? 6.652   0.729   -0.362  1.00 0.00 ? 18 ASP A CA   7  
ATOM   3742  C  C    . ASP A 1 18 ? 6.356   0.034   0.954   1.00 0.00 ? 18 ASP A C    7  
ATOM   3743  O  O    . ASP A 1 18 ? 7.255   -0.382  1.686   1.00 0.00 ? 18 ASP A O    7  
ATOM   3744  C  CB   . ASP A 1 18 ? 8.144   1.055   -0.483  1.00 0.00 ? 18 ASP A CB   7  
ATOM   3745  C  CG   . ASP A 1 18 ? 8.900   -0.014  -1.255  1.00 0.00 ? 18 ASP A CG   7  
ATOM   3746  O  OD1  . ASP A 1 18 ? 8.903   -1.185  -0.823  1.00 0.00 ? 18 ASP A OD1  7  
ATOM   3747  O  OD2  . ASP A 1 18 ? 9.489   0.314   -2.310  1.00 0.00 ? 18 ASP A OD2  7  
ATOM   3748  H  H    . ASP A 1 18 ? 4.938   1.801   -0.968  1.00 0.00 ? 18 ASP A H    7  
ATOM   3749  H  HA   . ASP A 1 18 ? 6.385   0.048   -1.159  1.00 0.00 ? 18 ASP A HA   7  
ATOM   3750  H  HB2  . ASP A 1 18 ? 8.262   1.998   -0.998  1.00 0.00 ? 18 ASP A HB2  7  
ATOM   3751  H  HB3  . ASP A 1 18 ? 8.572   1.131   0.505   1.00 0.00 ? 18 ASP A HB3  7  
ATOM   3752  N  N    . ARG A 1 19 ? 5.070   -0.176  1.192   1.00 0.00 ? 19 ARG A N    7  
ATOM   3753  C  CA   . ARG A 1 19 ? 4.621   -0.970  2.322   1.00 0.00 ? 19 ARG A CA   7  
ATOM   3754  C  C    . ARG A 1 19 ? 4.736   -2.438  1.947   1.00 0.00 ? 19 ARG A C    7  
ATOM   3755  O  O    . ARG A 1 19 ? 5.321   -2.761  0.920   1.00 0.00 ? 19 ARG A O    7  
ATOM   3756  C  CB   . ARG A 1 19 ? 3.178   -0.627  2.680   1.00 0.00 ? 19 ARG A CB   7  
ATOM   3757  C  CG   . ARG A 1 19 ? 2.873   0.858   2.623   1.00 0.00 ? 19 ARG A CG   7  
ATOM   3758  C  CD   . ARG A 1 19 ? 2.206   1.340   3.896   1.00 0.00 ? 19 ARG A CD   7  
ATOM   3759  N  NE   . ARG A 1 19 ? 0.922   0.677   4.132   1.00 0.00 ? 19 ARG A NE   7  
ATOM   3760  C  CZ   . ARG A 1 19 ? 0.580   0.122   5.300   1.00 0.00 ? 19 ARG A CZ   7  
ATOM   3761  N  NH1  . ARG A 1 19 ? 1.439   0.115   6.311   1.00 0.00 ? 19 ARG A NH1  7  
ATOM   3762  N  NH2  . ARG A 1 19 ? -0.617  -0.427  5.465   1.00 0.00 ? 19 ARG A NH2  7  
ATOM   3763  H  H    . ARG A 1 19 ? 4.416   0.116   0.529   1.00 0.00 ? 19 ARG A H    7  
ATOM   3764  H  HA   . ARG A 1 19 ? 5.264   -0.765  3.164   1.00 0.00 ? 19 ARG A HA   7  
ATOM   3765  H  HB2  . ARG A 1 19 ? 2.517   -1.135  1.994   1.00 0.00 ? 19 ARG A HB2  7  
ATOM   3766  H  HB3  . ARG A 1 19 ? 2.977   -0.974  3.681   1.00 0.00 ? 19 ARG A HB3  7  
ATOM   3767  H  HG2  . ARG A 1 19 ? 3.797   1.399   2.483   1.00 0.00 ? 19 ARG A HG2  7  
ATOM   3768  H  HG3  . ARG A 1 19 ? 2.214   1.048   1.788   1.00 0.00 ? 19 ARG A HG3  7  
ATOM   3769  H  HD2  . ARG A 1 19 ? 2.862   1.136   4.730   1.00 0.00 ? 19 ARG A HD2  7  
ATOM   3770  H  HD3  . ARG A 1 19 ? 2.044   2.406   3.822   1.00 0.00 ? 19 ARG A HD3  7  
ATOM   3771  H  HE   . ARG A 1 19 ? 0.276   0.661   3.383   1.00 0.00 ? 19 ARG A HE   7  
ATOM   3772  H  HH11 . ARG A 1 19 ? 2.352   0.529   6.209   1.00 0.00 ? 19 ARG A HH11 7  
ATOM   3773  H  HH12 . ARG A 1 19 ? 1.180   -0.308  7.188   1.00 0.00 ? 19 ARG A HH12 7  
ATOM   3774  H  HH21 . ARG A 1 19 ? -1.282  -0.432  4.721   1.00 0.00 ? 19 ARG A HH21 7  
ATOM   3775  H  HH22 . ARG A 1 19 ? -0.858  -0.852  6.352   1.00 0.00 ? 19 ARG A HH22 7  
ATOM   3776  N  N    . SER A 1 20 ? 4.160   -3.323  2.732   1.00 0.00 ? 20 SER A N    7  
ATOM   3777  C  CA   . SER A 1 20 ? 4.218   -4.734  2.393   1.00 0.00 ? 20 SER A CA   7  
ATOM   3778  C  C    . SER A 1 20 ? 3.037   -5.503  2.965   1.00 0.00 ? 20 SER A C    7  
ATOM   3779  O  O    . SER A 1 20 ? 2.757   -5.448  4.162   1.00 0.00 ? 20 SER A O    7  
ATOM   3780  C  CB   . SER A 1 20 ? 5.534   -5.339  2.871   1.00 0.00 ? 20 SER A CB   7  
ATOM   3781  O  OG   . SER A 1 20 ? 6.192   -4.484  3.794   1.00 0.00 ? 20 SER A OG   7  
ATOM   3782  H  H    . SER A 1 20 ? 3.682   -3.029  3.542   1.00 0.00 ? 20 SER A H    7  
ATOM   3783  H  HA   . SER A 1 20 ? 4.178   -4.806  1.318   1.00 0.00 ? 20 SER A HA   7  
ATOM   3784  H  HB2  . SER A 1 20 ? 5.336   -6.287  3.346   1.00 0.00 ? 20 SER A HB2  7  
ATOM   3785  H  HB3  . SER A 1 20 ? 6.184   -5.492  2.019   1.00 0.00 ? 20 SER A HB3  7  
ATOM   3786  H  HG   . SER A 1 20 ? 6.716   -3.831  3.305   1.00 0.00 ? 20 SER A HG   7  
ATOM   3787  N  N    . PHE A 1 21 ? 2.352   -6.216  2.088   1.00 0.00 ? 21 PHE A N    7  
ATOM   3788  C  CA   . PHE A 1 21 ? 1.195   -7.013  2.461   1.00 0.00 ? 21 PHE A CA   7  
ATOM   3789  C  C    . PHE A 1 21 ? 1.290   -8.390  1.824   1.00 0.00 ? 21 PHE A C    7  
ATOM   3790  O  O    . PHE A 1 21 ? 1.735   -8.523  0.683   1.00 0.00 ? 21 PHE A O    7  
ATOM   3791  C  CB   . PHE A 1 21 ? -0.106  -6.341  2.006   1.00 0.00 ? 21 PHE A CB   7  
ATOM   3792  C  CG   . PHE A 1 21 ? -0.176  -4.867  2.288   1.00 0.00 ? 21 PHE A CG   7  
ATOM   3793  C  CD1  . PHE A 1 21 ? 0.429   -3.954  1.440   1.00 0.00 ? 21 PHE A CD1  7  
ATOM   3794  C  CD2  . PHE A 1 21 ? -0.850  -4.397  3.402   1.00 0.00 ? 21 PHE A CD2  7  
ATOM   3795  C  CE1  . PHE A 1 21 ? 0.365   -2.602  1.701   1.00 0.00 ? 21 PHE A CE1  7  
ATOM   3796  C  CE2  . PHE A 1 21 ? -0.917  -3.044  3.666   1.00 0.00 ? 21 PHE A CE2  7  
ATOM   3797  C  CZ   . PHE A 1 21 ? -0.308  -2.148  2.813   1.00 0.00 ? 21 PHE A CZ   7  
ATOM   3798  H  H    . PHE A 1 21 ? 2.635   -6.204  1.144   1.00 0.00 ? 21 PHE A H    7  
ATOM   3799  H  HA   . PHE A 1 21 ? 1.188   -7.114  3.535   1.00 0.00 ? 21 PHE A HA   7  
ATOM   3800  H  HB2  . PHE A 1 21 ? -0.215  -6.476  0.941   1.00 0.00 ? 21 PHE A HB2  7  
ATOM   3801  H  HB3  . PHE A 1 21 ? -0.938  -6.815  2.507   1.00 0.00 ? 21 PHE A HB3  7  
ATOM   3802  H  HD1  . PHE A 1 21 ? 0.959   -4.310  0.569   1.00 0.00 ? 21 PHE A HD1  7  
ATOM   3803  H  HD2  . PHE A 1 21 ? -1.328  -5.099  4.070   1.00 0.00 ? 21 PHE A HD2  7  
ATOM   3804  H  HE1  . PHE A 1 21 ? 0.842   -1.900  1.033   1.00 0.00 ? 21 PHE A HE1  7  
ATOM   3805  H  HE2  . PHE A 1 21 ? -1.447  -2.690  4.538   1.00 0.00 ? 21 PHE A HE2  7  
ATOM   3806  H  HZ   . PHE A 1 21 ? -0.356  -1.087  3.018   1.00 0.00 ? 21 PHE A HZ   7  
ATOM   3807  N  N    . SER A 1 22 ? 0.863   -9.408  2.549   1.00 0.00 ? 22 SER A N    7  
ATOM   3808  C  CA   . SER A 1 22 ? 0.866   -10.761 2.024   1.00 0.00 ? 22 SER A CA   7  
ATOM   3809  C  C    . SER A 1 22 ? -0.297  -10.949 1.047   1.00 0.00 ? 22 SER A C    7  
ATOM   3810  O  O    . SER A 1 22 ? -0.232  -11.768 0.129   1.00 0.00 ? 22 SER A O    7  
ATOM   3811  C  CB   . SER A 1 22 ? 0.769   -11.765 3.171   1.00 0.00 ? 22 SER A CB   7  
ATOM   3812  O  OG   . SER A 1 22 ? 0.921   -11.117 4.427   1.00 0.00 ? 22 SER A OG   7  
ATOM   3813  H  H    . SER A 1 22 ? 0.534   -9.248  3.460   1.00 0.00 ? 22 SER A H    7  
ATOM   3814  H  HA   . SER A 1 22 ? 1.797   -10.914 1.496   1.00 0.00 ? 22 SER A HA   7  
ATOM   3815  H  HB2  . SER A 1 22 ? -0.195  -12.251 3.142   1.00 0.00 ? 22 SER A HB2  7  
ATOM   3816  H  HB3  . SER A 1 22 ? 1.549   -12.502 3.064   1.00 0.00 ? 22 SER A HB3  7  
ATOM   3817  H  HG   . SER A 1 22 ? 0.091   -11.190 4.924   1.00 0.00 ? 22 SER A HG   7  
ATOM   3818  N  N    . ARG A 1 23 ? -1.356  -10.173 1.253   1.00 0.00 ? 23 ARG A N    7  
ATOM   3819  C  CA   . ARG A 1 23 ? -2.533  -10.227 0.400   1.00 0.00 ? 23 ARG A CA   7  
ATOM   3820  C  C    . ARG A 1 23 ? -2.645  -8.970  -0.451  1.00 0.00 ? 23 ARG A C    7  
ATOM   3821  O  O    . ARG A 1 23 ? -2.538  -7.853  0.060   1.00 0.00 ? 23 ARG A O    7  
ATOM   3822  C  CB   . ARG A 1 23 ? -3.796  -10.385 1.249   1.00 0.00 ? 23 ARG A CB   7  
ATOM   3823  C  CG   . ARG A 1 23 ? -3.705  -11.504 2.272   1.00 0.00 ? 23 ARG A CG   7  
ATOM   3824  C  CD   . ARG A 1 23 ? -4.753  -11.352 3.363   1.00 0.00 ? 23 ARG A CD   7  
ATOM   3825  N  NE   . ARG A 1 23 ? -6.078  -11.031 2.827   1.00 0.00 ? 23 ARG A NE   7  
ATOM   3826  C  CZ   . ARG A 1 23 ? -7.051  -11.923 2.645   1.00 0.00 ? 23 ARG A CZ   7  
ATOM   3827  N  NH1  . ARG A 1 23 ? -6.840  -13.213 2.891   1.00 0.00 ? 23 ARG A NH1  7  
ATOM   3828  N  NH2  . ARG A 1 23 ? -8.229  -11.515 2.197   1.00 0.00 ? 23 ARG A NH2  7  
ATOM   3829  H  H    . ARG A 1 23 ? -1.345  -9.543  2.007   1.00 0.00 ? 23 ARG A H    7  
ATOM   3830  H  HA   . ARG A 1 23 ? -2.439  -11.080 -0.254  1.00 0.00 ? 23 ARG A HA   7  
ATOM   3831  H  HB2  . ARG A 1 23 ? -3.980  -9.462  1.774   1.00 0.00 ? 23 ARG A HB2  7  
ATOM   3832  H  HB3  . ARG A 1 23 ? -4.631  -10.592 0.596   1.00 0.00 ? 23 ARG A HB3  7  
ATOM   3833  H  HG2  . ARG A 1 23 ? -3.853  -12.448 1.771   1.00 0.00 ? 23 ARG A HG2  7  
ATOM   3834  H  HG3  . ARG A 1 23 ? -2.723  -11.483 2.723   1.00 0.00 ? 23 ARG A HG3  7  
ATOM   3835  H  HD2  . ARG A 1 23 ? -4.816  -12.279 3.915   1.00 0.00 ? 23 ARG A HD2  7  
ATOM   3836  H  HD3  . ARG A 1 23 ? -4.445  -10.560 4.031   1.00 0.00 ? 23 ARG A HD3  7  
ATOM   3837  H  HE   . ARG A 1 23 ? -6.262  -10.086 2.609   1.00 0.00 ? 23 ARG A HE   7  
ATOM   3838  H  HH11 . ARG A 1 23 ? -5.941  -13.526 3.215   1.00 0.00 ? 23 ARG A HH11 7  
ATOM   3839  H  HH12 . ARG A 1 23 ? -7.582  -13.884 2.761   1.00 0.00 ? 23 ARG A HH12 7  
ATOM   3840  H  HH21 . ARG A 1 23 ? -8.380  -10.539 1.998   1.00 0.00 ? 23 ARG A HH21 7  
ATOM   3841  H  HH22 . ARG A 1 23 ? -8.981  -12.176 2.058   1.00 0.00 ? 23 ARG A HH22 7  
ATOM   3842  N  N    . SER A 1 24 ? -2.984  -9.160  -1.719  1.00 0.00 ? 24 SER A N    7  
ATOM   3843  C  CA   . SER A 1 24 ? -3.234  -8.054  -2.632  1.00 0.00 ? 24 SER A CA   7  
ATOM   3844  C  C    . SER A 1 24 ? -4.464  -7.276  -2.177  1.00 0.00 ? 24 SER A C    7  
ATOM   3845  O  O    . SER A 1 24 ? -4.576  -6.068  -2.399  1.00 0.00 ? 24 SER A O    7  
ATOM   3846  C  CB   . SER A 1 24 ? -3.444  -8.585  -4.051  1.00 0.00 ? 24 SER A CB   7  
ATOM   3847  O  OG   . SER A 1 24 ? -3.104  -7.616  -5.026  1.00 0.00 ? 24 SER A OG   7  
ATOM   3848  H  H    . SER A 1 24 ? -3.157  -10.078 -2.028  1.00 0.00 ? 24 SER A H    7  
ATOM   3849  H  HA   . SER A 1 24 ? -2.372  -7.400  -2.614  1.00 0.00 ? 24 SER A HA   7  
ATOM   3850  H  HB2  . SER A 1 24 ? -2.823  -9.456  -4.200  1.00 0.00 ? 24 SER A HB2  7  
ATOM   3851  H  HB3  . SER A 1 24 ? -4.481  -8.858  -4.180  1.00 0.00 ? 24 SER A HB3  7  
ATOM   3852  H  HG   . SER A 1 24 ? -3.595  -7.800  -5.841  1.00 0.00 ? 24 SER A HG   7  
ATOM   3853  N  N    . ASP A 1 25 ? -5.361  -7.983  -1.503  1.00 0.00 ? 25 ASP A N    7  
ATOM   3854  C  CA   . ASP A 1 25 ? -6.573  -7.387  -0.965  1.00 0.00 ? 25 ASP A CA   7  
ATOM   3855  C  C    . ASP A 1 25 ? -6.242  -6.362  0.118   1.00 0.00 ? 25 ASP A C    7  
ATOM   3856  O  O    . ASP A 1 25 ? -6.816  -5.275  0.150   1.00 0.00 ? 25 ASP A O    7  
ATOM   3857  C  CB   . ASP A 1 25 ? -7.479  -8.493  -0.421  1.00 0.00 ? 25 ASP A CB   7  
ATOM   3858  C  CG   . ASP A 1 25 ? -8.094  -8.177  0.930   1.00 0.00 ? 25 ASP A CG   7  
ATOM   3859  O  OD1  . ASP A 1 25 ? -9.060  -7.389  0.981   1.00 0.00 ? 25 ASP A OD1  7  
ATOM   3860  O  OD2  . ASP A 1 25 ? -7.620  -8.737  1.945   1.00 0.00 ? 25 ASP A OD2  7  
ATOM   3861  H  H    . ASP A 1 25 ? -5.201  -8.942  -1.361  1.00 0.00 ? 25 ASP A H    7  
ATOM   3862  H  HA   . ASP A 1 25 ? -7.078  -6.889  -1.773  1.00 0.00 ? 25 ASP A HA   7  
ATOM   3863  H  HB2  . ASP A 1 25 ? -8.275  -8.664  -1.122  1.00 0.00 ? 25 ASP A HB2  7  
ATOM   3864  H  HB3  . ASP A 1 25 ? -6.898  -9.394  -0.326  1.00 0.00 ? 25 ASP A HB3  7  
ATOM   3865  N  N    . HIS A 1 26 ? -5.255  -6.683  0.951   1.00 0.00 ? 26 HIS A N    7  
ATOM   3866  C  CA   . HIS A 1 26 ? -4.819  -5.774  2.005   1.00 0.00 ? 26 HIS A CA   7  
ATOM   3867  C  C    . HIS A 1 26 ? -4.112  -4.565  1.412   1.00 0.00 ? 26 HIS A C    7  
ATOM   3868  O  O    . HIS A 1 26 ? -4.271  -3.444  1.893   1.00 0.00 ? 26 HIS A O    7  
ATOM   3869  C  CB   . HIS A 1 26 ? -3.898  -6.494  2.989   1.00 0.00 ? 26 HIS A CB   7  
ATOM   3870  C  CG   . HIS A 1 26 ? -4.611  -7.035  4.189   1.00 0.00 ? 26 HIS A CG   7  
ATOM   3871  N  ND1  . HIS A 1 26 ? -4.079  -7.013  5.457   1.00 0.00 ? 26 HIS A ND1  7  
ATOM   3872  C  CD2  . HIS A 1 26 ? -5.820  -7.634  4.304   1.00 0.00 ? 26 HIS A CD2  7  
ATOM   3873  C  CE1  . HIS A 1 26 ? -4.926  -7.577  6.297   1.00 0.00 ? 26 HIS A CE1  7  
ATOM   3874  N  NE2  . HIS A 1 26 ? -5.992  -7.965  5.623   1.00 0.00 ? 26 HIS A NE2  7  
ATOM   3875  H  H    . HIS A 1 26 ? -4.787  -7.534  0.828   1.00 0.00 ? 26 HIS A H    7  
ATOM   3876  H  HA   . HIS A 1 26 ? -5.700  -5.436  2.531   1.00 0.00 ? 26 HIS A HA   7  
ATOM   3877  H  HB2  . HIS A 1 26 ? -3.423  -7.323  2.483   1.00 0.00 ? 26 HIS A HB2  7  
ATOM   3878  H  HB3  . HIS A 1 26 ? -3.139  -5.806  3.331   1.00 0.00 ? 26 HIS A HB3  7  
ATOM   3879  H  HD1  . HIS A 1 26 ? -3.206  -6.621  5.712   1.00 0.00 ? 26 HIS A HD1  7  
ATOM   3880  H  HD2  . HIS A 1 26 ? -6.522  -7.815  3.500   1.00 0.00 ? 26 HIS A HD2  7  
ATOM   3881  H  HE1  . HIS A 1 26 ? -4.773  -7.698  7.360   1.00 0.00 ? 26 HIS A HE1  7  
ATOM   3882  H  HE2  . HIS A 1 26 ? -6.655  -8.615  5.956   1.00 0.00 ? 26 HIS A HE2  7  
ATOM   3883  N  N    . LEU A 1 27 ? -3.403  -4.791  0.308   1.00 0.00 ? 27 LEU A N    7  
ATOM   3884  C  CA   . LEU A 1 27 ? -2.761  -3.711  -0.433  1.00 0.00 ? 27 LEU A CA   7  
ATOM   3885  C  C    . LEU A 1 27 ? -3.800  -2.659  -0.807  1.00 0.00 ? 27 LEU A C    7  
ATOM   3886  O  O    . LEU A 1 27 ? -3.678  -1.484  -0.452  1.00 0.00 ? 27 LEU A O    7  
ATOM   3887  C  CB   . LEU A 1 27 ? -2.116  -4.252  -1.714  1.00 0.00 ? 27 LEU A CB   7  
ATOM   3888  C  CG   . LEU A 1 27 ? -1.168  -3.297  -2.451  1.00 0.00 ? 27 LEU A CG   7  
ATOM   3889  C  CD1  . LEU A 1 27 ? -0.673  -2.179  -1.546  1.00 0.00 ? 27 LEU A CD1  7  
ATOM   3890  C  CD2  . LEU A 1 27 ? -0.005  -4.053  -3.058  1.00 0.00 ? 27 LEU A CD2  7  
ATOM   3891  H  H    . LEU A 1 27 ? -3.372  -5.700  -0.056  1.00 0.00 ? 27 LEU A H    7  
ATOM   3892  H  HA   . LEU A 1 27 ? -2.004  -3.266  0.195   1.00 0.00 ? 27 LEU A HA   7  
ATOM   3893  H  HB2  . LEU A 1 27 ? -1.563  -5.145  -1.460  1.00 0.00 ? 27 LEU A HB2  7  
ATOM   3894  H  HB3  . LEU A 1 27 ? -2.907  -4.527  -2.396  1.00 0.00 ? 27 LEU A HB3  7  
ATOM   3895  H  HG   . LEU A 1 27 ? -1.716  -2.836  -3.259  1.00 0.00 ? 27 LEU A HG   7  
ATOM   3896  H  HD11 . LEU A 1 27 ? 0.258   -2.477  -1.084  1.00 0.00 ? 27 LEU A HD11 7  
ATOM   3897  H  HD12 . LEU A 1 27 ? -0.515  -1.286  -2.133  1.00 0.00 ? 27 LEU A HD12 7  
ATOM   3898  H  HD13 . LEU A 1 27 ? -1.409  -1.981  -0.780  1.00 0.00 ? 27 LEU A HD13 7  
ATOM   3899  H  HD21 . LEU A 1 27 ? 0.492   -4.628  -2.292  1.00 0.00 ? 27 LEU A HD21 7  
ATOM   3900  H  HD22 . LEU A 1 27 ? -0.369  -4.717  -3.829  1.00 0.00 ? 27 LEU A HD22 7  
ATOM   3901  H  HD23 . LEU A 1 27 ? 0.693   -3.350  -3.491  1.00 0.00 ? 27 LEU A HD23 7  
ATOM   3902  N  N    . ALA A 1 28 ? -4.816  -3.109  -1.538  1.00 0.00 ? 28 ALA A N    7  
ATOM   3903  C  CA   . ALA A 1 28 ? -5.891  -2.246  -2.012  1.00 0.00 ? 28 ALA A CA   7  
ATOM   3904  C  C    . ALA A 1 28 ? -6.559  -1.492  -0.865  1.00 0.00 ? 28 ALA A C    7  
ATOM   3905  O  O    . ALA A 1 28 ? -6.881  -0.312  -1.002  1.00 0.00 ? 28 ALA A O    7  
ATOM   3906  C  CB   . ALA A 1 28 ? -6.922  -3.066  -2.774  1.00 0.00 ? 28 ALA A CB   7  
ATOM   3907  H  H    . ALA A 1 28 ? -4.831  -4.059  -1.785  1.00 0.00 ? 28 ALA A H    7  
ATOM   3908  H  HA   . ALA A 1 28 ? -5.459  -1.527  -2.697  1.00 0.00 ? 28 ALA A HA   7  
ATOM   3909  H  HB1  . ALA A 1 28 ? -7.501  -2.413  -3.411  1.00 0.00 ? 28 ALA A HB1  7  
ATOM   3910  H  HB2  . ALA A 1 28 ? -6.420  -3.806  -3.379  1.00 0.00 ? 28 ALA A HB2  7  
ATOM   3911  H  HB3  . ALA A 1 28 ? -7.579  -3.559  -2.073  1.00 0.00 ? 28 ALA A HB3  7  
ATOM   3912  N  N    . LEU A 1 29 ? -6.742  -2.172  0.268   1.00 0.00 ? 29 LEU A N    7  
ATOM   3913  C  CA   . LEU A 1 29 ? -7.362  -1.562  1.443   1.00 0.00 ? 29 LEU A CA   7  
ATOM   3914  C  C    . LEU A 1 29 ? -6.589  -0.322  1.885   1.00 0.00 ? 29 LEU A C    7  
ATOM   3915  O  O    . LEU A 1 29 ? -7.165  0.751   2.057   1.00 0.00 ? 29 LEU A O    7  
ATOM   3916  C  CB   . LEU A 1 29 ? -7.438  -2.563  2.598   1.00 0.00 ? 29 LEU A CB   7  
ATOM   3917  C  CG   . LEU A 1 29 ? -8.363  -3.760  2.367   1.00 0.00 ? 29 LEU A CG   7  
ATOM   3918  C  CD1  . LEU A 1 29 ? -8.248  -4.746  3.517   1.00 0.00 ? 29 LEU A CD1  7  
ATOM   3919  C  CD2  . LEU A 1 29 ? -9.804  -3.299  2.197   1.00 0.00 ? 29 LEU A CD2  7  
ATOM   3920  H  H    . LEU A 1 29 ? -6.451  -3.110  0.314   1.00 0.00 ? 29 LEU A H    7  
ATOM   3921  H  HA   . LEU A 1 29 ? -8.363  -1.267  1.175   1.00 0.00 ? 29 LEU A HA   7  
ATOM   3922  H  HB2  . LEU A 1 29 ? -6.442  -2.937  2.790   1.00 0.00 ? 29 LEU A HB2  7  
ATOM   3923  H  HB3  . LEU A 1 29 ? -7.782  -2.038  3.473   1.00 0.00 ? 29 LEU A HB3  7  
ATOM   3924  H  HG   . LEU A 1 29 ? -8.063  -4.268  1.462   1.00 0.00 ? 29 LEU A HG   7  
ATOM   3925  H  HD11 . LEU A 1 29 ? -7.388  -5.380  3.362   1.00 0.00 ? 29 LEU A HD11 7  
ATOM   3926  H  HD12 . LEU A 1 29 ? -8.135  -4.206  4.446   1.00 0.00 ? 29 LEU A HD12 7  
ATOM   3927  H  HD13 . LEU A 1 29 ? -9.141  -5.353  3.561   1.00 0.00 ? 29 LEU A HD13 7  
ATOM   3928  H  HD21 . LEU A 1 29 ? -10.452 -4.161  2.126   1.00 0.00 ? 29 LEU A HD21 7  
ATOM   3929  H  HD22 . LEU A 1 29 ? -10.095 -2.700  3.048   1.00 0.00 ? 29 LEU A HD22 7  
ATOM   3930  H  HD23 . LEU A 1 29 ? -9.890  -2.710  1.297   1.00 0.00 ? 29 LEU A HD23 7  
ATOM   3931  N  N    . HIS A 1 30 ? -5.273  -0.460  2.005   1.00 0.00 ? 30 HIS A N    7  
ATOM   3932  C  CA   . HIS A 1 30 ? -4.418  0.667   2.371   1.00 0.00 ? 30 HIS A CA   7  
ATOM   3933  C  C    . HIS A 1 30 ? -4.401  1.702   1.250   1.00 0.00 ? 30 HIS A C    7  
ATOM   3934  O  O    . HIS A 1 30 ? -4.308  2.907   1.491   1.00 0.00 ? 30 HIS A O    7  
ATOM   3935  C  CB   . HIS A 1 30 ? -2.986  0.184   2.670   1.00 0.00 ? 30 HIS A CB   7  
ATOM   3936  C  CG   . HIS A 1 30 ? -1.920  1.225   2.444   1.00 0.00 ? 30 HIS A CG   7  
ATOM   3937  N  ND1  . HIS A 1 30 ? -1.715  2.301   3.276   1.00 0.00 ? 30 HIS A ND1  7  
ATOM   3938  C  CD2  . HIS A 1 30 ? -1.026  1.365   1.428   1.00 0.00 ? 30 HIS A CD2  7  
ATOM   3939  C  CE1  . HIS A 1 30 ? -0.732  3.045   2.751   1.00 0.00 ? 30 HIS A CE1  7  
ATOM   3940  N  NE2  . HIS A 1 30 ? -0.275  2.524   1.625   1.00 0.00 ? 30 HIS A NE2  7  
ATOM   3941  H  H    . HIS A 1 30 ? -4.864  -1.334  1.811   1.00 0.00 ? 30 HIS A H    7  
ATOM   3942  H  HA   . HIS A 1 30 ? -4.830  1.121   3.258   1.00 0.00 ? 30 HIS A HA   7  
ATOM   3943  H  HB2  . HIS A 1 30 ? -2.928  -0.123  3.703   1.00 0.00 ? 30 HIS A HB2  7  
ATOM   3944  H  HB3  . HIS A 1 30 ? -2.762  -0.662  2.036   1.00 0.00 ? 30 HIS A HB3  7  
ATOM   3945  H  HD1  . HIS A 1 30 ? -2.221  2.509   4.101   1.00 0.00 ? 30 HIS A HD1  7  
ATOM   3946  H  HD2  . HIS A 1 30 ? -0.904  0.689   0.593   1.00 0.00 ? 30 HIS A HD2  7  
ATOM   3947  H  HE1  . HIS A 1 30 ? -0.358  3.958   3.194   1.00 0.00 ? 30 HIS A HE1  7  
ATOM   3948  N  N    . ARG A 1 31 ? -4.428  1.213   0.020   1.00 0.00 ? 31 ARG A N    7  
ATOM   3949  C  CA   . ARG A 1 31 ? -4.306  2.069   -1.145  1.00 0.00 ? 31 ARG A CA   7  
ATOM   3950  C  C    . ARG A 1 31 ? -5.579  2.878   -1.392  1.00 0.00 ? 31 ARG A C    7  
ATOM   3951  O  O    . ARG A 1 31 ? -5.642  3.674   -2.330  1.00 0.00 ? 31 ARG A O    7  
ATOM   3952  C  CB   . ARG A 1 31 ? -3.967  1.236   -2.372  1.00 0.00 ? 31 ARG A CB   7  
ATOM   3953  C  CG   . ARG A 1 31 ? -2.524  0.761   -2.389  1.00 0.00 ? 31 ARG A CG   7  
ATOM   3954  C  CD   . ARG A 1 31 ? -1.988  0.643   -3.806  1.00 0.00 ? 31 ARG A CD   7  
ATOM   3955  N  NE   . ARG A 1 31 ? -1.688  1.951   -4.388  1.00 0.00 ? 31 ARG A NE   7  
ATOM   3956  C  CZ   . ARG A 1 31 ? -2.516  2.619   -5.196  1.00 0.00 ? 31 ARG A CZ   7  
ATOM   3957  N  NH1  . ARG A 1 31 ? -3.686  2.091   -5.532  1.00 0.00 ? 31 ARG A NH1  7  
ATOM   3958  N  NH2  . ARG A 1 31 ? -2.165  3.803   -5.684  1.00 0.00 ? 31 ARG A NH2  7  
ATOM   3959  H  H    . ARG A 1 31 ? -4.483  0.239   -0.105  1.00 0.00 ? 31 ARG A H    7  
ATOM   3960  H  HA   . ARG A 1 31 ? -3.485  2.751   -0.957  1.00 0.00 ? 31 ARG A HA   7  
ATOM   3961  H  HB2  . ARG A 1 31 ? -4.616  0.373   -2.402  1.00 0.00 ? 31 ARG A HB2  7  
ATOM   3962  H  HB3  . ARG A 1 31 ? -4.136  1.837   -3.252  1.00 0.00 ? 31 ARG A HB3  7  
ATOM   3963  H  HG2  . ARG A 1 31 ? -1.920  1.469   -1.845  1.00 0.00 ? 31 ARG A HG2  7  
ATOM   3964  H  HG3  . ARG A 1 31 ? -2.467  -0.205  -1.908  1.00 0.00 ? 31 ARG A HG3  7  
ATOM   3965  H  HD2  . ARG A 1 31 ? -1.080  0.056   -3.784  1.00 0.00 ? 31 ARG A HD2  7  
ATOM   3966  H  HD3  . ARG A 1 31 ? -2.727  0.146   -4.417  1.00 0.00 ? 31 ARG A HD3  7  
ATOM   3967  H  HE   . ARG A 1 31 ? -0.819  2.350   -4.163  1.00 0.00 ? 31 ARG A HE   7  
ATOM   3968  H  HH11 . ARG A 1 31 ? -3.953  1.184   -5.188  1.00 0.00 ? 31 ARG A HH11 7  
ATOM   3969  H  HH12 . ARG A 1 31 ? -4.321  2.604   -6.123  1.00 0.00 ? 31 ARG A HH12 7  
ATOM   3970  H  HH21 . ARG A 1 31 ? -1.266  4.207   -5.457  1.00 0.00 ? 31 ARG A HH21 7  
ATOM   3971  H  HH22 . ARG A 1 31 ? -2.799  4.313   -6.281  1.00 0.00 ? 31 ARG A HH22 7  
ATOM   3972  N  N    . LYS A 1 32 ? -6.564  2.726   -0.513  1.00 0.00 ? 32 LYS A N    7  
ATOM   3973  C  CA   . LYS A 1 32 ? -7.792  3.507   -0.598  1.00 0.00 ? 32 LYS A CA   7  
ATOM   3974  C  C    . LYS A 1 32 ? -7.490  4.980   -0.352  1.00 0.00 ? 32 LYS A C    7  
ATOM   3975  O  O    . LYS A 1 32 ? -8.133  5.867   -0.915  1.00 0.00 ? 32 LYS A O    7  
ATOM   3976  C  CB   . LYS A 1 32 ? -8.817  3.009   0.421   1.00 0.00 ? 32 LYS A CB   7  
ATOM   3977  C  CG   . LYS A 1 32 ? -10.029 2.350   -0.211  1.00 0.00 ? 32 LYS A CG   7  
ATOM   3978  C  CD   . LYS A 1 32 ? -9.713  0.939   -0.673  1.00 0.00 ? 32 LYS A CD   7  
ATOM   3979  C  CE   . LYS A 1 32 ? -10.468 0.592   -1.944  1.00 0.00 ? 32 LYS A CE   7  
ATOM   3980  N  NZ   . LYS A 1 32 ? -11.659 -0.254  -1.667  1.00 0.00 ? 32 LYS A NZ   7  
ATOM   3981  H  H    . LYS A 1 32 ? -6.445  2.098   0.233   1.00 0.00 ? 32 LYS A H    7  
ATOM   3982  H  HA   . LYS A 1 32 ? -8.198  3.392   -1.591  1.00 0.00 ? 32 LYS A HA   7  
ATOM   3983  H  HB2  . LYS A 1 32 ? -8.341  2.290   1.070   1.00 0.00 ? 32 LYS A HB2  7  
ATOM   3984  H  HB3  . LYS A 1 32 ? -9.156  3.846   1.012   1.00 0.00 ? 32 LYS A HB3  7  
ATOM   3985  H  HG2  . LYS A 1 32 ? -10.825 2.312   0.517   1.00 0.00 ? 32 LYS A HG2  7  
ATOM   3986  H  HG3  . LYS A 1 32 ? -10.342 2.938   -1.062  1.00 0.00 ? 32 LYS A HG3  7  
ATOM   3987  H  HD2  . LYS A 1 32 ? -8.652  0.860   -0.862  1.00 0.00 ? 32 LYS A HD2  7  
ATOM   3988  H  HD3  . LYS A 1 32 ? -9.996  0.244   0.105   1.00 0.00 ? 32 LYS A HD3  7  
ATOM   3989  H  HE2  . LYS A 1 32 ? -10.791 1.508   -2.418  1.00 0.00 ? 32 LYS A HE2  7  
ATOM   3990  H  HE3  . LYS A 1 32 ? -9.803  0.059   -2.608  1.00 0.00 ? 32 LYS A HE3  7  
ATOM   3991  H  HZ1  . LYS A 1 32 ? -12.236 -0.352  -2.532  1.00 0.00 ? 32 LYS A HZ1  7  
ATOM   3992  H  HZ2  . LYS A 1 32 ? -12.241 0.180   -0.919  1.00 0.00 ? 32 LYS A HZ2  7  
ATOM   3993  H  HZ3  . LYS A 1 32 ? -11.359 -1.203  -1.354  1.00 0.00 ? 32 LYS A HZ3  7  
ATOM   3994  N  N    . ARG A 1 33 ? -6.453  5.232   0.436   1.00 0.00 ? 33 ARG A N    7  
ATOM   3995  C  CA   . ARG A 1 33 ? -6.020  6.594   0.718   1.00 0.00 ? 33 ARG A CA   7  
ATOM   3996  C  C    . ARG A 1 33 ? -5.203  7.148   -0.443  1.00 0.00 ? 33 ARG A C    7  
ATOM   3997  O  O    . ARG A 1 33 ? -4.833  8.321   -0.453  1.00 0.00 ? 33 ARG A O    7  
ATOM   3998  C  CB   . ARG A 1 33 ? -5.198  6.639   2.009   1.00 0.00 ? 33 ARG A CB   7  
ATOM   3999  C  CG   . ARG A 1 33 ? -5.966  6.164   3.231   1.00 0.00 ? 33 ARG A CG   7  
ATOM   4000  C  CD   . ARG A 1 33 ? -5.699  7.047   4.439   1.00 0.00 ? 33 ARG A CD   7  
ATOM   4001  N  NE   . ARG A 1 33 ? -6.911  7.719   4.912   1.00 0.00 ? 33 ARG A NE   7  
ATOM   4002  C  CZ   . ARG A 1 33 ? -7.727  7.221   5.848   1.00 0.00 ? 33 ARG A CZ   7  
ATOM   4003  N  NH1  . ARG A 1 33 ? -7.480  6.036   6.392   1.00 0.00 ? 33 ARG A NH1  7  
ATOM   4004  N  NH2  . ARG A 1 33 ? -8.790  7.911   6.239   1.00 0.00 ? 33 ARG A NH2  7  
ATOM   4005  H  H    . ARG A 1 33 ? -5.951  4.480   0.820   1.00 0.00 ? 33 ARG A H    7  
ATOM   4006  H  HA   . ARG A 1 33 ? -6.902  7.203   0.839   1.00 0.00 ? 33 ARG A HA   7  
ATOM   4007  H  HB2  . ARG A 1 33 ? -4.328  6.011   1.891   1.00 0.00 ? 33 ARG A HB2  7  
ATOM   4008  H  HB3  . ARG A 1 33 ? -4.877  7.655   2.183   1.00 0.00 ? 33 ARG A HB3  7  
ATOM   4009  H  HG2  . ARG A 1 33 ? -7.022  6.184   3.012   1.00 0.00 ? 33 ARG A HG2  7  
ATOM   4010  H  HG3  . ARG A 1 33 ? -5.662  5.155   3.462   1.00 0.00 ? 33 ARG A HG3  7  
ATOM   4011  H  HD2  . ARG A 1 33 ? -5.306  6.433   5.236   1.00 0.00 ? 33 ARG A HD2  7  
ATOM   4012  H  HD3  . ARG A 1 33 ? -4.967  7.794   4.168   1.00 0.00 ? 33 ARG A HD3  7  
ATOM   4013  H  HE   . ARG A 1 33 ? -7.127  8.597   4.511   1.00 0.00 ? 33 ARG A HE   7  
ATOM   4014  H  HH11 . ARG A 1 33 ? -6.679  5.499   6.100   1.00 0.00 ? 33 ARG A HH11 7  
ATOM   4015  H  HH12 . ARG A 1 33 ? -8.090  5.668   7.102   1.00 0.00 ? 33 ARG A HH12 7  
ATOM   4016  H  HH21 . ARG A 1 33 ? -8.987  8.813   5.840   1.00 0.00 ? 33 ARG A HH21 7  
ATOM   4017  H  HH22 . ARG A 1 33 ? -9.416  7.529   6.931   1.00 0.00 ? 33 ARG A HH22 7  
ATOM   4018  N  N    . HIS A 1 34 ? -4.963  6.311   -1.444  1.00 0.00 ? 34 HIS A N    7  
ATOM   4019  C  CA   . HIS A 1 34 ? -4.229  6.725   -2.627  1.00 0.00 ? 34 HIS A CA   7  
ATOM   4020  C  C    . HIS A 1 34 ? -5.194  7.015   -3.769  1.00 0.00 ? 34 HIS A C    7  
ATOM   4021  O  O    . HIS A 1 34 ? -4.798  7.485   -4.837  1.00 0.00 ? 34 HIS A O    7  
ATOM   4022  C  CB   . HIS A 1 34 ? -3.222  5.647   -3.024  1.00 0.00 ? 34 HIS A CB   7  
ATOM   4023  C  CG   . HIS A 1 34 ? -2.117  5.489   -2.030  1.00 0.00 ? 34 HIS A CG   7  
ATOM   4024  N  ND1  . HIS A 1 34 ? -1.354  6.534   -1.572  1.00 0.00 ? 34 HIS A ND1  7  
ATOM   4025  C  CD2  . HIS A 1 34 ? -1.668  4.385   -1.381  1.00 0.00 ? 34 HIS A CD2  7  
ATOM   4026  C  CE1  . HIS A 1 34 ? -0.486  6.047   -0.677  1.00 0.00 ? 34 HIS A CE1  7  
ATOM   4027  N  NE2  . HIS A 1 34 ? -0.632  4.744   -0.522  1.00 0.00 ? 34 HIS A NE2  7  
ATOM   4028  H  H    . HIS A 1 34 ? -5.313  5.391   -1.399  1.00 0.00 ? 34 HIS A H    7  
ATOM   4029  H  HA   . HIS A 1 34 ? -3.697  7.632   -2.383  1.00 0.00 ? 34 HIS A HA   7  
ATOM   4030  H  HB2  . HIS A 1 34 ? -3.733  4.701   -3.110  1.00 0.00 ? 34 HIS A HB2  7  
ATOM   4031  H  HB3  . HIS A 1 34 ? -2.782  5.904   -3.975  1.00 0.00 ? 34 HIS A HB3  7  
ATOM   4032  H  HD1  . HIS A 1 34 ? -1.419  7.475   -1.863  1.00 0.00 ? 34 HIS A HD1  7  
ATOM   4033  H  HD2  . HIS A 1 34 ? -2.047  3.382   -1.500  1.00 0.00 ? 34 HIS A HD2  7  
ATOM   4034  H  HE1  . HIS A 1 34 ? 0.248   6.644   -0.154  1.00 0.00 ? 34 HIS A HE1  7  
ATOM   4035  N  N    . MET A 1 35 ? -6.477  6.820   -3.497  1.00 0.00 ? 35 MET A N    7  
ATOM   4036  C  CA   . MET A 1 35 ? -7.523  7.161   -4.451  1.00 0.00 ? 35 MET A CA   7  
ATOM   4037  C  C    . MET A 1 35 ? -7.824  8.648   -4.350  1.00 0.00 ? 35 MET A C    7  
ATOM   4038  O  O    . MET A 1 35 ? -8.078  9.321   -5.350  1.00 0.00 ? 35 MET A O    7  
ATOM   4039  C  CB   . MET A 1 35 ? -8.785  6.345   -4.173  1.00 0.00 ? 35 MET A CB   7  
ATOM   4040  C  CG   . MET A 1 35 ? -8.627  4.864   -4.466  1.00 0.00 ? 35 MET A CG   7  
ATOM   4041  S  SD   . MET A 1 35 ? -10.073 3.902   -3.984  1.00 0.00 ? 35 MET A SD   7  
ATOM   4042  C  CE   . MET A 1 35 ? -10.468 3.095   -5.533  1.00 0.00 ? 35 MET A CE   7  
ATOM   4043  H  H    . MET A 1 35 ? -6.732  6.504   -2.604  1.00 0.00 ? 35 MET A H    7  
ATOM   4044  H  HA   . MET A 1 35 ? -7.161  6.936   -5.443  1.00 0.00 ? 35 MET A HA   7  
ATOM   4045  H  HB2  . MET A 1 35 ? -9.049  6.459   -3.132  1.00 0.00 ? 35 MET A HB2  7  
ATOM   4046  H  HB3  . MET A 1 35 ? -9.590  6.729   -4.783  1.00 0.00 ? 35 MET A HB3  7  
ATOM   4047  H  HG2  . MET A 1 35 ? -8.463  4.734   -5.524  1.00 0.00 ? 35 MET A HG2  7  
ATOM   4048  H  HG3  . MET A 1 35 ? -7.769  4.493   -3.923  1.00 0.00 ? 35 MET A HG3  7  
ATOM   4049  H  HE1  . MET A 1 35 ? -10.666 2.049   -5.352  1.00 0.00 ? 35 MET A HE1  7  
ATOM   4050  H  HE2  . MET A 1 35 ? -11.342 3.557   -5.967  1.00 0.00 ? 35 MET A HE2  7  
ATOM   4051  H  HE3  . MET A 1 35 ? -9.634  3.191   -6.213  1.00 0.00 ? 35 MET A HE3  7  
ATOM   4052  N  N    . LEU A 1 36 ? -7.664  9.172   -3.145  1.00 0.00 ? 36 LEU A N    7  
ATOM   4053  C  CA   . LEU A 1 36 ? -7.802  10.595  -2.894  1.00 0.00 ? 36 LEU A CA   7  
ATOM   4054  C  C    . LEU A 1 36 ? -6.550  11.094  -2.196  1.00 0.00 ? 36 LEU A C    7  
ATOM   4055  O  O    . LEU A 1 36 ? -6.385  10.903  -0.991  1.00 0.00 ? 36 LEU A O    7  
ATOM   4056  C  CB   . LEU A 1 36 ? -9.037  10.883  -2.037  1.00 0.00 ? 36 LEU A CB   7  
ATOM   4057  C  CG   . LEU A 1 36 ? -10.219 9.933   -2.246  1.00 0.00 ? 36 LEU A CG   7  
ATOM   4058  C  CD1  . LEU A 1 36 ? -10.402 9.031   -1.033  1.00 0.00 ? 36 LEU A CD1  7  
ATOM   4059  C  CD2  . LEU A 1 36 ? -11.490 10.722  -2.524  1.00 0.00 ? 36 LEU A CD2  7  
ATOM   4060  H  H    . LEU A 1 36 ? -7.353  8.596   -2.418  1.00 0.00 ? 36 LEU A H    7  
ATOM   4061  H  HA   . LEU A 1 36 ? -7.900  11.096  -3.846  1.00 0.00 ? 36 LEU A HA   7  
ATOM   4062  H  HB2  . LEU A 1 36 ? -8.744  10.836  -0.997  1.00 0.00 ? 36 LEU A HB2  7  
ATOM   4063  H  HB3  . LEU A 1 36 ? -9.368  11.889  -2.252  1.00 0.00 ? 36 LEU A HB3  7  
ATOM   4064  H  HG   . LEU A 1 36 ? -10.020 9.305   -3.102  1.00 0.00 ? 36 LEU A HG   7  
ATOM   4065  H  HD11 . LEU A 1 36 ? -10.930 9.568   -0.259  1.00 0.00 ? 36 LEU A HD11 7  
ATOM   4066  H  HD12 . LEU A 1 36 ? -10.970 8.155   -1.316  1.00 0.00 ? 36 LEU A HD12 7  
ATOM   4067  H  HD13 . LEU A 1 36 ? -9.435  8.726   -0.664  1.00 0.00 ? 36 LEU A HD13 7  
ATOM   4068  H  HD21 . LEU A 1 36 ? -11.441 11.674  -2.018  1.00 0.00 ? 36 LEU A HD21 7  
ATOM   4069  H  HD22 . LEU A 1 36 ? -11.586 10.884  -3.588  1.00 0.00 ? 36 LEU A HD22 7  
ATOM   4070  H  HD23 . LEU A 1 36 ? -12.344 10.168  -2.166  1.00 0.00 ? 36 LEU A HD23 7  
ATOM   4071  N  N    . VAL A 1 37 ? -5.612  11.597  -2.978  1.00 0.00 ? 37 VAL A N    7  
ATOM   4072  C  CA   . VAL A 1 37 ? -4.325  12.014  -2.449  1.00 0.00 ? 37 VAL A CA   7  
ATOM   4073  C  C    . VAL A 1 37 ? -4.454  13.332  -1.695  1.00 0.00 ? 37 VAL A C    7  
ATOM   4074  O  O    . VAL A 1 37 ? -3.849  13.463  -0.610  1.00 0.00 ? 37 VAL A O    7  
ATOM   4075  C  CB   . VAL A 1 37 ? -3.281  12.160  -3.575  1.00 0.00 ? 37 VAL A CB   7  
ATOM   4076  C  CG1  . VAL A 1 37 ? -1.921  12.546  -3.013  1.00 0.00 ? 37 VAL A CG1  7  
ATOM   4077  C  CG2  . VAL A 1 37 ? -3.179  10.870  -4.375  1.00 0.00 ? 37 VAL A CG2  7  
ATOM   4078  O  OXT  . VAL A 1 37 ? -5.174  14.232  -2.184  1.00 0.00 ? 37 VAL A OXT  7  
ATOM   4079  H  H    . VAL A 1 37 ? -5.767  11.636  -3.944  1.00 0.00 ? 37 VAL A H    7  
ATOM   4080  H  HA   . VAL A 1 37 ? -3.986  11.248  -1.765  1.00 0.00 ? 37 VAL A HA   7  
ATOM   4081  H  HB   . VAL A 1 37 ? -3.607  12.945  -4.239  1.00 0.00 ? 37 VAL A HB   7  
ATOM   4082  H  HG11 . VAL A 1 37 ? -2.053  13.080  -2.083  1.00 0.00 ? 37 VAL A HG11 7  
ATOM   4083  H  HG12 . VAL A 1 37 ? -1.338  11.655  -2.838  1.00 0.00 ? 37 VAL A HG12 7  
ATOM   4084  H  HG13 . VAL A 1 37 ? -1.407  13.179  -3.721  1.00 0.00 ? 37 VAL A HG13 7  
ATOM   4085  H  HG21 . VAL A 1 37 ? -3.007  10.041  -3.702  1.00 0.00 ? 37 VAL A HG21 7  
ATOM   4086  H  HG22 . VAL A 1 37 ? -4.098  10.709  -4.917  1.00 0.00 ? 37 VAL A HG22 7  
ATOM   4087  H  HG23 . VAL A 1 37 ? -2.356  10.941  -5.072  1.00 0.00 ? 37 VAL A HG23 7  
HETATM 4088  ZN ZN   . ZN  B 2 .  ? 0.753   3.572   0.252   1.00 0.00 ? 38 ZN  A ZN   7  
ATOM   4089  N  N    . GLY A 1 1  ? 8.076   -0.562  -6.607  1.00 0.00 ? 1  GLY A N    8  
ATOM   4090  C  CA   . GLY A 1 1  ? 8.371   0.797   -6.102  1.00 0.00 ? 1  GLY A CA   8  
ATOM   4091  C  C    . GLY A 1 1  ? 8.787   0.792   -4.646  1.00 0.00 ? 1  GLY A C    8  
ATOM   4092  O  O    . GLY A 1 1  ? 7.985   1.097   -3.764  1.00 0.00 ? 1  GLY A O    8  
ATOM   4093  H  H1   . GLY A 1 1  ? 8.766   -1.244  -6.226  1.00 0.00 ? 1  GLY A H1   8  
ATOM   4094  H  H2   . GLY A 1 1  ? 8.131   -0.575  -7.647  1.00 0.00 ? 1  GLY A H2   8  
ATOM   4095  H  H3   . GLY A 1 1  ? 7.117   -0.854  -6.316  1.00 0.00 ? 1  GLY A H3   8  
ATOM   4096  H  HA2  . GLY A 1 1  ? 9.170   1.224   -6.692  1.00 0.00 ? 1  GLY A HA2  8  
ATOM   4097  H  HA3  . GLY A 1 1  ? 7.489   1.410   -6.212  1.00 0.00 ? 1  GLY A HA3  8  
ATOM   4098  N  N    . SER A 1 2  ? 10.053  0.491   -4.398  1.00 0.00 ? 2  SER A N    8  
ATOM   4099  C  CA   . SER A 1 2  ? 10.592  0.504   -3.044  1.00 0.00 ? 2  SER A CA   8  
ATOM   4100  C  C    . SER A 1 2  ? 11.291  1.832   -2.765  1.00 0.00 ? 2  SER A C    8  
ATOM   4101  O  O    . SER A 1 2  ? 11.675  2.546   -3.693  1.00 0.00 ? 2  SER A O    8  
ATOM   4102  C  CB   . SER A 1 2  ? 11.567  -0.663  -2.851  1.00 0.00 ? 2  SER A CB   8  
ATOM   4103  O  OG   . SER A 1 2  ? 11.226  -1.754  -3.690  1.00 0.00 ? 2  SER A OG   8  
ATOM   4104  H  H    . SER A 1 2  ? 10.657  0.308   -5.149  1.00 0.00 ? 2  SER A H    8  
ATOM   4105  H  HA   . SER A 1 2  ? 9.767   0.392   -2.356  1.00 0.00 ? 2  SER A HA   8  
ATOM   4106  H  HB2  . SER A 1 2  ? 12.569  -0.340  -3.092  1.00 0.00 ? 2  SER A HB2  8  
ATOM   4107  H  HB3  . SER A 1 2  ? 11.533  -0.992  -1.821  1.00 0.00 ? 2  SER A HB3  8  
ATOM   4108  H  HG   . SER A 1 2  ? 10.284  -1.709  -3.909  1.00 0.00 ? 2  SER A HG   8  
ATOM   4109  N  N    . THR A 1 3  ? 11.424  2.178   -1.493  1.00 0.00 ? 3  THR A N    8  
ATOM   4110  C  CA   . THR A 1 3  ? 12.079  3.417   -1.105  1.00 0.00 ? 3  THR A CA   8  
ATOM   4111  C  C    . THR A 1 3  ? 13.142  3.131   -0.050  1.00 0.00 ? 3  THR A C    8  
ATOM   4112  O  O    . THR A 1 3  ? 13.556  1.981   0.122   1.00 0.00 ? 3  THR A O    8  
ATOM   4113  C  CB   . THR A 1 3  ? 11.068  4.459   -0.565  1.00 0.00 ? 3  THR A CB   8  
ATOM   4114  O  OG1  . THR A 1 3  ? 10.634  4.103   0.754   1.00 0.00 ? 3  THR A OG1  8  
ATOM   4115  C  CG2  . THR A 1 3  ? 9.858   4.577   -1.479  1.00 0.00 ? 3  THR A CG2  8  
ATOM   4116  H  H    . THR A 1 3  ? 11.082  1.580   -0.788  1.00 0.00 ? 3  THR A H    8  
ATOM   4117  H  HA   . THR A 1 3  ? 12.559  3.829   -1.981  1.00 0.00 ? 3  THR A HA   8  
ATOM   4118  H  HB   . THR A 1 3  ? 11.560  5.421   -0.523  1.00 0.00 ? 3  THR A HB   8  
ATOM   4119  H  HG1  . THR A 1 3  ? 10.609  3.129   0.835   1.00 0.00 ? 3  THR A HG1  8  
ATOM   4120  H  HG21 . THR A 1 3  ? 9.707   3.641   -1.998  1.00 0.00 ? 3  THR A HG21 8  
ATOM   4121  H  HG22 . THR A 1 3  ? 10.024  5.366   -2.199  1.00 0.00 ? 3  THR A HG22 8  
ATOM   4122  H  HG23 . THR A 1 3  ? 8.983   4.807   -0.891  1.00 0.00 ? 3  THR A HG23 8  
ATOM   4123  N  N    . ARG A 1 4  ? 13.529  4.152   0.701   1.00 0.00 ? 4  ARG A N    8  
ATOM   4124  C  CA   . ARG A 1 4  ? 14.491  3.984   1.782   1.00 0.00 ? 4  ARG A CA   8  
ATOM   4125  C  C    . ARG A 1 4  ? 13.793  3.490   3.045   1.00 0.00 ? 4  ARG A C    8  
ATOM   4126  O  O    . ARG A 1 4  ? 13.880  4.112   4.107   1.00 0.00 ? 4  ARG A O    8  
ATOM   4127  C  CB   . ARG A 1 4  ? 15.212  5.302   2.063   1.00 0.00 ? 4  ARG A CB   8  
ATOM   4128  C  CG   . ARG A 1 4  ? 16.456  5.514   1.214   1.00 0.00 ? 4  ARG A CG   8  
ATOM   4129  C  CD   . ARG A 1 4  ? 17.087  6.874   1.479   1.00 0.00 ? 4  ARG A CD   8  
ATOM   4130  N  NE   . ARG A 1 4  ? 16.111  7.962   1.389   1.00 0.00 ? 4  ARG A NE   8  
ATOM   4131  C  CZ   . ARG A 1 4  ? 15.791  8.585   0.254   1.00 0.00 ? 4  ARG A CZ   8  
ATOM   4132  N  NH1  . ARG A 1 4  ? 16.373  8.237   -0.891  1.00 0.00 ? 4  ARG A NH1  8  
ATOM   4133  N  NH2  . ARG A 1 4  ? 14.880  9.552   0.263   1.00 0.00 ? 4  ARG A NH2  8  
ATOM   4134  H  H    . ARG A 1 4  ? 13.126  5.033   0.551   1.00 0.00 ? 4  ARG A H    8  
ATOM   4135  H  HA   . ARG A 1 4  ? 15.213  3.245   1.471   1.00 0.00 ? 4  ARG A HA   8  
ATOM   4136  H  HB2  . ARG A 1 4  ? 14.529  6.116   1.872   1.00 0.00 ? 4  ARG A HB2  8  
ATOM   4137  H  HB3  . ARG A 1 4  ? 15.502  5.324   3.103   1.00 0.00 ? 4  ARG A HB3  8  
ATOM   4138  H  HG2  . ARG A 1 4  ? 17.174  4.742   1.446   1.00 0.00 ? 4  ARG A HG2  8  
ATOM   4139  H  HG3  . ARG A 1 4  ? 16.182  5.453   0.171   1.00 0.00 ? 4  ARG A HG3  8  
ATOM   4140  H  HD2  . ARG A 1 4  ? 17.519  6.869   2.470   1.00 0.00 ? 4  ARG A HD2  8  
ATOM   4141  H  HD3  . ARG A 1 4  ? 17.867  7.041   0.750   1.00 0.00 ? 4  ARG A HD3  8  
ATOM   4142  H  HE   . ARG A 1 4  ? 15.670  8.247   2.230   1.00 0.00 ? 4  ARG A HE   8  
ATOM   4143  H  HH11 . ARG A 1 4  ? 17.065  7.503   -0.907  1.00 0.00 ? 4  ARG A HH11 8  
ATOM   4144  H  HH12 . ARG A 1 4  ? 16.119  8.695   -1.750  1.00 0.00 ? 4  ARG A HH12 8  
ATOM   4145  H  HH21 . ARG A 1 4  ? 14.426  9.814   1.121   1.00 0.00 ? 4  ARG A HH21 8  
ATOM   4146  H  HH22 . ARG A 1 4  ? 14.656  10.046  -0.589  1.00 0.00 ? 4  ARG A HH22 8  
ATOM   4147  N  N    . GLY A 1 5  ? 13.081  2.383   2.915   1.00 0.00 ? 5  GLY A N    8  
ATOM   4148  C  CA   . GLY A 1 5  ? 12.368  1.816   4.035   1.00 0.00 ? 5  GLY A CA   8  
ATOM   4149  C  C    . GLY A 1 5  ? 12.218  0.319   3.903   1.00 0.00 ? 5  GLY A C    8  
ATOM   4150  O  O    . GLY A 1 5  ? 13.082  -0.439  4.345   1.00 0.00 ? 5  GLY A O    8  
ATOM   4151  H  H    . GLY A 1 5  ? 13.036  1.943   2.035   1.00 0.00 ? 5  GLY A H    8  
ATOM   4152  H  HA2  . GLY A 1 5  ? 12.910  2.037   4.943   1.00 0.00 ? 5  GLY A HA2  8  
ATOM   4153  H  HA3  . GLY A 1 5  ? 11.387  2.264   4.091   1.00 0.00 ? 5  GLY A HA3  8  
ATOM   4154  N  N    . SER A 1 6  ? 11.182  -0.104  3.203   1.00 0.00 ? 6  SER A N    8  
ATOM   4155  C  CA   . SER A 1 6  ? 10.960  -1.517  2.941   1.00 0.00 ? 6  SER A CA   8  
ATOM   4156  C  C    . SER A 1 6  ? 11.312  -1.844  1.492   1.00 0.00 ? 6  SER A C    8  
ATOM   4157  O  O    . SER A 1 6  ? 10.661  -1.369  0.556   1.00 0.00 ? 6  SER A O    8  
ATOM   4158  C  CB   . SER A 1 6  ? 9.507   -1.878  3.242   1.00 0.00 ? 6  SER A CB   8  
ATOM   4159  O  OG   . SER A 1 6  ? 8.814   -0.768  3.792   1.00 0.00 ? 6  SER A OG   8  
ATOM   4160  H  H    . SER A 1 6  ? 10.582  0.556   2.786   1.00 0.00 ? 6  SER A H    8  
ATOM   4161  H  HA   . SER A 1 6  ? 11.608  -2.082  3.595   1.00 0.00 ? 6  SER A HA   8  
ATOM   4162  H  HB2  . SER A 1 6  ? 9.014   -2.179  2.329   1.00 0.00 ? 6  SER A HB2  8  
ATOM   4163  H  HB3  . SER A 1 6  ? 9.480   -2.692  3.951   1.00 0.00 ? 6  SER A HB3  8  
ATOM   4164  H  HG   . SER A 1 6  ? 8.598   -0.142  3.078   1.00 0.00 ? 6  SER A HG   8  
ATOM   4165  N  N    . THR A 1 7  ? 12.391  -2.585  1.301   1.00 0.00 ? 7  THR A N    8  
ATOM   4166  C  CA   . THR A 1 7  ? 12.892  -2.847  -0.034  1.00 0.00 ? 7  THR A CA   8  
ATOM   4167  C  C    . THR A 1 7  ? 12.136  -3.995  -0.696  1.00 0.00 ? 7  THR A C    8  
ATOM   4168  O  O    . THR A 1 7  ? 12.660  -5.098  -0.861  1.00 0.00 ? 7  THR A O    8  
ATOM   4169  C  CB   . THR A 1 7  ? 14.394  -3.162  0.007   1.00 0.00 ? 7  THR A CB   8  
ATOM   4170  O  OG1  . THR A 1 7  ? 14.789  -3.455  1.355   1.00 0.00 ? 7  THR A OG1  8  
ATOM   4171  C  CG2  . THR A 1 7  ? 15.204  -1.989  -0.521  1.00 0.00 ? 7  THR A CG2  8  
ATOM   4172  H  H    . THR A 1 7  ? 12.920  -2.880  2.074   1.00 0.00 ? 7  THR A H    8  
ATOM   4173  H  HA   . THR A 1 7  ? 12.752  -1.951  -0.623  1.00 0.00 ? 7  THR A HA   8  
ATOM   4174  H  HB   . THR A 1 7  ? 14.587  -4.024  -0.615  1.00 0.00 ? 7  THR A HB   8  
ATOM   4175  H  HG1  . THR A 1 7  ? 15.122  -4.367  1.395   1.00 0.00 ? 7  THR A HG1  8  
ATOM   4176  H  HG21 . THR A 1 7  ? 15.003  -1.114  0.080   1.00 0.00 ? 7  THR A HG21 8  
ATOM   4177  H  HG22 . THR A 1 7  ? 14.927  -1.794  -1.545  1.00 0.00 ? 7  THR A HG22 8  
ATOM   4178  H  HG23 . THR A 1 7  ? 16.257  -2.225  -0.472  1.00 0.00 ? 7  THR A HG23 8  
ATOM   4179  N  N    . GLY A 1 8  ? 10.911  -3.690  -1.113  1.00 0.00 ? 8  GLY A N    8  
ATOM   4180  C  CA   . GLY A 1 8  ? 10.087  -4.637  -1.839  1.00 0.00 ? 8  GLY A CA   8  
ATOM   4181  C  C    . GLY A 1 8  ? 9.864   -5.939  -1.107  1.00 0.00 ? 8  GLY A C    8  
ATOM   4182  O  O    . GLY A 1 8  ? 9.848   -7.007  -1.720  1.00 0.00 ? 8  GLY A O    8  
ATOM   4183  H  H    . GLY A 1 8  ? 10.581  -2.775  -0.971  1.00 0.00 ? 8  GLY A H    8  
ATOM   4184  H  HA2  . GLY A 1 8  ? 9.126   -4.184  -2.017  1.00 0.00 ? 8  GLY A HA2  8  
ATOM   4185  H  HA3  . GLY A 1 8  ? 10.555  -4.846  -2.788  1.00 0.00 ? 8  GLY A HA3  8  
ATOM   4186  N  N    . ILE A 1 9  ? 9.587   -5.844  0.180   1.00 0.00 ? 9  ILE A N    8  
ATOM   4187  C  CA   . ILE A 1 9  ? 9.245   -7.023  0.961   1.00 0.00 ? 9  ILE A CA   8  
ATOM   4188  C  C    . ILE A 1 9  ? 7.805   -7.435  0.659   1.00 0.00 ? 9  ILE A C    8  
ATOM   4189  O  O    . ILE A 1 9  ? 7.006   -6.597  0.237   1.00 0.00 ? 9  ILE A O    8  
ATOM   4190  C  CB   . ILE A 1 9  ? 9.402   -6.751  2.474   1.00 0.00 ? 9  ILE A CB   8  
ATOM   4191  C  CG1  . ILE A 1 9  ? 10.627  -5.865  2.732   1.00 0.00 ? 9  ILE A CG1  8  
ATOM   4192  C  CG2  . ILE A 1 9  ? 9.515   -8.054  3.254   1.00 0.00 ? 9  ILE A CG2  8  
ATOM   4193  C  CD1  . ILE A 1 9  ? 10.639  -5.236  4.109   1.00 0.00 ? 9  ILE A CD1  8  
ATOM   4194  H  H    . ILE A 1 9  ? 9.501   -4.959  0.583   1.00 0.00 ? 9  ILE A H    8  
ATOM   4195  H  HA   . ILE A 1 9  ? 9.914   -7.823  0.678   1.00 0.00 ? 9  ILE A HA   8  
ATOM   4196  H  HB   . ILE A 1 9  ? 8.520   -6.233  2.811   1.00 0.00 ? 9  ILE A HB   8  
ATOM   4197  H  HG12 . ILE A 1 9  ? 11.522  -6.460  2.632   1.00 0.00 ? 9  ILE A HG12 8  
ATOM   4198  H  HG13 . ILE A 1 9  ? 10.645  -5.069  2.004   1.00 0.00 ? 9  ILE A HG13 8  
ATOM   4199  H  HG21 . ILE A 1 9  ? 10.501  -8.126  3.690   1.00 0.00 ? 9  ILE A HG21 8  
ATOM   4200  H  HG22 . ILE A 1 9  ? 8.772   -8.071  4.037   1.00 0.00 ? 9  ILE A HG22 8  
ATOM   4201  H  HG23 . ILE A 1 9  ? 9.355   -8.888  2.585   1.00 0.00 ? 9  ILE A HG23 8  
ATOM   4202  H  HD11 . ILE A 1 9  ? 10.223  -5.928  4.827   1.00 0.00 ? 9  ILE A HD11 8  
ATOM   4203  H  HD12 . ILE A 1 9  ? 11.656  -5.000  4.385   1.00 0.00 ? 9  ILE A HD12 8  
ATOM   4204  H  HD13 . ILE A 1 9  ? 10.051  -4.330  4.099   1.00 0.00 ? 9  ILE A HD13 8  
ATOM   4205  N  N    . LYS A 1 10 ? 7.463   -8.693  0.959   1.00 0.00 ? 10 LYS A N    8  
ATOM   4206  C  CA   . LYS A 1 10 ? 6.109   -9.219  0.750   1.00 0.00 ? 10 LYS A CA   8  
ATOM   4207  C  C    . LYS A 1 10 ? 5.719   -9.218  -0.733  1.00 0.00 ? 10 LYS A C    8  
ATOM   4208  O  O    . LYS A 1 10 ? 6.210   -8.413  -1.522  1.00 0.00 ? 10 LYS A O    8  
ATOM   4209  C  CB   . LYS A 1 10 ? 5.084   -8.440  1.578   1.00 0.00 ? 10 LYS A CB   8  
ATOM   4210  C  CG   . LYS A 1 10 ? 4.501   -9.252  2.721   1.00 0.00 ? 10 LYS A CG   8  
ATOM   4211  C  CD   . LYS A 1 10 ? 4.702   -8.563  4.054   1.00 0.00 ? 10 LYS A CD   8  
ATOM   4212  C  CE   . LYS A 1 10 ? 5.872   -9.167  4.814   1.00 0.00 ? 10 LYS A CE   8  
ATOM   4213  N  NZ   . LYS A 1 10 ? 6.007   -8.591  6.174   1.00 0.00 ? 10 LYS A NZ   8  
ATOM   4214  H  H    . LYS A 1 10 ? 8.145   -9.289  1.339   1.00 0.00 ? 10 LYS A H    8  
ATOM   4215  H  HA   . LYS A 1 10 ? 6.108   -10.244 1.091   1.00 0.00 ? 10 LYS A HA   8  
ATOM   4216  H  HB2  . LYS A 1 10 ? 5.558   -7.562  1.992   1.00 0.00 ? 10 LYS A HB2  8  
ATOM   4217  H  HB3  . LYS A 1 10 ? 4.273   -8.135  0.932   1.00 0.00 ? 10 LYS A HB3  8  
ATOM   4218  H  HG2  . LYS A 1 10 ? 3.441   -9.383  2.553   1.00 0.00 ? 10 LYS A HG2  8  
ATOM   4219  H  HG3  . LYS A 1 10 ? 4.986   -10.217 2.746   1.00 0.00 ? 10 LYS A HG3  8  
ATOM   4220  H  HD2  . LYS A 1 10 ? 4.899   -7.516  3.881   1.00 0.00 ? 10 LYS A HD2  8  
ATOM   4221  H  HD3  . LYS A 1 10 ? 3.806   -8.673  4.645   1.00 0.00 ? 10 LYS A HD3  8  
ATOM   4222  H  HE2  . LYS A 1 10 ? 5.717   -10.233 4.900   1.00 0.00 ? 10 LYS A HE2  8  
ATOM   4223  H  HE3  . LYS A 1 10 ? 6.780   -8.981  4.258   1.00 0.00 ? 10 LYS A HE3  8  
ATOM   4224  H  HZ1  . LYS A 1 10 ? 6.406   -7.627  6.116   1.00 0.00 ? 10 LYS A HZ1  8  
ATOM   4225  H  HZ2  . LYS A 1 10 ? 6.643   -9.185  6.751   1.00 0.00 ? 10 LYS A HZ2  8  
ATOM   4226  H  HZ3  . LYS A 1 10 ? 5.075   -8.542  6.639   1.00 0.00 ? 10 LYS A HZ3  8  
ATOM   4227  N  N    . PRO A 1 11 ? 4.905   -10.196 -1.156  1.00 0.00 ? 11 PRO A N    8  
ATOM   4228  C  CA   . PRO A 1 11 ? 4.508   -10.344 -2.562  1.00 0.00 ? 11 PRO A CA   8  
ATOM   4229  C  C    . PRO A 1 11 ? 3.771   -9.118  -3.101  1.00 0.00 ? 11 PRO A C    8  
ATOM   4230  O  O    . PRO A 1 11 ? 3.760   -8.866  -4.309  1.00 0.00 ? 11 PRO A O    8  
ATOM   4231  C  CB   . PRO A 1 11 ? 3.577   -11.562 -2.554  1.00 0.00 ? 11 PRO A CB   8  
ATOM   4232  C  CG   . PRO A 1 11 ? 3.177   -11.737 -1.129  1.00 0.00 ? 11 PRO A CG   8  
ATOM   4233  C  CD   . PRO A 1 11 ? 4.346   -11.267 -0.318  1.00 0.00 ? 11 PRO A CD   8  
ATOM   4234  H  HA   . PRO A 1 11 ? 5.361   -10.549 -3.189  1.00 0.00 ? 11 PRO A HA   8  
ATOM   4235  H  HB2  . PRO A 1 11 ? 2.720   -11.366 -3.182  1.00 0.00 ? 11 PRO A HB2  8  
ATOM   4236  H  HB3  . PRO A 1 11 ? 4.109   -12.426 -2.922  1.00 0.00 ? 11 PRO A HB3  8  
ATOM   4237  H  HG2  . PRO A 1 11 ? 2.309   -11.134 -0.916  1.00 0.00 ? 11 PRO A HG2  8  
ATOM   4238  H  HG3  . PRO A 1 11 ? 2.973   -12.778 -0.928  1.00 0.00 ? 11 PRO A HG3  8  
ATOM   4239  H  HD2  . PRO A 1 11 ? 4.018   -10.883 0.637   1.00 0.00 ? 11 PRO A HD2  8  
ATOM   4240  H  HD3  . PRO A 1 11 ? 5.061   -12.063 -0.182  1.00 0.00 ? 11 PRO A HD3  8  
ATOM   4241  N  N    . PHE A 1 12 ? 3.137   -8.371  -2.209  1.00 0.00 ? 12 PHE A N    8  
ATOM   4242  C  CA   . PHE A 1 12 ? 2.357   -7.216  -2.600  1.00 0.00 ? 12 PHE A CA   8  
ATOM   4243  C  C    . PHE A 1 12 ? 2.736   -5.995  -1.770  1.00 0.00 ? 12 PHE A C    8  
ATOM   4244  O  O    . PHE A 1 12 ? 2.193   -5.773  -0.692  1.00 0.00 ? 12 PHE A O    8  
ATOM   4245  C  CB   . PHE A 1 12 ? 0.870   -7.521  -2.428  1.00 0.00 ? 12 PHE A CB   8  
ATOM   4246  C  CG   . PHE A 1 12 ? 0.408   -8.722  -3.202  1.00 0.00 ? 12 PHE A CG   8  
ATOM   4247  C  CD1  . PHE A 1 12 ? 0.419   -8.716  -4.587  1.00 0.00 ? 12 PHE A CD1  8  
ATOM   4248  C  CD2  . PHE A 1 12 ? -0.032  -9.859  -2.544  1.00 0.00 ? 12 PHE A CD2  8  
ATOM   4249  C  CE1  . PHE A 1 12 ? 0.002   -9.821  -5.302  1.00 0.00 ? 12 PHE A CE1  8  
ATOM   4250  C  CE2  . PHE A 1 12 ? -0.452  -10.967 -3.252  1.00 0.00 ? 12 PHE A CE2  8  
ATOM   4251  C  CZ   . PHE A 1 12 ? -0.436  -10.949 -4.633  1.00 0.00 ? 12 PHE A CZ   8  
ATOM   4252  H  H    . PHE A 1 12 ? 3.169   -8.622  -1.265  1.00 0.00 ? 12 PHE A H    8  
ATOM   4253  H  HA   . PHE A 1 12 ? 2.560   -7.012  -3.641  1.00 0.00 ? 12 PHE A HA   8  
ATOM   4254  H  HB2  . PHE A 1 12 ? 0.672   -7.705  -1.382  1.00 0.00 ? 12 PHE A HB2  8  
ATOM   4255  H  HB3  . PHE A 1 12 ? 0.294   -6.668  -2.755  1.00 0.00 ? 12 PHE A HB3  8  
ATOM   4256  H  HD1  . PHE A 1 12 ? 0.761   -7.835  -5.111  1.00 0.00 ? 12 PHE A HD1  8  
ATOM   4257  H  HD2  . PHE A 1 12 ? -0.047  -9.872  -1.466  1.00 0.00 ? 12 PHE A HD2  8  
ATOM   4258  H  HE1  . PHE A 1 12 ? 0.011   -9.802  -6.381  1.00 0.00 ? 12 PHE A HE1  8  
ATOM   4259  H  HE2  . PHE A 1 12 ? -0.795  -11.845 -2.727  1.00 0.00 ? 12 PHE A HE2  8  
ATOM   4260  H  HZ   . PHE A 1 12 ? -0.763  -11.814 -5.190  1.00 0.00 ? 12 PHE A HZ   8  
ATOM   4261  N  N    . GLN A 1 13 ? 3.666   -5.206  -2.275  1.00 0.00 ? 13 GLN A N    8  
ATOM   4262  C  CA   . GLN A 1 13 ? 4.080   -3.995  -1.585  1.00 0.00 ? 13 GLN A CA   8  
ATOM   4263  C  C    . GLN A 1 13 ? 3.364   -2.785  -2.192  1.00 0.00 ? 13 GLN A C    8  
ATOM   4264  O  O    . GLN A 1 13 ? 2.956   -2.822  -3.356  1.00 0.00 ? 13 GLN A O    8  
ATOM   4265  C  CB   . GLN A 1 13 ? 5.606   -3.819  -1.670  1.00 0.00 ? 13 GLN A CB   8  
ATOM   4266  C  CG   . GLN A 1 13 ? 6.069   -2.858  -2.753  1.00 0.00 ? 13 GLN A CG   8  
ATOM   4267  C  CD   . GLN A 1 13 ? 7.508   -2.403  -2.573  1.00 0.00 ? 13 GLN A CD   8  
ATOM   4268  O  OE1  . GLN A 1 13 ? 8.276   -2.342  -3.533  1.00 0.00 ? 13 GLN A OE1  8  
ATOM   4269  N  NE2  . GLN A 1 13 ? 7.884   -2.063  -1.346  1.00 0.00 ? 13 GLN A NE2  8  
ATOM   4270  H  H    . GLN A 1 13 ? 4.080   -5.439  -3.130  1.00 0.00 ? 13 GLN A H    8  
ATOM   4271  H  HA   . GLN A 1 13 ? 3.792   -4.087  -0.547  1.00 0.00 ? 13 GLN A HA   8  
ATOM   4272  H  HB2  . GLN A 1 13 ? 5.962   -3.455  -0.720  1.00 0.00 ? 13 GLN A HB2  8  
ATOM   4273  H  HB3  . GLN A 1 13 ? 6.052   -4.783  -1.863  1.00 0.00 ? 13 GLN A HB3  8  
ATOM   4274  H  HG2  . GLN A 1 13 ? 5.974   -3.341  -3.707  1.00 0.00 ? 13 GLN A HG2  8  
ATOM   4275  H  HG3  . GLN A 1 13 ? 5.429   -1.986  -2.733  1.00 0.00 ? 13 GLN A HG3  8  
ATOM   4276  H  HE21 . GLN A 1 13 ? 7.222   -2.119  -0.621  1.00 0.00 ? 13 GLN A HE21 8  
ATOM   4277  H  HE22 . GLN A 1 13 ? 8.803   -1.757  -1.214  1.00 0.00 ? 13 GLN A HE22 8  
ATOM   4278  N  N    . CYS A 1 14 ? 3.272   -1.693  -1.435  1.00 0.00 ? 14 CYS A N    8  
ATOM   4279  C  CA   . CYS A 1 14 ? 2.684   -0.465  -1.962  1.00 0.00 ? 14 CYS A CA   8  
ATOM   4280  C  C    . CYS A 1 14 ? 3.667   0.215   -2.909  1.00 0.00 ? 14 CYS A C    8  
ATOM   4281  O  O    . CYS A 1 14 ? 4.768   0.577   -2.508  1.00 0.00 ? 14 CYS A O    8  
ATOM   4282  C  CB   . CYS A 1 14 ? 2.286   0.529   -0.857  1.00 0.00 ? 14 CYS A CB   8  
ATOM   4283  S  SG   . CYS A 1 14 ? 1.492   2.025   -1.553  1.00 0.00 ? 14 CYS A SG   8  
ATOM   4284  H  H    . CYS A 1 14 ? 3.693   -1.690  -0.555  1.00 0.00 ? 14 CYS A H    8  
ATOM   4285  H  HA   . CYS A 1 14 ? 1.794   -0.732  -2.512  1.00 0.00 ? 14 CYS A HA   8  
ATOM   4286  H  HB2  . CYS A 1 14 ? 1.592   0.055   -0.180  1.00 0.00 ? 14 CYS A HB2  8  
ATOM   4287  H  HB3  . CYS A 1 14 ? 3.167   0.841   -0.316  1.00 0.00 ? 14 CYS A HB3  8  
ATOM   4288  N  N    . PRO A 1 15 ? 3.266   0.462   -4.160  1.00 0.00 ? 15 PRO A N    8  
ATOM   4289  C  CA   . PRO A 1 15 ? 4.103   1.181   -5.122  1.00 0.00 ? 15 PRO A CA   8  
ATOM   4290  C  C    . PRO A 1 15 ? 4.166   2.679   -4.823  1.00 0.00 ? 15 PRO A C    8  
ATOM   4291  O  O    . PRO A 1 15 ? 4.873   3.433   -5.498  1.00 0.00 ? 15 PRO A O    8  
ATOM   4292  C  CB   . PRO A 1 15 ? 3.396   0.932   -6.451  1.00 0.00 ? 15 PRO A CB   8  
ATOM   4293  C  CG   . PRO A 1 15 ? 1.965   0.739   -6.089  1.00 0.00 ? 15 PRO A CG   8  
ATOM   4294  C  CD   . PRO A 1 15 ? 1.953   0.101   -4.726  1.00 0.00 ? 15 PRO A CD   8  
ATOM   4295  H  HA   . PRO A 1 15 ? 5.103   0.776   -5.158  1.00 0.00 ? 15 PRO A HA   8  
ATOM   4296  H  HB2  . PRO A 1 15 ? 3.530   1.788   -7.096  1.00 0.00 ? 15 PRO A HB2  8  
ATOM   4297  H  HB3  . PRO A 1 15 ? 3.809   0.051   -6.923  1.00 0.00 ? 15 PRO A HB3  8  
ATOM   4298  H  HG2  . PRO A 1 15 ? 1.463   1.695   -6.057  1.00 0.00 ? 15 PRO A HG2  8  
ATOM   4299  H  HG3  . PRO A 1 15 ? 1.490   0.090   -6.810  1.00 0.00 ? 15 PRO A HG3  8  
ATOM   4300  H  HD2  . PRO A 1 15 ? 1.151   0.508   -4.129  1.00 0.00 ? 15 PRO A HD2  8  
ATOM   4301  H  HD3  . PRO A 1 15 ? 1.853   -0.970  -4.812  1.00 0.00 ? 15 PRO A HD3  8  
ATOM   4302  N  N    . ASP A 1 16 ? 3.418   3.103   -3.814  1.00 0.00 ? 16 ASP A N    8  
ATOM   4303  C  CA   . ASP A 1 16 ? 3.354   4.503   -3.440  1.00 0.00 ? 16 ASP A CA   8  
ATOM   4304  C  C    . ASP A 1 16 ? 4.177   4.757   -2.183  1.00 0.00 ? 16 ASP A C    8  
ATOM   4305  O  O    . ASP A 1 16 ? 4.690   5.857   -1.974  1.00 0.00 ? 16 ASP A O    8  
ATOM   4306  C  CB   . ASP A 1 16 ? 1.898   4.899   -3.192  1.00 0.00 ? 16 ASP A CB   8  
ATOM   4307  C  CG   . ASP A 1 16 ? 1.237   5.553   -4.391  1.00 0.00 ? 16 ASP A CG   8  
ATOM   4308  O  OD1  . ASP A 1 16 ? 1.521   6.738   -4.664  1.00 0.00 ? 16 ASP A OD1  8  
ATOM   4309  O  OD2  . ASP A 1 16 ? 0.417   4.885   -5.059  1.00 0.00 ? 16 ASP A OD2  8  
ATOM   4310  H  H    . ASP A 1 16 ? 2.881   2.455   -3.305  1.00 0.00 ? 16 ASP A H    8  
ATOM   4311  H  HA   . ASP A 1 16 ? 3.750   5.091   -4.251  1.00 0.00 ? 16 ASP A HA   8  
ATOM   4312  H  HB2  . ASP A 1 16 ? 1.338   4.013   -2.941  1.00 0.00 ? 16 ASP A HB2  8  
ATOM   4313  H  HB3  . ASP A 1 16 ? 1.860   5.583   -2.363  1.00 0.00 ? 16 ASP A HB3  8  
ATOM   4314  N  N    . CYS A 1 17 ? 4.213   3.763   -1.301  1.00 0.00 ? 17 CYS A N    8  
ATOM   4315  C  CA   . CYS A 1 17 ? 4.868   3.913   -0.009  1.00 0.00 ? 17 CYS A CA   8  
ATOM   4316  C  C    . CYS A 1 17 ? 6.094   3.030   0.134   1.00 0.00 ? 17 CYS A C    8  
ATOM   4317  O  O    . CYS A 1 17 ? 6.969   3.337   0.934   1.00 0.00 ? 17 CYS A O    8  
ATOM   4318  C  CB   . CYS A 1 17 ? 3.893   3.579   1.113   1.00 0.00 ? 17 CYS A CB   8  
ATOM   4319  S  SG   . CYS A 1 17 ? 2.420   4.629   1.128   1.00 0.00 ? 17 CYS A SG   8  
ATOM   4320  H  H    . CYS A 1 17 ? 3.713   2.940   -1.490  1.00 0.00 ? 17 CYS A H    8  
ATOM   4321  H  HA   . CYS A 1 17 ? 5.166   4.944   0.086   1.00 0.00 ? 17 CYS A HA   8  
ATOM   4322  H  HB2  . CYS A 1 17 ? 3.567   2.555   1.005   1.00 0.00 ? 17 CYS A HB2  8  
ATOM   4323  H  HB3  . CYS A 1 17 ? 4.393   3.696   2.063   1.00 0.00 ? 17 CYS A HB3  8  
ATOM   4324  N  N    . ASP A 1 18 ? 6.024   1.862   -0.496  1.00 0.00 ? 18 ASP A N    8  
ATOM   4325  C  CA   . ASP A 1 18 ? 6.981   0.762   -0.324  1.00 0.00 ? 18 ASP A CA   8  
ATOM   4326  C  C    . ASP A 1 18 ? 6.609   -0.068  0.899   1.00 0.00 ? 18 ASP A C    8  
ATOM   4327  O  O    . ASP A 1 18 ? 7.356   -0.953  1.316   1.00 0.00 ? 18 ASP A O    8  
ATOM   4328  C  CB   . ASP A 1 18 ? 8.462   1.232   -0.299  1.00 0.00 ? 18 ASP A CB   8  
ATOM   4329  C  CG   . ASP A 1 18 ? 9.127   1.414   1.077   1.00 0.00 ? 18 ASP A CG   8  
ATOM   4330  O  OD1  . ASP A 1 18 ? 8.451   1.433   2.130   1.00 0.00 ? 18 ASP A OD1  8  
ATOM   4331  O  OD2  . ASP A 1 18 ? 10.365  1.568   1.097   1.00 0.00 ? 18 ASP A OD2  8  
ATOM   4332  H  H    . ASP A 1 18 ? 5.221   1.680   -1.029  1.00 0.00 ? 18 ASP A H    8  
ATOM   4333  H  HA   . ASP A 1 18 ? 6.856   0.119   -1.187  1.00 0.00 ? 18 ASP A HA   8  
ATOM   4334  H  HB2  . ASP A 1 18 ? 9.054   0.513   -0.846  1.00 0.00 ? 18 ASP A HB2  8  
ATOM   4335  H  HB3  . ASP A 1 18 ? 8.518   2.178   -0.819  1.00 0.00 ? 18 ASP A HB3  8  
ATOM   4336  N  N    . ARG A 1 19 ? 5.350   0.081   1.321   1.00 0.00 ? 19 ARG A N    8  
ATOM   4337  C  CA   . ARG A 1 19 ? 4.771   -0.764  2.367   1.00 0.00 ? 19 ARG A CA   8  
ATOM   4338  C  C    . ARG A 1 19 ? 4.762   -2.221  1.917   1.00 0.00 ? 19 ARG A C    8  
ATOM   4339  O  O    . ARG A 1 19 ? 5.167   -2.517  0.806   1.00 0.00 ? 19 ARG A O    8  
ATOM   4340  C  CB   . ARG A 1 19 ? 3.349   -0.310  2.683   1.00 0.00 ? 19 ARG A CB   8  
ATOM   4341  C  CG   . ARG A 1 19 ? 3.262   0.606   3.887   1.00 0.00 ? 19 ARG A CG   8  
ATOM   4342  C  CD   . ARG A 1 19 ? 2.150   1.622   3.731   1.00 0.00 ? 19 ARG A CD   8  
ATOM   4343  N  NE   . ARG A 1 19 ? 0.840   1.035   3.997   1.00 0.00 ? 19 ARG A NE   8  
ATOM   4344  C  CZ   . ARG A 1 19 ? 0.338   0.877   5.226   1.00 0.00 ? 19 ARG A CZ   8  
ATOM   4345  N  NH1  . ARG A 1 19 ? 0.999   1.348   6.277   1.00 0.00 ? 19 ARG A NH1  8  
ATOM   4346  N  NH2  . ARG A 1 19 ? -0.832  0.274   5.400   1.00 0.00 ? 19 ARG A NH2  8  
ATOM   4347  H  H    . ARG A 1 19 ? 4.766   0.696   0.837   1.00 0.00 ? 19 ARG A H    8  
ATOM   4348  H  HA   . ARG A 1 19 ? 5.384   -0.670  3.252   1.00 0.00 ? 19 ARG A HA   8  
ATOM   4349  H  HB2  . ARG A 1 19 ? 2.954   0.217   1.829   1.00 0.00 ? 19 ARG A HB2  8  
ATOM   4350  H  HB3  . ARG A 1 19 ? 2.738   -1.180  2.875   1.00 0.00 ? 19 ARG A HB3  8  
ATOM   4351  H  HG2  . ARG A 1 19 ? 3.073   0.012   4.769   1.00 0.00 ? 19 ARG A HG2  8  
ATOM   4352  H  HG3  . ARG A 1 19 ? 4.198   1.125   3.996   1.00 0.00 ? 19 ARG A HG3  8  
ATOM   4353  H  HD2  . ARG A 1 19 ? 2.319   2.432   4.423   1.00 0.00 ? 19 ARG A HD2  8  
ATOM   4354  H  HD3  . ARG A 1 19 ? 2.167   2.003   2.721   1.00 0.00 ? 19 ARG A HD3  8  
ATOM   4355  H  HE   . ARG A 1 19 ? 0.313   0.735   3.214   1.00 0.00 ? 19 ARG A HE   8  
ATOM   4356  H  HH11 . ARG A 1 19 ? 1.871   1.829   6.153   1.00 0.00 ? 19 ARG A HH11 8  
ATOM   4357  H  HH12 . ARG A 1 19 ? 0.624   1.235   7.208   1.00 0.00 ? 19 ARG A HH12 8  
ATOM   4358  H  HH21 . ARG A 1 19 ? -1.348  -0.063  4.614   1.00 0.00 ? 19 ARG A HH21 8  
ATOM   4359  H  HH22 . ARG A 1 19 ? -1.209  0.157   6.332   1.00 0.00 ? 19 ARG A HH22 8  
ATOM   4360  N  N    . SER A 1 20 ? 4.288   -3.132  2.752   1.00 0.00 ? 20 SER A N    8  
ATOM   4361  C  CA   . SER A 1 20 ? 4.306   -4.542  2.374   1.00 0.00 ? 20 SER A CA   8  
ATOM   4362  C  C    . SER A 1 20 ? 3.108   -5.308  2.919   1.00 0.00 ? 20 SER A C    8  
ATOM   4363  O  O    . SER A 1 20 ? 2.788   -5.228  4.108   1.00 0.00 ? 20 SER A O    8  
ATOM   4364  C  CB   . SER A 1 20 ? 5.603   -5.191  2.852   1.00 0.00 ? 20 SER A CB   8  
ATOM   4365  O  OG   . SER A 1 20 ? 6.308   -4.336  3.742   1.00 0.00 ? 20 SER A OG   8  
ATOM   4366  H  H    . SER A 1 20 ? 3.912   -2.858  3.623   1.00 0.00 ? 20 SER A H    8  
ATOM   4367  H  HA   . SER A 1 20 ? 4.275   -4.589  1.295   1.00 0.00 ? 20 SER A HA   8  
ATOM   4368  H  HB2  . SER A 1 20 ? 5.368   -6.112  3.364   1.00 0.00 ? 20 SER A HB2  8  
ATOM   4369  H  HB3  . SER A 1 20 ? 6.233   -5.402  2.002   1.00 0.00 ? 20 SER A HB3  8  
ATOM   4370  H  HG   . SER A 1 20 ? 6.173   -3.419  3.473   1.00 0.00 ? 20 SER A HG   8  
ATOM   4371  N  N    . PHE A 1 21 ? 2.451   -6.050  2.034   1.00 0.00 ? 21 PHE A N    8  
ATOM   4372  C  CA   . PHE A 1 21 ? 1.283   -6.837  2.392   1.00 0.00 ? 21 PHE A CA   8  
ATOM   4373  C  C    . PHE A 1 21 ? 1.367   -8.213  1.752   1.00 0.00 ? 21 PHE A C    8  
ATOM   4374  O  O    . PHE A 1 21 ? 1.889   -8.363  0.646   1.00 0.00 ? 21 PHE A O    8  
ATOM   4375  C  CB   . PHE A 1 21 ? 0.001   -6.136  1.929   1.00 0.00 ? 21 PHE A CB   8  
ATOM   4376  C  CG   . PHE A 1 21 ? -0.062  -4.688  2.315   1.00 0.00 ? 21 PHE A CG   8  
ATOM   4377  C  CD1  . PHE A 1 21 ? 0.525   -3.718  1.519   1.00 0.00 ? 21 PHE A CD1  8  
ATOM   4378  C  CD2  . PHE A 1 21 ? -0.693  -4.300  3.484   1.00 0.00 ? 21 PHE A CD2  8  
ATOM   4379  C  CE1  . PHE A 1 21 ? 0.488   -2.390  1.884   1.00 0.00 ? 21 PHE A CE1  8  
ATOM   4380  C  CE2  . PHE A 1 21 ? -0.737  -2.972  3.852   1.00 0.00 ? 21 PHE A CE2  8  
ATOM   4381  C  CZ   . PHE A 1 21 ? -0.143  -2.017  3.050   1.00 0.00 ? 21 PHE A CZ   8  
ATOM   4382  H  H    . PHE A 1 21 ? 2.755   -6.062  1.096   1.00 0.00 ? 21 PHE A H    8  
ATOM   4383  H  HA   . PHE A 1 21 ? 1.265   -6.943  3.467   1.00 0.00 ? 21 PHE A HA   8  
ATOM   4384  H  HB2  . PHE A 1 21 ? -0.065  -6.195  0.853   1.00 0.00 ? 21 PHE A HB2  8  
ATOM   4385  H  HB3  . PHE A 1 21 ? -0.852  -6.636  2.365   1.00 0.00 ? 21 PHE A HB3  8  
ATOM   4386  H  HD1  . PHE A 1 21 ? 1.025   -4.010  0.607   1.00 0.00 ? 21 PHE A HD1  8  
ATOM   4387  H  HD2  . PHE A 1 21 ? -1.159  -5.049  4.109   1.00 0.00 ? 21 PHE A HD2  8  
ATOM   4388  H  HE1  . PHE A 1 21 ? 0.949   -1.644  1.254   1.00 0.00 ? 21 PHE A HE1  8  
ATOM   4389  H  HE2  . PHE A 1 21 ? -1.233  -2.679  4.767   1.00 0.00 ? 21 PHE A HE2  8  
ATOM   4390  H  HZ   . PHE A 1 21 ? -0.166  -0.979  3.341   1.00 0.00 ? 21 PHE A HZ   8  
ATOM   4391  N  N    . SER A 1 22 ? 0.844   -9.213  2.436   1.00 0.00 ? 22 SER A N    8  
ATOM   4392  C  CA   . SER A 1 22 ? 0.831   -10.563 1.907   1.00 0.00 ? 22 SER A CA   8  
ATOM   4393  C  C    . SER A 1 22 ? -0.418  -10.775 1.058   1.00 0.00 ? 22 SER A C    8  
ATOM   4394  O  O    . SER A 1 22 ? -0.510  -11.726 0.282   1.00 0.00 ? 22 SER A O    8  
ATOM   4395  C  CB   . SER A 1 22 ? 0.876   -11.573 3.053   1.00 0.00 ? 22 SER A CB   8  
ATOM   4396  O  OG   . SER A 1 22 ? 0.856   -10.914 4.313   1.00 0.00 ? 22 SER A OG   8  
ATOM   4397  H  H    . SER A 1 22 ? 0.437   -9.038  3.315   1.00 0.00 ? 22 SER A H    8  
ATOM   4398  H  HA   . SER A 1 22 ? 1.709   -10.686 1.287   1.00 0.00 ? 22 SER A HA   8  
ATOM   4399  H  HB2  . SER A 1 22 ? 0.017   -12.225 2.989   1.00 0.00 ? 22 SER A HB2  8  
ATOM   4400  H  HB3  . SER A 1 22 ? 1.780   -12.158 2.980   1.00 0.00 ? 22 SER A HB3  8  
ATOM   4401  H  HG   . SER A 1 22 ? 0.088   -11.222 4.819   1.00 0.00 ? 22 SER A HG   8  
ATOM   4402  N  N    . ARG A 1 23 ? -1.371  -9.861  1.202   1.00 0.00 ? 23 ARG A N    8  
ATOM   4403  C  CA   . ARG A 1 23 ? -2.614  -9.917  0.450   1.00 0.00 ? 23 ARG A CA   8  
ATOM   4404  C  C    . ARG A 1 23 ? -2.725  -8.732  -0.495  1.00 0.00 ? 23 ARG A C    8  
ATOM   4405  O  O    . ARG A 1 23 ? -2.590  -7.581  -0.076  1.00 0.00 ? 23 ARG A O    8  
ATOM   4406  C  CB   . ARG A 1 23 ? -3.816  -9.916  1.397   1.00 0.00 ? 23 ARG A CB   8  
ATOM   4407  C  CG   . ARG A 1 23 ? -3.762  -10.989 2.471   1.00 0.00 ? 23 ARG A CG   8  
ATOM   4408  C  CD   . ARG A 1 23 ? -4.945  -10.881 3.424   1.00 0.00 ? 23 ARG A CD   8  
ATOM   4409  N  NE   . ARG A 1 23 ? -6.222  -10.769 2.716   1.00 0.00 ? 23 ARG A NE   8  
ATOM   4410  C  CZ   . ARG A 1 23 ? -6.938  -11.813 2.294   1.00 0.00 ? 23 ARG A CZ   8  
ATOM   4411  N  NH1  . ARG A 1 23 ? -6.543  -13.051 2.560   1.00 0.00 ? 23 ARG A NH1  8  
ATOM   4412  N  NH2  . ARG A 1 23 ? -8.070  -11.618 1.628   1.00 0.00 ? 23 ARG A NH2  8  
ATOM   4413  H  H    . ARG A 1 23 ? -1.226  -9.119  1.826   1.00 0.00 ? 23 ARG A H    8  
ATOM   4414  H  HA   . ARG A 1 23 ? -2.620  -10.826 -0.132  1.00 0.00 ? 23 ARG A HA   8  
ATOM   4415  H  HB2  . ARG A 1 23 ? -3.873  -8.955  1.885   1.00 0.00 ? 23 ARG A HB2  8  
ATOM   4416  H  HB3  . ARG A 1 23 ? -4.714  -10.067 0.815   1.00 0.00 ? 23 ARG A HB3  8  
ATOM   4417  H  HG2  . ARG A 1 23 ? -3.781  -11.960 1.998   1.00 0.00 ? 23 ARG A HG2  8  
ATOM   4418  H  HG3  . ARG A 1 23 ? -2.846  -10.875 3.034   1.00 0.00 ? 23 ARG A HG3  8  
ATOM   4419  H  HD2  . ARG A 1 23 ? -4.967  -11.762 4.048   1.00 0.00 ? 23 ARG A HD2  8  
ATOM   4420  H  HD3  . ARG A 1 23 ? -4.810  -10.006 4.044   1.00 0.00 ? 23 ARG A HD3  8  
ATOM   4421  H  HE   . ARG A 1 23 ? -6.562  -9.854  2.535   1.00 0.00 ? 23 ARG A HE   8  
ATOM   4422  H  HH11 . ARG A 1 23 ? -5.704  -13.216 3.088   1.00 0.00 ? 23 ARG A HH11 8  
ATOM   4423  H  HH12 . ARG A 1 23 ? -7.083  -13.833 2.223   1.00 0.00 ? 23 ARG A HH12 8  
ATOM   4424  H  HH21 . ARG A 1 23 ? -8.393  -10.688 1.442   1.00 0.00 ? 23 ARG A HH21 8  
ATOM   4425  H  HH22 . ARG A 1 23 ? -8.602  -12.404 1.301   1.00 0.00 ? 23 ARG A HH22 8  
ATOM   4426  N  N    . SER A 1 24 ? -3.110  -9.018  -1.729  1.00 0.00 ? 24 SER A N    8  
ATOM   4427  C  CA   . SER A 1 24 ? -3.402  -7.982  -2.707  1.00 0.00 ? 24 SER A CA   8  
ATOM   4428  C  C    . SER A 1 24 ? -4.609  -7.169  -2.242  1.00 0.00 ? 24 SER A C    8  
ATOM   4429  O  O    . SER A 1 24 ? -4.724  -5.973  -2.518  1.00 0.00 ? 24 SER A O    8  
ATOM   4430  C  CB   . SER A 1 24 ? -3.685  -8.620  -4.069  1.00 0.00 ? 24 SER A CB   8  
ATOM   4431  O  OG   . SER A 1 24 ? -2.824  -8.111  -5.073  1.00 0.00 ? 24 SER A OG   8  
ATOM   4432  H  H    . SER A 1 24 ? -3.296  -9.956  -1.963  1.00 0.00 ? 24 SER A H    8  
ATOM   4433  H  HA   . SER A 1 24 ? -2.539  -7.335  -2.782  1.00 0.00 ? 24 SER A HA   8  
ATOM   4434  H  HB2  . SER A 1 24 ? -3.539  -9.687  -3.998  1.00 0.00 ? 24 SER A HB2  8  
ATOM   4435  H  HB3  . SER A 1 24 ? -4.706  -8.420  -4.348  1.00 0.00 ? 24 SER A HB3  8  
ATOM   4436  H  HG   . SER A 1 24 ? -2.734  -7.151  -4.969  1.00 0.00 ? 24 SER A HG   8  
ATOM   4437  N  N    . ASP A 1 25 ? -5.471  -7.830  -1.480  1.00 0.00 ? 25 ASP A N    8  
ATOM   4438  C  CA   . ASP A 1 25 ? -6.642  -7.199  -0.896  1.00 0.00 ? 25 ASP A CA   8  
ATOM   4439  C  C    . ASP A 1 25 ? -6.230  -6.152  0.130   1.00 0.00 ? 25 ASP A C    8  
ATOM   4440  O  O    . ASP A 1 25 ? -6.692  -5.014  0.090   1.00 0.00 ? 25 ASP A O    8  
ATOM   4441  C  CB   . ASP A 1 25 ? -7.521  -8.279  -0.258  1.00 0.00 ? 25 ASP A CB   8  
ATOM   4442  C  CG   . ASP A 1 25 ? -7.993  -7.948  1.146   1.00 0.00 ? 25 ASP A CG   8  
ATOM   4443  O  OD1  . ASP A 1 25 ? -9.053  -7.304  1.288   1.00 0.00 ? 25 ASP A OD1  8  
ATOM   4444  O  OD2  . ASP A 1 25 ? -7.328  -8.377  2.113   1.00 0.00 ? 25 ASP A OD2  8  
ATOM   4445  H  H    . ASP A 1 25 ? -5.302  -8.778  -1.283  1.00 0.00 ? 25 ASP A H    8  
ATOM   4446  H  HA   . ASP A 1 25 ? -7.191  -6.717  -1.689  1.00 0.00 ? 25 ASP A HA   8  
ATOM   4447  H  HB2  . ASP A 1 25 ? -8.385  -8.426  -0.873  1.00 0.00 ? 25 ASP A HB2  8  
ATOM   4448  H  HB3  . ASP A 1 25 ? -6.960  -9.200  -0.215  1.00 0.00 ? 25 ASP A HB3  8  
ATOM   4449  N  N    . HIS A 1 26 ? -5.338  -6.545  1.029   1.00 0.00 ? 26 HIS A N    8  
ATOM   4450  C  CA   . HIS A 1 26 ? -4.848  -5.647  2.073   1.00 0.00 ? 26 HIS A CA   8  
ATOM   4451  C  C    . HIS A 1 26 ? -4.077  -4.486  1.463   1.00 0.00 ? 26 HIS A C    8  
ATOM   4452  O  O    . HIS A 1 26 ? -4.197  -3.348  1.920   1.00 0.00 ? 26 HIS A O    8  
ATOM   4453  C  CB   . HIS A 1 26 ? -3.974  -6.397  3.082   1.00 0.00 ? 26 HIS A CB   8  
ATOM   4454  C  CG   . HIS A 1 26 ? -4.681  -6.680  4.374   1.00 0.00 ? 26 HIS A CG   8  
ATOM   4455  N  ND1  . HIS A 1 26 ? -4.104  -6.511  5.616   1.00 0.00 ? 26 HIS A ND1  8  
ATOM   4456  C  CD2  . HIS A 1 26 ? -5.942  -7.112  4.606   1.00 0.00 ? 26 HIS A CD2  8  
ATOM   4457  C  CE1  . HIS A 1 26 ? -4.982  -6.826  6.551   1.00 0.00 ? 26 HIS A CE1  8  
ATOM   4458  N  NE2  . HIS A 1 26 ? -6.104  -7.192  5.963   1.00 0.00 ? 26 HIS A NE2  8  
ATOM   4459  H  H    . HIS A 1 26 ? -5.021  -7.471  1.000   1.00 0.00 ? 26 HIS A H    8  
ATOM   4460  H  HA   . HIS A 1 26 ? -5.711  -5.251  2.588   1.00 0.00 ? 26 HIS A HA   8  
ATOM   4461  H  HB2  . HIS A 1 26 ? -3.668  -7.341  2.656   1.00 0.00 ? 26 HIS A HB2  8  
ATOM   4462  H  HB3  . HIS A 1 26 ? -3.097  -5.804  3.303   1.00 0.00 ? 26 HIS A HB3  8  
ATOM   4463  H  HD1  . HIS A 1 26 ? -3.183  -6.193  5.790   1.00 0.00 ? 26 HIS A HD1  8  
ATOM   4464  H  HD2  . HIS A 1 26 ? -6.685  -7.349  3.856   1.00 0.00 ? 26 HIS A HD2  8  
ATOM   4465  H  HE1  . HIS A 1 26 ? -4.812  -6.785  7.616   1.00 0.00 ? 26 HIS A HE1  8  
ATOM   4466  H  HE2  . HIS A 1 26 ? -6.961  -7.358  6.428   1.00 0.00 ? 26 HIS A HE2  8  
ATOM   4467  N  N    . LEU A 1 27 ? -3.386  -4.761  0.358   1.00 0.00 ? 27 LEU A N    8  
ATOM   4468  C  CA   . LEU A 1 27 ? -2.727  -3.715  -0.412  1.00 0.00 ? 27 LEU A CA   8  
ATOM   4469  C  C    . LEU A 1 27 ? -3.745  -2.655  -0.810  1.00 0.00 ? 27 LEU A C    8  
ATOM   4470  O  O    . LEU A 1 27 ? -3.626  -1.486  -0.438  1.00 0.00 ? 27 LEU A O    8  
ATOM   4471  C  CB   . LEU A 1 27 ? -2.093  -4.295  -1.682  1.00 0.00 ? 27 LEU A CB   8  
ATOM   4472  C  CG   . LEU A 1 27 ? -1.116  -3.373  -2.434  1.00 0.00 ? 27 LEU A CG   8  
ATOM   4473  C  CD1  . LEU A 1 27 ? -0.615  -2.240  -1.550  1.00 0.00 ? 27 LEU A CD1  8  
ATOM   4474  C  CD2  . LEU A 1 27 ? 0.048   -4.165  -2.991  1.00 0.00 ? 27 LEU A CD2  8  
ATOM   4475  H  H    . LEU A 1 27 ? -3.401  -5.675  0.003   1.00 0.00 ? 27 LEU A H    8  
ATOM   4476  H  HA   . LEU A 1 27 ? -1.961  -3.267  0.201   1.00 0.00 ? 27 LEU A HA   8  
ATOM   4477  H  HB2  . LEU A 1 27 ? -1.563  -5.196  -1.413  1.00 0.00 ? 27 LEU A HB2  8  
ATOM   4478  H  HB3  . LEU A 1 27 ? -2.892  -4.561  -2.361  1.00 0.00 ? 27 LEU A HB3  8  
ATOM   4479  H  HG   . LEU A 1 27 ? -1.639  -2.927  -3.269  1.00 0.00 ? 27 LEU A HG   8  
ATOM   4480  H  HD11 . LEU A 1 27 ? -0.417  -1.369  -2.159  1.00 0.00 ? 27 LEU A HD11 8  
ATOM   4481  H  HD12 . LEU A 1 27 ? -1.365  -2.000  -0.811  1.00 0.00 ? 27 LEU A HD12 8  
ATOM   4482  H  HD13 . LEU A 1 27 ? 0.296   -2.546  -1.054  1.00 0.00 ? 27 LEU A HD13 8  
ATOM   4483  H  HD21 . LEU A 1 27 ? 0.643   -3.530  -3.632  1.00 0.00 ? 27 LEU A HD21 8  
ATOM   4484  H  HD22 . LEU A 1 27 ? 0.660   -4.527  -2.177  1.00 0.00 ? 27 LEU A HD22 8  
ATOM   4485  H  HD23 . LEU A 1 27 ? -0.324  -5.004  -3.561  1.00 0.00 ? 27 LEU A HD23 8  
ATOM   4486  N  N    . ALA A 1 28 ? -4.743  -3.084  -1.578  1.00 0.00 ? 28 ALA A N    8  
ATOM   4487  C  CA   . ALA A 1 28 ? -5.788  -2.193  -2.059  1.00 0.00 ? 28 ALA A CA   8  
ATOM   4488  C  C    . ALA A 1 28 ? -6.479  -1.478  -0.904  1.00 0.00 ? 28 ALA A C    8  
ATOM   4489  O  O    . ALA A 1 28 ? -6.737  -0.282  -0.989  1.00 0.00 ? 28 ALA A O    8  
ATOM   4490  C  CB   . ALA A 1 28 ? -6.799  -2.965  -2.890  1.00 0.00 ? 28 ALA A CB   8  
ATOM   4491  H  H    . ALA A 1 28 ? -4.770  -4.032  -1.839  1.00 0.00 ? 28 ALA A H    8  
ATOM   4492  H  HA   . ALA A 1 28 ? -5.321  -1.454  -2.698  1.00 0.00 ? 28 ALA A HA   8  
ATOM   4493  H  HB1  . ALA A 1 28 ? -6.283  -3.524  -3.658  1.00 0.00 ? 28 ALA A HB1  8  
ATOM   4494  H  HB2  . ALA A 1 28 ? -7.344  -3.646  -2.253  1.00 0.00 ? 28 ALA A HB2  8  
ATOM   4495  H  HB3  . ALA A 1 28 ? -7.488  -2.273  -3.350  1.00 0.00 ? 28 ALA A HB3  8  
ATOM   4496  N  N    . LEU A 1 29 ? -6.754  -2.207  0.176   1.00 0.00 ? 29 LEU A N    8  
ATOM   4497  C  CA   . LEU A 1 29 ? -7.406  -1.631  1.354   1.00 0.00 ? 29 LEU A CA   8  
ATOM   4498  C  C    . LEU A 1 29 ? -6.645  -0.411  1.861   1.00 0.00 ? 29 LEU A C    8  
ATOM   4499  O  O    . LEU A 1 29 ? -7.241  0.628   2.152   1.00 0.00 ? 29 LEU A O    8  
ATOM   4500  C  CB   . LEU A 1 29 ? -7.519  -2.665  2.469   1.00 0.00 ? 29 LEU A CB   8  
ATOM   4501  C  CG   . LEU A 1 29 ? -8.555  -3.768  2.235   1.00 0.00 ? 29 LEU A CG   8  
ATOM   4502  C  CD1  . LEU A 1 29 ? -8.555  -4.744  3.400   1.00 0.00 ? 29 LEU A CD1  8  
ATOM   4503  C  CD2  . LEU A 1 29 ? -9.943  -3.168  2.038   1.00 0.00 ? 29 LEU A CD2  8  
ATOM   4504  H  H    . LEU A 1 29 ? -6.522  -3.163  0.180   1.00 0.00 ? 29 LEU A H    8  
ATOM   4505  H  HA   . LEU A 1 29 ? -8.397  -1.325  1.067   1.00 0.00 ? 29 LEU A HA   8  
ATOM   4506  H  HB2  . LEU A 1 29 ? -6.554  -3.127  2.602   1.00 0.00 ? 29 LEU A HB2  8  
ATOM   4507  H  HB3  . LEU A 1 29 ? -7.782  -2.147  3.378   1.00 0.00 ? 29 LEU A HB3  8  
ATOM   4508  H  HG   . LEU A 1 29 ? -8.295  -4.315  1.340   1.00 0.00 ? 29 LEU A HG   8  
ATOM   4509  H  HD11 . LEU A 1 29 ? -9.231  -5.559  3.187   1.00 0.00 ? 29 LEU A HD11 8  
ATOM   4510  H  HD12 . LEU A 1 29 ? -7.557  -5.132  3.544   1.00 0.00 ? 29 LEU A HD12 8  
ATOM   4511  H  HD13 . LEU A 1 29 ? -8.875  -4.235  4.298   1.00 0.00 ? 29 LEU A HD13 8  
ATOM   4512  H  HD21 . LEU A 1 29 ? -10.234 -2.630  2.927   1.00 0.00 ? 29 LEU A HD21 8  
ATOM   4513  H  HD22 . LEU A 1 29 ? -9.924  -2.490  1.197   1.00 0.00 ? 29 LEU A HD22 8  
ATOM   4514  H  HD23 . LEU A 1 29 ? -10.655 -3.958  1.846   1.00 0.00 ? 29 LEU A HD23 8  
ATOM   4515  N  N    . HIS A 1 30 ? -5.325  -0.511  1.884   1.00 0.00 ? 30 HIS A N    8  
ATOM   4516  C  CA   . HIS A 1 30 ? -4.488  0.616   2.265   1.00 0.00 ? 30 HIS A CA   8  
ATOM   4517  C  C    . HIS A 1 30 ? -4.486  1.663   1.153   1.00 0.00 ? 30 HIS A C    8  
ATOM   4518  O  O    . HIS A 1 30 ? -4.489  2.869   1.410   1.00 0.00 ? 30 HIS A O    8  
ATOM   4519  C  CB   . HIS A 1 30 ? -3.048  0.155   2.562   1.00 0.00 ? 30 HIS A CB   8  
ATOM   4520  C  CG   . HIS A 1 30 ? -2.009  1.208   2.303   1.00 0.00 ? 30 HIS A CG   8  
ATOM   4521  N  ND1  . HIS A 1 30 ? -1.855  2.331   3.076   1.00 0.00 ? 30 HIS A ND1  8  
ATOM   4522  C  CD2  . HIS A 1 30 ? -1.101  1.318   1.299   1.00 0.00 ? 30 HIS A CD2  8  
ATOM   4523  C  CE1  . HIS A 1 30 ? -0.891  3.078   2.531   1.00 0.00 ? 30 HIS A CE1  8  
ATOM   4524  N  NE2  . HIS A 1 30 ? -0.395  2.510   1.450   1.00 0.00 ? 30 HIS A NE2  8  
ATOM   4525  H  H    . HIS A 1 30 ? -4.903  -1.346  1.584   1.00 0.00 ? 30 HIS A H    8  
ATOM   4526  H  HA   . HIS A 1 30 ? -4.906  1.057   3.155   1.00 0.00 ? 30 HIS A HA   8  
ATOM   4527  H  HB2  . HIS A 1 30 ? -2.976  -0.130  3.600   1.00 0.00 ? 30 HIS A HB2  8  
ATOM   4528  H  HB3  . HIS A 1 30 ? -2.811  -0.699  1.944   1.00 0.00 ? 30 HIS A HB3  8  
ATOM   4529  H  HD1  . HIS A 1 30 ? -2.367  2.556   3.896   1.00 0.00 ? 30 HIS A HD1  8  
ATOM   4530  H  HD2  . HIS A 1 30 ? -0.941  0.602   0.506   1.00 0.00 ? 30 HIS A HD2  8  
ATOM   4531  H  HE1  . HIS A 1 30 ? -0.558  4.028   2.926   1.00 0.00 ? 30 HIS A HE1  8  
ATOM   4532  N  N    . ARG A 1 31 ? -4.424  1.192   -0.084  1.00 0.00 ? 31 ARG A N    8  
ATOM   4533  C  CA   . ARG A 1 31 ? -4.308  2.078   -1.230  1.00 0.00 ? 31 ARG A CA   8  
ATOM   4534  C  C    . ARG A 1 31 ? -5.628  2.776   -1.536  1.00 0.00 ? 31 ARG A C    8  
ATOM   4535  O  O    . ARG A 1 31 ? -5.695  3.636   -2.414  1.00 0.00 ? 31 ARG A O    8  
ATOM   4536  C  CB   . ARG A 1 31 ? -3.810  1.313   -2.452  1.00 0.00 ? 31 ARG A CB   8  
ATOM   4537  C  CG   . ARG A 1 31 ? -2.381  0.819   -2.298  1.00 0.00 ? 31 ARG A CG   8  
ATOM   4538  C  CD   . ARG A 1 31 ? -1.768  0.416   -3.626  1.00 0.00 ? 31 ARG A CD   8  
ATOM   4539  N  NE   . ARG A 1 31 ? -1.208  1.554   -4.351  1.00 0.00 ? 31 ARG A NE   8  
ATOM   4540  C  CZ   . ARG A 1 31 ? -1.331  1.726   -5.666  1.00 0.00 ? 31 ARG A CZ   8  
ATOM   4541  N  NH1  . ARG A 1 31 ? -1.942  0.806   -6.404  1.00 0.00 ? 31 ARG A NH1  8  
ATOM   4542  N  NH2  . ARG A 1 31 ? -0.808  2.797   -6.247  1.00 0.00 ? 31 ARG A NH2  8  
ATOM   4543  H  H    . ARG A 1 31 ? -4.408  0.219   -0.227  1.00 0.00 ? 31 ARG A H    8  
ATOM   4544  H  HA   . ARG A 1 31 ? -3.573  2.829   -0.975  1.00 0.00 ? 31 ARG A HA   8  
ATOM   4545  H  HB2  . ARG A 1 31 ? -4.451  0.461   -2.619  1.00 0.00 ? 31 ARG A HB2  8  
ATOM   4546  H  HB3  . ARG A 1 31 ? -3.854  1.966   -3.311  1.00 0.00 ? 31 ARG A HB3  8  
ATOM   4547  H  HG2  . ARG A 1 31 ? -1.786  1.606   -1.865  1.00 0.00 ? 31 ARG A HG2  8  
ATOM   4548  H  HG3  . ARG A 1 31 ? -2.379  -0.037  -1.639  1.00 0.00 ? 31 ARG A HG3  8  
ATOM   4549  H  HD2  . ARG A 1 31 ? -0.977  -0.297  -3.440  1.00 0.00 ? 31 ARG A HD2  8  
ATOM   4550  H  HD3  . ARG A 1 31 ? -2.532  -0.045  -4.235  1.00 0.00 ? 31 ARG A HD3  8  
ATOM   4551  H  HE   . ARG A 1 31 ? -0.712  2.222   -3.828  1.00 0.00 ? 31 ARG A HE   8  
ATOM   4552  H  HH11 . ARG A 1 31 ? -2.307  -0.033  -5.974  1.00 0.00 ? 31 ARG A HH11 8  
ATOM   4553  H  HH12 . ARG A 1 31 ? -2.051  0.941   -7.394  1.00 0.00 ? 31 ARG A HH12 8  
ATOM   4554  H  HH21 . ARG A 1 31 ? -0.315  3.490   -5.698  1.00 0.00 ? 31 ARG A HH21 8  
ATOM   4555  H  HH22 . ARG A 1 31 ? -0.892  2.924   -7.244  1.00 0.00 ? 31 ARG A HH22 8  
ATOM   4556  N  N    . LYS A 1 32 ? -6.639  2.505   -0.717  1.00 0.00 ? 32 LYS A N    8  
ATOM   4557  C  CA   . LYS A 1 32 ? -7.902  3.218   -0.806  1.00 0.00 ? 32 LYS A CA   8  
ATOM   4558  C  C    . LYS A 1 32 ? -7.694  4.657   -0.364  1.00 0.00 ? 32 LYS A C    8  
ATOM   4559  O  O    . LYS A 1 32 ? -8.372  5.575   -0.830  1.00 0.00 ? 32 LYS A O    8  
ATOM   4560  C  CB   . LYS A 1 32 ? -8.964  2.545   0.063   1.00 0.00 ? 32 LYS A CB   8  
ATOM   4561  C  CG   . LYS A 1 32 ? -10.058 1.862   -0.738  1.00 0.00 ? 32 LYS A CG   8  
ATOM   4562  C  CD   . LYS A 1 32 ? -9.500  0.768   -1.633  1.00 0.00 ? 32 LYS A CD   8  
ATOM   4563  C  CE   . LYS A 1 32 ? -10.017 -0.601  -1.227  1.00 0.00 ? 32 LYS A CE   8  
ATOM   4564  N  NZ   . LYS A 1 32 ? -10.904 -1.190  -2.264  1.00 0.00 ? 32 LYS A NZ   8  
ATOM   4565  H  H    . LYS A 1 32 ? -6.503  1.863   0.015   1.00 0.00 ? 32 LYS A H    8  
ATOM   4566  H  HA   . LYS A 1 32 ? -8.224  3.206   -1.836  1.00 0.00 ? 32 LYS A HA   8  
ATOM   4567  H  HB2  . LYS A 1 32 ? -8.487  1.803   0.687   1.00 0.00 ? 32 LYS A HB2  8  
ATOM   4568  H  HB3  . LYS A 1 32 ? -9.421  3.292   0.692   1.00 0.00 ? 32 LYS A HB3  8  
ATOM   4569  H  HG2  . LYS A 1 32 ? -10.771 1.425   -0.056  1.00 0.00 ? 32 LYS A HG2  8  
ATOM   4570  H  HG3  . LYS A 1 32 ? -10.552 2.599   -1.354  1.00 0.00 ? 32 LYS A HG3  8  
ATOM   4571  H  HD2  . LYS A 1 32 ? -9.793  0.966   -2.652  1.00 0.00 ? 32 LYS A HD2  8  
ATOM   4572  H  HD3  . LYS A 1 32 ? -8.420  0.771   -1.558  1.00 0.00 ? 32 LYS A HD3  8  
ATOM   4573  H  HE2  . LYS A 1 32 ? -9.174  -1.260  -1.072  1.00 0.00 ? 32 LYS A HE2  8  
ATOM   4574  H  HE3  . LYS A 1 32 ? -10.570 -0.504  -0.305  1.00 0.00 ? 32 LYS A HE3  8  
ATOM   4575  H  HZ1  . LYS A 1 32 ? -11.112 -0.482  -3.002  1.00 0.00 ? 32 LYS A HZ1  8  
ATOM   4576  H  HZ2  . LYS A 1 32 ? -11.803 -1.496  -1.833  1.00 0.00 ? 32 LYS A HZ2  8  
ATOM   4577  H  HZ3  . LYS A 1 32 ? -10.445 -2.016  -2.708  1.00 0.00 ? 32 LYS A HZ3  8  
ATOM   4578  N  N    . ARG A 1 33 ? -6.678  4.854   0.469   1.00 0.00 ? 33 ARG A N    8  
ATOM   4579  C  CA   . ARG A 1 33 ? -6.300  6.176   0.932   1.00 0.00 ? 33 ARG A CA   8  
ATOM   4580  C  C    . ARG A 1 33 ? -5.560  6.933   -0.163  1.00 0.00 ? 33 ARG A C    8  
ATOM   4581  O  O    . ARG A 1 33 ? -5.457  8.158   -0.129  1.00 0.00 ? 33 ARG A O    8  
ATOM   4582  C  CB   . ARG A 1 33 ? -5.414  6.061   2.171   1.00 0.00 ? 33 ARG A CB   8  
ATOM   4583  C  CG   . ARG A 1 33 ? -6.160  5.617   3.420   1.00 0.00 ? 33 ARG A CG   8  
ATOM   4584  C  CD   . ARG A 1 33 ? -6.648  6.804   4.238   1.00 0.00 ? 33 ARG A CD   8  
ATOM   4585  N  NE   . ARG A 1 33 ? -5.801  7.984   4.064   1.00 0.00 ? 33 ARG A NE   8  
ATOM   4586  C  CZ   . ARG A 1 33 ? -6.266  9.230   3.976   1.00 0.00 ? 33 ARG A CZ   8  
ATOM   4587  N  NH1  . ARG A 1 33 ? -7.568  9.465   4.072   1.00 0.00 ? 33 ARG A NH1  8  
ATOM   4588  N  NH2  . ARG A 1 33 ? -5.425  10.237  3.788   1.00 0.00 ? 33 ARG A NH2  8  
ATOM   4589  H  H    . ARG A 1 33 ? -6.139  4.083   0.751   1.00 0.00 ? 33 ARG A H    8  
ATOM   4590  H  HA   . ARG A 1 33 ? -7.198  6.712   1.181   1.00 0.00 ? 33 ARG A HA   8  
ATOM   4591  H  HB2  . ARG A 1 33 ? -4.632  5.345   1.973   1.00 0.00 ? 33 ARG A HB2  8  
ATOM   4592  H  HB3  . ARG A 1 33 ? -4.966  7.023   2.368   1.00 0.00 ? 33 ARG A HB3  8  
ATOM   4593  H  HG2  . ARG A 1 33 ? -7.012  5.023   3.125   1.00 0.00 ? 33 ARG A HG2  8  
ATOM   4594  H  HG3  . ARG A 1 33 ? -5.497  5.019   4.029   1.00 0.00 ? 33 ARG A HG3  8  
ATOM   4595  H  HD2  . ARG A 1 33 ? -7.653  7.047   3.926   1.00 0.00 ? 33 ARG A HD2  8  
ATOM   4596  H  HD3  . ARG A 1 33 ? -6.654  6.528   5.283   1.00 0.00 ? 33 ARG A HD3  8  
ATOM   4597  H  HE   . ARG A 1 33 ? -4.825  7.835   4.000   1.00 0.00 ? 33 ARG A HE   8  
ATOM   4598  H  HH11 . ARG A 1 33 ? -8.213  8.703   4.209   1.00 0.00 ? 33 ARG A HH11 8  
ATOM   4599  H  HH12 . ARG A 1 33 ? -7.922  10.407  4.007   1.00 0.00 ? 33 ARG A HH12 8  
ATOM   4600  H  HH21 . ARG A 1 33 ? -4.442  10.063  3.711   1.00 0.00 ? 33 ARG A HH21 8  
ATOM   4601  H  HH22 . ARG A 1 33 ? -5.771  11.182  3.716   1.00 0.00 ? 33 ARG A HH22 8  
ATOM   4602  N  N    . HIS A 1 34 ? -5.093  6.200   -1.160  1.00 0.00 ? 34 HIS A N    8  
ATOM   4603  C  CA   . HIS A 1 34 ? -4.385  6.799   -2.282  1.00 0.00 ? 34 HIS A CA   8  
ATOM   4604  C  C    . HIS A 1 34 ? -5.368  7.257   -3.349  1.00 0.00 ? 34 HIS A C    8  
ATOM   4605  O  O    . HIS A 1 34 ? -4.994  7.940   -4.301  1.00 0.00 ? 34 HIS A O    8  
ATOM   4606  C  CB   . HIS A 1 34 ? -3.377  5.808   -2.873  1.00 0.00 ? 34 HIS A CB   8  
ATOM   4607  C  CG   . HIS A 1 34 ? -2.191  5.574   -1.991  1.00 0.00 ? 34 HIS A CG   8  
ATOM   4608  N  ND1  . HIS A 1 34 ? -1.397  6.584   -1.498  1.00 0.00 ? 34 HIS A ND1  8  
ATOM   4609  C  CD2  . HIS A 1 34 ? -1.683  4.417   -1.480  1.00 0.00 ? 34 HIS A CD2  8  
ATOM   4610  C  CE1  . HIS A 1 34 ? -0.459  6.026   -0.722  1.00 0.00 ? 34 HIS A CE1  8  
ATOM   4611  N  NE2  . HIS A 1 34 ? -0.592  4.714   -0.677  1.00 0.00 ? 34 HIS A NE2  8  
ATOM   4612  H  H    . HIS A 1 34 ? -5.259  5.232   -1.161  1.00 0.00 ? 34 HIS A H    8  
ATOM   4613  H  HA   . HIS A 1 34 ? -3.850  7.660   -1.910  1.00 0.00 ? 34 HIS A HA   8  
ATOM   4614  H  HB2  . HIS A 1 34 ? -3.867  4.858   -3.035  1.00 0.00 ? 34 HIS A HB2  8  
ATOM   4615  H  HB3  . HIS A 1 34 ? -3.023  6.191   -3.819  1.00 0.00 ? 34 HIS A HB3  8  
ATOM   4616  H  HD1  . HIS A 1 34 ? -1.488  7.542   -1.694  1.00 0.00 ? 34 HIS A HD1  8  
ATOM   4617  H  HD2  . HIS A 1 34 ? -2.046  3.415   -1.678  1.00 0.00 ? 34 HIS A HD2  8  
ATOM   4618  H  HE1  . HIS A 1 34 ? 0.304   6.580   -0.195  1.00 0.00 ? 34 HIS A HE1  8  
ATOM   4619  N  N    . MET A 1 35 ? -6.640  6.945   -3.134  1.00 0.00 ? 35 MET A N    8  
ATOM   4620  C  CA   . MET A 1 35 ? -7.702  7.381   -4.033  1.00 0.00 ? 35 MET A CA   8  
ATOM   4621  C  C    . MET A 1 35 ? -8.129  8.804   -3.695  1.00 0.00 ? 35 MET A C    8  
ATOM   4622  O  O    . MET A 1 35 ? -8.866  9.440   -4.447  1.00 0.00 ? 35 MET A O    8  
ATOM   4623  C  CB   . MET A 1 35 ? -8.899  6.435   -3.943  1.00 0.00 ? 35 MET A CB   8  
ATOM   4624  C  CG   . MET A 1 35 ? -8.656  5.087   -4.601  1.00 0.00 ? 35 MET A CG   8  
ATOM   4625  S  SD   . MET A 1 35 ? -10.113 4.025   -4.583  1.00 0.00 ? 35 MET A SD   8  
ATOM   4626  C  CE   . MET A 1 35 ? -11.100 4.786   -5.870  1.00 0.00 ? 35 MET A CE   8  
ATOM   4627  H  H    . MET A 1 35 ? -6.877  6.445   -2.323  1.00 0.00 ? 35 MET A H    8  
ATOM   4628  H  HA   . MET A 1 35 ? -7.315  7.364   -5.040  1.00 0.00 ? 35 MET A HA   8  
ATOM   4629  H  HB2  . MET A 1 35 ? -9.132  6.266   -2.903  1.00 0.00 ? 35 MET A HB2  8  
ATOM   4630  H  HB3  . MET A 1 35 ? -9.748  6.899   -4.423  1.00 0.00 ? 35 MET A HB3  8  
ATOM   4631  H  HG2  . MET A 1 35 ? -8.361  5.253   -5.627  1.00 0.00 ? 35 MET A HG2  8  
ATOM   4632  H  HG3  . MET A 1 35 ? -7.856  4.585   -4.076  1.00 0.00 ? 35 MET A HG3  8  
ATOM   4633  H  HE1  . MET A 1 35 ? -11.078 4.165   -6.755  1.00 0.00 ? 35 MET A HE1  8  
ATOM   4634  H  HE2  . MET A 1 35 ? -12.119 4.888   -5.527  1.00 0.00 ? 35 MET A HE2  8  
ATOM   4635  H  HE3  . MET A 1 35 ? -10.698 5.761   -6.104  1.00 0.00 ? 35 MET A HE3  8  
ATOM   4636  N  N    . LEU A 1 36 ? -7.590  9.326   -2.601  1.00 0.00 ? 36 LEU A N    8  
ATOM   4637  C  CA   . LEU A 1 36 ? -7.838  10.700  -2.203  1.00 0.00 ? 36 LEU A CA   8  
ATOM   4638  C  C    . LEU A 1 36 ? -6.509  11.407  -2.000  1.00 0.00 ? 36 LEU A C    8  
ATOM   4639  O  O    . LEU A 1 36 ? -6.236  11.966  -0.938  1.00 0.00 ? 36 LEU A O    8  
ATOM   4640  C  CB   . LEU A 1 36 ? -8.669  10.759  -0.916  1.00 0.00 ? 36 LEU A CB   8  
ATOM   4641  C  CG   . LEU A 1 36 ? -9.282  9.433   -0.458  1.00 0.00 ? 36 LEU A CG   8  
ATOM   4642  C  CD1  . LEU A 1 36 ? -8.634  8.971   0.836   1.00 0.00 ? 36 LEU A CD1  8  
ATOM   4643  C  CD2  . LEU A 1 36 ? -10.784 9.579   -0.280  1.00 0.00 ? 36 LEU A CD2  8  
ATOM   4644  H  H    . LEU A 1 36 ? -6.935  8.800   -2.095  1.00 0.00 ? 36 LEU A H    8  
ATOM   4645  H  HA   . LEU A 1 36 ? -8.379  11.187  -3.001  1.00 0.00 ? 36 LEU A HA   8  
ATOM   4646  H  HB2  . LEU A 1 36 ? -8.036  11.128  -0.125  1.00 0.00 ? 36 LEU A HB2  8  
ATOM   4647  H  HB3  . LEU A 1 36 ? -9.473  11.466  -1.066  1.00 0.00 ? 36 LEU A HB3  8  
ATOM   4648  H  HG   . LEU A 1 36 ? -9.104  8.679   -1.212  1.00 0.00 ? 36 LEU A HG   8  
ATOM   4649  H  HD11 . LEU A 1 36 ? -8.019  8.104   0.640   1.00 0.00 ? 36 LEU A HD11 8  
ATOM   4650  H  HD12 . LEU A 1 36 ? -8.020  9.766   1.236   1.00 0.00 ? 36 LEU A HD12 8  
ATOM   4651  H  HD13 . LEU A 1 36 ? -9.401  8.713   1.551   1.00 0.00 ? 36 LEU A HD13 8  
ATOM   4652  H  HD21 . LEU A 1 36 ? -11.156 8.770   0.329   1.00 0.00 ? 36 LEU A HD21 8  
ATOM   4653  H  HD22 . LEU A 1 36 ? -10.999 10.521  0.203   1.00 0.00 ? 36 LEU A HD22 8  
ATOM   4654  H  HD23 . LEU A 1 36 ? -11.265 9.554   -1.246  1.00 0.00 ? 36 LEU A HD23 8  
ATOM   4655  N  N    . VAL A 1 37 ? -5.670  11.343  -3.017  1.00 0.00 ? 37 VAL A N    8  
ATOM   4656  C  CA   . VAL A 1 37 ? -4.358  11.951  -2.960  1.00 0.00 ? 37 VAL A CA   8  
ATOM   4657  C  C    . VAL A 1 37 ? -4.349  13.232  -3.788  1.00 0.00 ? 37 VAL A C    8  
ATOM   4658  O  O    . VAL A 1 37 ? -3.738  14.229  -3.350  1.00 0.00 ? 37 VAL A O    8  
ATOM   4659  C  CB   . VAL A 1 37 ? -3.268  10.963  -3.455  1.00 0.00 ? 37 VAL A CB   8  
ATOM   4660  C  CG1  . VAL A 1 37 ? -2.069  11.689  -4.045  1.00 0.00 ? 37 VAL A CG1  8  
ATOM   4661  C  CG2  . VAL A 1 37 ? -2.825  10.053  -2.321  1.00 0.00 ? 37 VAL A CG2  8  
ATOM   4662  O  OXT  . VAL A 1 37 ? -4.984  13.245  -4.864  1.00 0.00 ? 37 VAL A OXT  8  
ATOM   4663  H  H    . VAL A 1 37 ? -5.942  10.870  -3.832  1.00 0.00 ? 37 VAL A H    8  
ATOM   4664  H  HA   . VAL A 1 37 ? -4.154  12.194  -1.929  1.00 0.00 ? 37 VAL A HA   8  
ATOM   4665  H  HB   . VAL A 1 37 ? -3.698  10.345  -4.228  1.00 0.00 ? 37 VAL A HB   8  
ATOM   4666  H  HG11 . VAL A 1 37 ? -2.390  12.306  -4.870  1.00 0.00 ? 37 VAL A HG11 8  
ATOM   4667  H  HG12 . VAL A 1 37 ? -1.613  12.310  -3.286  1.00 0.00 ? 37 VAL A HG12 8  
ATOM   4668  H  HG13 . VAL A 1 37 ? -1.348  10.964  -4.397  1.00 0.00 ? 37 VAL A HG13 8  
ATOM   4669  H  HG21 . VAL A 1 37 ? -3.570  9.287   -2.163  1.00 0.00 ? 37 VAL A HG21 8  
ATOM   4670  H  HG22 . VAL A 1 37 ? -1.883  9.591   -2.579  1.00 0.00 ? 37 VAL A HG22 8  
ATOM   4671  H  HG23 . VAL A 1 37 ? -2.706  10.633  -1.418  1.00 0.00 ? 37 VAL A HG23 8  
HETATM 4672  ZN ZN   . ZN  B 2 .  ? 0.705   3.470   0.111   1.00 0.00 ? 38 ZN  A ZN   8  
ATOM   4673  N  N    . GLY A 1 1  ? 10.554  1.781   -10.413 1.00 0.00 ? 1  GLY A N    9  
ATOM   4674  C  CA   . GLY A 1 1  ? 10.126  3.109   -9.920  1.00 0.00 ? 1  GLY A CA   9  
ATOM   4675  C  C    . GLY A 1 1  ? 9.682   3.062   -8.476  1.00 0.00 ? 1  GLY A C    9  
ATOM   4676  O  O    . GLY A 1 1  ? 10.079  3.907   -7.670  1.00 0.00 ? 1  GLY A O    9  
ATOM   4677  H  H1   . GLY A 1 1  ? 9.771   1.320   -10.923 1.00 0.00 ? 1  GLY A H1   9  
ATOM   4678  H  H2   . GLY A 1 1  ? 10.832  1.174   -9.613  1.00 0.00 ? 1  GLY A H2   9  
ATOM   4679  H  H3   . GLY A 1 1  ? 11.365  1.882   -11.060 1.00 0.00 ? 1  GLY A H3   9  
ATOM   4680  H  HA2  . GLY A 1 1  ? 10.952  3.799   -10.012 1.00 0.00 ? 1  GLY A HA2  9  
ATOM   4681  H  HA3  . GLY A 1 1  ? 9.306   3.461   -10.530 1.00 0.00 ? 1  GLY A HA3  9  
ATOM   4682  N  N    . SER A 1 2  ? 8.860   2.073   -8.146  1.00 0.00 ? 2  SER A N    9  
ATOM   4683  C  CA   . SER A 1 2  ? 8.348   1.913   -6.793  1.00 0.00 ? 2  SER A CA   9  
ATOM   4684  C  C    . SER A 1 2  ? 9.451   1.468   -5.833  1.00 0.00 ? 2  SER A C    9  
ATOM   4685  O  O    . SER A 1 2  ? 10.575  1.183   -6.254  1.00 0.00 ? 2  SER A O    9  
ATOM   4686  C  CB   . SER A 1 2  ? 7.203   0.899   -6.791  1.00 0.00 ? 2  SER A CB   9  
ATOM   4687  O  OG   . SER A 1 2  ? 6.717   0.681   -8.107  1.00 0.00 ? 2  SER A OG   9  
ATOM   4688  H  H    . SER A 1 2  ? 8.573   1.435   -8.837  1.00 0.00 ? 2  SER A H    9  
ATOM   4689  H  HA   . SER A 1 2  ? 7.969   2.870   -6.466  1.00 0.00 ? 2  SER A HA   9  
ATOM   4690  H  HB2  . SER A 1 2  ? 7.557   -0.040  -6.392  1.00 0.00 ? 2  SER A HB2  9  
ATOM   4691  H  HB3  . SER A 1 2  ? 6.395   1.271   -6.178  1.00 0.00 ? 2  SER A HB3  9  
ATOM   4692  H  HG   . SER A 1 2  ? 6.053   1.357   -8.322  1.00 0.00 ? 2  SER A HG   9  
ATOM   4693  N  N    . THR A 1 3  ? 9.125   1.480   -4.539  1.00 0.00 ? 3  THR A N    9  
ATOM   4694  C  CA   . THR A 1 3  ? 10.070  1.154   -3.473  1.00 0.00 ? 3  THR A CA   9  
ATOM   4695  C  C    . THR A 1 3  ? 10.966  2.347   -3.162  1.00 0.00 ? 3  THR A C    9  
ATOM   4696  O  O    . THR A 1 3  ? 11.963  2.595   -3.843  1.00 0.00 ? 3  THR A O    9  
ATOM   4697  C  CB   . THR A 1 3  ? 10.936  -0.086  -3.794  1.00 0.00 ? 3  THR A CB   9  
ATOM   4698  O  OG1  . THR A 1 3  ? 10.111  -1.150  -4.290  1.00 0.00 ? 3  THR A OG1  9  
ATOM   4699  C  CG2  . THR A 1 3  ? 11.676  -0.559  -2.555  1.00 0.00 ? 3  THR A CG2  9  
ATOM   4700  H  H    . THR A 1 3  ? 8.230   1.791   -4.288  1.00 0.00 ? 3  THR A H    9  
ATOM   4701  H  HA   . THR A 1 3  ? 9.489   0.930   -2.588  1.00 0.00 ? 3  THR A HA   9  
ATOM   4702  H  HB   . THR A 1 3  ? 11.659  0.182   -4.549  1.00 0.00 ? 3  THR A HB   9  
ATOM   4703  H  HG1  . THR A 1 3  ? 9.274   -1.163  -3.795  1.00 0.00 ? 3  THR A HG1  9  
ATOM   4704  H  HG21 . THR A 1 3  ? 12.681  -0.850  -2.823  1.00 0.00 ? 3  THR A HG21 9  
ATOM   4705  H  HG22 . THR A 1 3  ? 11.158  -1.405  -2.129  1.00 0.00 ? 3  THR A HG22 9  
ATOM   4706  H  HG23 . THR A 1 3  ? 11.715  0.240   -1.832  1.00 0.00 ? 3  THR A HG23 9  
ATOM   4707  N  N    . ARG A 1 4  ? 10.589  3.094   -2.134  1.00 0.00 ? 4  ARG A N    9  
ATOM   4708  C  CA   . ARG A 1 4  ? 11.342  4.268   -1.729  1.00 0.00 ? 4  ARG A CA   9  
ATOM   4709  C  C    . ARG A 1 4  ? 12.490  3.863   -0.818  1.00 0.00 ? 4  ARG A C    9  
ATOM   4710  O  O    . ARG A 1 4  ? 13.658  4.057   -1.151  1.00 0.00 ? 4  ARG A O    9  
ATOM   4711  C  CB   . ARG A 1 4  ? 10.434  5.276   -1.016  1.00 0.00 ? 4  ARG A CB   9  
ATOM   4712  C  CG   . ARG A 1 4  ? 8.951   5.071   -1.289  1.00 0.00 ? 4  ARG A CG   9  
ATOM   4713  C  CD   . ARG A 1 4  ? 8.245   6.382   -1.587  1.00 0.00 ? 4  ARG A CD   9  
ATOM   4714  N  NE   . ARG A 1 4  ? 8.800   7.051   -2.763  1.00 0.00 ? 4  ARG A NE   9  
ATOM   4715  C  CZ   . ARG A 1 4  ? 8.510   8.299   -3.120  1.00 0.00 ? 4  ARG A CZ   9  
ATOM   4716  N  NH1  . ARG A 1 4  ? 7.614   9.004   -2.435  1.00 0.00 ? 4  ARG A NH1  9  
ATOM   4717  N  NH2  . ARG A 1 4  ? 9.106   8.838   -4.178  1.00 0.00 ? 4  ARG A NH2  9  
ATOM   4718  H  H    . ARG A 1 4  ? 9.791   2.839   -1.623  1.00 0.00 ? 4  ARG A H    9  
ATOM   4719  H  HA   . ARG A 1 4  ? 11.747  4.725   -2.620  1.00 0.00 ? 4  ARG A HA   9  
ATOM   4720  H  HB2  . ARG A 1 4  ? 10.596  5.196   0.048   1.00 0.00 ? 4  ARG A HB2  9  
ATOM   4721  H  HB3  . ARG A 1 4  ? 10.702  6.272   -1.336  1.00 0.00 ? 4  ARG A HB3  9  
ATOM   4722  H  HG2  . ARG A 1 4  ? 8.841   4.416   -2.140  1.00 0.00 ? 4  ARG A HG2  9  
ATOM   4723  H  HG3  . ARG A 1 4  ? 8.495   4.615   -0.421  1.00 0.00 ? 4  ARG A HG3  9  
ATOM   4724  H  HD2  . ARG A 1 4  ? 7.198   6.179   -1.762  1.00 0.00 ? 4  ARG A HD2  9  
ATOM   4725  H  HD3  . ARG A 1 4  ? 8.346   7.033   -0.730  1.00 0.00 ? 4  ARG A HD3  9  
ATOM   4726  H  HE   . ARG A 1 4  ? 9.443   6.537   -3.314  1.00 0.00 ? 4  ARG A HE   9  
ATOM   4727  H  HH11 . ARG A 1 4  ? 7.145   8.594   -1.642  1.00 0.00 ? 4  ARG A HH11 9  
ATOM   4728  H  HH12 . ARG A 1 4  ? 7.397   9.951   -2.704  1.00 0.00 ? 4  ARG A HH12 9  
ATOM   4729  H  HH21 . ARG A 1 4  ? 9.773   8.303   -4.709  1.00 0.00 ? 4  ARG A HH21 9  
ATOM   4730  H  HH22 . ARG A 1 4  ? 8.894   9.779   -4.454  1.00 0.00 ? 4  ARG A HH22 9  
ATOM   4731  N  N    . GLY A 1 5  ? 12.159  3.233   0.301   1.00 0.00 ? 5  GLY A N    9  
ATOM   4732  C  CA   . GLY A 1 5  ? 13.183  2.768   1.209   1.00 0.00 ? 5  GLY A CA   9  
ATOM   4733  C  C    . GLY A 1 5  ? 12.650  2.476   2.591   1.00 0.00 ? 5  GLY A C    9  
ATOM   4734  O  O    . GLY A 1 5  ? 13.382  2.562   3.578   1.00 0.00 ? 5  GLY A O    9  
ATOM   4735  H  H    . GLY A 1 5  ? 11.207  3.057   0.496   1.00 0.00 ? 5  GLY A H    9  
ATOM   4736  H  HA2  . GLY A 1 5  ? 13.615  1.863   0.810   1.00 0.00 ? 5  GLY A HA2  9  
ATOM   4737  H  HA3  . GLY A 1 5  ? 13.954  3.522   1.282   1.00 0.00 ? 5  GLY A HA3  9  
ATOM   4738  N  N    . SER A 1 6  ? 11.420  2.012   2.647   1.00 0.00 ? 6  SER A N    9  
ATOM   4739  C  CA   . SER A 1 6  ? 10.832  1.559   3.885   1.00 0.00 ? 6  SER A CA   9  
ATOM   4740  C  C    . SER A 1 6  ? 11.055  0.055   3.997   1.00 0.00 ? 6  SER A C    9  
ATOM   4741  O  O    . SER A 1 6  ? 12.166  -0.432  3.761   1.00 0.00 ? 6  SER A O    9  
ATOM   4742  C  CB   . SER A 1 6  ? 9.342   1.925   3.909   1.00 0.00 ? 6  SER A CB   9  
ATOM   4743  O  OG   . SER A 1 6  ? 9.107   3.159   3.247   1.00 0.00 ? 6  SER A OG   9  
ATOM   4744  H  H    . SER A 1 6  ? 10.926  1.853   1.811   1.00 0.00 ? 6  SER A H    9  
ATOM   4745  H  HA   . SER A 1 6  ? 11.334  2.050   4.703   1.00 0.00 ? 6  SER A HA   9  
ATOM   4746  H  HB2  . SER A 1 6  ? 8.774   1.160   3.404   1.00 0.00 ? 6  SER A HB2  9  
ATOM   4747  H  HB3  . SER A 1 6  ? 9.007   2.009   4.933   1.00 0.00 ? 6  SER A HB3  9  
ATOM   4748  H  HG   . SER A 1 6  ? 9.180   3.022   2.285   1.00 0.00 ? 6  SER A HG   9  
ATOM   4749  N  N    . THR A 1 7  ? 10.003  -0.690  4.236   1.00 0.00 ? 7  THR A N    9  
ATOM   4750  C  CA   . THR A 1 7  ? 10.094  -2.132  4.254   1.00 0.00 ? 7  THR A CA   9  
ATOM   4751  C  C    . THR A 1 7  ? 9.149   -2.745  3.221   1.00 0.00 ? 7  THR A C    9  
ATOM   4752  O  O    . THR A 1 7  ? 8.073   -3.246  3.564   1.00 0.00 ? 7  THR A O    9  
ATOM   4753  C  CB   . THR A 1 7  ? 9.793   -2.680  5.657   1.00 0.00 ? 7  THR A CB   9  
ATOM   4754  O  OG1  . THR A 1 7  ? 8.985   -1.746  6.388   1.00 0.00 ? 7  THR A OG1  9  
ATOM   4755  C  CG2  . THR A 1 7  ? 11.087  -2.917  6.408   1.00 0.00 ? 7  THR A CG2  9  
ATOM   4756  H  H    . THR A 1 7  ? 9.136   -0.268  4.361   1.00 0.00 ? 7  THR A H    9  
ATOM   4757  H  HA   . THR A 1 7  ? 11.107  -2.401  3.997   1.00 0.00 ? 7  THR A HA   9  
ATOM   4758  H  HB   . THR A 1 7  ? 9.266   -3.619  5.564   1.00 0.00 ? 7  THR A HB   9  
ATOM   4759  H  HG1  . THR A 1 7  ? 8.249   -2.220  6.809   1.00 0.00 ? 7  THR A HG1  9  
ATOM   4760  H  HG21 . THR A 1 7  ? 10.914  -2.804  7.469   1.00 0.00 ? 7  THR A HG21 9  
ATOM   4761  H  HG22 . THR A 1 7  ? 11.822  -2.191  6.084   1.00 0.00 ? 7  THR A HG22 9  
ATOM   4762  H  HG23 . THR A 1 7  ? 11.448  -3.913  6.204   1.00 0.00 ? 7  THR A HG23 9  
ATOM   4763  N  N    . GLY A 1 8  ? 9.554   -2.669  1.952   1.00 0.00 ? 8  GLY A N    9  
ATOM   4764  C  CA   . GLY A 1 8  ? 8.748   -3.186  0.859   1.00 0.00 ? 8  GLY A CA   9  
ATOM   4765  C  C    . GLY A 1 8  ? 8.827   -4.695  0.747   1.00 0.00 ? 8  GLY A C    9  
ATOM   4766  O  O    . GLY A 1 8  ? 9.141   -5.244  -0.312  1.00 0.00 ? 8  GLY A O    9  
ATOM   4767  H  H    . GLY A 1 8  ? 10.408  -2.229  1.753   1.00 0.00 ? 8  GLY A H    9  
ATOM   4768  H  HA2  . GLY A 1 8  ? 7.719   -2.904  1.020   1.00 0.00 ? 8  GLY A HA2  9  
ATOM   4769  H  HA3  . GLY A 1 8  ? 9.091   -2.748  -0.067  1.00 0.00 ? 8  GLY A HA3  9  
ATOM   4770  N  N    . ILE A 1 9  ? 8.535   -5.355  1.850   1.00 0.00 ? 9  ILE A N    9  
ATOM   4771  C  CA   . ILE A 1 9  ? 8.518   -6.804  1.917   1.00 0.00 ? 9  ILE A CA   9  
ATOM   4772  C  C    . ILE A 1 9  ? 7.236   -7.344  1.290   1.00 0.00 ? 9  ILE A C    9  
ATOM   4773  O  O    . ILE A 1 9  ? 6.309   -6.578  1.025   1.00 0.00 ? 9  ILE A O    9  
ATOM   4774  C  CB   . ILE A 1 9  ? 8.620   -7.287  3.380   1.00 0.00 ? 9  ILE A CB   9  
ATOM   4775  C  CG1  . ILE A 1 9  ? 9.454   -6.313  4.213   1.00 0.00 ? 9  ILE A CG1  9  
ATOM   4776  C  CG2  . ILE A 1 9  ? 9.220   -8.683  3.451   1.00 0.00 ? 9  ILE A CG2  9  
ATOM   4777  C  CD1  . ILE A 1 9  ? 8.968   -6.174  5.638   1.00 0.00 ? 9  ILE A CD1  9  
ATOM   4778  H  H    . ILE A 1 9  ? 8.249   -4.842  2.633   1.00 0.00 ? 9  ILE A H    9  
ATOM   4779  H  HA   . ILE A 1 9  ? 9.369   -7.180  1.369   1.00 0.00 ? 9  ILE A HA   9  
ATOM   4780  H  HB   . ILE A 1 9  ? 7.622   -7.324  3.785   1.00 0.00 ? 9  ILE A HB   9  
ATOM   4781  H  HG12 . ILE A 1 9  ? 10.477  -6.659  4.246   1.00 0.00 ? 9  ILE A HG12 9  
ATOM   4782  H  HG13 . ILE A 1 9  ? 9.423   -5.336  3.755   1.00 0.00 ? 9  ILE A HG13 9  
ATOM   4783  H  HG21 . ILE A 1 9  ? 9.406   -8.946  4.484   1.00 0.00 ? 9  ILE A HG21 9  
ATOM   4784  H  HG22 . ILE A 1 9  ? 8.531   -9.393  3.017   1.00 0.00 ? 9  ILE A HG22 9  
ATOM   4785  H  HG23 . ILE A 1 9  ? 10.149  -8.703  2.902   1.00 0.00 ? 9  ILE A HG23 9  
ATOM   4786  H  HD11 . ILE A 1 9  ? 9.768   -5.791  6.255   1.00 0.00 ? 9  ILE A HD11 9  
ATOM   4787  H  HD12 . ILE A 1 9  ? 8.132   -5.493  5.668   1.00 0.00 ? 9  ILE A HD12 9  
ATOM   4788  H  HD13 . ILE A 1 9  ? 8.658   -7.140  6.010   1.00 0.00 ? 9  ILE A HD13 9  
ATOM   4789  N  N    . LYS A 1 10 ? 7.170   -8.665  1.106   1.00 0.00 ? 10 LYS A N    9  
ATOM   4790  C  CA   . LYS A 1 10 ? 5.978   -9.325  0.575   1.00 0.00 ? 10 LYS A CA   9  
ATOM   4791  C  C    . LYS A 1 10 ? 5.760   -8.979  -0.899  1.00 0.00 ? 10 LYS A C    9  
ATOM   4792  O  O    . LYS A 1 10 ? 6.151   -7.911  -1.365  1.00 0.00 ? 10 LYS A O    9  
ATOM   4793  C  CB   . LYS A 1 10 ? 4.739   -8.970  1.405   1.00 0.00 ? 10 LYS A CB   9  
ATOM   4794  C  CG   . LYS A 1 10 ? 4.488   -9.934  2.552   1.00 0.00 ? 10 LYS A CG   9  
ATOM   4795  C  CD   . LYS A 1 10 ? 4.309   -9.202  3.870   1.00 0.00 ? 10 LYS A CD   9  
ATOM   4796  C  CE   . LYS A 1 10 ? 5.621   -9.100  4.629   1.00 0.00 ? 10 LYS A CE   9  
ATOM   4797  N  NZ   . LYS A 1 10 ? 5.754   -10.156 5.666   1.00 0.00 ? 10 LYS A NZ   9  
ATOM   4798  H  H    . LYS A 1 10 ? 7.946   -9.216  1.349   1.00 0.00 ? 10 LYS A H    9  
ATOM   4799  H  HA   . LYS A 1 10 ? 6.143   -10.390 0.648   1.00 0.00 ? 10 LYS A HA   9  
ATOM   4800  H  HB2  . LYS A 1 10 ? 4.866   -7.980  1.816   1.00 0.00 ? 10 LYS A HB2  9  
ATOM   4801  H  HB3  . LYS A 1 10 ? 3.873   -8.977  0.760   1.00 0.00 ? 10 LYS A HB3  9  
ATOM   4802  H  HG2  . LYS A 1 10 ? 3.593   -10.500 2.343   1.00 0.00 ? 10 LYS A HG2  9  
ATOM   4803  H  HG3  . LYS A 1 10 ? 5.330   -10.605 2.633   1.00 0.00 ? 10 LYS A HG3  9  
ATOM   4804  H  HD2  . LYS A 1 10 ? 3.942   -8.206  3.670   1.00 0.00 ? 10 LYS A HD2  9  
ATOM   4805  H  HD3  . LYS A 1 10 ? 3.592   -9.740  4.474   1.00 0.00 ? 10 LYS A HD3  9  
ATOM   4806  H  HE2  . LYS A 1 10 ? 6.434   -9.198  3.926   1.00 0.00 ? 10 LYS A HE2  9  
ATOM   4807  H  HE3  . LYS A 1 10 ? 5.672   -8.133  5.106   1.00 0.00 ? 10 LYS A HE3  9  
ATOM   4808  H  HZ1  . LYS A 1 10 ? 5.920   -11.084 5.217   1.00 0.00 ? 10 LYS A HZ1  9  
ATOM   4809  H  HZ2  . LYS A 1 10 ? 4.886   -10.209 6.241   1.00 0.00 ? 10 LYS A HZ2  9  
ATOM   4810  H  HZ3  . LYS A 1 10 ? 6.560   -9.939  6.294   1.00 0.00 ? 10 LYS A HZ3  9  
ATOM   4811  N  N    . PRO A 1 11 ? 5.206   -9.921  -1.674  1.00 0.00 ? 11 PRO A N    9  
ATOM   4812  C  CA   . PRO A 1 11 ? 4.983   -9.742  -3.114  1.00 0.00 ? 11 PRO A CA   9  
ATOM   4813  C  C    . PRO A 1 11 ? 4.062   -8.563  -3.424  1.00 0.00 ? 11 PRO A C    9  
ATOM   4814  O  O    . PRO A 1 11 ? 4.039   -8.063  -4.549  1.00 0.00 ? 11 PRO A O    9  
ATOM   4815  C  CB   . PRO A 1 11 ? 4.315   -11.056 -3.545  1.00 0.00 ? 11 PRO A CB   9  
ATOM   4816  C  CG   . PRO A 1 11 ? 3.799   -11.653 -2.282  1.00 0.00 ? 11 PRO A CG   9  
ATOM   4817  C  CD   . PRO A 1 11 ? 4.781   -11.254 -1.223  1.00 0.00 ? 11 PRO A CD   9  
ATOM   4818  H  HA   . PRO A 1 11 ? 5.913   -9.620  -3.645  1.00 0.00 ? 11 PRO A HA   9  
ATOM   4819  H  HB2  . PRO A 1 11 ? 3.516   -10.844 -4.240  1.00 0.00 ? 11 PRO A HB2  9  
ATOM   4820  H  HB3  . PRO A 1 11 ? 5.047   -11.699 -4.015  1.00 0.00 ? 11 PRO A HB3  9  
ATOM   4821  H  HG2  . PRO A 1 11 ? 2.823   -11.250 -2.061  1.00 0.00 ? 11 PRO A HG2  9  
ATOM   4822  H  HG3  . PRO A 1 11 ? 3.755   -12.726 -2.369  1.00 0.00 ? 11 PRO A HG3  9  
ATOM   4823  H  HD2  . PRO A 1 11 ? 4.300   -11.201 -0.258  1.00 0.00 ? 11 PRO A HD2  9  
ATOM   4824  H  HD3  . PRO A 1 11 ? 5.616   -11.940 -1.199  1.00 0.00 ? 11 PRO A HD3  9  
ATOM   4825  N  N    . PHE A 1 12 ? 3.288   -8.142  -2.431  1.00 0.00 ? 12 PHE A N    9  
ATOM   4826  C  CA   . PHE A 1 12 ? 2.340   -7.059  -2.609  1.00 0.00 ? 12 PHE A CA   9  
ATOM   4827  C  C    . PHE A 1 12 ? 2.680   -5.877  -1.712  1.00 0.00 ? 12 PHE A C    9  
ATOM   4828  O  O    . PHE A 1 12 ? 2.104   -5.704  -0.642  1.00 0.00 ? 12 PHE A O    9  
ATOM   4829  C  CB   . PHE A 1 12 ? 0.923   -7.548  -2.315  1.00 0.00 ? 12 PHE A CB   9  
ATOM   4830  C  CG   . PHE A 1 12 ? 0.509   -8.726  -3.155  1.00 0.00 ? 12 PHE A CG   9  
ATOM   4831  C  CD1  . PHE A 1 12 ? 0.528   -8.650  -4.541  1.00 0.00 ? 12 PHE A CD1  9  
ATOM   4832  C  CD2  . PHE A 1 12 ? 0.099   -9.905  -2.559  1.00 0.00 ? 12 PHE A CD2  9  
ATOM   4833  C  CE1  . PHE A 1 12 ? 0.146   -9.734  -5.313  1.00 0.00 ? 12 PHE A CE1  9  
ATOM   4834  C  CE2  . PHE A 1 12 ? -0.284  -10.990 -3.324  1.00 0.00 ? 12 PHE A CE2  9  
ATOM   4835  C  CZ   . PHE A 1 12 ? -0.261  -10.903 -4.703  1.00 0.00 ? 12 PHE A CZ   9  
ATOM   4836  H  H    . PHE A 1 12 ? 3.352   -8.577  -1.558  1.00 0.00 ? 12 PHE A H    9  
ATOM   4837  H  HA   . PHE A 1 12 ? 2.393   -6.740  -3.639  1.00 0.00 ? 12 PHE A HA   9  
ATOM   4838  H  HB2  . PHE A 1 12 ? 0.863   -7.841  -1.274  1.00 0.00 ? 12 PHE A HB2  9  
ATOM   4839  H  HB3  . PHE A 1 12 ? 0.225   -6.744  -2.499  1.00 0.00 ? 12 PHE A HB3  9  
ATOM   4840  H  HD1  . PHE A 1 12 ? 0.848   -7.736  -5.019  1.00 0.00 ? 12 PHE A HD1  9  
ATOM   4841  H  HD2  . PHE A 1 12 ? 0.079   -9.973  -1.482  1.00 0.00 ? 12 PHE A HD2  9  
ATOM   4842  H  HE1  . PHE A 1 12 ? 0.165   -9.663  -6.391  1.00 0.00 ? 12 PHE A HE1  9  
ATOM   4843  H  HE2  . PHE A 1 12 ? -0.603  -11.903 -2.846  1.00 0.00 ? 12 PHE A HE2  9  
ATOM   4844  H  HZ   . PHE A 1 12 ? -0.561  -11.749 -5.305  1.00 0.00 ? 12 PHE A HZ   9  
ATOM   4845  N  N    . GLN A 1 13 ? 3.576   -5.036  -2.186  1.00 0.00 ? 13 GLN A N    9  
ATOM   4846  C  CA   . GLN A 1 13 ? 3.924   -3.819  -1.477  1.00 0.00 ? 13 GLN A CA   9  
ATOM   4847  C  C    . GLN A 1 13 ? 3.207   -2.638  -2.122  1.00 0.00 ? 13 GLN A C    9  
ATOM   4848  O  O    . GLN A 1 13 ? 2.880   -2.684  -3.311  1.00 0.00 ? 13 GLN A O    9  
ATOM   4849  C  CB   . GLN A 1 13 ? 5.440   -3.613  -1.507  1.00 0.00 ? 13 GLN A CB   9  
ATOM   4850  C  CG   . GLN A 1 13 ? 5.917   -2.697  -2.622  1.00 0.00 ? 13 GLN A CG   9  
ATOM   4851  C  CD   . GLN A 1 13 ? 7.424   -2.566  -2.681  1.00 0.00 ? 13 GLN A CD   9  
ATOM   4852  O  OE1  . GLN A 1 13 ? 7.956   -1.469  -2.835  1.00 0.00 ? 13 GLN A OE1  9  
ATOM   4853  N  NE2  . GLN A 1 13 ? 8.124   -3.682  -2.575  1.00 0.00 ? 13 GLN A NE2  9  
ATOM   4854  H  H    . GLN A 1 13 ? 3.977   -5.207  -3.060  1.00 0.00 ? 13 GLN A H    9  
ATOM   4855  H  HA   . GLN A 1 13 ? 3.594   -3.919  -0.455  1.00 0.00 ? 13 GLN A HA   9  
ATOM   4856  H  HB2  . GLN A 1 13 ? 5.753   -3.192  -0.563  1.00 0.00 ? 13 GLN A HB2  9  
ATOM   4857  H  HB3  . GLN A 1 13 ? 5.915   -4.576  -1.635  1.00 0.00 ? 13 GLN A HB3  9  
ATOM   4858  H  HG2  . GLN A 1 13 ? 5.569   -3.086  -3.565  1.00 0.00 ? 13 GLN A HG2  9  
ATOM   4859  H  HG3  . GLN A 1 13 ? 5.494   -1.716  -2.461  1.00 0.00 ? 13 GLN A HG3  9  
ATOM   4860  H  HE21 . GLN A 1 13 ? 7.634   -4.530  -2.466  1.00 0.00 ? 13 GLN A HE21 9  
ATOM   4861  H  HE22 . GLN A 1 13 ? 9.104   -3.624  -2.603  1.00 0.00 ? 13 GLN A HE22 9  
ATOM   4862  N  N    . CYS A 1 14 ? 3.017   -1.561  -1.370  1.00 0.00 ? 14 CYS A N    9  
ATOM   4863  C  CA   . CYS A 1 14 ? 2.430   -0.361  -1.937  1.00 0.00 ? 14 CYS A CA   9  
ATOM   4864  C  C    . CYS A 1 14 ? 3.403   0.264   -2.928  1.00 0.00 ? 14 CYS A C    9  
ATOM   4865  O  O    . CYS A 1 14 ? 4.558   0.510   -2.593  1.00 0.00 ? 14 CYS A O    9  
ATOM   4866  C  CB   . CYS A 1 14 ? 2.069   0.666   -0.861  1.00 0.00 ? 14 CYS A CB   9  
ATOM   4867  S  SG   . CYS A 1 14 ? 1.433   2.217   -1.579  1.00 0.00 ? 14 CYS A SG   9  
ATOM   4868  H  H    . CYS A 1 14 ? 3.344   -1.552  -0.451  1.00 0.00 ? 14 CYS A H    9  
ATOM   4869  H  HA   . CYS A 1 14 ? 1.530   -0.647  -2.463  1.00 0.00 ? 14 CYS A HA   9  
ATOM   4870  H  HB2  . CYS A 1 14 ? 1.307   0.254   -0.215  1.00 0.00 ? 14 CYS A HB2  9  
ATOM   4871  H  HB3  . CYS A 1 14 ? 2.949   0.901   -0.280  1.00 0.00 ? 14 CYS A HB3  9  
ATOM   4872  N  N    . PRO A 1 15 ? 2.944   0.550   -4.149  1.00 0.00 ? 15 PRO A N    9  
ATOM   4873  C  CA   . PRO A 1 15 ? 3.778   1.170   -5.176  1.00 0.00 ? 15 PRO A CA   9  
ATOM   4874  C  C    . PRO A 1 15 ? 4.043   2.646   -4.888  1.00 0.00 ? 15 PRO A C    9  
ATOM   4875  O  O    . PRO A 1 15 ? 4.794   3.304   -5.609  1.00 0.00 ? 15 PRO A O    9  
ATOM   4876  C  CB   . PRO A 1 15 ? 2.949   1.011   -6.449  1.00 0.00 ? 15 PRO A CB   9  
ATOM   4877  C  CG   . PRO A 1 15 ? 1.537   0.951   -5.979  1.00 0.00 ? 15 PRO A CG   9  
ATOM   4878  C  CD   . PRO A 1 15 ? 1.573   0.297   -4.625  1.00 0.00 ? 15 PRO A CD   9  
ATOM   4879  H  HA   . PRO A 1 15 ? 4.719   0.651   -5.289  1.00 0.00 ? 15 PRO A HA   9  
ATOM   4880  H  HB2  . PRO A 1 15 ? 3.113   1.859   -7.097  1.00 0.00 ? 15 PRO A HB2  9  
ATOM   4881  H  HB3  . PRO A 1 15 ? 3.235   0.102   -6.957  1.00 0.00 ? 15 PRO A HB3  9  
ATOM   4882  H  HG2  . PRO A 1 15 ? 1.133   1.950   -5.903  1.00 0.00 ? 15 PRO A HG2  9  
ATOM   4883  H  HG3  . PRO A 1 15 ? 0.949   0.360   -6.666  1.00 0.00 ? 15 PRO A HG3  9  
ATOM   4884  H  HD2  . PRO A 1 15 ? 0.851   0.754   -3.968  1.00 0.00 ? 15 PRO A HD2  9  
ATOM   4885  H  HD3  . PRO A 1 15 ? 1.386   -0.766  -4.713  1.00 0.00 ? 15 PRO A HD3  9  
ATOM   4886  N  N    . ASP A 1 16 ? 3.406   3.171   -3.847  1.00 0.00 ? 16 ASP A N    9  
ATOM   4887  C  CA   . ASP A 1 16 ? 3.557   4.576   -3.489  1.00 0.00 ? 16 ASP A CA   9  
ATOM   4888  C  C    . ASP A 1 16 ? 4.381   4.728   -2.220  1.00 0.00 ? 16 ASP A C    9  
ATOM   4889  O  O    . ASP A 1 16 ? 5.032   5.752   -2.010  1.00 0.00 ? 16 ASP A O    9  
ATOM   4890  C  CB   . ASP A 1 16 ? 2.186   5.227   -3.286  1.00 0.00 ? 16 ASP A CB   9  
ATOM   4891  C  CG   . ASP A 1 16 ? 2.036   6.537   -4.035  1.00 0.00 ? 16 ASP A CG   9  
ATOM   4892  O  OD1  . ASP A 1 16 ? 3.012   7.312   -4.103  1.00 0.00 ? 16 ASP A OD1  9  
ATOM   4893  O  OD2  . ASP A 1 16 ? 0.933   6.798   -4.563  1.00 0.00 ? 16 ASP A OD2  9  
ATOM   4894  H  H    . ASP A 1 16 ? 2.803   2.600   -3.313  1.00 0.00 ? 16 ASP A H    9  
ATOM   4895  H  HA   . ASP A 1 16 ? 4.068   5.073   -4.301  1.00 0.00 ? 16 ASP A HA   9  
ATOM   4896  H  HB2  . ASP A 1 16 ? 1.419   4.550   -3.632  1.00 0.00 ? 16 ASP A HB2  9  
ATOM   4897  H  HB3  . ASP A 1 16 ? 2.040   5.418   -2.233  1.00 0.00 ? 16 ASP A HB3  9  
ATOM   4898  N  N    . CYS A 1 17 ? 4.255   3.756   -1.325  1.00 0.00 ? 17 CYS A N    9  
ATOM   4899  C  CA   . CYS A 1 17 ? 4.886   3.844   -0.016  1.00 0.00 ? 17 CYS A CA   9  
ATOM   4900  C  C    . CYS A 1 17 ? 6.035   2.853   0.152   1.00 0.00 ? 17 CYS A C    9  
ATOM   4901  O  O    . CYS A 1 17 ? 6.883   3.050   1.019   1.00 0.00 ? 17 CYS A O    9  
ATOM   4902  C  CB   . CYS A 1 17 ? 3.852   3.607   1.080   1.00 0.00 ? 17 CYS A CB   9  
ATOM   4903  S  SG   . CYS A 1 17 ? 2.440   4.755   1.038   1.00 0.00 ? 17 CYS A SG   9  
ATOM   4904  H  H    . CYS A 1 17 ? 3.649   3.010   -1.517  1.00 0.00 ? 17 CYS A H    9  
ATOM   4905  H  HA   . CYS A 1 17 ? 5.276   4.844   0.089   1.00 0.00 ? 17 CYS A HA   9  
ATOM   4906  H  HB2  . CYS A 1 17 ? 3.463   2.605   0.984   1.00 0.00 ? 17 CYS A HB2  9  
ATOM   4907  H  HB3  . CYS A 1 17 ? 4.331   3.709   2.042   1.00 0.00 ? 17 CYS A HB3  9  
ATOM   4908  N  N    . ASP A 1 18 ? 5.900   1.696   -0.491  1.00 0.00 ? 18 ASP A N    9  
ATOM   4909  C  CA   . ASP A 1 18 ? 6.811   0.557   -0.304  1.00 0.00 ? 18 ASP A CA   9  
ATOM   4910  C  C    . ASP A 1 18 ? 6.597   -0.045  1.085   1.00 0.00 ? 18 ASP A C    9  
ATOM   4911  O  O    . ASP A 1 18 ? 7.513   -0.372  1.832   1.00 0.00 ? 18 ASP A O    9  
ATOM   4912  C  CB   . ASP A 1 18 ? 8.284   0.894   -0.685  1.00 0.00 ? 18 ASP A CB   9  
ATOM   4913  C  CG   . ASP A 1 18 ? 9.244   1.281   0.434   1.00 0.00 ? 18 ASP A CG   9  
ATOM   4914  O  OD1  . ASP A 1 18 ? 9.890   0.383   1.003   1.00 0.00 ? 18 ASP A OD1  9  
ATOM   4915  O  OD2  . ASP A 1 18 ? 9.454   2.493   0.661   1.00 0.00 ? 18 ASP A OD2  9  
ATOM   4916  H  H    . ASP A 1 18 ? 5.105   1.567   -1.047  1.00 0.00 ? 18 ASP A H    9  
ATOM   4917  H  HA   . ASP A 1 18 ? 6.472   -0.205  -0.998  1.00 0.00 ? 18 ASP A HA   9  
ATOM   4918  H  HB2  . ASP A 1 18 ? 8.706   0.033   -1.174  1.00 0.00 ? 18 ASP A HB2  9  
ATOM   4919  H  HB3  . ASP A 1 18 ? 8.264   1.707   -1.398  1.00 0.00 ? 18 ASP A HB3  9  
ATOM   4920  N  N    . ARG A 1 19 ? 5.323   -0.310  1.347   1.00 0.00 ? 19 ARG A N    9  
ATOM   4921  C  CA   . ARG A 1 19 ? 4.902   -1.022  2.543   1.00 0.00 ? 19 ARG A CA   9  
ATOM   4922  C  C    . ARG A 1 19 ? 4.981   -2.526  2.290   1.00 0.00 ? 19 ARG A C    9  
ATOM   4923  O  O    . ARG A 1 19 ? 5.730   -2.960  1.420   1.00 0.00 ? 19 ARG A O    9  
ATOM   4924  C  CB   . ARG A 1 19 ? 3.483   -0.604  2.925   1.00 0.00 ? 19 ARG A CB   9  
ATOM   4925  C  CG   . ARG A 1 19 ? 3.444   0.561   3.895   1.00 0.00 ? 19 ARG A CG   9  
ATOM   4926  C  CD   . ARG A 1 19 ? 2.351   1.556   3.539   1.00 0.00 ? 19 ARG A CD   9  
ATOM   4927  N  NE   . ARG A 1 19 ? 1.027   1.097   3.960   1.00 0.00 ? 19 ARG A NE   9  
ATOM   4928  C  CZ   . ARG A 1 19 ? 0.662   0.938   5.238   1.00 0.00 ? 19 ARG A CZ   9  
ATOM   4929  N  NH1  . ARG A 1 19 ? 1.472   1.325   6.217   1.00 0.00 ? 19 ARG A NH1  9  
ATOM   4930  N  NH2  . ARG A 1 19 ? -0.527  0.432   5.536   1.00 0.00 ? 19 ARG A NH2  9  
ATOM   4931  H  H    . ARG A 1 19 ? 4.658   -0.108  0.660   1.00 0.00 ? 19 ARG A H    9  
ATOM   4932  H  HA   . ARG A 1 19 ? 5.581   -0.763  3.341   1.00 0.00 ? 19 ARG A HA   9  
ATOM   4933  H  HB2  . ARG A 1 19 ? 2.949   -0.320  2.029   1.00 0.00 ? 19 ARG A HB2  9  
ATOM   4934  H  HB3  . ARG A 1 19 ? 2.981   -1.442  3.381   1.00 0.00 ? 19 ARG A HB3  9  
ATOM   4935  H  HG2  . ARG A 1 19 ? 3.262   0.182   4.890   1.00 0.00 ? 19 ARG A HG2  9  
ATOM   4936  H  HG3  . ARG A 1 19 ? 4.396   1.064   3.871   1.00 0.00 ? 19 ARG A HG3  9  
ATOM   4937  H  HD2  . ARG A 1 19 ? 2.565   2.496   4.027   1.00 0.00 ? 19 ARG A HD2  9  
ATOM   4938  H  HD3  . ARG A 1 19 ? 2.349   1.701   2.469   1.00 0.00 ? 19 ARG A HD3  9  
ATOM   4939  H  HE   . ARG A 1 19 ? 0.380   0.877   3.248   1.00 0.00 ? 19 ARG A HE   9  
ATOM   4940  H  HH11 . ARG A 1 19 ? 2.364   1.741   6.004   1.00 0.00 ? 19 ARG A HH11 9  
ATOM   4941  H  HH12 . ARG A 1 19 ? 1.199   1.206   7.174   1.00 0.00 ? 19 ARG A HH12 9  
ATOM   4942  H  HH21 . ARG A 1 19 ? -1.163  0.166   4.811   1.00 0.00 ? 19 ARG A HH21 9  
ATOM   4943  H  HH22 . ARG A 1 19 ? -0.795  0.304   6.502   1.00 0.00 ? 19 ARG A HH22 9  
ATOM   4944  N  N    . SER A 1 20 ? 4.207   -3.328  3.007   1.00 0.00 ? 20 SER A N    9  
ATOM   4945  C  CA   . SER A 1 20 ? 4.237   -4.766  2.783   1.00 0.00 ? 20 SER A CA   9  
ATOM   4946  C  C    . SER A 1 20 ? 2.930   -5.440  3.168   1.00 0.00 ? 20 SER A C    9  
ATOM   4947  O  O    . SER A 1 20 ? 2.472   -5.342  4.309   1.00 0.00 ? 20 SER A O    9  
ATOM   4948  C  CB   . SER A 1 20 ? 5.386   -5.403  3.555   1.00 0.00 ? 20 SER A CB   9  
ATOM   4949  O  OG   . SER A 1 20 ? 5.898   -4.525  4.549   1.00 0.00 ? 20 SER A OG   9  
ATOM   4950  H  H    . SER A 1 20 ? 3.598   -2.953  3.683   1.00 0.00 ? 20 SER A H    9  
ATOM   4951  H  HA   . SER A 1 20 ? 4.399   -4.925  1.726   1.00 0.00 ? 20 SER A HA   9  
ATOM   4952  H  HB2  . SER A 1 20 ? 5.029   -6.302  4.030   1.00 0.00 ? 20 SER A HB2  9  
ATOM   4953  H  HB3  . SER A 1 20 ? 6.181   -5.652  2.865   1.00 0.00 ? 20 SER A HB3  9  
ATOM   4954  H  HG   . SER A 1 20 ? 6.620   -3.996  4.167   1.00 0.00 ? 20 SER A HG   9  
ATOM   4955  N  N    . PHE A 1 21 ? 2.352   -6.146  2.209   1.00 0.00 ? 21 PHE A N    9  
ATOM   4956  C  CA   . PHE A 1 21 ? 1.111   -6.870  2.419   1.00 0.00 ? 21 PHE A CA   9  
ATOM   4957  C  C    . PHE A 1 21 ? 1.201   -8.244  1.769   1.00 0.00 ? 21 PHE A C    9  
ATOM   4958  O  O    . PHE A 1 21 ? 1.649   -8.372  0.630   1.00 0.00 ? 21 PHE A O    9  
ATOM   4959  C  CB   . PHE A 1 21 ? -0.077  -6.088  1.842   1.00 0.00 ? 21 PHE A CB   9  
ATOM   4960  C  CG   . PHE A 1 21 ? -0.073  -4.631  2.209   1.00 0.00 ? 21 PHE A CG   9  
ATOM   4961  C  CD1  . PHE A 1 21 ? 0.688   -3.723  1.490   1.00 0.00 ? 21 PHE A CD1  9  
ATOM   4962  C  CD2  . PHE A 1 21 ? -0.820  -4.174  3.281   1.00 0.00 ? 21 PHE A CD2  9  
ATOM   4963  C  CE1  . PHE A 1 21 ? 0.710   -2.391  1.836   1.00 0.00 ? 21 PHE A CE1  9  
ATOM   4964  C  CE2  . PHE A 1 21 ? -0.806  -2.839  3.630   1.00 0.00 ? 21 PHE A CE2  9  
ATOM   4965  C  CZ   . PHE A 1 21 ? -0.038  -1.948  2.907   1.00 0.00 ? 21 PHE A CZ   9  
ATOM   4966  H  H    . PHE A 1 21 ? 2.776   -6.189  1.323   1.00 0.00 ? 21 PHE A H    9  
ATOM   4967  H  HA   . PHE A 1 21 ? 0.972   -6.992  3.483   1.00 0.00 ? 21 PHE A HA   9  
ATOM   4968  H  HB2  . PHE A 1 21 ? -0.054  -6.157  0.765   1.00 0.00 ? 21 PHE A HB2  9  
ATOM   4969  H  HB3  . PHE A 1 21 ? -0.996  -6.521  2.206   1.00 0.00 ? 21 PHE A HB3  9  
ATOM   4970  H  HD1  . PHE A 1 21 ? 1.281   -4.074  0.655   1.00 0.00 ? 21 PHE A HD1  9  
ATOM   4971  H  HD2  . PHE A 1 21 ? -1.420  -4.872  3.847   1.00 0.00 ? 21 PHE A HD2  9  
ATOM   4972  H  HE1  . PHE A 1 21 ? 1.306   -1.695  1.265   1.00 0.00 ? 21 PHE A HE1  9  
ATOM   4973  H  HE2  . PHE A 1 21 ? -1.393  -2.492  4.469   1.00 0.00 ? 21 PHE A HE2  9  
ATOM   4974  H  HZ   . PHE A 1 21 ? -0.017  -0.907  3.184   1.00 0.00 ? 21 PHE A HZ   9  
ATOM   4975  N  N    . SER A 1 22 ? 0.824   -9.274  2.508   1.00 0.00 ? 22 SER A N    9  
ATOM   4976  C  CA   . SER A 1 22 ? 0.866   -10.631 1.995   1.00 0.00 ? 22 SER A CA   9  
ATOM   4977  C  C    . SER A 1 22 ? -0.281  -10.851 1.016   1.00 0.00 ? 22 SER A C    9  
ATOM   4978  O  O    . SER A 1 22 ? -0.221  -11.725 0.153   1.00 0.00 ? 22 SER A O    9  
ATOM   4979  C  CB   . SER A 1 22 ? 0.777   -11.624 3.154   1.00 0.00 ? 22 SER A CB   9  
ATOM   4980  O  OG   . SER A 1 22 ? 0.174   -11.021 4.291   1.00 0.00 ? 22 SER A OG   9  
ATOM   4981  H  H    . SER A 1 22 ? 0.507   -9.119  3.427   1.00 0.00 ? 22 SER A H    9  
ATOM   4982  H  HA   . SER A 1 22 ? 1.807   -10.769 1.477   1.00 0.00 ? 22 SER A HA   9  
ATOM   4983  H  HB2  . SER A 1 22 ? 0.180   -12.471 2.854   1.00 0.00 ? 22 SER A HB2  9  
ATOM   4984  H  HB3  . SER A 1 22 ? 1.769   -11.956 3.420   1.00 0.00 ? 22 SER A HB3  9  
ATOM   4985  H  HG   . SER A 1 22 ? 0.781   -11.074 5.046   1.00 0.00 ? 22 SER A HG   9  
ATOM   4986  N  N    . ARG A 1 23 ? -1.320  -10.036 1.155   1.00 0.00 ? 23 ARG A N    9  
ATOM   4987  C  CA   . ARG A 1 23 ? -2.486  -10.112 0.286   1.00 0.00 ? 23 ARG A CA   9  
ATOM   4988  C  C    . ARG A 1 23 ? -2.640  -8.838  -0.521  1.00 0.00 ? 23 ARG A C    9  
ATOM   4989  O  O    . ARG A 1 23 ? -2.593  -7.733  0.024   1.00 0.00 ? 23 ARG A O    9  
ATOM   4990  C  CB   . ARG A 1 23 ? -3.759  -10.341 1.100   1.00 0.00 ? 23 ARG A CB   9  
ATOM   4991  C  CG   . ARG A 1 23 ? -3.539  -11.083 2.404   1.00 0.00 ? 23 ARG A CG   9  
ATOM   4992  C  CD   . ARG A 1 23 ? -4.718  -10.899 3.339   1.00 0.00 ? 23 ARG A CD   9  
ATOM   4993  N  NE   . ARG A 1 23 ? -5.936  -11.497 2.803   1.00 0.00 ? 23 ARG A NE   9  
ATOM   4994  C  CZ   . ARG A 1 23 ? -6.318  -12.751 3.052   1.00 0.00 ? 23 ARG A CZ   9  
ATOM   4995  N  NH1  . ARG A 1 23 ? -5.575  -13.523 3.838   1.00 0.00 ? 23 ARG A NH1  9  
ATOM   4996  N  NH2  . ARG A 1 23 ? -7.442  -13.227 2.534   1.00 0.00 ? 23 ARG A NH2  9  
ATOM   4997  H  H    . ARG A 1 23 ? -1.297  -9.353  1.860   1.00 0.00 ? 23 ARG A H    9  
ATOM   4998  H  HA   . ARG A 1 23 ? -2.350  -10.938 -0.396  1.00 0.00 ? 23 ARG A HA   9  
ATOM   4999  H  HB2  . ARG A 1 23 ? -4.202  -9.383  1.329   1.00 0.00 ? 23 ARG A HB2  9  
ATOM   5000  H  HB3  . ARG A 1 23 ? -4.453  -10.911 0.502   1.00 0.00 ? 23 ARG A HB3  9  
ATOM   5001  H  HG2  . ARG A 1 23 ? -3.418  -12.136 2.193   1.00 0.00 ? 23 ARG A HG2  9  
ATOM   5002  H  HG3  . ARG A 1 23 ? -2.646  -10.700 2.881   1.00 0.00 ? 23 ARG A HG3  9  
ATOM   5003  H  HD2  . ARG A 1 23 ? -4.487  -11.362 4.287   1.00 0.00 ? 23 ARG A HD2  9  
ATOM   5004  H  HD3  . ARG A 1 23 ? -4.881  -9.842  3.487   1.00 0.00 ? 23 ARG A HD3  9  
ATOM   5005  H  HE   . ARG A 1 23 ? -6.502  -10.927 2.224   1.00 0.00 ? 23 ARG A HE   9  
ATOM   5006  H  HH11 . ARG A 1 23 ? -4.736  -13.162 4.250   1.00 0.00 ? 23 ARG A HH11 9  
ATOM   5007  H  HH12 . ARG A 1 23 ? -5.843  -14.477 4.009   1.00 0.00 ? 23 ARG A HH12 9  
ATOM   5008  H  HH21 . ARG A 1 23 ? -8.019  -12.642 1.945   1.00 0.00 ? 23 ARG A HH21 9  
ATOM   5009  H  HH22 . ARG A 1 23 ? -7.732  -14.172 2.732   1.00 0.00 ? 23 ARG A HH22 9  
ATOM   5010  N  N    . SER A 1 24 ? -2.958  -9.006  -1.795  1.00 0.00 ? 24 SER A N    9  
ATOM   5011  C  CA   . SER A 1 24 ? -3.258  -7.882  -2.664  1.00 0.00 ? 24 SER A CA   9  
ATOM   5012  C  C    . SER A 1 24 ? -4.539  -7.189  -2.198  1.00 0.00 ? 24 SER A C    9  
ATOM   5013  O  O    . SER A 1 24 ? -4.725  -5.985  -2.397  1.00 0.00 ? 24 SER A O    9  
ATOM   5014  C  CB   . SER A 1 24 ? -3.404  -8.369  -4.104  1.00 0.00 ? 24 SER A CB   9  
ATOM   5015  O  OG   . SER A 1 24 ? -2.528  -7.673  -4.976  1.00 0.00 ? 24 SER A OG   9  
ATOM   5016  H  H    . SER A 1 24 ? -3.081  -9.918  -2.137  1.00 0.00 ? 24 SER A H    9  
ATOM   5017  H  HA   . SER A 1 24 ? -2.434  -7.184  -2.605  1.00 0.00 ? 24 SER A HA   9  
ATOM   5018  H  HB2  . SER A 1 24 ? -3.170  -9.422  -4.150  1.00 0.00 ? 24 SER A HB2  9  
ATOM   5019  H  HB3  . SER A 1 24 ? -4.419  -8.215  -4.429  1.00 0.00 ? 24 SER A HB3  9  
ATOM   5020  H  HG   . SER A 1 24 ? -2.514  -8.121  -5.839  1.00 0.00 ? 24 SER A HG   9  
ATOM   5021  N  N    . ASP A 1 25 ? -5.389  -7.952  -1.519  1.00 0.00 ? 25 ASP A N    9  
ATOM   5022  C  CA   . ASP A 1 25 ? -6.616  -7.429  -0.952  1.00 0.00 ? 25 ASP A CA   9  
ATOM   5023  C  C    . ASP A 1 25 ? -6.310  -6.443  0.172   1.00 0.00 ? 25 ASP A C    9  
ATOM   5024  O  O    . ASP A 1 25 ? -6.930  -5.382  0.271   1.00 0.00 ? 25 ASP A O    9  
ATOM   5025  C  CB   . ASP A 1 25 ? -7.462  -8.600  -0.448  1.00 0.00 ? 25 ASP A CB   9  
ATOM   5026  C  CG   . ASP A 1 25 ? -7.907  -8.468  0.998   1.00 0.00 ? 25 ASP A CG   9  
ATOM   5027  O  OD1  . ASP A 1 25 ? -8.877  -7.728  1.268   1.00 0.00 ? 25 ASP A OD1  9  
ATOM   5028  O  OD2  . ASP A 1 25 ? -7.307  -9.137  1.866   1.00 0.00 ? 25 ASP A OD2  9  
ATOM   5029  H  H    . ASP A 1 25 ? -5.177  -8.900  -1.381  1.00 0.00 ? 25 ASP A H    9  
ATOM   5030  H  HA   . ASP A 1 25 ? -7.150  -6.917  -1.733  1.00 0.00 ? 25 ASP A HA   9  
ATOM   5031  H  HB2  . ASP A 1 25 ? -8.334  -8.685  -1.066  1.00 0.00 ? 25 ASP A HB2  9  
ATOM   5032  H  HB3  . ASP A 1 25 ? -6.884  -9.505  -0.541  1.00 0.00 ? 25 ASP A HB3  9  
ATOM   5033  N  N    . HIS A 1 26 ? -5.299  -6.761  0.973   1.00 0.00 ? 26 HIS A N    9  
ATOM   5034  C  CA   . HIS A 1 26 ? -4.882  -5.882  2.059   1.00 0.00 ? 26 HIS A CA   9  
ATOM   5035  C  C    . HIS A 1 26 ? -4.159  -4.662  1.514   1.00 0.00 ? 26 HIS A C    9  
ATOM   5036  O  O    . HIS A 1 26 ? -4.328  -3.553  2.022   1.00 0.00 ? 26 HIS A O    9  
ATOM   5037  C  CB   . HIS A 1 26 ? -3.991  -6.625  3.049   1.00 0.00 ? 26 HIS A CB   9  
ATOM   5038  C  CG   . HIS A 1 26 ? -4.730  -7.071  4.270   1.00 0.00 ? 26 HIS A CG   9  
ATOM   5039  N  ND1  . HIS A 1 26 ? -4.225  -6.966  5.544   1.00 0.00 ? 26 HIS A ND1  9  
ATOM   5040  C  CD2  . HIS A 1 26 ? -5.961  -7.610  4.398   1.00 0.00 ? 26 HIS A CD2  9  
ATOM   5041  C  CE1  . HIS A 1 26 ? -5.115  -7.415  6.406   1.00 0.00 ? 26 HIS A CE1  9  
ATOM   5042  N  NE2  . HIS A 1 26 ? -6.183  -7.813  5.736   1.00 0.00 ? 26 HIS A NE2  9  
ATOM   5043  H  H    . HIS A 1 26 ? -4.806  -7.589  0.812   1.00 0.00 ? 26 HIS A H    9  
ATOM   5044  H  HA   . HIS A 1 26 ? -5.772  -5.549  2.573   1.00 0.00 ? 26 HIS A HA   9  
ATOM   5045  H  HB2  . HIS A 1 26 ? -3.577  -7.500  2.570   1.00 0.00 ? 26 HIS A HB2  9  
ATOM   5046  H  HB3  . HIS A 1 26 ? -3.189  -5.975  3.364   1.00 0.00 ? 26 HIS A HB3  9  
ATOM   5047  H  HD1  . HIS A 1 26 ? -3.332  -6.614  5.783   1.00 0.00 ? 26 HIS A HD1  9  
ATOM   5048  H  HD2  . HIS A 1 26 ? -6.643  -7.845  3.590   1.00 0.00 ? 26 HIS A HD2  9  
ATOM   5049  H  HE1  . HIS A 1 26 ? -4.994  -7.450  7.478   1.00 0.00 ? 26 HIS A HE1  9  
ATOM   5050  H  HE2  . HIS A 1 26 ? -7.068  -7.974  6.141   1.00 0.00 ? 26 HIS A HE2  9  
ATOM   5051  N  N    . LEU A 1 27 ? -3.454  -4.857  0.404   1.00 0.00 ? 27 LEU A N    9  
ATOM   5052  C  CA   . LEU A 1 27 ? -2.821  -3.759  -0.313  1.00 0.00 ? 27 LEU A CA   9  
ATOM   5053  C  C    . LEU A 1 27 ? -3.860  -2.700  -0.656  1.00 0.00 ? 27 LEU A C    9  
ATOM   5054  O  O    . LEU A 1 27 ? -3.726  -1.530  -0.288  1.00 0.00 ? 27 LEU A O    9  
ATOM   5055  C  CB   . LEU A 1 27 ? -2.191  -4.272  -1.611  1.00 0.00 ? 27 LEU A CB   9  
ATOM   5056  C  CG   . LEU A 1 27 ? -1.226  -3.313  -2.318  1.00 0.00 ? 27 LEU A CG   9  
ATOM   5057  C  CD1  . LEU A 1 27 ? -0.717  -2.233  -1.377  1.00 0.00 ? 27 LEU A CD1  9  
ATOM   5058  C  CD2  . LEU A 1 27 ? -0.069  -4.075  -2.927  1.00 0.00 ? 27 LEU A CD2  9  
ATOM   5059  H  H    . LEU A 1 27 ? -3.429  -5.756  0.011   1.00 0.00 ? 27 LEU A H    9  
ATOM   5060  H  HA   . LEU A 1 27 ? -2.057  -3.328  0.316   1.00 0.00 ? 27 LEU A HA   9  
ATOM   5061  H  HB2  . LEU A 1 27 ? -1.654  -5.180  -1.384  1.00 0.00 ? 27 LEU A HB2  9  
ATOM   5062  H  HB3  . LEU A 1 27 ? -2.990  -4.512  -2.298  1.00 0.00 ? 27 LEU A HB3  9  
ATOM   5063  H  HG   . LEU A 1 27 ? -1.762  -2.822  -3.120  1.00 0.00 ? 27 LEU A HG   9  
ATOM   5064  H  HD11 . LEU A 1 27 ? -0.019  -2.672  -0.675  1.00 0.00 ? 27 LEU A HD11 9  
ATOM   5065  H  HD12 . LEU A 1 27 ? -0.218  -1.464  -1.946  1.00 0.00 ? 27 LEU A HD12 9  
ATOM   5066  H  HD13 . LEU A 1 27 ? -1.546  -1.804  -0.837  1.00 0.00 ? 27 LEU A HD13 9  
ATOM   5067  H  HD21 . LEU A 1 27 ? 0.403   -4.678  -2.165  1.00 0.00 ? 27 LEU A HD21 9  
ATOM   5068  H  HD22 . LEU A 1 27 ? -0.433  -4.712  -3.718  1.00 0.00 ? 27 LEU A HD22 9  
ATOM   5069  H  HD23 . LEU A 1 27 ? 0.649   -3.375  -3.328  1.00 0.00 ? 27 LEU A HD23 9  
ATOM   5070  N  N    . ALA A 1 28 ? -4.886  -3.129  -1.381  1.00 0.00 ? 28 ALA A N    9  
ATOM   5071  C  CA   . ALA A 1 28 ? -5.955  -2.243  -1.820  1.00 0.00 ? 28 ALA A CA   9  
ATOM   5072  C  C    . ALA A 1 28 ? -6.599  -1.505  -0.645  1.00 0.00 ? 28 ALA A C    9  
ATOM   5073  O  O    . ALA A 1 28 ? -6.943  -0.331  -0.763  1.00 0.00 ? 28 ALA A O    9  
ATOM   5074  C  CB   . ALA A 1 28 ? -7.003  -3.031  -2.589  1.00 0.00 ? 28 ALA A CB   9  
ATOM   5075  H  H    . ALA A 1 28 ? -4.900  -4.068  -1.669  1.00 0.00 ? 28 ALA A H    9  
ATOM   5076  H  HA   . ALA A 1 28 ? -5.523  -1.516  -2.493  1.00 0.00 ? 28 ALA A HA   9  
ATOM   5077  H  HB1  . ALA A 1 28 ? -7.980  -2.613  -2.399  1.00 0.00 ? 28 ALA A HB1  9  
ATOM   5078  H  HB2  . ALA A 1 28 ? -6.788  -2.976  -3.647  1.00 0.00 ? 28 ALA A HB2  9  
ATOM   5079  H  HB3  . ALA A 1 28 ? -6.984  -4.063  -2.269  1.00 0.00 ? 28 ALA A HB3  9  
ATOM   5080  N  N    . LEU A 1 29 ? -6.748  -2.191  0.485   1.00 0.00 ? 29 LEU A N    9  
ATOM   5081  C  CA   . LEU A 1 29 ? -7.350  -1.591  1.674   1.00 0.00 ? 29 LEU A CA   9  
ATOM   5082  C  C    . LEU A 1 29 ? -6.586  -0.339  2.108   1.00 0.00 ? 29 LEU A C    9  
ATOM   5083  O  O    . LEU A 1 29 ? -7.190  0.690   2.420   1.00 0.00 ? 29 LEU A O    9  
ATOM   5084  C  CB   . LEU A 1 29 ? -7.394  -2.596  2.820   1.00 0.00 ? 29 LEU A CB   9  
ATOM   5085  C  CG   . LEU A 1 29 ? -8.469  -3.673  2.698   1.00 0.00 ? 29 LEU A CG   9  
ATOM   5086  C  CD1  . LEU A 1 29 ? -8.108  -4.882  3.544   1.00 0.00 ? 29 LEU A CD1  9  
ATOM   5087  C  CD2  . LEU A 1 29 ? -9.827  -3.122  3.106   1.00 0.00 ? 29 LEU A CD2  9  
ATOM   5088  H  H    . LEU A 1 29 ? -6.455  -3.128  0.519   1.00 0.00 ? 29 LEU A H    9  
ATOM   5089  H  HA   . LEU A 1 29 ? -8.358  -1.308  1.424   1.00 0.00 ? 29 LEU A HA   9  
ATOM   5090  H  HB2  . LEU A 1 29 ? -6.431  -3.080  2.883   1.00 0.00 ? 29 LEU A HB2  9  
ATOM   5091  H  HB3  . LEU A 1 29 ? -7.567  -2.051  3.734   1.00 0.00 ? 29 LEU A HB3  9  
ATOM   5092  H  HG   . LEU A 1 29 ? -8.533  -3.995  1.668   1.00 0.00 ? 29 LEU A HG   9  
ATOM   5093  H  HD11 . LEU A 1 29 ? -7.413  -5.506  3.001   1.00 0.00 ? 29 LEU A HD11 9  
ATOM   5094  H  HD12 . LEU A 1 29 ? -7.652  -4.554  4.467   1.00 0.00 ? 29 LEU A HD12 9  
ATOM   5095  H  HD13 . LEU A 1 29 ? -9.002  -5.447  3.765   1.00 0.00 ? 29 LEU A HD13 9  
ATOM   5096  H  HD21 . LEU A 1 29 ? -9.713  -2.488  3.973   1.00 0.00 ? 29 LEU A HD21 9  
ATOM   5097  H  HD22 . LEU A 1 29 ? -10.243 -2.547  2.290   1.00 0.00 ? 29 LEU A HD22 9  
ATOM   5098  H  HD23 . LEU A 1 29 ? -10.492 -3.940  3.345   1.00 0.00 ? 29 LEU A HD23 9  
ATOM   5099  N  N    . HIS A 1 30 ? -5.262  -0.413  2.052   1.00 0.00 ? 30 HIS A N    9  
ATOM   5100  C  CA   . HIS A 1 30 ? -4.420  0.736   2.354   1.00 0.00 ? 30 HIS A CA   9  
ATOM   5101  C  C    . HIS A 1 30 ? -4.443  1.728   1.192   1.00 0.00 ? 30 HIS A C    9  
ATOM   5102  O  O    . HIS A 1 30 ? -4.407  2.942   1.391   1.00 0.00 ? 30 HIS A O    9  
ATOM   5103  C  CB   . HIS A 1 30 ? -2.971  0.292   2.644   1.00 0.00 ? 30 HIS A CB   9  
ATOM   5104  C  CG   . HIS A 1 30 ? -1.944  1.350   2.357   1.00 0.00 ? 30 HIS A CG   9  
ATOM   5105  N  ND1  . HIS A 1 30 ? -1.733  2.446   3.158   1.00 0.00 ? 30 HIS A ND1  9  
ATOM   5106  C  CD2  . HIS A 1 30 ? -1.101  1.492   1.300   1.00 0.00 ? 30 HIS A CD2  9  
ATOM   5107  C  CE1  . HIS A 1 30 ? -0.801  3.210   2.574   1.00 0.00 ? 30 HIS A CE1  9  
ATOM   5108  N  NE2  . HIS A 1 30 ? -0.381  2.675   1.443   1.00 0.00 ? 30 HIS A NE2  9  
ATOM   5109  H  H    . HIS A 1 30 ? -4.843  -1.247  1.745   1.00 0.00 ? 30 HIS A H    9  
ATOM   5110  H  HA   . HIS A 1 30 ? -4.821  1.219   3.232   1.00 0.00 ? 30 HIS A HA   9  
ATOM   5111  H  HB2  . HIS A 1 30 ? -2.887  0.028   3.688   1.00 0.00 ? 30 HIS A HB2  9  
ATOM   5112  H  HB3  . HIS A 1 30 ? -2.734  -0.572  2.040   1.00 0.00 ? 30 HIS A HB3  9  
ATOM   5113  H  HD1  . HIS A 1 30 ? -2.179  2.633   4.024   1.00 0.00 ? 30 HIS A HD1  9  
ATOM   5114  H  HD2  . HIS A 1 30 ? -0.996  0.800   0.475   1.00 0.00 ? 30 HIS A HD2  9  
ATOM   5115  H  HE1  . HIS A 1 30 ? -0.435  4.144   2.980   1.00 0.00 ? 30 HIS A HE1  9  
ATOM   5116  N  N    . ARG A 1 31 ? -4.424  1.197   -0.024  1.00 0.00 ? 31 ARG A N    9  
ATOM   5117  C  CA   . ARG A 1 31 ? -4.306  2.025   -1.215  1.00 0.00 ? 31 ARG A CA   9  
ATOM   5118  C  C    . ARG A 1 31 ? -5.577  2.824   -1.481  1.00 0.00 ? 31 ARG A C    9  
ATOM   5119  O  O    . ARG A 1 31 ? -5.608  3.664   -2.378  1.00 0.00 ? 31 ARG A O    9  
ATOM   5120  C  CB   . ARG A 1 31 ? -3.958  1.168   -2.426  1.00 0.00 ? 31 ARG A CB   9  
ATOM   5121  C  CG   . ARG A 1 31 ? -2.518  0.680   -2.422  1.00 0.00 ? 31 ARG A CG   9  
ATOM   5122  C  CD   . ARG A 1 31 ? -2.008  0.412   -3.828  1.00 0.00 ? 31 ARG A CD   9  
ATOM   5123  N  NE   . ARG A 1 31 ? -1.787  1.646   -4.579  1.00 0.00 ? 31 ARG A NE   9  
ATOM   5124  C  CZ   . ARG A 1 31 ? -2.525  2.025   -5.625  1.00 0.00 ? 31 ARG A CZ   9  
ATOM   5125  N  NH1  . ARG A 1 31 ? -3.565  1.300   -6.006  1.00 0.00 ? 31 ARG A NH1  9  
ATOM   5126  N  NH2  . ARG A 1 31 ? -2.225  3.135   -6.281  1.00 0.00 ? 31 ARG A NH2  9  
ATOM   5127  H  H    . ARG A 1 31 ? -4.420  0.218   -0.121  1.00 0.00 ? 31 ARG A H    9  
ATOM   5128  H  HA   . ARG A 1 31 ? -3.492  2.716   -1.040  1.00 0.00 ? 31 ARG A HA   9  
ATOM   5129  H  HB2  . ARG A 1 31 ? -4.612  0.308   -2.445  1.00 0.00 ? 31 ARG A HB2  9  
ATOM   5130  H  HB3  . ARG A 1 31 ? -4.118  1.753   -3.319  1.00 0.00 ? 31 ARG A HB3  9  
ATOM   5131  H  HG2  . ARG A 1 31 ? -1.897  1.433   -1.964  1.00 0.00 ? 31 ARG A HG2  9  
ATOM   5132  H  HG3  . ARG A 1 31 ? -2.461  -0.234  -1.848  1.00 0.00 ? 31 ARG A HG3  9  
ATOM   5133  H  HD2  . ARG A 1 31 ? -1.072  -0.124  -3.758  1.00 0.00 ? 31 ARG A HD2  9  
ATOM   5134  H  HD3  . ARG A 1 31 ? -2.733  -0.194  -4.352  1.00 0.00 ? 31 ARG A HD3  9  
ATOM   5135  H  HE   . ARG A 1 31 ? -1.034  2.214   -4.301  1.00 0.00 ? 31 ARG A HE   9  
ATOM   5136  H  HH11 . ARG A 1 31 ? -3.813  0.460   -5.508  1.00 0.00 ? 31 ARG A HH11 9  
ATOM   5137  H  HH12 . ARG A 1 31 ? -4.115  1.585   -6.801  1.00 0.00 ? 31 ARG A HH12 9  
ATOM   5138  H  HH21 . ARG A 1 31 ? -1.439  3.698   -5.992  1.00 0.00 ? 31 ARG A HH21 9  
ATOM   5139  H  HH22 . ARG A 1 31 ? -2.775  3.420   -7.076  1.00 0.00 ? 31 ARG A HH22 9  
ATOM   5140  N  N    . LYS A 1 32 ? -6.581  2.639   -0.634  1.00 0.00 ? 32 LYS A N    9  
ATOM   5141  C  CA   . LYS A 1 32 ? -7.807  3.422   -0.716  1.00 0.00 ? 32 LYS A CA   9  
ATOM   5142  C  C    . LYS A 1 32 ? -7.501  4.896   -0.491  1.00 0.00 ? 32 LYS A C    9  
ATOM   5143  O  O    . LYS A 1 32 ? -8.117  5.772   -1.094  1.00 0.00 ? 32 LYS A O    9  
ATOM   5144  C  CB   . LYS A 1 32 ? -8.822  2.937   0.322   1.00 0.00 ? 32 LYS A CB   9  
ATOM   5145  C  CG   . LYS A 1 32 ? -10.010 2.202   -0.280  1.00 0.00 ? 32 LYS A CG   9  
ATOM   5146  C  CD   . LYS A 1 32 ? -9.564  1.131   -1.261  1.00 0.00 ? 32 LYS A CD   9  
ATOM   5147  C  CE   . LYS A 1 32 ? -10.324 -0.167  -1.055  1.00 0.00 ? 32 LYS A CE   9  
ATOM   5148  N  NZ   . LYS A 1 32 ? -11.211 -0.476  -2.204  1.00 0.00 ? 32 LYS A NZ   9  
ATOM   5149  H  H    . LYS A 1 32 ? -6.474  1.993   0.097   1.00 0.00 ? 32 LYS A H    9  
ATOM   5150  H  HA   . LYS A 1 32 ? -8.222  3.293   -1.704  1.00 0.00 ? 32 LYS A HA   9  
ATOM   5151  H  HB2  . LYS A 1 32 ? -8.324  2.269   1.009   1.00 0.00 ? 32 LYS A HB2  9  
ATOM   5152  H  HB3  . LYS A 1 32 ? -9.193  3.791   0.871   1.00 0.00 ? 32 LYS A HB3  9  
ATOM   5153  H  HG2  . LYS A 1 32 ? -10.572 1.735   0.514   1.00 0.00 ? 32 LYS A HG2  9  
ATOM   5154  H  HG3  . LYS A 1 32 ? -10.636 2.914   -0.797  1.00 0.00 ? 32 LYS A HG3  9  
ATOM   5155  H  HD2  . LYS A 1 32 ? -9.738  1.483   -2.267  1.00 0.00 ? 32 LYS A HD2  9  
ATOM   5156  H  HD3  . LYS A 1 32 ? -8.506  0.946   -1.119  1.00 0.00 ? 32 LYS A HD3  9  
ATOM   5157  H  HE2  . LYS A 1 32 ? -9.614  -0.970  -0.932  1.00 0.00 ? 32 LYS A HE2  9  
ATOM   5158  H  HE3  . LYS A 1 32 ? -10.925 -0.078  -0.162  1.00 0.00 ? 32 LYS A HE3  9  
ATOM   5159  H  HZ1  . LYS A 1 32 ? -11.564 0.407   -2.635  1.00 0.00 ? 32 LYS A HZ1  9  
ATOM   5160  H  HZ2  . LYS A 1 32 ? -12.028 -1.041  -1.884  1.00 0.00 ? 32 LYS A HZ2  9  
ATOM   5161  H  HZ3  . LYS A 1 32 ? -10.688 -1.018  -2.929  1.00 0.00 ? 32 LYS A HZ3  9  
ATOM   5162  N  N    . ARG A 1 33 ? -6.477  5.157   0.314   1.00 0.00 ? 33 ARG A N    9  
ATOM   5163  C  CA   . ARG A 1 33 ? -6.039  6.517   0.583   1.00 0.00 ? 33 ARG A CA   9  
ATOM   5164  C  C    . ARG A 1 33 ? -5.365  7.128   -0.636  1.00 0.00 ? 33 ARG A C    9  
ATOM   5165  O  O    . ARG A 1 33 ? -5.279  8.351   -0.766  1.00 0.00 ? 33 ARG A O    9  
ATOM   5166  C  CB   . ARG A 1 33 ? -5.079  6.537   1.774   1.00 0.00 ? 33 ARG A CB   9  
ATOM   5167  C  CG   . ARG A 1 33 ? -5.696  7.089   3.045   1.00 0.00 ? 33 ARG A CG   9  
ATOM   5168  C  CD   . ARG A 1 33 ? -6.389  8.417   2.798   1.00 0.00 ? 33 ARG A CD   9  
ATOM   5169  N  NE   . ARG A 1 33 ? -7.844  8.288   2.834   1.00 0.00 ? 33 ARG A NE   9  
ATOM   5170  C  CZ   . ARG A 1 33 ? -8.683  9.272   2.528   1.00 0.00 ? 33 ARG A CZ   9  
ATOM   5171  N  NH1  . ARG A 1 33 ? -8.219  10.411  2.029   1.00 0.00 ? 33 ARG A NH1  9  
ATOM   5172  N  NH2  . ARG A 1 33 ? -9.991  9.106   2.693   1.00 0.00 ? 33 ARG A NH2  9  
ATOM   5173  H  H    . ARG A 1 33 ? -5.989  4.409   0.723   1.00 0.00 ? 33 ARG A H    9  
ATOM   5174  H  HA   . ARG A 1 33 ? -6.908  7.099   0.821   1.00 0.00 ? 33 ARG A HA   9  
ATOM   5175  H  HB2  . ARG A 1 33 ? -4.748  5.528   1.971   1.00 0.00 ? 33 ARG A HB2  9  
ATOM   5176  H  HB3  . ARG A 1 33 ? -4.221  7.144   1.521   1.00 0.00 ? 33 ARG A HB3  9  
ATOM   5177  H  HG2  . ARG A 1 33 ? -6.421  6.381   3.417   1.00 0.00 ? 33 ARG A HG2  9  
ATOM   5178  H  HG3  . ARG A 1 33 ? -4.919  7.231   3.780   1.00 0.00 ? 33 ARG A HG3  9  
ATOM   5179  H  HD2  . ARG A 1 33 ? -6.081  9.117   3.561   1.00 0.00 ? 33 ARG A HD2  9  
ATOM   5180  H  HD3  . ARG A 1 33 ? -6.093  8.788   1.828   1.00 0.00 ? 33 ARG A HD3  9  
ATOM   5181  H  HE   . ARG A 1 33 ? -8.214  7.421   3.138   1.00 0.00 ? 33 ARG A HE   9  
ATOM   5182  H  HH11 . ARG A 1 33 ? -7.232  10.530  1.876   1.00 0.00 ? 33 ARG A HH11 9  
ATOM   5183  H  HH12 . ARG A 1 33 ? -8.847  11.165  1.816   1.00 0.00 ? 33 ARG A HH12 9  
ATOM   5184  H  HH21 . ARG A 1 33 ? -10.349 8.238   3.058   1.00 0.00 ? 33 ARG A HH21 9  
ATOM   5185  H  HH22 . ARG A 1 33 ? -10.635 9.847   2.453   1.00 0.00 ? 33 ARG A HH22 9  
ATOM   5186  N  N    . HIS A 1 34 ? -4.951  6.275   -1.558  1.00 0.00 ? 34 HIS A N    9  
ATOM   5187  C  CA   . HIS A 1 34 ? -4.340  6.728   -2.797  1.00 0.00 ? 34 HIS A CA   9  
ATOM   5188  C  C    . HIS A 1 34 ? -5.396  6.821   -3.889  1.00 0.00 ? 34 HIS A C    9  
ATOM   5189  O  O    . HIS A 1 34 ? -5.109  7.221   -5.017  1.00 0.00 ? 34 HIS A O    9  
ATOM   5190  C  CB   . HIS A 1 34 ? -3.218  5.776   -3.231  1.00 0.00 ? 34 HIS A CB   9  
ATOM   5191  C  CG   . HIS A 1 34 ? -2.115  5.631   -2.224  1.00 0.00 ? 34 HIS A CG   9  
ATOM   5192  N  ND1  . HIS A 1 34 ? -1.272  6.652   -1.852  1.00 0.00 ? 34 HIS A ND1  9  
ATOM   5193  C  CD2  . HIS A 1 34 ? -1.726  4.547   -1.504  1.00 0.00 ? 34 HIS A CD2  9  
ATOM   5194  C  CE1  . HIS A 1 34 ? -0.418  6.167   -0.939  1.00 0.00 ? 34 HIS A CE1  9  
ATOM   5195  N  NE2  . HIS A 1 34 ? -0.649  4.888   -0.692  1.00 0.00 ? 34 HIS A NE2  9  
ATOM   5196  H  H    . HIS A 1 34 ? -5.113  5.313   -1.425  1.00 0.00 ? 34 HIS A H    9  
ATOM   5197  H  HA   . HIS A 1 34 ? -3.925  7.711   -2.626  1.00 0.00 ? 34 HIS A HA   9  
ATOM   5198  H  HB2  . HIS A 1 34 ? -3.636  4.796   -3.403  1.00 0.00 ? 34 HIS A HB2  9  
ATOM   5199  H  HB3  . HIS A 1 34 ? -2.782  6.140   -4.150  1.00 0.00 ? 34 HIS A HB3  9  
ATOM   5200  H  HD1  . HIS A 1 34 ? -1.277  7.569   -2.210  1.00 0.00 ? 34 HIS A HD1  9  
ATOM   5201  H  HD2  . HIS A 1 34 ? -2.159  3.559   -1.558  1.00 0.00 ? 34 HIS A HD2  9  
ATOM   5202  H  HE1  . HIS A 1 34 ? 0.359   6.747   -0.464  1.00 0.00 ? 34 HIS A HE1  9  
ATOM   5203  N  N    . MET A 1 35 ? -6.618  6.436   -3.546  1.00 0.00 ? 35 MET A N    9  
ATOM   5204  C  CA   . MET A 1 35 ? -7.722  6.464   -4.494  1.00 0.00 ? 35 MET A CA   9  
ATOM   5205  C  C    . MET A 1 35 ? -8.691  7.582   -4.139  1.00 0.00 ? 35 MET A C    9  
ATOM   5206  O  O    . MET A 1 35 ? -9.347  8.153   -5.009  1.00 0.00 ? 35 MET A O    9  
ATOM   5207  C  CB   . MET A 1 35 ? -8.446  5.118   -4.509  1.00 0.00 ? 35 MET A CB   9  
ATOM   5208  C  CG   . MET A 1 35 ? -7.633  4.001   -5.141  1.00 0.00 ? 35 MET A CG   9  
ATOM   5209  S  SD   . MET A 1 35 ? -8.639  2.887   -6.140  1.00 0.00 ? 35 MET A SD   9  
ATOM   5210  C  CE   . MET A 1 35 ? -8.066  3.308   -7.786  1.00 0.00 ? 35 MET A CE   9  
ATOM   5211  H  H    . MET A 1 35 ? -6.781  6.126   -2.626  1.00 0.00 ? 35 MET A H    9  
ATOM   5212  H  HA   . MET A 1 35 ? -7.312  6.656   -5.475  1.00 0.00 ? 35 MET A HA   9  
ATOM   5213  H  HB2  . MET A 1 35 ? -8.676  4.837   -3.492  1.00 0.00 ? 35 MET A HB2  9  
ATOM   5214  H  HB3  . MET A 1 35 ? -9.367  5.223   -5.062  1.00 0.00 ? 35 MET A HB3  9  
ATOM   5215  H  HG2  . MET A 1 35 ? -6.873  4.440   -5.772  1.00 0.00 ? 35 MET A HG2  9  
ATOM   5216  H  HG3  . MET A 1 35 ? -7.161  3.430   -4.356  1.00 0.00 ? 35 MET A HG3  9  
ATOM   5217  H  HE1  . MET A 1 35 ? -8.547  4.219   -8.114  1.00 0.00 ? 35 MET A HE1  9  
ATOM   5218  H  HE2  . MET A 1 35 ? -6.997  3.452   -7.766  1.00 0.00 ? 35 MET A HE2  9  
ATOM   5219  H  HE3  . MET A 1 35 ? -8.308  2.507   -8.469  1.00 0.00 ? 35 MET A HE3  9  
ATOM   5220  N  N    . LEU A 1 36 ? -8.685  7.968   -2.872  1.00 0.00 ? 36 LEU A N    9  
ATOM   5221  C  CA   . LEU A 1 36 ? -9.476  9.094   -2.415  1.00 0.00 ? 36 LEU A CA   9  
ATOM   5222  C  C    . LEU A 1 36 ? -8.544  10.251  -2.105  1.00 0.00 ? 36 LEU A C    9  
ATOM   5223  O  O    . LEU A 1 36 ? -8.536  10.789  -0.997  1.00 0.00 ? 36 LEU A O    9  
ATOM   5224  C  CB   . LEU A 1 36 ? -10.287 8.715   -1.171  1.00 0.00 ? 36 LEU A CB   9  
ATOM   5225  C  CG   . LEU A 1 36 ? -11.120 7.438   -1.300  1.00 0.00 ? 36 LEU A CG   9  
ATOM   5226  C  CD1  . LEU A 1 36 ? -11.570 6.956   0.070   1.00 0.00 ? 36 LEU A CD1  9  
ATOM   5227  C  CD2  . LEU A 1 36 ? -12.321 7.669   -2.205  1.00 0.00 ? 36 LEU A CD2  9  
ATOM   5228  H  H    . LEU A 1 36 ? -8.065  7.542   -2.247  1.00 0.00 ? 36 LEU A H    9  
ATOM   5229  H  HA   . LEU A 1 36 ? -10.147 9.382   -3.211  1.00 0.00 ? 36 LEU A HA   9  
ATOM   5230  H  HB2  . LEU A 1 36 ? -9.600  8.591   -0.347  1.00 0.00 ? 36 LEU A HB2  9  
ATOM   5231  H  HB3  . LEU A 1 36 ? -10.954 9.532   -0.941  1.00 0.00 ? 36 LEU A HB3  9  
ATOM   5232  H  HG   . LEU A 1 36 ? -10.511 6.663   -1.742  1.00 0.00 ? 36 LEU A HG   9  
ATOM   5233  H  HD11 . LEU A 1 36 ? -10.709 6.653   0.647   1.00 0.00 ? 36 LEU A HD11 9  
ATOM   5234  H  HD12 . LEU A 1 36 ? -12.085 7.757   0.584   1.00 0.00 ? 36 LEU A HD12 9  
ATOM   5235  H  HD13 . LEU A 1 36 ? -12.239 6.115   -0.046  1.00 0.00 ? 36 LEU A HD13 9  
ATOM   5236  H  HD21 . LEU A 1 36 ? -12.006 8.199   -3.091  1.00 0.00 ? 36 LEU A HD21 9  
ATOM   5237  H  HD22 . LEU A 1 36 ? -12.747 6.718   -2.489  1.00 0.00 ? 36 LEU A HD22 9  
ATOM   5238  H  HD23 . LEU A 1 36 ? -13.062 8.253   -1.679  1.00 0.00 ? 36 LEU A HD23 9  
ATOM   5239  N  N    . VAL A 1 37 ? -7.718  10.590  -3.081  1.00 0.00 ? 37 VAL A N    9  
ATOM   5240  C  CA   . VAL A 1 37 ? -6.727  11.636  -2.909  1.00 0.00 ? 37 VAL A CA   9  
ATOM   5241  C  C    . VAL A 1 37 ? -7.327  13.000  -3.213  1.00 0.00 ? 37 VAL A C    9  
ATOM   5242  O  O    . VAL A 1 37 ? -8.224  13.074  -4.078  1.00 0.00 ? 37 VAL A O    9  
ATOM   5243  C  CB   . VAL A 1 37 ? -5.483  11.422  -3.802  1.00 0.00 ? 37 VAL A CB   9  
ATOM   5244  C  CG1  . VAL A 1 37 ? -4.400  10.678  -3.039  1.00 0.00 ? 37 VAL A CG1  9  
ATOM   5245  C  CG2  . VAL A 1 37 ? -5.844  10.685  -5.087  1.00 0.00 ? 37 VAL A CG2  9  
ATOM   5246  O  OXT  . VAL A 1 37 ? -6.894  13.992  -2.596  1.00 0.00 ? 37 VAL A OXT  9  
ATOM   5247  H  H    . VAL A 1 37 ? -7.764  10.110  -3.931  1.00 0.00 ? 37 VAL A H    9  
ATOM   5248  H  HA   . VAL A 1 37 ? -6.411  11.613  -1.878  1.00 0.00 ? 37 VAL A HA   9  
ATOM   5249  H  HB   . VAL A 1 37 ? -5.092  12.393  -4.072  1.00 0.00 ? 37 VAL A HB   9  
ATOM   5250  H  HG11 . VAL A 1 37 ? -4.098  9.807   -3.603  1.00 0.00 ? 37 VAL A HG11 9  
ATOM   5251  H  HG12 . VAL A 1 37 ? -3.548  11.328  -2.901  1.00 0.00 ? 37 VAL A HG12 9  
ATOM   5252  H  HG13 . VAL A 1 37 ? -4.781  10.372  -2.076  1.00 0.00 ? 37 VAL A HG13 9  
ATOM   5253  H  HG21 . VAL A 1 37 ? -5.945  9.629   -4.879  1.00 0.00 ? 37 VAL A HG21 9  
ATOM   5254  H  HG22 . VAL A 1 37 ? -6.776  11.069  -5.474  1.00 0.00 ? 37 VAL A HG22 9  
ATOM   5255  H  HG23 . VAL A 1 37 ? -5.062  10.834  -5.817  1.00 0.00 ? 37 VAL A HG23 9  
HETATM 5256  ZN ZN   . ZN  B 2 .  ? 0.677   3.648   0.071   1.00 0.00 ? 38 ZN  A ZN   9  
ATOM   5257  N  N    . GLY A 1 1  ? 6.797   8.007   -2.307  1.00 0.00 ? 1  GLY A N    10 
ATOM   5258  C  CA   . GLY A 1 1  ? 7.215   7.594   -0.951  1.00 0.00 ? 1  GLY A CA   10 
ATOM   5259  C  C    . GLY A 1 1  ? 8.177   6.431   -0.997  1.00 0.00 ? 1  GLY A C    10 
ATOM   5260  O  O    . GLY A 1 1  ? 8.007   5.504   -1.788  1.00 0.00 ? 1  GLY A O    10 
ATOM   5261  H  H1   . GLY A 1 1  ? 7.139   8.968   -2.511  1.00 0.00 ? 1  GLY A H1   10 
ATOM   5262  H  H2   . GLY A 1 1  ? 5.762   7.998   -2.377  1.00 0.00 ? 1  GLY A H2   10 
ATOM   5263  H  H3   . GLY A 1 1  ? 7.190   7.352   -3.016  1.00 0.00 ? 1  GLY A H3   10 
ATOM   5264  H  HA2  . GLY A 1 1  ? 7.695   8.427   -0.458  1.00 0.00 ? 1  GLY A HA2  10 
ATOM   5265  H  HA3  . GLY A 1 1  ? 6.340   7.306   -0.384  1.00 0.00 ? 1  GLY A HA3  10 
ATOM   5266  N  N    . SER A 1 2  ? 9.220   6.505   -0.192  1.00 0.00 ? 2  SER A N    10 
ATOM   5267  C  CA   . SER A 1 2  ? 10.239  5.471   -0.168  1.00 0.00 ? 2  SER A CA   10 
ATOM   5268  C  C    . SER A 1 2  ? 10.099  4.601   1.080   1.00 0.00 ? 2  SER A C    10 
ATOM   5269  O  O    . SER A 1 2  ? 9.208   4.830   1.902   1.00 0.00 ? 2  SER A O    10 
ATOM   5270  C  CB   . SER A 1 2  ? 11.620  6.123   -0.215  1.00 0.00 ? 2  SER A CB   10 
ATOM   5271  O  OG   . SER A 1 2  ? 11.547  7.424   -0.779  1.00 0.00 ? 2  SER A OG   10 
ATOM   5272  H  H    . SER A 1 2  ? 9.326   7.297   0.386   1.00 0.00 ? 2  SER A H    10 
ATOM   5273  H  HA   . SER A 1 2  ? 10.110  4.853   -1.044  1.00 0.00 ? 2  SER A HA   10 
ATOM   5274  H  HB2  . SER A 1 2  ? 12.014  6.198   0.789   1.00 0.00 ? 2  SER A HB2  10 
ATOM   5275  H  HB3  . SER A 1 2  ? 12.281  5.518   -0.818  1.00 0.00 ? 2  SER A HB3  10 
ATOM   5276  H  HG   . SER A 1 2  ? 10.707  7.521   -1.253  1.00 0.00 ? 2  SER A HG   10 
ATOM   5277  N  N    . THR A 1 3  ? 10.977  3.603   1.190   1.00 0.00 ? 3  THR A N    10 
ATOM   5278  C  CA   . THR A 1 3  ? 11.008  2.672   2.317   1.00 0.00 ? 3  THR A CA   10 
ATOM   5279  C  C    . THR A 1 3  ? 10.748  3.358   3.662   1.00 0.00 ? 3  THR A C    10 
ATOM   5280  O  O    . THR A 1 3  ? 11.241  4.459   3.928   1.00 0.00 ? 3  THR A O    10 
ATOM   5281  C  CB   . THR A 1 3  ? 12.369  1.951   2.369   1.00 0.00 ? 3  THR A CB   10 
ATOM   5282  O  OG1  . THR A 1 3  ? 12.693  1.433   1.071   1.00 0.00 ? 3  THR A OG1  10 
ATOM   5283  C  CG2  . THR A 1 3  ? 12.357  0.817   3.382   1.00 0.00 ? 3  THR A CG2  10 
ATOM   5284  H  H    . THR A 1 3  ? 11.621  3.469   0.462   1.00 0.00 ? 3  THR A H    10 
ATOM   5285  H  HA   . THR A 1 3  ? 10.245  1.928   2.152   1.00 0.00 ? 3  THR A HA   10 
ATOM   5286  H  HB   . THR A 1 3  ? 13.125  2.668   2.661   1.00 0.00 ? 3  THR A HB   10 
ATOM   5287  H  HG1  . THR A 1 3  ? 13.022  2.152   0.510   1.00 0.00 ? 3  THR A HG1  10 
ATOM   5288  H  HG21 . THR A 1 3  ? 11.509  0.931   4.040   1.00 0.00 ? 3  THR A HG21 10 
ATOM   5289  H  HG22 . THR A 1 3  ? 13.269  0.842   3.962   1.00 0.00 ? 3  THR A HG22 10 
ATOM   5290  H  HG23 . THR A 1 3  ? 12.287  -0.129  2.865   1.00 0.00 ? 3  THR A HG23 10 
ATOM   5291  N  N    . ARG A 1 4  ? 9.966   2.695   4.500   1.00 0.00 ? 4  ARG A N    10 
ATOM   5292  C  CA   . ARG A 1 4  ? 9.611   3.215   5.809   1.00 0.00 ? 4  ARG A CA   10 
ATOM   5293  C  C    . ARG A 1 4  ? 9.547   2.074   6.819   1.00 0.00 ? 4  ARG A C    10 
ATOM   5294  O  O    . ARG A 1 4  ? 8.644   2.009   7.654   1.00 0.00 ? 4  ARG A O    10 
ATOM   5295  C  CB   . ARG A 1 4  ? 8.266   3.946   5.749   1.00 0.00 ? 4  ARG A CB   10 
ATOM   5296  C  CG   . ARG A 1 4  ? 7.224   3.258   4.876   1.00 0.00 ? 4  ARG A CG   10 
ATOM   5297  C  CD   . ARG A 1 4  ? 6.149   4.233   4.420   1.00 0.00 ? 4  ARG A CD   10 
ATOM   5298  N  NE   . ARG A 1 4  ? 6.704   5.317   3.608   1.00 0.00 ? 4  ARG A NE   10 
ATOM   5299  C  CZ   . ARG A 1 4  ? 6.042   6.429   3.288   1.00 0.00 ? 4  ARG A CZ   10 
ATOM   5300  N  NH1  . ARG A 1 4  ? 4.794   6.607   3.704   1.00 0.00 ? 4  ARG A NH1  10 
ATOM   5301  N  NH2  . ARG A 1 4  ? 6.638   7.367   2.560   1.00 0.00 ? 4  ARG A NH2  10 
ATOM   5302  H  H    . ARG A 1 4  ? 9.601   1.821   4.220   1.00 0.00 ? 4  ARG A H    10 
ATOM   5303  H  HA   . ARG A 1 4  ? 10.380  3.909   6.112   1.00 0.00 ? 4  ARG A HA   10 
ATOM   5304  H  HB2  . ARG A 1 4  ? 7.869   4.022   6.751   1.00 0.00 ? 4  ARG A HB2  10 
ATOM   5305  H  HB3  . ARG A 1 4  ? 8.428   4.940   5.360   1.00 0.00 ? 4  ARG A HB3  10 
ATOM   5306  H  HG2  . ARG A 1 4  ? 7.714   2.846   4.007   1.00 0.00 ? 4  ARG A HG2  10 
ATOM   5307  H  HG3  . ARG A 1 4  ? 6.761   2.463   5.443   1.00 0.00 ? 4  ARG A HG3  10 
ATOM   5308  H  HD2  . ARG A 1 4  ? 5.420   3.695   3.833   1.00 0.00 ? 4  ARG A HD2  10 
ATOM   5309  H  HD3  . ARG A 1 4  ? 5.670   4.656   5.291   1.00 0.00 ? 4  ARG A HD3  10 
ATOM   5310  H  HE   . ARG A 1 4  ? 7.628   5.208   3.283   1.00 0.00 ? 4  ARG A HE   10 
ATOM   5311  H  HH11 . ARG A 1 4  ? 4.341   5.903   4.261   1.00 0.00 ? 4  ARG A HH11 10 
ATOM   5312  H  HH12 . ARG A 1 4  ? 4.295   7.449   3.467   1.00 0.00 ? 4  ARG A HH12 10 
ATOM   5313  H  HH21 . ARG A 1 4  ? 7.586   7.241   2.257   1.00 0.00 ? 4  ARG A HH21 10 
ATOM   5314  H  HH22 . ARG A 1 4  ? 6.144   8.207   2.309   1.00 0.00 ? 4  ARG A HH22 10 
ATOM   5315  N  N    . GLY A 1 5  ? 10.538  1.193   6.758   1.00 0.00 ? 5  GLY A N    10 
ATOM   5316  C  CA   . GLY A 1 5  ? 10.607  0.090   7.694   1.00 0.00 ? 5  GLY A CA   10 
ATOM   5317  C  C    . GLY A 1 5  ? 10.771  -1.256  7.014   1.00 0.00 ? 5  GLY A C    10 
ATOM   5318  O  O    . GLY A 1 5  ? 11.234  -2.218  7.627   1.00 0.00 ? 5  GLY A O    10 
ATOM   5319  H  H    . GLY A 1 5  ? 11.259  1.325   6.105   1.00 0.00 ? 5  GLY A H    10 
ATOM   5320  H  HA2  . GLY A 1 5  ? 11.443  0.249   8.358   1.00 0.00 ? 5  GLY A HA2  10 
ATOM   5321  H  HA3  . GLY A 1 5  ? 9.698   0.074   8.278   1.00 0.00 ? 5  GLY A HA3  10 
ATOM   5322  N  N    . SER A 1 6  ? 10.340  -1.350  5.766   1.00 0.00 ? 6  SER A N    10 
ATOM   5323  C  CA   . SER A 1 6  ? 10.374  -2.617  5.046   1.00 0.00 ? 6  SER A CA   10 
ATOM   5324  C  C    . SER A 1 6  ? 10.940  -2.438  3.639   1.00 0.00 ? 6  SER A C    10 
ATOM   5325  O  O    . SER A 1 6  ? 10.430  -1.642  2.850   1.00 0.00 ? 6  SER A O    10 
ATOM   5326  C  CB   . SER A 1 6  ? 8.963   -3.200  4.977   1.00 0.00 ? 6  SER A CB   10 
ATOM   5327  O  OG   . SER A 1 6  ? 8.138   -2.649  5.995   1.00 0.00 ? 6  SER A OG   10 
ATOM   5328  H  H    . SER A 1 6  ? 9.916   -0.572  5.345   1.00 0.00 ? 6  SER A H    10 
ATOM   5329  H  HA   . SER A 1 6  ? 11.008  -3.296  5.596   1.00 0.00 ? 6  SER A HA   10 
ATOM   5330  H  HB2  . SER A 1 6  ? 8.528   -2.974  4.016   1.00 0.00 ? 6  SER A HB2  10 
ATOM   5331  H  HB3  . SER A 1 6  ? 9.012   -4.270  5.110   1.00 0.00 ? 6  SER A HB3  10 
ATOM   5332  H  HG   . SER A 1 6  ? 8.422   -2.991  6.859   1.00 0.00 ? 6  SER A HG   10 
ATOM   5333  N  N    . THR A 1 7  ? 12.043  -3.112  3.359   1.00 0.00 ? 7  THR A N    10 
ATOM   5334  C  CA   . THR A 1 7  ? 12.737  -2.945  2.094   1.00 0.00 ? 7  THR A CA   10 
ATOM   5335  C  C    . THR A 1 7  ? 12.131  -3.817  0.994   1.00 0.00 ? 7  THR A C    10 
ATOM   5336  O  O    . THR A 1 7  ? 12.737  -4.797  0.557   1.00 0.00 ? 7  THR A O    10 
ATOM   5337  C  CB   . THR A 1 7  ? 14.223  -3.290  2.262   1.00 0.00 ? 7  THR A CB   10 
ATOM   5338  O  OG1  . THR A 1 7  ? 14.373  -4.225  3.340   1.00 0.00 ? 7  THR A OG1  10 
ATOM   5339  C  CG2  . THR A 1 7  ? 15.039  -2.042  2.554   1.00 0.00 ? 7  THR A CG2  10 
ATOM   5340  H  H    . THR A 1 7  ? 12.453  -3.675  4.054   1.00 0.00 ? 7  THR A H    10 
ATOM   5341  H  HA   . THR A 1 7  ? 12.662  -1.907  1.802   1.00 0.00 ? 7  THR A HA   10 
ATOM   5342  H  HB   . THR A 1 7  ? 14.584  -3.737  1.346   1.00 0.00 ? 7  THR A HB   10 
ATOM   5343  H  HG1  . THR A 1 7  ? 15.267  -4.145  3.710   1.00 0.00 ? 7  THR A HG1  10 
ATOM   5344  H  HG21 . THR A 1 7  ? 14.374  -1.203  2.699   1.00 0.00 ? 7  THR A HG21 10 
ATOM   5345  H  HG22 . THR A 1 7  ? 15.697  -1.840  1.723   1.00 0.00 ? 7  THR A HG22 10 
ATOM   5346  H  HG23 . THR A 1 7  ? 15.624  -2.197  3.449   1.00 0.00 ? 7  THR A HG23 10 
ATOM   5347  N  N    . GLY A 1 8  ? 10.965  -3.408  0.508   1.00 0.00 ? 8  GLY A N    10 
ATOM   5348  C  CA   . GLY A 1 8  ? 10.314  -4.101  -0.590  1.00 0.00 ? 8  GLY A CA   10 
ATOM   5349  C  C    . GLY A 1 8  ? 10.020  -5.548  -0.284  1.00 0.00 ? 8  GLY A C    10 
ATOM   5350  O  O    . GLY A 1 8  ? 10.110  -6.409  -1.157  1.00 0.00 ? 8  GLY A O    10 
ATOM   5351  H  H    . GLY A 1 8  ? 10.562  -2.585  0.865   1.00 0.00 ? 8  GLY A H    10 
ATOM   5352  H  HA2  . GLY A 1 8  ? 9.381   -3.605  -0.803  1.00 0.00 ? 8  GLY A HA2  10 
ATOM   5353  H  HA3  . GLY A 1 8  ? 10.946  -4.048  -1.462  1.00 0.00 ? 8  GLY A HA3  10 
ATOM   5354  N  N    . ILE A 1 9  ? 9.615   -5.798  0.942   1.00 0.00 ? 9  ILE A N    10 
ATOM   5355  C  CA   . ILE A 1 9  ? 9.239   -7.140  1.367   1.00 0.00 ? 9  ILE A CA   10 
ATOM   5356  C  C    . ILE A 1 9  ? 7.833   -7.483  0.872   1.00 0.00 ? 9  ILE A C    10 
ATOM   5357  O  O    . ILE A 1 9  ? 7.057   -6.583  0.559   1.00 0.00 ? 9  ILE A O    10 
ATOM   5358  C  CB   . ILE A 1 9  ? 9.308   -7.269  2.906   1.00 0.00 ? 9  ILE A CB   10 
ATOM   5359  C  CG1  . ILE A 1 9  ? 10.507  -6.484  3.449   1.00 0.00 ? 9  ILE A CG1  10 
ATOM   5360  C  CG2  . ILE A 1 9  ? 9.401   -8.730  3.326   1.00 0.00 ? 9  ILE A CG2  10 
ATOM   5361  C  CD1  . ILE A 1 9  ? 10.521  -6.354  4.956   1.00 0.00 ? 9  ILE A CD1  10 
ATOM   5362  H  H    . ILE A 1 9  ? 9.470   -5.041  1.546   1.00 0.00 ? 9  ILE A H    10 
ATOM   5363  H  HA   . ILE A 1 9  ? 9.943   -7.837  0.933   1.00 0.00 ? 9  ILE A HA   10 
ATOM   5364  H  HB   . ILE A 1 9  ? 8.401   -6.855  3.317   1.00 0.00 ? 9  ILE A HB   10 
ATOM   5365  H  HG12 . ILE A 1 9  ? 11.418  -6.983  3.154   1.00 0.00 ? 9  ILE A HG12 10 
ATOM   5366  H  HG13 . ILE A 1 9  ? 10.498  -5.488  3.030   1.00 0.00 ? 9  ILE A HG13 10 
ATOM   5367  H  HG21 . ILE A 1 9  ? 8.515   -9.002  3.881   1.00 0.00 ? 9  ILE A HG21 10 
ATOM   5368  H  HG22 . ILE A 1 9  ? 9.480   -9.353  2.448   1.00 0.00 ? 9  ILE A HG22 10 
ATOM   5369  H  HG23 . ILE A 1 9  ? 10.273  -8.872  3.947   1.00 0.00 ? 9  ILE A HG23 10 
ATOM   5370  H  HD11 . ILE A 1 9  ? 11.382  -6.871  5.354   1.00 0.00 ? 9  ILE A HD11 10 
ATOM   5371  H  HD12 . ILE A 1 9  ? 10.572  -5.310  5.229   1.00 0.00 ? 9  ILE A HD12 10 
ATOM   5372  H  HD13 . ILE A 1 9  ? 9.620   -6.789  5.365   1.00 0.00 ? 9  ILE A HD13 10 
ATOM   5373  N  N    . LYS A 1 10 ? 7.493   -8.774  0.874   1.00 0.00 ? 10 LYS A N    10 
ATOM   5374  C  CA   . LYS A 1 10 ? 6.160   -9.250  0.477   1.00 0.00 ? 10 LYS A CA   10 
ATOM   5375  C  C    . LYS A 1 10 ? 5.896   -9.035  -1.019  1.00 0.00 ? 10 LYS A C    10 
ATOM   5376  O  O    . LYS A 1 10 ? 6.406   -8.095  -1.629  1.00 0.00 ? 10 LYS A O    10 
ATOM   5377  C  CB   . LYS A 1 10 ? 5.066   -8.581  1.316   1.00 0.00 ? 10 LYS A CB   10 
ATOM   5378  C  CG   . LYS A 1 10 ? 4.762   -9.324  2.606   1.00 0.00 ? 10 LYS A CG   10 
ATOM   5379  C  CD   . LYS A 1 10 ? 4.597   -8.370  3.775   1.00 0.00 ? 10 LYS A CD   10 
ATOM   5380  C  CE   . LYS A 1 10 ? 5.851   -8.306  4.630   1.00 0.00 ? 10 LYS A CE   10 
ATOM   5381  N  NZ   . LYS A 1 10 ? 5.619   -8.841  5.995   1.00 0.00 ? 10 LYS A NZ   10 
ATOM   5382  H  H    . LYS A 1 10 ? 8.150   -9.432  1.180   1.00 0.00 ? 10 LYS A H    10 
ATOM   5383  H  HA   . LYS A 1 10 ? 6.131   -10.313 0.671   1.00 0.00 ? 10 LYS A HA   10 
ATOM   5384  H  HB2  . LYS A 1 10 ? 5.379   -7.577  1.564   1.00 0.00 ? 10 LYS A HB2  10 
ATOM   5385  H  HB3  . LYS A 1 10 ? 4.159   -8.532  0.729   1.00 0.00 ? 10 LYS A HB3  10 
ATOM   5386  H  HG2  . LYS A 1 10 ? 3.847   -9.883  2.479   1.00 0.00 ? 10 LYS A HG2  10 
ATOM   5387  H  HG3  . LYS A 1 10 ? 5.574   -10.003 2.818   1.00 0.00 ? 10 LYS A HG3  10 
ATOM   5388  H  HD2  . LYS A 1 10 ? 4.382   -7.385  3.395   1.00 0.00 ? 10 LYS A HD2  10 
ATOM   5389  H  HD3  . LYS A 1 10 ? 3.772   -8.708  4.387   1.00 0.00 ? 10 LYS A HD3  10 
ATOM   5390  H  HE2  . LYS A 1 10 ? 6.628   -8.885  4.153   1.00 0.00 ? 10 LYS A HE2  10 
ATOM   5391  H  HE3  . LYS A 1 10 ? 6.166   -7.276  4.704   1.00 0.00 ? 10 LYS A HE3  10 
ATOM   5392  H  HZ1  . LYS A 1 10 ? 4.614   -9.087  6.119   1.00 0.00 ? 10 LYS A HZ1  10 
ATOM   5393  H  HZ2  . LYS A 1 10 ? 5.878   -8.127  6.711   1.00 0.00 ? 10 LYS A HZ2  10 
ATOM   5394  H  HZ3  . LYS A 1 10 ? 6.192   -9.697  6.147   1.00 0.00 ? 10 LYS A HZ3  10 
ATOM   5395  N  N    . PRO A 1 11 ? 5.146   -9.950  -1.650  1.00 0.00 ? 11 PRO A N    10 
ATOM   5396  C  CA   . PRO A 1 11 ? 4.874   -9.894  -3.090  1.00 0.00 ? 11 PRO A CA   10 
ATOM   5397  C  C    . PRO A 1 11 ? 3.863   -8.808  -3.458  1.00 0.00 ? 11 PRO A C    10 
ATOM   5398  O  O    . PRO A 1 11 ? 3.689   -8.479  -4.631  1.00 0.00 ? 11 PRO A O    10 
ATOM   5399  C  CB   . PRO A 1 11 ? 4.299   -11.280 -3.394  1.00 0.00 ? 11 PRO A CB   10 
ATOM   5400  C  CG   . PRO A 1 11 ? 3.686   -11.714 -2.110  1.00 0.00 ? 11 PRO A CG   10 
ATOM   5401  C  CD   . PRO A 1 11 ? 4.565   -11.154 -1.027  1.00 0.00 ? 11 PRO A CD   10 
ATOM   5402  H  HA   . PRO A 1 11 ? 5.780   -9.746  -3.658  1.00 0.00 ? 11 PRO A HA   10 
ATOM   5403  H  HB2  . PRO A 1 11 ? 3.563   -11.206 -4.180  1.00 0.00 ? 11 PRO A HB2  10 
ATOM   5404  H  HB3  . PRO A 1 11 ? 5.094   -11.947 -3.697  1.00 0.00 ? 11 PRO A HB3  10 
ATOM   5405  H  HG2  . PRO A 1 11 ? 2.686   -11.313 -2.028  1.00 0.00 ? 11 PRO A HG2  10 
ATOM   5406  H  HG3  . PRO A 1 11 ? 3.666   -12.793 -2.055  1.00 0.00 ? 11 PRO A HG3  10 
ATOM   5407  H  HD2  . PRO A 1 11 ? 3.978   -10.894 -0.159  1.00 0.00 ? 11 PRO A HD2  10 
ATOM   5408  H  HD3  . PRO A 1 11 ? 5.338   -11.860 -0.764  1.00 0.00 ? 11 PRO A HD3  10 
ATOM   5409  N  N    . PHE A 1 12 ? 3.190   -8.263  -2.452  1.00 0.00 ? 12 PHE A N    10 
ATOM   5410  C  CA   . PHE A 1 12 ? 2.187   -7.232  -2.668  1.00 0.00 ? 12 PHE A CA   10 
ATOM   5411  C  C    . PHE A 1 12 ? 2.513   -5.996  -1.846  1.00 0.00 ? 12 PHE A C    10 
ATOM   5412  O  O    . PHE A 1 12 ? 2.130   -5.893  -0.687  1.00 0.00 ? 12 PHE A O    10 
ATOM   5413  C  CB   . PHE A 1 12 ? 0.795   -7.747  -2.293  1.00 0.00 ? 12 PHE A CB   10 
ATOM   5414  C  CG   . PHE A 1 12 ? 0.406   -9.016  -2.996  1.00 0.00 ? 12 PHE A CG   10 
ATOM   5415  C  CD1  . PHE A 1 12 ? 0.320   -9.062  -4.376  1.00 0.00 ? 12 PHE A CD1  10 
ATOM   5416  C  CD2  . PHE A 1 12 ? 0.126   -10.162 -2.273  1.00 0.00 ? 12 PHE A CD2  10 
ATOM   5417  C  CE1  . PHE A 1 12 ? -0.038  -10.227 -5.024  1.00 0.00 ? 12 PHE A CE1  10 
ATOM   5418  C  CE2  . PHE A 1 12 ? -0.234  -11.331 -2.913  1.00 0.00 ? 12 PHE A CE2  10 
ATOM   5419  C  CZ   . PHE A 1 12 ? -0.315  -11.364 -4.291  1.00 0.00 ? 12 PHE A CZ   10 
ATOM   5420  H  H    . PHE A 1 12 ? 3.380   -8.554  -1.538  1.00 0.00 ? 12 PHE A H    10 
ATOM   5421  H  HA   . PHE A 1 12 ? 2.197   -6.970  -3.715  1.00 0.00 ? 12 PHE A HA   10 
ATOM   5422  H  HB2  . PHE A 1 12 ? 0.765   -7.934  -1.229  1.00 0.00 ? 12 PHE A HB2  10 
ATOM   5423  H  HB3  . PHE A 1 12 ? 0.063   -6.992  -2.540  1.00 0.00 ? 12 PHE A HB3  10 
ATOM   5424  H  HD1  . PHE A 1 12 ? 0.538   -8.172  -4.951  1.00 0.00 ? 12 PHE A HD1  10 
ATOM   5425  H  HD2  . PHE A 1 12 ? 0.190   -10.137 -1.195  1.00 0.00 ? 12 PHE A HD2  10 
ATOM   5426  H  HE1  . PHE A 1 12 ? -0.103  -10.250 -6.101  1.00 0.00 ? 12 PHE A HE1  10 
ATOM   5427  H  HE2  . PHE A 1 12 ? -0.452  -12.217 -2.336  1.00 0.00 ? 12 PHE A HE2  10 
ATOM   5428  H  HZ   . PHE A 1 12 ? -0.596  -12.279 -4.793  1.00 0.00 ? 12 PHE A HZ   10 
ATOM   5429  N  N    . GLN A 1 13 ? 3.269   -5.090  -2.426  1.00 0.00 ? 13 GLN A N    10 
ATOM   5430  C  CA   . GLN A 1 13 ? 3.661   -3.883  -1.723  1.00 0.00 ? 13 GLN A CA   10 
ATOM   5431  C  C    . GLN A 1 13 ? 2.990   -2.661  -2.314  1.00 0.00 ? 13 GLN A C    10 
ATOM   5432  O  O    . GLN A 1 13 ? 2.601   -2.656  -3.485  1.00 0.00 ? 13 GLN A O    10 
ATOM   5433  C  CB   . GLN A 1 13 ? 5.173   -3.701  -1.767  1.00 0.00 ? 13 GLN A CB   10 
ATOM   5434  C  CG   . GLN A 1 13 ? 5.837   -4.018  -0.449  1.00 0.00 ? 13 GLN A CG   10 
ATOM   5435  C  CD   . GLN A 1 13 ? 7.078   -3.194  -0.158  1.00 0.00 ? 13 GLN A CD   10 
ATOM   5436  O  OE1  . GLN A 1 13 ? 7.531   -3.139  0.986   1.00 0.00 ? 13 GLN A OE1  10 
ATOM   5437  N  NE2  . GLN A 1 13 ? 7.653   -2.565  -1.174  1.00 0.00 ? 13 GLN A NE2  10 
ATOM   5438  H  H    . GLN A 1 13 ? 3.598   -5.247  -3.340  1.00 0.00 ? 13 GLN A H    10 
ATOM   5439  H  HA   . GLN A 1 13 ? 3.351   -3.986  -0.695  1.00 0.00 ? 13 GLN A HA   10 
ATOM   5440  H  HB2  . GLN A 1 13 ? 5.583   -4.355  -2.522  1.00 0.00 ? 13 GLN A HB2  10 
ATOM   5441  H  HB3  . GLN A 1 13 ? 5.391   -2.677  -2.024  1.00 0.00 ? 13 GLN A HB3  10 
ATOM   5442  H  HG2  . GLN A 1 13 ? 5.122   -3.836  0.340   1.00 0.00 ? 13 GLN A HG2  10 
ATOM   5443  H  HG3  . GLN A 1 13 ? 6.099   -5.053  -0.446  1.00 0.00 ? 13 GLN A HG3  10 
ATOM   5444  H  HE21 . GLN A 1 13 ? 7.263   -2.663  -2.065  1.00 0.00 ? 13 GLN A HE21 10 
ATOM   5445  H  HE22 . GLN A 1 13 ? 8.448   -2.008  -0.983  1.00 0.00 ? 13 GLN A HE22 10 
ATOM   5446  N  N    . CYS A 1 14 ? 2.977   -1.587  -1.541  1.00 0.00 ? 14 CYS A N    10 
ATOM   5447  C  CA   . CYS A 1 14 ? 2.495   -0.317  -2.037  1.00 0.00 ? 14 CYS A CA   10 
ATOM   5448  C  C    . CYS A 1 14 ? 3.537   0.290   -2.959  1.00 0.00 ? 14 CYS A C    10 
ATOM   5449  O  O    . CYS A 1 14 ? 4.666   0.554   -2.539  1.00 0.00 ? 14 CYS A O    10 
ATOM   5450  C  CB   . CYS A 1 14 ? 2.183   0.680   -0.918  1.00 0.00 ? 14 CYS A CB   10 
ATOM   5451  S  SG   . CYS A 1 14 ? 1.616   2.284   -1.585  1.00 0.00 ? 14 CYS A SG   10 
ATOM   5452  H  H    . CYS A 1 14 ? 3.405   -1.637  -0.653  1.00 0.00 ? 14 CYS A H    10 
ATOM   5453  H  HA   . CYS A 1 14 ? 1.591   -0.504  -2.596  1.00 0.00 ? 14 CYS A HA   10 
ATOM   5454  H  HB2  . CYS A 1 14 ? 1.408   0.276   -0.284  1.00 0.00 ? 14 CYS A HB2  10 
ATOM   5455  H  HB3  . CYS A 1 14 ? 3.074   0.856   -0.336  1.00 0.00 ? 14 CYS A HB3  10 
ATOM   5456  N  N    . PRO A 1 15 ? 3.162   0.565   -4.209  1.00 0.00 ? 15 PRO A N    10 
ATOM   5457  C  CA   . PRO A 1 15 ? 4.058   1.196   -5.175  1.00 0.00 ? 15 PRO A CA   10 
ATOM   5458  C  C    . PRO A 1 15 ? 4.292   2.673   -4.862  1.00 0.00 ? 15 PRO A C    10 
ATOM   5459  O  O    . PRO A 1 15 ? 5.042   3.356   -5.563  1.00 0.00 ? 15 PRO A O    10 
ATOM   5460  C  CB   . PRO A 1 15 ? 3.315   1.042   -6.500  1.00 0.00 ? 15 PRO A CB   10 
ATOM   5461  C  CG   . PRO A 1 15 ? 1.876   0.966   -6.122  1.00 0.00 ? 15 PRO A CG   10 
ATOM   5462  C  CD   . PRO A 1 15 ? 1.828   0.300   -4.777  1.00 0.00 ? 15 PRO A CD   10 
ATOM   5463  H  HA   . PRO A 1 15 ? 5.010   0.684   -5.228  1.00 0.00 ? 15 PRO A HA   10 
ATOM   5464  H  HB2  . PRO A 1 15 ? 3.514   1.897   -7.128  1.00 0.00 ? 15 PRO A HB2  10 
ATOM   5465  H  HB3  . PRO A 1 15 ? 3.641   0.139   -6.996  1.00 0.00 ? 15 PRO A HB3  10 
ATOM   5466  H  HG2  . PRO A 1 15 ? 1.458   1.961   -6.062  1.00 0.00 ? 15 PRO A HG2  10 
ATOM   5467  H  HG3  . PRO A 1 15 ? 1.337   0.377   -6.851  1.00 0.00 ? 15 PRO A HG3  10 
ATOM   5468  H  HD2  . PRO A 1 15 ? 1.055   0.742   -4.167  1.00 0.00 ? 15 PRO A HD2  10 
ATOM   5469  H  HD3  . PRO A 1 15 ? 1.662   -0.762  -4.889  1.00 0.00 ? 15 PRO A HD3  10 
ATOM   5470  N  N    . ASP A 1 16 ? 3.622   3.172   -3.827  1.00 0.00 ? 16 ASP A N    10 
ATOM   5471  C  CA   . ASP A 1 16 ? 3.731   4.580   -3.470  1.00 0.00 ? 16 ASP A CA   10 
ATOM   5472  C  C    . ASP A 1 16 ? 4.473   4.777   -2.154  1.00 0.00 ? 16 ASP A C    10 
ATOM   5473  O  O    . ASP A 1 16 ? 5.086   5.818   -1.946  1.00 0.00 ? 16 ASP A O    10 
ATOM   5474  C  CB   . ASP A 1 16 ? 2.343   5.215   -3.378  1.00 0.00 ? 16 ASP A CB   10 
ATOM   5475  C  CG   . ASP A 1 16 ? 2.392   6.729   -3.387  1.00 0.00 ? 16 ASP A CG   10 
ATOM   5476  O  OD1  . ASP A 1 16 ? 2.492   7.332   -2.301  1.00 0.00 ? 16 ASP A OD1  10 
ATOM   5477  O  OD2  . ASP A 1 16 ? 2.304   7.326   -4.481  1.00 0.00 ? 16 ASP A OD2  10 
ATOM   5478  H  H    . ASP A 1 16 ? 3.020   2.584   -3.309  1.00 0.00 ? 16 ASP A H    10 
ATOM   5479  H  HA   . ASP A 1 16 ? 4.287   5.072   -4.251  1.00 0.00 ? 16 ASP A HA   10 
ATOM   5480  H  HB2  . ASP A 1 16 ? 1.748   4.890   -4.219  1.00 0.00 ? 16 ASP A HB2  10 
ATOM   5481  H  HB3  . ASP A 1 16 ? 1.868   4.895   -2.462  1.00 0.00 ? 16 ASP A HB3  10 
ATOM   5482  N  N    . CYS A 1 17 ? 4.339   3.831   -1.232  1.00 0.00 ? 17 CYS A N    10 
ATOM   5483  C  CA   . CYS A 1 17 ? 4.933   3.988   0.093   1.00 0.00 ? 17 CYS A CA   10 
ATOM   5484  C  C    . CYS A 1 17 ? 6.079   3.012   0.350   1.00 0.00 ? 17 CYS A C    10 
ATOM   5485  O  O    . CYS A 1 17 ? 6.867   3.239   1.265   1.00 0.00 ? 17 CYS A O    10 
ATOM   5486  C  CB   . CYS A 1 17 ? 3.881   3.803   1.183   1.00 0.00 ? 17 CYS A CB   10 
ATOM   5487  S  SG   . CYS A 1 17 ? 2.431   4.886   1.031   1.00 0.00 ? 17 CYS A SG   10 
ATOM   5488  H  H    . CYS A 1 17 ? 3.767   3.056   -1.415  1.00 0.00 ? 17 CYS A H    10 
ATOM   5489  H  HA   . CYS A 1 17 ? 5.316   4.992   0.153   1.00 0.00 ? 17 CYS A HA   10 
ATOM   5490  H  HB2  . CYS A 1 17 ? 3.528   2.783   1.161   1.00 0.00 ? 17 CYS A HB2  10 
ATOM   5491  H  HB3  . CYS A 1 17 ? 4.337   3.995   2.144   1.00 0.00 ? 17 CYS A HB3  10 
ATOM   5492  N  N    . ASP A 1 18 ? 5.970   1.822   -0.245  1.00 0.00 ? 18 ASP A N    10 
ATOM   5493  C  CA   . ASP A 1 18 ? 6.817   0.673   0.113   1.00 0.00 ? 18 ASP A CA   10 
ATOM   5494  C  C    . ASP A 1 18 ? 6.243   0.011   1.359   1.00 0.00 ? 18 ASP A C    10 
ATOM   5495  O  O    . ASP A 1 18 ? 6.955   -0.601  2.157   1.00 0.00 ? 18 ASP A O    10 
ATOM   5496  C  CB   . ASP A 1 18 ? 8.294   1.045   0.315   1.00 0.00 ? 18 ASP A CB   10 
ATOM   5497  C  CG   . ASP A 1 18 ? 9.185   0.422   -0.744  1.00 0.00 ? 18 ASP A CG   10 
ATOM   5498  O  OD1  . ASP A 1 18 ? 9.637   -0.729  -0.558  1.00 0.00 ? 18 ASP A OD1  10 
ATOM   5499  O  OD2  . ASP A 1 18 ? 9.430   1.077   -1.780  1.00 0.00 ? 18 ASP A OD2  10 
ATOM   5500  H  H    . ASP A 1 18 ? 5.191   1.660   -0.818  1.00 0.00 ? 18 ASP A H    10 
ATOM   5501  H  HA   . ASP A 1 18 ? 6.757   -0.038  -0.697  1.00 0.00 ? 18 ASP A HA   10 
ATOM   5502  H  HB2  . ASP A 1 18 ? 8.400   2.118   0.266   1.00 0.00 ? 18 ASP A HB2  10 
ATOM   5503  H  HB3  . ASP A 1 18 ? 8.619   0.696   1.284   1.00 0.00 ? 18 ASP A HB3  10 
ATOM   5504  N  N    . ARG A 1 19 ? 4.915   0.048   1.442   1.00 0.00 ? 19 ARG A N    10 
ATOM   5505  C  CA   . ARG A 1 19 ? 4.180   -0.680  2.463   1.00 0.00 ? 19 ARG A CA   10 
ATOM   5506  C  C    . ARG A 1 19 ? 4.006   -2.101  1.985   1.00 0.00 ? 19 ARG A C    10 
ATOM   5507  O  O    . ARG A 1 19 ? 3.871   -2.318  0.794   1.00 0.00 ? 19 ARG A O    10 
ATOM   5508  C  CB   . ARG A 1 19 ? 2.813   -0.052  2.689   1.00 0.00 ? 19 ARG A CB   10 
ATOM   5509  C  CG   . ARG A 1 19 ? 2.873   1.355   3.238   1.00 0.00 ? 19 ARG A CG   10 
ATOM   5510  C  CD   . ARG A 1 19 ? 1.921   1.527   4.401   1.00 0.00 ? 19 ARG A CD   10 
ATOM   5511  N  NE   . ARG A 1 19 ? 0.703   0.736   4.240   1.00 0.00 ? 19 ARG A NE   10 
ATOM   5512  C  CZ   . ARG A 1 19 ? 0.044   0.194   5.271   1.00 0.00 ? 19 ARG A CZ   10 
ATOM   5513  N  NH1  . ARG A 1 19 ? 0.495   0.353   6.505   1.00 0.00 ? 19 ARG A NH1  10 
ATOM   5514  N  NH2  . ARG A 1 19 ? -1.070  -0.495  5.070   1.00 0.00 ? 19 ARG A NH2  10 
ATOM   5515  H  H    . ARG A 1 19 ? 4.414   0.483   0.726   1.00 0.00 ? 19 ARG A H    10 
ATOM   5516  H  HA   . ARG A 1 19 ? 4.751   -0.670  3.380   1.00 0.00 ? 19 ARG A HA   10 
ATOM   5517  H  HB2  . ARG A 1 19 ? 2.285   -0.024  1.747   1.00 0.00 ? 19 ARG A HB2  10 
ATOM   5518  H  HB3  . ARG A 1 19 ? 2.259   -0.664  3.384   1.00 0.00 ? 19 ARG A HB3  10 
ATOM   5519  H  HG2  . ARG A 1 19 ? 3.880   1.563   3.573   1.00 0.00 ? 19 ARG A HG2  10 
ATOM   5520  H  HG3  . ARG A 1 19 ? 2.601   2.047   2.454   1.00 0.00 ? 19 ARG A HG3  10 
ATOM   5521  H  HD2  . ARG A 1 19 ? 2.418   1.210   5.303   1.00 0.00 ? 19 ARG A HD2  10 
ATOM   5522  H  HD3  . ARG A 1 19 ? 1.654   2.568   4.483   1.00 0.00 ? 19 ARG A HD3  10 
ATOM   5523  H  HE   . ARG A 1 19 ? 0.363   0.606   3.317   1.00 0.00 ? 19 ARG A HE   10 
ATOM   5524  H  HH11 . ARG A 1 19 ? 1.332   0.891   6.678   1.00 0.00 ? 19 ARG A HH11 10 
ATOM   5525  H  HH12 . ARG A 1 19 ? 0.016   -0.081  7.278   1.00 0.00 ? 19 ARG A HH12 10 
ATOM   5526  H  HH21 . ARG A 1 19 ? -1.426  -0.619  4.146   1.00 0.00 ? 19 ARG A HH21 10 
ATOM   5527  H  HH22 . ARG A 1 19 ? -1.568  -0.902  5.852   1.00 0.00 ? 19 ARG A HH22 10 
ATOM   5528  N  N    . SER A 1 20 ? 4.086   -3.065  2.870   1.00 0.00 ? 20 SER A N    10 
ATOM   5529  C  CA   . SER A 1 20 ? 4.093   -4.457  2.431   1.00 0.00 ? 20 SER A CA   10 
ATOM   5530  C  C    . SER A 1 20 ? 2.902   -5.249  2.951   1.00 0.00 ? 20 SER A C    10 
ATOM   5531  O  O    . SER A 1 20 ? 2.479   -5.090  4.098   1.00 0.00 ? 20 SER A O    10 
ATOM   5532  C  CB   . SER A 1 20 ? 5.391   -5.130  2.849   1.00 0.00 ? 20 SER A CB   10 
ATOM   5533  O  OG   . SER A 1 20 ? 6.336   -4.176  3.314   1.00 0.00 ? 20 SER A OG   10 
ATOM   5534  H  H    . SER A 1 20 ? 4.216   -2.844  3.817   1.00 0.00 ? 20 SER A H    10 
ATOM   5535  H  HA   . SER A 1 20 ? 4.046   -4.450  1.352   1.00 0.00 ? 20 SER A HA   10 
ATOM   5536  H  HB2  . SER A 1 20 ? 5.183   -5.838  3.636   1.00 0.00 ? 20 SER A HB2  10 
ATOM   5537  H  HB3  . SER A 1 20 ? 5.812   -5.652  1.999   1.00 0.00 ? 20 SER A HB3  10 
ATOM   5538  H  HG   . SER A 1 20 ? 6.680   -3.672  2.557   1.00 0.00 ? 20 SER A HG   10 
ATOM   5539  N  N    . PHE A 1 21 ? 2.347   -6.072  2.071   1.00 0.00 ? 21 PHE A N    10 
ATOM   5540  C  CA   . PHE A 1 21 ? 1.178   -6.881  2.388   1.00 0.00 ? 21 PHE A CA   10 
ATOM   5541  C  C    . PHE A 1 21 ? 1.341   -8.292  1.833   1.00 0.00 ? 21 PHE A C    10 
ATOM   5542  O  O    . PHE A 1 21 ? 1.846   -8.481  0.726   1.00 0.00 ? 21 PHE A O    10 
ATOM   5543  C  CB   . PHE A 1 21 ? -0.089  -6.247  1.801   1.00 0.00 ? 21 PHE A CB   10 
ATOM   5544  C  CG   . PHE A 1 21 ? -0.154  -4.761  1.993   1.00 0.00 ? 21 PHE A CG   10 
ATOM   5545  C  CD1  . PHE A 1 21 ? 0.432   -3.902  1.078   1.00 0.00 ? 21 PHE A CD1  10 
ATOM   5546  C  CD2  . PHE A 1 21 ? -0.775  -4.227  3.104   1.00 0.00 ? 21 PHE A CD2  10 
ATOM   5547  C  CE1  . PHE A 1 21 ? 0.400   -2.538  1.272   1.00 0.00 ? 21 PHE A CE1  10 
ATOM   5548  C  CE2  . PHE A 1 21 ? -0.816  -2.866  3.300   1.00 0.00 ? 21 PHE A CE2  10 
ATOM   5549  C  CZ   . PHE A 1 21 ? -0.226  -2.020  2.384   1.00 0.00 ? 21 PHE A CZ   10 
ATOM   5550  H  H    . PHE A 1 21 ? 2.710   -6.103  1.154   1.00 0.00 ? 21 PHE A H    10 
ATOM   5551  H  HA   . PHE A 1 21 ? 1.087   -6.932  3.461   1.00 0.00 ? 21 PHE A HA   10 
ATOM   5552  H  HB2  . PHE A 1 21 ? -0.127  -6.447  0.741   1.00 0.00 ? 21 PHE A HB2  10 
ATOM   5553  H  HB3  . PHE A 1 21 ? -0.956  -6.683  2.276   1.00 0.00 ? 21 PHE A HB3  10 
ATOM   5554  H  HD1  . PHE A 1 21 ? 0.921   -4.310  0.204   1.00 0.00 ? 21 PHE A HD1  10 
ATOM   5555  H  HD2  . PHE A 1 21 ? -1.237  -4.887  3.821   1.00 0.00 ? 21 PHE A HD2  10 
ATOM   5556  H  HE1  . PHE A 1 21 ? 0.861   -1.877  0.551   1.00 0.00 ? 21 PHE A HE1  10 
ATOM   5557  H  HE2  . PHE A 1 21 ? -1.306  -2.460  4.173   1.00 0.00 ? 21 PHE A HE2  10 
ATOM   5558  H  HZ   . PHE A 1 21 ? -0.250  -0.951  2.544   1.00 0.00 ? 21 PHE A HZ   10 
ATOM   5559  N  N    . SER A 1 22 ? 0.898   -9.277  2.597   1.00 0.00 ? 22 SER A N    10 
ATOM   5560  C  CA   . SER A 1 22 ? 0.946   -10.661 2.155   1.00 0.00 ? 22 SER A CA   10 
ATOM   5561  C  C    . SER A 1 22 ? -0.289  -10.983 1.319   1.00 0.00 ? 22 SER A C    10 
ATOM   5562  O  O    . SER A 1 22 ? -0.289  -11.908 0.507   1.00 0.00 ? 22 SER A O    10 
ATOM   5563  C  CB   . SER A 1 22 ? 1.030   -11.587 3.364   1.00 0.00 ? 22 SER A CB   10 
ATOM   5564  O  OG   . SER A 1 22 ? 1.022   -10.838 4.572   1.00 0.00 ? 22 SER A OG   10 
ATOM   5565  H  H    . SER A 1 22 ? 0.512   -9.071  3.476   1.00 0.00 ? 22 SER A H    10 
ATOM   5566  H  HA   . SER A 1 22 ? 1.829   -10.790 1.544   1.00 0.00 ? 22 SER A HA   10 
ATOM   5567  H  HB2  . SER A 1 22 ? 0.183   -12.258 3.363   1.00 0.00 ? 22 SER A HB2  10 
ATOM   5568  H  HB3  . SER A 1 22 ? 1.945   -12.159 3.314   1.00 0.00 ? 22 SER A HB3  10 
ATOM   5569  H  HG   . SER A 1 22 ? 1.935   -10.630 4.830   1.00 0.00 ? 22 SER A HG   10 
ATOM   5570  N  N    . ARG A 1 23 ? -1.333  -10.181 1.504   1.00 0.00 ? 23 ARG A N    10 
ATOM   5571  C  CA   . ARG A 1 23 ? -2.571  -10.335 0.754   1.00 0.00 ? 23 ARG A CA   10 
ATOM   5572  C  C    . ARG A 1 23 ? -2.758  -9.181  -0.196  1.00 0.00 ? 23 ARG A C    10 
ATOM   5573  O  O    . ARG A 1 23 ? -2.644  -8.015  0.182   1.00 0.00 ? 23 ARG A O    10 
ATOM   5574  C  CB   . ARG A 1 23 ? -3.773  -10.436 1.696   1.00 0.00 ? 23 ARG A CB   10 
ATOM   5575  C  CG   . ARG A 1 23 ? -3.558  -11.388 2.863   1.00 0.00 ? 23 ARG A CG   10 
ATOM   5576  C  CD   . ARG A 1 23 ? -4.831  -12.132 3.227   1.00 0.00 ? 23 ARG A CD   10 
ATOM   5577  N  NE   . ARG A 1 23 ? -5.948  -11.226 3.486   1.00 0.00 ? 23 ARG A NE   10 
ATOM   5578  C  CZ   . ARG A 1 23 ? -6.268  -10.750 4.693   1.00 0.00 ? 23 ARG A CZ   10 
ATOM   5579  N  NH1  . ARG A 1 23 ? -5.501  -11.002 5.745   1.00 0.00 ? 23 ARG A NH1  10 
ATOM   5580  N  NH2  . ARG A 1 23 ? -7.352  -10.005 4.837   1.00 0.00 ? 23 ARG A NH2  10 
ATOM   5581  H  H    . ARG A 1 23 ? -1.256  -9.444  2.149   1.00 0.00 ? 23 ARG A H    10 
ATOM   5582  H  HA   . ARG A 1 23 ? -2.506  -11.233 0.160   1.00 0.00 ? 23 ARG A HA   10 
ATOM   5583  H  HB2  . ARG A 1 23 ? -3.984  -9.455  2.096   1.00 0.00 ? 23 ARG A HB2  10 
ATOM   5584  H  HB3  . ARG A 1 23 ? -4.631  -10.776 1.134   1.00 0.00 ? 23 ARG A HB3  10 
ATOM   5585  H  HG2  . ARG A 1 23 ? -2.803  -12.108 2.590   1.00 0.00 ? 23 ARG A HG2  10 
ATOM   5586  H  HG3  . ARG A 1 23 ? -3.228  -10.820 3.720   1.00 0.00 ? 23 ARG A HG3  10 
ATOM   5587  H  HD2  . ARG A 1 23 ? -5.097  -12.785 2.410   1.00 0.00 ? 23 ARG A HD2  10 
ATOM   5588  H  HD3  . ARG A 1 23 ? -4.646  -12.721 4.114   1.00 0.00 ? 23 ARG A HD3  10 
ATOM   5589  H  HE   . ARG A 1 23 ? -6.508  -10.977 2.715   1.00 0.00 ? 23 ARG A HE   10 
ATOM   5590  H  HH11 . ARG A 1 23 ? -4.662  -11.557 5.645   1.00 0.00 ? 23 ARG A HH11 10 
ATOM   5591  H  HH12 . ARG A 1 23 ? -5.748  -10.638 6.651   1.00 0.00 ? 23 ARG A HH12 10 
ATOM   5592  H  HH21 . ARG A 1 23 ? -7.934  -9.798  4.036   1.00 0.00 ? 23 ARG A HH21 10 
ATOM   5593  H  HH22 . ARG A 1 23 ? -7.602  -9.635  5.740   1.00 0.00 ? 23 ARG A HH22 10 
ATOM   5594  N  N    . SER A 1 24 ? -3.062  -9.532  -1.425  1.00 0.00 ? 24 SER A N    10 
ATOM   5595  C  CA   . SER A 1 24 ? -3.280  -8.580  -2.485  1.00 0.00 ? 24 SER A CA   10 
ATOM   5596  C  C    . SER A 1 24 ? -4.462  -7.666  -2.168  1.00 0.00 ? 24 SER A C    10 
ATOM   5597  O  O    . SER A 1 24 ? -4.512  -6.516  -2.606  1.00 0.00 ? 24 SER A O    10 
ATOM   5598  C  CB   . SER A 1 24 ? -3.528  -9.370  -3.756  1.00 0.00 ? 24 SER A CB   10 
ATOM   5599  O  OG   . SER A 1 24 ? -3.687  -10.749 -3.450  1.00 0.00 ? 24 SER A OG   10 
ATOM   5600  H  H    . SER A 1 24 ? -3.140  -10.491 -1.639  1.00 0.00 ? 24 SER A H    10 
ATOM   5601  H  HA   . SER A 1 24 ? -2.387  -7.986  -2.601  1.00 0.00 ? 24 SER A HA   10 
ATOM   5602  H  HB2  . SER A 1 24 ? -4.420  -9.011  -4.241  1.00 0.00 ? 24 SER A HB2  10 
ATOM   5603  H  HB3  . SER A 1 24 ? -2.681  -9.259  -4.410  1.00 0.00 ? 24 SER A HB3  10 
ATOM   5604  H  HG   . SER A 1 24 ? -4.413  -11.117 -3.975  1.00 0.00 ? 24 SER A HG   10 
ATOM   5605  N  N    . ASP A 1 25 ? -5.377  -8.168  -1.347  1.00 0.00 ? 25 ASP A N    10 
ATOM   5606  C  CA   . ASP A 1 25 ? -6.530  -7.391  -0.920  1.00 0.00 ? 25 ASP A CA   10 
ATOM   5607  C  C    . ASP A 1 25 ? -6.112  -6.319  0.076   1.00 0.00 ? 25 ASP A C    10 
ATOM   5608  O  O    . ASP A 1 25 ? -6.595  -5.186  0.030   1.00 0.00 ? 25 ASP A O    10 
ATOM   5609  C  CB   . ASP A 1 25 ? -7.571  -8.303  -0.282  1.00 0.00 ? 25 ASP A CB   10 
ATOM   5610  C  CG   . ASP A 1 25 ? -8.832  -7.563  0.104   1.00 0.00 ? 25 ASP A CG   10 
ATOM   5611  O  OD1  . ASP A 1 25 ? -9.648  -7.259  -0.793  1.00 0.00 ? 25 ASP A OD1  10 
ATOM   5612  O  OD2  . ASP A 1 25 ? -9.020  -7.290  1.305   1.00 0.00 ? 25 ASP A OD2  10 
ATOM   5613  H  H    . ASP A 1 25 ? -5.261  -9.084  -1.002  1.00 0.00 ? 25 ASP A H    10 
ATOM   5614  H  HA   . ASP A 1 25 ? -6.955  -6.919  -1.791  1.00 0.00 ? 25 ASP A HA   10 
ATOM   5615  H  HB2  . ASP A 1 25 ? -7.831  -9.080  -0.980  1.00 0.00 ? 25 ASP A HB2  10 
ATOM   5616  H  HB3  . ASP A 1 25 ? -7.150  -8.747  0.609   1.00 0.00 ? 25 ASP A HB3  10 
ATOM   5617  N  N    . HIS A 1 26 ? -5.171  -6.678  0.942   1.00 0.00 ? 26 HIS A N    10 
ATOM   5618  C  CA   . HIS A 1 26 ? -4.652  -5.752  1.947   1.00 0.00 ? 26 HIS A CA   10 
ATOM   5619  C  C    . HIS A 1 26 ? -3.986  -4.555  1.284   1.00 0.00 ? 26 HIS A C    10 
ATOM   5620  O  O    . HIS A 1 26 ? -4.070  -3.433  1.788   1.00 0.00 ? 26 HIS A O    10 
ATOM   5621  C  CB   . HIS A 1 26 ? -3.660  -6.457  2.876   1.00 0.00 ? 26 HIS A CB   10 
ATOM   5622  C  CG   . HIS A 1 26 ? -4.228  -6.755  4.229   1.00 0.00 ? 26 HIS A CG   10 
ATOM   5623  N  ND1  . HIS A 1 26 ? -3.605  -6.414  5.410   1.00 0.00 ? 26 HIS A ND1  10 
ATOM   5624  C  CD2  . HIS A 1 26 ? -5.386  -7.360  4.580   1.00 0.00 ? 26 HIS A CD2  10 
ATOM   5625  C  CE1  . HIS A 1 26 ? -4.357  -6.795  6.427   1.00 0.00 ? 26 HIS A CE1  10 
ATOM   5626  N  NE2  . HIS A 1 26 ? -5.444  -7.371  5.948   1.00 0.00 ? 26 HIS A NE2  10 
ATOM   5627  H  H    . HIS A 1 26 ? -4.796  -7.581  0.883   1.00 0.00 ? 26 HIS A H    10 
ATOM   5628  H  HA   . HIS A 1 26 ? -5.489  -5.402  2.532   1.00 0.00 ? 26 HIS A HA   10 
ATOM   5629  H  HB2  . HIS A 1 26 ? -3.357  -7.391  2.427   1.00 0.00 ? 26 HIS A HB2  10 
ATOM   5630  H  HB3  . HIS A 1 26 ? -2.792  -5.827  3.009   1.00 0.00 ? 26 HIS A HB3  10 
ATOM   5631  H  HD1  . HIS A 1 26 ? -2.728  -5.962  5.497   1.00 0.00 ? 26 HIS A HD1  10 
ATOM   5632  H  HD2  . HIS A 1 26 ? -6.120  -7.776  3.904   1.00 0.00 ? 26 HIS A HD2  10 
ATOM   5633  H  HE1  . HIS A 1 26 ? -4.124  -6.659  7.472   1.00 0.00 ? 26 HIS A HE1  10 
ATOM   5634  H  HE2  . HIS A 1 26 ? -6.242  -7.605  6.482   1.00 0.00 ? 26 HIS A HE2  10 
ATOM   5635  N  N    . LEU A 1 27 ? -3.405  -4.788  0.110   1.00 0.00 ? 27 LEU A N    10 
ATOM   5636  C  CA   . LEU A 1 27 ? -2.830  -3.715  -0.692  1.00 0.00 ? 27 LEU A CA   10 
ATOM   5637  C  C    . LEU A 1 27 ? -3.877  -2.641  -0.955  1.00 0.00 ? 27 LEU A C    10 
ATOM   5638  O  O    . LEU A 1 27 ? -3.723  -1.491  -0.541  1.00 0.00 ? 27 LEU A O    10 
ATOM   5639  C  CB   . LEU A 1 27 ? -2.328  -4.260  -2.032  1.00 0.00 ? 27 LEU A CB   10 
ATOM   5640  C  CG   . LEU A 1 27 ? -1.362  -3.354  -2.807  1.00 0.00 ? 27 LEU A CG   10 
ATOM   5641  C  CD1  . LEU A 1 27 ? -0.726  -2.313  -1.902  1.00 0.00 ? 27 LEU A CD1  10 
ATOM   5642  C  CD2  . LEU A 1 27 ? -0.299  -4.173  -3.511  1.00 0.00 ? 27 LEU A CD2  10 
ATOM   5643  H  H    . LEU A 1 27 ? -3.430  -5.697  -0.260  1.00 0.00 ? 27 LEU A H    10 
ATOM   5644  H  HA   . LEU A 1 27 ? -2.005  -3.285  -0.147  1.00 0.00 ? 27 LEU A HA   10 
ATOM   5645  H  HB2  . LEU A 1 27 ? -1.828  -5.199  -1.845  1.00 0.00 ? 27 LEU A HB2  10 
ATOM   5646  H  HB3  . LEU A 1 27 ? -3.185  -4.452  -2.660  1.00 0.00 ? 27 LEU A HB3  10 
ATOM   5647  H  HG   . LEU A 1 27 ? -1.924  -2.825  -3.563  1.00 0.00 ? 27 LEU A HG   10 
ATOM   5648  H  HD11 . LEU A 1 27 ? -0.343  -1.500  -2.500  1.00 0.00 ? 27 LEU A HD11 10 
ATOM   5649  H  HD12 . LEU A 1 27 ? -1.466  -1.937  -1.212  1.00 0.00 ? 27 LEU A HD12 10 
ATOM   5650  H  HD13 . LEU A 1 27 ? 0.085   -2.767  -1.348  1.00 0.00 ? 27 LEU A HD13 10 
ATOM   5651  H  HD21 . LEU A 1 27 ? 0.293   -4.701  -2.777  1.00 0.00 ? 27 LEU A HD21 10 
ATOM   5652  H  HD22 . LEU A 1 27 ? -0.771  -4.883  -4.173  1.00 0.00 ? 27 LEU A HD22 10 
ATOM   5653  H  HD23 . LEU A 1 27 ? 0.339   -3.514  -4.084  1.00 0.00 ? 27 LEU A HD23 10 
ATOM   5654  N  N    . ALA A 1 28 ? -4.930  -3.037  -1.660  1.00 0.00 ? 28 ALA A N    10 
ATOM   5655  C  CA   . ALA A 1 28 ? -6.004  -2.129  -2.032  1.00 0.00 ? 28 ALA A CA   10 
ATOM   5656  C  C    . ALA A 1 28 ? -6.604  -1.438  -0.815  1.00 0.00 ? 28 ALA A C    10 
ATOM   5657  O  O    . ALA A 1 28 ? -6.922  -0.253  -0.869  1.00 0.00 ? 28 ALA A O    10 
ATOM   5658  C  CB   . ALA A 1 28 ? -7.076  -2.878  -2.803  1.00 0.00 ? 28 ALA A CB   10 
ATOM   5659  H  H    . ALA A 1 28 ? -4.972  -3.965  -1.967  1.00 0.00 ? 28 ALA A H    10 
ATOM   5660  H  HA   . ALA A 1 28 ? -5.587  -1.379  -2.686  1.00 0.00 ? 28 ALA A HA   10 
ATOM   5661  H  HB1  . ALA A 1 28 ? -7.498  -3.650  -2.176  1.00 0.00 ? 28 ALA A HB1  10 
ATOM   5662  H  HB2  . ALA A 1 28 ? -7.855  -2.190  -3.100  1.00 0.00 ? 28 ALA A HB2  10 
ATOM   5663  H  HB3  . ALA A 1 28 ? -6.638  -3.327  -3.681  1.00 0.00 ? 28 ALA A HB3  10 
ATOM   5664  N  N    . LEU A 1 29 ? -6.737  -2.181  0.285   1.00 0.00 ? 29 LEU A N    10 
ATOM   5665  C  CA   . LEU A 1 29 ? -7.280  -1.636  1.525   1.00 0.00 ? 29 LEU A CA   10 
ATOM   5666  C  C    . LEU A 1 29 ? -6.501  -0.404  1.975   1.00 0.00 ? 29 LEU A C    10 
ATOM   5667  O  O    . LEU A 1 29 ? -7.086  0.632   2.299   1.00 0.00 ? 29 LEU A O    10 
ATOM   5668  C  CB   . LEU A 1 29 ? -7.259  -2.691  2.628   1.00 0.00 ? 29 LEU A CB   10 
ATOM   5669  C  CG   . LEU A 1 29 ? -8.259  -3.830  2.451   1.00 0.00 ? 29 LEU A CG   10 
ATOM   5670  C  CD1  . LEU A 1 29 ? -8.041  -4.895  3.510   1.00 0.00 ? 29 LEU A CD1  10 
ATOM   5671  C  CD2  . LEU A 1 29 ? -9.682  -3.301  2.513   1.00 0.00 ? 29 LEU A CD2  10 
ATOM   5672  H  H    . LEU A 1 29 ? -6.471  -3.128  0.255   1.00 0.00 ? 29 LEU A H    10 
ATOM   5673  H  HA   . LEU A 1 29 ? -8.303  -1.349  1.342   1.00 0.00 ? 29 LEU A HA   10 
ATOM   5674  H  HB2  . LEU A 1 29 ? -6.266  -3.112  2.677   1.00 0.00 ? 29 LEU A HB2  10 
ATOM   5675  H  HB3  . LEU A 1 29 ? -7.471  -2.201  3.563   1.00 0.00 ? 29 LEU A HB3  10 
ATOM   5676  H  HG   . LEU A 1 29 ? -8.110  -4.286  1.481   1.00 0.00 ? 29 LEU A HG   10 
ATOM   5677  H  HD11 . LEU A 1 29 ? -7.187  -4.629  4.114   1.00 0.00 ? 29 LEU A HD11 10 
ATOM   5678  H  HD12 . LEU A 1 29 ? -8.919  -4.966  4.135   1.00 0.00 ? 29 LEU A HD12 10 
ATOM   5679  H  HD13 . LEU A 1 29 ? -7.862  -5.847  3.031   1.00 0.00 ? 29 LEU A HD13 10 
ATOM   5680  H  HD21 . LEU A 1 29 ? -9.964  -2.914  1.546   1.00 0.00 ? 29 LEU A HD21 10 
ATOM   5681  H  HD22 . LEU A 1 29 ? -10.352 -4.100  2.792   1.00 0.00 ? 29 LEU A HD22 10 
ATOM   5682  H  HD23 . LEU A 1 29 ? -9.739  -2.512  3.248   1.00 0.00 ? 29 LEU A HD23 10 
ATOM   5683  N  N    . HIS A 1 30 ? -5.179  -0.499  1.930   1.00 0.00 ? 30 HIS A N    10 
ATOM   5684  C  CA   . HIS A 1 30 ? -4.328  0.630   2.279   1.00 0.00 ? 30 HIS A CA   10 
ATOM   5685  C  C    . HIS A 1 30 ? -4.374  1.683   1.183   1.00 0.00 ? 30 HIS A C    10 
ATOM   5686  O  O    . HIS A 1 30 ? -4.319  2.886   1.448   1.00 0.00 ? 30 HIS A O    10 
ATOM   5687  C  CB   . HIS A 1 30 ? -2.874  0.168   2.490   1.00 0.00 ? 30 HIS A CB   10 
ATOM   5688  C  CG   . HIS A 1 30 ? -1.849  1.250   2.266   1.00 0.00 ? 30 HIS A CG   10 
ATOM   5689  N  ND1  . HIS A 1 30 ? -1.689  2.336   3.092   1.00 0.00 ? 30 HIS A ND1  10 
ATOM   5690  C  CD2  . HIS A 1 30 ? -0.960  1.419   1.251   1.00 0.00 ? 30 HIS A CD2  10 
ATOM   5691  C  CE1  . HIS A 1 30 ? -0.736  3.121   2.562   1.00 0.00 ? 30 HIS A CE1  10 
ATOM   5692  N  NE2  . HIS A 1 30 ? -0.257  2.608   1.441   1.00 0.00 ? 30 HIS A NE2  10 
ATOM   5693  H  H    . HIS A 1 30 ? -4.769  -1.334  1.609   1.00 0.00 ? 30 HIS A H    10 
ATOM   5694  H  HA   . HIS A 1 30 ? -4.700  1.060   3.196   1.00 0.00 ? 30 HIS A HA   10 
ATOM   5695  H  HB2  . HIS A 1 30 ? -2.761  -0.187  3.503   1.00 0.00 ? 30 HIS A HB2  10 
ATOM   5696  H  HB3  . HIS A 1 30 ? -2.658  -0.640  1.806   1.00 0.00 ? 30 HIS A HB3  10 
ATOM   5697  H  HD1  . HIS A 1 30 ? -2.184  2.508   3.931   1.00 0.00 ? 30 HIS A HD1  10 
ATOM   5698  H  HD2  . HIS A 1 30 ? -0.810  0.744   0.422   1.00 0.00 ? 30 HIS A HD2  10 
ATOM   5699  H  HE1  . HIS A 1 30 ? -0.407  4.055   2.995   1.00 0.00 ? 30 HIS A HE1  10 
ATOM   5700  N  N    . ARG A 1 31 ? -4.400  1.219   -0.057  1.00 0.00 ? 31 ARG A N    10 
ATOM   5701  C  CA   . ARG A 1 31 ? -4.314  2.106   -1.200  1.00 0.00 ? 31 ARG A CA   10 
ATOM   5702  C  C    . ARG A 1 31 ? -5.610  2.886   -1.402  1.00 0.00 ? 31 ARG A C    10 
ATOM   5703  O  O    . ARG A 1 31 ? -5.734  3.663   -2.347  1.00 0.00 ? 31 ARG A O    10 
ATOM   5704  C  CB   . ARG A 1 31 ? -3.963  1.327   -2.465  1.00 0.00 ? 31 ARG A CB   10 
ATOM   5705  C  CG   . ARG A 1 31 ? -2.568  0.718   -2.424  1.00 0.00 ? 31 ARG A CG   10 
ATOM   5706  C  CD   . ARG A 1 31 ? -2.040  0.383   -3.809  1.00 0.00 ? 31 ARG A CD   10 
ATOM   5707  N  NE   . ARG A 1 31 ? -2.010  1.546   -4.680  1.00 0.00 ? 31 ARG A NE   10 
ATOM   5708  C  CZ   . ARG A 1 31 ? -2.844  1.740   -5.700  1.00 0.00 ? 31 ARG A CZ   10 
ATOM   5709  N  NH1  . ARG A 1 31 ? -3.758  0.825   -6.004  1.00 0.00 ? 31 ARG A NH1  10 
ATOM   5710  N  NH2  . ARG A 1 31 ? -2.752  2.845   -6.428  1.00 0.00 ? 31 ARG A NH2  10 
ATOM   5711  H  H    . ARG A 1 31 ? -4.426  0.247   -0.206  1.00 0.00 ? 31 ARG A H    10 
ATOM   5712  H  HA   . ARG A 1 31 ? -3.510  2.803   -0.995  1.00 0.00 ? 31 ARG A HA   10 
ATOM   5713  H  HB2  . ARG A 1 31 ? -4.681  0.531   -2.598  1.00 0.00 ? 31 ARG A HB2  10 
ATOM   5714  H  HB3  . ARG A 1 31 ? -4.018  2.000   -3.308  1.00 0.00 ? 31 ARG A HB3  10 
ATOM   5715  H  HG2  . ARG A 1 31 ? -1.897  1.423   -1.960  1.00 0.00 ? 31 ARG A HG2  10 
ATOM   5716  H  HG3  . ARG A 1 31 ? -2.604  -0.186  -1.834  1.00 0.00 ? 31 ARG A HG3  10 
ATOM   5717  H  HD2  . ARG A 1 31 ? -1.028  0.006   -3.708  1.00 0.00 ? 31 ARG A HD2  10 
ATOM   5718  H  HD3  . ARG A 1 31 ? -2.666  -0.377  -4.251  1.00 0.00 ? 31 ARG A HD3  10 
ATOM   5719  H  HE   . ARG A 1 31 ? -1.324  2.229   -4.487  1.00 0.00 ? 31 ARG A HE   10 
ATOM   5720  H  HH11 . ARG A 1 31 ? -3.829  -0.024  -5.465  1.00 0.00 ? 31 ARG A HH11 10 
ATOM   5721  H  HH12 . ARG A 1 31 ? -4.385  0.976   -6.773  1.00 0.00 ? 31 ARG A HH12 10 
ATOM   5722  H  HH21 . ARG A 1 31 ? -2.056  3.539   -6.213  1.00 0.00 ? 31 ARG A HH21 10 
ATOM   5723  H  HH22 . ARG A 1 31 ? -3.387  2.995   -7.200  1.00 0.00 ? 31 ARG A HH22 10 
ATOM   5724  N  N    . LYS A 1 32 ? -6.529  2.753   -0.453  1.00 0.00 ? 32 LYS A N    10 
ATOM   5725  C  CA   . LYS A 1 32 ? -7.755  3.534   -0.459  1.00 0.00 ? 32 LYS A CA   10 
ATOM   5726  C  C    . LYS A 1 32 ? -7.430  4.992   -0.180  1.00 0.00 ? 32 LYS A C    10 
ATOM   5727  O  O    . LYS A 1 32 ? -8.102  5.898   -0.672  1.00 0.00 ? 32 LYS A O    10 
ATOM   5728  C  CB   . LYS A 1 32 ? -8.738  3.007   0.583   1.00 0.00 ? 32 LYS A CB   10 
ATOM   5729  C  CG   . LYS A 1 32 ? -9.980  2.374   -0.018  1.00 0.00 ? 32 LYS A CG   10 
ATOM   5730  C  CD   . LYS A 1 32 ? -9.623  1.194   -0.902  1.00 0.00 ? 32 LYS A CD   10 
ATOM   5731  C  CE   . LYS A 1 32 ? -10.238 -0.093  -0.384  1.00 0.00 ? 32 LYS A CE   10 
ATOM   5732  N  NZ   . LYS A 1 32 ? -10.779 -0.933  -1.485  1.00 0.00 ? 32 LYS A NZ   10 
ATOM   5733  H  H    . LYS A 1 32 ? -6.346  2.159   0.305   1.00 0.00 ? 32 LYS A H    10 
ATOM   5734  H  HA   . LYS A 1 32 ? -8.199  3.453   -1.438  1.00 0.00 ? 32 LYS A HA   10 
ATOM   5735  H  HB2  . LYS A 1 32 ? -8.241  2.263   1.187   1.00 0.00 ? 32 LYS A HB2  10 
ATOM   5736  H  HB3  . LYS A 1 32 ? -9.047  3.825   1.214   1.00 0.00 ? 32 LYS A HB3  10 
ATOM   5737  H  HG2  . LYS A 1 32 ? -10.622 2.033   0.781   1.00 0.00 ? 32 LYS A HG2  10 
ATOM   5738  H  HG3  . LYS A 1 32 ? -10.498 3.113   -0.611  1.00 0.00 ? 32 LYS A HG3  10 
ATOM   5739  H  HD2  . LYS A 1 32 ? -9.987  1.382   -1.899  1.00 0.00 ? 32 LYS A HD2  10 
ATOM   5740  H  HD3  . LYS A 1 32 ? -8.545  1.084   -0.922  1.00 0.00 ? 32 LYS A HD3  10 
ATOM   5741  H  HE2  . LYS A 1 32 ? -9.479  -0.652  0.145   1.00 0.00 ? 32 LYS A HE2  10 
ATOM   5742  H  HE3  . LYS A 1 32 ? -11.040 0.156   0.296   1.00 0.00 ? 32 LYS A HE3  10 
ATOM   5743  H  HZ1  . LYS A 1 32 ? -10.386 -0.623  -2.402  1.00 0.00 ? 32 LYS A HZ1  10 
ATOM   5744  H  HZ2  . LYS A 1 32 ? -11.817 -0.856  -1.519  1.00 0.00 ? 32 LYS A HZ2  10 
ATOM   5745  H  HZ3  . LYS A 1 32 ? -10.522 -1.934  -1.333  1.00 0.00 ? 32 LYS A HZ3  10 
ATOM   5746  N  N    . ARG A 1 33 ? -6.322  5.208   0.521   1.00 0.00 ? 33 ARG A N    10 
ATOM   5747  C  CA   . ARG A 1 33 ? -5.828  6.553   0.783   1.00 0.00 ? 33 ARG A CA   10 
ATOM   5748  C  C    . ARG A 1 33 ? -5.035  7.068   -0.412  1.00 0.00 ? 33 ARG A C    10 
ATOM   5749  O  O    . ARG A 1 33 ? -4.435  8.140   -0.358  1.00 0.00 ? 33 ARG A O    10 
ATOM   5750  C  CB   . ARG A 1 33 ? -4.949  6.562   2.033   1.00 0.00 ? 33 ARG A CB   10 
ATOM   5751  C  CG   . ARG A 1 33 ? -5.581  7.254   3.228   1.00 0.00 ? 33 ARG A CG   10 
ATOM   5752  C  CD   . ARG A 1 33 ? -6.225  8.575   2.842   1.00 0.00 ? 33 ARG A CD   10 
ATOM   5753  N  NE   . ARG A 1 33 ? -5.236  9.600   2.498   1.00 0.00 ? 33 ARG A NE   10 
ATOM   5754  C  CZ   . ARG A 1 33 ? -4.478  10.245  3.389   1.00 0.00 ? 33 ARG A CZ   10 
ATOM   5755  N  NH1  . ARG A 1 33 ? -4.567  9.967   4.686   1.00 0.00 ? 33 ARG A NH1  10 
ATOM   5756  N  NH2  . ARG A 1 33 ? -3.631  11.176  2.974   1.00 0.00 ? 33 ARG A NH2  10 
ATOM   5757  H  H    . ARG A 1 33 ? -5.790  4.439   0.819   1.00 0.00 ? 33 ARG A H    10 
ATOM   5758  H  HA   . ARG A 1 33 ? -6.678  7.198   0.944   1.00 0.00 ? 33 ARG A HA   10 
ATOM   5759  H  HB2  . ARG A 1 33 ? -4.735  5.544   2.312   1.00 0.00 ? 33 ARG A HB2  10 
ATOM   5760  H  HB3  . ARG A 1 33 ? -4.020  7.064   1.801   1.00 0.00 ? 33 ARG A HB3  10 
ATOM   5761  H  HG2  . ARG A 1 33 ? -6.338  6.607   3.644   1.00 0.00 ? 33 ARG A HG2  10 
ATOM   5762  H  HG3  . ARG A 1 33 ? -4.819  7.440   3.969   1.00 0.00 ? 33 ARG A HG3  10 
ATOM   5763  H  HD2  . ARG A 1 33 ? -6.863  8.408   1.989   1.00 0.00 ? 33 ARG A HD2  10 
ATOM   5764  H  HD3  . ARG A 1 33 ? -6.820  8.925   3.672   1.00 0.00 ? 33 ARG A HD3  10 
ATOM   5765  H  HE   . ARG A 1 33 ? -5.145  9.836   1.542   1.00 0.00 ? 33 ARG A HE   10 
ATOM   5766  H  HH11 . ARG A 1 33 ? -5.216  9.272   5.009   1.00 0.00 ? 33 ARG A HH11 10 
ATOM   5767  H  HH12 . ARG A 1 33 ? -3.989  10.453  5.351   1.00 0.00 ? 33 ARG A HH12 10 
ATOM   5768  H  HH21 . ARG A 1 33 ? -3.565  11.392  1.987   1.00 0.00 ? 33 ARG A HH21 10 
ATOM   5769  H  HH22 . ARG A 1 33 ? -3.071  11.686  3.635   1.00 0.00 ? 33 ARG A HH22 10 
ATOM   5770  N  N    . HIS A 1 34 ? -5.040  6.299   -1.493  1.00 0.00 ? 34 HIS A N    10 
ATOM   5771  C  CA   . HIS A 1 34 ? -4.348  6.680   -2.713  1.00 0.00 ? 34 HIS A CA   10 
ATOM   5772  C  C    . HIS A 1 34 ? -5.353  6.866   -3.842  1.00 0.00 ? 34 HIS A C    10 
ATOM   5773  O  O    . HIS A 1 34 ? -5.059  6.585   -5.006  1.00 0.00 ? 34 HIS A O    10 
ATOM   5774  C  CB   . HIS A 1 34 ? -3.317  5.614   -3.097  1.00 0.00 ? 34 HIS A CB   10 
ATOM   5775  C  CG   . HIS A 1 34 ? -2.174  5.512   -2.138  1.00 0.00 ? 34 HIS A CG   10 
ATOM   5776  N  ND1  . HIS A 1 34 ? -1.333  6.554   -1.845  1.00 0.00 ? 34 HIS A ND1  10 
ATOM   5777  C  CD2  . HIS A 1 34 ? -1.735  4.457   -1.408  1.00 0.00 ? 34 HIS A CD2  10 
ATOM   5778  C  CE1  . HIS A 1 34 ? -0.424  6.110   -0.967  1.00 0.00 ? 34 HIS A CE1  10 
ATOM   5779  N  NE2  . HIS A 1 34 ? -0.620  4.837   -0.670  1.00 0.00 ? 34 HIS A NE2  10 
ATOM   5780  H  H    . HIS A 1 34 ? -5.534  5.449   -1.476  1.00 0.00 ? 34 HIS A H    10 
ATOM   5781  H  HA   . HIS A 1 34 ? -3.842  7.617   -2.534  1.00 0.00 ? 34 HIS A HA   10 
ATOM   5782  H  HB2  . HIS A 1 34 ? -3.804  4.653   -3.134  1.00 0.00 ? 34 HIS A HB2  10 
ATOM   5783  H  HB3  . HIS A 1 34 ? -2.915  5.848   -4.071  1.00 0.00 ? 34 HIS A HB3  10 
ATOM   5784  H  HD1  . HIS A 1 34 ? -1.388  7.469   -2.215  1.00 0.00 ? 34 HIS A HD1  10 
ATOM   5785  H  HD2  . HIS A 1 34 ? -2.176  3.469   -1.390  1.00 0.00 ? 34 HIS A HD2  10 
ATOM   5786  H  HE1  . HIS A 1 34 ? 0.369   6.715   -0.554  1.00 0.00 ? 34 HIS A HE1  10 
ATOM   5787  N  N    . MET A 1 35 ? -6.564  7.269   -3.479  1.00 0.00 ? 35 MET A N    10 
ATOM   5788  C  CA   . MET A 1 35 ? -7.636  7.441   -4.450  1.00 0.00 ? 35 MET A CA   10 
ATOM   5789  C  C    . MET A 1 35 ? -7.902  8.918   -4.701  1.00 0.00 ? 35 MET A C    10 
ATOM   5790  O  O    . MET A 1 35 ? -8.076  9.342   -5.843  1.00 0.00 ? 35 MET A O    10 
ATOM   5791  C  CB   . MET A 1 35 ? -8.914  6.757   -3.960  1.00 0.00 ? 35 MET A CB   10 
ATOM   5792  C  CG   . MET A 1 35 ? -8.819  5.242   -3.919  1.00 0.00 ? 35 MET A CG   10 
ATOM   5793  S  SD   . MET A 1 35 ? -10.416 4.448   -3.656  1.00 0.00 ? 35 MET A SD   10 
ATOM   5794  C  CE   . MET A 1 35 ? -10.173 2.913   -4.549  1.00 0.00 ? 35 MET A CE   10 
ATOM   5795  H  H    . MET A 1 35 ? -6.748  7.438   -2.527  1.00 0.00 ? 35 MET A H    10 
ATOM   5796  H  HA   . MET A 1 35 ? -7.324  6.982   -5.375  1.00 0.00 ? 35 MET A HA   10 
ATOM   5797  H  HB2  . MET A 1 35 ? -9.136  7.109   -2.966  1.00 0.00 ? 35 MET A HB2  10 
ATOM   5798  H  HB3  . MET A 1 35 ? -9.728  7.028   -4.619  1.00 0.00 ? 35 MET A HB3  10 
ATOM   5799  H  HG2  . MET A 1 35 ? -8.409  4.895   -4.856  1.00 0.00 ? 35 MET A HG2  10 
ATOM   5800  H  HG3  . MET A 1 35 ? -8.157  4.962   -3.113  1.00 0.00 ? 35 MET A HG3  10 
ATOM   5801  H  HE1  . MET A 1 35 ? -10.126 3.118   -5.609  1.00 0.00 ? 35 MET A HE1  10 
ATOM   5802  H  HE2  . MET A 1 35 ? -9.248  2.457   -4.231  1.00 0.00 ? 35 MET A HE2  10 
ATOM   5803  H  HE3  . MET A 1 35 ? -10.996 2.243   -4.348  1.00 0.00 ? 35 MET A HE3  10 
ATOM   5804  N  N    . LEU A 1 36 ? -7.871  9.705   -3.633  1.00 0.00 ? 36 LEU A N    10 
ATOM   5805  C  CA   . LEU A 1 36 ? -8.048  11.144  -3.726  1.00 0.00 ? 36 LEU A CA   10 
ATOM   5806  C  C    . LEU A 1 36 ? -7.153  11.817  -2.701  1.00 0.00 ? 36 LEU A C    10 
ATOM   5807  O  O    . LEU A 1 36 ? -7.611  12.619  -1.884  1.00 0.00 ? 36 LEU A O    10 
ATOM   5808  C  CB   . LEU A 1 36 ? -9.512  11.541  -3.478  1.00 0.00 ? 36 LEU A CB   10 
ATOM   5809  C  CG   . LEU A 1 36 ? -10.543 10.416  -3.613  1.00 0.00 ? 36 LEU A CG   10 
ATOM   5810  C  CD1  . LEU A 1 36 ? -10.994 9.939   -2.241  1.00 0.00 ? 36 LEU A CD1  10 
ATOM   5811  C  CD2  . LEU A 1 36 ? -11.733 10.888  -4.432  1.00 0.00 ? 36 LEU A CD2  10 
ATOM   5812  H  H    . LEU A 1 36 ? -7.647  9.317   -2.754  1.00 0.00 ? 36 LEU A H    10 
ATOM   5813  H  HA   . LEU A 1 36 ? -7.753  11.458  -4.717  1.00 0.00 ? 36 LEU A HA   10 
ATOM   5814  H  HB2  . LEU A 1 36 ? -9.585  11.941  -2.478  1.00 0.00 ? 36 LEU A HB2  10 
ATOM   5815  H  HB3  . LEU A 1 36 ? -9.773  12.321  -4.177  1.00 0.00 ? 36 LEU A HB3  10 
ATOM   5816  H  HG   . LEU A 1 36 ? -10.091 9.581   -4.128  1.00 0.00 ? 36 LEU A HG   10 
ATOM   5817  H  HD11 . LEU A 1 36 ? -10.234 10.177  -1.509  1.00 0.00 ? 36 LEU A HD11 10 
ATOM   5818  H  HD12 . LEU A 1 36 ? -11.917 10.429  -1.976  1.00 0.00 ? 36 LEU A HD12 10 
ATOM   5819  H  HD13 . LEU A 1 36 ? -11.147 8.870   -2.264  1.00 0.00 ? 36 LEU A HD13 10 
ATOM   5820  H  HD21 . LEU A 1 36 ? -12.420 11.424  -3.792  1.00 0.00 ? 36 LEU A HD21 10 
ATOM   5821  H  HD22 . LEU A 1 36 ? -11.392 11.543  -5.220  1.00 0.00 ? 36 LEU A HD22 10 
ATOM   5822  H  HD23 . LEU A 1 36 ? -12.235 10.036  -4.864  1.00 0.00 ? 36 LEU A HD23 10 
ATOM   5823  N  N    . VAL A 1 37 ? -5.876  11.450  -2.750  1.00 0.00 ? 37 VAL A N    10 
ATOM   5824  C  CA   . VAL A 1 37 ? -4.853  11.956  -1.837  1.00 0.00 ? 37 VAL A CA   10 
ATOM   5825  C  C    . VAL A 1 37 ? -5.002  11.358  -0.433  1.00 0.00 ? 37 VAL A C    10 
ATOM   5826  O  O    . VAL A 1 37 ? -6.118  10.921  -0.075  1.00 0.00 ? 37 VAL A O    10 
ATOM   5827  C  CB   . VAL A 1 37 ? -4.832  13.510  -1.787  1.00 0.00 ? 37 VAL A CB   10 
ATOM   5828  C  CG1  . VAL A 1 37 ? -5.227  14.055  -0.420  1.00 0.00 ? 37 VAL A CG1  10 
ATOM   5829  C  CG2  . VAL A 1 37 ? -3.460  14.028  -2.185  1.00 0.00 ? 37 VAL A CG2  10 
ATOM   5830  O  OXT  . VAL A 1 37 ? -3.991  11.290  0.293   1.00 0.00 ? 37 VAL A OXT  10 
ATOM   5831  H  H    . VAL A 1 37 ? -5.609  10.786  -3.427  1.00 0.00 ? 37 VAL A H    10 
ATOM   5832  H  HA   . VAL A 1 37 ? -3.905  11.629  -2.232  1.00 0.00 ? 37 VAL A HA   10 
ATOM   5833  H  HB   . VAL A 1 37 ? -5.547  13.877  -2.509  1.00 0.00 ? 37 VAL A HB   10 
ATOM   5834  H  HG11 . VAL A 1 37 ? -4.668  13.540  0.348   1.00 0.00 ? 37 VAL A HG11 10 
ATOM   5835  H  HG12 . VAL A 1 37 ? -5.008  15.112  -0.377  1.00 0.00 ? 37 VAL A HG12 10 
ATOM   5836  H  HG13 . VAL A 1 37 ? -6.283  13.899  -0.262  1.00 0.00 ? 37 VAL A HG13 10 
ATOM   5837  H  HG21 . VAL A 1 37 ? -3.174  14.831  -1.521  1.00 0.00 ? 37 VAL A HG21 10 
ATOM   5838  H  HG22 . VAL A 1 37 ? -2.739  13.228  -2.117  1.00 0.00 ? 37 VAL A HG22 10 
ATOM   5839  H  HG23 . VAL A 1 37 ? -3.496  14.396  -3.199  1.00 0.00 ? 37 VAL A HG23 10 
HETATM 5840  ZN ZN   . ZN  B 2 .  ? 0.761   3.658   0.085   1.00 0.00 ? 38 ZN  A ZN   10 
ATOM   5841  N  N    . GLY A 1 1  ? 13.975  4.326   -5.679  1.00 0.00 ? 1  GLY A N    11 
ATOM   5842  C  CA   . GLY A 1 1  ? 13.177  3.337   -6.439  1.00 0.00 ? 1  GLY A CA   11 
ATOM   5843  C  C    . GLY A 1 1  ? 12.326  2.480   -5.529  1.00 0.00 ? 1  GLY A C    11 
ATOM   5844  O  O    . GLY A 1 1  ? 12.453  2.557   -4.306  1.00 0.00 ? 1  GLY A O    11 
ATOM   5845  H  H1   . GLY A 1 1  ? 14.977  4.267   -5.955  1.00 0.00 ? 1  GLY A H1   11 
ATOM   5846  H  H2   . GLY A 1 1  ? 13.901  4.136   -4.655  1.00 0.00 ? 1  GLY A H2   11 
ATOM   5847  H  H3   . GLY A 1 1  ? 13.629  5.291   -5.865  1.00 0.00 ? 1  GLY A H3   11 
ATOM   5848  H  HA2  . GLY A 1 1  ? 12.533  3.862   -7.130  1.00 0.00 ? 1  GLY A HA2  11 
ATOM   5849  H  HA3  . GLY A 1 1  ? 13.847  2.700   -6.998  1.00 0.00 ? 1  GLY A HA3  11 
ATOM   5850  N  N    . SER A 1 2  ? 11.449  1.681   -6.120  1.00 0.00 ? 2  SER A N    11 
ATOM   5851  C  CA   . SER A 1 2  ? 10.558  0.822   -5.357  1.00 0.00 ? 2  SER A CA   11 
ATOM   5852  C  C    . SER A 1 2  ? 11.288  -0.427  -4.877  1.00 0.00 ? 2  SER A C    11 
ATOM   5853  O  O    . SER A 1 2  ? 12.185  -0.928  -5.559  1.00 0.00 ? 2  SER A O    11 
ATOM   5854  C  CB   . SER A 1 2  ? 9.352   0.434   -6.215  1.00 0.00 ? 2  SER A CB   11 
ATOM   5855  O  OG   . SER A 1 2  ? 9.180   1.344   -7.292  1.00 0.00 ? 2  SER A OG   11 
ATOM   5856  H  H    . SER A 1 2  ? 11.394  1.672   -7.100  1.00 0.00 ? 2  SER A H    11 
ATOM   5857  H  HA   . SER A 1 2  ? 10.213  1.381   -4.497  1.00 0.00 ? 2  SER A HA   11 
ATOM   5858  H  HB2  . SER A 1 2  ? 9.504   -0.557  -6.618  1.00 0.00 ? 2  SER A HB2  11 
ATOM   5859  H  HB3  . SER A 1 2  ? 8.459   0.443   -5.604  1.00 0.00 ? 2  SER A HB3  11 
ATOM   5860  H  HG   . SER A 1 2  ? 9.231   0.859   -8.133  1.00 0.00 ? 2  SER A HG   11 
ATOM   5861  N  N    . THR A 1 3  ? 10.895  -0.925  -3.707  1.00 0.00 ? 3  THR A N    11 
ATOM   5862  C  CA   . THR A 1 3  ? 11.497  -2.118  -3.122  1.00 0.00 ? 3  THR A CA   11 
ATOM   5863  C  C    . THR A 1 3  ? 12.998  -1.919  -2.899  1.00 0.00 ? 3  THR A C    11 
ATOM   5864  O  O    . THR A 1 3  ? 13.823  -2.745  -3.301  1.00 0.00 ? 3  THR A O    11 
ATOM   5865  C  CB   . THR A 1 3  ? 11.245  -3.357  -4.008  1.00 0.00 ? 3  THR A CB   11 
ATOM   5866  O  OG1  . THR A 1 3  ? 9.954   -3.248  -4.624  1.00 0.00 ? 3  THR A OG1  11 
ATOM   5867  C  CG2  . THR A 1 3  ? 11.311  -4.640  -3.194  1.00 0.00 ? 3  THR A CG2  11 
ATOM   5868  H  H    . THR A 1 3  ? 10.170  -0.466  -3.213  1.00 0.00 ? 3  THR A H    11 
ATOM   5869  H  HA   . THR A 1 3  ? 11.027  -2.286  -2.164  1.00 0.00 ? 3  THR A HA   11 
ATOM   5870  H  HB   . THR A 1 3  ? 12.004  -3.391  -4.776  1.00 0.00 ? 3  THR A HB   11 
ATOM   5871  H  HG1  . THR A 1 3  ? 9.489   -2.491  -4.245  1.00 0.00 ? 3  THR A HG1  11 
ATOM   5872  H  HG21 . THR A 1 3  ? 12.168  -4.605  -2.537  1.00 0.00 ? 3  THR A HG21 11 
ATOM   5873  H  HG22 . THR A 1 3  ? 11.405  -5.485  -3.859  1.00 0.00 ? 3  THR A HG22 11 
ATOM   5874  H  HG23 . THR A 1 3  ? 10.410  -4.740  -2.607  1.00 0.00 ? 3  THR A HG23 11 
ATOM   5875  N  N    . ARG A 1 4  ? 13.341  -0.801  -2.271  1.00 0.00 ? 4  ARG A N    11 
ATOM   5876  C  CA   . ARG A 1 4  ? 14.735  -0.473  -2.002  1.00 0.00 ? 4  ARG A CA   11 
ATOM   5877  C  C    . ARG A 1 4  ? 15.137  -0.907  -0.595  1.00 0.00 ? 4  ARG A C    11 
ATOM   5878  O  O    . ARG A 1 4  ? 14.410  -0.663  0.369   1.00 0.00 ? 4  ARG A O    11 
ATOM   5879  C  CB   . ARG A 1 4  ? 14.982  1.033   -2.185  1.00 0.00 ? 4  ARG A CB   11 
ATOM   5880  C  CG   . ARG A 1 4  ? 14.202  1.917   -1.222  1.00 0.00 ? 4  ARG A CG   11 
ATOM   5881  C  CD   . ARG A 1 4  ? 15.125  2.670   -0.273  1.00 0.00 ? 4  ARG A CD   11 
ATOM   5882  N  NE   . ARG A 1 4  ? 14.590  2.718   1.088   1.00 0.00 ? 4  ARG A NE   11 
ATOM   5883  C  CZ   . ARG A 1 4  ? 15.006  3.564   2.028   1.00 0.00 ? 4  ARG A CZ   11 
ATOM   5884  N  NH1  . ARG A 1 4  ? 15.985  4.422   1.776   1.00 0.00 ? 4  ARG A NH1  11 
ATOM   5885  N  NH2  . ARG A 1 4  ? 14.443  3.540   3.233   1.00 0.00 ? 4  ARG A NH2  11 
ATOM   5886  H  H    . ARG A 1 4  ? 12.638  -0.182  -1.980  1.00 0.00 ? 4  ARG A H    11 
ATOM   5887  H  HA   . ARG A 1 4  ? 15.340  -1.013  -2.713  1.00 0.00 ? 4  ARG A HA   11 
ATOM   5888  H  HB2  . ARG A 1 4  ? 16.035  1.232   -2.043  1.00 0.00 ? 4  ARG A HB2  11 
ATOM   5889  H  HB3  . ARG A 1 4  ? 14.708  1.311   -3.192  1.00 0.00 ? 4  ARG A HB3  11 
ATOM   5890  H  HG2  . ARG A 1 4  ? 13.627  2.633   -1.791  1.00 0.00 ? 4  ARG A HG2  11 
ATOM   5891  H  HG3  . ARG A 1 4  ? 13.534  1.297   -0.643  1.00 0.00 ? 4  ARG A HG3  11 
ATOM   5892  H  HD2  . ARG A 1 4  ? 16.085  2.175   -0.254  1.00 0.00 ? 4  ARG A HD2  11 
ATOM   5893  H  HD3  . ARG A 1 4  ? 15.249  3.679   -0.636  1.00 0.00 ? 4  ARG A HD3  11 
ATOM   5894  H  HE   . ARG A 1 4  ? 13.866  2.081   1.310   1.00 0.00 ? 4  ARG A HE   11 
ATOM   5895  H  HH11 . ARG A 1 4  ? 16.421  4.443   0.870   1.00 0.00 ? 4  ARG A HH11 11 
ATOM   5896  H  HH12 . ARG A 1 4  ? 16.303  5.057   2.498   1.00 0.00 ? 4  ARG A HH12 11 
ATOM   5897  H  HH21 . ARG A 1 4  ? 13.713  2.883   3.433   1.00 0.00 ? 4  ARG A HH21 11 
ATOM   5898  H  HH22 . ARG A 1 4  ? 14.734  4.193   3.945   1.00 0.00 ? 4  ARG A HH22 11 
ATOM   5899  N  N    . GLY A 1 5  ? 16.308  -1.527  -0.486  1.00 0.00 ? 5  GLY A N    11 
ATOM   5900  C  CA   . GLY A 1 5  ? 16.832  -1.943  0.808   1.00 0.00 ? 5  GLY A CA   11 
ATOM   5901  C  C    . GLY A 1 5  ? 15.942  -2.945  1.517   1.00 0.00 ? 5  GLY A C    11 
ATOM   5902  O  O    . GLY A 1 5  ? 15.996  -4.148  1.243   1.00 0.00 ? 5  GLY A O    11 
ATOM   5903  H  H    . GLY A 1 5  ? 16.839  -1.686  -1.299  1.00 0.00 ? 5  GLY A H    11 
ATOM   5904  H  HA2  . GLY A 1 5  ? 17.807  -2.386  0.660   1.00 0.00 ? 5  GLY A HA2  11 
ATOM   5905  H  HA3  . GLY A 1 5  ? 16.940  -1.069  1.434   1.00 0.00 ? 5  GLY A HA3  11 
ATOM   5906  N  N    . SER A 1 6  ? 15.114  -2.448  2.422   1.00 0.00 ? 6  SER A N    11 
ATOM   5907  C  CA   . SER A 1 6  ? 14.206  -3.291  3.184   1.00 0.00 ? 6  SER A CA   11 
ATOM   5908  C  C    . SER A 1 6  ? 12.811  -2.680  3.192   1.00 0.00 ? 6  SER A C    11 
ATOM   5909  O  O    . SER A 1 6  ? 11.906  -3.158  3.876   1.00 0.00 ? 6  SER A O    11 
ATOM   5910  C  CB   . SER A 1 6  ? 14.722  -3.457  4.612   1.00 0.00 ? 6  SER A CB   11 
ATOM   5911  O  OG   . SER A 1 6  ? 15.804  -2.571  4.872   1.00 0.00 ? 6  SER A OG   11 
ATOM   5912  H  H    . SER A 1 6  ? 15.125  -1.478  2.598   1.00 0.00 ? 6  SER A H    11 
ATOM   5913  H  HA   . SER A 1 6  ? 14.165  -4.258  2.705   1.00 0.00 ? 6  SER A HA   11 
ATOM   5914  H  HB2  . SER A 1 6  ? 13.925  -3.247  5.311   1.00 0.00 ? 6  SER A HB2  11 
ATOM   5915  H  HB3  . SER A 1 6  ? 15.063  -4.468  4.749   1.00 0.00 ? 6  SER A HB3  11 
ATOM   5916  H  HG   . SER A 1 6  ? 15.686  -2.177  5.752   1.00 0.00 ? 6  SER A HG   11 
ATOM   5917  N  N    . THR A 1 7  ? 12.630  -1.678  2.354   1.00 0.00 ? 7  THR A N    11 
ATOM   5918  C  CA   . THR A 1 7  ? 11.334  -1.052  2.170   1.00 0.00 ? 7  THR A CA   11 
ATOM   5919  C  C    . THR A 1 7  ? 10.661  -1.606  0.923   1.00 0.00 ? 7  THR A C    11 
ATOM   5920  O  O    . THR A 1 7  ? 10.997  -1.216  -0.195  1.00 0.00 ? 7  THR A O    11 
ATOM   5921  C  CB   . THR A 1 7  ? 11.457  0.477   2.056   1.00 0.00 ? 7  THR A CB   11 
ATOM   5922  O  OG1  . THR A 1 7  ? 12.823  0.840   1.828   1.00 0.00 ? 7  THR A OG1  11 
ATOM   5923  C  CG2  . THR A 1 7  ? 10.954  1.155   3.320   1.00 0.00 ? 7  THR A CG2  11 
ATOM   5924  H  H    . THR A 1 7  ? 13.379  -1.395  1.790   1.00 0.00 ? 7  THR A H    11 
ATOM   5925  H  HA   . THR A 1 7  ? 10.724  -1.284  3.033   1.00 0.00 ? 7  THR A HA   11 
ATOM   5926  H  HB   . THR A 1 7  ? 10.860  0.812   1.220   1.00 0.00 ? 7  THR A HB   11 
ATOM   5927  H  HG1  . THR A 1 7  ? 13.210  0.233   1.179   1.00 0.00 ? 7  THR A HG1  11 
ATOM   5928  H  HG21 . THR A 1 7  ? 9.883   1.033   3.391   1.00 0.00 ? 7  THR A HG21 11 
ATOM   5929  H  HG22 . THR A 1 7  ? 11.196  2.205   3.286   1.00 0.00 ? 7  THR A HG22 11 
ATOM   5930  H  HG23 . THR A 1 7  ? 11.425  0.702   4.179   1.00 0.00 ? 7  THR A HG23 11 
ATOM   5931  N  N    . GLY A 1 8  ? 9.800   -2.593  1.115   1.00 0.00 ? 8  GLY A N    11 
ATOM   5932  C  CA   . GLY A 1 8  ? 9.140   -3.240  -0.001  1.00 0.00 ? 8  GLY A CA   11 
ATOM   5933  C  C    . GLY A 1 8  ? 9.132   -4.745  0.138   1.00 0.00 ? 8  GLY A C    11 
ATOM   5934  O  O    . GLY A 1 8  ? 9.327   -5.477  -0.834  1.00 0.00 ? 8  GLY A O    11 
ATOM   5935  H  H    . GLY A 1 8  ? 9.627   -2.907  2.032   1.00 0.00 ? 8  GLY A H    11 
ATOM   5936  H  HA2  . GLY A 1 8  ? 8.121   -2.894  -0.043  1.00 0.00 ? 8  GLY A HA2  11 
ATOM   5937  H  HA3  . GLY A 1 8  ? 9.645   -2.971  -0.916  1.00 0.00 ? 8  GLY A HA3  11 
ATOM   5938  N  N    . ILE A 1 9  ? 8.869   -5.204  1.347   1.00 0.00 ? 9  ILE A N    11 
ATOM   5939  C  CA   . ILE A 1 9  ? 8.756   -6.627  1.630   1.00 0.00 ? 9  ILE A CA   11 
ATOM   5940  C  C    . ILE A 1 9  ? 7.410   -7.153  1.137   1.00 0.00 ? 9  ILE A C    11 
ATOM   5941  O  O    . ILE A 1 9  ? 6.506   -6.362  0.861   1.00 0.00 ? 9  ILE A O    11 
ATOM   5942  C  CB   . ILE A 1 9  ? 8.901   -6.900  3.145   1.00 0.00 ? 9  ILE A CB   11 
ATOM   5943  C  CG1  . ILE A 1 9  ? 9.912   -5.936  3.771   1.00 0.00 ? 9  ILE A CG1  11 
ATOM   5944  C  CG2  . ILE A 1 9  ? 9.330   -8.337  3.395   1.00 0.00 ? 9  ILE A CG2  11 
ATOM   5945  C  CD1  . ILE A 1 9  ? 9.639   -5.636  5.229   1.00 0.00 ? 9  ILE A CD1  11 
ATOM   5946  H  H    . ILE A 1 9  ? 8.668   -4.559  2.060   1.00 0.00 ? 9  ILE A H    11 
ATOM   5947  H  HA   . ILE A 1 9  ? 9.552   -7.141  1.111   1.00 0.00 ? 9  ILE A HA   11 
ATOM   5948  H  HB   . ILE A 1 9  ? 7.939   -6.748  3.606   1.00 0.00 ? 9  ILE A HB   11 
ATOM   5949  H  HG12 . ILE A 1 9  ? 10.899  -6.366  3.701   1.00 0.00 ? 9  ILE A HG12 11 
ATOM   5950  H  HG13 . ILE A 1 9  ? 9.891   -5.001  3.230   1.00 0.00 ? 9  ILE A HG13 11 
ATOM   5951  H  HG21 . ILE A 1 9  ? 10.405  -8.387  3.450   1.00 0.00 ? 9  ILE A HG21 11 
ATOM   5952  H  HG22 . ILE A 1 9  ? 8.904   -8.684  4.324   1.00 0.00 ? 9  ILE A HG22 11 
ATOM   5953  H  HG23 . ILE A 1 9  ? 8.984   -8.961  2.585   1.00 0.00 ? 9  ILE A HG23 11 
ATOM   5954  H  HD11 . ILE A 1 9  ? 8.754   -5.022  5.311   1.00 0.00 ? 9  ILE A HD11 11 
ATOM   5955  H  HD12 . ILE A 1 9  ? 9.486   -6.562  5.764   1.00 0.00 ? 9  ILE A HD12 11 
ATOM   5956  H  HD13 . ILE A 1 9  ? 10.482  -5.111  5.650   1.00 0.00 ? 9  ILE A HD13 11 
ATOM   5957  N  N    . LYS A 1 10 ? 7.283   -8.481  1.029   1.00 0.00 ? 10 LYS A N    11 
ATOM   5958  C  CA   . LYS A 1 10 ? 6.040   -9.122  0.587   1.00 0.00 ? 10 LYS A CA   11 
ATOM   5959  C  C    . LYS A 1 10 ? 5.796   -8.894  -0.903  1.00 0.00 ? 10 LYS A C    11 
ATOM   5960  O  O    . LYS A 1 10 ? 6.210   -7.883  -1.468  1.00 0.00 ? 10 LYS A O    11 
ATOM   5961  C  CB   . LYS A 1 10 ? 4.844   -8.627  1.403   1.00 0.00 ? 10 LYS A CB   11 
ATOM   5962  C  CG   . LYS A 1 10 ? 4.428   -9.591  2.497   1.00 0.00 ? 10 LYS A CG   11 
ATOM   5963  C  CD   . LYS A 1 10 ? 4.332   -8.895  3.844   1.00 0.00 ? 10 LYS A CD   11 
ATOM   5964  C  CE   . LYS A 1 10 ? 5.511   -9.244  4.737   1.00 0.00 ? 10 LYS A CE   11 
ATOM   5965  N  NZ   . LYS A 1 10 ? 5.237   -8.912  6.157   1.00 0.00 ? 10 LYS A NZ   11 
ATOM   5966  H  H    . LYS A 1 10 ? 8.053   -9.050  1.248   1.00 0.00 ? 10 LYS A H    11 
ATOM   5967  H  HA   . LYS A 1 10 ? 6.143   -10.184 0.752   1.00 0.00 ? 10 LYS A HA   11 
ATOM   5968  H  HB2  . LYS A 1 10 ? 5.100   -7.682  1.861   1.00 0.00 ? 10 LYS A HB2  11 
ATOM   5969  H  HB3  . LYS A 1 10 ? 4.005   -8.481  0.741   1.00 0.00 ? 10 LYS A HB3  11 
ATOM   5970  H  HG2  . LYS A 1 10 ? 3.462   -10.008 2.248   1.00 0.00 ? 10 LYS A HG2  11 
ATOM   5971  H  HG3  . LYS A 1 10 ? 5.158   -10.384 2.563   1.00 0.00 ? 10 LYS A HG3  11 
ATOM   5972  H  HD2  . LYS A 1 10 ? 4.316   -7.826  3.686   1.00 0.00 ? 10 LYS A HD2  11 
ATOM   5973  H  HD3  . LYS A 1 10 ? 3.419   -9.202  4.332   1.00 0.00 ? 10 LYS A HD3  11 
ATOM   5974  H  HE2  . LYS A 1 10 ? 5.707   -10.302 4.655   1.00 0.00 ? 10 LYS A HE2  11 
ATOM   5975  H  HE3  . LYS A 1 10 ? 6.376   -8.690  4.405   1.00 0.00 ? 10 LYS A HE3  11 
ATOM   5976  H  HZ1  . LYS A 1 10 ? 4.247   -8.603  6.269   1.00 0.00 ? 10 LYS A HZ1  11 
ATOM   5977  H  HZ2  . LYS A 1 10 ? 5.864   -8.139  6.471   1.00 0.00 ? 10 LYS A HZ2  11 
ATOM   5978  H  HZ3  . LYS A 1 10 ? 5.400   -9.748  6.762   1.00 0.00 ? 10 LYS A HZ3  11 
ATOM   5979  N  N    . PRO A 1 11 ? 5.177   -9.871  -1.581  1.00 0.00 ? 11 PRO A N    11 
ATOM   5980  C  CA   . PRO A 1 11 ? 4.914   -9.795  -3.021  1.00 0.00 ? 11 PRO A CA   11 
ATOM   5981  C  C    . PRO A 1 11 ? 3.986   -8.639  -3.382  1.00 0.00 ? 11 PRO A C    11 
ATOM   5982  O  O    . PRO A 1 11 ? 3.918   -8.220  -4.541  1.00 0.00 ? 11 PRO A O    11 
ATOM   5983  C  CB   . PRO A 1 11 ? 4.248   -11.140 -3.342  1.00 0.00 ? 11 PRO A CB   11 
ATOM   5984  C  CG   . PRO A 1 11 ? 3.739   -11.639 -2.036  1.00 0.00 ? 11 PRO A CG   11 
ATOM   5985  C  CD   . PRO A 1 11 ? 4.710   -11.144 -1.006  1.00 0.00 ? 11 PRO A CD   11 
ATOM   5986  H  HA   . PRO A 1 11 ? 5.828   -9.704  -3.582  1.00 0.00 ? 11 PRO A HA   11 
ATOM   5987  H  HB2  . PRO A 1 11 ? 3.444   -10.988 -4.046  1.00 0.00 ? 11 PRO A HB2  11 
ATOM   5988  H  HB3  . PRO A 1 11 ? 4.979   -11.815 -3.761  1.00 0.00 ? 11 PRO A HB3  11 
ATOM   5989  H  HG2  . PRO A 1 11 ? 2.756   -11.235 -1.849  1.00 0.00 ? 11 PRO A HG2  11 
ATOM   5990  H  HG3  . PRO A 1 11 ? 3.711   -12.718 -2.038  1.00 0.00 ? 11 PRO A HG3  11 
ATOM   5991  H  HD2  . PRO A 1 11 ? 4.213   -10.983 -0.062  1.00 0.00 ? 11 PRO A HD2  11 
ATOM   5992  H  HD3  . PRO A 1 11 ? 5.528   -11.838 -0.893  1.00 0.00 ? 11 PRO A HD3  11 
ATOM   5993  N  N    . PHE A 1 12 ? 3.269   -8.133  -2.387  1.00 0.00 ? 12 PHE A N    11 
ATOM   5994  C  CA   . PHE A 1 12 ? 2.336   -7.040  -2.597  1.00 0.00 ? 12 PHE A CA   11 
ATOM   5995  C  C    . PHE A 1 12 ? 2.670   -5.855  -1.702  1.00 0.00 ? 12 PHE A C    11 
ATOM   5996  O  O    . PHE A 1 12 ? 2.019   -5.624  -0.687  1.00 0.00 ? 12 PHE A O    11 
ATOM   5997  C  CB   . PHE A 1 12 ? 0.907   -7.504  -2.325  1.00 0.00 ? 12 PHE A CB   11 
ATOM   5998  C  CG   . PHE A 1 12 ? 0.527   -8.751  -3.068  1.00 0.00 ? 12 PHE A CG   11 
ATOM   5999  C  CD1  . PHE A 1 12 ? 0.580   -8.794  -4.454  1.00 0.00 ? 12 PHE A CD1  11 
ATOM   6000  C  CD2  . PHE A 1 12 ? 0.123   -9.881  -2.381  1.00 0.00 ? 12 PHE A CD2  11 
ATOM   6001  C  CE1  . PHE A 1 12 ? 0.232   -9.944  -5.135  1.00 0.00 ? 12 PHE A CE1  11 
ATOM   6002  C  CE2  . PHE A 1 12 ? -0.225  -11.032 -3.056  1.00 0.00 ? 12 PHE A CE2  11 
ATOM   6003  C  CZ   . PHE A 1 12 ? -0.170  -11.064 -4.435  1.00 0.00 ? 12 PHE A CZ   11 
ATOM   6004  H  H    . PHE A 1 12 ? 3.363   -8.511  -1.487  1.00 0.00 ? 12 PHE A H    11 
ATOM   6005  H  HA   . PHE A 1 12 ? 2.414   -6.730  -3.628  1.00 0.00 ? 12 PHE A HA   11 
ATOM   6006  H  HB2  . PHE A 1 12 ? 0.797   -7.700  -1.265  1.00 0.00 ? 12 PHE A HB2  11 
ATOM   6007  H  HB3  . PHE A 1 12 ? 0.223   -6.719  -2.613  1.00 0.00 ? 12 PHE A HB3  11 
ATOM   6008  H  HD1  . PHE A 1 12 ? 0.895   -7.917  -5.001  1.00 0.00 ? 12 PHE A HD1  11 
ATOM   6009  H  HD2  . PHE A 1 12 ? 0.076   -9.858  -1.302  1.00 0.00 ? 12 PHE A HD2  11 
ATOM   6010  H  HE1  . PHE A 1 12 ? 0.275   -9.968  -6.215  1.00 0.00 ? 12 PHE A HE1  11 
ATOM   6011  H  HE2  . PHE A 1 12 ? -0.542  -11.905 -2.506  1.00 0.00 ? 12 PHE A HE2  11 
ATOM   6012  H  HZ   . PHE A 1 12 ? -0.442  -11.962 -4.966  1.00 0.00 ? 12 PHE A HZ   11 
ATOM   6013  N  N    . GLN A 1 13 ? 3.664   -5.087  -2.099  1.00 0.00 ? 13 GLN A N    11 
ATOM   6014  C  CA   . GLN A 1 13 ? 4.023   -3.884  -1.386  1.00 0.00 ? 13 GLN A CA   11 
ATOM   6015  C  C    . GLN A 1 13 ? 3.325   -2.691  -2.028  1.00 0.00 ? 13 GLN A C    11 
ATOM   6016  O  O    . GLN A 1 13 ? 2.977   -2.742  -3.211  1.00 0.00 ? 13 GLN A O    11 
ATOM   6017  C  CB   . GLN A 1 13 ? 5.535   -3.714  -1.431  1.00 0.00 ? 13 GLN A CB   11 
ATOM   6018  C  CG   . GLN A 1 13 ? 6.049   -3.213  -2.763  1.00 0.00 ? 13 GLN A CG   11 
ATOM   6019  C  CD   . GLN A 1 13 ? 6.523   -4.334  -3.667  1.00 0.00 ? 13 GLN A CD   11 
ATOM   6020  O  OE1  . GLN A 1 13 ? 6.003   -4.521  -4.767  1.00 0.00 ? 13 GLN A OE1  11 
ATOM   6021  N  NE2  . GLN A 1 13 ? 7.502   -5.096  -3.206  1.00 0.00 ? 13 GLN A NE2  11 
ATOM   6022  H  H    . GLN A 1 13 ? 4.148   -5.308  -2.915  1.00 0.00 ? 13 GLN A H    11 
ATOM   6023  H  HA   . GLN A 1 13 ? 3.702   -3.982  -0.364  1.00 0.00 ? 13 GLN A HA   11 
ATOM   6024  H  HB2  . GLN A 1 13 ? 5.835   -3.016  -0.664  1.00 0.00 ? 13 GLN A HB2  11 
ATOM   6025  H  HB3  . GLN A 1 13 ? 5.989   -4.672  -1.235  1.00 0.00 ? 13 GLN A HB3  11 
ATOM   6026  H  HG2  . GLN A 1 13 ? 5.256   -2.681  -3.262  1.00 0.00 ? 13 GLN A HG2  11 
ATOM   6027  H  HG3  . GLN A 1 13 ? 6.868   -2.543  -2.580  1.00 0.00 ? 13 GLN A HG3  11 
ATOM   6028  H  HE21 . GLN A 1 13 ? 7.867   -4.898  -2.318  1.00 0.00 ? 13 GLN A HE21 11 
ATOM   6029  H  HE22 . GLN A 1 13 ? 7.823   -5.829  -3.772  1.00 0.00 ? 13 GLN A HE22 11 
ATOM   6030  N  N    . CYS A 1 14 ? 3.135   -1.618  -1.271  1.00 0.00 ? 14 CYS A N    11 
ATOM   6031  C  CA   . CYS A 1 14 ? 2.516   -0.427  -1.828  1.00 0.00 ? 14 CYS A CA   11 
ATOM   6032  C  C    . CYS A 1 14 ? 3.443   0.193   -2.863  1.00 0.00 ? 14 CYS A C    11 
ATOM   6033  O  O    . CYS A 1 14 ? 4.597   0.489   -2.565  1.00 0.00 ? 14 CYS A O    11 
ATOM   6034  C  CB   . CYS A 1 14 ? 2.183   0.618   -0.758  1.00 0.00 ? 14 CYS A CB   11 
ATOM   6035  S  SG   . CYS A 1 14 ? 1.494   2.148   -1.483  1.00 0.00 ? 14 CYS A SG   11 
ATOM   6036  H  H    . CYS A 1 14 ? 3.460   -1.616  -0.353  1.00 0.00 ? 14 CYS A H    11 
ATOM   6037  H  HA   . CYS A 1 14 ? 1.601   -0.729  -2.316  1.00 0.00 ? 14 CYS A HA   11 
ATOM   6038  H  HB2  . CYS A 1 14 ? 1.455   0.211   -0.072  1.00 0.00 ? 14 CYS A HB2  11 
ATOM   6039  H  HB3  . CYS A 1 14 ? 3.081   0.881   -0.220  1.00 0.00 ? 14 CYS A HB3  11 
ATOM   6040  N  N    . PRO A 1 15 ? 2.951   0.416   -4.087  1.00 0.00 ? 15 PRO A N    11 
ATOM   6041  C  CA   . PRO A 1 15 ? 3.748   1.026   -5.150  1.00 0.00 ? 15 PRO A CA   11 
ATOM   6042  C  C    . PRO A 1 15 ? 3.992   2.516   -4.911  1.00 0.00 ? 15 PRO A C    11 
ATOM   6043  O  O    . PRO A 1 15 ? 4.691   3.171   -5.687  1.00 0.00 ? 15 PRO A O    11 
ATOM   6044  C  CB   . PRO A 1 15 ? 2.897   0.809   -6.402  1.00 0.00 ? 15 PRO A CB   11 
ATOM   6045  C  CG   . PRO A 1 15 ? 1.498   0.696   -5.904  1.00 0.00 ? 15 PRO A CG   11 
ATOM   6046  C  CD   . PRO A 1 15 ? 1.587   0.080   -4.534  1.00 0.00 ? 15 PRO A CD   11 
ATOM   6047  H  HA   . PRO A 1 15 ? 4.697   0.523   -5.269  1.00 0.00 ? 15 PRO A HA   11 
ATOM   6048  H  HB2  . PRO A 1 15 ? 3.011   1.652   -7.066  1.00 0.00 ? 15 PRO A HB2  11 
ATOM   6049  H  HB3  . PRO A 1 15 ? 3.211   -0.094  -6.903  1.00 0.00 ? 15 PRO A HB3  11 
ATOM   6050  H  HG2  . PRO A 1 15 ? 1.049   1.676   -5.845  1.00 0.00 ? 15 PRO A HG2  11 
ATOM   6051  H  HG3  . PRO A 1 15 ? 0.925   0.060   -6.563  1.00 0.00 ? 15 PRO A HG3  11 
ATOM   6052  H  HD2  . PRO A 1 15 ? 0.850   0.517   -3.879  1.00 0.00 ? 15 PRO A HD2  11 
ATOM   6053  H  HD3  . PRO A 1 15 ? 1.454   -0.990  -4.592  1.00 0.00 ? 15 PRO A HD3  11 
ATOM   6054  N  N    . ASP A 1 16 ? 3.409   3.052   -3.843  1.00 0.00 ? 16 ASP A N    11 
ATOM   6055  C  CA   . ASP A 1 16 ? 3.558   4.470   -3.525  1.00 0.00 ? 16 ASP A CA   11 
ATOM   6056  C  C    . ASP A 1 16 ? 4.361   4.672   -2.244  1.00 0.00 ? 16 ASP A C    11 
ATOM   6057  O  O    . ASP A 1 16 ? 5.051   5.682   -2.085  1.00 0.00 ? 16 ASP A O    11 
ATOM   6058  C  CB   . ASP A 1 16 ? 2.183   5.131   -3.385  1.00 0.00 ? 16 ASP A CB   11 
ATOM   6059  C  CG   . ASP A 1 16 ? 2.253   6.642   -3.481  1.00 0.00 ? 16 ASP A CG   11 
ATOM   6060  O  OD1  . ASP A 1 16 ? 2.814   7.157   -4.472  1.00 0.00 ? 16 ASP A OD1  11 
ATOM   6061  O  OD2  . ASP A 1 16 ? 1.731   7.327   -2.574  1.00 0.00 ? 16 ASP A OD2  11 
ATOM   6062  H  H    . ASP A 1 16 ? 2.850   2.482   -3.262  1.00 0.00 ? 16 ASP A H    11 
ATOM   6063  H  HA   . ASP A 1 16 ? 4.087   4.935   -4.343  1.00 0.00 ? 16 ASP A HA   11 
ATOM   6064  H  HB2  . ASP A 1 16 ? 1.536   4.772   -4.171  1.00 0.00 ? 16 ASP A HB2  11 
ATOM   6065  H  HB3  . ASP A 1 16 ? 1.760   4.868   -2.427  1.00 0.00 ? 16 ASP A HB3  11 
ATOM   6066  N  N    . CYS A 1 17 ? 4.222   3.744   -1.306  1.00 0.00 ? 17 CYS A N    11 
ATOM   6067  C  CA   . CYS A 1 17 ? 4.892   3.860   -0.015  1.00 0.00 ? 17 CYS A CA   11 
ATOM   6068  C  C    . CYS A 1 17 ? 6.043   2.870   0.124   1.00 0.00 ? 17 CYS A C    11 
ATOM   6069  O  O    . CYS A 1 17 ? 6.953   3.087   0.929   1.00 0.00 ? 17 CYS A O    11 
ATOM   6070  C  CB   . CYS A 1 17 ? 3.900   3.646   1.122   1.00 0.00 ? 17 CYS A CB   11 
ATOM   6071  S  SG   . CYS A 1 17 ? 2.469   4.765   1.078   1.00 0.00 ? 17 CYS A SG   11 
ATOM   6072  H  H    . CYS A 1 17 ? 3.612   2.992   -1.467  1.00 0.00 ? 17 CYS A H    11 
ATOM   6073  H  HA   . CYS A 1 17 ? 5.285   4.861   0.055   1.00 0.00 ? 17 CYS A HA   11 
ATOM   6074  H  HB2  . CYS A 1 17 ? 3.527   2.634   1.078   1.00 0.00 ? 17 CYS A HB2  11 
ATOM   6075  H  HB3  . CYS A 1 17 ? 4.407   3.796   2.064   1.00 0.00 ? 17 CYS A HB3  11 
ATOM   6076  N  N    . ASP A 1 18 ? 5.885   1.713   -0.513  1.00 0.00 ? 18 ASP A N    11 
ATOM   6077  C  CA   . ASP A 1 18 ? 6.814   0.587   -0.374  1.00 0.00 ? 18 ASP A CA   11 
ATOM   6078  C  C    . ASP A 1 18 ? 6.598   -0.101  0.963   1.00 0.00 ? 18 ASP A C    11 
ATOM   6079  O  O    . ASP A 1 18 ? 7.540   -0.367  1.709   1.00 0.00 ? 18 ASP A O    11 
ATOM   6080  C  CB   . ASP A 1 18 ? 8.274   1.024   -0.526  1.00 0.00 ? 18 ASP A CB   11 
ATOM   6081  C  CG   . ASP A 1 18 ? 8.856   0.629   -1.864  1.00 0.00 ? 18 ASP A CG   11 
ATOM   6082  O  OD1  . ASP A 1 18 ? 8.488   -0.440  -2.395  1.00 0.00 ? 18 ASP A OD1  11 
ATOM   6083  O  OD2  . ASP A 1 18 ? 9.675   1.395   -2.406  1.00 0.00 ? 18 ASP A OD2  11 
ATOM   6084  H  H    . ASP A 1 18 ? 5.070   1.581   -1.042  1.00 0.00 ? 18 ASP A H    11 
ATOM   6085  H  HA   . ASP A 1 18 ? 6.582   -0.121  -1.157  1.00 0.00 ? 18 ASP A HA   11 
ATOM   6086  H  HB2  . ASP A 1 18 ? 8.333   2.097   -0.433  1.00 0.00 ? 18 ASP A HB2  11 
ATOM   6087  H  HB3  . ASP A 1 18 ? 8.866   0.565   0.253   1.00 0.00 ? 18 ASP A HB3  11 
ATOM   6088  N  N    . ARG A 1 19 ? 5.336   -0.394  1.246   1.00 0.00 ? 19 ARG A N    11 
ATOM   6089  C  CA   . ARG A 1 19 ? 4.959   -1.095  2.466   1.00 0.00 ? 19 ARG A CA   11 
ATOM   6090  C  C    . ARG A 1 19 ? 5.092   -2.600  2.266   1.00 0.00 ? 19 ARG A C    11 
ATOM   6091  O  O    . ARG A 1 19 ? 5.938   -3.048  1.495   1.00 0.00 ? 19 ARG A O    11 
ATOM   6092  C  CB   . ARG A 1 19 ? 3.528   -0.742  2.853   1.00 0.00 ? 19 ARG A CB   11 
ATOM   6093  C  CG   . ARG A 1 19 ? 3.435   0.410   3.830   1.00 0.00 ? 19 ARG A CG   11 
ATOM   6094  C  CD   . ARG A 1 19 ? 2.404   1.432   3.382   1.00 0.00 ? 19 ARG A CD   11 
ATOM   6095  N  NE   . ARG A 1 19 ? 1.092   1.189   3.979   1.00 0.00 ? 19 ARG A NE   11 
ATOM   6096  C  CZ   . ARG A 1 19 ? 0.830   1.339   5.284   1.00 0.00 ? 19 ARG A CZ   11 
ATOM   6097  N  NH1  . ARG A 1 19 ? 1.764   1.799   6.106   1.00 0.00 ? 19 ARG A NH1  11 
ATOM   6098  N  NH2  . ARG A 1 19 ? -0.372  1.064   5.768   1.00 0.00 ? 19 ARG A NH2  11 
ATOM   6099  H  H    . ARG A 1 19 ? 4.643   -0.156  0.599   1.00 0.00 ? 19 ARG A H    11 
ATOM   6100  H  HA   . ARG A 1 19 ? 5.628   -0.783  3.252   1.00 0.00 ? 19 ARG A HA   11 
ATOM   6101  H  HB2  . ARG A 1 19 ? 2.980   -0.476  1.960   1.00 0.00 ? 19 ARG A HB2  11 
ATOM   6102  H  HB3  . ARG A 1 19 ? 3.065   -1.607  3.305   1.00 0.00 ? 19 ARG A HB3  11 
ATOM   6103  H  HG2  . ARG A 1 19 ? 3.152   0.026   4.797   1.00 0.00 ? 19 ARG A HG2  11 
ATOM   6104  H  HG3  . ARG A 1 19 ? 4.399   0.891   3.898   1.00 0.00 ? 19 ARG A HG3  11 
ATOM   6105  H  HD2  . ARG A 1 19 ? 2.742   2.416   3.672   1.00 0.00 ? 19 ARG A HD2  11 
ATOM   6106  H  HD3  . ARG A 1 19 ? 2.313   1.385   2.307   1.00 0.00 ? 19 ARG A HD3  11 
ATOM   6107  H  HE   . ARG A 1 19 ? 0.365   0.897   3.373   1.00 0.00 ? 19 ARG A HE   11 
ATOM   6108  H  HH11 . ARG A 1 19 ? 2.678   2.040   5.761   1.00 0.00 ? 19 ARG A HH11 11 
ATOM   6109  H  HH12 . ARG A 1 19 ? 1.554   1.919   7.087   1.00 0.00 ? 19 ARG A HH12 11 
ATOM   6110  H  HH21 . ARG A 1 19 ? -1.105  0.740   5.166   1.00 0.00 ? 19 ARG A HH21 11 
ATOM   6111  H  HH22 . ARG A 1 19 ? -0.553  1.176   6.754   1.00 0.00 ? 19 ARG A HH22 11 
ATOM   6112  N  N    . SER A 1 20 ? 4.247   -3.379  2.927   1.00 0.00 ? 20 SER A N    11 
ATOM   6113  C  CA   . SER A 1 20 ? 4.278   -4.822  2.757   1.00 0.00 ? 20 SER A CA   11 
ATOM   6114  C  C    . SER A 1 20 ? 2.950   -5.458  3.133   1.00 0.00 ? 20 SER A C    11 
ATOM   6115  O  O    . SER A 1 20 ? 2.469   -5.309  4.257   1.00 0.00 ? 20 SER A O    11 
ATOM   6116  C  CB   . SER A 1 20 ? 5.398   -5.443  3.589   1.00 0.00 ? 20 SER A CB   11 
ATOM   6117  O  OG   . SER A 1 20 ? 5.779   -4.597  4.665   1.00 0.00 ? 20 SER A OG   11 
ATOM   6118  H  H    . SER A 1 20 ? 3.579   -2.978  3.529   1.00 0.00 ? 20 SER A H    11 
ATOM   6119  H  HA   . SER A 1 20 ? 4.466   -5.020  1.712   1.00 0.00 ? 20 SER A HA   11 
ATOM   6120  H  HB2  . SER A 1 20 ? 5.055   -6.385  3.987   1.00 0.00 ? 20 SER A HB2  11 
ATOM   6121  H  HB3  . SER A 1 20 ? 6.257   -5.612  2.956   1.00 0.00 ? 20 SER A HB3  11 
ATOM   6122  H  HG   . SER A 1 20 ? 5.058   -3.984  4.865   1.00 0.00 ? 20 SER A HG   11 
ATOM   6123  N  N    . PHE A 1 21 ? 2.370   -6.166  2.178   1.00 0.00 ? 21 PHE A N    11 
ATOM   6124  C  CA   . PHE A 1 21 ? 1.118   -6.869  2.384   1.00 0.00 ? 21 PHE A CA   11 
ATOM   6125  C  C    . PHE A 1 21 ? 1.205   -8.241  1.734   1.00 0.00 ? 21 PHE A C    11 
ATOM   6126  O  O    . PHE A 1 21 ? 1.711   -8.376  0.620   1.00 0.00 ? 21 PHE A O    11 
ATOM   6127  C  CB   . PHE A 1 21 ? -0.057  -6.084  1.787   1.00 0.00 ? 21 PHE A CB   11 
ATOM   6128  C  CG   . PHE A 1 21 ? -0.048  -4.618  2.134   1.00 0.00 ? 21 PHE A CG   11 
ATOM   6129  C  CD1  . PHE A 1 21 ? 0.750   -3.730  1.431   1.00 0.00 ? 21 PHE A CD1  11 
ATOM   6130  C  CD2  . PHE A 1 21 ? -0.835  -4.132  3.163   1.00 0.00 ? 21 PHE A CD2  11 
ATOM   6131  C  CE1  . PHE A 1 21 ? 0.765   -2.389  1.750   1.00 0.00 ? 21 PHE A CE1  11 
ATOM   6132  C  CE2  . PHE A 1 21 ? -0.825  -2.789  3.487   1.00 0.00 ? 21 PHE A CE2  11 
ATOM   6133  C  CZ   . PHE A 1 21 ? -0.021  -1.918  2.778   1.00 0.00 ? 21 PHE A CZ   11 
ATOM   6134  H  H    . PHE A 1 21 ? 2.803   -6.228  1.300   1.00 0.00 ? 21 PHE A H    11 
ATOM   6135  H  HA   . PHE A 1 21 ? 0.967   -6.989  3.447   1.00 0.00 ? 21 PHE A HA   11 
ATOM   6136  H  HB2  . PHE A 1 21 ? -0.026  -6.171  0.711   1.00 0.00 ? 21 PHE A HB2  11 
ATOM   6137  H  HB3  . PHE A 1 21 ? -0.981  -6.507  2.150   1.00 0.00 ? 21 PHE A HB3  11 
ATOM   6138  H  HD1  . PHE A 1 21 ? 1.375   -4.100  0.631   1.00 0.00 ? 21 PHE A HD1  11 
ATOM   6139  H  HD2  . PHE A 1 21 ? -1.464  -4.813  3.717   1.00 0.00 ? 21 PHE A HD2  11 
ATOM   6140  H  HE1  . PHE A 1 21 ? 1.393   -1.706  1.193   1.00 0.00 ? 21 PHE A HE1  11 
ATOM   6141  H  HE2  . PHE A 1 21 ? -1.443  -2.422  4.295   1.00 0.00 ? 21 PHE A HE2  11 
ATOM   6142  H  HZ   . PHE A 1 21 ? -0.006  -0.870  3.031   1.00 0.00 ? 21 PHE A HZ   11 
ATOM   6143  N  N    . SER A 1 22 ? 0.764   -9.260  2.446   1.00 0.00 ? 22 SER A N    11 
ATOM   6144  C  CA   . SER A 1 22 ? 0.810   -10.620 1.934   1.00 0.00 ? 22 SER A CA   11 
ATOM   6145  C  C    . SER A 1 22 ? -0.405  -10.879 1.048   1.00 0.00 ? 22 SER A C    11 
ATOM   6146  O  O    . SER A 1 22 ? -0.389  -11.751 0.180   1.00 0.00 ? 22 SER A O    11 
ATOM   6147  C  CB   . SER A 1 22 ? 0.843   -11.609 3.097   1.00 0.00 ? 22 SER A CB   11 
ATOM   6148  O  OG   . SER A 1 22 ? 0.764   -10.931 4.343   1.00 0.00 ? 22 SER A OG   11 
ATOM   6149  H  H    . SER A 1 22 ? 0.396   -9.097  3.345   1.00 0.00 ? 22 SER A H    11 
ATOM   6150  H  HA   . SER A 1 22 ? 1.714   -10.728 1.344   1.00 0.00 ? 22 SER A HA   11 
ATOM   6151  H  HB2  . SER A 1 22 ? 0.003   -12.284 3.014   1.00 0.00 ? 22 SER A HB2  11 
ATOM   6152  H  HB3  . SER A 1 22 ? 1.763   -12.173 3.062   1.00 0.00 ? 22 SER A HB3  11 
ATOM   6153  H  HG   . SER A 1 22 ? 1.636   -10.949 4.771   1.00 0.00 ? 22 SER A HG   11 
ATOM   6154  N  N    . ARG A 1 23 ? -1.433  -10.066 1.244   1.00 0.00 ? 23 ARG A N    11 
ATOM   6155  C  CA   . ARG A 1 23 ? -2.643  -10.137 0.441   1.00 0.00 ? 23 ARG A CA   11 
ATOM   6156  C  C    . ARG A 1 23 ? -2.732  -8.937  -0.480  1.00 0.00 ? 23 ARG A C    11 
ATOM   6157  O  O    . ARG A 1 23 ? -2.604  -7.796  -0.028  1.00 0.00 ? 23 ARG A O    11 
ATOM   6158  C  CB   . ARG A 1 23 ? -3.879  -10.156 1.340   1.00 0.00 ? 23 ARG A CB   11 
ATOM   6159  C  CG   . ARG A 1 23 ? -4.180  -11.500 1.967   1.00 0.00 ? 23 ARG A CG   11 
ATOM   6160  C  CD   . ARG A 1 23 ? -5.566  -11.973 1.574   1.00 0.00 ? 23 ARG A CD   11 
ATOM   6161  N  NE   . ARG A 1 23 ? -6.616  -11.064 2.041   1.00 0.00 ? 23 ARG A NE   11 
ATOM   6162  C  CZ   . ARG A 1 23 ? -7.804  -11.465 2.494   1.00 0.00 ? 23 ARG A CZ   11 
ATOM   6163  N  NH1  . ARG A 1 23 ? -8.102  -12.757 2.551   1.00 0.00 ? 23 ARG A NH1  11 
ATOM   6164  N  NH2  . ARG A 1 23 ? -8.697  -10.566 2.877   1.00 0.00 ? 23 ARG A NH2  11 
ATOM   6165  H  H    . ARG A 1 23 ? -1.358  -9.368  1.927   1.00 0.00 ? 23 ARG A H    11 
ATOM   6166  H  HA   . ARG A 1 23 ? -2.614  -11.038 -0.152  1.00 0.00 ? 23 ARG A HA   11 
ATOM   6167  H  HB2  . ARG A 1 23 ? -3.742  -9.441  2.132   1.00 0.00 ? 23 ARG A HB2  11 
ATOM   6168  H  HB3  . ARG A 1 23 ? -4.736  -9.859  0.751   1.00 0.00 ? 23 ARG A HB3  11 
ATOM   6169  H  HG2  . ARG A 1 23 ? -3.450  -12.220 1.624   1.00 0.00 ? 23 ARG A HG2  11 
ATOM   6170  H  HG3  . ARG A 1 23 ? -4.128  -11.406 3.041   1.00 0.00 ? 23 ARG A HG3  11 
ATOM   6171  H  HD2  . ARG A 1 23 ? -5.611  -12.032 0.501   1.00 0.00 ? 23 ARG A HD2  11 
ATOM   6172  H  HD3  . ARG A 1 23 ? -5.734  -12.953 1.998   1.00 0.00 ? 23 ARG A HD3  11 
ATOM   6173  H  HE   . ARG A 1 23 ? -6.428  -10.103 2.007   1.00 0.00 ? 23 ARG A HE   11 
ATOM   6174  H  HH11 . ARG A 1 23 ? -7.436  -13.447 2.245   1.00 0.00 ? 23 ARG A HH11 11 
ATOM   6175  H  HH12 . ARG A 1 23 ? -8.995  -13.057 2.914   1.00 0.00 ? 23 ARG A HH12 11 
ATOM   6176  H  HH21 . ARG A 1 23 ? -8.483  -9.581  2.826   1.00 0.00 ? 23 ARG A HH21 11 
ATOM   6177  H  HH22 . ARG A 1 23 ? -9.602  -10.860 3.210   1.00 0.00 ? 23 ARG A HH22 11 
ATOM   6178  N  N    . SER A 1 24 ? -3.080  -9.184  -1.733  1.00 0.00 ? 24 SER A N    11 
ATOM   6179  C  CA   . SER A 1 24 ? -3.333  -8.104  -2.675  1.00 0.00 ? 24 SER A CA   11 
ATOM   6180  C  C    . SER A 1 24 ? -4.533  -7.281  -2.203  1.00 0.00 ? 24 SER A C    11 
ATOM   6181  O  O    . SER A 1 24 ? -4.599  -6.069  -2.409  1.00 0.00 ? 24 SER A O    11 
ATOM   6182  C  CB   . SER A 1 24 ? -3.589  -8.673  -4.070  1.00 0.00 ? 24 SER A CB   11 
ATOM   6183  O  OG   . SER A 1 24 ? -2.794  -8.017  -5.050  1.00 0.00 ? 24 SER A OG   11 
ATOM   6184  H  H    . SER A 1 24 ? -3.240  -10.115 -2.014  1.00 0.00 ? 24 SER A H    11 
ATOM   6185  H  HA   . SER A 1 24 ? -2.457  -7.471  -2.702  1.00 0.00 ? 24 SER A HA   11 
ATOM   6186  H  HB2  . SER A 1 24 ? -3.346  -9.724  -4.074  1.00 0.00 ? 24 SER A HB2  11 
ATOM   6187  H  HB3  . SER A 1 24 ? -4.630  -8.544  -4.320  1.00 0.00 ? 24 SER A HB3  11 
ATOM   6188  H  HG   . SER A 1 24 ? -2.864  -7.057  -4.931  1.00 0.00 ? 24 SER A HG   11 
ATOM   6189  N  N    . ASP A 1 25 ? -5.429  -7.944  -1.481  1.00 0.00 ? 25 ASP A N    11 
ATOM   6190  C  CA   . ASP A 1 25 ? -6.585  -7.296  -0.879  1.00 0.00 ? 25 ASP A CA   11 
ATOM   6191  C  C    . ASP A 1 25 ? -6.139  -6.270  0.154   1.00 0.00 ? 25 ASP A C    11 
ATOM   6192  O  O    . ASP A 1 25 ? -6.590  -5.122  0.150   1.00 0.00 ? 25 ASP A O    11 
ATOM   6193  C  CB   . ASP A 1 25 ? -7.475  -8.349  -0.218  1.00 0.00 ? 25 ASP A CB   11 
ATOM   6194  C  CG   . ASP A 1 25 ? -8.273  -7.810  0.955   1.00 0.00 ? 25 ASP A CG   11 
ATOM   6195  O  OD1  . ASP A 1 25 ? -9.304  -7.143  0.722   1.00 0.00 ? 25 ASP A OD1  11 
ATOM   6196  O  OD2  . ASP A 1 25 ? -7.877  -8.067  2.113   1.00 0.00 ? 25 ASP A OD2  11 
ATOM   6197  H  H    . ASP A 1 25 ? -5.286  -8.905  -1.316  1.00 0.00 ? 25 ASP A H    11 
ATOM   6198  H  HA   . ASP A 1 25 ? -7.137  -6.797  -1.660  1.00 0.00 ? 25 ASP A HA   11 
ATOM   6199  H  HB2  . ASP A 1 25 ? -8.163  -8.732  -0.948  1.00 0.00 ? 25 ASP A HB2  11 
ATOM   6200  H  HB3  . ASP A 1 25 ? -6.854  -9.159  0.139   1.00 0.00 ? 25 ASP A HB3  11 
ATOM   6201  N  N    . HIS A 1 26 ? -5.219  -6.695  1.011   1.00 0.00 ? 26 HIS A N    11 
ATOM   6202  C  CA   . HIS A 1 26 ? -4.664  -5.833  2.052   1.00 0.00 ? 26 HIS A CA   11 
ATOM   6203  C  C    . HIS A 1 26 ? -3.989  -4.612  1.439   1.00 0.00 ? 26 HIS A C    11 
ATOM   6204  O  O    . HIS A 1 26 ? -4.156  -3.493  1.928   1.00 0.00 ? 26 HIS A O    11 
ATOM   6205  C  CB   . HIS A 1 26 ? -3.665  -6.609  2.916   1.00 0.00 ? 26 HIS A CB   11 
ATOM   6206  C  CG   . HIS A 1 26 ? -4.202  -6.968  4.267   1.00 0.00 ? 26 HIS A CG   11 
ATOM   6207  N  ND1  . HIS A 1 26 ? -3.472  -6.843  5.429   1.00 0.00 ? 26 HIS A ND1  11 
ATOM   6208  C  CD2  . HIS A 1 26 ? -5.411  -7.450  4.635   1.00 0.00 ? 26 HIS A CD2  11 
ATOM   6209  C  CE1  . HIS A 1 26 ? -4.208  -7.232  6.450   1.00 0.00 ? 26 HIS A CE1  11 
ATOM   6210  N  NE2  . HIS A 1 26 ? -5.388  -7.605  5.996   1.00 0.00 ? 26 HIS A NE2  11 
ATOM   6211  H  H    . HIS A 1 26 ? -4.899  -7.614  0.931   1.00 0.00 ? 26 HIS A H    11 
ATOM   6212  H  HA   . HIS A 1 26 ? -5.481  -5.498  2.673   1.00 0.00 ? 26 HIS A HA   11 
ATOM   6213  H  HB2  . HIS A 1 26 ? -3.396  -7.525  2.411   1.00 0.00 ? 26 HIS A HB2  11 
ATOM   6214  H  HB3  . HIS A 1 26 ? -2.780  -6.008  3.059   1.00 0.00 ? 26 HIS A HB3  11 
ATOM   6215  H  HD1  . HIS A 1 26 ? -2.539  -6.528  5.495   1.00 0.00 ? 26 HIS A HD1  11 
ATOM   6216  H  HD2  . HIS A 1 26 ? -6.237  -7.680  3.975   1.00 0.00 ? 26 HIS A HD2  11 
ATOM   6217  H  HE1  . HIS A 1 26 ? -3.897  -7.242  7.484   1.00 0.00 ? 26 HIS A HE1  11 
ATOM   6218  H  HE2  . HIS A 1 26 ? -6.164  -7.846  6.560   1.00 0.00 ? 26 HIS A HE2  11 
ATOM   6219  N  N    . LEU A 1 27 ? -3.313  -4.825  0.313   1.00 0.00 ? 27 LEU A N    11 
ATOM   6220  C  CA   . LEU A 1 27 ? -2.709  -3.737  -0.447  1.00 0.00 ? 27 LEU A CA   11 
ATOM   6221  C  C    . LEU A 1 27 ? -3.765  -2.692  -0.790  1.00 0.00 ? 27 LEU A C    11 
ATOM   6222  O  O    . LEU A 1 27 ? -3.649  -1.519  -0.417  1.00 0.00 ? 27 LEU A O    11 
ATOM   6223  C  CB   . LEU A 1 27 ? -2.102  -4.273  -1.746  1.00 0.00 ? 27 LEU A CB   11 
ATOM   6224  C  CG   . LEU A 1 27 ? -1.124  -3.336  -2.466  1.00 0.00 ? 27 LEU A CG   11 
ATOM   6225  C  CD1  . LEU A 1 27 ? -0.593  -2.255  -1.536  1.00 0.00 ? 27 LEU A CD1  11 
ATOM   6226  C  CD2  . LEU A 1 27 ? 0.018   -4.124  -3.078  1.00 0.00 ? 27 LEU A CD2  11 
ATOM   6227  H  H    . LEU A 1 27 ? -3.278  -5.735  -0.055  1.00 0.00 ? 27 LEU A H    11 
ATOM   6228  H  HA   . LEU A 1 27 ? -1.936  -3.285  0.156   1.00 0.00 ? 27 LEU A HA   11 
ATOM   6229  H  HB2  . LEU A 1 27 ? -1.581  -5.191  -1.517  1.00 0.00 ? 27 LEU A HB2  11 
ATOM   6230  H  HB3  . LEU A 1 27 ? -2.910  -4.501  -2.425  1.00 0.00 ? 27 LEU A HB3  11 
ATOM   6231  H  HG   . LEU A 1 27 ? -1.655  -2.844  -3.270  1.00 0.00 ? 27 LEU A HG   11 
ATOM   6232  H  HD11 . LEU A 1 27 ? 0.077   -2.702  -0.812  1.00 0.00 ? 27 LEU A HD11 11 
ATOM   6233  H  HD12 . LEU A 1 27 ? -0.059  -1.515  -2.113  1.00 0.00 ? 27 LEU A HD12 11 
ATOM   6234  H  HD13 . LEU A 1 27 ? -1.420  -1.785  -1.021  1.00 0.00 ? 27 LEU A HD13 11 
ATOM   6235  H  HD21 . LEU A 1 27 ? 0.839   -4.172  -2.378  1.00 0.00 ? 27 LEU A HD21 11 
ATOM   6236  H  HD22 . LEU A 1 27 ? -0.316  -5.125  -3.309  1.00 0.00 ? 27 LEU A HD22 11 
ATOM   6237  H  HD23 . LEU A 1 27 ? 0.346   -3.636  -3.984  1.00 0.00 ? 27 LEU A HD23 11 
ATOM   6238  N  N    . ALA A 1 28 ? -4.778  -3.132  -1.526  1.00 0.00 ? 28 ALA A N    11 
ATOM   6239  C  CA   . ALA A 1 28 ? -5.850  -2.258  -1.979  1.00 0.00 ? 28 ALA A CA   11 
ATOM   6240  C  C    . ALA A 1 28 ? -6.521  -1.528  -0.819  1.00 0.00 ? 28 ALA A C    11 
ATOM   6241  O  O    . ALA A 1 28 ? -6.881  -0.360  -0.950  1.00 0.00 ? 28 ALA A O    11 
ATOM   6242  C  CB   . ALA A 1 28 ? -6.878  -3.056  -2.766  1.00 0.00 ? 28 ALA A CB   11 
ATOM   6243  H  H    . ALA A 1 28 ? -4.774  -4.071  -1.819  1.00 0.00 ? 28 ALA A H    11 
ATOM   6244  H  HA   . ALA A 1 28 ? -5.414  -1.524  -2.646  1.00 0.00 ? 28 ALA A HA   11 
ATOM   6245  H  HB1  . ALA A 1 28 ? -6.661  -2.976  -3.821  1.00 0.00 ? 28 ALA A HB1  11 
ATOM   6246  H  HB2  . ALA A 1 28 ? -6.835  -4.094  -2.468  1.00 0.00 ? 28 ALA A HB2  11 
ATOM   6247  H  HB3  . ALA A 1 28 ? -7.865  -2.665  -2.569  1.00 0.00 ? 28 ALA A HB3  11 
ATOM   6248  N  N    . LEU A 1 29 ? -6.668  -2.214  0.314   1.00 0.00 ? 29 LEU A N    11 
ATOM   6249  C  CA   . LEU A 1 29 ? -7.284  -1.622  1.499   1.00 0.00 ? 29 LEU A CA   11 
ATOM   6250  C  C    . LEU A 1 29 ? -6.527  -0.379  1.953   1.00 0.00 ? 29 LEU A C    11 
ATOM   6251  O  O    . LEU A 1 29 ? -7.127  0.661   2.236   1.00 0.00 ? 29 LEU A O    11 
ATOM   6252  C  CB   . LEU A 1 29 ? -7.335  -2.633  2.643   1.00 0.00 ? 29 LEU A CB   11 
ATOM   6253  C  CG   . LEU A 1 29 ? -8.310  -3.794  2.449   1.00 0.00 ? 29 LEU A CG   11 
ATOM   6254  C  CD1  . LEU A 1 29 ? -8.050  -4.879  3.480   1.00 0.00 ? 29 LEU A CD1  11 
ATOM   6255  C  CD2  . LEU A 1 29 ? -9.747  -3.302  2.533   1.00 0.00 ? 29 LEU A CD2  11 
ATOM   6256  H  H    . LEU A 1 29 ? -6.346  -3.143  0.358   1.00 0.00 ? 29 LEU A H    11 
ATOM   6257  H  HA   . LEU A 1 29 ? -8.291  -1.339  1.242   1.00 0.00 ? 29 LEU A HA   11 
ATOM   6258  H  HB2  . LEU A 1 29 ? -6.344  -3.039  2.780   1.00 0.00 ? 29 LEU A HB2  11 
ATOM   6259  H  HB3  . LEU A 1 29 ? -7.616  -2.104  3.539   1.00 0.00 ? 29 LEU A HB3  11 
ATOM   6260  H  HG   . LEU A 1 29 ? -8.157  -4.223  1.468   1.00 0.00 ? 29 LEU A HG   11 
ATOM   6261  H  HD11 . LEU A 1 29 ? -7.048  -5.266  3.349   1.00 0.00 ? 29 LEU A HD11 11 
ATOM   6262  H  HD12 . LEU A 1 29 ? -8.148  -4.465  4.474   1.00 0.00 ? 29 LEU A HD12 11 
ATOM   6263  H  HD13 . LEU A 1 29 ? -8.766  -5.680  3.351   1.00 0.00 ? 29 LEU A HD13 11 
ATOM   6264  H  HD21 . LEU A 1 29 ? -10.421 -4.133  2.383   1.00 0.00 ? 29 LEU A HD21 11 
ATOM   6265  H  HD22 . LEU A 1 29 ? -9.923  -2.864  3.504   1.00 0.00 ? 29 LEU A HD22 11 
ATOM   6266  H  HD23 . LEU A 1 29 ? -9.917  -2.560  1.767   1.00 0.00 ? 29 LEU A HD23 11 
ATOM   6267  N  N    . HIS A 1 30 ? -5.205  -0.472  1.983   1.00 0.00 ? 30 HIS A N    11 
ATOM   6268  C  CA   . HIS A 1 30 ? -4.380  0.663   2.366   1.00 0.00 ? 30 HIS A CA   11 
ATOM   6269  C  C    . HIS A 1 30 ? -4.399  1.717   1.265   1.00 0.00 ? 30 HIS A C    11 
ATOM   6270  O  O    . HIS A 1 30 ? -4.345  2.917   1.529   1.00 0.00 ? 30 HIS A O    11 
ATOM   6271  C  CB   . HIS A 1 30 ? -2.933  0.215   2.653   1.00 0.00 ? 30 HIS A CB   11 
ATOM   6272  C  CG   . HIS A 1 30 ? -1.905  1.284   2.406   1.00 0.00 ? 30 HIS A CG   11 
ATOM   6273  N  ND1  . HIS A 1 30 ? -1.786  2.420   3.168   1.00 0.00 ? 30 HIS A ND1  11 
ATOM   6274  C  CD2  . HIS A 1 30 ? -0.984  1.399   1.415   1.00 0.00 ? 30 HIS A CD2  11 
ATOM   6275  C  CE1  . HIS A 1 30 ? -0.824  3.179   2.626   1.00 0.00 ? 30 HIS A CE1  11 
ATOM   6276  N  NE2  . HIS A 1 30 ? -0.301  2.605   1.556   1.00 0.00 ? 30 HIS A NE2  11 
ATOM   6277  H  H    . HIS A 1 30 ? -4.775  -1.313  1.710   1.00 0.00 ? 30 HIS A H    11 
ATOM   6278  H  HA   . HIS A 1 30 ? -4.803  1.090   3.263   1.00 0.00 ? 30 HIS A HA   11 
ATOM   6279  H  HB2  . HIS A 1 30 ? -2.857  -0.084  3.688   1.00 0.00 ? 30 HIS A HB2  11 
ATOM   6280  H  HB3  . HIS A 1 30 ? -2.691  -0.628  2.025   1.00 0.00 ? 30 HIS A HB3  11 
ATOM   6281  H  HD1  . HIS A 1 30 ? -2.339  2.655   3.953   1.00 0.00 ? 30 HIS A HD1  11 
ATOM   6282  H  HD2  . HIS A 1 30 ? -0.802  0.675   0.633   1.00 0.00 ? 30 HIS A HD2  11 
ATOM   6283  H  HE1  . HIS A 1 30 ? -0.514  4.137   3.014   1.00 0.00 ? 30 HIS A HE1  11 
ATOM   6284  N  N    . ARG A 1 31 ? -4.428  1.254   0.028   1.00 0.00 ? 31 ARG A N    11 
ATOM   6285  C  CA   . ARG A 1 31 ? -4.338  2.142   -1.118  1.00 0.00 ? 31 ARG A CA   11 
ATOM   6286  C  C    . ARG A 1 31 ? -5.642  2.897   -1.352  1.00 0.00 ? 31 ARG A C    11 
ATOM   6287  O  O    . ARG A 1 31 ? -5.753  3.671   -2.299  1.00 0.00 ? 31 ARG A O    11 
ATOM   6288  C  CB   . ARG A 1 31 ? -3.961  1.356   -2.366  1.00 0.00 ? 31 ARG A CB   11 
ATOM   6289  C  CG   . ARG A 1 31 ? -2.538  0.833   -2.330  1.00 0.00 ? 31 ARG A CG   11 
ATOM   6290  C  CD   . ARG A 1 31 ? -1.973  0.643   -3.724  1.00 0.00 ? 31 ARG A CD   11 
ATOM   6291  N  NE   . ARG A 1 31 ? -1.441  1.890   -4.274  1.00 0.00 ? 31 ARG A NE   11 
ATOM   6292  C  CZ   . ARG A 1 31 ? -1.960  2.523   -5.329  1.00 0.00 ? 31 ARG A CZ   11 
ATOM   6293  N  NH1  . ARG A 1 31 ? -3.108  2.117   -5.854  1.00 0.00 ? 31 ARG A NH1  11 
ATOM   6294  N  NH2  . ARG A 1 31 ? -1.344  3.583   -5.840  1.00 0.00 ? 31 ARG A NH2  11 
ATOM   6295  H  H    . ARG A 1 31 ? -4.462  0.281   -0.119  1.00 0.00 ? 31 ARG A H    11 
ATOM   6296  H  HA   . ARG A 1 31 ? -3.547  2.854   -0.911  1.00 0.00 ? 31 ARG A HA   11 
ATOM   6297  H  HB2  . ARG A 1 31 ? -4.632  0.516   -2.467  1.00 0.00 ? 31 ARG A HB2  11 
ATOM   6298  H  HB3  . ARG A 1 31 ? -4.069  2.002   -3.225  1.00 0.00 ? 31 ARG A HB3  11 
ATOM   6299  H  HG2  . ARG A 1 31 ? -1.920  1.539   -1.798  1.00 0.00 ? 31 ARG A HG2  11 
ATOM   6300  H  HG3  . ARG A 1 31 ? -2.527  -0.115  -1.813  1.00 0.00 ? 31 ARG A HG3  11 
ATOM   6301  H  HD2  . ARG A 1 31 ? -1.171  -0.082  -3.675  1.00 0.00 ? 31 ARG A HD2  11 
ATOM   6302  H  HD3  . ARG A 1 31 ? -2.754  0.274   -4.371  1.00 0.00 ? 31 ARG A HD3  11 
ATOM   6303  H  HE   . ARG A 1 31 ? -0.627  2.244   -3.859  1.00 0.00 ? 31 ARG A HE   11 
ATOM   6304  H  HH11 . ARG A 1 31 ? -3.598  1.333   -5.459  1.00 0.00 ? 31 ARG A HH11 11 
ATOM   6305  H  HH12 . ARG A 1 31 ? -3.488  2.577   -6.667  1.00 0.00 ? 31 ARG A HH12 11 
ATOM   6306  H  HH21 . ARG A 1 31 ? -0.477  3.907   -5.448  1.00 0.00 ? 31 ARG A HH21 11 
ATOM   6307  H  HH22 . ARG A 1 31 ? -1.737  4.066   -6.636  1.00 0.00 ? 31 ARG A HH22 11 
ATOM   6308  N  N    . LYS A 1 32 ? -6.618  2.679   -0.478  1.00 0.00 ? 32 LYS A N    11 
ATOM   6309  C  CA   . LYS A 1 32 ? -7.907  3.353   -0.582  1.00 0.00 ? 32 LYS A CA   11 
ATOM   6310  C  C    . LYS A 1 32 ? -7.733  4.863   -0.521  1.00 0.00 ? 32 LYS A C    11 
ATOM   6311  O  O    . LYS A 1 32 ? -8.396  5.602   -1.247  1.00 0.00 ? 32 LYS A O    11 
ATOM   6312  C  CB   . LYS A 1 32 ? -8.842  2.893   0.538   1.00 0.00 ? 32 LYS A CB   11 
ATOM   6313  C  CG   . LYS A 1 32 ? -10.062 2.138   0.040   1.00 0.00 ? 32 LYS A CG   11 
ATOM   6314  C  CD   . LYS A 1 32 ? -9.664  0.899   -0.744  1.00 0.00 ? 32 LYS A CD   11 
ATOM   6315  C  CE   . LYS A 1 32 ? -10.648 0.612   -1.869  1.00 0.00 ? 32 LYS A CE   11 
ATOM   6316  N  NZ   . LYS A 1 32 ? -10.119 1.014   -3.202  1.00 0.00 ? 32 LYS A NZ   11 
ATOM   6317  H  H    . LYS A 1 32 ? -6.469  2.048   0.256   1.00 0.00 ? 32 LYS A H    11 
ATOM   6318  H  HA   . LYS A 1 32 ? -8.343  3.091   -1.532  1.00 0.00 ? 32 LYS A HA   11 
ATOM   6319  H  HB2  . LYS A 1 32 ? -8.293  2.247   1.206   1.00 0.00 ? 32 LYS A HB2  11 
ATOM   6320  H  HB3  . LYS A 1 32 ? -9.181  3.759   1.087   1.00 0.00 ? 32 LYS A HB3  11 
ATOM   6321  H  HG2  . LYS A 1 32 ? -10.660 1.840   0.887   1.00 0.00 ? 32 LYS A HG2  11 
ATOM   6322  H  HG3  . LYS A 1 32 ? -10.639 2.789   -0.601  1.00 0.00 ? 32 LYS A HG3  11 
ATOM   6323  H  HD2  . LYS A 1 32 ? -8.680  1.053   -1.166  1.00 0.00 ? 32 LYS A HD2  11 
ATOM   6324  H  HD3  . LYS A 1 32 ? -9.640  0.054   -0.072  1.00 0.00 ? 32 LYS A HD3  11 
ATOM   6325  H  HE2  . LYS A 1 32 ? -10.859 -0.447  -1.881  1.00 0.00 ? 32 LYS A HE2  11 
ATOM   6326  H  HE3  . LYS A 1 32 ? -11.560 1.156   -1.675  1.00 0.00 ? 32 LYS A HE3  11 
ATOM   6327  H  HZ1  . LYS A 1 32 ? -9.081  0.906   -3.231  1.00 0.00 ? 32 LYS A HZ1  11 
ATOM   6328  H  HZ2  . LYS A 1 32 ? -10.357 2.011   -3.399  1.00 0.00 ? 32 LYS A HZ2  11 
ATOM   6329  H  HZ3  . LYS A 1 32 ? -10.538 0.419   -3.947  1.00 0.00 ? 32 LYS A HZ3  11 
ATOM   6330  N  N    . ARG A 1 33 ? -6.824  5.316   0.336   1.00 0.00 ? 33 ARG A N    11 
ATOM   6331  C  CA   . ARG A 1 33 ? -6.565  6.738   0.495   1.00 0.00 ? 33 ARG A CA   11 
ATOM   6332  C  C    . ARG A 1 33 ? -5.582  7.251   -0.553  1.00 0.00 ? 33 ARG A C    11 
ATOM   6333  O  O    . ARG A 1 33 ? -5.171  8.409   -0.514  1.00 0.00 ? 33 ARG A O    11 
ATOM   6334  C  CB   . ARG A 1 33 ? -6.027  7.028   1.896   1.00 0.00 ? 33 ARG A CB   11 
ATOM   6335  C  CG   . ARG A 1 33 ? -6.796  8.115   2.620   1.00 0.00 ? 33 ARG A CG   11 
ATOM   6336  C  CD   . ARG A 1 33 ? -6.175  8.431   3.967   1.00 0.00 ? 33 ARG A CD   11 
ATOM   6337  N  NE   . ARG A 1 33 ? -5.337  9.627   3.922   1.00 0.00 ? 33 ARG A NE   11 
ATOM   6338  C  CZ   . ARG A 1 33 ? -4.027  9.632   4.174   1.00 0.00 ? 33 ARG A CZ   11 
ATOM   6339  N  NH1  . ARG A 1 33 ? -3.400  8.504   4.496   1.00 0.00 ? 33 ARG A NH1  11 
ATOM   6340  N  NH2  . ARG A 1 33 ? -3.346  10.770  4.113   1.00 0.00 ? 33 ARG A NH2  11 
ATOM   6341  H  H    . ARG A 1 33 ? -6.326  4.678   0.889   1.00 0.00 ? 33 ARG A H    11 
ATOM   6342  H  HA   . ARG A 1 33 ? -7.505  7.258   0.371   1.00 0.00 ? 33 ARG A HA   11 
ATOM   6343  H  HB2  . ARG A 1 33 ? -6.080  6.124   2.483   1.00 0.00 ? 33 ARG A HB2  11 
ATOM   6344  H  HB3  . ARG A 1 33 ? -4.995  7.337   1.818   1.00 0.00 ? 33 ARG A HB3  11 
ATOM   6345  H  HG2  . ARG A 1 33 ? -6.796  9.009   2.015   1.00 0.00 ? 33 ARG A HG2  11 
ATOM   6346  H  HG3  . ARG A 1 33 ? -7.811  7.779   2.769   1.00 0.00 ? 33 ARG A HG3  11 
ATOM   6347  H  HD2  . ARG A 1 33 ? -6.965  8.582   4.688   1.00 0.00 ? 33 ARG A HD2  11 
ATOM   6348  H  HD3  . ARG A 1 33 ? -5.569  7.590   4.272   1.00 0.00 ? 33 ARG A HD3  11 
ATOM   6349  H  HE   . ARG A 1 33 ? -5.782  10.480  3.688   1.00 0.00 ? 33 ARG A HE   11 
ATOM   6350  H  HH11 . ARG A 1 33 ? -3.911  7.637   4.553   1.00 0.00 ? 33 ARG A HH11 11 
ATOM   6351  H  HH12 . ARG A 1 33 ? -2.410  8.510   4.682   1.00 0.00 ? 33 ARG A HH12 11 
ATOM   6352  H  HH21 . ARG A 1 33 ? -3.812  11.634  3.877   1.00 0.00 ? 33 ARG A HH21 11 
ATOM   6353  H  HH22 . ARG A 1 33 ? -2.357  10.781  4.298   1.00 0.00 ? 33 ARG A HH22 11 
ATOM   6354  N  N    . HIS A 1 34 ? -5.228  6.401   -1.510  1.00 0.00 ? 34 HIS A N    11 
ATOM   6355  C  CA   . HIS A 1 34 ? -4.332  6.811   -2.579  1.00 0.00 ? 34 HIS A CA   11 
ATOM   6356  C  C    . HIS A 1 34 ? -5.131  7.284   -3.788  1.00 0.00 ? 34 HIS A C    11 
ATOM   6357  O  O    . HIS A 1 34 ? -4.570  7.776   -4.769  1.00 0.00 ? 34 HIS A O    11 
ATOM   6358  C  CB   . HIS A 1 34 ? -3.385  5.673   -2.964  1.00 0.00 ? 34 HIS A CB   11 
ATOM   6359  C  CG   . HIS A 1 34 ? -2.228  5.524   -2.022  1.00 0.00 ? 34 HIS A CG   11 
ATOM   6360  N  ND1  . HIS A 1 34 ? -1.440  6.570   -1.606  1.00 0.00 ? 34 HIS A ND1  11 
ATOM   6361  C  CD2  . HIS A 1 34 ? -1.743  4.421   -1.397  1.00 0.00 ? 34 HIS A CD2  11 
ATOM   6362  C  CE1  . HIS A 1 34 ? -0.522  6.081   -0.760  1.00 0.00 ? 34 HIS A CE1  11 
ATOM   6363  N  NE2  . HIS A 1 34 ? -0.660  4.779   -0.598  1.00 0.00 ? 34 HIS A NE2  11 
ATOM   6364  H  H    . HIS A 1 34 ? -5.597  5.490   -1.513  1.00 0.00 ? 34 HIS A H    11 
ATOM   6365  H  HA   . HIS A 1 34 ? -3.747  7.640   -2.209  1.00 0.00 ? 34 HIS A HA   11 
ATOM   6366  H  HB2  . HIS A 1 34 ? -3.934  4.743   -2.973  1.00 0.00 ? 34 HIS A HB2  11 
ATOM   6367  H  HB3  . HIS A 1 34 ? -2.988  5.860   -3.950  1.00 0.00 ? 34 HIS A HB3  11 
ATOM   6368  H  HD1  . HIS A 1 34 ? -1.524  7.509   -1.890  1.00 0.00 ? 34 HIS A HD1  11 
ATOM   6369  H  HD2  . HIS A 1 34 ? -2.124  3.415   -1.497  1.00 0.00 ? 34 HIS A HD2  11 
ATOM   6370  H  HE1  . HIS A 1 34 ? 0.233   6.680   -0.271  1.00 0.00 ? 34 HIS A HE1  11 
ATOM   6371  N  N    . MET A 1 35 ? -6.450  7.234   -3.657  1.00 0.00 ? 35 MET A N    11 
ATOM   6372  C  CA   . MET A 1 35 ? -7.342  7.768   -4.671  1.00 0.00 ? 35 MET A CA   11 
ATOM   6373  C  C    . MET A 1 35 ? -7.339  9.288   -4.597  1.00 0.00 ? 35 MET A C    11 
ATOM   6374  O  O    . MET A 1 35 ? -7.011  9.976   -5.565  1.00 0.00 ? 35 MET A O    11 
ATOM   6375  C  CB   . MET A 1 35 ? -8.761  7.237   -4.460  1.00 0.00 ? 35 MET A CB   11 
ATOM   6376  C  CG   . MET A 1 35 ? -9.139  6.126   -5.417  1.00 0.00 ? 35 MET A CG   11 
ATOM   6377  S  SD   . MET A 1 35 ? -10.832 6.272   -6.026  1.00 0.00 ? 35 MET A SD   11 
ATOM   6378  C  CE   . MET A 1 35 ? -10.700 7.739   -7.046  1.00 0.00 ? 35 MET A CE   11 
ATOM   6379  H  H    . MET A 1 35 ? -6.832  6.901   -2.820  1.00 0.00 ? 35 MET A H    11 
ATOM   6380  H  HA   . MET A 1 35 ? -6.982  7.459   -5.641  1.00 0.00 ? 35 MET A HA   11 
ATOM   6381  H  HB2  . MET A 1 35 ? -8.846  6.857   -3.451  1.00 0.00 ? 35 MET A HB2  11 
ATOM   6382  H  HB3  . MET A 1 35 ? -9.462  8.048   -4.589  1.00 0.00 ? 35 MET A HB3  11 
ATOM   6383  H  HG2  . MET A 1 35 ? -8.462  6.152   -6.257  1.00 0.00 ? 35 MET A HG2  11 
ATOM   6384  H  HG3  . MET A 1 35 ? -9.035  5.180   -4.906  1.00 0.00 ? 35 MET A HG3  11 
ATOM   6385  H  HE1  . MET A 1 35 ? -11.361 7.648   -7.894  1.00 0.00 ? 35 MET A HE1  11 
ATOM   6386  H  HE2  . MET A 1 35 ? -10.975 8.608   -6.466  1.00 0.00 ? 35 MET A HE2  11 
ATOM   6387  H  HE3  . MET A 1 35 ? -9.683  7.846   -7.394  1.00 0.00 ? 35 MET A HE3  11 
ATOM   6388  N  N    . LEU A 1 36 ? -7.628  9.793   -3.411  1.00 0.00 ? 36 LEU A N    11 
ATOM   6389  C  CA   . LEU A 1 36 ? -7.605  11.204  -3.136  1.00 0.00 ? 36 LEU A CA   11 
ATOM   6390  C  C    . LEU A 1 36 ? -7.051  11.428  -1.733  1.00 0.00 ? 36 LEU A C    11 
ATOM   6391  O  O    . LEU A 1 36 ? -7.676  11.054  -0.736  1.00 0.00 ? 36 LEU A O    11 
ATOM   6392  C  CB   . LEU A 1 36 ? -9.019  11.776  -3.272  1.00 0.00 ? 36 LEU A CB   11 
ATOM   6393  C  CG   . LEU A 1 36 ? -9.373  12.851  -2.258  1.00 0.00 ? 36 LEU A CG   11 
ATOM   6394  C  CD1  . LEU A 1 36 ? -8.835  14.204  -2.688  1.00 0.00 ? 36 LEU A CD1  11 
ATOM   6395  C  CD2  . LEU A 1 36 ? -10.874 12.912  -2.050  1.00 0.00 ? 36 LEU A CD2  11 
ATOM   6396  H  H    . LEU A 1 36 ? -7.839  9.187   -2.665  1.00 0.00 ? 36 LEU A H    11 
ATOM   6397  H  HA   . LEU A 1 36 ? -6.954  11.679  -3.856  1.00 0.00 ? 36 LEU A HA   11 
ATOM   6398  H  HB2  . LEU A 1 36 ? -9.124  12.193  -4.263  1.00 0.00 ? 36 LEU A HB2  11 
ATOM   6399  H  HB3  . LEU A 1 36 ? -9.723  10.963  -3.165  1.00 0.00 ? 36 LEU A HB3  11 
ATOM   6400  H  HG   . LEU A 1 36 ? -8.915  12.585  -1.317  1.00 0.00 ? 36 LEU A HG   11 
ATOM   6401  H  HD11 . LEU A 1 36 ? -7.759  14.205  -2.609  1.00 0.00 ? 36 LEU A HD11 11 
ATOM   6402  H  HD12 . LEU A 1 36 ? -9.123  14.397  -3.711  1.00 0.00 ? 36 LEU A HD12 11 
ATOM   6403  H  HD13 . LEU A 1 36 ? -9.245  14.973  -2.048  1.00 0.00 ? 36 LEU A HD13 11 
ATOM   6404  H  HD21 . LEU A 1 36 ? -11.227 11.956  -1.692  1.00 0.00 ? 36 LEU A HD21 11 
ATOM   6405  H  HD22 . LEU A 1 36 ? -11.105 13.677  -1.325  1.00 0.00 ? 36 LEU A HD22 11 
ATOM   6406  H  HD23 . LEU A 1 36 ? -11.357 13.145  -2.987  1.00 0.00 ? 36 LEU A HD23 11 
ATOM   6407  N  N    . VAL A 1 37 ? -5.823  11.903  -1.663  1.00 0.00 ? 37 VAL A N    11 
ATOM   6408  C  CA   . VAL A 1 37 ? -5.153  12.076  -0.387  1.00 0.00 ? 37 VAL A CA   11 
ATOM   6409  C  C    . VAL A 1 37 ? -5.408  13.477  0.166   1.00 0.00 ? 37 VAL A C    11 
ATOM   6410  O  O    . VAL A 1 37 ? -5.578  14.418  -0.643  1.00 0.00 ? 37 VAL A O    11 
ATOM   6411  C  CB   . VAL A 1 37 ? -3.633  11.800  -0.512  1.00 0.00 ? 37 VAL A CB   11 
ATOM   6412  C  CG1  . VAL A 1 37 ? -2.894  12.986  -1.115  1.00 0.00 ? 37 VAL A CG1  11 
ATOM   6413  C  CG2  . VAL A 1 37 ? -3.045  11.434  0.839   1.00 0.00 ? 37 VAL A CG2  11 
ATOM   6414  O  OXT  . VAL A 1 37 ? -5.476  13.628  1.404   1.00 0.00 ? 37 VAL A OXT  11 
ATOM   6415  H  H    . VAL A 1 37 ? -5.330  12.083  -2.495  1.00 0.00 ? 37 VAL A H    11 
ATOM   6416  H  HA   . VAL A 1 37 ? -5.570  11.352  0.299   1.00 0.00 ? 37 VAL A HA   11 
ATOM   6417  H  HB   . VAL A 1 37 ? -3.500  10.956  -1.172  1.00 0.00 ? 37 VAL A HB   11 
ATOM   6418  H  HG11 . VAL A 1 37 ? -3.593  13.791  -1.294  1.00 0.00 ? 37 VAL A HG11 11 
ATOM   6419  H  HG12 . VAL A 1 37 ? -2.128  13.318  -0.431  1.00 0.00 ? 37 VAL A HG12 11 
ATOM   6420  H  HG13 . VAL A 1 37 ? -2.441  12.690  -2.050  1.00 0.00 ? 37 VAL A HG13 11 
ATOM   6421  H  HG21 . VAL A 1 37 ? -2.027  11.794  0.899   1.00 0.00 ? 37 VAL A HG21 11 
ATOM   6422  H  HG22 . VAL A 1 37 ? -3.635  11.887  1.621   1.00 0.00 ? 37 VAL A HG22 11 
ATOM   6423  H  HG23 . VAL A 1 37 ? -3.055  10.360  0.955   1.00 0.00 ? 37 VAL A HG23 11 
HETATM 6424  ZN ZN   . ZN  B 2 .  ? 0.717   3.589   0.164   1.00 0.00 ? 38 ZN  A ZN   11 
ATOM   6425  N  N    . GLY A 1 1  ? 9.031   5.367   -3.148  1.00 0.00 ? 1  GLY A N    12 
ATOM   6426  C  CA   . GLY A 1 1  ? 8.726   5.717   -1.739  1.00 0.00 ? 1  GLY A CA   12 
ATOM   6427  C  C    . GLY A 1 1  ? 9.419   4.782   -0.777  1.00 0.00 ? 1  GLY A C    12 
ATOM   6428  O  O    . GLY A 1 1  ? 9.834   3.693   -1.166  1.00 0.00 ? 1  GLY A O    12 
ATOM   6429  H  H1   . GLY A 1 1  ? 8.224   5.609   -3.763  1.00 0.00 ? 1  GLY A H1   12 
ATOM   6430  H  H2   . GLY A 1 1  ? 9.223   4.345   -3.230  1.00 0.00 ? 1  GLY A H2   12 
ATOM   6431  H  H3   . GLY A 1 1  ? 9.871   5.892   -3.475  1.00 0.00 ? 1  GLY A H3   12 
ATOM   6432  H  HA2  . GLY A 1 1  ? 9.054   6.728   -1.546  1.00 0.00 ? 1  GLY A HA2  12 
ATOM   6433  H  HA3  . GLY A 1 1  ? 7.659   5.655   -1.584  1.00 0.00 ? 1  GLY A HA3  12 
ATOM   6434  N  N    . SER A 1 2  ? 9.558   5.197   0.472   1.00 0.00 ? 2  SER A N    12 
ATOM   6435  C  CA   . SER A 1 2  ? 10.186  4.366   1.486   1.00 0.00 ? 2  SER A CA   12 
ATOM   6436  C  C    . SER A 1 2  ? 9.570   4.645   2.853   1.00 0.00 ? 2  SER A C    12 
ATOM   6437  O  O    . SER A 1 2  ? 9.684   5.755   3.379   1.00 0.00 ? 2  SER A O    12 
ATOM   6438  C  CB   . SER A 1 2  ? 11.700  4.615   1.531   1.00 0.00 ? 2  SER A CB   12 
ATOM   6439  O  OG   . SER A 1 2  ? 12.123  5.453   0.464   1.00 0.00 ? 2  SER A OG   12 
ATOM   6440  H  H    . SER A 1 2  ? 9.199   6.078   0.731   1.00 0.00 ? 2  SER A H    12 
ATOM   6441  H  HA   . SER A 1 2  ? 10.006  3.333   1.228   1.00 0.00 ? 2  SER A HA   12 
ATOM   6442  H  HB2  . SER A 1 2  ? 11.955  5.092   2.467   1.00 0.00 ? 2  SER A HB2  12 
ATOM   6443  H  HB3  . SER A 1 2  ? 12.219  3.670   1.459   1.00 0.00 ? 2  SER A HB3  12 
ATOM   6444  H  HG   . SER A 1 2  ? 11.404  6.062   0.226   1.00 0.00 ? 2  SER A HG   12 
ATOM   6445  N  N    . THR A 1 3  ? 8.913   3.642   3.421   1.00 0.00 ? 3  THR A N    12 
ATOM   6446  C  CA   . THR A 1 3  ? 8.278   3.780   4.724   1.00 0.00 ? 3  THR A CA   12 
ATOM   6447  C  C    . THR A 1 3  ? 9.311   3.823   5.843   1.00 0.00 ? 3  THR A C    12 
ATOM   6448  O  O    . THR A 1 3  ? 8.966   3.875   7.024   1.00 0.00 ? 3  THR A O    12 
ATOM   6449  C  CB   . THR A 1 3  ? 7.293   2.626   4.993   1.00 0.00 ? 3  THR A CB   12 
ATOM   6450  O  OG1  . THR A 1 3  ? 7.839   1.386   4.516   1.00 0.00 ? 3  THR A OG1  12 
ATOM   6451  C  CG2  . THR A 1 3  ? 5.958   2.888   4.320   1.00 0.00 ? 3  THR A CG2  12 
ATOM   6452  H  H    . THR A 1 3  ? 8.818   2.787   2.928   1.00 0.00 ? 3  THR A H    12 
ATOM   6453  H  HA   . THR A 1 3  ? 7.734   4.705   4.725   1.00 0.00 ? 3  THR A HA   12 
ATOM   6454  H  HB   . THR A 1 3  ? 7.132   2.554   6.059   1.00 0.00 ? 3  THR A HB   12 
ATOM   6455  H  HG1  . THR A 1 3  ? 7.853   1.389   3.537   1.00 0.00 ? 3  THR A HG1  12 
ATOM   6456  H  HG21 . THR A 1 3  ? 5.926   3.910   3.970   1.00 0.00 ? 3  THR A HG21 12 
ATOM   6457  H  HG22 . THR A 1 3  ? 5.158   2.726   5.028   1.00 0.00 ? 3  THR A HG22 12 
ATOM   6458  H  HG23 . THR A 1 3  ? 5.839   2.218   3.482   1.00 0.00 ? 3  THR A HG23 12 
ATOM   6459  N  N    . ARG A 1 4  ? 10.575  3.800   5.444   1.00 0.00 ? 4  ARG A N    12 
ATOM   6460  C  CA   . ARG A 1 4  ? 11.703  3.814   6.369   1.00 0.00 ? 4  ARG A CA   12 
ATOM   6461  C  C    . ARG A 1 4  ? 11.592  2.654   7.352   1.00 0.00 ? 4  ARG A C    12 
ATOM   6462  O  O    . ARG A 1 4  ? 11.743  2.819   8.565   1.00 0.00 ? 4  ARG A O    12 
ATOM   6463  C  CB   . ARG A 1 4  ? 11.783  5.157   7.101   1.00 0.00 ? 4  ARG A CB   12 
ATOM   6464  C  CG   . ARG A 1 4  ? 12.589  6.205   6.347   1.00 0.00 ? 4  ARG A CG   12 
ATOM   6465  C  CD   . ARG A 1 4  ? 11.809  7.500   6.169   1.00 0.00 ? 4  ARG A CD   12 
ATOM   6466  N  NE   . ARG A 1 4  ? 11.160  7.584   4.857   1.00 0.00 ? 4  ARG A NE   12 
ATOM   6467  C  CZ   . ARG A 1 4  ? 11.364  8.571   3.979   1.00 0.00 ? 4  ARG A CZ   12 
ATOM   6468  N  NH1  . ARG A 1 4  ? 12.249  9.527   4.235   1.00 0.00 ? 4  ARG A NH1  12 
ATOM   6469  N  NH2  . ARG A 1 4  ? 10.689  8.592   2.835   1.00 0.00 ? 4  ARG A NH2  12 
ATOM   6470  H  H    . ARG A 1 4  ? 10.750  3.760   4.484   1.00 0.00 ? 4  ARG A H    12 
ATOM   6471  H  HA   . ARG A 1 4  ? 12.603  3.682   5.785   1.00 0.00 ? 4  ARG A HA   12 
ATOM   6472  H  HB2  . ARG A 1 4  ? 10.783  5.537   7.248   1.00 0.00 ? 4  ARG A HB2  12 
ATOM   6473  H  HB3  . ARG A 1 4  ? 12.245  5.002   8.065   1.00 0.00 ? 4  ARG A HB3  12 
ATOM   6474  H  HG2  . ARG A 1 4  ? 13.492  6.415   6.901   1.00 0.00 ? 4  ARG A HG2  12 
ATOM   6475  H  HG3  . ARG A 1 4  ? 12.846  5.813   5.374   1.00 0.00 ? 4  ARG A HG3  12 
ATOM   6476  H  HD2  . ARG A 1 4  ? 11.051  7.556   6.937   1.00 0.00 ? 4  ARG A HD2  12 
ATOM   6477  H  HD3  . ARG A 1 4  ? 12.488  8.332   6.276   1.00 0.00 ? 4  ARG A HD3  12 
ATOM   6478  H  HE   . ARG A 1 4  ? 10.519  6.870   4.625   1.00 0.00 ? 4  ARG A HE   12 
ATOM   6479  H  HH11 . ARG A 1 4  ? 12.779  9.515   5.091   1.00 0.00 ? 4  ARG A HH11 12 
ATOM   6480  H  HH12 . ARG A 1 4  ? 12.395  10.274  3.572   1.00 0.00 ? 4  ARG A HH12 12 
ATOM   6481  H  HH21 . ARG A 1 4  ? 10.024  7.865   2.625   1.00 0.00 ? 4  ARG A HH21 12 
ATOM   6482  H  HH22 . ARG A 1 4  ? 10.832  9.338   2.175   1.00 0.00 ? 4  ARG A HH22 12 
ATOM   6483  N  N    . GLY A 1 5  ? 11.275  1.487   6.810   1.00 0.00 ? 5  GLY A N    12 
ATOM   6484  C  CA   . GLY A 1 5  ? 11.105  0.298   7.618   1.00 0.00 ? 5  GLY A CA   12 
ATOM   6485  C  C    . GLY A 1 5  ? 10.888  -0.927  6.755   1.00 0.00 ? 5  GLY A C    12 
ATOM   6486  O  O    . GLY A 1 5  ? 11.849  -1.584  6.350   1.00 0.00 ? 5  GLY A O    12 
ATOM   6487  H  H    . GLY A 1 5  ? 11.135  1.435   5.839   1.00 0.00 ? 5  GLY A H    12 
ATOM   6488  H  HA2  . GLY A 1 5  ? 11.986  0.152   8.225   1.00 0.00 ? 5  GLY A HA2  12 
ATOM   6489  H  HA3  . GLY A 1 5  ? 10.249  0.431   8.263   1.00 0.00 ? 5  GLY A HA3  12 
ATOM   6490  N  N    . SER A 1 6  ? 9.637   -1.169  6.386   1.00 0.00 ? 6  SER A N    12 
ATOM   6491  C  CA   . SER A 1 6  ? 9.298   -2.267  5.495   1.00 0.00 ? 6  SER A CA   12 
ATOM   6492  C  C    . SER A 1 6  ? 9.787   -1.965  4.084   1.00 0.00 ? 6  SER A C    12 
ATOM   6493  O  O    . SER A 1 6  ? 9.193   -1.155  3.382   1.00 0.00 ? 6  SER A O    12 
ATOM   6494  C  CB   . SER A 1 6  ? 7.783   -2.486  5.495   1.00 0.00 ? 6  SER A CB   12 
ATOM   6495  O  OG   . SER A 1 6  ? 7.082   -1.249  5.460   1.00 0.00 ? 6  SER A OG   12 
ATOM   6496  H  H    . SER A 1 6  ? 8.924   -0.559  6.679   1.00 0.00 ? 6  SER A H    12 
ATOM   6497  H  HA   . SER A 1 6  ? 9.788   -3.159  5.855   1.00 0.00 ? 6  SER A HA   12 
ATOM   6498  H  HB2  . SER A 1 6  ? 7.503   -3.065  4.627   1.00 0.00 ? 6  SER A HB2  12 
ATOM   6499  H  HB3  . SER A 1 6  ? 7.499   -3.020  6.391   1.00 0.00 ? 6  SER A HB3  12 
ATOM   6500  H  HG   . SER A 1 6  ? 7.518   -0.652  4.831   1.00 0.00 ? 6  SER A HG   12 
ATOM   6501  N  N    . THR A 1 7  ? 10.914  -2.549  3.709   1.00 0.00 ? 7  THR A N    12 
ATOM   6502  C  CA   . THR A 1 7  ? 11.532  -2.253  2.427   1.00 0.00 ? 7  THR A CA   12 
ATOM   6503  C  C    . THR A 1 7  ? 10.919  -3.079  1.301   1.00 0.00 ? 7  THR A C    12 
ATOM   6504  O  O    . THR A 1 7  ? 11.561  -3.984  0.771   1.00 0.00 ? 7  THR A O    12 
ATOM   6505  C  CB   . THR A 1 7  ? 13.045  -2.525  2.490   1.00 0.00 ? 7  THR A CB   12 
ATOM   6506  O  OG1  . THR A 1 7  ? 13.350  -3.281  3.675   1.00 0.00 ? 7  THR A OG1  12 
ATOM   6507  C  CG2  . THR A 1 7  ? 13.835  -1.228  2.494   1.00 0.00 ? 7  THR A CG2  12 
ATOM   6508  H  H    . THR A 1 7  ? 11.382  -3.137  4.339   1.00 0.00 ? 7  THR A H    12 
ATOM   6509  H  HA   . THR A 1 7  ? 11.384  -1.204  2.216   1.00 0.00 ? 7  THR A HA   12 
ATOM   6510  H  HB   . THR A 1 7  ? 13.330  -3.102  1.619   1.00 0.00 ? 7  THR A HB   12 
ATOM   6511  H  HG1  . THR A 1 7  ? 13.473  -2.676  4.420   1.00 0.00 ? 7  THR A HG1  12 
ATOM   6512  H  HG21 . THR A 1 7  ? 13.319  -0.490  1.898   1.00 0.00 ? 7  THR A HG21 12 
ATOM   6513  H  HG22 . THR A 1 7  ? 14.814  -1.404  2.080   1.00 0.00 ? 7  THR A HG22 12 
ATOM   6514  H  HG23 . THR A 1 7  ? 13.931  -0.869  3.508   1.00 0.00 ? 7  THR A HG23 12 
ATOM   6515  N  N    . GLY A 1 8  ? 9.696   -2.718  0.910   1.00 0.00 ? 8  GLY A N    12 
ATOM   6516  C  CA   . GLY A 1 8  ? 9.013   -3.392  -0.184  1.00 0.00 ? 8  GLY A CA   12 
ATOM   6517  C  C    . GLY A 1 8  ? 8.993   -4.898  -0.034  1.00 0.00 ? 8  GLY A C    12 
ATOM   6518  O  O    . GLY A 1 8  ? 9.246   -5.630  -0.990  1.00 0.00 ? 8  GLY A O    12 
ATOM   6519  H  H    . GLY A 1 8  ? 9.260   -1.954  1.354   1.00 0.00 ? 8  GLY A H    12 
ATOM   6520  H  HA2  . GLY A 1 8  ? 7.994   -3.043  -0.218  1.00 0.00 ? 8  GLY A HA2  12 
ATOM   6521  H  HA3  . GLY A 1 8  ? 9.502   -3.139  -1.112  1.00 0.00 ? 8  GLY A HA3  12 
ATOM   6522  N  N    . ILE A 1 9  ? 8.684   -5.354  1.166   1.00 0.00 ? 9  ILE A N    12 
ATOM   6523  C  CA   . ILE A 1 9  ? 8.581   -6.776  1.444   1.00 0.00 ? 9  ILE A CA   12 
ATOM   6524  C  C    . ILE A 1 9  ? 7.258   -7.316  0.903   1.00 0.00 ? 9  ILE A C    12 
ATOM   6525  O  O    . ILE A 1 9  ? 6.359   -6.533  0.586   1.00 0.00 ? 9  ILE A O    12 
ATOM   6526  C  CB   . ILE A 1 9  ? 8.665   -7.054  2.960   1.00 0.00 ? 9  ILE A CB   12 
ATOM   6527  C  CG1  . ILE A 1 9  ? 9.557   -6.024  3.655   1.00 0.00 ? 9  ILE A CG1  12 
ATOM   6528  C  CG2  . ILE A 1 9  ? 9.184   -8.460  3.222   1.00 0.00 ? 9  ILE A CG2  12 
ATOM   6529  C  CD1  . ILE A 1 9  ? 9.266   -5.880  5.134   1.00 0.00 ? 9  ILE A CD1  12 
ATOM   6530  H  H    . ILE A 1 9  ? 8.446   -4.715  1.865   1.00 0.00 ? 9  ILE A H    12 
ATOM   6531  H  HA   . ILE A 1 9  ? 9.400   -7.279  0.953   1.00 0.00 ? 9  ILE A HA   12 
ATOM   6532  H  HB   . ILE A 1 9  ? 7.669   -6.980  3.364   1.00 0.00 ? 9  ILE A HB   12 
ATOM   6533  H  HG12 . ILE A 1 9  ? 10.589  -6.319  3.547   1.00 0.00 ? 9  ILE A HG12 12 
ATOM   6534  H  HG13 . ILE A 1 9  ? 9.412   -5.060  3.192   1.00 0.00 ? 9  ILE A HG13 12 
ATOM   6535  H  HG21 . ILE A 1 9  ? 8.431   -9.180  2.935   1.00 0.00 ? 9  ILE A HG21 12 
ATOM   6536  H  HG22 . ILE A 1 9  ? 10.080  -8.628  2.644   1.00 0.00 ? 9  ILE A HG22 12 
ATOM   6537  H  HG23 . ILE A 1 9  ? 9.407   -8.571  4.272   1.00 0.00 ? 9  ILE A HG23 12 
ATOM   6538  H  HD11 . ILE A 1 9  ? 8.695   -6.732  5.474   1.00 0.00 ? 9  ILE A HD11 12 
ATOM   6539  H  HD12 . ILE A 1 9  ? 10.195  -5.828  5.681   1.00 0.00 ? 9  ILE A HD12 12 
ATOM   6540  H  HD13 . ILE A 1 9  ? 8.699   -4.976  5.303   1.00 0.00 ? 9  ILE A HD13 12 
ATOM   6541  N  N    . LYS A 1 10 ? 7.129   -8.644  0.837   1.00 0.00 ? 10 LYS A N    12 
ATOM   6542  C  CA   . LYS A 1 10 ? 5.891   -9.290  0.394   1.00 0.00 ? 10 LYS A CA   12 
ATOM   6543  C  C    . LYS A 1 10 ? 5.640   -9.062  -1.095  1.00 0.00 ? 10 LYS A C    12 
ATOM   6544  O  O    . LYS A 1 10 ? 6.087   -8.069  -1.672  1.00 0.00 ? 10 LYS A O    12 
ATOM   6545  C  CB   . LYS A 1 10 ? 4.694   -8.805  1.219   1.00 0.00 ? 10 LYS A CB   12 
ATOM   6546  C  CG   . LYS A 1 10 ? 4.420   -9.662  2.443   1.00 0.00 ? 10 LYS A CG   12 
ATOM   6547  C  CD   . LYS A 1 10 ? 4.369   -8.827  3.710   1.00 0.00 ? 10 LYS A CD   12 
ATOM   6548  C  CE   . LYS A 1 10 ? 5.530   -9.146  4.639   1.00 0.00 ? 10 LYS A CE   12 
ATOM   6549  N  NZ   . LYS A 1 10 ? 5.208   -10.254 5.575   1.00 0.00 ? 10 LYS A NZ   12 
ATOM   6550  H  H    . LYS A 1 10 ? 7.884   -9.208  1.113   1.00 0.00 ? 10 LYS A H    12 
ATOM   6551  H  HA   . LYS A 1 10 ? 6.007   -10.353 0.557   1.00 0.00 ? 10 LYS A HA   12 
ATOM   6552  H  HB2  . LYS A 1 10 ? 4.883   -7.792  1.545   1.00 0.00 ? 10 LYS A HB2  12 
ATOM   6553  H  HB3  . LYS A 1 10 ? 3.813   -8.814  0.592   1.00 0.00 ? 10 LYS A HB3  12 
ATOM   6554  H  HG2  . LYS A 1 10 ? 3.469   -10.158 2.316   1.00 0.00 ? 10 LYS A HG2  12 
ATOM   6555  H  HG3  . LYS A 1 10 ? 5.204   -10.399 2.538   1.00 0.00 ? 10 LYS A HG3  12 
ATOM   6556  H  HD2  . LYS A 1 10 ? 4.413   -7.782  3.442   1.00 0.00 ? 10 LYS A HD2  12 
ATOM   6557  H  HD3  . LYS A 1 10 ? 3.442   -9.028  4.226   1.00 0.00 ? 10 LYS A HD3  12 
ATOM   6558  H  HE2  . LYS A 1 10 ? 6.384   -9.430  4.043   1.00 0.00 ? 10 LYS A HE2  12 
ATOM   6559  H  HE3  . LYS A 1 10 ? 5.769   -8.262  5.212   1.00 0.00 ? 10 LYS A HE3  12 
ATOM   6560  H  HZ1  . LYS A 1 10 ? 4.980   -9.874  6.520   1.00 0.00 ? 10 LYS A HZ1  12 
ATOM   6561  H  HZ2  . LYS A 1 10 ? 6.023   -10.900 5.662   1.00 0.00 ? 10 LYS A HZ2  12 
ATOM   6562  H  HZ3  . LYS A 1 10 ? 4.388   -10.798 5.224   1.00 0.00 ? 10 LYS A HZ3  12 
ATOM   6563  N  N    . PRO A 1 11 ? 5.006   -10.035 -1.767  1.00 0.00 ? 11 PRO A N    12 
ATOM   6564  C  CA   . PRO A 1 11 ? 4.739   -9.959  -3.209  1.00 0.00 ? 11 PRO A CA   12 
ATOM   6565  C  C    . PRO A 1 11 ? 3.801   -8.807  -3.566  1.00 0.00 ? 11 PRO A C    12 
ATOM   6566  O  O    . PRO A 1 11 ? 3.619   -8.485  -4.739  1.00 0.00 ? 11 PRO A O    12 
ATOM   6567  C  CB   . PRO A 1 11 ? 4.075   -11.304 -3.531  1.00 0.00 ? 11 PRO A CB   12 
ATOM   6568  C  CG   . PRO A 1 11 ? 3.561   -11.796 -2.226  1.00 0.00 ? 11 PRO A CG   12 
ATOM   6569  C  CD   . PRO A 1 11 ? 4.536   -11.307 -1.195  1.00 0.00 ? 11 PRO A CD   12 
ATOM   6570  H  HA   . PRO A 1 11 ? 5.653   -9.862  -3.774  1.00 0.00 ? 11 PRO A HA   12 
ATOM   6571  H  HB2  . PRO A 1 11 ? 3.274   -11.152 -4.239  1.00 0.00 ? 11 PRO A HB2  12 
ATOM   6572  H  HB3  . PRO A 1 11 ? 4.807   -11.980 -3.947  1.00 0.00 ? 11 PRO A HB3  12 
ATOM   6573  H  HG2  . PRO A 1 11 ? 2.580   -11.384 -2.042  1.00 0.00 ? 11 PRO A HG2  12 
ATOM   6574  H  HG3  . PRO A 1 11 ? 3.523   -12.875 -2.226  1.00 0.00 ? 11 PRO A HG3  12 
ATOM   6575  H  HD2  . PRO A 1 11 ? 4.039   -11.148 -0.250  1.00 0.00 ? 11 PRO A HD2  12 
ATOM   6576  H  HD3  . PRO A 1 11 ? 5.353   -12.005 -1.084  1.00 0.00 ? 11 PRO A HD3  12 
ATOM   6577  N  N    . PHE A 1 12 ? 3.205   -8.197  -2.548  1.00 0.00 ? 12 PHE A N    12 
ATOM   6578  C  CA   . PHE A 1 12 ? 2.289   -7.087  -2.740  1.00 0.00 ? 12 PHE A CA   12 
ATOM   6579  C  C    . PHE A 1 12 ? 2.683   -5.912  -1.852  1.00 0.00 ? 12 PHE A C    12 
ATOM   6580  O  O    . PHE A 1 12 ? 2.261   -5.818  -0.701  1.00 0.00 ? 12 PHE A O    12 
ATOM   6581  C  CB   . PHE A 1 12 ? 0.857   -7.526  -2.427  1.00 0.00 ? 12 PHE A CB   12 
ATOM   6582  C  CG   . PHE A 1 12 ? 0.400   -8.701  -3.245  1.00 0.00 ? 12 PHE A CG   12 
ATOM   6583  C  CD1  . PHE A 1 12 ? 0.358   -8.627  -4.630  1.00 0.00 ? 12 PHE A CD1  12 
ATOM   6584  C  CD2  . PHE A 1 12 ? 0.018   -9.880  -2.630  1.00 0.00 ? 12 PHE A CD2  12 
ATOM   6585  C  CE1  . PHE A 1 12 ? -0.055  -9.711  -5.382  1.00 0.00 ? 12 PHE A CE1  12 
ATOM   6586  C  CE2  . PHE A 1 12 ? -0.397  -10.966 -3.376  1.00 0.00 ? 12 PHE A CE2  12 
ATOM   6587  C  CZ   . PHE A 1 12 ? -0.435  -10.881 -4.754  1.00 0.00 ? 12 PHE A CZ   12 
ATOM   6588  H  H    . PHE A 1 12 ? 3.394   -8.497  -1.636  1.00 0.00 ? 12 PHE A H    12 
ATOM   6589  H  HA   . PHE A 1 12 ? 2.349   -6.781  -3.774  1.00 0.00 ? 12 PHE A HA   12 
ATOM   6590  H  HB2  . PHE A 1 12 ? 0.794   -7.799  -1.383  1.00 0.00 ? 12 PHE A HB2  12 
ATOM   6591  H  HB3  . PHE A 1 12 ? 0.185   -6.702  -2.619  1.00 0.00 ? 12 PHE A HB3  12 
ATOM   6592  H  HD1  . PHE A 1 12 ? 0.654   -7.712  -5.121  1.00 0.00 ? 12 PHE A HD1  12 
ATOM   6593  H  HD2  . PHE A 1 12 ? 0.046   -9.948  -1.553  1.00 0.00 ? 12 PHE A HD2  12 
ATOM   6594  H  HE1  . PHE A 1 12 ? -0.084  -9.642  -6.459  1.00 0.00 ? 12 PHE A HE1  12 
ATOM   6595  H  HE2  . PHE A 1 12 ? -0.695  -11.879 -2.882  1.00 0.00 ? 12 PHE A HE2  12 
ATOM   6596  H  HZ   . PHE A 1 12 ? -0.756  -11.729 -5.339  1.00 0.00 ? 12 PHE A HZ   12 
ATOM   6597  N  N    . GLN A 1 13 ? 3.514   -5.036  -2.379  1.00 0.00 ? 13 GLN A N    12 
ATOM   6598  C  CA   . GLN A 1 13 ? 3.959   -3.873  -1.647  1.00 0.00 ? 13 GLN A CA   12 
ATOM   6599  C  C    . GLN A 1 13 ? 3.320   -2.612  -2.226  1.00 0.00 ? 13 GLN A C    12 
ATOM   6600  O  O    . GLN A 1 13 ? 2.982   -2.576  -3.411  1.00 0.00 ? 13 GLN A O    12 
ATOM   6601  C  CB   . GLN A 1 13 ? 5.479   -3.798  -1.719  1.00 0.00 ? 13 GLN A CB   12 
ATOM   6602  C  CG   . GLN A 1 13 ? 5.995   -3.196  -3.008  1.00 0.00 ? 13 GLN A CG   12 
ATOM   6603  C  CD   . GLN A 1 13 ? 7.241   -3.891  -3.525  1.00 0.00 ? 13 GLN A CD   12 
ATOM   6604  O  OE1  . GLN A 1 13 ? 8.208   -3.238  -3.918  1.00 0.00 ? 13 GLN A OE1  12 
ATOM   6605  N  NE2  . GLN A 1 13 ? 7.229   -5.214  -3.531  1.00 0.00 ? 13 GLN A NE2  12 
ATOM   6606  H  H    . GLN A 1 13 ? 3.851   -5.176  -3.284  1.00 0.00 ? 13 GLN A H    12 
ATOM   6607  H  HA   . GLN A 1 13 ? 3.657   -3.984  -0.619  1.00 0.00 ? 13 GLN A HA   12 
ATOM   6608  H  HB2  . GLN A 1 13 ? 5.843   -3.206  -0.893  1.00 0.00 ? 13 GLN A HB2  12 
ATOM   6609  H  HB3  . GLN A 1 13 ? 5.869   -4.799  -1.637  1.00 0.00 ? 13 GLN A HB3  12 
ATOM   6610  H  HG2  . GLN A 1 13 ? 5.218   -3.272  -3.751  1.00 0.00 ? 13 GLN A HG2  12 
ATOM   6611  H  HG3  . GLN A 1 13 ? 6.224   -2.156  -2.836  1.00 0.00 ? 13 GLN A HG3  12 
ATOM   6612  H  HE21 . GLN A 1 13 ? 6.427   -5.675  -3.208  1.00 0.00 ? 13 GLN A HE21 12 
ATOM   6613  H  HE22 . GLN A 1 13 ? 8.032   -5.685  -3.853  1.00 0.00 ? 13 GLN A HE22 12 
ATOM   6614  N  N    . CYS A 1 14 ? 3.162   -1.575  -1.406  1.00 0.00 ? 14 CYS A N    12 
ATOM   6615  C  CA   . CYS A 1 14 ? 2.590   -0.330  -1.891  1.00 0.00 ? 14 CYS A CA   12 
ATOM   6616  C  C    . CYS A 1 14 ? 3.549   0.336   -2.869  1.00 0.00 ? 14 CYS A C    12 
ATOM   6617  O  O    . CYS A 1 14 ? 4.719   0.548   -2.556  1.00 0.00 ? 14 CYS A O    12 
ATOM   6618  C  CB   . CYS A 1 14 ? 2.265   0.656   -0.759  1.00 0.00 ? 14 CYS A CB   12 
ATOM   6619  S  SG   . CYS A 1 14 ? 1.673   2.257   -1.414  1.00 0.00 ? 14 CYS A SG   12 
ATOM   6620  H  H    . CYS A 1 14 ? 3.476   -1.641  -0.481  1.00 0.00 ? 14 CYS A H    12 
ATOM   6621  H  HA   . CYS A 1 14 ? 1.676   -0.572  -2.411  1.00 0.00 ? 14 CYS A HA   12 
ATOM   6622  H  HB2  . CYS A 1 14 ? 1.496   0.239   -0.124  1.00 0.00 ? 14 CYS A HB2  12 
ATOM   6623  H  HB3  . CYS A 1 14 ? 3.155   0.842   -0.177  1.00 0.00 ? 14 CYS A HB3  12 
ATOM   6624  N  N    . PRO A 1 15 ? 3.059   0.702   -4.058  1.00 0.00 ? 15 PRO A N    12 
ATOM   6625  C  CA   . PRO A 1 15 ? 3.875   1.370   -5.069  1.00 0.00 ? 15 PRO A CA   12 
ATOM   6626  C  C    . PRO A 1 15 ? 4.116   2.842   -4.744  1.00 0.00 ? 15 PRO A C    12 
ATOM   6627  O  O    . PRO A 1 15 ? 4.836   3.535   -5.463  1.00 0.00 ? 15 PRO A O    12 
ATOM   6628  C  CB   . PRO A 1 15 ? 3.038   1.232   -6.339  1.00 0.00 ? 15 PRO A CB   12 
ATOM   6629  C  CG   . PRO A 1 15 ? 1.629   1.162   -5.860  1.00 0.00 ? 15 PRO A CG   12 
ATOM   6630  C  CD   . PRO A 1 15 ? 1.673   0.486   -4.515  1.00 0.00 ? 15 PRO A CD   12 
ATOM   6631  H  HA   . PRO A 1 15 ? 4.823   0.873   -5.199  1.00 0.00 ? 15 PRO A HA   12 
ATOM   6632  H  HB2  . PRO A 1 15 ? 3.196   2.093   -6.973  1.00 0.00 ? 15 PRO A HB2  12 
ATOM   6633  H  HB3  . PRO A 1 15 ? 3.320   0.333   -6.865  1.00 0.00 ? 15 PRO A HB3  12 
ATOM   6634  H  HG2  . PRO A 1 15 ? 1.224   2.159   -5.766  1.00 0.00 ? 15 PRO A HG2  12 
ATOM   6635  H  HG3  . PRO A 1 15 ? 1.036   0.580   -6.551  1.00 0.00 ? 15 PRO A HG3  12 
ATOM   6636  H  HD2  . PRO A 1 15 ? 0.970   0.950   -3.839  1.00 0.00 ? 15 PRO A HD2  12 
ATOM   6637  H  HD3  . PRO A 1 15 ? 1.462   -0.567  -4.616  1.00 0.00 ? 15 PRO A HD3  12 
ATOM   6638  N  N    . ASP A 1 16 ? 3.484   3.324   -3.683  1.00 0.00 ? 16 ASP A N    12 
ATOM   6639  C  CA   . ASP A 1 16 ? 3.606   4.725   -3.299  1.00 0.00 ? 16 ASP A CA   12 
ATOM   6640  C  C    . ASP A 1 16 ? 4.443   4.870   -2.041  1.00 0.00 ? 16 ASP A C    12 
ATOM   6641  O  O    . ASP A 1 16 ? 5.228   5.809   -1.910  1.00 0.00 ? 16 ASP A O    12 
ATOM   6642  C  CB   . ASP A 1 16 ? 2.220   5.335   -3.068  1.00 0.00 ? 16 ASP A CB   12 
ATOM   6643  C  CG   . ASP A 1 16 ? 2.262   6.843   -2.907  1.00 0.00 ? 16 ASP A CG   12 
ATOM   6644  O  OD1  . ASP A 1 16 ? 2.173   7.555   -3.927  1.00 0.00 ? 16 ASP A OD1  12 
ATOM   6645  O  OD2  . ASP A 1 16 ? 2.372   7.325   -1.761  1.00 0.00 ? 16 ASP A OD2  12 
ATOM   6646  H  H    . ASP A 1 16 ? 2.907   2.726   -3.147  1.00 0.00 ? 16 ASP A H    12 
ATOM   6647  H  HA   . ASP A 1 16 ? 4.092   5.250   -4.106  1.00 0.00 ? 16 ASP A HA   12 
ATOM   6648  H  HB2  . ASP A 1 16 ? 1.587   5.102   -3.912  1.00 0.00 ? 16 ASP A HB2  12 
ATOM   6649  H  HB3  . ASP A 1 16 ? 1.789   4.908   -2.174  1.00 0.00 ? 16 ASP A HB3  12 
ATOM   6650  N  N    . CYS A 1 17 ? 4.238   3.965   -1.096  1.00 0.00 ? 17 CYS A N    12 
ATOM   6651  C  CA   . CYS A 1 17 ? 4.920   4.048   0.187   1.00 0.00 ? 17 CYS A CA   12 
ATOM   6652  C  C    . CYS A 1 17 ? 6.022   3.007   0.322   1.00 0.00 ? 17 CYS A C    12 
ATOM   6653  O  O    . CYS A 1 17 ? 6.992   3.250   1.023   1.00 0.00 ? 17 CYS A O    12 
ATOM   6654  C  CB   . CYS A 1 17 ? 3.925   3.900   1.335   1.00 0.00 ? 17 CYS A CB   12 
ATOM   6655  S  SG   . CYS A 1 17 ? 2.435   4.925   1.167   1.00 0.00 ? 17 CYS A SG   12 
ATOM   6656  H  H    . CYS A 1 17 ? 3.584   3.249   -1.254  1.00 0.00 ? 17 CYS A H    12 
ATOM   6657  H  HA   . CYS A 1 17 ? 5.367   5.027   0.244   1.00 0.00 ? 17 CYS A HA   12 
ATOM   6658  H  HB2  . CYS A 1 17 ? 3.608   2.870   1.395   1.00 0.00 ? 17 CYS A HB2  12 
ATOM   6659  H  HB3  . CYS A 1 17 ? 4.413   4.174   2.259   1.00 0.00 ? 17 CYS A HB3  12 
ATOM   6660  N  N    . ASP A 1 18 ? 5.797   1.843   -0.299  1.00 0.00 ? 18 ASP A N    12 
ATOM   6661  C  CA   . ASP A 1 18 ? 6.675   0.655   -0.226  1.00 0.00 ? 18 ASP A CA   12 
ATOM   6662  C  C    . ASP A 1 18 ? 6.365   -0.177  1.022   1.00 0.00 ? 18 ASP A C    12 
ATOM   6663  O  O    . ASP A 1 18 ? 7.119   -1.081  1.387   1.00 0.00 ? 18 ASP A O    12 
ATOM   6664  C  CB   . ASP A 1 18 ? 8.187   1.001   -0.338  1.00 0.00 ? 18 ASP A CB   12 
ATOM   6665  C  CG   . ASP A 1 18 ? 8.974   1.088   0.976   1.00 0.00 ? 18 ASP A CG   12 
ATOM   6666  O  OD1  . ASP A 1 18 ? 8.402   1.398   2.037   1.00 0.00 ? 18 ASP A OD1  12 
ATOM   6667  O  OD2  . ASP A 1 18 ? 10.203  0.858   0.938   1.00 0.00 ? 18 ASP A OD2  12 
ATOM   6668  H  H    . ASP A 1 18 ? 4.960   1.754   -0.801  1.00 0.00 ? 18 ASP A H    12 
ATOM   6669  H  HA   . ASP A 1 18 ? 6.418   0.043   -1.080  1.00 0.00 ? 18 ASP A HA   12 
ATOM   6670  H  HB2  . ASP A 1 18 ? 8.662   0.250   -0.949  1.00 0.00 ? 18 ASP A HB2  12 
ATOM   6671  H  HB3  . ASP A 1 18 ? 8.279   1.955   -0.841  1.00 0.00 ? 18 ASP A HB3  12 
ATOM   6672  N  N    . ARG A 1 19 ? 5.129   -0.028  1.505   1.00 0.00 ? 19 ARG A N    12 
ATOM   6673  C  CA   . ARG A 1 19 ? 4.599   -0.891  2.561   1.00 0.00 ? 19 ARG A CA   12 
ATOM   6674  C  C    . ARG A 1 19 ? 4.503   -2.325  2.063   1.00 0.00 ? 19 ARG A C    12 
ATOM   6675  O  O    . ARG A 1 19 ? 4.665   -2.578  0.879   1.00 0.00 ? 19 ARG A O    12 
ATOM   6676  C  CB   . ARG A 1 19 ? 3.215   -0.420  3.008   1.00 0.00 ? 19 ARG A CB   12 
ATOM   6677  C  CG   . ARG A 1 19 ? 3.023   1.079   2.934   1.00 0.00 ? 19 ARG A CG   12 
ATOM   6678  C  CD   . ARG A 1 19 ? 2.243   1.592   4.127   1.00 0.00 ? 19 ARG A CD   12 
ATOM   6679  N  NE   . ARG A 1 19 ? 0.940   0.940   4.258   1.00 0.00 ? 19 ARG A NE   12 
ATOM   6680  C  CZ   . ARG A 1 19 ? 0.350   0.704   5.437   1.00 0.00 ? 19 ARG A CZ   12 
ATOM   6681  N  NH1  . ARG A 1 19 ? 0.927   1.113   6.561   1.00 0.00 ? 19 ARG A NH1  12 
ATOM   6682  N  NH2  . ARG A 1 19 ? -0.829  0.093   5.491   1.00 0.00 ? 19 ARG A NH2  12 
ATOM   6683  H  H    . ARG A 1 19 ? 4.519   0.580   1.042   1.00 0.00 ? 19 ARG A H    12 
ATOM   6684  H  HA   . ARG A 1 19 ? 5.276   -0.853  3.401   1.00 0.00 ? 19 ARG A HA   12 
ATOM   6685  H  HB2  . ARG A 1 19 ? 2.470   -0.887  2.382   1.00 0.00 ? 19 ARG A HB2  12 
ATOM   6686  H  HB3  . ARG A 1 19 ? 3.058   -0.729  4.030   1.00 0.00 ? 19 ARG A HB3  12 
ATOM   6687  H  HG2  . ARG A 1 19 ? 3.993   1.555   2.917   1.00 0.00 ? 19 ARG A HG2  12 
ATOM   6688  H  HG3  . ARG A 1 19 ? 2.484   1.323   2.030   1.00 0.00 ? 19 ARG A HG3  12 
ATOM   6689  H  HD2  . ARG A 1 19 ? 2.818   1.405   5.022   1.00 0.00 ? 19 ARG A HD2  12 
ATOM   6690  H  HD3  . ARG A 1 19 ? 2.092   2.654   4.012   1.00 0.00 ? 19 ARG A HD3  12 
ATOM   6691  H  HE   . ARG A 1 19 ? 0.485   0.666   3.420   1.00 0.00 ? 19 ARG A HE   12 
ATOM   6692  H  HH11 . ARG A 1 19 ? 1.806   1.603   6.530   1.00 0.00 ? 19 ARG A HH11 12 
ATOM   6693  H  HH12 . ARG A 1 19 ? 0.490   0.934   7.453   1.00 0.00 ? 19 ARG A HH12 12 
ATOM   6694  H  HH21 . ARG A 1 19 ? -1.282  -0.207  4.653   1.00 0.00 ? 19 ARG A HH21 12 
ATOM   6695  H  HH22 . ARG A 1 19 ? -1.282  -0.059  6.384   1.00 0.00 ? 19 ARG A HH22 12 
ATOM   6696  N  N    . SER A 1 20 ? 4.210   -3.259  2.953   1.00 0.00 ? 20 SER A N    12 
ATOM   6697  C  CA   . SER A 1 20 ? 4.141   -4.662  2.557   1.00 0.00 ? 20 SER A CA   12 
ATOM   6698  C  C    . SER A 1 20 ? 2.843   -5.325  2.997   1.00 0.00 ? 20 SER A C    12 
ATOM   6699  O  O    . SER A 1 20 ? 2.341   -5.073  4.096   1.00 0.00 ? 20 SER A O    12 
ATOM   6700  C  CB   . SER A 1 20 ? 5.326   -5.424  3.140   1.00 0.00 ? 20 SER A CB   12 
ATOM   6701  O  OG   . SER A 1 20 ? 6.287   -4.536  3.681   1.00 0.00 ? 20 SER A OG   12 
ATOM   6702  H  H    . SER A 1 20 ? 4.033   -3.006  3.887   1.00 0.00 ? 20 SER A H    12 
ATOM   6703  H  HA   . SER A 1 20 ? 4.198   -4.701  1.481   1.00 0.00 ? 20 SER A HA   12 
ATOM   6704  H  HB2  . SER A 1 20 ? 4.974   -6.083  3.917   1.00 0.00 ? 20 SER A HB2  12 
ATOM   6705  H  HB3  . SER A 1 20 ? 5.794   -6.007  2.358   1.00 0.00 ? 20 SER A HB3  12 
ATOM   6706  H  HG   . SER A 1 20 ? 6.130   -3.655  3.329   1.00 0.00 ? 20 SER A HG   12 
ATOM   6707  N  N    . PHE A 1 21 ? 2.290   -6.145  2.108   1.00 0.00 ? 21 PHE A N    12 
ATOM   6708  C  CA   . PHE A 1 21 ? 1.047   -6.857  2.364   1.00 0.00 ? 21 PHE A CA   12 
ATOM   6709  C  C    . PHE A 1 21 ? 1.108   -8.253  1.757   1.00 0.00 ? 21 PHE A C    12 
ATOM   6710  O  O    . PHE A 1 21 ? 1.510   -8.426  0.608   1.00 0.00 ? 21 PHE A O    12 
ATOM   6711  C  CB   . PHE A 1 21 ? -0.144  -6.093  1.779   1.00 0.00 ? 21 PHE A CB   12 
ATOM   6712  C  CG   . PHE A 1 21 ? -0.202  -4.655  2.200   1.00 0.00 ? 21 PHE A CG   12 
ATOM   6713  C  CD1  . PHE A 1 21 ? 0.472   -3.683  1.481   1.00 0.00 ? 21 PHE A CD1  12 
ATOM   6714  C  CD2  . PHE A 1 21 ? -0.926  -4.278  3.317   1.00 0.00 ? 21 PHE A CD2  12 
ATOM   6715  C  CE1  . PHE A 1 21 ? 0.425   -2.362  1.868   1.00 0.00 ? 21 PHE A CE1  12 
ATOM   6716  C  CE2  . PHE A 1 21 ? -0.977  -2.956  3.708   1.00 0.00 ? 21 PHE A CE2  12 
ATOM   6717  C  CZ   . PHE A 1 21 ? -0.302  -1.999  2.982   1.00 0.00 ? 21 PHE A CZ   12 
ATOM   6718  H  H    . PHE A 1 21 ? 2.721   -6.255  1.232   1.00 0.00 ? 21 PHE A H    12 
ATOM   6719  H  HA   . PHE A 1 21 ? 0.923   -6.942  3.433   1.00 0.00 ? 21 PHE A HA   12 
ATOM   6720  H  HB2  . PHE A 1 21 ? -0.088  -6.119  0.700   1.00 0.00 ? 21 PHE A HB2  12 
ATOM   6721  H  HB3  . PHE A 1 21 ? -1.059  -6.570  2.098   1.00 0.00 ? 21 PHE A HB3  12 
ATOM   6722  H  HD1  . PHE A 1 21 ? 1.045   -3.969  0.611   1.00 0.00 ? 21 PHE A HD1  12 
ATOM   6723  H  HD2  . PHE A 1 21 ? -1.452  -5.028  3.886   1.00 0.00 ? 21 PHE A HD2  12 
ATOM   6724  H  HE1  . PHE A 1 21 ? 0.953   -1.614  1.298   1.00 0.00 ? 21 PHE A HE1  12 
ATOM   6725  H  HE2  . PHE A 1 21 ? -1.546  -2.673  4.583   1.00 0.00 ? 21 PHE A HE2  12 
ATOM   6726  H  HZ   . PHE A 1 21 ? -0.341  -0.966  3.287   1.00 0.00 ? 21 PHE A HZ   12 
ATOM   6727  N  N    . SER A 1 22 ? 0.737   -9.250  2.540   1.00 0.00 ? 22 SER A N    12 
ATOM   6728  C  CA   . SER A 1 22 ? 0.747   -10.627 2.072   1.00 0.00 ? 22 SER A CA   12 
ATOM   6729  C  C    . SER A 1 22 ? -0.365  -10.841 1.046   1.00 0.00 ? 22 SER A C    12 
ATOM   6730  O  O    . SER A 1 22 ? -0.213  -11.604 0.091   1.00 0.00 ? 22 SER A O    12 
ATOM   6731  C  CB   . SER A 1 22 ? 0.565   -11.566 3.260   1.00 0.00 ? 22 SER A CB   12 
ATOM   6732  O  OG   . SER A 1 22 ? 0.380   -10.823 4.458   1.00 0.00 ? 22 SER A OG   12 
ATOM   6733  H  H    . SER A 1 22 ? 0.457   -9.062  3.460   1.00 0.00 ? 22 SER A H    12 
ATOM   6734  H  HA   . SER A 1 22 ? 1.704   -10.819 1.604   1.00 0.00 ? 22 SER A HA   12 
ATOM   6735  H  HB2  . SER A 1 22 ? -0.302  -12.187 3.098   1.00 0.00 ? 22 SER A HB2  12 
ATOM   6736  H  HB3  . SER A 1 22 ? 1.442   -12.188 3.367   1.00 0.00 ? 22 SER A HB3  12 
ATOM   6737  H  HG   . SER A 1 22 ? 1.194   -10.853 4.982   1.00 0.00 ? 22 SER A HG   12 
ATOM   6738  N  N    . ARG A 1 23 ? -1.477  -10.142 1.251   1.00 0.00 ? 23 ARG A N    12 
ATOM   6739  C  CA   . ARG A 1 23 ? -2.614  -10.209 0.350   1.00 0.00 ? 23 ARG A CA   12 
ATOM   6740  C  C    . ARG A 1 23 ? -2.718  -8.934  -0.465  1.00 0.00 ? 23 ARG A C    12 
ATOM   6741  O  O    . ARG A 1 23 ? -2.613  -7.833  0.079   1.00 0.00 ? 23 ARG A O    12 
ATOM   6742  C  CB   . ARG A 1 23 ? -3.905  -10.411 1.146   1.00 0.00 ? 23 ARG A CB   12 
ATOM   6743  C  CG   . ARG A 1 23 ? -4.175  -11.857 1.523   1.00 0.00 ? 23 ARG A CG   12 
ATOM   6744  C  CD   . ARG A 1 23 ? -5.622  -12.228 1.263   1.00 0.00 ? 23 ARG A CD   12 
ATOM   6745  N  NE   . ARG A 1 23 ? -6.529  -11.628 2.239   1.00 0.00 ? 23 ARG A NE   12 
ATOM   6746  C  CZ   . ARG A 1 23 ? -7.206  -12.322 3.158   1.00 0.00 ? 23 ARG A CZ   12 
ATOM   6747  N  NH1  . ARG A 1 23 ? -7.094  -13.642 3.213   1.00 0.00 ? 23 ARG A NH1  12 
ATOM   6748  N  NH2  . ARG A 1 23 ? -8.012  -11.696 4.004   1.00 0.00 ? 23 ARG A NH2  12 
ATOM   6749  H  H    . ARG A 1 23 ? -1.529  -9.551  2.034   1.00 0.00 ? 23 ARG A H    12 
ATOM   6750  H  HA   . ARG A 1 23 ? -2.473  -11.041 -0.322  1.00 0.00 ? 23 ARG A HA   12 
ATOM   6751  H  HB2  . ARG A 1 23 ? -3.847  -9.831  2.055   1.00 0.00 ? 23 ARG A HB2  12 
ATOM   6752  H  HB3  . ARG A 1 23 ? -4.737  -10.056 0.556   1.00 0.00 ? 23 ARG A HB3  12 
ATOM   6753  H  HG2  . ARG A 1 23 ? -3.537  -12.498 0.934   1.00 0.00 ? 23 ARG A HG2  12 
ATOM   6754  H  HG3  . ARG A 1 23 ? -3.959  -11.992 2.574   1.00 0.00 ? 23 ARG A HG3  12 
ATOM   6755  H  HD2  . ARG A 1 23 ? -5.893  -11.882 0.279   1.00 0.00 ? 23 ARG A HD2  12 
ATOM   6756  H  HD3  . ARG A 1 23 ? -5.720  -13.303 1.306   1.00 0.00 ? 23 ARG A HD3  12 
ATOM   6757  H  HE   . ARG A 1 23 ? -6.644  -10.643 2.203   1.00 0.00 ? 23 ARG A HE   12 
ATOM   6758  H  HH11 . ARG A 1 23 ? -6.504  -14.127 2.560   1.00 0.00 ? 23 ARG A HH11 12 
ATOM   6759  H  HH12 . ARG A 1 23 ? -7.593  -14.167 3.915   1.00 0.00 ? 23 ARG A HH12 12 
ATOM   6760  H  HH21 . ARG A 1 23 ? -8.119  -10.696 3.958   1.00 0.00 ? 23 ARG A HH21 12 
ATOM   6761  H  HH22 . ARG A 1 23 ? -8.527  -12.218 4.698   1.00 0.00 ? 23 ARG A HH22 12 
ATOM   6762  N  N    . SER A 1 24 ? -3.055  -9.084  -1.737  1.00 0.00 ? 24 SER A N    12 
ATOM   6763  C  CA   . SER A 1 24 ? -3.314  -7.945  -2.604  1.00 0.00 ? 24 SER A CA   12 
ATOM   6764  C  C    . SER A 1 24 ? -4.537  -7.190  -2.092  1.00 0.00 ? 24 SER A C    12 
ATOM   6765  O  O    . SER A 1 24 ? -4.660  -5.974  -2.255  1.00 0.00 ? 24 SER A O    12 
ATOM   6766  C  CB   . SER A 1 24 ? -3.550  -8.425  -4.035  1.00 0.00 ? 24 SER A CB   12 
ATOM   6767  O  OG   . SER A 1 24 ? -2.722  -7.740  -4.959  1.00 0.00 ? 24 SER A OG   12 
ATOM   6768  H  H    . SER A 1 24 ? -3.222  -9.994  -2.083  1.00 0.00 ? 24 SER A H    12 
ATOM   6769  H  HA   . SER A 1 24 ? -2.451  -7.294  -2.577  1.00 0.00 ? 24 SER A HA   12 
ATOM   6770  H  HB2  . SER A 1 24 ? -3.332  -9.482  -4.095  1.00 0.00 ? 24 SER A HB2  12 
ATOM   6771  H  HB3  . SER A 1 24 ? -4.582  -8.260  -4.298  1.00 0.00 ? 24 SER A HB3  12 
ATOM   6772  H  HG   . SER A 1 24 ? -2.549  -8.315  -5.716  1.00 0.00 ? 24 SER A HG   12 
ATOM   6773  N  N    . ASP A 1 25 ? -5.402  -7.926  -1.403  1.00 0.00 ? 25 ASP A N    12 
ATOM   6774  C  CA   . ASP A 1 25 ? -6.577  -7.368  -0.768  1.00 0.00 ? 25 ASP A CA   12 
ATOM   6775  C  C    . ASP A 1 25 ? -6.179  -6.405  0.351   1.00 0.00 ? 25 ASP A C    12 
ATOM   6776  O  O    . ASP A 1 25 ? -6.737  -5.316  0.474   1.00 0.00 ? 25 ASP A O    12 
ATOM   6777  C  CB   . ASP A 1 25 ? -7.431  -8.520  -0.234  1.00 0.00 ? 25 ASP A CB   12 
ATOM   6778  C  CG   . ASP A 1 25 ? -7.764  -8.409  1.242   1.00 0.00 ? 25 ASP A CG   12 
ATOM   6779  O  OD1  . ASP A 1 25 ? -8.791  -7.784  1.582   1.00 0.00 ? 25 ASP A OD1  12 
ATOM   6780  O  OD2  . ASP A 1 25 ? -7.007  -8.965  2.066   1.00 0.00 ? 25 ASP A OD2  12 
ATOM   6781  H  H    . ASP A 1 25 ? -5.228  -8.883  -1.292  1.00 0.00 ? 25 ASP A H    12 
ATOM   6782  H  HA   . ASP A 1 25 ? -7.137  -6.829  -1.516  1.00 0.00 ? 25 ASP A HA   12 
ATOM   6783  H  HB2  . ASP A 1 25 ? -8.347  -8.556  -0.787  1.00 0.00 ? 25 ASP A HB2  12 
ATOM   6784  H  HB3  . ASP A 1 25 ? -6.895  -9.443  -0.389  1.00 0.00 ? 25 ASP A HB3  12 
ATOM   6785  N  N    . HIS A 1 26 ? -5.144  -6.776  1.100   1.00 0.00 ? 26 HIS A N    12 
ATOM   6786  C  CA   . HIS A 1 26 ? -4.626  -5.927  2.165   1.00 0.00 ? 26 HIS A CA   12 
ATOM   6787  C  C    . HIS A 1 26 ? -3.966  -4.687  1.582   1.00 0.00 ? 26 HIS A C    12 
ATOM   6788  O  O    . HIS A 1 26 ? -4.113  -3.587  2.116   1.00 0.00 ? 26 HIS A O    12 
ATOM   6789  C  CB   . HIS A 1 26 ? -3.630  -6.699  3.034   1.00 0.00 ? 26 HIS A CB   12 
ATOM   6790  C  CG   . HIS A 1 26 ? -4.242  -7.280  4.268   1.00 0.00 ? 26 HIS A CG   12 
ATOM   6791  N  ND1  . HIS A 1 26 ? -3.566  -7.396  5.460   1.00 0.00 ? 26 HIS A ND1  12 
ATOM   6792  C  CD2  . HIS A 1 26 ? -5.481  -7.776  4.491   1.00 0.00 ? 26 HIS A CD2  12 
ATOM   6793  C  CE1  . HIS A 1 26 ? -4.357  -7.937  6.364   1.00 0.00 ? 26 HIS A CE1  12 
ATOM   6794  N  NE2  . HIS A 1 26 ? -5.525  -8.177  5.803   1.00 0.00 ? 26 HIS A NE2  12 
ATOM   6795  H  H    . HIS A 1 26 ? -4.693  -7.622  0.902   1.00 0.00 ? 26 HIS A H    12 
ATOM   6796  H  HA   . HIS A 1 26 ? -5.461  -5.620  2.778   1.00 0.00 ? 26 HIS A HA   12 
ATOM   6797  H  HB2  . HIS A 1 26 ? -3.211  -7.511  2.456   1.00 0.00 ? 26 HIS A HB2  12 
ATOM   6798  H  HB3  . HIS A 1 26 ? -2.835  -6.033  3.338   1.00 0.00 ? 26 HIS A HB3  12 
ATOM   6799  H  HD1  . HIS A 1 26 ? -2.627  -7.125  5.620   1.00 0.00 ? 26 HIS A HD1  12 
ATOM   6800  H  HD2  . HIS A 1 26 ? -6.286  -7.847  3.768   1.00 0.00 ? 26 HIS A HD2  12 
ATOM   6801  H  HE1  . HIS A 1 26 ? -4.094  -8.147  7.391   1.00 0.00 ? 26 HIS A HE1  12 
ATOM   6802  H  HE2  . HIS A 1 26 ? -6.266  -8.678  6.223   1.00 0.00 ? 26 HIS A HE2  12 
ATOM   6803  N  N    . LEU A 1 27 ? -3.304  -4.868  0.444   1.00 0.00 ? 27 LEU A N    12 
ATOM   6804  C  CA   . LEU A 1 27 ? -2.702  -3.761  -0.288  1.00 0.00 ? 27 LEU A CA   12 
ATOM   6805  C  C    . LEU A 1 27 ? -3.754  -2.706  -0.598  1.00 0.00 ? 27 LEU A C    12 
ATOM   6806  O  O    . LEU A 1 27 ? -3.623  -1.541  -0.214  1.00 0.00 ? 27 LEU A O    12 
ATOM   6807  C  CB   . LEU A 1 27 ? -2.090  -4.264  -1.603  1.00 0.00 ? 27 LEU A CB   12 
ATOM   6808  C  CG   . LEU A 1 27 ? -1.150  -3.293  -2.333  1.00 0.00 ? 27 LEU A CG   12 
ATOM   6809  C  CD1  . LEU A 1 27 ? -0.638  -2.199  -1.407  1.00 0.00 ? 27 LEU A CD1  12 
ATOM   6810  C  CD2  . LEU A 1 27 ? 0.008   -4.042  -2.961  1.00 0.00 ? 27 LEU A CD2  12 
ATOM   6811  H  H    . LEU A 1 27 ? -3.271  -5.769  0.053   1.00 0.00 ? 27 LEU A H    12 
ATOM   6812  H  HA   . LEU A 1 27 ? -1.930  -3.326  0.327   1.00 0.00 ? 27 LEU A HA   12 
ATOM   6813  H  HB2  . LEU A 1 27 ? -1.538  -5.167  -1.392  1.00 0.00 ? 27 LEU A HB2  12 
ATOM   6814  H  HB3  . LEU A 1 27 ? -2.900  -4.512  -2.273  1.00 0.00 ? 27 LEU A HB3  12 
ATOM   6815  H  HG   . LEU A 1 27 ? -1.704  -2.816  -3.127  1.00 0.00 ? 27 LEU A HG   12 
ATOM   6816  H  HD11 . LEU A 1 27 ? -0.321  -1.350  -1.994  1.00 0.00 ? 27 LEU A HD11 12 
ATOM   6817  H  HD12 . LEU A 1 27 ? -1.428  -1.900  -0.734  1.00 0.00 ? 27 LEU A HD12 12 
ATOM   6818  H  HD13 . LEU A 1 27 ? 0.198   -2.577  -0.835  1.00 0.00 ? 27 LEU A HD13 12 
ATOM   6819  H  HD21 . LEU A 1 27 ? -0.367  -4.728  -3.704  1.00 0.00 ? 27 LEU A HD21 12 
ATOM   6820  H  HD22 . LEU A 1 27 ? 0.680   -3.336  -3.427  1.00 0.00 ? 27 LEU A HD22 12 
ATOM   6821  H  HD23 . LEU A 1 27 ? 0.538   -4.592  -2.197  1.00 0.00 ? 27 LEU A HD23 12 
ATOM   6822  N  N    . ALA A 1 28 ? -4.781  -3.130  -1.324  1.00 0.00 ? 28 ALA A N    12 
ATOM   6823  C  CA   . ALA A 1 28 ? -5.852  -2.245  -1.753  1.00 0.00 ? 28 ALA A CA   12 
ATOM   6824  C  C    . ALA A 1 28 ? -6.501  -1.524  -0.572  1.00 0.00 ? 28 ALA A C    12 
ATOM   6825  O  O    . ALA A 1 28 ? -6.849  -0.351  -0.681  1.00 0.00 ? 28 ALA A O    12 
ATOM   6826  C  CB   . ALA A 1 28 ? -6.894  -3.025  -2.534  1.00 0.00 ? 28 ALA A CB   12 
ATOM   6827  H  H    . ALA A 1 28 ? -4.794  -4.067  -1.620  1.00 0.00 ? 28 ALA A H    12 
ATOM   6828  H  HA   . ALA A 1 28 ? -5.421  -1.506  -2.418  1.00 0.00 ? 28 ALA A HA   12 
ATOM   6829  H  HB1  . ALA A 1 28 ? -6.404  -3.636  -3.276  1.00 0.00 ? 28 ALA A HB1  12 
ATOM   6830  H  HB2  . ALA A 1 28 ? -7.450  -3.658  -1.858  1.00 0.00 ? 28 ALA A HB2  12 
ATOM   6831  H  HB3  . ALA A 1 28 ? -7.570  -2.338  -3.022  1.00 0.00 ? 28 ALA A HB3  12 
ATOM   6832  N  N    . LEU A 1 29 ? -6.640  -2.220  0.558   1.00 0.00 ? 29 LEU A N    12 
ATOM   6833  C  CA   . LEU A 1 29 ? -7.218  -1.624  1.763   1.00 0.00 ? 29 LEU A CA   12 
ATOM   6834  C  C    . LEU A 1 29 ? -6.465  -0.356  2.153   1.00 0.00 ? 29 LEU A C    12 
ATOM   6835  O  O    . LEU A 1 29 ? -7.070  0.678   2.435   1.00 0.00 ? 29 LEU A O    12 
ATOM   6836  C  CB   . LEU A 1 29 ? -7.189  -2.612  2.928   1.00 0.00 ? 29 LEU A CB   12 
ATOM   6837  C  CG   . LEU A 1 29 ? -8.106  -3.827  2.788   1.00 0.00 ? 29 LEU A CG   12 
ATOM   6838  C  CD1  . LEU A 1 29 ? -7.829  -4.828  3.898   1.00 0.00 ? 29 LEU A CD1  12 
ATOM   6839  C  CD2  . LEU A 1 29 ? -9.567  -3.401  2.805   1.00 0.00 ? 29 LEU A CD2  12 
ATOM   6840  H  H    . LEU A 1 29 ? -6.347  -3.157  0.582   1.00 0.00 ? 29 LEU A H    12 
ATOM   6841  H  HA   . LEU A 1 29 ? -8.241  -1.366  1.549   1.00 0.00 ? 29 LEU A HA   12 
ATOM   6842  H  HB2  . LEU A 1 29 ? -6.175  -2.966  3.046   1.00 0.00 ? 29 LEU A HB2  12 
ATOM   6843  H  HB3  . LEU A 1 29 ? -7.472  -2.080  3.821   1.00 0.00 ? 29 LEU A HB3  12 
ATOM   6844  H  HG   . LEU A 1 29 ? -7.909  -4.314  1.842   1.00 0.00 ? 29 LEU A HG   12 
ATOM   6845  H  HD11 . LEU A 1 29 ? -7.322  -4.330  4.710   1.00 0.00 ? 29 LEU A HD11 12 
ATOM   6846  H  HD12 . LEU A 1 29 ? -8.763  -5.238  4.254   1.00 0.00 ? 29 LEU A HD12 12 
ATOM   6847  H  HD13 . LEU A 1 29 ? -7.207  -5.624  3.518   1.00 0.00 ? 29 LEU A HD13 12 
ATOM   6848  H  HD21 . LEU A 1 29 ? -9.854  -3.142  3.813   1.00 0.00 ? 29 LEU A HD21 12 
ATOM   6849  H  HD22 . LEU A 1 29 ? -9.698  -2.545  2.160   1.00 0.00 ? 29 LEU A HD22 12 
ATOM   6850  H  HD23 . LEU A 1 29 ? -10.182 -4.215  2.451   1.00 0.00 ? 29 LEU A HD23 12 
ATOM   6851  N  N    . HIS A 1 30 ? -5.140  -0.432  2.121   1.00 0.00 ? 30 HIS A N    12 
ATOM   6852  C  CA   . HIS A 1 30 ? -4.303  0.718   2.425   1.00 0.00 ? 30 HIS A CA   12 
ATOM   6853  C  C    . HIS A 1 30 ? -4.301  1.694   1.254   1.00 0.00 ? 30 HIS A C    12 
ATOM   6854  O  O    . HIS A 1 30 ? -4.180  2.907   1.433   1.00 0.00 ? 30 HIS A O    12 
ATOM   6855  C  CB   . HIS A 1 30 ? -2.866  0.267   2.737   1.00 0.00 ? 30 HIS A CB   12 
ATOM   6856  C  CG   . HIS A 1 30 ? -1.819  1.317   2.476   1.00 0.00 ? 30 HIS A CG   12 
ATOM   6857  N  ND1  . HIS A 1 30 ? -1.647  2.430   3.259   1.00 0.00 ? 30 HIS A ND1  12 
ATOM   6858  C  CD2  . HIS A 1 30 ? -0.907  1.420   1.471   1.00 0.00 ? 30 HIS A CD2  12 
ATOM   6859  C  CE1  . HIS A 1 30 ? -0.665  3.161   2.723   1.00 0.00 ? 30 HIS A CE1  12 
ATOM   6860  N  NE2  . HIS A 1 30 ? -0.174  2.599   1.632   1.00 0.00 ? 30 HIS A NE2  12 
ATOM   6861  H  H    . HIS A 1 30 ? -4.717  -1.276  1.851   1.00 0.00 ? 30 HIS A H    12 
ATOM   6862  H  HA   . HIS A 1 30 ? -4.714  1.210   3.293   1.00 0.00 ? 30 HIS A HA   12 
ATOM   6863  H  HB2  . HIS A 1 30 ? -2.804  -0.008  3.779   1.00 0.00 ? 30 HIS A HB2  12 
ATOM   6864  H  HB3  . HIS A 1 30 ? -2.631  -0.596  2.130   1.00 0.00 ? 30 HIS A HB3  12 
ATOM   6865  H  HD1  . HIS A 1 30 ? -2.170  2.664   4.064   1.00 0.00 ? 30 HIS A HD1  12 
ATOM   6866  H  HD2  . HIS A 1 30 ? -0.766  0.709   0.670   1.00 0.00 ? 30 HIS A HD2  12 
ATOM   6867  H  HE1  . HIS A 1 30 ? -0.315  4.096   3.131   1.00 0.00 ? 30 HIS A HE1  12 
ATOM   6868  N  N    . ARG A 1 31 ? -4.341  1.148   0.052   1.00 0.00 ? 31 ARG A N    12 
ATOM   6869  C  CA   . ARG A 1 31 ? -4.211  1.951   -1.147  1.00 0.00 ? 31 ARG A CA   12 
ATOM   6870  C  C    . ARG A 1 31 ? -5.496  2.718   -1.440  1.00 0.00 ? 31 ARG A C    12 
ATOM   6871  O  O    . ARG A 1 31 ? -5.575  3.463   -2.415  1.00 0.00 ? 31 ARG A O    12 
ATOM   6872  C  CB   . ARG A 1 31 ? -3.840  1.078   -2.341  1.00 0.00 ? 31 ARG A CB   12 
ATOM   6873  C  CG   . ARG A 1 31 ? -2.374  0.689   -2.366  1.00 0.00 ? 31 ARG A CG   12 
ATOM   6874  C  CD   . ARG A 1 31 ? -1.881  0.447   -3.781  1.00 0.00 ? 31 ARG A CD   12 
ATOM   6875  N  NE   . ARG A 1 31 ? -1.692  1.695   -4.519  1.00 0.00 ? 31 ARG A NE   12 
ATOM   6876  C  CZ   . ARG A 1 31 ? -2.479  2.099   -5.518  1.00 0.00 ? 31 ARG A CZ   12 
ATOM   6877  N  NH1  . ARG A 1 31 ? -3.535  1.375   -5.873  1.00 0.00 ? 31 ARG A NH1  12 
ATOM   6878  N  NH2  . ARG A 1 31 ? -2.210  3.229   -6.161  1.00 0.00 ? 31 ARG A NH2  12 
ATOM   6879  H  H    . ARG A 1 31 ? -4.402  0.169   -0.030  1.00 0.00 ? 31 ARG A H    12 
ATOM   6880  H  HA   . ARG A 1 31 ? -3.407  2.657   -0.971  1.00 0.00 ? 31 ARG A HA   12 
ATOM   6881  H  HB2  . ARG A 1 31 ? -4.431  0.174   -2.311  1.00 0.00 ? 31 ARG A HB2  12 
ATOM   6882  H  HB3  . ARG A 1 31 ? -4.066  1.619   -3.248  1.00 0.00 ? 31 ARG A HB3  12 
ATOM   6883  H  HG2  . ARG A 1 31 ? -1.796  1.485   -1.925  1.00 0.00 ? 31 ARG A HG2  12 
ATOM   6884  H  HG3  . ARG A 1 31 ? -2.244  -0.215  -1.789  1.00 0.00 ? 31 ARG A HG3  12 
ATOM   6885  H  HD2  . ARG A 1 31 ? -0.933  -0.073  -3.733  1.00 0.00 ? 31 ARG A HD2  12 
ATOM   6886  H  HD3  . ARG A 1 31 ? -2.605  -0.164  -4.300  1.00 0.00 ? 31 ARG A HD3  12 
ATOM   6887  H  HE   . ARG A 1 31 ? -0.928  2.254   -4.263  1.00 0.00 ? 31 ARG A HE   12 
ATOM   6888  H  HH11 . ARG A 1 31 ? -3.754  0.516   -5.389  1.00 0.00 ? 31 ARG A HH11 12 
ATOM   6889  H  HH12 . ARG A 1 31 ? -4.124  1.679   -6.635  1.00 0.00 ? 31 ARG A HH12 12 
ATOM   6890  H  HH21 . ARG A 1 31 ? -1.408  3.783   -5.904  1.00 0.00 ? 31 ARG A HH21 12 
ATOM   6891  H  HH22 . ARG A 1 31 ? -2.813  3.546   -6.905  1.00 0.00 ? 31 ARG A HH22 12 
ATOM   6892  N  N    . LYS A 1 32 ? -6.487  2.548   -0.572  1.00 0.00 ? 32 LYS A N    12 
ATOM   6893  C  CA   . LYS A 1 32 ? -7.758  3.244   -0.706  1.00 0.00 ? 32 LYS A CA   12 
ATOM   6894  C  C    . LYS A 1 32 ? -7.550  4.749   -0.628  1.00 0.00 ? 32 LYS A C    12 
ATOM   6895  O  O    . LYS A 1 32 ? -8.257  5.516   -1.278  1.00 0.00 ? 32 LYS A O    12 
ATOM   6896  C  CB   . LYS A 1 32 ? -8.727  2.793   0.388   1.00 0.00 ? 32 LYS A CB   12 
ATOM   6897  C  CG   . LYS A 1 32 ? -9.954  2.074   -0.143  1.00 0.00 ? 32 LYS A CG   12 
ATOM   6898  C  CD   . LYS A 1 32 ? -9.576  0.962   -1.112  1.00 0.00 ? 32 LYS A CD   12 
ATOM   6899  C  CE   . LYS A 1 32 ? -10.516 -0.223  -0.994  1.00 0.00 ? 32 LYS A CE   12 
ATOM   6900  N  NZ   . LYS A 1 32 ? -10.387 -1.153  -2.145  1.00 0.00 ? 32 LYS A NZ   12 
ATOM   6901  H  H    . LYS A 1 32 ? -6.360  1.933   0.182   1.00 0.00 ? 32 LYS A H    12 
ATOM   6902  H  HA   . LYS A 1 32 ? -8.175  2.998   -1.671  1.00 0.00 ? 32 LYS A HA   12 
ATOM   6903  H  HB2  . LYS A 1 32 ? -8.208  2.125   1.058   1.00 0.00 ? 32 LYS A HB2  12 
ATOM   6904  H  HB3  . LYS A 1 32 ? -9.055  3.662   0.939   1.00 0.00 ? 32 LYS A HB3  12 
ATOM   6905  H  HG2  . LYS A 1 32 ? -10.495 1.645   0.688   1.00 0.00 ? 32 LYS A HG2  12 
ATOM   6906  H  HG3  . LYS A 1 32 ? -10.583 2.786   -0.654  1.00 0.00 ? 32 LYS A HG3  12 
ATOM   6907  H  HD2  . LYS A 1 32 ? -9.622  1.346   -2.122  1.00 0.00 ? 32 LYS A HD2  12 
ATOM   6908  H  HD3  . LYS A 1 32 ? -8.566  0.636   -0.896  1.00 0.00 ? 32 LYS A HD3  12 
ATOM   6909  H  HE2  . LYS A 1 32 ? -10.286 -0.759  -0.085  1.00 0.00 ? 32 LYS A HE2  12 
ATOM   6910  H  HE3  . LYS A 1 32 ? -11.531 0.142   -0.949  1.00 0.00 ? 32 LYS A HE3  12 
ATOM   6911  H  HZ1  . LYS A 1 32 ? -11.327 -1.371  -2.539  1.00 0.00 ? 32 LYS A HZ1  12 
ATOM   6912  H  HZ2  . LYS A 1 32 ? -9.939  -2.044  -1.837  1.00 0.00 ? 32 LYS A HZ2  12 
ATOM   6913  H  HZ3  . LYS A 1 32 ? -9.801  -0.721  -2.893  1.00 0.00 ? 32 LYS A HZ3  12 
ATOM   6914  N  N    . ARG A 1 33 ? -6.547  5.159   0.137   1.00 0.00 ? 33 ARG A N    12 
ATOM   6915  C  CA   . ARG A 1 33 ? -6.215  6.571   0.270   1.00 0.00 ? 33 ARG A CA   12 
ATOM   6916  C  C    . ARG A 1 33 ? -5.287  7.023   -0.857  1.00 0.00 ? 33 ARG A C    12 
ATOM   6917  O  O    . ARG A 1 33 ? -4.831  8.166   -0.881  1.00 0.00 ? 33 ARG A O    12 
ATOM   6918  C  CB   . ARG A 1 33 ? -5.574  6.843   1.635   1.00 0.00 ? 33 ARG A CB   12 
ATOM   6919  C  CG   . ARG A 1 33 ? -4.169  6.285   1.785   1.00 0.00 ? 33 ARG A CG   12 
ATOM   6920  C  CD   . ARG A 1 33 ? -3.432  6.953   2.934   1.00 0.00 ? 33 ARG A CD   12 
ATOM   6921  N  NE   . ARG A 1 33 ? -2.190  7.586   2.494   1.00 0.00 ? 33 ARG A NE   12 
ATOM   6922  C  CZ   . ARG A 1 33 ? -0.982  7.268   2.963   1.00 0.00 ? 33 ARG A CZ   12 
ATOM   6923  N  NH1  . ARG A 1 33 ? -0.844  6.306   3.866   1.00 0.00 ? 33 ARG A NH1  12 
ATOM   6924  N  NH2  . ARG A 1 33 ? 0.089   7.910   2.522   1.00 0.00 ? 33 ARG A NH2  12 
ATOM   6925  H  H    . ARG A 1 33 ? -6.007  4.492   0.614   1.00 0.00 ? 33 ARG A H    12 
ATOM   6926  H  HA   . ARG A 1 33 ? -7.134  7.131   0.200   1.00 0.00 ? 33 ARG A HA   12 
ATOM   6927  H  HB2  . ARG A 1 33 ? -5.530  7.910   1.789   1.00 0.00 ? 33 ARG A HB2  12 
ATOM   6928  H  HB3  . ARG A 1 33 ? -6.194  6.404   2.403   1.00 0.00 ? 33 ARG A HB3  12 
ATOM   6929  H  HG2  . ARG A 1 33 ? -4.233  5.225   1.981   1.00 0.00 ? 33 ARG A HG2  12 
ATOM   6930  H  HG3  . ARG A 1 33 ? -3.622  6.453   0.870   1.00 0.00 ? 33 ARG A HG3  12 
ATOM   6931  H  HD2  . ARG A 1 33 ? -4.074  7.705   3.367   1.00 0.00 ? 33 ARG A HD2  12 
ATOM   6932  H  HD3  . ARG A 1 33 ? -3.200  6.206   3.678   1.00 0.00 ? 33 ARG A HD3  12 
ATOM   6933  H  HE   . ARG A 1 33 ? -2.264  8.304   1.821   1.00 0.00 ? 33 ARG A HE   12 
ATOM   6934  H  HH11 . ARG A 1 33 ? -1.650  5.806   4.204   1.00 0.00 ? 33 ARG A HH11 12 
ATOM   6935  H  HH12 . ARG A 1 33 ? 0.069   6.077   4.226   1.00 0.00 ? 33 ARG A HH12 12 
ATOM   6936  H  HH21 . ARG A 1 33 ? -0.006  8.636   1.829   1.00 0.00 ? 33 ARG A HH21 12 
ATOM   6937  H  HH22 . ARG A 1 33 ? 1.001   7.686   2.885   1.00 0.00 ? 33 ARG A HH22 12 
ATOM   6938  N  N    . HIS A 1 34 ? -5.041  6.136   -1.813  1.00 0.00 ? 34 HIS A N    12 
ATOM   6939  C  CA   . HIS A 1 34 ? -4.214  6.466   -2.964  1.00 0.00 ? 34 HIS A CA   12 
ATOM   6940  C  C    . HIS A 1 34 ? -5.071  6.559   -4.218  1.00 0.00 ? 34 HIS A C    12 
ATOM   6941  O  O    . HIS A 1 34 ? -4.557  6.682   -5.333  1.00 0.00 ? 34 HIS A O    12 
ATOM   6942  C  CB   . HIS A 1 34 ? -3.127  5.411   -3.170  1.00 0.00 ? 34 HIS A CB   12 
ATOM   6943  C  CG   . HIS A 1 34 ? -2.104  5.362   -2.079  1.00 0.00 ? 34 HIS A CG   12 
ATOM   6944  N  ND1  . HIS A 1 34 ? -1.431  6.461   -1.596  1.00 0.00 ? 34 HIS A ND1  12 
ATOM   6945  C  CD2  . HIS A 1 34 ? -1.614  4.299   -1.400  1.00 0.00 ? 34 HIS A CD2  12 
ATOM   6946  C  CE1  . HIS A 1 34 ? -0.567  6.033   -0.666  1.00 0.00 ? 34 HIS A CE1  12 
ATOM   6947  N  NE2  . HIS A 1 34 ? -0.637  4.722   -0.511  1.00 0.00 ? 34 HIS A NE2  12 
ATOM   6948  H  H    . HIS A 1 34 ? -5.459  5.245   -1.762  1.00 0.00 ? 34 HIS A H    12 
ATOM   6949  H  HA   . HIS A 1 34 ? -3.751  7.424   -2.783  1.00 0.00 ? 34 HIS A HA   12 
ATOM   6950  H  HB2  . HIS A 1 34 ? -3.590  4.438   -3.229  1.00 0.00 ? 34 HIS A HB2  12 
ATOM   6951  H  HB3  . HIS A 1 34 ? -2.612  5.615   -4.097  1.00 0.00 ? 34 HIS A HB3  12 
ATOM   6952  H  HD1  . HIS A 1 34 ? -1.557  7.399   -1.886  1.00 0.00 ? 34 HIS A HD1  12 
ATOM   6953  H  HD2  . HIS A 1 34 ? -1.930  3.272   -1.516  1.00 0.00 ? 34 HIS A HD2  12 
ATOM   6954  H  HE1  . HIS A 1 34 ? 0.100   6.678   -0.111  1.00 0.00 ? 34 HIS A HE1  12 
ATOM   6955  N  N    . MET A 1 35 ? -6.380  6.480   -4.028  1.00 0.00 ? 35 MET A N    12 
ATOM   6956  C  CA   . MET A 1 35 ? -7.320  6.514   -5.139  1.00 0.00 ? 35 MET A CA   12 
ATOM   6957  C  C    . MET A 1 35 ? -7.473  7.931   -5.669  1.00 0.00 ? 35 MET A C    12 
ATOM   6958  O  O    . MET A 1 35 ? -7.198  8.201   -6.842  1.00 0.00 ? 35 MET A O    12 
ATOM   6959  C  CB   . MET A 1 35 ? -8.679  5.968   -4.700  1.00 0.00 ? 35 MET A CB   12 
ATOM   6960  C  CG   . MET A 1 35 ? -8.707  4.456   -4.559  1.00 0.00 ? 35 MET A CG   12 
ATOM   6961  S  SD   . MET A 1 35 ? -9.814  3.674   -5.745  1.00 0.00 ? 35 MET A SD   12 
ATOM   6962  C  CE   . MET A 1 35 ? -8.683  2.552   -6.564  1.00 0.00 ? 35 MET A CE   12 
ATOM   6963  H  H    . MET A 1 35 ? -6.724  6.395   -3.113  1.00 0.00 ? 35 MET A H    12 
ATOM   6964  H  HA   . MET A 1 35 ? -6.927  5.889   -5.926  1.00 0.00 ? 35 MET A HA   12 
ATOM   6965  H  HB2  . MET A 1 35 ? -8.939  6.403   -3.746  1.00 0.00 ? 35 MET A HB2  12 
ATOM   6966  H  HB3  . MET A 1 35 ? -9.420  6.253   -5.431  1.00 0.00 ? 35 MET A HB3  12 
ATOM   6967  H  HG2  . MET A 1 35 ? -7.709  4.074   -4.713  1.00 0.00 ? 35 MET A HG2  12 
ATOM   6968  H  HG3  . MET A 1 35 ? -9.038  4.207   -3.560  1.00 0.00 ? 35 MET A HG3  12 
ATOM   6969  H  HE1  . MET A 1 35 ? -8.958  2.456   -7.605  1.00 0.00 ? 35 MET A HE1  12 
ATOM   6970  H  HE2  . MET A 1 35 ? -7.676  2.937   -6.491  1.00 0.00 ? 35 MET A HE2  12 
ATOM   6971  H  HE3  . MET A 1 35 ? -8.733  1.583   -6.089  1.00 0.00 ? 35 MET A HE3  12 
ATOM   6972  N  N    . LEU A 1 36 ? -7.883  8.837   -4.793  1.00 0.00 ? 36 LEU A N    12 
ATOM   6973  C  CA   . LEU A 1 36 ? -8.043  10.241  -5.143  1.00 0.00 ? 36 LEU A CA   12 
ATOM   6974  C  C    . LEU A 1 36 ? -7.766  11.100  -3.920  1.00 0.00 ? 36 LEU A C    12 
ATOM   6975  O  O    . LEU A 1 36 ? -8.592  11.929  -3.530  1.00 0.00 ? 36 LEU A O    12 
ATOM   6976  C  CB   . LEU A 1 36 ? -9.458  10.523  -5.664  1.00 0.00 ? 36 LEU A CB   12 
ATOM   6977  C  CG   . LEU A 1 36 ? -10.287 9.293   -6.035  1.00 0.00 ? 36 LEU A CG   12 
ATOM   6978  C  CD1  . LEU A 1 36 ? -11.541 9.222   -5.180  1.00 0.00 ? 36 LEU A CD1  12 
ATOM   6979  C  CD2  . LEU A 1 36 ? -10.645 9.320   -7.512  1.00 0.00 ? 36 LEU A CD2  12 
ATOM   6980  H  H    . LEU A 1 36 ? -8.049  8.562   -3.860  1.00 0.00 ? 36 LEU A H    12 
ATOM   6981  H  HA   . LEU A 1 36 ? -7.323  10.480  -5.912  1.00 0.00 ? 36 LEU A HA   12 
ATOM   6982  H  HB2  . LEU A 1 36 ? -9.992  11.068  -4.902  1.00 0.00 ? 36 LEU A HB2  12 
ATOM   6983  H  HB3  . LEU A 1 36 ? -9.377  11.149  -6.540  1.00 0.00 ? 36 LEU A HB3  12 
ATOM   6984  H  HG   . LEU A 1 36 ? -9.704  8.402   -5.846  1.00 0.00 ? 36 LEU A HG   12 
ATOM   6985  H  HD11 . LEU A 1 36 ? -11.373 8.556   -4.347  1.00 0.00 ? 36 LEU A HD11 12 
ATOM   6986  H  HD12 . LEU A 1 36 ? -11.781 10.209  -4.810  1.00 0.00 ? 36 LEU A HD12 12 
ATOM   6987  H  HD13 . LEU A 1 36 ? -12.362 8.852   -5.776  1.00 0.00 ? 36 LEU A HD13 12 
ATOM   6988  H  HD21 . LEU A 1 36 ? -9.745  9.244   -8.101  1.00 0.00 ? 36 LEU A HD21 12 
ATOM   6989  H  HD22 . LEU A 1 36 ? -11.296 8.489   -7.740  1.00 0.00 ? 36 LEU A HD22 12 
ATOM   6990  H  HD23 . LEU A 1 36 ? -11.150 10.247  -7.741  1.00 0.00 ? 36 LEU A HD23 12 
ATOM   6991  N  N    . VAL A 1 37 ? -6.598  10.876  -3.322  1.00 0.00 ? 37 VAL A N    12 
ATOM   6992  C  CA   . VAL A 1 37 ? -6.178  11.571  -2.108  1.00 0.00 ? 37 VAL A CA   12 
ATOM   6993  C  C    . VAL A 1 37 ? -7.189  11.357  -0.982  1.00 0.00 ? 37 VAL A C    12 
ATOM   6994  O  O    . VAL A 1 37 ? -8.070  12.218  -0.779  1.00 0.00 ? 37 VAL A O    12 
ATOM   6995  C  CB   . VAL A 1 37 ? -5.948  13.082  -2.342  1.00 0.00 ? 37 VAL A CB   12 
ATOM   6996  C  CG1  . VAL A 1 37 ? -5.296  13.721  -1.124  1.00 0.00 ? 37 VAL A CG1  12 
ATOM   6997  C  CG2  . VAL A 1 37 ? -5.089  13.305  -3.581  1.00 0.00 ? 37 VAL A CG2  12 
ATOM   6998  O  OXT  . VAL A 1 37 ? -7.111  10.302  -0.319  1.00 0.00 ? 37 VAL A OXT  12 
ATOM   6999  H  H    . VAL A 1 37 ? -6.006  10.192  -3.694  1.00 0.00 ? 37 VAL A H    12 
ATOM   7000  H  HA   . VAL A 1 37 ? -5.237  11.136  -1.803  1.00 0.00 ? 37 VAL A HA   12 
ATOM   7001  H  HB   . VAL A 1 37 ? -6.907  13.553  -2.503  1.00 0.00 ? 37 VAL A HB   12 
ATOM   7002  H  HG11 . VAL A 1 37 ? -5.948  13.619  -0.269  1.00 0.00 ? 37 VAL A HG11 12 
ATOM   7003  H  HG12 . VAL A 1 37 ? -4.356  13.229  -0.920  1.00 0.00 ? 37 VAL A HG12 12 
ATOM   7004  H  HG13 . VAL A 1 37 ? -5.117  14.769  -1.319  1.00 0.00 ? 37 VAL A HG13 12 
ATOM   7005  H  HG21 . VAL A 1 37 ? -4.476  12.432  -3.755  1.00 0.00 ? 37 VAL A HG21 12 
ATOM   7006  H  HG22 . VAL A 1 37 ? -5.726  13.473  -4.437  1.00 0.00 ? 37 VAL A HG22 12 
ATOM   7007  H  HG23 . VAL A 1 37 ? -4.454  14.165  -3.429  1.00 0.00 ? 37 VAL A HG23 12 
HETATM 7008  ZN ZN   . ZN  B 2 .  ? 0.797   3.623   0.245   1.00 0.00 ? 38 ZN  A ZN   12 
ATOM   7009  N  N    . GLY A 1 1  ? 6.105   -3.395  6.917   1.00 0.00 ? 1  GLY A N    13 
ATOM   7010  C  CA   . GLY A 1 1  ? 6.261   -1.923  6.986   1.00 0.00 ? 1  GLY A CA   13 
ATOM   7011  C  C    . GLY A 1 1  ? 6.769   -1.346  5.683   1.00 0.00 ? 1  GLY A C    13 
ATOM   7012  O  O    . GLY A 1 1  ? 6.925   -2.071  4.700   1.00 0.00 ? 1  GLY A O    13 
ATOM   7013  H  H1   . GLY A 1 1  ? 6.789   -3.860  7.553   1.00 0.00 ? 1  GLY A H1   13 
ATOM   7014  H  H2   . GLY A 1 1  ? 6.276   -3.726  5.943   1.00 0.00 ? 1  GLY A H2   13 
ATOM   7015  H  H3   . GLY A 1 1  ? 5.142   -3.671  7.196   1.00 0.00 ? 1  GLY A H3   13 
ATOM   7016  H  HA2  . GLY A 1 1  ? 5.303   -1.480  7.216   1.00 0.00 ? 1  GLY A HA2  13 
ATOM   7017  H  HA3  . GLY A 1 1  ? 6.959   -1.680  7.774   1.00 0.00 ? 1  GLY A HA3  13 
ATOM   7018  N  N    . SER A 1 2  ? 7.015   -0.046  5.664   1.00 0.00 ? 2  SER A N    13 
ATOM   7019  C  CA   . SER A 1 2  ? 7.500   0.618   4.468   1.00 0.00 ? 2  SER A CA   13 
ATOM   7020  C  C    . SER A 1 2  ? 9.019   0.512   4.375   1.00 0.00 ? 2  SER A C    13 
ATOM   7021  O  O    . SER A 1 2  ? 9.747   1.169   5.130   1.00 0.00 ? 2  SER A O    13 
ATOM   7022  C  CB   . SER A 1 2  ? 7.062   2.084   4.472   1.00 0.00 ? 2  SER A CB   13 
ATOM   7023  O  OG   . SER A 1 2  ? 5.996   2.292   5.389   1.00 0.00 ? 2  SER A OG   13 
ATOM   7024  H  H    . SER A 1 2  ? 6.866   0.486   6.477   1.00 0.00 ? 2  SER A H    13 
ATOM   7025  H  HA   . SER A 1 2  ? 7.064   0.123   3.614   1.00 0.00 ? 2  SER A HA   13 
ATOM   7026  H  HB2  . SER A 1 2  ? 7.895   2.707   4.759   1.00 0.00 ? 2  SER A HB2  13 
ATOM   7027  H  HB3  . SER A 1 2  ? 6.730   2.360   3.482   1.00 0.00 ? 2  SER A HB3  13 
ATOM   7028  H  HG   . SER A 1 2  ? 5.636   3.184   5.267   1.00 0.00 ? 2  SER A HG   13 
ATOM   7029  N  N    . THR A 1 3  ? 9.481   -0.330  3.453   1.00 0.00 ? 3  THR A N    13 
ATOM   7030  C  CA   . THR A 1 3  ? 10.907  -0.553  3.224   1.00 0.00 ? 3  THR A CA   13 
ATOM   7031  C  C    . THR A 1 3  ? 11.619  -0.994  4.511   1.00 0.00 ? 3  THR A C    13 
ATOM   7032  O  O    . THR A 1 3  ? 11.141  -1.904  5.193   1.00 0.00 ? 3  THR A O    13 
ATOM   7033  C  CB   . THR A 1 3  ? 11.569  0.703   2.612   1.00 0.00 ? 3  THR A CB   13 
ATOM   7034  O  OG1  . THR A 1 3  ? 10.620  1.388   1.785   1.00 0.00 ? 3  THR A OG1  13 
ATOM   7035  C  CG2  . THR A 1 3  ? 12.785  0.327   1.772   1.00 0.00 ? 3  THR A CG2  13 
ATOM   7036  H  H    . THR A 1 3  ? 8.834   -0.808  2.888   1.00 0.00 ? 3  THR A H    13 
ATOM   7037  H  HA   . THR A 1 3  ? 10.998  -1.352  2.506   1.00 0.00 ? 3  THR A HA   13 
ATOM   7038  H  HB   . THR A 1 3  ? 11.882  1.361   3.410   1.00 0.00 ? 3  THR A HB   13 
ATOM   7039  H  HG1  . THR A 1 3  ? 10.391  0.822   1.027   1.00 0.00 ? 3  THR A HG1  13 
ATOM   7040  H  HG21 . THR A 1 3  ? 13.612  0.974   2.028   1.00 0.00 ? 3  THR A HG21 13 
ATOM   7041  H  HG22 . THR A 1 3  ? 12.549  0.441   0.726   1.00 0.00 ? 3  THR A HG22 13 
ATOM   7042  H  HG23 . THR A 1 3  ? 13.057  -0.699  1.971   1.00 0.00 ? 3  THR A HG23 13 
ATOM   7043  N  N    . ARG A 1 4  ? 12.788  -0.412  4.782   1.00 0.00 ? 4  ARG A N    13 
ATOM   7044  C  CA   . ARG A 1 4  ? 13.622  -0.785  5.928   1.00 0.00 ? 4  ARG A CA   13 
ATOM   7045  C  C    . ARG A 1 4  ? 14.247  -2.154  5.702   1.00 0.00 ? 4  ARG A C    13 
ATOM   7046  O  O    . ARG A 1 4  ? 13.743  -3.173  6.170   1.00 0.00 ? 4  ARG A O    13 
ATOM   7047  C  CB   . ARG A 1 4  ? 12.827  -0.775  7.239   1.00 0.00 ? 4  ARG A CB   13 
ATOM   7048  C  CG   . ARG A 1 4  ? 12.863  0.555   7.966   1.00 0.00 ? 4  ARG A CG   13 
ATOM   7049  C  CD   . ARG A 1 4  ? 11.474  0.982   8.404   1.00 0.00 ? 4  ARG A CD   13 
ATOM   7050  N  NE   . ARG A 1 4  ? 11.267  0.782   9.835   1.00 0.00 ? 4  ARG A NE   13 
ATOM   7051  C  CZ   . ARG A 1 4  ? 10.438  1.513   10.580  1.00 0.00 ? 4  ARG A CZ   13 
ATOM   7052  N  NH1  . ARG A 1 4  ? 9.701   2.469   10.028  1.00 0.00 ? 4  ARG A NH1  13 
ATOM   7053  N  NH2  . ARG A 1 4  ? 10.337  1.275   11.880  1.00 0.00 ? 4  ARG A NH2  13 
ATOM   7054  H  H    . ARG A 1 4  ? 13.140  0.241   4.144   1.00 0.00 ? 4  ARG A H    13 
ATOM   7055  H  HA   . ARG A 1 4  ? 14.416  -0.056  5.999   1.00 0.00 ? 4  ARG A HA   13 
ATOM   7056  H  HB2  . ARG A 1 4  ? 11.796  -1.015  7.021   1.00 0.00 ? 4  ARG A HB2  13 
ATOM   7057  H  HB3  . ARG A 1 4  ? 13.232  -1.532  7.895   1.00 0.00 ? 4  ARG A HB3  13 
ATOM   7058  H  HG2  . ARG A 1 4  ? 13.490  0.462   8.838   1.00 0.00 ? 4  ARG A HG2  13 
ATOM   7059  H  HG3  . ARG A 1 4  ? 13.269  1.306   7.305   1.00 0.00 ? 4  ARG A HG3  13 
ATOM   7060  H  HD2  . ARG A 1 4  ? 11.345  2.030   8.174   1.00 0.00 ? 4  ARG A HD2  13 
ATOM   7061  H  HD3  . ARG A 1 4  ? 10.744  0.402   7.860   1.00 0.00 ? 4  ARG A HD3  13 
ATOM   7062  H  HE   . ARG A 1 4  ? 11.787  0.068   10.268  1.00 0.00 ? 4  ARG A HE   13 
ATOM   7063  H  HH11 . ARG A 1 4  ? 9.764   2.649   9.042   1.00 0.00 ? 4  ARG A HH11 13 
ATOM   7064  H  HH12 . ARG A 1 4  ? 9.070   3.016   10.595  1.00 0.00 ? 4  ARG A HH12 13 
ATOM   7065  H  HH21 . ARG A 1 4  ? 10.884  0.543   12.301  1.00 0.00 ? 4  ARG A HH21 13 
ATOM   7066  H  HH22 . ARG A 1 4  ? 9.723   1.832   12.454  1.00 0.00 ? 4  ARG A HH22 13 
ATOM   7067  N  N    . GLY A 1 5  ? 15.310  -2.173  4.915   1.00 0.00 ? 5  GLY A N    13 
ATOM   7068  C  CA   . GLY A 1 5  ? 15.955  -3.418  4.566   1.00 0.00 ? 5  GLY A CA   13 
ATOM   7069  C  C    . GLY A 1 5  ? 15.722  -3.774  3.117   1.00 0.00 ? 5  GLY A C    13 
ATOM   7070  O  O    . GLY A 1 5  ? 16.434  -3.297  2.233   1.00 0.00 ? 5  GLY A O    13 
ATOM   7071  H  H    . GLY A 1 5  ? 15.638  -1.330  4.525   1.00 0.00 ? 5  GLY A H    13 
ATOM   7072  H  HA2  . GLY A 1 5  ? 17.018  -3.326  4.741   1.00 0.00 ? 5  GLY A HA2  13 
ATOM   7073  H  HA3  . GLY A 1 5  ? 15.563  -4.207  5.190   1.00 0.00 ? 5  GLY A HA3  13 
ATOM   7074  N  N    . SER A 1 6  ? 14.660  -4.518  2.860   1.00 0.00 ? 6  SER A N    13 
ATOM   7075  C  CA   . SER A 1 6  ? 14.286  -4.866  1.501   1.00 0.00 ? 6  SER A CA   13 
ATOM   7076  C  C    . SER A 1 6  ? 13.371  -3.798  0.913   1.00 0.00 ? 6  SER A C    13 
ATOM   7077  O  O    . SER A 1 6  ? 12.547  -3.213  1.618   1.00 0.00 ? 6  SER A O    13 
ATOM   7078  C  CB   . SER A 1 6  ? 13.593  -6.227  1.480   1.00 0.00 ? 6  SER A CB   13 
ATOM   7079  O  OG   . SER A 1 6  ? 14.134  -7.084  2.471   1.00 0.00 ? 6  SER A OG   13 
ATOM   7080  H  H    . SER A 1 6  ? 14.077  -4.789  3.598   1.00 0.00 ? 6  SER A H    13 
ATOM   7081  H  HA   . SER A 1 6  ? 15.188  -4.918  0.910   1.00 0.00 ? 6  SER A HA   13 
ATOM   7082  H  HB2  . SER A 1 6  ? 12.538  -6.095  1.673   1.00 0.00 ? 6  SER A HB2  13 
ATOM   7083  H  HB3  . SER A 1 6  ? 13.729  -6.686  0.511   1.00 0.00 ? 6  SER A HB3  13 
ATOM   7084  H  HG   . SER A 1 6  ? 15.090  -6.930  2.534   1.00 0.00 ? 6  SER A HG   13 
ATOM   7085  N  N    . THR A 1 7  ? 13.527  -3.541  -0.373  1.00 0.00 ? 7  THR A N    13 
ATOM   7086  C  CA   . THR A 1 7  ? 12.714  -2.552  -1.052  1.00 0.00 ? 7  THR A CA   13 
ATOM   7087  C  C    . THR A 1 7  ? 11.407  -3.179  -1.516  1.00 0.00 ? 7  THR A C    13 
ATOM   7088  O  O    . THR A 1 7  ? 11.365  -3.864  -2.542  1.00 0.00 ? 7  THR A O    13 
ATOM   7089  C  CB   . THR A 1 7  ? 13.464  -1.958  -2.255  1.00 0.00 ? 7  THR A CB   13 
ATOM   7090  O  OG1  . THR A 1 7  ? 14.151  -3.005  -2.959  1.00 0.00 ? 7  THR A OG1  13 
ATOM   7091  C  CG2  . THR A 1 7  ? 14.465  -0.911  -1.795  1.00 0.00 ? 7  THR A CG2  13 
ATOM   7092  H  H    . THR A 1 7  ? 14.202  -4.041  -0.886  1.00 0.00 ? 7  THR A H    13 
ATOM   7093  H  HA   . THR A 1 7  ? 12.498  -1.756  -0.354  1.00 0.00 ? 7  THR A HA   13 
ATOM   7094  H  HB   . THR A 1 7  ? 12.751  -1.491  -2.918  1.00 0.00 ? 7  THR A HB   13 
ATOM   7095  H  HG1  . THR A 1 7  ? 13.606  -3.805  -2.953  1.00 0.00 ? 7  THR A HG1  13 
ATOM   7096  H  HG21 . THR A 1 7  ? 15.469  -1.267  -1.974  1.00 0.00 ? 7  THR A HG21 13 
ATOM   7097  H  HG22 . THR A 1 7  ? 14.332  -0.726  -0.737  1.00 0.00 ? 7  THR A HG22 13 
ATOM   7098  H  HG23 . THR A 1 7  ? 14.305  0.005   -2.343  1.00 0.00 ? 7  THR A HG23 13 
ATOM   7099  N  N    . GLY A 1 8  ? 10.377  -3.030  -0.705  1.00 0.00 ? 8  GLY A N    13 
ATOM   7100  C  CA   . GLY A 1 8  ? 9.104   -3.641  -1.003  1.00 0.00 ? 8  GLY A CA   13 
ATOM   7101  C  C    . GLY A 1 8  ? 9.046   -5.081  -0.543  1.00 0.00 ? 8  GLY A C    13 
ATOM   7102  O  O    . GLY A 1 8  ? 9.120   -6.004  -1.354  1.00 0.00 ? 8  GLY A O    13 
ATOM   7103  H  H    . GLY A 1 8  ? 10.490  -2.520  0.126   1.00 0.00 ? 8  GLY A H    13 
ATOM   7104  H  HA2  . GLY A 1 8  ? 8.321   -3.082  -0.511  1.00 0.00 ? 8  GLY A HA2  13 
ATOM   7105  H  HA3  . GLY A 1 8  ? 8.943   -3.608  -2.070  1.00 0.00 ? 8  GLY A HA3  13 
ATOM   7106  N  N    . ILE A 1 9  ? 8.901   -5.272  0.760   1.00 0.00 ? 9  ILE A N    13 
ATOM   7107  C  CA   . ILE A 1 9  ? 8.795   -6.606  1.321   1.00 0.00 ? 9  ILE A CA   13 
ATOM   7108  C  C    . ILE A 1 9  ? 7.429   -7.195  0.976   1.00 0.00 ? 9  ILE A C    13 
ATOM   7109  O  O    . ILE A 1 9  ? 6.503   -6.446  0.658   1.00 0.00 ? 9  ILE A O    13 
ATOM   7110  C  CB   . ILE A 1 9  ? 8.971   -6.566  2.856   1.00 0.00 ? 9  ILE A CB   13 
ATOM   7111  C  CG1  . ILE A 1 9  ? 9.990   -5.498  3.261   1.00 0.00 ? 9  ILE A CG1  13 
ATOM   7112  C  CG2  . ILE A 1 9  ? 9.398   -7.924  3.388   1.00 0.00 ? 9  ILE A CG2  13 
ATOM   7113  C  CD1  . ILE A 1 9  ? 9.660   -4.814  4.570   1.00 0.00 ? 9  ILE A CD1  13 
ATOM   7114  H  H    . ILE A 1 9  ? 8.811   -4.498  1.351   1.00 0.00 ? 9  ILE A H    13 
ATOM   7115  H  HA   . ILE A 1 9  ? 9.572   -7.223  0.895   1.00 0.00 ? 9  ILE A HA   13 
ATOM   7116  H  HB   . ILE A 1 9  ? 8.015   -6.319  3.292   1.00 0.00 ? 9  ILE A HB   13 
ATOM   7117  H  HG12 . ILE A 1 9  ? 10.961  -5.958  3.365   1.00 0.00 ? 9  ILE A HG12 13 
ATOM   7118  H  HG13 . ILE A 1 9  ? 10.036  -4.741  2.492   1.00 0.00 ? 9  ILE A HG13 13 
ATOM   7119  H  HG21 . ILE A 1 9  ? 10.473  -8.007  3.334   1.00 0.00 ? 9  ILE A HG21 13 
ATOM   7120  H  HG22 . ILE A 1 9  ? 9.080   -8.025  4.415   1.00 0.00 ? 9  ILE A HG22 13 
ATOM   7121  H  HG23 . ILE A 1 9  ? 8.945   -8.703  2.792   1.00 0.00 ? 9  ILE A HG23 13 
ATOM   7122  H  HD11 . ILE A 1 9  ? 10.551  -4.746  5.175   1.00 0.00 ? 9  ILE A HD11 13 
ATOM   7123  H  HD12 . ILE A 1 9  ? 9.281   -3.821  4.373   1.00 0.00 ? 9  ILE A HD12 13 
ATOM   7124  H  HD13 . ILE A 1 9  ? 8.910   -5.387  5.096   1.00 0.00 ? 9  ILE A HD13 13 
ATOM   7125  N  N    . LYS A 1 10 ? 7.297   -8.522  1.076   1.00 0.00 ? 10 LYS A N    13 
ATOM   7126  C  CA   . LYS A 1 10 ? 6.030   -9.200  0.785   1.00 0.00 ? 10 LYS A CA   13 
ATOM   7127  C  C    . LYS A 1 10 ? 5.662   -9.079  -0.700  1.00 0.00 ? 10 LYS A C    13 
ATOM   7128  O  O    . LYS A 1 10 ? 6.108   -8.164  -1.393  1.00 0.00 ? 10 LYS A O    13 
ATOM   7129  C  CB   . LYS A 1 10 ? 4.907   -8.662  1.676   1.00 0.00 ? 10 LYS A CB   13 
ATOM   7130  C  CG   . LYS A 1 10 ? 4.527   -9.613  2.799   1.00 0.00 ? 10 LYS A CG   13 
ATOM   7131  C  CD   . LYS A 1 10 ? 4.436   -8.899  4.134   1.00 0.00 ? 10 LYS A CD   13 
ATOM   7132  C  CE   . LYS A 1 10 ? 5.720   -9.053  4.927   1.00 0.00 ? 10 LYS A CE   13 
ATOM   7133  N  NZ   . LYS A 1 10 ? 5.814   -10.377 5.598   1.00 0.00 ? 10 LYS A NZ   13 
ATOM   7134  H  H    . LYS A 1 10 ? 8.071   -9.057  1.346   1.00 0.00 ? 10 LYS A H    13 
ATOM   7135  H  HA   . LYS A 1 10 ? 6.170   -10.248 1.008   1.00 0.00 ? 10 LYS A HA   13 
ATOM   7136  H  HB2  . LYS A 1 10 ? 5.226   -7.728  2.114   1.00 0.00 ? 10 LYS A HB2  13 
ATOM   7137  H  HB3  . LYS A 1 10 ? 4.030   -8.485  1.069   1.00 0.00 ? 10 LYS A HB3  13 
ATOM   7138  H  HG2  . LYS A 1 10 ? 3.570   -10.052 2.574   1.00 0.00 ? 10 LYS A HG2  13 
ATOM   7139  H  HG3  . LYS A 1 10 ? 5.273   -10.391 2.866   1.00 0.00 ? 10 LYS A HG3  13 
ATOM   7140  H  HD2  . LYS A 1 10 ? 4.254   -7.849  3.959   1.00 0.00 ? 10 LYS A HD2  13 
ATOM   7141  H  HD3  . LYS A 1 10 ? 3.617   -9.319  4.703   1.00 0.00 ? 10 LYS A HD3  13 
ATOM   7142  H  HE2  . LYS A 1 10 ? 6.552   -8.945  4.250   1.00 0.00 ? 10 LYS A HE2  13 
ATOM   7143  H  HE3  . LYS A 1 10 ? 5.761   -8.274  5.674   1.00 0.00 ? 10 LYS A HE3  13 
ATOM   7144  H  HZ1  . LYS A 1 10 ? 5.072   -11.020 5.239   1.00 0.00 ? 10 LYS A HZ1  13 
ATOM   7145  H  HZ2  . LYS A 1 10 ? 5.694   -10.269 6.627   1.00 0.00 ? 10 LYS A HZ2  13 
ATOM   7146  H  HZ3  . LYS A 1 10 ? 6.747   -10.806 5.409   1.00 0.00 ? 10 LYS A HZ3  13 
ATOM   7147  N  N    . PRO A 1 11 ? 4.962   -10.086 -1.245  1.00 0.00 ? 11 PRO A N    13 
ATOM   7148  C  CA   . PRO A 1 11 ? 4.623   -10.141 -2.674  1.00 0.00 ? 11 PRO A CA   13 
ATOM   7149  C  C    . PRO A 1 11 ? 3.809   -8.934  -3.147  1.00 0.00 ? 11 PRO A C    13 
ATOM   7150  O  O    . PRO A 1 11 ? 3.766   -8.641  -4.342  1.00 0.00 ? 11 PRO A O    13 
ATOM   7151  C  CB   . PRO A 1 11 ? 3.791   -11.424 -2.806  1.00 0.00 ? 11 PRO A CB   13 
ATOM   7152  C  CG   . PRO A 1 11 ? 3.379   -11.766 -1.415  1.00 0.00 ? 11 PRO A CG   13 
ATOM   7153  C  CD   . PRO A 1 11 ? 4.491   -11.283 -0.535  1.00 0.00 ? 11 PRO A CD   13 
ATOM   7154  H  HA   . PRO A 1 11 ? 5.510   -10.229 -3.281  1.00 0.00 ? 11 PRO A HA   13 
ATOM   7155  H  HB2  . PRO A 1 11 ? 2.934   -11.235 -3.435  1.00 0.00 ? 11 PRO A HB2  13 
ATOM   7156  H  HB3  . PRO A 1 11 ? 4.397   -12.206 -3.239  1.00 0.00 ? 11 PRO A HB3  13 
ATOM   7157  H  HG2  . PRO A 1 11 ? 2.460   -11.256 -1.171  1.00 0.00 ? 11 PRO A HG2  13 
ATOM   7158  H  HG3  . PRO A 1 11 ? 3.257   -12.834 -1.318  1.00 0.00 ? 11 PRO A HG3  13 
ATOM   7159  H  HD2  . PRO A 1 11 ? 4.113   -11.031 0.446   1.00 0.00 ? 11 PRO A HD2  13 
ATOM   7160  H  HD3  . PRO A 1 11 ? 5.270   -12.026 -0.465  1.00 0.00 ? 11 PRO A HD3  13 
ATOM   7161  N  N    . PHE A 1 12 ? 3.151   -8.250  -2.218  1.00 0.00 ? 12 PHE A N    13 
ATOM   7162  C  CA   . PHE A 1 12 ? 2.321   -7.106  -2.553  1.00 0.00 ? 12 PHE A CA   13 
ATOM   7163  C  C    . PHE A 1 12 ? 2.702   -5.889  -1.721  1.00 0.00 ? 12 PHE A C    13 
ATOM   7164  O  O    . PHE A 1 12 ? 2.188   -5.686  -0.627  1.00 0.00 ? 12 PHE A O    13 
ATOM   7165  C  CB   . PHE A 1 12 ? 0.848   -7.441  -2.331  1.00 0.00 ? 12 PHE A CB   13 
ATOM   7166  C  CG   . PHE A 1 12 ? 0.333   -8.498  -3.266  1.00 0.00 ? 12 PHE A CG   13 
ATOM   7167  C  CD1  . PHE A 1 12 ? 0.202   -8.242  -4.621  1.00 0.00 ? 12 PHE A CD1  13 
ATOM   7168  C  CD2  . PHE A 1 12 ? -0.012  -9.753  -2.790  1.00 0.00 ? 12 PHE A CD2  13 
ATOM   7169  C  CE1  . PHE A 1 12 ? -0.264  -9.216  -5.484  1.00 0.00 ? 12 PHE A CE1  13 
ATOM   7170  C  CE2  . PHE A 1 12 ? -0.480  -10.729 -3.646  1.00 0.00 ? 12 PHE A CE2  13 
ATOM   7171  C  CZ   . PHE A 1 12 ? -0.606  -10.462 -4.995  1.00 0.00 ? 12 PHE A CZ   13 
ATOM   7172  H  H    . PHE A 1 12 ? 3.217   -8.527  -1.281  1.00 0.00 ? 12 PHE A H    13 
ATOM   7173  H  HA   . PHE A 1 12 ? 2.476   -6.878  -3.595  1.00 0.00 ? 12 PHE A HA   13 
ATOM   7174  H  HB2  . PHE A 1 12 ? 0.719   -7.797  -1.317  1.00 0.00 ? 12 PHE A HB2  13 
ATOM   7175  H  HB3  . PHE A 1 12 ? 0.256   -6.548  -2.472  1.00 0.00 ? 12 PHE A HB3  13 
ATOM   7176  H  HD1  . PHE A 1 12 ? 0.468   -7.267  -5.004  1.00 0.00 ? 12 PHE A HD1  13 
ATOM   7177  H  HD2  . PHE A 1 12 ? 0.087   -9.964  -1.737  1.00 0.00 ? 12 PHE A HD2  13 
ATOM   7178  H  HE1  . PHE A 1 12 ? -0.361  -9.005  -6.539  1.00 0.00 ? 12 PHE A HE1  13 
ATOM   7179  H  HE2  . PHE A 1 12 ? -0.748  -11.702 -3.261  1.00 0.00 ? 12 PHE A HE2  13 
ATOM   7180  H  HZ   . PHE A 1 12 ? -0.974  -11.225 -5.664  1.00 0.00 ? 12 PHE A HZ   13 
ATOM   7181  N  N    . GLN A 1 13 ? 3.609   -5.092  -2.242  1.00 0.00 ? 13 GLN A N    13 
ATOM   7182  C  CA   . GLN A 1 13 ? 4.041   -3.884  -1.573  1.00 0.00 ? 13 GLN A CA   13 
ATOM   7183  C  C    . GLN A 1 13 ? 3.351   -2.671  -2.185  1.00 0.00 ? 13 GLN A C    13 
ATOM   7184  O  O    . GLN A 1 13 ? 2.974   -2.700  -3.359  1.00 0.00 ? 13 GLN A O    13 
ATOM   7185  C  CB   . GLN A 1 13 ? 5.552   -3.763  -1.703  1.00 0.00 ? 13 GLN A CB   13 
ATOM   7186  C  CG   . GLN A 1 13 ? 6.017   -3.463  -3.115  1.00 0.00 ? 13 GLN A CG   13 
ATOM   7187  C  CD   . GLN A 1 13 ? 6.790   -4.609  -3.751  1.00 0.00 ? 13 GLN A CD   13 
ATOM   7188  O  OE1  . GLN A 1 13 ? 7.648   -4.388  -4.601  1.00 0.00 ? 13 GLN A OE1  13 
ATOM   7189  N  NE2  . GLN A 1 13 ? 6.488   -5.842  -3.360  1.00 0.00 ? 13 GLN A NE2  13 
ATOM   7190  H  H    . GLN A 1 13 ? 4.001   -5.314  -3.106  1.00 0.00 ? 13 GLN A H    13 
ATOM   7191  H  HA   . GLN A 1 13 ? 3.775   -3.956  -0.531  1.00 0.00 ? 13 GLN A HA   13 
ATOM   7192  H  HB2  . GLN A 1 13 ? 5.900   -2.973  -1.053  1.00 0.00 ? 13 GLN A HB2  13 
ATOM   7193  H  HB3  . GLN A 1 13 ? 5.993   -4.694  -1.395  1.00 0.00 ? 13 GLN A HB3  13 
ATOM   7194  H  HG2  . GLN A 1 13 ? 5.149   -3.257  -3.722  1.00 0.00 ? 13 GLN A HG2  13 
ATOM   7195  H  HG3  . GLN A 1 13 ? 6.650   -2.588  -3.089  1.00 0.00 ? 13 GLN A HG3  13 
ATOM   7196  H  HE21 . GLN A 1 13 ? 5.788   -5.962  -2.685  1.00 0.00 ? 13 GLN A HE21 13 
ATOM   7197  H  HE22 . GLN A 1 13 ? 6.984   -6.591  -3.765  1.00 0.00 ? 13 GLN A HE22 13 
ATOM   7198  N  N    . CYS A 1 14 ? 3.207   -1.600  -1.412  1.00 0.00 ? 14 CYS A N    13 
ATOM   7199  C  CA   . CYS A 1 14 ? 2.600   -0.387  -1.935  1.00 0.00 ? 14 CYS A CA   13 
ATOM   7200  C  C    . CYS A 1 14 ? 3.536   0.273   -2.940  1.00 0.00 ? 14 CYS A C    13 
ATOM   7201  O  O    . CYS A 1 14 ? 4.722   0.451   -2.667  1.00 0.00 ? 14 CYS A O    13 
ATOM   7202  C  CB   . CYS A 1 14 ? 2.255   0.620   -0.832  1.00 0.00 ? 14 CYS A CB   13 
ATOM   7203  S  SG   . CYS A 1 14 ? 1.610   2.185   -1.514  1.00 0.00 ? 14 CYS A SG   13 
ATOM   7204  H  H    . CYS A 1 14 ? 3.555   -1.615  -0.502  1.00 0.00 ? 14 CYS A H    13 
ATOM   7205  H  HA   . CYS A 1 14 ? 1.689   -0.671  -2.443  1.00 0.00 ? 14 CYS A HA   13 
ATOM   7206  H  HB2  . CYS A 1 14 ? 1.503   0.198   -0.180  1.00 0.00 ? 14 CYS A HB2  13 
ATOM   7207  H  HB3  . CYS A 1 14 ? 3.143   0.847   -0.259  1.00 0.00 ? 14 CYS A HB3  13 
ATOM   7208  N  N    . PRO A 1 15 ? 3.012   0.658   -4.107  1.00 0.00 ? 15 PRO A N    13 
ATOM   7209  C  CA   . PRO A 1 15 ? 3.799   1.322   -5.142  1.00 0.00 ? 15 PRO A CA   13 
ATOM   7210  C  C    . PRO A 1 15 ? 4.062   2.798   -4.835  1.00 0.00 ? 15 PRO A C    13 
ATOM   7211  O  O    . PRO A 1 15 ? 4.786   3.471   -5.570  1.00 0.00 ? 15 PRO A O    13 
ATOM   7212  C  CB   . PRO A 1 15 ? 2.928   1.184   -6.385  1.00 0.00 ? 15 PRO A CB   13 
ATOM   7213  C  CG   . PRO A 1 15 ? 1.534   1.136   -5.864  1.00 0.00 ? 15 PRO A CG   13 
ATOM   7214  C  CD   . PRO A 1 15 ? 1.609   0.458   -4.522  1.00 0.00 ? 15 PRO A CD   13 
ATOM   7215  H  HA   . PRO A 1 15 ? 4.739   0.821   -5.308  1.00 0.00 ? 15 PRO A HA   13 
ATOM   7216  H  HB2  . PRO A 1 15 ? 3.085   2.035   -7.027  1.00 0.00 ? 15 PRO A HB2  13 
ATOM   7217  H  HB3  . PRO A 1 15 ? 3.186   0.276   -6.911  1.00 0.00 ? 15 PRO A HB3  13 
ATOM   7218  H  HG2  . PRO A 1 15 ? 1.151   2.140   -5.755  1.00 0.00 ? 15 PRO A HG2  13 
ATOM   7219  H  HG3  . PRO A 1 15 ? 0.911   0.567   -6.537  1.00 0.00 ? 15 PRO A HG3  13 
ATOM   7220  H  HD2  . PRO A 1 15 ? 0.931   0.928   -3.826  1.00 0.00 ? 15 PRO A HD2  13 
ATOM   7221  H  HD3  . PRO A 1 15 ? 1.382   -0.594  -4.620  1.00 0.00 ? 15 PRO A HD3  13 
ATOM   7222  N  N    . ASP A 1 16 ? 3.456   3.313   -3.767  1.00 0.00 ? 16 ASP A N    13 
ATOM   7223  C  CA   . ASP A 1 16 ? 3.632   4.719   -3.404  1.00 0.00 ? 16 ASP A CA   13 
ATOM   7224  C  C    . ASP A 1 16 ? 4.411   4.859   -2.103  1.00 0.00 ? 16 ASP A C    13 
ATOM   7225  O  O    . ASP A 1 16 ? 5.130   5.840   -1.899  1.00 0.00 ? 16 ASP A O    13 
ATOM   7226  C  CB   . ASP A 1 16 ? 2.273   5.410   -3.265  1.00 0.00 ? 16 ASP A CB   13 
ATOM   7227  C  CG   . ASP A 1 16 ? 2.365   6.920   -3.387  1.00 0.00 ? 16 ASP A CG   13 
ATOM   7228  O  OD1  . ASP A 1 16 ? 3.066   7.410   -4.300  1.00 0.00 ? 16 ASP A OD1  13 
ATOM   7229  O  OD2  . ASP A 1 16 ? 1.715   7.626   -2.589  1.00 0.00 ? 16 ASP A OD2  13 
ATOM   7230  H  H    . ASP A 1 16 ? 2.861   2.741   -3.224  1.00 0.00 ? 16 ASP A H    13 
ATOM   7231  H  HA   . ASP A 1 16 ? 4.189   5.198   -4.197  1.00 0.00 ? 16 ASP A HA   13 
ATOM   7232  H  HB2  . ASP A 1 16 ? 1.611   5.046   -4.037  1.00 0.00 ? 16 ASP A HB2  13 
ATOM   7233  H  HB3  . ASP A 1 16 ? 1.857   5.171   -2.298  1.00 0.00 ? 16 ASP A HB3  13 
ATOM   7234  N  N    . CYS A 1 17 ? 4.225   3.908   -1.199  1.00 0.00 ? 17 CYS A N    13 
ATOM   7235  C  CA   . CYS A 1 17 ? 4.873   3.964   0.105   1.00 0.00 ? 17 CYS A CA   13 
ATOM   7236  C  C    . CYS A 1 17 ? 6.004   2.947   0.224   1.00 0.00 ? 17 CYS A C    13 
ATOM   7237  O  O    . CYS A 1 17 ? 6.941   3.152   1.001   1.00 0.00 ? 17 CYS A O    13 
ATOM   7238  C  CB   . CYS A 1 17 ? 3.855   3.744   1.219   1.00 0.00 ? 17 CYS A CB   13 
ATOM   7239  S  SG   . CYS A 1 17 ? 2.378   4.797   1.087   1.00 0.00 ? 17 CYS A SG   13 
ATOM   7240  H  H    . CYS A 1 17 ? 3.605   3.173   -1.399  1.00 0.00 ? 17 CYS A H    13 
ATOM   7241  H  HA   . CYS A 1 17 ? 5.290   4.952   0.214   1.00 0.00 ? 17 CYS A HA   13 
ATOM   7242  H  HB2  . CYS A 1 17 ? 3.529   2.713   1.200   1.00 0.00 ? 17 CYS A HB2  13 
ATOM   7243  H  HB3  . CYS A 1 17 ? 4.324   3.951   2.169   1.00 0.00 ? 17 CYS A HB3  13 
ATOM   7244  N  N    . ASP A 1 18 ? 5.835   1.809   -0.456  1.00 0.00 ? 18 ASP A N    13 
ATOM   7245  C  CA   . ASP A 1 18 ? 6.775   0.683   -0.381  1.00 0.00 ? 18 ASP A CA   13 
ATOM   7246  C  C    . ASP A 1 18 ? 6.540   -0.115  0.894   1.00 0.00 ? 18 ASP A C    13 
ATOM   7247  O  O    . ASP A 1 18 ? 7.479   -0.558  1.555   1.00 0.00 ? 18 ASP A O    13 
ATOM   7248  C  CB   . ASP A 1 18 ? 8.234   1.151   -0.469  1.00 0.00 ? 18 ASP A CB   13 
ATOM   7249  C  CG   . ASP A 1 18 ? 9.163   0.098   -1.033  1.00 0.00 ? 18 ASP A CG   13 
ATOM   7250  O  OD1  . ASP A 1 18 ? 8.809   -0.531  -2.055  1.00 0.00 ? 18 ASP A OD1  13 
ATOM   7251  O  OD2  . ASP A 1 18 ? 10.264  -0.087  -0.468  1.00 0.00 ? 18 ASP A OD2  13 
ATOM   7252  H  H    . ASP A 1 18 ? 5.025   1.704   -0.998  1.00 0.00 ? 18 ASP A H    13 
ATOM   7253  H  HA   . ASP A 1 18 ? 6.566   0.038   -1.224  1.00 0.00 ? 18 ASP A HA   13 
ATOM   7254  H  HB2  . ASP A 1 18 ? 8.285   2.021   -1.105  1.00 0.00 ? 18 ASP A HB2  13 
ATOM   7255  H  HB3  . ASP A 1 18 ? 8.579   1.416   0.521   1.00 0.00 ? 18 ASP A HB3  13 
ATOM   7256  N  N    . ARG A 1 19 ? 5.264   -0.300  1.226   1.00 0.00 ? 19 ARG A N    13 
ATOM   7257  C  CA   . ARG A 1 19 ? 4.866   -1.077  2.399   1.00 0.00 ? 19 ARG A CA   13 
ATOM   7258  C  C    . ARG A 1 19 ? 5.004   -2.571  2.116   1.00 0.00 ? 19 ARG A C    13 
ATOM   7259  O  O    . ARG A 1 19 ? 5.720   -2.964  1.200   1.00 0.00 ? 19 ARG A O    13 
ATOM   7260  C  CB   . ARG A 1 19 ? 3.425   -0.753  2.793   1.00 0.00 ? 19 ARG A CB   13 
ATOM   7261  C  CG   . ARG A 1 19 ? 3.065   0.715   2.651   1.00 0.00 ? 19 ARG A CG   13 
ATOM   7262  C  CD   . ARG A 1 19 ? 2.417   1.254   3.910   1.00 0.00 ? 19 ARG A CD   13 
ATOM   7263  N  NE   . ARG A 1 19 ? 1.065   0.727   4.107   1.00 0.00 ? 19 ARG A NE   13 
ATOM   7264  C  CZ   . ARG A 1 19 ? 0.617   0.269   5.280   1.00 0.00 ? 19 ARG A CZ   13 
ATOM   7265  N  NH1  . ARG A 1 19 ? 1.439   0.177   6.316   1.00 0.00 ? 19 ARG A NH1  13 
ATOM   7266  N  NH2  . ARG A 1 19 ? -0.648  -0.111  5.412   1.00 0.00 ? 19 ARG A NH2  13 
ATOM   7267  H  H    . ARG A 1 19 ? 4.570   0.076   0.648   1.00 0.00 ? 19 ARG A H    13 
ATOM   7268  H  HA   . ARG A 1 19 ? 5.520   -0.812  3.214   1.00 0.00 ? 19 ARG A HA   13 
ATOM   7269  H  HB2  . ARG A 1 19 ? 2.758   -1.327  2.167   1.00 0.00 ? 19 ARG A HB2  13 
ATOM   7270  H  HB3  . ARG A 1 19 ? 3.272   -1.041  3.823   1.00 0.00 ? 19 ARG A HB3  13 
ATOM   7271  H  HG2  . ARG A 1 19 ? 3.963   1.277   2.454   1.00 0.00 ? 19 ARG A HG2  13 
ATOM   7272  H  HG3  . ARG A 1 19 ? 2.377   0.830   1.826   1.00 0.00 ? 19 ARG A HG3  13 
ATOM   7273  H  HD2  . ARG A 1 19 ? 3.027   0.982   4.758   1.00 0.00 ? 19 ARG A HD2  13 
ATOM   7274  H  HD3  . ARG A 1 19 ? 2.366   2.330   3.838   1.00 0.00 ? 19 ARG A HD3  13 
ATOM   7275  H  HE   . ARG A 1 19 ? 0.450   0.747   3.331   1.00 0.00 ? 19 ARG A HE   13 
ATOM   7276  H  HH11 . ARG A 1 19 ? 2.407   0.448   6.225   1.00 0.00 ? 19 ARG A HH11 13 
ATOM   7277  H  HH12 . ARG A 1 19 ? 1.102   -0.165  7.203   1.00 0.00 ? 19 ARG A HH12 13 
ATOM   7278  H  HH21 . ARG A 1 19 ? -1.276  -0.056  4.638   1.00 0.00 ? 19 ARG A HH21 13 
ATOM   7279  H  HH22 . ARG A 1 19 ? -0.986  -0.456  6.302   1.00 0.00 ? 19 ARG A HH22 13 
ATOM   7280  N  N    . SER A 1 20 ? 4.304   -3.406  2.871   1.00 0.00 ? 20 SER A N    13 
ATOM   7281  C  CA   . SER A 1 20 ? 4.369   -4.842  2.637   1.00 0.00 ? 20 SER A CA   13 
ATOM   7282  C  C    . SER A 1 20 ? 3.080   -5.549  3.033   1.00 0.00 ? 20 SER A C    13 
ATOM   7283  O  O    . SER A 1 20 ? 2.666   -5.525  4.194   1.00 0.00 ? 20 SER A O    13 
ATOM   7284  C  CB   . SER A 1 20 ? 5.537   -5.456  3.397   1.00 0.00 ? 20 SER A CB   13 
ATOM   7285  O  OG   . SER A 1 20 ? 6.009   -4.582  4.409   1.00 0.00 ? 20 SER A OG   13 
ATOM   7286  H  H    . SER A 1 20 ? 3.721   -3.057  3.587   1.00 0.00 ? 20 SER A H    13 
ATOM   7287  H  HA   . SER A 1 20 ? 4.528   -4.989  1.580   1.00 0.00 ? 20 SER A HA   13 
ATOM   7288  H  HB2  . SER A 1 20 ? 5.207   -6.378  3.849   1.00 0.00 ? 20 SER A HB2  13 
ATOM   7289  H  HB3  . SER A 1 20 ? 6.343   -5.660  2.707   1.00 0.00 ? 20 SER A HB3  13 
ATOM   7290  H  HG   . SER A 1 20 ? 6.272   -3.742  4.007   1.00 0.00 ? 20 SER A HG   13 
ATOM   7291  N  N    . PHE A 1 21 ? 2.472   -6.206  2.062   1.00 0.00 ? 21 PHE A N    13 
ATOM   7292  C  CA   . PHE A 1 21 ? 1.248   -6.958  2.278   1.00 0.00 ? 21 PHE A CA   13 
ATOM   7293  C  C    . PHE A 1 21 ? 1.361   -8.323  1.615   1.00 0.00 ? 21 PHE A C    13 
ATOM   7294  O  O    . PHE A 1 21 ? 1.943   -8.455  0.538   1.00 0.00 ? 21 PHE A O    13 
ATOM   7295  C  CB   . PHE A 1 21 ? 0.037   -6.202  1.716   1.00 0.00 ? 21 PHE A CB   13 
ATOM   7296  C  CG   . PHE A 1 21 ? -0.013  -4.758  2.114   1.00 0.00 ? 21 PHE A CG   13 
ATOM   7297  C  CD1  . PHE A 1 21 ? 0.753   -3.814  1.450   1.00 0.00 ? 21 PHE A CD1  13 
ATOM   7298  C  CD2  . PHE A 1 21 ? -0.826  -4.343  3.154   1.00 0.00 ? 21 PHE A CD2  13 
ATOM   7299  C  CE1  . PHE A 1 21 ? 0.710   -2.487  1.814   1.00 0.00 ? 21 PHE A CE1  13 
ATOM   7300  C  CE2  . PHE A 1 21 ? -0.873  -3.016  3.523   1.00 0.00 ? 21 PHE A CE2  13 
ATOM   7301  C  CZ   . PHE A 1 21 ? -0.103  -2.088  2.852   1.00 0.00 ? 21 PHE A CZ   13 
ATOM   7302  H  H    . PHE A 1 21 ? 2.864   -6.194  1.162   1.00 0.00 ? 21 PHE A H    13 
ATOM   7303  H  HA   . PHE A 1 21 ? 1.123   -7.093  3.341   1.00 0.00 ? 21 PHE A HA   13 
ATOM   7304  H  HB2  . PHE A 1 21 ? 0.062   -6.246  0.638   1.00 0.00 ? 21 PHE A HB2  13 
ATOM   7305  H  HB3  . PHE A 1 21 ? -0.867  -6.674  2.070   1.00 0.00 ? 21 PHE A HB3  13 
ATOM   7306  H  HD1  . PHE A 1 21 ? 1.398   -4.129  0.641   1.00 0.00 ? 21 PHE A HD1  13 
ATOM   7307  H  HD2  . PHE A 1 21 ? -1.429  -5.070  3.679   1.00 0.00 ? 21 PHE A HD2  13 
ATOM   7308  H  HE1  . PHE A 1 21 ? 1.313   -1.762  1.288   1.00 0.00 ? 21 PHE A HE1  13 
ATOM   7309  H  HE2  . PHE A 1 21 ? -1.510  -2.703  4.338   1.00 0.00 ? 21 PHE A HE2  13 
ATOM   7310  H  HZ   . PHE A 1 21 ? -0.133  -1.048  3.140   1.00 0.00 ? 21 PHE A HZ   13 
ATOM   7311  N  N    . SER A 1 22 ? 0.827   -9.336  2.269   1.00 0.00 ? 22 SER A N    13 
ATOM   7312  C  CA   . SER A 1 22 ? 0.851   -10.682 1.727   1.00 0.00 ? 22 SER A CA   13 
ATOM   7313  C  C    . SER A 1 22 ? -0.347  -10.881 0.804   1.00 0.00 ? 22 SER A C    13 
ATOM   7314  O  O    . SER A 1 22 ? -0.342  -11.738 -0.081  1.00 0.00 ? 22 SER A O    13 
ATOM   7315  C  CB   . SER A 1 22 ? 0.825   -11.695 2.870   1.00 0.00 ? 22 SER A CB   13 
ATOM   7316  O  OG   . SER A 1 22 ? 0.600   -11.044 4.114   1.00 0.00 ? 22 SER A OG   13 
ATOM   7317  H  H    . SER A 1 22 ? 0.390   -9.177  3.134   1.00 0.00 ? 22 SER A H    13 
ATOM   7318  H  HA   . SER A 1 22 ? 1.763   -10.802 1.160   1.00 0.00 ? 22 SER A HA   13 
ATOM   7319  H  HB2  . SER A 1 22 ? 0.029   -12.406 2.700   1.00 0.00 ? 22 SER A HB2  13 
ATOM   7320  H  HB3  . SER A 1 22 ? 1.773   -12.214 2.913   1.00 0.00 ? 22 SER A HB3  13 
ATOM   7321  H  HG   . SER A 1 22 ? -0.198  -11.403 4.523   1.00 0.00 ? 22 SER A HG   13 
ATOM   7322  N  N    . ARG A 1 23 ? -1.356  -10.043 1.003   1.00 0.00 ? 23 ARG A N    13 
ATOM   7323  C  CA   . ARG A 1 23 ? -2.562  -10.065 0.193   1.00 0.00 ? 23 ARG A CA   13 
ATOM   7324  C  C    . ARG A 1 23 ? -2.718  -8.768  -0.557  1.00 0.00 ? 23 ARG A C    13 
ATOM   7325  O  O    . ARG A 1 23 ? -2.619  -7.680  0.019   1.00 0.00 ? 23 ARG A O    13 
ATOM   7326  C  CB   . ARG A 1 23 ? -3.792  -10.299 1.071   1.00 0.00 ? 23 ARG A CB   13 
ATOM   7327  C  CG   . ARG A 1 23 ? -3.718  -11.562 1.907   1.00 0.00 ? 23 ARG A CG   13 
ATOM   7328  C  CD   . ARG A 1 23 ? -4.986  -11.771 2.726   1.00 0.00 ? 23 ARG A CD   13 
ATOM   7329  N  NE   . ARG A 1 23 ? -6.205  -11.490 1.964   1.00 0.00 ? 23 ARG A NE   13 
ATOM   7330  C  CZ   . ARG A 1 23 ? -6.847  -12.396 1.223   1.00 0.00 ? 23 ARG A CZ   13 
ATOM   7331  N  NH1  . ARG A 1 23 ? -6.373  -13.633 1.120   1.00 0.00 ? 23 ARG A NH1  13 
ATOM   7332  N  NH2  . ARG A 1 23 ? -7.971  -12.070 0.597   1.00 0.00 ? 23 ARG A NH2  13 
ATOM   7333  H  H    . ARG A 1 23 ? -1.273  -9.365  1.702   1.00 0.00 ? 23 ARG A H    13 
ATOM   7334  H  HA   . ARG A 1 23 ? -2.484  -10.859 -0.536  1.00 0.00 ? 23 ARG A HA   13 
ATOM   7335  H  HB2  . ARG A 1 23 ? -3.907  -9.457  1.741   1.00 0.00 ? 23 ARG A HB2  13 
ATOM   7336  H  HB3  . ARG A 1 23 ? -4.664  -10.363 0.438   1.00 0.00 ? 23 ARG A HB3  13 
ATOM   7337  H  HG2  . ARG A 1 23 ? -3.581  -12.407 1.249   1.00 0.00 ? 23 ARG A HG2  13 
ATOM   7338  H  HG3  . ARG A 1 23 ? -2.875  -11.485 2.581   1.00 0.00 ? 23 ARG A HG3  13 
ATOM   7339  H  HD2  . ARG A 1 23 ? -5.014  -12.798 3.059   1.00 0.00 ? 23 ARG A HD2  13 
ATOM   7340  H  HD3  . ARG A 1 23 ? -4.953  -11.119 3.585   1.00 0.00 ? 23 ARG A HD3  13 
ATOM   7341  H  HE   . ARG A 1 23 ? -6.578  -10.573 2.026   1.00 0.00 ? 23 ARG A HE   13 
ATOM   7342  H  HH11 . ARG A 1 23 ? -5.529  -13.896 1.600   1.00 0.00 ? 23 ARG A HH11 13 
ATOM   7343  H  HH12 . ARG A 1 23 ? -6.856  -14.316 0.558   1.00 0.00 ? 23 ARG A HH12 13 
ATOM   7344  H  HH21 . ARG A 1 23 ? -8.346  -11.142 0.684   1.00 0.00 ? 23 ARG A HH21 13 
ATOM   7345  H  HH22 . ARG A 1 23 ? -8.451  -12.747 0.037   1.00 0.00 ? 23 ARG A HH22 13 
ATOM   7346  N  N    . SER A 1 24 ? -3.051  -8.900  -1.821  1.00 0.00 ? 24 SER A N    13 
ATOM   7347  C  CA   . SER A 1 24 ? -3.331  -7.768  -2.665  1.00 0.00 ? 24 SER A CA   13 
ATOM   7348  C  C    . SER A 1 24 ? -4.582  -7.047  -2.165  1.00 0.00 ? 24 SER A C    13 
ATOM   7349  O  O    . SER A 1 24 ? -4.708  -5.827  -2.283  1.00 0.00 ? 24 SER A O    13 
ATOM   7350  C  CB   . SER A 1 24 ? -3.523  -8.276  -4.082  1.00 0.00 ? 24 SER A CB   13 
ATOM   7351  O  OG   . SER A 1 24 ? -3.761  -9.674  -4.085  1.00 0.00 ? 24 SER A OG   13 
ATOM   7352  H  H    . SER A 1 24 ? -3.169  -9.802  -2.193  1.00 0.00 ? 24 SER A H    13 
ATOM   7353  H  HA   . SER A 1 24 ? -2.486  -7.095  -2.631  1.00 0.00 ? 24 SER A HA   13 
ATOM   7354  H  HB2  . SER A 1 24 ? -4.364  -7.780  -4.528  1.00 0.00 ? 24 SER A HB2  13 
ATOM   7355  H  HB3  . SER A 1 24 ? -2.632  -8.077  -4.652  1.00 0.00 ? 24 SER A HB3  13 
ATOM   7356  H  HG   . SER A 1 24 ? -4.413  -9.882  -4.767  1.00 0.00 ? 24 SER A HG   13 
ATOM   7357  N  N    . ASP A 1 25 ? -5.455  -7.814  -1.522  1.00 0.00 ? 25 ASP A N    13 
ATOM   7358  C  CA   . ASP A 1 25 ? -6.645  -7.282  -0.889  1.00 0.00 ? 25 ASP A CA   13 
ATOM   7359  C  C    . ASP A 1 25 ? -6.263  -6.313  0.226   1.00 0.00 ? 25 ASP A C    13 
ATOM   7360  O  O    . ASP A 1 25 ? -6.800  -5.210  0.315   1.00 0.00 ? 25 ASP A O    13 
ATOM   7361  C  CB   . ASP A 1 25 ? -7.480  -8.446  -0.348  1.00 0.00 ? 25 ASP A CB   13 
ATOM   7362  C  CG   . ASP A 1 25 ? -7.924  -8.274  1.092   1.00 0.00 ? 25 ASP A CG   13 
ATOM   7363  O  OD1  . ASP A 1 25 ? -8.944  -7.596  1.327   1.00 0.00 ? 25 ASP A OD1  13 
ATOM   7364  O  OD2  . ASP A 1 25 ? -7.266  -8.847  1.988   1.00 0.00 ? 25 ASP A OD2  13 
ATOM   7365  H  H    . ASP A 1 25 ? -5.273  -8.778  -1.439  1.00 0.00 ? 25 ASP A H    13 
ATOM   7366  H  HA   . ASP A 1 25 ? -7.214  -6.755  -1.636  1.00 0.00 ? 25 ASP A HA   13 
ATOM   7367  H  HB2  . ASP A 1 25 ? -8.355  -8.557  -0.957  1.00 0.00 ? 25 ASP A HB2  13 
ATOM   7368  H  HB3  . ASP A 1 25 ? -6.892  -9.349  -0.416  1.00 0.00 ? 25 ASP A HB3  13 
ATOM   7369  N  N    . HIS A 1 26 ? -5.258  -6.694  1.009   1.00 0.00 ? 26 HIS A N    13 
ATOM   7370  C  CA   . HIS A 1 26 ? -4.757  -5.847  2.082   1.00 0.00 ? 26 HIS A CA   13 
ATOM   7371  C  C    . HIS A 1 26 ? -4.045  -4.629  1.518   1.00 0.00 ? 26 HIS A C    13 
ATOM   7372  O  O    . HIS A 1 26 ? -4.188  -3.521  2.040   1.00 0.00 ? 26 HIS A O    13 
ATOM   7373  C  CB   . HIS A 1 26 ? -3.819  -6.635  2.994   1.00 0.00 ? 26 HIS A CB   13 
ATOM   7374  C  CG   . HIS A 1 26 ? -4.478  -7.093  4.253   1.00 0.00 ? 26 HIS A CG   13 
ATOM   7375  N  ND1  . HIS A 1 26 ? -3.923  -6.923  5.501   1.00 0.00 ? 26 HIS A ND1  13 
ATOM   7376  C  CD2  . HIS A 1 26 ? -5.667  -7.706  4.452   1.00 0.00 ? 26 HIS A CD2  13 
ATOM   7377  C  CE1  . HIS A 1 26 ? -4.737  -7.413  6.413   1.00 0.00 ? 26 HIS A CE1  13 
ATOM   7378  N  NE2  . HIS A 1 26 ? -5.806  -7.892  5.805   1.00 0.00 ? 26 HIS A NE2  13 
ATOM   7379  H  H    . HIS A 1 26 ? -4.817  -7.552  0.832   1.00 0.00 ? 26 HIS A H    13 
ATOM   7380  H  HA   . HIS A 1 26 ? -5.606  -5.514  2.660   1.00 0.00 ? 26 HIS A HA   13 
ATOM   7381  H  HB2  . HIS A 1 26 ? -3.461  -7.508  2.468   1.00 0.00 ? 26 HIS A HB2  13 
ATOM   7382  H  HB3  . HIS A 1 26 ? -2.979  -6.012  3.264   1.00 0.00 ? 26 HIS A HB3  13 
ATOM   7383  H  HD1  . HIS A 1 26 ? -3.055  -6.490  5.694   1.00 0.00 ? 26 HIS A HD1  13 
ATOM   7384  H  HD2  . HIS A 1 26 ? -6.378  -7.995  3.685   1.00 0.00 ? 26 HIS A HD2  13 
ATOM   7385  H  HE1  . HIS A 1 26 ? -4.561  -7.423  7.479   1.00 0.00 ? 26 HIS A HE1  13 
ATOM   7386  H  HE2  . HIS A 1 26 ? -6.635  -8.166  6.258   1.00 0.00 ? 26 HIS A HE2  13 
ATOM   7387  N  N    . LEU A 1 27 ? -3.364  -4.823  0.394   1.00 0.00 ? 27 LEU A N    13 
ATOM   7388  C  CA   . LEU A 1 27 ? -2.746  -3.718  -0.329  1.00 0.00 ? 27 LEU A CA   13 
ATOM   7389  C  C    . LEU A 1 27 ? -3.802  -2.667  -0.655  1.00 0.00 ? 27 LEU A C    13 
ATOM   7390  O  O    . LEU A 1 27 ? -3.682  -1.505  -0.261  1.00 0.00 ? 27 LEU A O    13 
ATOM   7391  C  CB   . LEU A 1 27 ? -2.117  -4.210  -1.635  1.00 0.00 ? 27 LEU A CB   13 
ATOM   7392  C  CG   . LEU A 1 27 ? -1.166  -3.227  -2.332  1.00 0.00 ? 27 LEU A CG   13 
ATOM   7393  C  CD1  . LEU A 1 27 ? -0.661  -2.158  -1.374  1.00 0.00 ? 27 LEU A CD1  13 
ATOM   7394  C  CD2  . LEU A 1 27 ? -0.005  -3.959  -2.974  1.00 0.00 ? 27 LEU A CD2  13 
ATOM   7395  H  H    . LEU A 1 27 ? -3.347  -5.720  -0.004  1.00 0.00 ? 27 LEU A H    13 
ATOM   7396  H  HA   . LEU A 1 27 ? -1.985  -3.280  0.298   1.00 0.00 ? 27 LEU A HA   13 
ATOM   7397  H  HB2  . LEU A 1 27 ? -1.567  -5.116  -1.422  1.00 0.00 ? 27 LEU A HB2  13 
ATOM   7398  H  HB3  . LEU A 1 27 ? -2.913  -4.451  -2.323  1.00 0.00 ? 27 LEU A HB3  13 
ATOM   7399  H  HG   . LEU A 1 27 ? -1.716  -2.726  -3.119  1.00 0.00 ? 27 LEU A HG   13 
ATOM   7400  H  HD11 . LEU A 1 27 ? -0.220  -1.349  -1.935  1.00 0.00 ? 27 LEU A HD11 13 
ATOM   7401  H  HD12 . LEU A 1 27 ? -1.486  -1.784  -0.786  1.00 0.00 ? 27 LEU A HD12 13 
ATOM   7402  H  HD13 . LEU A 1 27 ? 0.083   -2.589  -0.716  1.00 0.00 ? 27 LEU A HD13 13 
ATOM   7403  H  HD21 . LEU A 1 27 ? -0.376  -4.629  -3.735  1.00 0.00 ? 27 LEU A HD21 13 
ATOM   7404  H  HD22 . LEU A 1 27 ? 0.666   -3.241  -3.424  1.00 0.00 ? 27 LEU A HD22 13 
ATOM   7405  H  HD23 . LEU A 1 27 ? 0.526   -4.524  -2.223  1.00 0.00 ? 27 LEU A HD23 13 
ATOM   7406  N  N    . ALA A 1 28 ? -4.825  -3.095  -1.387  1.00 0.00 ? 28 ALA A N    13 
ATOM   7407  C  CA   . ALA A 1 28 ? -5.911  -2.218  -1.804  1.00 0.00 ? 28 ALA A CA   13 
ATOM   7408  C  C    . ALA A 1 28 ? -6.570  -1.528  -0.612  1.00 0.00 ? 28 ALA A C    13 
ATOM   7409  O  O    . ALA A 1 28 ? -6.954  -0.363  -0.701  1.00 0.00 ? 28 ALA A O    13 
ATOM   7410  C  CB   . ALA A 1 28 ? -6.942  -3.001  -2.600  1.00 0.00 ? 28 ALA A CB   13 
ATOM   7411  H  H    . ALA A 1 28 ? -4.833  -4.034  -1.684  1.00 0.00 ? 28 ALA A H    13 
ATOM   7412  H  HA   . ALA A 1 28 ? -5.492  -1.462  -2.454  1.00 0.00 ? 28 ALA A HA   13 
ATOM   7413  H  HB1  . ALA A 1 28 ? -6.463  -3.835  -3.089  1.00 0.00 ? 28 ALA A HB1  13 
ATOM   7414  H  HB2  . ALA A 1 28 ? -7.710  -3.366  -1.934  1.00 0.00 ? 28 ALA A HB2  13 
ATOM   7415  H  HB3  . ALA A 1 28 ? -7.389  -2.356  -3.344  1.00 0.00 ? 28 ALA A HB3  13 
ATOM   7416  N  N    . LEU A 1 29 ? -6.678  -2.243  0.508   1.00 0.00 ? 29 LEU A N    13 
ATOM   7417  C  CA   . LEU A 1 29 ? -7.259  -1.683  1.724   1.00 0.00 ? 29 LEU A CA   13 
ATOM   7418  C  C    . LEU A 1 29 ? -6.484  -0.450  2.174   1.00 0.00 ? 29 LEU A C    13 
ATOM   7419  O  O    . LEU A 1 29 ? -7.071  0.575   2.518   1.00 0.00 ? 29 LEU A O    13 
ATOM   7420  C  CB   . LEU A 1 29 ? -7.280  -2.720  2.845   1.00 0.00 ? 29 LEU A CB   13 
ATOM   7421  C  CG   . LEU A 1 29 ? -8.217  -3.906  2.619   1.00 0.00 ? 29 LEU A CG   13 
ATOM   7422  C  CD1  . LEU A 1 29 ? -8.056  -4.927  3.732   1.00 0.00 ? 29 LEU A CD1  13 
ATOM   7423  C  CD2  . LEU A 1 29 ? -9.662  -3.438  2.526   1.00 0.00 ? 29 LEU A CD2  13 
ATOM   7424  H  H    . LEU A 1 29 ? -6.356  -3.172  0.515   1.00 0.00 ? 29 LEU A H    13 
ATOM   7425  H  HA   . LEU A 1 29 ? -8.273  -1.391  1.502   1.00 0.00 ? 29 LEU A HA   13 
ATOM   7426  H  HB2  . LEU A 1 29 ? -6.278  -3.100  2.973   1.00 0.00 ? 29 LEU A HB2  13 
ATOM   7427  H  HB3  . LEU A 1 29 ? -7.579  -2.223  3.753   1.00 0.00 ? 29 LEU A HB3  13 
ATOM   7428  H  HG   . LEU A 1 29 ? -7.960  -4.387  1.687   1.00 0.00 ? 29 LEU A HG   13 
ATOM   7429  H  HD11 . LEU A 1 29 ? -7.645  -4.445  4.606   1.00 0.00 ? 29 LEU A HD11 13 
ATOM   7430  H  HD12 . LEU A 1 29 ? -9.019  -5.352  3.973   1.00 0.00 ? 29 LEU A HD12 13 
ATOM   7431  H  HD13 . LEU A 1 29 ? -7.389  -5.711  3.406   1.00 0.00 ? 29 LEU A HD13 13 
ATOM   7432  H  HD21 . LEU A 1 29 ? -9.695  -2.471  2.049   1.00 0.00 ? 29 LEU A HD21 13 
ATOM   7433  H  HD22 . LEU A 1 29 ? -10.233 -4.147  1.947   1.00 0.00 ? 29 LEU A HD22 13 
ATOM   7434  H  HD23 . LEU A 1 29 ? -10.081 -3.364  3.520   1.00 0.00 ? 29 LEU A HD23 13 
ATOM   7435  N  N    . HIS A 1 30 ? -5.165  -0.532  2.100   1.00 0.00 ? 30 HIS A N    13 
ATOM   7436  C  CA   . HIS A 1 30 ? -4.315  0.602   2.432   1.00 0.00 ? 30 HIS A CA   13 
ATOM   7437  C  C    . HIS A 1 30 ? -4.356  1.639   1.310   1.00 0.00 ? 30 HIS A C    13 
ATOM   7438  O  O    . HIS A 1 30 ? -4.199  2.841   1.543   1.00 0.00 ? 30 HIS A O    13 
ATOM   7439  C  CB   . HIS A 1 30 ? -2.867  0.131   2.676   1.00 0.00 ? 30 HIS A CB   13 
ATOM   7440  C  CG   . HIS A 1 30 ? -1.823  1.177   2.406   1.00 0.00 ? 30 HIS A CG   13 
ATOM   7441  N  ND1  . HIS A 1 30 ? -1.562  2.231   3.246   1.00 0.00 ? 30 HIS A ND1  13 
ATOM   7442  C  CD2  . HIS A 1 30 ? -1.003  1.341   1.333   1.00 0.00 ? 30 HIS A CD2  13 
ATOM   7443  C  CE1  . HIS A 1 30 ? -0.620  2.990   2.673   1.00 0.00 ? 30 HIS A CE1  13 
ATOM   7444  N  NE2  . HIS A 1 30 ? -0.244  2.495   1.507   1.00 0.00 ? 30 HIS A NE2  13 
ATOM   7445  H  H    . HIS A 1 30 ? -4.754  -1.362  1.770   1.00 0.00 ? 30 HIS A H    13 
ATOM   7446  H  HA   . HIS A 1 30 ? -4.698  1.050   3.338   1.00 0.00 ? 30 HIS A HA   13 
ATOM   7447  H  HB2  . HIS A 1 30 ? -2.765  -0.175  3.707   1.00 0.00 ? 30 HIS A HB2  13 
ATOM   7448  H  HB3  . HIS A 1 30 ? -2.658  -0.713  2.038   1.00 0.00 ? 30 HIS A HB3  13 
ATOM   7449  H  HD1  . HIS A 1 30 ? -2.000  2.405   4.120   1.00 0.00 ? 30 HIS A HD1  13 
ATOM   7450  H  HD2  . HIS A 1 30 ? -0.944  0.688   0.476   1.00 0.00 ? 30 HIS A HD2  13 
ATOM   7451  H  HE1  . HIS A 1 30 ? -0.219  3.894   3.109   1.00 0.00 ? 30 HIS A HE1  13 
ATOM   7452  N  N    . ARG A 1 31 ? -4.448  1.154   0.083   1.00 0.00 ? 31 ARG A N    13 
ATOM   7453  C  CA   . ARG A 1 31 ? -4.338  2.013   -1.083  1.00 0.00 ? 31 ARG A CA   13 
ATOM   7454  C  C    . ARG A 1 31 ? -5.627  2.786   -1.356  1.00 0.00 ? 31 ARG A C    13 
ATOM   7455  O  O    . ARG A 1 31 ? -5.704  3.539   -2.323  1.00 0.00 ? 31 ARG A O    13 
ATOM   7456  C  CB   . ARG A 1 31 ? -3.947  1.191   -2.311  1.00 0.00 ? 31 ARG A CB   13 
ATOM   7457  C  CG   . ARG A 1 31 ? -2.492  0.755   -2.298  1.00 0.00 ? 31 ARG A CG   13 
ATOM   7458  C  CD   . ARG A 1 31 ? -1.975  0.458   -3.695  1.00 0.00 ? 31 ARG A CD   13 
ATOM   7459  N  NE   . ARG A 1 31 ? -1.832  1.668   -4.501  1.00 0.00 ? 31 ARG A NE   13 
ATOM   7460  C  CZ   . ARG A 1 31 ? -2.522  1.919   -5.615  1.00 0.00 ? 31 ARG A CZ   13 
ATOM   7461  N  NH1  . ARG A 1 31 ? -3.451  1.067   -6.039  1.00 0.00 ? 31 ARG A NH1  13 
ATOM   7462  N  NH2  . ARG A 1 31 ? -2.281  3.030   -6.296  1.00 0.00 ? 31 ARG A NH2  13 
ATOM   7463  H  H    . ARG A 1 31 ? -4.496  0.178   -0.042  1.00 0.00 ? 31 ARG A H    13 
ATOM   7464  H  HA   . ARG A 1 31 ? -3.546  2.720   -0.878  1.00 0.00 ? 31 ARG A HA   13 
ATOM   7465  H  HB2  . ARG A 1 31 ? -4.566  0.308   -2.353  1.00 0.00 ? 31 ARG A HB2  13 
ATOM   7466  H  HB3  . ARG A 1 31 ? -4.116  1.784   -3.198  1.00 0.00 ? 31 ARG A HB3  13 
ATOM   7467  H  HG2  . ARG A 1 31 ? -1.895  1.544   -1.867  1.00 0.00 ? 31 ARG A HG2  13 
ATOM   7468  H  HG3  . ARG A 1 31 ? -2.401  -0.136  -1.695  1.00 0.00 ? 31 ARG A HG3  13 
ATOM   7469  H  HD2  . ARG A 1 31 ? -1.007  -0.016  -3.610  1.00 0.00 ? 31 ARG A HD2  13 
ATOM   7470  H  HD3  . ARG A 1 31 ? -2.664  -0.212  -4.186  1.00 0.00 ? 31 ARG A HD3  13 
ATOM   7471  H  HE   . ARG A 1 31 ? -1.162  2.333   -4.204  1.00 0.00 ? 31 ARG A HE   13 
ATOM   7472  H  HH11 . ARG A 1 31 ? -3.644  0.220   -5.525  1.00 0.00 ? 31 ARG A HH11 13 
ATOM   7473  H  HH12 . ARG A 1 31 ? -3.971  1.268   -6.880  1.00 0.00 ? 31 ARG A HH12 13 
ATOM   7474  H  HH21 . ARG A 1 31 ? -1.588  3.681   -5.969  1.00 0.00 ? 31 ARG A HH21 13 
ATOM   7475  H  HH22 . ARG A 1 31 ? -2.774  3.219   -7.152  1.00 0.00 ? 31 ARG A HH22 13 
ATOM   7476  N  N    . LYS A 1 32 ? -6.619  2.630   -0.484  1.00 0.00 ? 32 LYS A N    13 
ATOM   7477  C  CA   . LYS A 1 32 ? -7.883  3.352   -0.620  1.00 0.00 ? 32 LYS A CA   13 
ATOM   7478  C  C    . LYS A 1 32 ? -7.648  4.855   -0.639  1.00 0.00 ? 32 LYS A C    13 
ATOM   7479  O  O    . LYS A 1 32 ? -8.249  5.585   -1.433  1.00 0.00 ? 32 LYS A O    13 
ATOM   7480  C  CB   . LYS A 1 32 ? -8.823  3.006   0.529   1.00 0.00 ? 32 LYS A CB   13 
ATOM   7481  C  CG   . LYS A 1 32 ? -9.924  2.039   0.141   1.00 0.00 ? 32 LYS A CG   13 
ATOM   7482  C  CD   . LYS A 1 32 ? -9.670  0.667   0.729   1.00 0.00 ? 32 LYS A CD   13 
ATOM   7483  C  CE   . LYS A 1 32 ? -10.793 -0.295  0.399   1.00 0.00 ? 32 LYS A CE   13 
ATOM   7484  N  NZ   . LYS A 1 32 ? -11.831 -0.310  1.461   1.00 0.00 ? 32 LYS A NZ   13 
ATOM   7485  H  H    . LYS A 1 32 ? -6.502  2.013   0.271   1.00 0.00 ? 32 LYS A H    13 
ATOM   7486  H  HA   . LYS A 1 32 ? -8.340  3.054   -1.552  1.00 0.00 ? 32 LYS A HA   13 
ATOM   7487  H  HB2  . LYS A 1 32 ? -8.248  2.560   1.328   1.00 0.00 ? 32 LYS A HB2  13 
ATOM   7488  H  HB3  . LYS A 1 32 ? -9.281  3.914   0.891   1.00 0.00 ? 32 LYS A HB3  13 
ATOM   7489  H  HG2  . LYS A 1 32 ? -10.869 2.412   0.508   1.00 0.00 ? 32 LYS A HG2  13 
ATOM   7490  H  HG3  . LYS A 1 32 ? -9.957  1.959   -0.936  1.00 0.00 ? 32 LYS A HG3  13 
ATOM   7491  H  HD2  . LYS A 1 32 ? -8.743  0.278   0.330   1.00 0.00 ? 32 LYS A HD2  13 
ATOM   7492  H  HD3  . LYS A 1 32 ? -9.591  0.757   1.804   1.00 0.00 ? 32 LYS A HD3  13 
ATOM   7493  H  HE2  . LYS A 1 32 ? -11.246 0.008   -0.533  1.00 0.00 ? 32 LYS A HE2  13 
ATOM   7494  H  HE3  . LYS A 1 32 ? -10.382 -1.289  0.294   1.00 0.00 ? 32 LYS A HE3  13 
ATOM   7495  H  HZ1  . LYS A 1 32 ? -12.516 0.464   1.305   1.00 0.00 ? 32 LYS A HZ1  13 
ATOM   7496  H  HZ2  . LYS A 1 32 ? -11.391 -0.181  2.399   1.00 0.00 ? 32 LYS A HZ2  13 
ATOM   7497  H  HZ3  . LYS A 1 32 ? -12.345 -1.220  1.449   1.00 0.00 ? 32 LYS A HZ3  13 
ATOM   7498  N  N    . ARG A 1 33 ? -6.755  5.308   0.231   1.00 0.00 ? 33 ARG A N    13 
ATOM   7499  C  CA   . ARG A 1 33 ? -6.432  6.724   0.335   1.00 0.00 ? 33 ARG A CA   13 
ATOM   7500  C  C    . ARG A 1 33 ? -5.622  7.194   -0.867  1.00 0.00 ? 33 ARG A C    13 
ATOM   7501  O  O    . ARG A 1 33 ? -5.519  8.389   -1.134  1.00 0.00 ? 33 ARG A O    13 
ATOM   7502  C  CB   . ARG A 1 33 ? -5.659  6.999   1.627   1.00 0.00 ? 33 ARG A CB   13 
ATOM   7503  C  CG   . ARG A 1 33 ? -6.364  7.962   2.566   1.00 0.00 ? 33 ARG A CG   13 
ATOM   7504  C  CD   . ARG A 1 33 ? -5.701  7.983   3.933   1.00 0.00 ? 33 ARG A CD   13 
ATOM   7505  N  NE   . ARG A 1 33 ? -6.479  7.249   4.931   1.00 0.00 ? 33 ARG A NE   13 
ATOM   7506  C  CZ   . ARG A 1 33 ? -5.942  6.583   5.953   1.00 0.00 ? 33 ARG A CZ   13 
ATOM   7507  N  NH1  . ARG A 1 33 ? -4.627  6.574   6.137   1.00 0.00 ? 33 ARG A NH1  13 
ATOM   7508  N  NH2  . ARG A 1 33 ? -6.731  5.931   6.801   1.00 0.00 ? 33 ARG A NH2  13 
ATOM   7509  H  H    . ARG A 1 33 ? -6.318  4.673   0.836   1.00 0.00 ? 33 ARG A H    13 
ATOM   7510  H  HA   . ARG A 1 33 ? -7.361  7.268   0.358   1.00 0.00 ? 33 ARG A HA   13 
ATOM   7511  H  HB2  . ARG A 1 33 ? -5.512  6.066   2.150   1.00 0.00 ? 33 ARG A HB2  13 
ATOM   7512  H  HB3  . ARG A 1 33 ? -4.696  7.417   1.374   1.00 0.00 ? 33 ARG A HB3  13 
ATOM   7513  H  HG2  . ARG A 1 33 ? -6.329  8.955   2.144   1.00 0.00 ? 33 ARG A HG2  13 
ATOM   7514  H  HG3  . ARG A 1 33 ? -7.392  7.651   2.680   1.00 0.00 ? 33 ARG A HG3  13 
ATOM   7515  H  HD2  . ARG A 1 33 ? -4.723  7.533   3.852   1.00 0.00 ? 33 ARG A HD2  13 
ATOM   7516  H  HD3  . ARG A 1 33 ? -5.599  9.009   4.253   1.00 0.00 ? 33 ARG A HD3  13 
ATOM   7517  H  HE   . ARG A 1 33 ? -7.461  7.250   4.831   1.00 0.00 ? 33 ARG A HE   13 
ATOM   7518  H  HH11 . ARG A 1 33 ? -4.017  7.067   5.501   1.00 0.00 ? 33 ARG A HH11 13 
ATOM   7519  H  HH12 . ARG A 1 33 ? -4.231  6.086   6.921   1.00 0.00 ? 33 ARG A HH12 13 
ATOM   7520  H  HH21 . ARG A 1 33 ? -7.726  5.944   6.673   1.00 0.00 ? 33 ARG A HH21 13 
ATOM   7521  H  HH22 . ARG A 1 33 ? -6.334  5.410   7.568   1.00 0.00 ? 33 ARG A HH22 13 
ATOM   7522  N  N    . HIS A 1 34 ? -5.100  6.243   -1.621  1.00 0.00 ? 34 HIS A N    13 
ATOM   7523  C  CA   . HIS A 1 34 ? -4.328  6.551   -2.816  1.00 0.00 ? 34 HIS A CA   13 
ATOM   7524  C  C    . HIS A 1 34 ? -5.256  6.760   -4.005  1.00 0.00 ? 34 HIS A C    13 
ATOM   7525  O  O    . HIS A 1 34 ? -4.841  7.243   -5.060  1.00 0.00 ? 34 HIS A O    13 
ATOM   7526  C  CB   . HIS A 1 34 ? -3.334  5.427   -3.111  1.00 0.00 ? 34 HIS A CB   13 
ATOM   7527  C  CG   . HIS A 1 34 ? -2.211  5.342   -2.121  1.00 0.00 ? 34 HIS A CG   13 
ATOM   7528  N  ND1  . HIS A 1 34 ? -1.410  6.400   -1.777  1.00 0.00 ? 34 HIS A ND1  13 
ATOM   7529  C  CD2  . HIS A 1 34 ? -1.760  4.284   -1.401  1.00 0.00 ? 34 HIS A CD2  13 
ATOM   7530  C  CE1  . HIS A 1 34 ? -0.517  5.967   -0.880  1.00 0.00 ? 34 HIS A CE1  13 
ATOM   7531  N  NE2  . HIS A 1 34 ? -0.682  4.683   -0.616  1.00 0.00 ? 34 HIS A NE2  13 
ATOM   7532  H  H    . HIS A 1 34 ? -5.267  5.305   -1.388  1.00 0.00 ? 34 HIS A H    13 
ATOM   7533  H  HA   . HIS A 1 34 ? -3.784  7.466   -2.632  1.00 0.00 ? 34 HIS A HA   13 
ATOM   7534  H  HB2  . HIS A 1 34 ? -3.856  4.483   -3.102  1.00 0.00 ? 34 HIS A HB2  13 
ATOM   7535  H  HB3  . HIS A 1 34 ? -2.903  5.586   -4.090  1.00 0.00 ? 34 HIS A HB3  13 
ATOM   7536  H  HD1  . HIS A 1 34 ? -1.457  7.312   -2.153  1.00 0.00 ? 34 HIS A HD1  13 
ATOM   7537  H  HD2  . HIS A 1 34 ? -2.165  3.283   -1.427  1.00 0.00 ? 34 HIS A HD2  13 
ATOM   7538  H  HE1  . HIS A 1 34 ? 0.239   6.588   -0.424  1.00 0.00 ? 34 HIS A HE1  13 
ATOM   7539  N  N    . MET A 1 35 ? -6.525  6.435   -3.808  1.00 0.00 ? 35 MET A N    13 
ATOM   7540  C  CA   . MET A 1 35 ? -7.536  6.622   -4.840  1.00 0.00 ? 35 MET A CA   13 
ATOM   7541  C  C    . MET A 1 35 ? -8.247  7.953   -4.632  1.00 0.00 ? 35 MET A C    13 
ATOM   7542  O  O    . MET A 1 35 ? -9.099  8.353   -5.424  1.00 0.00 ? 35 MET A O    13 
ATOM   7543  C  CB   . MET A 1 35 ? -8.547  5.475   -4.815  1.00 0.00 ? 35 MET A CB   13 
ATOM   7544  C  CG   . MET A 1 35 ? -7.909  4.102   -4.920  1.00 0.00 ? 35 MET A CG   13 
ATOM   7545  S  SD   . MET A 1 35 ? -8.971  2.793   -4.277  1.00 0.00 ? 35 MET A SD   13 
ATOM   7546  C  CE   . MET A 1 35 ? -7.868  1.385   -4.372  1.00 0.00 ? 35 MET A CE   13 
ATOM   7547  H  H    . MET A 1 35 ? -6.797  6.082   -2.932  1.00 0.00 ? 35 MET A H    13 
ATOM   7548  H  HA   . MET A 1 35 ? -7.039  6.637   -5.798  1.00 0.00 ? 35 MET A HA   13 
ATOM   7549  H  HB2  . MET A 1 35 ? -9.105  5.519   -3.893  1.00 0.00 ? 35 MET A HB2  13 
ATOM   7550  H  HB3  . MET A 1 35 ? -9.229  5.594   -5.644  1.00 0.00 ? 35 MET A HB3  13 
ATOM   7551  H  HG2  . MET A 1 35 ? -7.696  3.899   -5.957  1.00 0.00 ? 35 MET A HG2  13 
ATOM   7552  H  HG3  . MET A 1 35 ? -6.987  4.107   -4.358  1.00 0.00 ? 35 MET A HG3  13 
ATOM   7553  H  HE1  . MET A 1 35 ? -7.241  1.478   -5.246  1.00 0.00 ? 35 MET A HE1  13 
ATOM   7554  H  HE2  . MET A 1 35 ? -7.250  1.352   -3.487  1.00 0.00 ? 35 MET A HE2  13 
ATOM   7555  H  HE3  . MET A 1 35 ? -8.448  0.476   -4.439  1.00 0.00 ? 35 MET A HE3  13 
ATOM   7556  N  N    . LEU A 1 36 ? -7.823  8.670   -3.600  1.00 0.00 ? 36 LEU A N    13 
ATOM   7557  C  CA   . LEU A 1 36 ? -8.358  9.987   -3.307  1.00 0.00 ? 36 LEU A CA   13 
ATOM   7558  C  C    . LEU A 1 36 ? -7.306  11.035  -3.625  1.00 0.00 ? 36 LEU A C    13 
ATOM   7559  O  O    . LEU A 1 36 ? -6.663  11.589  -2.728  1.00 0.00 ? 36 LEU A O    13 
ATOM   7560  C  CB   . LEU A 1 36 ? -8.772  10.085  -1.837  1.00 0.00 ? 36 LEU A CB   13 
ATOM   7561  C  CG   . LEU A 1 36 ? -9.625  8.926   -1.319  1.00 0.00 ? 36 LEU A CG   13 
ATOM   7562  C  CD1  . LEU A 1 36 ? -9.272  8.609   0.123   1.00 0.00 ? 36 LEU A CD1  13 
ATOM   7563  C  CD2  . LEU A 1 36 ? -11.101 9.260   -1.440  1.00 0.00 ? 36 LEU A CD2  13 
ATOM   7564  H  H    . LEU A 1 36 ? -7.068  8.343   -3.071  1.00 0.00 ? 36 LEU A H    13 
ATOM   7565  H  HA   . LEU A 1 36 ? -9.221  10.151  -3.936  1.00 0.00 ? 36 LEU A HA   13 
ATOM   7566  H  HB2  . LEU A 1 36 ? -7.876  10.139  -1.236  1.00 0.00 ? 36 LEU A HB2  13 
ATOM   7567  H  HB3  . LEU A 1 36 ? -9.329  11.000  -1.701  1.00 0.00 ? 36 LEU A HB3  13 
ATOM   7568  H  HG   . LEU A 1 36 ? -9.429  8.046   -1.914  1.00 0.00 ? 36 LEU A HG   13 
ATOM   7569  H  HD11 . LEU A 1 36 ? -8.209  8.438   0.205   1.00 0.00 ? 36 LEU A HD11 13 
ATOM   7570  H  HD12 . LEU A 1 36 ? -9.554  9.438   0.755   1.00 0.00 ? 36 LEU A HD12 13 
ATOM   7571  H  HD13 . LEU A 1 36 ? -9.803  7.724   0.435   1.00 0.00 ? 36 LEU A HD13 13 
ATOM   7572  H  HD21 . LEU A 1 36 ? -11.521 8.734   -2.287  1.00 0.00 ? 36 LEU A HD21 13 
ATOM   7573  H  HD22 . LEU A 1 36 ? -11.614 8.958   -0.539  1.00 0.00 ? 36 LEU A HD22 13 
ATOM   7574  H  HD23 . LEU A 1 36 ? -11.220 10.324  -1.582  1.00 0.00 ? 36 LEU A HD23 13 
ATOM   7575  N  N    . VAL A 1 37 ? -7.054  11.209  -4.911  1.00 0.00 ? 37 VAL A N    13 
ATOM   7576  C  CA   . VAL A 1 37 ? -6.010  12.110  -5.362  1.00 0.00 ? 37 VAL A CA   13 
ATOM   7577  C  C    . VAL A 1 37 ? -6.450  13.557  -5.210  1.00 0.00 ? 37 VAL A C    13 
ATOM   7578  O  O    . VAL A 1 37 ? -5.610  14.405  -4.845  1.00 0.00 ? 37 VAL A O    13 
ATOM   7579  C  CB   . VAL A 1 37 ? -5.617  11.845  -6.833  1.00 0.00 ? 37 VAL A CB   13 
ATOM   7580  C  CG1  . VAL A 1 37 ? -4.686  10.647  -6.929  1.00 0.00 ? 37 VAL A CG1  13 
ATOM   7581  C  CG2  . VAL A 1 37 ? -6.851  11.640  -7.704  1.00 0.00 ? 37 VAL A CG2  13 
ATOM   7582  O  OXT  . VAL A 1 37 ? -7.645  13.843  -5.438  1.00 0.00 ? 37 VAL A OXT  13 
ATOM   7583  H  H    . VAL A 1 37 ? -7.551  10.683  -5.569  1.00 0.00 ? 37 VAL A H    13 
ATOM   7584  H  HA   . VAL A 1 37 ? -5.143  11.937  -4.741  1.00 0.00 ? 37 VAL A HA   13 
ATOM   7585  H  HB   . VAL A 1 37 ? -5.085  12.711  -7.201  1.00 0.00 ? 37 VAL A HB   13 
ATOM   7586  H  HG11 . VAL A 1 37 ? -5.159  9.788   -6.477  1.00 0.00 ? 37 VAL A HG11 13 
ATOM   7587  H  HG12 . VAL A 1 37 ? -4.475  10.438  -7.968  1.00 0.00 ? 37 VAL A HG12 13 
ATOM   7588  H  HG13 . VAL A 1 37 ? -3.764  10.866  -6.409  1.00 0.00 ? 37 VAL A HG13 13 
ATOM   7589  H  HG21 . VAL A 1 37 ? -7.251  10.651  -7.535  1.00 0.00 ? 37 VAL A HG21 13 
ATOM   7590  H  HG22 . VAL A 1 37 ? -7.599  12.378  -7.448  1.00 0.00 ? 37 VAL A HG22 13 
ATOM   7591  H  HG23 . VAL A 1 37 ? -6.580  11.747  -8.744  1.00 0.00 ? 37 VAL A HG23 13 
HETATM 7592  ZN ZN   . ZN  B 2 .  ? 0.728   3.539   0.134   1.00 0.00 ? 38 ZN  A ZN   13 
ATOM   7593  N  N    . GLY A 1 1  ? 8.337   5.974   -2.780  1.00 0.00 ? 1  GLY A N    14 
ATOM   7594  C  CA   . GLY A 1 1  ? 7.608   4.826   -3.371  1.00 0.00 ? 1  GLY A CA   14 
ATOM   7595  C  C    . GLY A 1 1  ? 8.330   3.516   -3.146  1.00 0.00 ? 1  GLY A C    14 
ATOM   7596  O  O    . GLY A 1 1  ? 8.998   3.340   -2.127  1.00 0.00 ? 1  GLY A O    14 
ATOM   7597  H  H1   . GLY A 1 1  ? 9.366   5.832   -2.871  1.00 0.00 ? 1  GLY A H1   14 
ATOM   7598  H  H2   . GLY A 1 1  ? 8.102   6.064   -1.767  1.00 0.00 ? 1  GLY A H2   14 
ATOM   7599  H  H3   . GLY A 1 1  ? 8.072   6.856   -3.269  1.00 0.00 ? 1  GLY A H3   14 
ATOM   7600  H  HA2  . GLY A 1 1  ? 6.627   4.767   -2.924  1.00 0.00 ? 1  GLY A HA2  14 
ATOM   7601  H  HA3  . GLY A 1 1  ? 7.499   4.989   -4.435  1.00 0.00 ? 1  GLY A HA3  14 
ATOM   7602  N  N    . SER A 1 2  ? 8.207   2.600   -4.101  1.00 0.00 ? 2  SER A N    14 
ATOM   7603  C  CA   . SER A 1 2  ? 8.842   1.295   -4.005  1.00 0.00 ? 2  SER A CA   14 
ATOM   7604  C  C    . SER A 1 2  ? 10.350  1.400   -4.225  1.00 0.00 ? 2  SER A C    14 
ATOM   7605  O  O    . SER A 1 2  ? 10.833  2.314   -4.901  1.00 0.00 ? 2  SER A O    14 
ATOM   7606  C  CB   . SER A 1 2  ? 8.223   0.347   -5.033  1.00 0.00 ? 2  SER A CB   14 
ATOM   7607  O  OG   . SER A 1 2  ? 7.315   1.043   -5.874  1.00 0.00 ? 2  SER A OG   14 
ATOM   7608  H  H    . SER A 1 2  ? 7.667   2.804   -4.896  1.00 0.00 ? 2  SER A H    14 
ATOM   7609  H  HA   . SER A 1 2  ? 8.660   0.907   -3.013  1.00 0.00 ? 2  SER A HA   14 
ATOM   7610  H  HB2  . SER A 1 2  ? 9.004   -0.083  -5.641  1.00 0.00 ? 2  SER A HB2  14 
ATOM   7611  H  HB3  . SER A 1 2  ? 7.689   -0.439  -4.519  1.00 0.00 ? 2  SER A HB3  14 
ATOM   7612  H  HG   . SER A 1 2  ? 7.486   0.802   -6.798  1.00 0.00 ? 2  SER A HG   14 
ATOM   7613  N  N    . THR A 1 3  ? 11.092  0.504   -3.595  1.00 0.00 ? 3  THR A N    14 
ATOM   7614  C  CA   . THR A 1 3  ? 12.543  0.514   -3.673  1.00 0.00 ? 3  THR A CA   14 
ATOM   7615  C  C    . THR A 1 3  ? 13.070  -0.856  -4.100  1.00 0.00 ? 3  THR A C    14 
ATOM   7616  O  O    . THR A 1 3  ? 12.325  -1.836  -4.116  1.00 0.00 ? 3  THR A O    14 
ATOM   7617  C  CB   . THR A 1 3  ? 13.145  0.901   -2.311  1.00 0.00 ? 3  THR A CB   14 
ATOM   7618  O  OG1  . THR A 1 3  ? 12.161  1.583   -1.523  1.00 0.00 ? 3  THR A OG1  14 
ATOM   7619  C  CG2  . THR A 1 3  ? 14.368  1.786   -2.475  1.00 0.00 ? 3  THR A CG2  14 
ATOM   7620  H  H    . THR A 1 3  ? 10.653  -0.151  -3.008  1.00 0.00 ? 3  THR A H    14 
ATOM   7621  H  HA   . THR A 1 3  ? 12.839  1.255   -4.402  1.00 0.00 ? 3  THR A HA   14 
ATOM   7622  H  HB   . THR A 1 3  ? 13.440  -0.004  -1.797  1.00 0.00 ? 3  THR A HB   14 
ATOM   7623  H  HG1  . THR A 1 3  ? 11.401  0.994   -1.379  1.00 0.00 ? 3  THR A HG1  14 
ATOM   7624  H  HG21 . THR A 1 3  ? 14.088  2.818   -2.328  1.00 0.00 ? 3  THR A HG21 14 
ATOM   7625  H  HG22 . THR A 1 3  ? 14.774  1.660   -3.467  1.00 0.00 ? 3  THR A HG22 14 
ATOM   7626  H  HG23 . THR A 1 3  ? 15.112  1.506   -1.741  1.00 0.00 ? 3  THR A HG23 14 
ATOM   7627  N  N    . ARG A 1 4  ? 14.336  -0.917  -4.488  1.00 0.00 ? 4  ARG A N    14 
ATOM   7628  C  CA   . ARG A 1 4  ? 14.955  -2.181  -4.873  1.00 0.00 ? 4  ARG A CA   14 
ATOM   7629  C  C    . ARG A 1 4  ? 15.736  -2.771  -3.702  1.00 0.00 ? 4  ARG A C    14 
ATOM   7630  O  O    . ARG A 1 4  ? 15.665  -2.261  -2.581  1.00 0.00 ? 4  ARG A O    14 
ATOM   7631  C  CB   . ARG A 1 4  ? 15.879  -1.976  -6.074  1.00 0.00 ? 4  ARG A CB   14 
ATOM   7632  C  CG   . ARG A 1 4  ? 15.175  -2.127  -7.410  1.00 0.00 ? 4  ARG A CG   14 
ATOM   7633  C  CD   . ARG A 1 4  ? 15.262  -0.850  -8.230  1.00 0.00 ? 4  ARG A CD   14 
ATOM   7634  N  NE   . ARG A 1 4  ? 13.996  -0.117  -8.243  1.00 0.00 ? 4  ARG A NE   14 
ATOM   7635  C  CZ   . ARG A 1 4  ? 13.000  -0.359  -9.095  1.00 0.00 ? 4  ARG A CZ   14 
ATOM   7636  N  NH1  . ARG A 1 4  ? 13.089  -1.356  -9.970  1.00 0.00 ? 4  ARG A NH1  14 
ATOM   7637  N  NH2  . ARG A 1 4  ? 11.901  0.387   -9.057  1.00 0.00 ? 4  ARG A NH2  14 
ATOM   7638  H  H    . ARG A 1 4  ? 14.877  -0.096  -4.492  1.00 0.00 ? 4  ARG A H    14 
ATOM   7639  H  HA   . ARG A 1 4  ? 14.167  -2.865  -5.146  1.00 0.00 ? 4  ARG A HA   14 
ATOM   7640  H  HB2  . ARG A 1 4  ? 16.301  -0.983  -6.023  1.00 0.00 ? 4  ARG A HB2  14 
ATOM   7641  H  HB3  . ARG A 1 4  ? 16.675  -2.701  -6.027  1.00 0.00 ? 4  ARG A HB3  14 
ATOM   7642  H  HG2  . ARG A 1 4  ? 15.639  -2.931  -7.963  1.00 0.00 ? 4  ARG A HG2  14 
ATOM   7643  H  HG3  . ARG A 1 4  ? 14.136  -2.360  -7.234  1.00 0.00 ? 4  ARG A HG3  14 
ATOM   7644  H  HD2  . ARG A 1 4  ? 16.030  -0.218  -7.808  1.00 0.00 ? 4  ARG A HD2  14 
ATOM   7645  H  HD3  . ARG A 1 4  ? 15.527  -1.106  -9.245  1.00 0.00 ? 4  ARG A HD3  14 
ATOM   7646  H  HE   . ARG A 1 4  ? 13.889  0.613   -7.579  1.00 0.00 ? 4  ARG A HE   14 
ATOM   7647  H  HH11 . ARG A 1 4  ? 13.913  -1.937  -10.000 1.00 0.00 ? 4  ARG A HH11 14 
ATOM   7648  H  HH12 . ARG A 1 4  ? 12.328  -1.542  -10.609 1.00 0.00 ? 4  ARG A HH12 14 
ATOM   7649  H  HH21 . ARG A 1 4  ? 11.815  1.136   -8.388  1.00 0.00 ? 4  ARG A HH21 14 
ATOM   7650  H  HH22 . ARG A 1 4  ? 11.152  0.217   -9.704  1.00 0.00 ? 4  ARG A HH22 14 
ATOM   7651  N  N    . GLY A 1 5  ? 16.527  -3.803  -3.981  1.00 0.00 ? 5  GLY A N    14 
ATOM   7652  C  CA   . GLY A 1 5  ? 17.386  -4.388  -2.970  1.00 0.00 ? 5  GLY A CA   14 
ATOM   7653  C  C    . GLY A 1 5  ? 16.625  -5.174  -1.922  1.00 0.00 ? 5  GLY A C    14 
ATOM   7654  O  O    . GLY A 1 5  ? 16.267  -6.334  -2.141  1.00 0.00 ? 5  GLY A O    14 
ATOM   7655  H  H    . GLY A 1 5  ? 16.558  -4.149  -4.904  1.00 0.00 ? 5  GLY A H    14 
ATOM   7656  H  HA2  . GLY A 1 5  ? 18.092  -5.048  -3.454  1.00 0.00 ? 5  GLY A HA2  14 
ATOM   7657  H  HA3  . GLY A 1 5  ? 17.935  -3.595  -2.480  1.00 0.00 ? 5  GLY A HA3  14 
ATOM   7658  N  N    . SER A 1 6  ? 16.403  -4.549  -0.776  1.00 0.00 ? 6  SER A N    14 
ATOM   7659  C  CA   . SER A 1 6  ? 15.737  -5.198  0.345   1.00 0.00 ? 6  SER A CA   14 
ATOM   7660  C  C    . SER A 1 6  ? 14.649  -4.292  0.909   1.00 0.00 ? 6  SER A C    14 
ATOM   7661  O  O    . SER A 1 6  ? 13.922  -4.657  1.836   1.00 0.00 ? 6  SER A O    14 
ATOM   7662  C  CB   . SER A 1 6  ? 16.763  -5.536  1.428   1.00 0.00 ? 6  SER A CB   14 
ATOM   7663  O  OG   . SER A 1 6  ? 18.010  -4.904  1.167   1.00 0.00 ? 6  SER A OG   14 
ATOM   7664  H  H    . SER A 1 6  ? 16.747  -3.634  -0.658  1.00 0.00 ? 6  SER A H    14 
ATOM   7665  H  HA   . SER A 1 6  ? 15.284  -6.106  -0.017  1.00 0.00 ? 6  SER A HA   14 
ATOM   7666  H  HB2  . SER A 1 6  ? 16.396  -5.196  2.385   1.00 0.00 ? 6  SER A HB2  14 
ATOM   7667  H  HB3  . SER A 1 6  ? 16.913  -6.604  1.458   1.00 0.00 ? 6  SER A HB3  14 
ATOM   7668  H  HG   . SER A 1 6  ? 17.860  -3.971  0.944   1.00 0.00 ? 6  SER A HG   14 
ATOM   7669  N  N    . THR A 1 7  ? 14.497  -3.151  0.267   1.00 0.00 ? 7  THR A N    14 
ATOM   7670  C  CA   . THR A 1 7  ? 13.450  -2.196  0.589   1.00 0.00 ? 7  THR A CA   14 
ATOM   7671  C  C    . THR A 1 7  ? 12.211  -2.486  -0.252  1.00 0.00 ? 7  THR A C    14 
ATOM   7672  O  O    . THR A 1 7  ? 12.226  -2.307  -1.466  1.00 0.00 ? 7  THR A O    14 
ATOM   7673  C  CB   . THR A 1 7  ? 13.938  -0.754  0.368   1.00 0.00 ? 7  THR A CB   14 
ATOM   7674  O  OG1  . THR A 1 7  ? 15.173  -0.765  -0.367  1.00 0.00 ? 7  THR A OG1  14 
ATOM   7675  C  CG2  . THR A 1 7  ? 14.142  -0.039  1.695   1.00 0.00 ? 7  THR A CG2  14 
ATOM   7676  H  H    . THR A 1 7  ? 15.076  -2.969  -0.501  1.00 0.00 ? 7  THR A H    14 
ATOM   7677  H  HA   . THR A 1 7  ? 13.200  -2.317  1.634   1.00 0.00 ? 7  THR A HA   14 
ATOM   7678  H  HB   . THR A 1 7  ? 13.193  -0.219  -0.201  1.00 0.00 ? 7  THR A HB   14 
ATOM   7679  H  HG1  . THR A 1 7  ? 15.014  -1.090  -1.265  1.00 0.00 ? 7  THR A HG1  14 
ATOM   7680  H  HG21 . THR A 1 7  ? 14.484  -0.745  2.437   1.00 0.00 ? 7  THR A HG21 14 
ATOM   7681  H  HG22 . THR A 1 7  ? 13.206  0.398   2.015   1.00 0.00 ? 7  THR A HG22 14 
ATOM   7682  H  HG23 . THR A 1 7  ? 14.880  0.741   1.572   1.00 0.00 ? 7  THR A HG23 14 
ATOM   7683  N  N    . GLY A 1 8  ? 11.241  -3.151  0.353   1.00 0.00 ? 8  GLY A N    14 
ATOM   7684  C  CA   . GLY A 1 8  ? 10.099  -3.629  -0.387  1.00 0.00 ? 8  GLY A CA   14 
ATOM   7685  C  C    . GLY A 1 8  ? 9.863   -5.115  -0.209  1.00 0.00 ? 8  GLY A C    14 
ATOM   7686  O  O    . GLY A 1 8  ? 9.938   -5.882  -1.173  1.00 0.00 ? 8  GLY A O    14 
ATOM   7687  H  H    . GLY A 1 8  ? 11.308  -3.334  1.306   1.00 0.00 ? 8  GLY A H    14 
ATOM   7688  H  HA2  . GLY A 1 8  ? 9.220   -3.094  -0.056  1.00 0.00 ? 8  GLY A HA2  14 
ATOM   7689  H  HA3  . GLY A 1 8  ? 10.255  -3.425  -1.437  1.00 0.00 ? 8  GLY A HA3  14 
ATOM   7690  N  N    . ILE A 1 9  ? 9.536   -5.516  1.011   1.00 0.00 ? 9  ILE A N    14 
ATOM   7691  C  CA   . ILE A 1 9  ? 9.229   -6.909  1.315   1.00 0.00 ? 9  ILE A CA   14 
ATOM   7692  C  C    . ILE A 1 9  ? 7.814   -7.264  0.841   1.00 0.00 ? 9  ILE A C    14 
ATOM   7693  O  O    . ILE A 1 9  ? 7.068   -6.385  0.408   1.00 0.00 ? 9  ILE A O    14 
ATOM   7694  C  CB   . ILE A 1 9  ? 9.345   -7.175  2.836   1.00 0.00 ? 9  ILE A CB   14 
ATOM   7695  C  CG1  . ILE A 1 9  ? 10.425  -6.290  3.462   1.00 0.00 ? 9  ILE A CG1  14 
ATOM   7696  C  CG2  . ILE A 1 9  ? 9.650   -8.641  3.114   1.00 0.00 ? 9  ILE A CG2  14 
ATOM   7697  C  CD1  . ILE A 1 9  ? 10.315  -6.176  4.967   1.00 0.00 ? 9  ILE A CD1  14 
ATOM   7698  H  H    . ILE A 1 9  ? 9.424   -4.844  1.721   1.00 0.00 ? 9  ILE A H    14 
ATOM   7699  H  HA   . ILE A 1 9  ? 9.943   -7.535  0.801   1.00 0.00 ? 9  ILE A HA   14 
ATOM   7700  H  HB   . ILE A 1 9  ? 8.395   -6.934  3.286   1.00 0.00 ? 9  ILE A HB   14 
ATOM   7701  H  HG12 . ILE A 1 9  ? 11.395  -6.702  3.232   1.00 0.00 ? 9  ILE A HG12 14 
ATOM   7702  H  HG13 . ILE A 1 9  ? 10.353  -5.296  3.047   1.00 0.00 ? 9  ILE A HG13 14 
ATOM   7703  H  HG21 . ILE A 1 9  ? 10.327  -9.017  2.360   1.00 0.00 ? 9  ILE A HG21 14 
ATOM   7704  H  HG22 . ILE A 1 9  ? 10.108  -8.737  4.088   1.00 0.00 ? 9  ILE A HG22 14 
ATOM   7705  H  HG23 . ILE A 1 9  ? 8.732   -9.209  3.090   1.00 0.00 ? 9  ILE A HG23 14 
ATOM   7706  H  HD11 . ILE A 1 9  ? 11.106  -5.542  5.339   1.00 0.00 ? 9  ILE A HD11 14 
ATOM   7707  H  HD12 . ILE A 1 9  ? 9.357   -5.748  5.226   1.00 0.00 ? 9  ILE A HD12 14 
ATOM   7708  H  HD13 . ILE A 1 9  ? 10.402  -7.156  5.411   1.00 0.00 ? 9  ILE A HD13 14 
ATOM   7709  N  N    . LYS A 1 10 ? 7.447   -8.544  0.974   1.00 0.00 ? 10 LYS A N    14 
ATOM   7710  C  CA   . LYS A 1 10 ? 6.109   -9.033  0.682   1.00 0.00 ? 10 LYS A CA   14 
ATOM   7711  C  C    . LYS A 1 10 ? 5.781   -9.001  -0.808  1.00 0.00 ? 10 LYS A C    14 
ATOM   7712  O  O    . LYS A 1 10 ? 6.234   -8.134  -1.556  1.00 0.00 ? 10 LYS A O    14 
ATOM   7713  C  CB   . LYS A 1 10 ? 5.060   -8.268  1.494   1.00 0.00 ? 10 LYS A CB   14 
ATOM   7714  C  CG   . LYS A 1 10 ? 4.633   -8.990  2.763   1.00 0.00 ? 10 LYS A CG   14 
ATOM   7715  C  CD   . LYS A 1 10 ? 4.784   -8.105  3.988   1.00 0.00 ? 10 LYS A CD   14 
ATOM   7716  C  CE   . LYS A 1 10 ? 4.679   -8.907  5.273   1.00 0.00 ? 10 LYS A CE   14 
ATOM   7717  N  NZ   . LYS A 1 10 ? 3.271   -9.277  5.593   1.00 0.00 ? 10 LYS A NZ   14 
ATOM   7718  H  H    . LYS A 1 10 ? 8.092   -9.181  1.326   1.00 0.00 ? 10 LYS A H    14 
ATOM   7719  H  HA   . LYS A 1 10 ? 6.085   -10.066 1.000   1.00 0.00 ? 10 LYS A HA   14 
ATOM   7720  H  HB2  . LYS A 1 10 ? 5.465   -7.307  1.774   1.00 0.00 ? 10 LYS A HB2  14 
ATOM   7721  H  HB3  . LYS A 1 10 ? 4.184   -8.117  0.881   1.00 0.00 ? 10 LYS A HB3  14 
ATOM   7722  H  HG2  . LYS A 1 10 ? 3.597   -9.280  2.669   1.00 0.00 ? 10 LYS A HG2  14 
ATOM   7723  H  HG3  . LYS A 1 10 ? 5.245   -9.870  2.887   1.00 0.00 ? 10 LYS A HG3  14 
ATOM   7724  H  HD2  . LYS A 1 10 ? 5.750   -7.625  3.952   1.00 0.00 ? 10 LYS A HD2  14 
ATOM   7725  H  HD3  . LYS A 1 10 ? 4.008   -7.353  3.976   1.00 0.00 ? 10 LYS A HD3  14 
ATOM   7726  H  HE2  . LYS A 1 10 ? 5.262   -9.810  5.168   1.00 0.00 ? 10 LYS A HE2  14 
ATOM   7727  H  HE3  . LYS A 1 10 ? 5.080   -8.315  6.085   1.00 0.00 ? 10 LYS A HE3  14 
ATOM   7728  H  HZ1  . LYS A 1 10 ? 2.650   -8.443  5.501   1.00 0.00 ? 10 LYS A HZ1  14 
ATOM   7729  H  HZ2  . LYS A 1 10 ? 3.209   -9.633  6.571   1.00 0.00 ? 10 LYS A HZ2  14 
ATOM   7730  H  HZ3  . LYS A 1 10 ? 2.936   -10.021 4.943   1.00 0.00 ? 10 LYS A HZ3  14 
ATOM   7731  N  N    . PRO A 1 11 ? 5.012   -9.999  -1.256  1.00 0.00 ? 11 PRO A N    14 
ATOM   7732  C  CA   . PRO A 1 11 ? 4.616   -10.156 -2.660  1.00 0.00 ? 11 PRO A CA   14 
ATOM   7733  C  C    . PRO A 1 11 ? 3.801   -8.974  -3.165  1.00 0.00 ? 11 PRO A C    14 
ATOM   7734  O  O    . PRO A 1 11 ? 3.839   -8.636  -4.349  1.00 0.00 ? 11 PRO A O    14 
ATOM   7735  C  CB   . PRO A 1 11 ? 3.746   -11.414 -2.656  1.00 0.00 ? 11 PRO A CB   14 
ATOM   7736  C  CG   . PRO A 1 11 ? 4.121   -12.137 -1.414  1.00 0.00 ? 11 PRO A CG   14 
ATOM   7737  C  CD   . PRO A 1 11 ? 4.497   -11.080 -0.417  1.00 0.00 ? 11 PRO A CD   14 
ATOM   7738  H  HA   . PRO A 1 11 ? 5.470   -10.313 -3.297  1.00 0.00 ? 11 PRO A HA   14 
ATOM   7739  H  HB2  . PRO A 1 11 ? 2.702   -11.134 -2.649  1.00 0.00 ? 11 PRO A HB2  14 
ATOM   7740  H  HB3  . PRO A 1 11 ? 3.959   -12.003 -3.536  1.00 0.00 ? 11 PRO A HB3  14 
ATOM   7741  H  HG2  . PRO A 1 11 ? 3.283   -12.707 -1.058  1.00 0.00 ? 11 PRO A HG2  14 
ATOM   7742  H  HG3  . PRO A 1 11 ? 4.963   -12.786 -1.607  1.00 0.00 ? 11 PRO A HG3  14 
ATOM   7743  H  HD2  . PRO A 1 11 ? 3.642   -10.751 0.146   1.00 0.00 ? 11 PRO A HD2  14 
ATOM   7744  H  HD3  . PRO A 1 11 ? 5.256   -11.443 0.249   1.00 0.00 ? 11 PRO A HD3  14 
ATOM   7745  N  N    . PHE A 1 12 ? 3.025   -8.383  -2.270  1.00 0.00 ? 12 PHE A N    14 
ATOM   7746  C  CA   . PHE A 1 12 ? 2.150   -7.281  -2.630  1.00 0.00 ? 12 PHE A CA   14 
ATOM   7747  C  C    . PHE A 1 12 ? 2.539   -6.016  -1.882  1.00 0.00 ? 12 PHE A C    14 
ATOM   7748  O  O    . PHE A 1 12 ? 1.984   -5.690  -0.842  1.00 0.00 ? 12 PHE A O    14 
ATOM   7749  C  CB   . PHE A 1 12 ? 0.698   -7.650  -2.345  1.00 0.00 ? 12 PHE A CB   14 
ATOM   7750  C  CG   . PHE A 1 12 ? 0.212   -8.812  -3.165  1.00 0.00 ? 12 PHE A CG   14 
ATOM   7751  C  CD1  . PHE A 1 12 ? 0.116   -8.711  -4.543  1.00 0.00 ? 12 PHE A CD1  14 
ATOM   7752  C  CD2  . PHE A 1 12 ? -0.138  -10.006 -2.559  1.00 0.00 ? 12 PHE A CD2  14 
ATOM   7753  C  CE1  . PHE A 1 12 ? -0.327  -9.777  -5.302  1.00 0.00 ? 12 PHE A CE1  14 
ATOM   7754  C  CE2  . PHE A 1 12 ? -0.581  -11.078 -3.312  1.00 0.00 ? 12 PHE A CE2  14 
ATOM   7755  C  CZ   . PHE A 1 12 ? -0.675  -10.963 -4.685  1.00 0.00 ? 12 PHE A CZ   14 
ATOM   7756  H  H    . PHE A 1 12 ? 3.027   -8.713  -1.344  1.00 0.00 ? 12 PHE A H    14 
ATOM   7757  H  HA   . PHE A 1 12 ? 2.263   -7.108  -3.688  1.00 0.00 ? 12 PHE A HA   14 
ATOM   7758  H  HB2  . PHE A 1 12 ? 0.601   -7.910  -1.300  1.00 0.00 ? 12 PHE A HB2  14 
ATOM   7759  H  HB3  . PHE A 1 12 ? 0.068   -6.802  -2.560  1.00 0.00 ? 12 PHE A HB3  14 
ATOM   7760  H  HD1  . PHE A 1 12 ? 0.389   -7.785  -5.026  1.00 0.00 ? 12 PHE A HD1  14 
ATOM   7761  H  HD2  . PHE A 1 12 ? -0.067  -10.097 -1.485  1.00 0.00 ? 12 PHE A HD2  14 
ATOM   7762  H  HE1  . PHE A 1 12 ? -0.401  -9.683  -6.374  1.00 0.00 ? 12 PHE A HE1  14 
ATOM   7763  H  HE2  . PHE A 1 12 ? -0.850  -12.005 -2.829  1.00 0.00 ? 12 PHE A HE2  14 
ATOM   7764  H  HZ   . PHE A 1 12 ? -1.019  -11.800 -5.275  1.00 0.00 ? 12 PHE A HZ   14 
ATOM   7765  N  N    . GLN A 1 13 ? 3.510   -5.321  -2.428  1.00 0.00 ? 13 GLN A N    14 
ATOM   7766  C  CA   . GLN A 1 13 ? 4.010   -4.084  -1.866  1.00 0.00 ? 13 GLN A CA   14 
ATOM   7767  C  C    . GLN A 1 13 ? 3.158   -2.900  -2.287  1.00 0.00 ? 13 GLN A C    14 
ATOM   7768  O  O    . GLN A 1 13 ? 2.732   -2.836  -3.438  1.00 0.00 ? 13 GLN A O    14 
ATOM   7769  C  CB   . GLN A 1 13 ? 5.413   -3.876  -2.393  1.00 0.00 ? 13 GLN A CB   14 
ATOM   7770  C  CG   . GLN A 1 13 ? 6.450   -3.625  -1.342  1.00 0.00 ? 13 GLN A CG   14 
ATOM   7771  C  CD   . GLN A 1 13 ? 7.521   -2.685  -1.838  1.00 0.00 ? 13 GLN A CD   14 
ATOM   7772  O  OE1  . GLN A 1 13 ? 8.004   -2.807  -2.965  1.00 0.00 ? 13 GLN A OE1  14 
ATOM   7773  N  NE2  . GLN A 1 13 ? 7.895   -1.739  -1.005  1.00 0.00 ? 13 GLN A NE2  14 
ATOM   7774  H  H    . GLN A 1 13 ? 3.914   -5.647  -3.257  1.00 0.00 ? 13 GLN A H    14 
ATOM   7775  H  HA   . GLN A 1 13 ? 4.031   -4.162  -0.792  1.00 0.00 ? 13 GLN A HA   14 
ATOM   7776  H  HB2  . GLN A 1 13 ? 5.701   -4.760  -2.935  1.00 0.00 ? 13 GLN A HB2  14 
ATOM   7777  H  HB3  . GLN A 1 13 ? 5.407   -3.036  -3.070  1.00 0.00 ? 13 GLN A HB3  14 
ATOM   7778  H  HG2  . GLN A 1 13 ? 5.973   -3.186  -0.476  1.00 0.00 ? 13 GLN A HG2  14 
ATOM   7779  H  HG3  . GLN A 1 13 ? 6.900   -4.560  -1.070  1.00 0.00 ? 13 GLN A HG3  14 
ATOM   7780  H  HE21 . GLN A 1 13 ? 7.459   -1.700  -0.128  1.00 0.00 ? 13 GLN A HE21 14 
ATOM   7781  H  HE22 . GLN A 1 13 ? 8.613   -1.119  -1.286  1.00 0.00 ? 13 GLN A HE22 14 
ATOM   7782  N  N    . CYS A 1 14 ? 3.129   -1.858  -1.463  1.00 0.00 ? 14 CYS A N    14 
ATOM   7783  C  CA   . CYS A 1 14 ? 2.600   -0.592  -1.935  1.00 0.00 ? 14 CYS A CA   14 
ATOM   7784  C  C    . CYS A 1 14 ? 3.639   0.089   -2.811  1.00 0.00 ? 14 CYS A C    14 
ATOM   7785  O  O    . CYS A 1 14 ? 4.704   0.485   -2.324  1.00 0.00 ? 14 CYS A O    14 
ATOM   7786  C  CB   . CYS A 1 14 ? 2.186   0.368   -0.816  1.00 0.00 ? 14 CYS A CB   14 
ATOM   7787  S  SG   . CYS A 1 14 ? 1.320   1.828   -1.499  1.00 0.00 ? 14 CYS A SG   14 
ATOM   7788  H  H    . CYS A 1 14 ? 3.670   -1.885  -0.644  1.00 0.00 ? 14 CYS A H    14 
ATOM   7789  H  HA   . CYS A 1 14 ? 1.731   -0.810  -2.535  1.00 0.00 ? 14 CYS A HA   14 
ATOM   7790  H  HB2  . CYS A 1 14 ? 1.524   -0.141  -0.130  1.00 0.00 ? 14 CYS A HB2  14 
ATOM   7791  H  HB3  . CYS A 1 14 ? 3.063   0.713   -0.290  1.00 0.00 ? 14 CYS A HB3  14 
ATOM   7792  N  N    . PRO A 1 15 ? 3.321   0.303   -4.092  1.00 0.00 ? 15 PRO A N    14 
ATOM   7793  C  CA   . PRO A 1 15 ? 4.216   0.998   -5.010  1.00 0.00 ? 15 PRO A CA   14 
ATOM   7794  C  C    . PRO A 1 15 ? 4.266   2.494   -4.717  1.00 0.00 ? 15 PRO A C    14 
ATOM   7795  O  O    . PRO A 1 15 ? 4.948   3.254   -5.404  1.00 0.00 ? 15 PRO A O    14 
ATOM   7796  C  CB   . PRO A 1 15 ? 3.586   0.733   -6.379  1.00 0.00 ? 15 PRO A CB   14 
ATOM   7797  C  CG   . PRO A 1 15 ? 2.133   0.550   -6.101  1.00 0.00 ? 15 PRO A CG   14 
ATOM   7798  C  CD   . PRO A 1 15 ? 2.040   -0.062  -4.730  1.00 0.00 ? 15 PRO A CD   14 
ATOM   7799  H  HA   . PRO A 1 15 ? 5.213   0.588   -4.980  1.00 0.00 ? 15 PRO A HA   14 
ATOM   7800  H  HB2  . PRO A 1 15 ? 3.762   1.577   -7.029  1.00 0.00 ? 15 PRO A HB2  14 
ATOM   7801  H  HB3  . PRO A 1 15 ? 4.019   -0.158  -6.810  1.00 0.00 ? 15 PRO A HB3  14 
ATOM   7802  H  HG2  . PRO A 1 15 ? 1.633   1.505   -6.119  1.00 0.00 ? 15 PRO A HG2  14 
ATOM   7803  H  HG3  . PRO A 1 15 ? 1.702   -0.114  -6.836  1.00 0.00 ? 15 PRO A HG3  14 
ATOM   7804  H  HD2  . PRO A 1 15 ? 1.207   0.357   -4.187  1.00 0.00 ? 15 PRO A HD2  14 
ATOM   7805  H  HD3  . PRO A 1 15 ? 1.942   -1.137  -4.803  1.00 0.00 ? 15 PRO A HD3  14 
ATOM   7806  N  N    . ASP A 1 16 ? 3.479   2.920   -3.737  1.00 0.00 ? 16 ASP A N    14 
ATOM   7807  C  CA   . ASP A 1 16 ? 3.377   4.323   -3.396  1.00 0.00 ? 16 ASP A CA   14 
ATOM   7808  C  C    . ASP A 1 16 ? 4.123   4.624   -2.104  1.00 0.00 ? 16 ASP A C    14 
ATOM   7809  O  O    . ASP A 1 16 ? 4.304   5.788   -1.743  1.00 0.00 ? 16 ASP A O    14 
ATOM   7810  C  CB   . ASP A 1 16 ? 1.905   4.700   -3.231  1.00 0.00 ? 16 ASP A CB   14 
ATOM   7811  C  CG   . ASP A 1 16 ? 1.313   5.369   -4.454  1.00 0.00 ? 16 ASP A CG   14 
ATOM   7812  O  OD1  . ASP A 1 16 ? 2.020   6.156   -5.121  1.00 0.00 ? 16 ASP A OD1  14 
ATOM   7813  O  OD2  . ASP A 1 16 ? 0.130   5.102   -4.763  1.00 0.00 ? 16 ASP A OD2  14 
ATOM   7814  H  H    . ASP A 1 16 ? 2.906   2.273   -3.262  1.00 0.00 ? 16 ASP A H    14 
ATOM   7815  H  HA   . ASP A 1 16 ? 3.806   4.900   -4.199  1.00 0.00 ? 16 ASP A HA   14 
ATOM   7816  H  HB2  . ASP A 1 16 ? 1.340   3.805   -3.034  1.00 0.00 ? 16 ASP A HB2  14 
ATOM   7817  H  HB3  . ASP A 1 16 ? 1.810   5.367   -2.392  1.00 0.00 ? 16 ASP A HB3  14 
ATOM   7818  N  N    . CYS A 1 17 ? 4.404   3.584   -1.325  1.00 0.00 ? 17 CYS A N    14 
ATOM   7819  C  CA   . CYS A 1 17 ? 4.918   3.790   0.022   1.00 0.00 ? 17 CYS A CA   14 
ATOM   7820  C  C    . CYS A 1 17 ? 6.204   3.028   0.332   1.00 0.00 ? 17 CYS A C    14 
ATOM   7821  O  O    . CYS A 1 17 ? 6.866   3.369   1.314   1.00 0.00 ? 17 CYS A O    14 
ATOM   7822  C  CB   . CYS A 1 17 ? 3.868   3.372   1.040   1.00 0.00 ? 17 CYS A CB   14 
ATOM   7823  S  SG   . CYS A 1 17 ? 2.413   4.453   1.082   1.00 0.00 ? 17 CYS A SG   14 
ATOM   7824  H  H    . CYS A 1 17 ? 4.118   2.687   -1.603  1.00 0.00 ? 17 CYS A H    14 
ATOM   7825  H  HA   . CYS A 1 17 ? 5.102   4.842   0.138   1.00 0.00 ? 17 CYS A HA   14 
ATOM   7826  H  HB2  . CYS A 1 17 ? 3.535   2.373   0.807   1.00 0.00 ? 17 CYS A HB2  14 
ATOM   7827  H  HB3  . CYS A 1 17 ? 4.312   3.379   2.024   1.00 0.00 ? 17 CYS A HB3  14 
ATOM   7828  N  N    . ASP A 1 18 ? 6.343   1.842   -0.265  1.00 0.00 ? 18 ASP A N    14 
ATOM   7829  C  CA   . ASP A 1 18 ? 7.334   0.848   0.184   1.00 0.00 ? 18 ASP A CA   14 
ATOM   7830  C  C    . ASP A 1 18 ? 6.767   0.082   1.367   1.00 0.00 ? 18 ASP A C    14 
ATOM   7831  O  O    . ASP A 1 18 ? 7.447   -0.748  1.975   1.00 0.00 ? 18 ASP A O    14 
ATOM   7832  C  CB   . ASP A 1 18 ? 8.688   1.467   0.538   1.00 0.00 ? 18 ASP A CB   14 
ATOM   7833  C  CG   . ASP A 1 18 ? 9.847   0.574   0.148   1.00 0.00 ? 18 ASP A CG   14 
ATOM   7834  O  OD1  . ASP A 1 18 ? 9.907   0.148   -1.027  1.00 0.00 ? 18 ASP A OD1  14 
ATOM   7835  O  OD2  . ASP A 1 18 ? 10.715  0.311   1.007   1.00 0.00 ? 18 ASP A OD2  14 
ATOM   7836  H  H    . ASP A 1 18 ? 5.639   1.546   -0.883  1.00 0.00 ? 18 ASP A H    14 
ATOM   7837  H  HA   . ASP A 1 18 ? 7.486   0.136   -0.621  1.00 0.00 ? 18 ASP A HA   14 
ATOM   7838  H  HB2  . ASP A 1 18 ? 8.792   2.408   0.017   1.00 0.00 ? 18 ASP A HB2  14 
ATOM   7839  H  HB3  . ASP A 1 18 ? 8.732   1.645   1.603   1.00 0.00 ? 18 ASP A HB3  14 
ATOM   7840  N  N    . ARG A 1 19 ? 5.451   0.210   1.531   1.00 0.00 ? 19 ARG A N    14 
ATOM   7841  C  CA   . ARG A 1 19 ? 4.704   -0.635  2.447   1.00 0.00 ? 19 ARG A CA   14 
ATOM   7842  C  C    . ARG A 1 19 ? 4.632   -2.030  1.857   1.00 0.00 ? 19 ARG A C    14 
ATOM   7843  O  O    . ARG A 1 19 ? 4.980   -2.217  0.697   1.00 0.00 ? 19 ARG A O    14 
ATOM   7844  C  CB   . ARG A 1 19 ? 3.298   -0.084  2.661   1.00 0.00 ? 19 ARG A CB   14 
ATOM   7845  C  CG   . ARG A 1 19 ? 3.105   0.561   4.019   1.00 0.00 ? 19 ARG A CG   14 
ATOM   7846  C  CD   . ARG A 1 19 ? 1.946   1.537   4.011   1.00 0.00 ? 19 ARG A CD   14 
ATOM   7847  N  NE   . ARG A 1 19 ? 0.662   0.849   4.078   1.00 0.00 ? 19 ARG A NE   14 
ATOM   7848  C  CZ   . ARG A 1 19 ? 0.083   0.463   5.225   1.00 0.00 ? 19 ARG A CZ   14 
ATOM   7849  N  NH1  . ARG A 1 19 ? 0.655   0.741   6.393   1.00 0.00 ? 19 ARG A NH1  14 
ATOM   7850  N  NH2  . ARG A 1 19 ? -1.079  -0.177  5.202   1.00 0.00 ? 19 ARG A NH2  14 
ATOM   7851  H  H    . ARG A 1 19 ? 4.955   0.774   0.906   1.00 0.00 ? 19 ARG A H    14 
ATOM   7852  H  HA   . ARG A 1 19 ? 5.230   -0.669  3.390   1.00 0.00 ? 19 ARG A HA   14 
ATOM   7853  H  HB2  . ARG A 1 19 ? 3.094   0.657   1.901   1.00 0.00 ? 19 ARG A HB2  14 
ATOM   7854  H  HB3  . ARG A 1 19 ? 2.586   -0.892  2.565   1.00 0.00 ? 19 ARG A HB3  14 
ATOM   7855  H  HG2  . ARG A 1 19 ? 2.908   -0.208  4.752   1.00 0.00 ? 19 ARG A HG2  14 
ATOM   7856  H  HG3  . ARG A 1 19 ? 4.004   1.089   4.283   1.00 0.00 ? 19 ARG A HG3  14 
ATOM   7857  H  HD2  . ARG A 1 19 ? 2.037   2.196   4.863   1.00 0.00 ? 19 ARG A HD2  14 
ATOM   7858  H  HD3  . ARG A 1 19 ? 1.986   2.118   3.100   1.00 0.00 ? 19 ARG A HD3  14 
ATOM   7859  H  HE   . ARG A 1 19 ? 0.209   0.656   3.218   1.00 0.00 ? 19 ARG A HE   14 
ATOM   7860  H  HH11 . ARG A 1 19 ? 1.527   1.246   6.428   1.00 0.00 ? 19 ARG A HH11 14 
ATOM   7861  H  HH12 . ARG A 1 19 ? 0.222   0.441   7.253   1.00 0.00 ? 19 ARG A HH12 14 
ATOM   7862  H  HH21 . ARG A 1 19 ? -1.527  -0.373  4.331   1.00 0.00 ? 19 ARG A HH21 14 
ATOM   7863  H  HH22 . ARG A 1 19 ? -1.511  -0.480  6.064   1.00 0.00 ? 19 ARG A HH22 14 
ATOM   7864  N  N    . SER A 1 20 ? 4.230   -3.007  2.639   1.00 0.00 ? 20 SER A N    14 
ATOM   7865  C  CA   . SER A 1 20 ? 4.264   -4.380  2.160   1.00 0.00 ? 20 SER A CA   14 
ATOM   7866  C  C    . SER A 1 20 ? 3.101   -5.204  2.690   1.00 0.00 ? 20 SER A C    14 
ATOM   7867  O  O    . SER A 1 20 ? 2.760   -5.130  3.873   1.00 0.00 ? 20 SER A O    14 
ATOM   7868  C  CB   . SER A 1 20 ? 5.587   -5.028  2.564   1.00 0.00 ? 20 SER A CB   14 
ATOM   7869  O  OG   . SER A 1 20 ? 6.236   -4.286  3.585   1.00 0.00 ? 20 SER A OG   14 
ATOM   7870  H  H    . SER A 1 20 ? 3.948   -2.813  3.562   1.00 0.00 ? 20 SER A H    14 
ATOM   7871  H  HA   . SER A 1 20 ? 4.204   -4.353  1.084   1.00 0.00 ? 20 SER A HA   14 
ATOM   7872  H  HB2  . SER A 1 20 ? 5.399   -6.027  2.928   1.00 0.00 ? 20 SER A HB2  14 
ATOM   7873  H  HB3  . SER A 1 20 ? 6.237   -5.076  1.700   1.00 0.00 ? 20 SER A HB3  14 
ATOM   7874  H  HG   . SER A 1 20 ? 7.018   -3.850  3.215   1.00 0.00 ? 20 SER A HG   14 
ATOM   7875  N  N    . PHE A 1 21 ? 2.482   -5.972  1.800   1.00 0.00 ? 21 PHE A N    14 
ATOM   7876  C  CA   . PHE A 1 21 ? 1.348   -6.807  2.161   1.00 0.00 ? 21 PHE A CA   14 
ATOM   7877  C  C    . PHE A 1 21 ? 1.498   -8.195  1.560   1.00 0.00 ? 21 PHE A C    14 
ATOM   7878  O  O    . PHE A 1 21 ? 2.044   -8.363  0.472   1.00 0.00 ? 21 PHE A O    14 
ATOM   7879  C  CB   . PHE A 1 21 ? 0.040   -6.168  1.686   1.00 0.00 ? 21 PHE A CB   14 
ATOM   7880  C  CG   . PHE A 1 21 ? -0.079  -4.727  2.076   1.00 0.00 ? 21 PHE A CG   14 
ATOM   7881  C  CD1  . PHE A 1 21 ? 0.466   -3.733  1.279   1.00 0.00 ? 21 PHE A CD1  14 
ATOM   7882  C  CD2  . PHE A 1 21 ? -0.703  -4.368  3.256   1.00 0.00 ? 21 PHE A CD2  14 
ATOM   7883  C  CE1  . PHE A 1 21 ? 0.391   -2.410  1.654   1.00 0.00 ? 21 PHE A CE1  14 
ATOM   7884  C  CE2  . PHE A 1 21 ? -0.787  -3.046  3.633   1.00 0.00 ? 21 PHE A CE2  14 
ATOM   7885  C  CZ   . PHE A 1 21 ? -0.236  -2.067  2.831   1.00 0.00 ? 21 PHE A CZ   14 
ATOM   7886  H  H    . PHE A 1 21 ? 2.775   -5.949  0.853   1.00 0.00 ? 21 PHE A H    14 
ATOM   7887  H  HA   . PHE A 1 21 ? 1.330   -6.892  3.235   1.00 0.00 ? 21 PHE A HA   14 
ATOM   7888  H  HB2  . PHE A 1 21 ? -0.015  -6.229  0.610   1.00 0.00 ? 21 PHE A HB2  14 
ATOM   7889  H  HB3  . PHE A 1 21 ? -0.793  -6.702  2.119   1.00 0.00 ? 21 PHE A HB3  14 
ATOM   7890  H  HD1  . PHE A 1 21 ? 0.957   -4.003  0.356   1.00 0.00 ? 21 PHE A HD1  14 
ATOM   7891  H  HD2  . PHE A 1 21 ? -1.133  -5.136  3.884   1.00 0.00 ? 21 PHE A HD2  14 
ATOM   7892  H  HE1  . PHE A 1 21 ? 0.820   -1.644  1.024   1.00 0.00 ? 21 PHE A HE1  14 
ATOM   7893  H  HE2  . PHE A 1 21 ? -1.279  -2.776  4.555   1.00 0.00 ? 21 PHE A HE2  14 
ATOM   7894  H  HZ   . PHE A 1 21 ? -0.289  -1.033  3.130   1.00 0.00 ? 21 PHE A HZ   14 
ATOM   7895  N  N    . SER A 1 22 ? 1.022   -9.191  2.280   1.00 0.00 ? 22 SER A N    14 
ATOM   7896  C  CA   . SER A 1 22 ? 1.071   -10.558 1.811   1.00 0.00 ? 22 SER A CA   14 
ATOM   7897  C  C    . SER A 1 22 ? -0.167  -10.849 0.964   1.00 0.00 ? 22 SER A C    14 
ATOM   7898  O  O    . SER A 1 22 ? -0.197  -11.794 0.174   1.00 0.00 ? 22 SER A O    14 
ATOM   7899  C  CB   . SER A 1 22 ? 1.144   -11.495 3.011   1.00 0.00 ? 22 SER A CB   14 
ATOM   7900  O  OG   . SER A 1 22 ? 1.358   -10.764 4.212   1.00 0.00 ? 22 SER A OG   14 
ATOM   7901  H  H    . SER A 1 22 ? 0.598   -9.004  3.147   1.00 0.00 ? 22 SER A H    14 
ATOM   7902  H  HA   . SER A 1 22 ? 1.963   -10.677 1.205   1.00 0.00 ? 22 SER A HA   14 
ATOM   7903  H  HB2  . SER A 1 22 ? 0.218   -12.043 3.098   1.00 0.00 ? 22 SER A HB2  14 
ATOM   7904  H  HB3  . SER A 1 22 ? 1.961   -12.183 2.875   1.00 0.00 ? 22 SER A HB3  14 
ATOM   7905  H  HG   . SER A 1 22 ? 0.725   -11.066 4.884   1.00 0.00 ? 22 SER A HG   14 
ATOM   7906  N  N    . ARG A 1 23 ? -1.178  -9.999  1.128   1.00 0.00 ? 23 ARG A N    14 
ATOM   7907  C  CA   . ARG A 1 23 ? -2.417  -10.101 0.379   1.00 0.00 ? 23 ARG A CA   14 
ATOM   7908  C  C    . ARG A 1 23 ? -2.638  -8.858  -0.469  1.00 0.00 ? 23 ARG A C    14 
ATOM   7909  O  O    . ARG A 1 23 ? -2.528  -7.733  0.027   1.00 0.00 ? 23 ARG A O    14 
ATOM   7910  C  CB   . ARG A 1 23 ? -3.591  -10.267 1.340   1.00 0.00 ? 23 ARG A CB   14 
ATOM   7911  C  CG   . ARG A 1 23 ? -3.760  -11.680 1.858   1.00 0.00 ? 23 ARG A CG   14 
ATOM   7912  C  CD   . ARG A 1 23 ? -5.168  -12.177 1.600   1.00 0.00 ? 23 ARG A CD   14 
ATOM   7913  N  NE   . ARG A 1 23 ? -6.166  -11.407 2.339   1.00 0.00 ? 23 ARG A NE   14 
ATOM   7914  C  CZ   . ARG A 1 23 ? -7.153  -11.945 3.051   1.00 0.00 ? 23 ARG A CZ   14 
ATOM   7915  N  NH1  . ARG A 1 23 ? -7.296  -13.262 3.113   1.00 0.00 ? 23 ARG A NH1  14 
ATOM   7916  N  NH2  . ARG A 1 23 ? -8.001  -11.153 3.698   1.00 0.00 ? 23 ARG A NH2  14 
ATOM   7917  H  H    . ARG A 1 23 ? -1.083  -9.273  1.780   1.00 0.00 ? 23 ARG A H    14 
ATOM   7918  H  HA   . ARG A 1 23 ? -2.360  -10.962 -0.266  1.00 0.00 ? 23 ARG A HA   14 
ATOM   7919  H  HB2  . ARG A 1 23 ? -3.443  -9.614  2.184   1.00 0.00 ? 23 ARG A HB2  14 
ATOM   7920  H  HB3  . ARG A 1 23 ? -4.500  -9.981  0.833   1.00 0.00 ? 23 ARG A HB3  14 
ATOM   7921  H  HG2  . ARG A 1 23 ? -3.060  -12.330 1.352   1.00 0.00 ? 23 ARG A HG2  14 
ATOM   7922  H  HG3  . ARG A 1 23 ? -3.569  -11.690 2.922   1.00 0.00 ? 23 ARG A HG3  14 
ATOM   7923  H  HD2  . ARG A 1 23 ? -5.369  -12.087 0.544   1.00 0.00 ? 23 ARG A HD2  14 
ATOM   7924  H  HD3  . ARG A 1 23 ? -5.232  -13.214 1.895   1.00 0.00 ? 23 ARG A HD3  14 
ATOM   7925  H  HE   . ARG A 1 23 ? -6.097  -10.419 2.302   1.00 0.00 ? 23 ARG A HE   14 
ATOM   7926  H  HH11 . ARG A 1 23 ? -6.655  -13.865 2.625   1.00 0.00 ? 23 ARG A HH11 14 
ATOM   7927  H  HH12 . ARG A 1 23 ? -8.050  -13.666 3.641   1.00 0.00 ? 23 ARG A HH12 14 
ATOM   7928  H  HH21 . ARG A 1 23 ? -7.894  -10.155 3.648   1.00 0.00 ? 23 ARG A HH21 14 
ATOM   7929  H  HH22 . ARG A 1 23 ? -8.749  -11.547 4.241   1.00 0.00 ? 23 ARG A HH22 14 
ATOM   7930  N  N    . SER A 1 24 ? -3.079  -9.068  -1.701  1.00 0.00 ? 24 SER A N    14 
ATOM   7931  C  CA   . SER A 1 24 ? -3.449  -7.968  -2.581  1.00 0.00 ? 24 SER A CA   14 
ATOM   7932  C  C    . SER A 1 24 ? -4.665  -7.238  -2.020  1.00 0.00 ? 24 SER A C    14 
ATOM   7933  O  O    . SER A 1 24 ? -4.864  -6.046  -2.262  1.00 0.00 ? 24 SER A O    14 
ATOM   7934  C  CB   . SER A 1 24 ? -3.751  -8.499  -3.983  1.00 0.00 ? 24 SER A CB   14 
ATOM   7935  O  OG   . SER A 1 24 ? -3.078  -7.740  -4.972  1.00 0.00 ? 24 SER A OG   14 
ATOM   7936  H  H    . SER A 1 24 ? -3.256  -9.992  -1.994  1.00 0.00 ? 24 SER A H    14 
ATOM   7937  H  HA   . SER A 1 24 ? -2.617  -7.283  -2.631  1.00 0.00 ? 24 SER A HA   14 
ATOM   7938  H  HB2  . SER A 1 24 ? -3.428  -9.528  -4.053  1.00 0.00 ? 24 SER A HB2  14 
ATOM   7939  H  HB3  . SER A 1 24 ? -4.813  -8.444  -4.163  1.00 0.00 ? 24 SER A HB3  14 
ATOM   7940  H  HG   . SER A 1 24 ? -3.400  -7.998  -5.849  1.00 0.00 ? 24 SER A HG   14 
ATOM   7941  N  N    . ASP A 1 25 ? -5.461  -7.968  -1.250  1.00 0.00 ? 25 ASP A N    14 
ATOM   7942  C  CA   . ASP A 1 25 ? -6.646  -7.421  -0.615  1.00 0.00 ? 25 ASP A CA   14 
ATOM   7943  C  C    . ASP A 1 25 ? -6.271  -6.324  0.373   1.00 0.00 ? 25 ASP A C    14 
ATOM   7944  O  O    . ASP A 1 25 ? -6.821  -5.222  0.332   1.00 0.00 ? 25 ASP A O    14 
ATOM   7945  C  CB   . ASP A 1 25 ? -7.408  -8.559  0.076   1.00 0.00 ? 25 ASP A CB   14 
ATOM   7946  C  CG   . ASP A 1 25 ? -7.651  -8.344  1.559   1.00 0.00 ? 25 ASP A CG   14 
ATOM   7947  O  OD1  . ASP A 1 25 ? -8.698  -7.768  1.921   1.00 0.00 ? 25 ASP A OD1  14 
ATOM   7948  O  OD2  . ASP A 1 25 ? -6.807  -8.782  2.368   1.00 0.00 ? 25 ASP A OD2  14 
ATOM   7949  H  H    . ASP A 1 25 ? -5.242  -8.915  -1.104  1.00 0.00 ? 25 ASP A H    14 
ATOM   7950  H  HA   . ASP A 1 25 ? -7.266  -6.993  -1.387  1.00 0.00 ? 25 ASP A HA   14 
ATOM   7951  H  HB2  . ASP A 1 25 ? -8.353  -8.675  -0.403  1.00 0.00 ? 25 ASP A HB2  14 
ATOM   7952  H  HB3  . ASP A 1 25 ? -6.844  -9.473  -0.042  1.00 0.00 ? 25 ASP A HB3  14 
ATOM   7953  N  N    . HIS A 1 26 ? -5.291  -6.616  1.212   1.00 0.00 ? 26 HIS A N    14 
ATOM   7954  C  CA   . HIS A 1 26 ? -4.808  -5.652  2.193   1.00 0.00 ? 26 HIS A CA   14 
ATOM   7955  C  C    . HIS A 1 26 ? -4.145  -4.471  1.499   1.00 0.00 ? 26 HIS A C    14 
ATOM   7956  O  O    . HIS A 1 26 ? -4.309  -3.325  1.921   1.00 0.00 ? 26 HIS A O    14 
ATOM   7957  C  CB   . HIS A 1 26 ? -3.833  -6.314  3.164   1.00 0.00 ? 26 HIS A CB   14 
ATOM   7958  C  CG   . HIS A 1 26 ? -4.447  -6.626  4.492   1.00 0.00 ? 26 HIS A CG   14 
ATOM   7959  N  ND1  . HIS A 1 26 ? -3.832  -6.348  5.695   1.00 0.00 ? 26 HIS A ND1  14 
ATOM   7960  C  CD2  . HIS A 1 26 ? -5.636  -7.195  4.804   1.00 0.00 ? 26 HIS A CD2  14 
ATOM   7961  C  CE1  . HIS A 1 26 ? -4.615  -6.732  6.684   1.00 0.00 ? 26 HIS A CE1  14 
ATOM   7962  N  NE2  . HIS A 1 26 ? -5.712  -7.246  6.171   1.00 0.00 ? 26 HIS A NE2  14 
ATOM   7963  H  H    . HIS A 1 26 ? -4.894  -7.509  1.176   1.00 0.00 ? 26 HIS A H    14 
ATOM   7964  H  HA   . HIS A 1 26 ? -5.663  -5.292  2.745   1.00 0.00 ? 26 HIS A HA   14 
ATOM   7965  H  HB2  . HIS A 1 26 ? -3.474  -7.237  2.735   1.00 0.00 ? 26 HIS A HB2  14 
ATOM   7966  H  HB3  . HIS A 1 26 ? -2.997  -5.651  3.332   1.00 0.00 ? 26 HIS A HB3  14 
ATOM   7967  H  HD1  . HIS A 1 26 ? -2.944  -5.932  5.808   1.00 0.00 ? 26 HIS A HD1  14 
ATOM   7968  H  HD2  . HIS A 1 26 ? -6.384  -7.543  4.105   1.00 0.00 ? 26 HIS A HD2  14 
ATOM   7969  H  HE1  . HIS A 1 26 ? -4.393  -6.638  7.737   1.00 0.00 ? 26 HIS A HE1  14 
ATOM   7970  H  HE2  . HIS A 1 26 ? -6.474  -7.600  6.693   1.00 0.00 ? 26 HIS A HE2  14 
ATOM   7971  N  N    . LEU A 1 27 ? -3.483  -4.753  0.380   1.00 0.00 ? 27 LEU A N    14 
ATOM   7972  C  CA   . LEU A 1 27 ? -2.897  -3.711  -0.456  1.00 0.00 ? 27 LEU A CA   14 
ATOM   7973  C  C    . LEU A 1 27 ? -3.967  -2.701  -0.865  1.00 0.00 ? 27 LEU A C    14 
ATOM   7974  O  O    . LEU A 1 27 ? -3.869  -1.514  -0.548  1.00 0.00 ? 27 LEU A O    14 
ATOM   7975  C  CB   . LEU A 1 27 ? -2.272  -4.315  -1.721  1.00 0.00 ? 27 LEU A CB   14 
ATOM   7976  C  CG   . LEU A 1 27 ? -1.339  -3.394  -2.521  1.00 0.00 ? 27 LEU A CG   14 
ATOM   7977  C  CD1  . LEU A 1 27 ? -0.839  -2.227  -1.682  1.00 0.00 ? 27 LEU A CD1  14 
ATOM   7978  C  CD2  . LEU A 1 27 ? -0.176  -4.175  -3.097  1.00 0.00 ? 27 LEU A CD2  14 
ATOM   7979  H  H    . LEU A 1 27 ? -3.452  -5.682  0.069   1.00 0.00 ? 27 LEU A H    14 
ATOM   7980  H  HA   . LEU A 1 27 ? -2.133  -3.206  0.117   1.00 0.00 ? 27 LEU A HA   14 
ATOM   7981  H  HB2  . LEU A 1 27 ? -1.711  -5.191  -1.432  1.00 0.00 ? 27 LEU A HB2  14 
ATOM   7982  H  HB3  . LEU A 1 27 ? -3.076  -4.625  -2.374  1.00 0.00 ? 27 LEU A HB3  14 
ATOM   7983  H  HG   . LEU A 1 27 ? -1.896  -2.980  -3.349  1.00 0.00 ? 27 LEU A HG   14 
ATOM   7984  H  HD11 . LEU A 1 27 ? -0.984  -1.305  -2.226  1.00 0.00 ? 27 LEU A HD11 14 
ATOM   7985  H  HD12 . LEU A 1 27 ? -1.390  -2.191  -0.754  1.00 0.00 ? 27 LEU A HD12 14 
ATOM   7986  H  HD13 . LEU A 1 27 ? 0.215   -2.360  -1.470  1.00 0.00 ? 27 LEU A HD13 14 
ATOM   7987  H  HD21 . LEU A 1 27 ? -0.529  -4.802  -3.901  1.00 0.00 ? 27 LEU A HD21 14 
ATOM   7988  H  HD22 . LEU A 1 27 ? 0.563   -3.486  -3.478  1.00 0.00 ? 27 LEU A HD22 14 
ATOM   7989  H  HD23 . LEU A 1 27 ? 0.264   -4.789  -2.326  1.00 0.00 ? 27 LEU A HD23 14 
ATOM   7990  N  N    . ALA A 1 28 ? -4.969  -3.182  -1.599  1.00 0.00 ? 28 ALA A N    14 
ATOM   7991  C  CA   . ALA A 1 28 ? -6.039  -2.325  -2.095  1.00 0.00 ? 28 ALA A CA   14 
ATOM   7992  C  C    . ALA A 1 28 ? -6.734  -1.571  -0.962  1.00 0.00 ? 28 ALA A C    14 
ATOM   7993  O  O    . ALA A 1 28 ? -7.077  -0.398  -1.113  1.00 0.00 ? 28 ALA A O    14 
ATOM   7994  C  CB   . ALA A 1 28 ? -7.045  -3.146  -2.884  1.00 0.00 ? 28 ALA A CB   14 
ATOM   7995  H  H    . ALA A 1 28 ? -4.979  -4.141  -1.830  1.00 0.00 ? 28 ALA A H    14 
ATOM   7996  H  HA   . ALA A 1 28 ? -5.591  -1.602  -2.771  1.00 0.00 ? 28 ALA A HA   14 
ATOM   7997  H  HB1  . ALA A 1 28 ? -7.510  -2.524  -3.635  1.00 0.00 ? 28 ALA A HB1  14 
ATOM   7998  H  HB2  . ALA A 1 28 ? -6.537  -3.969  -3.363  1.00 0.00 ? 28 ALA A HB2  14 
ATOM   7999  H  HB3  . ALA A 1 28 ? -7.800  -3.528  -2.215  1.00 0.00 ? 28 ALA A HB3  14 
ATOM   8000  N  N    . LEU A 1 29 ? -6.913  -2.243  0.177   1.00 0.00 ? 29 LEU A N    14 
ATOM   8001  C  CA   . LEU A 1 29 ? -7.528  -1.628  1.348   1.00 0.00 ? 29 LEU A CA   14 
ATOM   8002  C  C    . LEU A 1 29 ? -6.762  -0.383  1.766   1.00 0.00 ? 29 LEU A C    14 
ATOM   8003  O  O    . LEU A 1 29 ? -7.342  0.692   1.928   1.00 0.00 ? 29 LEU A O    14 
ATOM   8004  C  CB   . LEU A 1 29 ? -7.573  -2.609  2.515   1.00 0.00 ? 29 LEU A CB   14 
ATOM   8005  C  CG   . LEU A 1 29 ? -8.633  -3.703  2.406   1.00 0.00 ? 29 LEU A CG   14 
ATOM   8006  C  CD1  . LEU A 1 29 ? -8.494  -4.686  3.555   1.00 0.00 ? 29 LEU A CD1  14 
ATOM   8007  C  CD2  . LEU A 1 29 ? -10.027 -3.094  2.385   1.00 0.00 ? 29 LEU A CD2  14 
ATOM   8008  H  H    . LEU A 1 29 ? -6.611  -3.176  0.235   1.00 0.00 ? 29 LEU A H    14 
ATOM   8009  H  HA   . LEU A 1 29 ? -8.535  -1.348  1.091   1.00 0.00 ? 29 LEU A HA   14 
ATOM   8010  H  HB2  . LEU A 1 29 ? -6.604  -3.078  2.602   1.00 0.00 ? 29 LEU A HB2  14 
ATOM   8011  H  HB3  . LEU A 1 29 ? -7.763  -2.046  3.413   1.00 0.00 ? 29 LEU A HB3  14 
ATOM   8012  H  HG   . LEU A 1 29 ? -8.490  -4.246  1.483   1.00 0.00 ? 29 LEU A HG   14 
ATOM   8013  H  HD11 . LEU A 1 29 ? -9.389  -5.288  3.625   1.00 0.00 ? 29 LEU A HD11 14 
ATOM   8014  H  HD12 . LEU A 1 29 ? -7.641  -5.325  3.378   1.00 0.00 ? 29 LEU A HD12 14 
ATOM   8015  H  HD13 . LEU A 1 29 ? -8.352  -4.142  4.478   1.00 0.00 ? 29 LEU A HD13 14 
ATOM   8016  H  HD21 . LEU A 1 29 ? -10.760 -3.877  2.267   1.00 0.00 ? 29 LEU A HD21 14 
ATOM   8017  H  HD22 . LEU A 1 29 ? -10.203 -2.569  3.312   1.00 0.00 ? 29 LEU A HD22 14 
ATOM   8018  H  HD23 . LEU A 1 29 ? -10.102 -2.402  1.559   1.00 0.00 ? 29 LEU A HD23 14 
ATOM   8019  N  N    . HIS A 1 30 ? -5.450  -0.521  1.893   1.00 0.00 ? 30 HIS A N    14 
ATOM   8020  C  CA   . HIS A 1 30 ? -4.601  0.600   2.260   1.00 0.00 ? 30 HIS A CA   14 
ATOM   8021  C  C    . HIS A 1 30 ? -4.580  1.646   1.144   1.00 0.00 ? 30 HIS A C    14 
ATOM   8022  O  O    . HIS A 1 30 ? -4.495  2.849   1.403   1.00 0.00 ? 30 HIS A O    14 
ATOM   8023  C  CB   . HIS A 1 30 ? -3.174  0.115   2.570   1.00 0.00 ? 30 HIS A CB   14 
ATOM   8024  C  CG   . HIS A 1 30 ? -2.112  1.148   2.336   1.00 0.00 ? 30 HIS A CG   14 
ATOM   8025  N  ND1  . HIS A 1 30 ? -1.988  2.298   3.076   1.00 0.00 ? 30 HIS A ND1  14 
ATOM   8026  C  CD2  . HIS A 1 30 ? -1.146  1.207   1.387   1.00 0.00 ? 30 HIS A CD2  14 
ATOM   8027  C  CE1  . HIS A 1 30 ? -0.977  3.009   2.561   1.00 0.00 ? 30 HIS A CE1  14 
ATOM   8028  N  NE2  . HIS A 1 30 ? -0.429  2.391   1.530   1.00 0.00 ? 30 HIS A NE2  14 
ATOM   8029  H  H    . HIS A 1 30 ? -5.040  -1.399  1.717   1.00 0.00 ? 30 HIS A H    14 
ATOM   8030  H  HA   . HIS A 1 30 ? -5.016  1.052   3.149   1.00 0.00 ? 30 HIS A HA   14 
ATOM   8031  H  HB2  . HIS A 1 30 ? -3.120  -0.182  3.607   1.00 0.00 ? 30 HIS A HB2  14 
ATOM   8032  H  HB3  . HIS A 1 30 ? -2.945  -0.738  1.948   1.00 0.00 ? 30 HIS A HB3  14 
ATOM   8033  H  HD1  . HIS A 1 30 ? -2.550  2.558   3.847   1.00 0.00 ? 30 HIS A HD1  14 
ATOM   8034  H  HD2  . HIS A 1 30 ? -0.950  0.455   0.636   1.00 0.00 ? 30 HIS A HD2  14 
ATOM   8035  H  HE1  . HIS A 1 30 ? -0.650  3.966   2.943   1.00 0.00 ? 30 HIS A HE1  14 
ATOM   8036  N  N    . ARG A 1 31 ? -4.589  1.180   -0.096  1.00 0.00 ? 31 ARG A N    14 
ATOM   8037  C  CA   . ARG A 1 31 ? -4.450  2.065   -1.241  1.00 0.00 ? 31 ARG A CA   14 
ATOM   8038  C  C    . ARG A 1 31 ? -5.716  2.881   -1.478  1.00 0.00 ? 31 ARG A C    14 
ATOM   8039  O  O    . ARG A 1 31 ? -5.731  3.780   -2.316  1.00 0.00 ? 31 ARG A O    14 
ATOM   8040  C  CB   . ARG A 1 31 ? -4.083  1.270   -2.491  1.00 0.00 ? 31 ARG A CB   14 
ATOM   8041  C  CG   . ARG A 1 31 ? -2.666  0.720   -2.453  1.00 0.00 ? 31 ARG A CG   14 
ATOM   8042  C  CD   . ARG A 1 31 ? -2.078  0.558   -3.846  1.00 0.00 ? 31 ARG A CD   14 
ATOM   8043  N  NE   . ARG A 1 31 ? -1.641  1.834   -4.411  1.00 0.00 ? 31 ARG A NE   14 
ATOM   8044  C  CZ   . ARG A 1 31 ? -2.231  2.435   -5.446  1.00 0.00 ? 31 ARG A CZ   14 
ATOM   8045  N  NH1  . ARG A 1 31 ? -3.246  1.849   -6.066  1.00 0.00 ? 31 ARG A NH1  14 
ATOM   8046  N  NH2  . ARG A 1 31 ? -1.795  3.613   -5.869  1.00 0.00 ? 31 ARG A NH2  14 
ATOM   8047  H  H    . ARG A 1 31 ? -4.630  0.206   -0.244  1.00 0.00 ? 31 ARG A H    14 
ATOM   8048  H  HA   . ARG A 1 31 ? -3.639  2.746   -1.016  1.00 0.00 ? 31 ARG A HA   14 
ATOM   8049  H  HB2  . ARG A 1 31 ? -4.770  0.442   -2.591  1.00 0.00 ? 31 ARG A HB2  14 
ATOM   8050  H  HB3  . ARG A 1 31 ? -4.179  1.913   -3.352  1.00 0.00 ? 31 ARG A HB3  14 
ATOM   8051  H  HG2  . ARG A 1 31 ? -2.045  1.399   -1.891  1.00 0.00 ? 31 ARG A HG2  14 
ATOM   8052  H  HG3  . ARG A 1 31 ? -2.678  -0.244  -1.965  1.00 0.00 ? 31 ARG A HG3  14 
ATOM   8053  H  HD2  . ARG A 1 31 ? -1.223  -0.102  -3.786  1.00 0.00 ? 31 ARG A HD2  14 
ATOM   8054  H  HD3  . ARG A 1 31 ? -2.830  0.123   -4.490  1.00 0.00 ? 31 ARG A HD3  14 
ATOM   8055  H  HE   . ARG A 1 31 ? -0.868  2.269   -3.987  1.00 0.00 ? 31 ARG A HE   14 
ATOM   8056  H  HH11 . ARG A 1 31 ? -3.580  0.951   -5.761  1.00 0.00 ? 31 ARG A HH11 14 
ATOM   8057  H  HH12 . ARG A 1 31 ? -3.685  2.298   -6.859  1.00 0.00 ? 31 ARG A HH12 14 
ATOM   8058  H  HH21 . ARG A 1 31 ? -1.011  4.065   -5.414  1.00 0.00 ? 31 ARG A HH21 14 
ATOM   8059  H  HH22 . ARG A 1 31 ? -2.253  4.074   -6.640  1.00 0.00 ? 31 ARG A HH22 14 
ATOM   8060  N  N    . LYS A 1 32 ? -6.729  2.652   -0.651  1.00 0.00 ? 32 LYS A N    14 
ATOM   8061  C  CA   . LYS A 1 32 ? -7.950  3.448   -0.698  1.00 0.00 ? 32 LYS A CA   14 
ATOM   8062  C  C    . LYS A 1 32 ? -7.644  4.902   -0.362  1.00 0.00 ? 32 LYS A C    14 
ATOM   8063  O  O    . LYS A 1 32 ? -8.306  5.819   -0.846  1.00 0.00 ? 32 LYS A O    14 
ATOM   8064  C  CB   . LYS A 1 32 ? -8.985  2.898   0.281   1.00 0.00 ? 32 LYS A CB   14 
ATOM   8065  C  CG   . LYS A 1 32 ? -10.191 2.274   -0.398  1.00 0.00 ? 32 LYS A CG   14 
ATOM   8066  C  CD   . LYS A 1 32 ? -9.777  1.185   -1.373  1.00 0.00 ? 32 LYS A CD   14 
ATOM   8067  C  CE   . LYS A 1 32 ? -10.662 -0.041  -1.246  1.00 0.00 ? 32 LYS A CE   14 
ATOM   8068  N  NZ   . LYS A 1 32 ? -11.626 -0.149  -2.373  1.00 0.00 ? 32 LYS A NZ   14 
ATOM   8069  H  H    . LYS A 1 32 ? -6.628  1.975   0.050   1.00 0.00 ? 32 LYS A H    14 
ATOM   8070  H  HA   . LYS A 1 32 ? -8.347  3.393   -1.700  1.00 0.00 ? 32 LYS A HA   14 
ATOM   8071  H  HB2  . LYS A 1 32 ? -8.516  2.144   0.898   1.00 0.00 ? 32 LYS A HB2  14 
ATOM   8072  H  HB3  . LYS A 1 32 ? -9.330  3.703   0.911   1.00 0.00 ? 32 LYS A HB3  14 
ATOM   8073  H  HG2  . LYS A 1 32 ? -10.834 1.844   0.357   1.00 0.00 ? 32 LYS A HG2  14 
ATOM   8074  H  HG3  . LYS A 1 32 ? -10.726 3.042   -0.935  1.00 0.00 ? 32 LYS A HG3  14 
ATOM   8075  H  HD2  . LYS A 1 32 ? -9.851  1.566   -2.380  1.00 0.00 ? 32 LYS A HD2  14 
ATOM   8076  H  HD3  . LYS A 1 32 ? -8.753  0.900   -1.166  1.00 0.00 ? 32 LYS A HD3  14 
ATOM   8077  H  HE2  . LYS A 1 32 ? -10.036 -0.921  -1.232  1.00 0.00 ? 32 LYS A HE2  14 
ATOM   8078  H  HE3  . LYS A 1 32 ? -11.211 0.025   -0.319  1.00 0.00 ? 32 LYS A HE3  14 
ATOM   8079  H  HZ1  . LYS A 1 32 ? -12.593 -0.294  -2.011  1.00 0.00 ? 32 LYS A HZ1  14 
ATOM   8080  H  HZ2  . LYS A 1 32 ? -11.375 -0.955  -2.988  1.00 0.00 ? 32 LYS A HZ2  14 
ATOM   8081  H  HZ3  . LYS A 1 32 ? -11.612 0.724   -2.946  1.00 0.00 ? 32 LYS A HZ3  14 
ATOM   8082  N  N    . ARG A 1 33 ? -6.601  5.104   0.434   1.00 0.00 ? 33 ARG A N    14 
ATOM   8083  C  CA   . ARG A 1 33 ? -6.173  6.442   0.815   1.00 0.00 ? 33 ARG A CA   14 
ATOM   8084  C  C    . ARG A 1 33 ? -5.339  7.082   -0.290  1.00 0.00 ? 33 ARG A C    14 
ATOM   8085  O  O    . ARG A 1 33 ? -4.995  8.260   -0.224  1.00 0.00 ? 33 ARG A O    14 
ATOM   8086  C  CB   . ARG A 1 33 ? -5.363  6.389   2.109   1.00 0.00 ? 33 ARG A CB   14 
ATOM   8087  C  CG   . ARG A 1 33 ? -6.164  5.915   3.310   1.00 0.00 ? 33 ARG A CG   14 
ATOM   8088  C  CD   . ARG A 1 33 ? -5.292  5.773   4.549   1.00 0.00 ? 33 ARG A CD   14 
ATOM   8089  N  NE   . ARG A 1 33 ? -4.041  6.528   4.443   1.00 0.00 ? 33 ARG A NE   14 
ATOM   8090  C  CZ   . ARG A 1 33 ? -2.845  6.038   4.770   1.00 0.00 ? 33 ARG A CZ   14 
ATOM   8091  N  NH1  . ARG A 1 33 ? -2.735  4.798   5.233   1.00 0.00 ? 33 ARG A NH1  14 
ATOM   8092  N  NH2  . ARG A 1 33 ? -1.759  6.787   4.632   1.00 0.00 ? 33 ARG A NH2  14 
ATOM   8093  H  H    . ARG A 1 33 ? -6.095  4.330   0.761   1.00 0.00 ? 33 ARG A H    14 
ATOM   8094  H  HA   . ARG A 1 33 ? -7.057  7.041   0.976   1.00 0.00 ? 33 ARG A HA   14 
ATOM   8095  H  HB2  . ARG A 1 33 ? -4.531  5.716   1.969   1.00 0.00 ? 33 ARG A HB2  14 
ATOM   8096  H  HB3  . ARG A 1 33 ? -4.985  7.378   2.323   1.00 0.00 ? 33 ARG A HB3  14 
ATOM   8097  H  HG2  . ARG A 1 33 ? -6.942  6.633   3.516   1.00 0.00 ? 33 ARG A HG2  14 
ATOM   8098  H  HG3  . ARG A 1 33 ? -6.606  4.956   3.080   1.00 0.00 ? 33 ARG A HG3  14 
ATOM   8099  H  HD2  . ARG A 1 33 ? -5.844  6.132   5.404   1.00 0.00 ? 33 ARG A HD2  14 
ATOM   8100  H  HD3  . ARG A 1 33 ? -5.056  4.727   4.690   1.00 0.00 ? 33 ARG A HD3  14 
ATOM   8101  H  HE   . ARG A 1 33 ? -4.101  7.459   4.110   1.00 0.00 ? 33 ARG A HE   14 
ATOM   8102  H  HH11 . ARG A 1 33 ? -3.552  4.220   5.336   1.00 0.00 ? 33 ARG A HH11 14 
ATOM   8103  H  HH12 . ARG A 1 33 ? -1.829  4.433   5.491   1.00 0.00 ? 33 ARG A HH12 14 
ATOM   8104  H  HH21 . ARG A 1 33 ? -1.832  7.726   4.276   1.00 0.00 ? 33 ARG A HH21 14 
ATOM   8105  H  HH22 . ARG A 1 33 ? -0.859  6.420   4.876   1.00 0.00 ? 33 ARG A HH22 14 
ATOM   8106  N  N    . HIS A 1 34 ? -5.035  6.306   -1.321  1.00 0.00 ? 34 HIS A N    14 
ATOM   8107  C  CA   . HIS A 1 34 ? -4.261  6.807   -2.444  1.00 0.00 ? 34 HIS A CA   14 
ATOM   8108  C  C    . HIS A 1 34 ? -5.189  7.266   -3.556  1.00 0.00 ? 34 HIS A C    14 
ATOM   8109  O  O    . HIS A 1 34 ? -4.757  7.870   -4.537  1.00 0.00 ? 34 HIS A O    14 
ATOM   8110  C  CB   . HIS A 1 34 ? -3.288  5.736   -2.939  1.00 0.00 ? 34 HIS A CB   14 
ATOM   8111  C  CG   . HIS A 1 34 ? -2.181  5.466   -1.965  1.00 0.00 ? 34 HIS A CG   14 
ATOM   8112  N  ND1  . HIS A 1 34 ? -1.479  6.456   -1.314  1.00 0.00 ? 34 HIS A ND1  14 
ATOM   8113  C  CD2  . HIS A 1 34 ? -1.676  4.292   -1.509  1.00 0.00 ? 34 HIS A CD2  14 
ATOM   8114  C  CE1  . HIS A 1 34 ? -0.589  5.867   -0.507  1.00 0.00 ? 34 HIS A CE1  14 
ATOM   8115  N  NE2  . HIS A 1 34 ? -0.669  4.555   -0.589  1.00 0.00 ? 34 HIS A NE2  14 
ATOM   8116  H  H    . HIS A 1 34 ? -5.356  5.373   -1.339  1.00 0.00 ? 34 HIS A H    14 
ATOM   8117  H  HA   . HIS A 1 34 ? -3.694  7.657   -2.095  1.00 0.00 ? 34 HIS A HA   14 
ATOM   8118  H  HB2  . HIS A 1 34 ? -3.829  4.814   -3.099  1.00 0.00 ? 34 HIS A HB2  14 
ATOM   8119  H  HB3  . HIS A 1 34 ? -2.846  6.058   -3.870  1.00 0.00 ? 34 HIS A HB3  14 
ATOM   8120  H  HD1  . HIS A 1 34 ? -1.622  7.431   -1.404  1.00 0.00 ? 34 HIS A HD1  14 
ATOM   8121  H  HD2  . HIS A 1 34 ? -2.002  3.301   -1.793  1.00 0.00 ? 34 HIS A HD2  14 
ATOM   8122  H  HE1  . HIS A 1 34 ? 0.103   6.397   0.131   1.00 0.00 ? 34 HIS A HE1  14 
ATOM   8123  N  N    . MET A 1 35 ? -6.483  7.115   -3.315  1.00 0.00 ? 35 MET A N    14 
ATOM   8124  C  CA   . MET A 1 35 ? -7.493  7.663   -4.201  1.00 0.00 ? 35 MET A CA   14 
ATOM   8125  C  C    . MET A 1 35 ? -7.695  9.134   -3.863  1.00 0.00 ? 35 MET A C    14 
ATOM   8126  O  O    . MET A 1 35 ? -8.164  9.922   -4.684  1.00 0.00 ? 35 MET A O    14 
ATOM   8127  C  CB   . MET A 1 35 ? -8.802  6.889   -4.066  1.00 0.00 ? 35 MET A CB   14 
ATOM   8128  C  CG   . MET A 1 35 ? -8.705  5.446   -4.536  1.00 0.00 ? 35 MET A CG   14 
ATOM   8129  S  SD   . MET A 1 35 ? -10.096 4.958   -5.572  1.00 0.00 ? 35 MET A SD   14 
ATOM   8130  C  CE   . MET A 1 35 ? -9.429  3.499   -6.365  1.00 0.00 ? 35 MET A CE   14 
ATOM   8131  H  H    . MET A 1 35 ? -6.763  6.722   -2.460  1.00 0.00 ? 35 MET A H    14 
ATOM   8132  H  HA   . MET A 1 35 ? -7.130  7.580   -5.215  1.00 0.00 ? 35 MET A HA   14 
ATOM   8133  H  HB2  . MET A 1 35 ? -9.099  6.888   -3.028  1.00 0.00 ? 35 MET A HB2  14 
ATOM   8134  H  HB3  . MET A 1 35 ? -9.563  7.384   -4.650  1.00 0.00 ? 35 MET A HB3  14 
ATOM   8135  H  HG2  . MET A 1 35 ? -7.793  5.327   -5.103  1.00 0.00 ? 35 MET A HG2  14 
ATOM   8136  H  HG3  . MET A 1 35 ? -8.673  4.801   -3.671  1.00 0.00 ? 35 MET A HG3  14 
ATOM   8137  H  HE1  . MET A 1 35 ? -10.134 2.687   -6.268  1.00 0.00 ? 35 MET A HE1  14 
ATOM   8138  H  HE2  . MET A 1 35 ? -9.256  3.708   -7.411  1.00 0.00 ? 35 MET A HE2  14 
ATOM   8139  H  HE3  . MET A 1 35 ? -8.497  3.226   -5.890  1.00 0.00 ? 35 MET A HE3  14 
ATOM   8140  N  N    . LEU A 1 36 ? -7.207  9.506   -2.683  1.00 0.00 ? 36 LEU A N    14 
ATOM   8141  C  CA   . LEU A 1 36 ? -7.169  10.894  -2.254  1.00 0.00 ? 36 LEU A CA   14 
ATOM   8142  C  C    . LEU A 1 36 ? -5.725  11.272  -1.938  1.00 0.00 ? 36 LEU A C    14 
ATOM   8143  O  O    . LEU A 1 36 ? -5.390  11.663  -0.816  1.00 0.00 ? 36 LEU A O    14 
ATOM   8144  C  CB   . LEU A 1 36 ? -8.059  11.105  -1.027  1.00 0.00 ? 36 LEU A CB   14 
ATOM   8145  C  CG   . LEU A 1 36 ? -9.535  10.767  -1.236  1.00 0.00 ? 36 LEU A CG   14 
ATOM   8146  C  CD1  . LEU A 1 36 ? -10.212 10.479  0.094   1.00 0.00 ? 36 LEU A CD1  14 
ATOM   8147  C  CD2  . LEU A 1 36 ? -10.242 11.902  -1.960  1.00 0.00 ? 36 LEU A CD2  14 
ATOM   8148  H  H    . LEU A 1 36 ? -6.770  8.834   -2.124  1.00 0.00 ? 36 LEU A H    14 
ATOM   8149  H  HA   . LEU A 1 36 ? -7.525  11.510  -3.065  1.00 0.00 ? 36 LEU A HA   14 
ATOM   8150  H  HB2  . LEU A 1 36 ? -7.679  10.491  -0.223  1.00 0.00 ? 36 LEU A HB2  14 
ATOM   8151  H  HB3  . LEU A 1 36 ? -7.988  12.140  -0.730  1.00 0.00 ? 36 LEU A HB3  14 
ATOM   8152  H  HG   . LEU A 1 36 ? -9.608  9.879   -1.849  1.00 0.00 ? 36 LEU A HG   14 
ATOM   8153  H  HD11 . LEU A 1 36 ? -9.950  11.248  0.803   1.00 0.00 ? 36 LEU A HD11 14 
ATOM   8154  H  HD12 . LEU A 1 36 ? -11.284 10.463  -0.043  1.00 0.00 ? 36 LEU A HD12 14 
ATOM   8155  H  HD13 . LEU A 1 36 ? -9.883  9.520   0.465   1.00 0.00 ? 36 LEU A HD13 14 
ATOM   8156  H  HD21 . LEU A 1 36 ? -10.154 12.810  -1.380  1.00 0.00 ? 36 LEU A HD21 14 
ATOM   8157  H  HD22 . LEU A 1 36 ? -9.787  12.049  -2.930  1.00 0.00 ? 36 LEU A HD22 14 
ATOM   8158  H  HD23 . LEU A 1 36 ? -11.287 11.653  -2.086  1.00 0.00 ? 36 LEU A HD23 14 
ATOM   8159  N  N    . VAL A 1 37 ? -4.863  11.051  -2.918  1.00 0.00 ? 37 VAL A N    14 
ATOM   8160  C  CA   . VAL A 1 37 ? -3.437  11.293  -2.765  1.00 0.00 ? 37 VAL A CA   14 
ATOM   8161  C  C    . VAL A 1 37 ? -3.138  12.789  -2.845  1.00 0.00 ? 37 VAL A C    14 
ATOM   8162  O  O    . VAL A 1 37 ? -3.908  13.514  -3.510  1.00 0.00 ? 37 VAL A O    14 
ATOM   8163  C  CB   . VAL A 1 37 ? -2.629  10.519  -3.838  1.00 0.00 ? 37 VAL A CB   14 
ATOM   8164  C  CG1  . VAL A 1 37 ? -3.026  10.956  -5.241  1.00 0.00 ? 37 VAL A CG1  14 
ATOM   8165  C  CG2  . VAL A 1 37 ? -1.130  10.686  -3.628  1.00 0.00 ? 37 VAL A CG2  14 
ATOM   8166  O  OXT  . VAL A 1 37 ? -2.153  13.237  -2.219  1.00 0.00 ? 37 VAL A OXT  14 
ATOM   8167  H  H    . VAL A 1 37 ? -5.194  10.695  -3.767  1.00 0.00 ? 37 VAL A H    14 
ATOM   8168  H  HA   . VAL A 1 37 ? -3.143  10.929  -1.791  1.00 0.00 ? 37 VAL A HA   14 
ATOM   8169  H  HB   . VAL A 1 37 ? -2.864  9.468   -3.739  1.00 0.00 ? 37 VAL A HB   14 
ATOM   8170  H  HG11 . VAL A 1 37 ? -2.146  11.007  -5.864  1.00 0.00 ? 37 VAL A HG11 14 
ATOM   8171  H  HG12 . VAL A 1 37 ? -3.721  10.241  -5.658  1.00 0.00 ? 37 VAL A HG12 14 
ATOM   8172  H  HG13 . VAL A 1 37 ? -3.493  11.928  -5.196  1.00 0.00 ? 37 VAL A HG13 14 
ATOM   8173  H  HG21 . VAL A 1 37 ? -0.598  10.209  -4.439  1.00 0.00 ? 37 VAL A HG21 14 
ATOM   8174  H  HG22 . VAL A 1 37 ? -0.886  11.739  -3.608  1.00 0.00 ? 37 VAL A HG22 14 
ATOM   8175  H  HG23 . VAL A 1 37 ? -0.842  10.231  -2.692  1.00 0.00 ? 37 VAL A HG23 14 
HETATM 8176  ZN ZN   . ZN  B 2 .  ? 0.639   3.306   0.154   1.00 0.00 ? 38 ZN  A ZN   14 
ATOM   8177  N  N    . GLY A 1 1  ? 5.936   6.827   2.900   1.00 0.00 ? 1  GLY A N    15 
ATOM   8178  C  CA   . GLY A 1 1  ? 7.016   5.916   2.446   1.00 0.00 ? 1  GLY A CA   15 
ATOM   8179  C  C    . GLY A 1 1  ? 8.045   5.664   3.530   1.00 0.00 ? 1  GLY A C    15 
ATOM   8180  O  O    . GLY A 1 1  ? 7.773   5.894   4.710   1.00 0.00 ? 1  GLY A O    15 
ATOM   8181  H  H1   . GLY A 1 1  ? 5.524   6.478   3.793   1.00 0.00 ? 1  GLY A H1   15 
ATOM   8182  H  H2   . GLY A 1 1  ? 5.185   6.884   2.181   1.00 0.00 ? 1  GLY A H2   15 
ATOM   8183  H  H3   . GLY A 1 1  ? 6.320   7.784   3.059   1.00 0.00 ? 1  GLY A H3   15 
ATOM   8184  H  HA2  . GLY A 1 1  ? 6.579   4.974   2.155   1.00 0.00 ? 1  GLY A HA2  15 
ATOM   8185  H  HA3  . GLY A 1 1  ? 7.507   6.353   1.591   1.00 0.00 ? 1  GLY A HA3  15 
ATOM   8186  N  N    . SER A 1 2  ? 9.227   5.202   3.118   1.00 0.00 ? 2  SER A N    15 
ATOM   8187  C  CA   . SER A 1 2  ? 10.332  4.919   4.030   1.00 0.00 ? 2  SER A CA   15 
ATOM   8188  C  C    . SER A 1 2  ? 9.936   3.894   5.093   1.00 0.00 ? 2  SER A C    15 
ATOM   8189  O  O    . SER A 1 2  ? 9.867   4.210   6.285   1.00 0.00 ? 2  SER A O    15 
ATOM   8190  C  CB   . SER A 1 2  ? 10.827  6.211   4.687   1.00 0.00 ? 2  SER A CB   15 
ATOM   8191  O  OG   . SER A 1 2  ? 11.140  7.193   3.710   1.00 0.00 ? 2  SER A OG   15 
ATOM   8192  H  H    . SER A 1 2  ? 9.361   5.048   2.153   1.00 0.00 ? 2  SER A H    15 
ATOM   8193  H  HA   . SER A 1 2  ? 11.136  4.503   3.442   1.00 0.00 ? 2  SER A HA   15 
ATOM   8194  H  HB2  . SER A 1 2  ? 10.058  6.600   5.336   1.00 0.00 ? 2  SER A HB2  15 
ATOM   8195  H  HB3  . SER A 1 2  ? 11.715  6.000   5.266   1.00 0.00 ? 2  SER A HB3  15 
ATOM   8196  H  HG   . SER A 1 2  ? 11.413  6.750   2.886   1.00 0.00 ? 2  SER A HG   15 
ATOM   8197  N  N    . THR A 1 3  ? 9.657   2.674   4.652   1.00 0.00 ? 3  THR A N    15 
ATOM   8198  C  CA   . THR A 1 3  ? 9.265   1.597   5.548   1.00 0.00 ? 3  THR A CA   15 
ATOM   8199  C  C    . THR A 1 3  ? 10.465  1.044   6.324   1.00 0.00 ? 3  THR A C    15 
ATOM   8200  O  O    . THR A 1 3  ? 10.854  -0.113  6.147   1.00 0.00 ? 3  THR A O    15 
ATOM   8201  C  CB   . THR A 1 3  ? 8.605   0.471   4.742   1.00 0.00 ? 3  THR A CB   15 
ATOM   8202  O  OG1  . THR A 1 3  ? 8.668   0.801   3.349   1.00 0.00 ? 3  THR A OG1  15 
ATOM   8203  C  CG2  . THR A 1 3  ? 7.156   0.276   5.159   1.00 0.00 ? 3  THR A CG2  15 
ATOM   8204  H  H    . THR A 1 3  ? 9.688   2.492   3.683   1.00 0.00 ? 3  THR A H    15 
ATOM   8205  H  HA   . THR A 1 3  ? 8.541   1.987   6.247   1.00 0.00 ? 3  THR A HA   15 
ATOM   8206  H  HB   . THR A 1 3  ? 9.147   -0.448  4.916   1.00 0.00 ? 3  THR A HB   15 
ATOM   8207  H  HG1  . THR A 1 3  ? 8.192   0.133   2.835   1.00 0.00 ? 3  THR A HG1  15 
ATOM   8208  H  HG21 . THR A 1 3  ? 7.012   -0.741  5.495   1.00 0.00 ? 3  THR A HG21 15 
ATOM   8209  H  HG22 . THR A 1 3  ? 6.508   0.469   4.316   1.00 0.00 ? 3  THR A HG22 15 
ATOM   8210  H  HG23 . THR A 1 3  ? 6.917   0.958   5.961   1.00 0.00 ? 3  THR A HG23 15 
ATOM   8211  N  N    . ARG A 1 4  ? 11.039  1.884   7.181   1.00 0.00 ? 4  ARG A N    15 
ATOM   8212  C  CA   . ARG A 1 4  ? 12.186  1.520   8.012   1.00 0.00 ? 4  ARG A CA   15 
ATOM   8213  C  C    . ARG A 1 4  ? 13.389  1.096   7.165   1.00 0.00 ? 4  ARG A C    15 
ATOM   8214  O  O    . ARG A 1 4  ? 14.041  1.934   6.544   1.00 0.00 ? 4  ARG A O    15 
ATOM   8215  C  CB   . ARG A 1 4  ? 11.805  0.411   8.995   1.00 0.00 ? 4  ARG A CB   15 
ATOM   8216  C  CG   . ARG A 1 4  ? 11.498  0.915   10.393  1.00 0.00 ? 4  ARG A CG   15 
ATOM   8217  C  CD   . ARG A 1 4  ? 10.002  1.016   10.625  1.00 0.00 ? 4  ARG A CD   15 
ATOM   8218  N  NE   . ARG A 1 4  ? 9.684   1.465   11.978  1.00 0.00 ? 4  ARG A NE   15 
ATOM   8219  C  CZ   . ARG A 1 4  ? 8.928   0.773   12.830  1.00 0.00 ? 4  ARG A CZ   15 
ATOM   8220  N  NH1  . ARG A 1 4  ? 8.477   -0.428  12.499  1.00 0.00 ? 4  ARG A NH1  15 
ATOM   8221  N  NH2  . ARG A 1 4  ? 8.661   1.261   14.032  1.00 0.00 ? 4  ARG A NH2  15 
ATOM   8222  H  H    . ARG A 1 4  ? 10.678  2.797   7.253   1.00 0.00 ? 4  ARG A H    15 
ATOM   8223  H  HA   . ARG A 1 4  ? 12.467  2.397   8.578   1.00 0.00 ? 4  ARG A HA   15 
ATOM   8224  H  HB2  . ARG A 1 4  ? 10.928  -0.099  8.620   1.00 0.00 ? 4  ARG A HB2  15 
ATOM   8225  H  HB3  . ARG A 1 4  ? 12.619  -0.294  9.060   1.00 0.00 ? 4  ARG A HB3  15 
ATOM   8226  H  HG2  . ARG A 1 4  ? 11.920  0.231   11.113  1.00 0.00 ? 4  ARG A HG2  15 
ATOM   8227  H  HG3  . ARG A 1 4  ? 11.939  1.892   10.518  1.00 0.00 ? 4  ARG A HG3  15 
ATOM   8228  H  HD2  . ARG A 1 4  ? 9.588   1.719   9.917   1.00 0.00 ? 4  ARG A HD2  15 
ATOM   8229  H  HD3  . ARG A 1 4  ? 9.559   0.042   10.465  1.00 0.00 ? 4  ARG A HD3  15 
ATOM   8230  H  HE   . ARG A 1 4  ? 10.049  2.340   12.261  1.00 0.00 ? 4  ARG A HE   15 
ATOM   8231  H  HH11 . ARG A 1 4  ? 8.705   -0.828  11.601  1.00 0.00 ? 4  ARG A HH11 15 
ATOM   8232  H  HH12 . ARG A 1 4  ? 7.900   -0.943  13.138  1.00 0.00 ? 4  ARG A HH12 15 
ATOM   8233  H  HH21 . ARG A 1 4  ? 9.028   2.158   14.312  1.00 0.00 ? 4  ARG A HH21 15 
ATOM   8234  H  HH22 . ARG A 1 4  ? 8.082   0.736   14.672  1.00 0.00 ? 4  ARG A HH22 15 
ATOM   8235  N  N    . GLY A 1 5  ? 13.680  -0.199  7.142   1.00 0.00 ? 5  GLY A N    15 
ATOM   8236  C  CA   . GLY A 1 5  ? 14.821  -0.688  6.396   1.00 0.00 ? 5  GLY A CA   15 
ATOM   8237  C  C    . GLY A 1 5  ? 14.418  -1.619  5.278   1.00 0.00 ? 5  GLY A C    15 
ATOM   8238  O  O    . GLY A 1 5  ? 14.890  -1.487  4.145   1.00 0.00 ? 5  GLY A O    15 
ATOM   8239  H  H    . GLY A 1 5  ? 13.122  -0.831  7.650   1.00 0.00 ? 5  GLY A H    15 
ATOM   8240  H  HA2  . GLY A 1 5  ? 15.352  0.154   5.977   1.00 0.00 ? 5  GLY A HA2  15 
ATOM   8241  H  HA3  . GLY A 1 5  ? 15.479  -1.217  7.071   1.00 0.00 ? 5  GLY A HA3  15 
ATOM   8242  N  N    . SER A 1 6  ? 13.511  -2.532  5.581   1.00 0.00 ? 6  SER A N    15 
ATOM   8243  C  CA   . SER A 1 6  ? 12.997  -3.454  4.586   1.00 0.00 ? 6  SER A CA   15 
ATOM   8244  C  C    . SER A 1 6  ? 11.896  -2.778  3.770   1.00 0.00 ? 6  SER A C    15 
ATOM   8245  O  O    . SER A 1 6  ? 10.709  -2.897  4.079   1.00 0.00 ? 6  SER A O    15 
ATOM   8246  C  CB   . SER A 1 6  ? 12.476  -4.717  5.270   1.00 0.00 ? 6  SER A CB   15 
ATOM   8247  O  OG   . SER A 1 6  ? 13.232  -5.005  6.439   1.00 0.00 ? 6  SER A OG   15 
ATOM   8248  H  H    . SER A 1 6  ? 13.144  -2.561  6.496   1.00 0.00 ? 6  SER A H    15 
ATOM   8249  H  HA   . SER A 1 6  ? 13.810  -3.717  3.925   1.00 0.00 ? 6  SER A HA   15 
ATOM   8250  H  HB2  . SER A 1 6  ? 11.444  -4.574  5.552   1.00 0.00 ? 6  SER A HB2  15 
ATOM   8251  H  HB3  . SER A 1 6  ? 12.552  -5.553  4.589   1.00 0.00 ? 6  SER A HB3  15 
ATOM   8252  H  HG   . SER A 1 6  ? 14.164  -4.774  6.282   1.00 0.00 ? 6  SER A HG   15 
ATOM   8253  N  N    . THR A 1 7  ? 12.315  -1.966  2.812   1.00 0.00 ? 7  THR A N    15 
ATOM   8254  C  CA   . THR A 1 7  ? 11.399  -1.157  2.032   1.00 0.00 ? 7  THR A CA   15 
ATOM   8255  C  C    . THR A 1 7  ? 10.808  -1.952  0.871   1.00 0.00 ? 7  THR A C    15 
ATOM   8256  O  O    . THR A 1 7  ? 11.185  -1.762  -0.287  1.00 0.00 ? 7  THR A O    15 
ATOM   8257  C  CB   . THR A 1 7  ? 12.126  0.092   1.494   1.00 0.00 ? 7  THR A CB   15 
ATOM   8258  O  OG1  . THR A 1 7  ? 13.545  -0.080  1.637   1.00 0.00 ? 7  THR A OG1  15 
ATOM   8259  C  CG2  . THR A 1 7  ? 11.692  1.342   2.239   1.00 0.00 ? 7  THR A CG2  15 
ATOM   8260  H  H    . THR A 1 7  ? 13.277  -1.832  2.690   1.00 0.00 ? 7  THR A H    15 
ATOM   8261  H  HA   . THR A 1 7  ? 10.599  -0.833  2.681   1.00 0.00 ? 7  THR A HA   15 
ATOM   8262  H  HB   . THR A 1 7  ? 11.885  0.209   0.446   1.00 0.00 ? 7  THR A HB   15 
ATOM   8263  H  HG1  . THR A 1 7  ? 13.971  0.791   1.692   1.00 0.00 ? 7  THR A HG1  15 
ATOM   8264  H  HG21 . THR A 1 7  ? 10.750  1.156   2.737   1.00 0.00 ? 7  THR A HG21 15 
ATOM   8265  H  HG22 . THR A 1 7  ? 11.576  2.159   1.540   1.00 0.00 ? 7  THR A HG22 15 
ATOM   8266  H  HG23 . THR A 1 7  ? 12.442  1.599   2.973   1.00 0.00 ? 7  THR A HG23 15 
ATOM   8267  N  N    . GLY A 1 8  ? 9.876   -2.839  1.193   1.00 0.00 ? 8  GLY A N    15 
ATOM   8268  C  CA   . GLY A 1 8  ? 9.218   -3.621  0.169   1.00 0.00 ? 8  GLY A CA   15 
ATOM   8269  C  C    . GLY A 1 8  ? 9.195   -5.103  0.478   1.00 0.00 ? 8  GLY A C    15 
ATOM   8270  O  O    . GLY A 1 8  ? 9.563   -5.922  -0.362  1.00 0.00 ? 8  GLY A O    15 
ATOM   8271  H  H    . GLY A 1 8  ? 9.617   -2.942  2.132   1.00 0.00 ? 8  GLY A H    15 
ATOM   8272  H  HA2  . GLY A 1 8  ? 8.200   -3.274  0.073   1.00 0.00 ? 8  GLY A HA2  15 
ATOM   8273  H  HA3  . GLY A 1 8  ? 9.729   -3.466  -0.770  1.00 0.00 ? 8  GLY A HA3  15 
ATOM   8274  N  N    . ILE A 1 9  ? 8.686   -5.448  1.651   1.00 0.00 ? 9  ILE A N    15 
ATOM   8275  C  CA   . ILE A 1 9  ? 8.492   -6.844  2.029   1.00 0.00 ? 9  ILE A CA   15 
ATOM   8276  C  C    . ILE A 1 9  ? 7.242   -7.407  1.347   1.00 0.00 ? 9  ILE A C    15 
ATOM   8277  O  O    . ILE A 1 9  ? 6.372   -6.640  0.939   1.00 0.00 ? 9  ILE A O    15 
ATOM   8278  C  CB   . ILE A 1 9  ? 8.345   -6.984  3.561   1.00 0.00 ? 9  ILE A CB   15 
ATOM   8279  C  CG1  . ILE A 1 9  ? 9.225   -5.964  4.283   1.00 0.00 ? 9  ILE A CG1  15 
ATOM   8280  C  CG2  . ILE A 1 9  ? 8.690   -8.395  4.017   1.00 0.00 ? 9  ILE A CG2  15 
ATOM   8281  C  CD1  . ILE A 1 9  ? 8.770   -5.670  5.697   1.00 0.00 ? 9  ILE A CD1  15 
ATOM   8282  H  H    . ILE A 1 9  ? 8.331   -4.748  2.234   1.00 0.00 ? 9  ILE A H    15 
ATOM   8283  H  HA   . ILE A 1 9  ? 9.357   -7.409  1.711   1.00 0.00 ? 9  ILE A HA   15 
ATOM   8284  H  HB   . ILE A 1 9  ? 7.314   -6.793  3.812   1.00 0.00 ? 9  ILE A HB   15 
ATOM   8285  H  HG12 . ILE A 1 9  ? 10.236  -6.341  4.332   1.00 0.00 ? 9  ILE A HG12 15 
ATOM   8286  H  HG13 . ILE A 1 9  ? 9.217   -5.036  3.731   1.00 0.00 ? 9  ILE A HG13 15 
ATOM   8287  H  HG21 . ILE A 1 9  ? 9.264   -8.893  3.249   1.00 0.00 ? 9  ILE A HG21 15 
ATOM   8288  H  HG22 . ILE A 1 9  ? 9.273   -8.348  4.925   1.00 0.00 ? 9  ILE A HG22 15 
ATOM   8289  H  HG23 . ILE A 1 9  ? 7.780   -8.948  4.204   1.00 0.00 ? 9  ILE A HG23 15 
ATOM   8290  H  HD11 . ILE A 1 9  ? 7.695   -5.751  5.752   1.00 0.00 ? 9  ILE A HD11 15 
ATOM   8291  H  HD12 . ILE A 1 9  ? 9.221   -6.378  6.376   1.00 0.00 ? 9  ILE A HD12 15 
ATOM   8292  H  HD13 . ILE A 1 9  ? 9.069   -4.669  5.971   1.00 0.00 ? 9  ILE A HD13 15 
ATOM   8293  N  N    . LYS A 1 10 ? 7.101   -8.735  1.329   1.00 0.00 ? 10 LYS A N    15 
ATOM   8294  C  CA   . LYS A 1 10 ? 5.886   -9.393  0.823   1.00 0.00 ? 10 LYS A CA   15 
ATOM   8295  C  C    . LYS A 1 10 ? 5.674   -9.153  -0.678  1.00 0.00 ? 10 LYS A C    15 
ATOM   8296  O  O    . LYS A 1 10 ? 6.097   -8.142  -1.229  1.00 0.00 ? 10 LYS A O    15 
ATOM   8297  C  CB   . LYS A 1 10 ? 4.656   -8.941  1.619   1.00 0.00 ? 10 LYS A CB   15 
ATOM   8298  C  CG   . LYS A 1 10 ? 4.635   -9.450  3.053   1.00 0.00 ? 10 LYS A CG   15 
ATOM   8299  C  CD   . LYS A 1 10 ? 4.426   -8.313  4.038   1.00 0.00 ? 10 LYS A CD   15 
ATOM   8300  C  CE   . LYS A 1 10 ? 4.213   -8.819  5.456   1.00 0.00 ? 10 LYS A CE   15 
ATOM   8301  N  NZ   . LYS A 1 10 ? 3.467   -7.832  6.281   1.00 0.00 ? 10 LYS A NZ   15 
ATOM   8302  H  H    . LYS A 1 10 ? 7.802   -9.290  1.735   1.00 0.00 ? 10 LYS A H    15 
ATOM   8303  H  HA   . LYS A 1 10 ? 6.016   -10.455 0.974   1.00 0.00 ? 10 LYS A HA   15 
ATOM   8304  H  HB2  . LYS A 1 10 ? 4.633   -7.862  1.644   1.00 0.00 ? 10 LYS A HB2  15 
ATOM   8305  H  HB3  . LYS A 1 10 ? 3.768   -9.299  1.120   1.00 0.00 ? 10 LYS A HB3  15 
ATOM   8306  H  HG2  . LYS A 1 10 ? 3.830   -10.162 3.161   1.00 0.00 ? 10 LYS A HG2  15 
ATOM   8307  H  HG3  . LYS A 1 10 ? 5.578   -9.934  3.267   1.00 0.00 ? 10 LYS A HG3  15 
ATOM   8308  H  HD2  . LYS A 1 10 ? 5.296   -7.674  4.022   1.00 0.00 ? 10 LYS A HD2  15 
ATOM   8309  H  HD3  . LYS A 1 10 ? 3.558   -7.746  3.734   1.00 0.00 ? 10 LYS A HD3  15 
ATOM   8310  H  HE2  . LYS A 1 10 ? 3.651   -9.740  5.417   1.00 0.00 ? 10 LYS A HE2  15 
ATOM   8311  H  HE3  . LYS A 1 10 ? 5.177   -9.004  5.910   1.00 0.00 ? 10 LYS A HE3  15 
ATOM   8312  H  HZ1  . LYS A 1 10 ? 4.080   -7.021  6.520   1.00 0.00 ? 10 LYS A HZ1  15 
ATOM   8313  H  HZ2  . LYS A 1 10 ? 3.136   -8.277  7.166   1.00 0.00 ? 10 LYS A HZ2  15 
ATOM   8314  H  HZ3  . LYS A 1 10 ? 2.637   -7.484  5.757   1.00 0.00 ? 10 LYS A HZ3  15 
ATOM   8315  N  N    . PRO A 1 11 ? 5.083   -10.130 -1.382  1.00 0.00 ? 11 PRO A N    15 
ATOM   8316  C  CA   . PRO A 1 11 ? 4.897   -10.068 -2.842  1.00 0.00 ? 11 PRO A CA   15 
ATOM   8317  C  C    . PRO A 1 11 ? 4.009   -8.906  -3.304  1.00 0.00 ? 11 PRO A C    15 
ATOM   8318  O  O    . PRO A 1 11 ? 3.978   -8.573  -4.494  1.00 0.00 ? 11 PRO A O    15 
ATOM   8319  C  CB   . PRO A 1 11 ? 4.229   -11.405 -3.180  1.00 0.00 ? 11 PRO A CB   15 
ATOM   8320  C  CG   . PRO A 1 11 ? 3.665   -11.893 -1.891  1.00 0.00 ? 11 PRO A CG   15 
ATOM   8321  C  CD   . PRO A 1 11 ? 4.604   -11.407 -0.828  1.00 0.00 ? 11 PRO A CD   15 
ATOM   8322  H  HA   . PRO A 1 11 ? 5.846   -10.008 -3.352  1.00 0.00 ? 11 PRO A HA   15 
ATOM   8323  H  HB2  . PRO A 1 11 ? 3.454   -11.246 -3.915  1.00 0.00 ? 11 PRO A HB2  15 
ATOM   8324  H  HB3  . PRO A 1 11 ? 4.967   -12.090 -3.571  1.00 0.00 ? 11 PRO A HB3  15 
ATOM   8325  H  HG2  . PRO A 1 11 ? 2.682   -11.476 -1.740  1.00 0.00 ? 11 PRO A HG2  15 
ATOM   8326  H  HG3  . PRO A 1 11 ? 3.622   -12.973 -1.890  1.00 0.00 ? 11 PRO A HG3  15 
ATOM   8327  H  HD2  . PRO A 1 11 ? 4.077   -11.254 0.102   1.00 0.00 ? 11 PRO A HD2  15 
ATOM   8328  H  HD3  . PRO A 1 11 ? 5.418   -12.101 -0.695  1.00 0.00 ? 11 PRO A HD3  15 
ATOM   8329  N  N    . PHE A 1 12 ? 3.279   -8.301  -2.373  1.00 0.00 ? 12 PHE A N    15 
ATOM   8330  C  CA   . PHE A 1 12 ? 2.377   -7.206  -2.698  1.00 0.00 ? 12 PHE A CA   15 
ATOM   8331  C  C    . PHE A 1 12 ? 2.689   -5.975  -1.857  1.00 0.00 ? 12 PHE A C    15 
ATOM   8332  O  O    . PHE A 1 12 ? 2.130   -5.787  -0.782  1.00 0.00 ? 12 PHE A O    15 
ATOM   8333  C  CB   . PHE A 1 12 ? 0.926   -7.624  -2.460  1.00 0.00 ? 12 PHE A CB   15 
ATOM   8334  C  CG   . PHE A 1 12 ? 0.505   -8.846  -3.225  1.00 0.00 ? 12 PHE A CG   15 
ATOM   8335  C  CD1  . PHE A 1 12 ? 0.537   -8.863  -4.609  1.00 0.00 ? 12 PHE A CD1  15 
ATOM   8336  C  CD2  . PHE A 1 12 ? 0.077   -9.979  -2.557  1.00 0.00 ? 12 PHE A CD2  15 
ATOM   8337  C  CE1  . PHE A 1 12 ? 0.148   -9.987  -5.311  1.00 0.00 ? 12 PHE A CE1  15 
ATOM   8338  C  CE2  . PHE A 1 12 ? -0.311  -11.108 -3.252  1.00 0.00 ? 12 PHE A CE2  15 
ATOM   8339  C  CZ   . PHE A 1 12 ? -0.275  -11.111 -4.632  1.00 0.00 ? 12 PHE A CZ   15 
ATOM   8340  H  H    . PHE A 1 12 ? 3.346   -8.600  -1.445  1.00 0.00 ? 12 PHE A H    15 
ATOM   8341  H  HA   . PHE A 1 12 ? 2.509   -6.960  -3.742  1.00 0.00 ? 12 PHE A HA   15 
ATOM   8342  H  HB2  . PHE A 1 12 ? 0.796   -7.831  -1.407  1.00 0.00 ? 12 PHE A HB2  15 
ATOM   8343  H  HB3  . PHE A 1 12 ? 0.274   -6.812  -2.742  1.00 0.00 ? 12 PHE A HB3  15 
ATOM   8344  H  HD1  . PHE A 1 12 ? 0.871   -7.985  -5.143  1.00 0.00 ? 12 PHE A HD1  15 
ATOM   8345  H  HD2  . PHE A 1 12 ? 0.050   -9.977  -1.476  1.00 0.00 ? 12 PHE A HD2  15 
ATOM   8346  H  HE1  . PHE A 1 12 ? 0.179   -9.987  -6.389  1.00 0.00 ? 12 PHE A HE1  15 
ATOM   8347  H  HE2  . PHE A 1 12 ? -0.646  -11.984 -2.717  1.00 0.00 ? 12 PHE A HE2  15 
ATOM   8348  H  HZ   . PHE A 1 12 ? -0.581  -11.990 -5.179  1.00 0.00 ? 12 PHE A HZ   15 
ATOM   8349  N  N    . GLN A 1 13 ? 3.563   -5.125  -2.353  1.00 0.00 ? 13 GLN A N    15 
ATOM   8350  C  CA   . GLN A 1 13 ? 3.894   -3.898  -1.649  1.00 0.00 ? 13 GLN A CA   15 
ATOM   8351  C  C    . GLN A 1 13 ? 3.074   -2.740  -2.161  1.00 0.00 ? 13 GLN A C    15 
ATOM   8352  O  O    . GLN A 1 13 ? 2.651   -2.736  -3.321  1.00 0.00 ? 13 GLN A O    15 
ATOM   8353  C  CB   . GLN A 1 13 ? 5.357   -3.538  -1.831  1.00 0.00 ? 13 GLN A CB   15 
ATOM   8354  C  CG   . GLN A 1 13 ? 6.303   -4.590  -1.347  1.00 0.00 ? 13 GLN A CG   15 
ATOM   8355  C  CD   . GLN A 1 13 ? 7.246   -5.051  -2.435  1.00 0.00 ? 13 GLN A CD   15 
ATOM   8356  O  OE1  . GLN A 1 13 ? 8.109   -4.298  -2.890  1.00 0.00 ? 13 GLN A OE1  15 
ATOM   8357  N  NE2  . GLN A 1 13 ? 7.085   -6.286  -2.860  1.00 0.00 ? 13 GLN A NE2  15 
ATOM   8358  H  H    . GLN A 1 13 ? 3.985   -5.315  -3.218  1.00 0.00 ? 13 GLN A H    15 
ATOM   8359  H  HA   . GLN A 1 13 ? 3.691   -4.042  -0.598  1.00 0.00 ? 13 GLN A HA   15 
ATOM   8360  H  HB2  . GLN A 1 13 ? 5.545   -3.369  -2.877  1.00 0.00 ? 13 GLN A HB2  15 
ATOM   8361  H  HB3  . GLN A 1 13 ? 5.556   -2.632  -1.278  1.00 0.00 ? 13 GLN A HB3  15 
ATOM   8362  H  HG2  . GLN A 1 13 ? 6.881   -4.184  -0.531  1.00 0.00 ? 13 GLN A HG2  15 
ATOM   8363  H  HG3  . GLN A 1 13 ? 5.726   -5.429  -0.998  1.00 0.00 ? 13 GLN A HG3  15 
ATOM   8364  H  HE21 . GLN A 1 13 ? 6.373   -6.822  -2.448  1.00 0.00 ? 13 GLN A HE21 15 
ATOM   8365  H  HE22 . GLN A 1 13 ? 7.691   -6.626  -3.561  1.00 0.00 ? 13 GLN A HE22 15 
ATOM   8366  N  N    . CYS A 1 14 ? 3.107   -1.657  -1.406  1.00 0.00 ? 14 CYS A N    15 
ATOM   8367  C  CA   . CYS A 1 14 ? 2.597   -0.400  -1.917  1.00 0.00 ? 14 CYS A CA   15 
ATOM   8368  C  C    . CYS A 1 14 ? 3.604   0.182   -2.896  1.00 0.00 ? 14 CYS A C    15 
ATOM   8369  O  O    . CYS A 1 14 ? 4.786   0.304   -2.576  1.00 0.00 ? 14 CYS A O    15 
ATOM   8370  C  CB   . CYS A 1 14 ? 2.319   0.631   -0.824  1.00 0.00 ? 14 CYS A CB   15 
ATOM   8371  S  SG   . CYS A 1 14 ? 1.633   2.166   -1.541  1.00 0.00 ? 14 CYS A SG   15 
ATOM   8372  H  H    . CYS A 1 14 ? 3.673   -1.666  -0.605  1.00 0.00 ? 14 CYS A H    15 
ATOM   8373  H  HA   . CYS A 1 14 ? 1.673   -0.603  -2.441  1.00 0.00 ? 14 CYS A HA   15 
ATOM   8374  H  HB2  . CYS A 1 14 ? 1.612   0.226   -0.118  1.00 0.00 ? 14 CYS A HB2  15 
ATOM   8375  H  HB3  . CYS A 1 14 ? 3.239   0.882   -0.318  1.00 0.00 ? 14 CYS A HB3  15 
ATOM   8376  N  N    . PRO A 1 15 ? 3.156   0.548   -4.098  1.00 0.00 ? 15 PRO A N    15 
ATOM   8377  C  CA   . PRO A 1 15 ? 4.031   1.125   -5.109  1.00 0.00 ? 15 PRO A CA   15 
ATOM   8378  C  C    . PRO A 1 15 ? 4.370   2.587   -4.823  1.00 0.00 ? 15 PRO A C    15 
ATOM   8379  O  O    . PRO A 1 15 ? 5.249   3.162   -5.463  1.00 0.00 ? 15 PRO A O    15 
ATOM   8380  C  CB   . PRO A 1 15 ? 3.212   1.005   -6.393  1.00 0.00 ? 15 PRO A CB   15 
ATOM   8381  C  CG   . PRO A 1 15 ? 1.791   1.019   -5.945  1.00 0.00 ? 15 PRO A CG   15 
ATOM   8382  C  CD   . PRO A 1 15 ? 1.769   0.398   -4.575  1.00 0.00 ? 15 PRO A CD   15 
ATOM   8383  H  HA   . PRO A 1 15 ? 4.944   0.560   -5.206  1.00 0.00 ? 15 PRO A HA   15 
ATOM   8384  H  HB2  . PRO A 1 15 ? 3.429   1.842   -7.042  1.00 0.00 ? 15 PRO A HB2  15 
ATOM   8385  H  HB3  . PRO A 1 15 ? 3.457   0.082   -6.895  1.00 0.00 ? 15 PRO A HB3  15 
ATOM   8386  H  HG2  . PRO A 1 15 ? 1.432   2.037   -5.899  1.00 0.00 ? 15 PRO A HG2  15 
ATOM   8387  H  HG3  . PRO A 1 15 ? 1.186   0.439   -6.627  1.00 0.00 ? 15 PRO A HG3  15 
ATOM   8388  H  HD2  . PRO A 1 15 ? 1.083   0.929   -3.933  1.00 0.00 ? 15 PRO A HD2  15 
ATOM   8389  H  HD3  . PRO A 1 15 ? 1.496   -0.644  -4.638  1.00 0.00 ? 15 PRO A HD3  15 
ATOM   8390  N  N    . ASP A 1 16 ? 3.683   3.185   -3.857  1.00 0.00 ? 16 ASP A N    15 
ATOM   8391  C  CA   . ASP A 1 16 ? 3.932   4.582   -3.513  1.00 0.00 ? 16 ASP A CA   15 
ATOM   8392  C  C    . ASP A 1 16 ? 4.712   4.691   -2.215  1.00 0.00 ? 16 ASP A C    15 
ATOM   8393  O  O    . ASP A 1 16 ? 5.571   5.560   -2.063  1.00 0.00 ? 16 ASP A O    15 
ATOM   8394  C  CB   . ASP A 1 16 ? 2.616   5.352   -3.380  1.00 0.00 ? 16 ASP A CB   15 
ATOM   8395  C  CG   . ASP A 1 16 ? 2.831   6.834   -3.130  1.00 0.00 ? 16 ASP A CG   15 
ATOM   8396  O  OD1  . ASP A 1 16 ? 2.967   7.591   -4.116  1.00 0.00 ? 16 ASP A OD1  15 
ATOM   8397  O  OD2  . ASP A 1 16 ? 2.850   7.253   -1.953  1.00 0.00 ? 16 ASP A OD2  15 
ATOM   8398  H  H    . ASP A 1 16 ? 3.008   2.671   -3.353  1.00 0.00 ? 16 ASP A H    15 
ATOM   8399  H  HA   . ASP A 1 16 ? 4.516   5.021   -4.307  1.00 0.00 ? 16 ASP A HA   15 
ATOM   8400  H  HB2  . ASP A 1 16 ? 2.045   5.237   -4.290  1.00 0.00 ? 16 ASP A HB2  15 
ATOM   8401  H  HB3  . ASP A 1 16 ? 2.050   4.945   -2.554  1.00 0.00 ? 16 ASP A HB3  15 
ATOM   8402  N  N    . CYS A 1 17 ? 4.368   3.842   -1.260  1.00 0.00 ? 17 CYS A N    15 
ATOM   8403  C  CA   . CYS A 1 17 ? 4.969   3.913   0.062   1.00 0.00 ? 17 CYS A CA   15 
ATOM   8404  C  C    . CYS A 1 17 ? 6.135   2.947   0.219   1.00 0.00 ? 17 CYS A C    15 
ATOM   8405  O  O    . CYS A 1 17 ? 6.987   3.151   1.085   1.00 0.00 ? 17 CYS A O    15 
ATOM   8406  C  CB   . CYS A 1 17 ? 3.925   3.637   1.139   1.00 0.00 ? 17 CYS A CB   15 
ATOM   8407  S  SG   . CYS A 1 17 ? 2.481   4.738   1.068   1.00 0.00 ? 17 CYS A SG   15 
ATOM   8408  H  H    . CYS A 1 17 ? 3.654   3.190   -1.434  1.00 0.00 ? 17 CYS A H    15 
ATOM   8409  H  HA   . CYS A 1 17 ? 5.336   4.916   0.189   1.00 0.00 ? 17 CYS A HA   15 
ATOM   8410  H  HB2  . CYS A 1 17 ? 3.568   2.623   1.034   1.00 0.00 ? 17 CYS A HB2  15 
ATOM   8411  H  HB3  . CYS A 1 17 ? 4.381   3.753   2.113   1.00 0.00 ? 17 CYS A HB3  15 
ATOM   8412  N  N    . ASP A 1 18 ? 6.043   1.814   -0.473  1.00 0.00 ? 18 ASP A N    15 
ATOM   8413  C  CA   . ASP A 1 18 ? 6.977   0.698   -0.300  1.00 0.00 ? 18 ASP A CA   15 
ATOM   8414  C  C    . ASP A 1 18 ? 6.615   -0.074  0.956   1.00 0.00 ? 18 ASP A C    15 
ATOM   8415  O  O    . ASP A 1 18 ? 7.460   -0.722  1.578   1.00 0.00 ? 18 ASP A O    15 
ATOM   8416  C  CB   . ASP A 1 18 ? 8.441   1.157   -0.262  1.00 0.00 ? 18 ASP A CB   15 
ATOM   8417  C  CG   . ASP A 1 18 ? 9.186   0.782   -1.523  1.00 0.00 ? 18 ASP A CG   15 
ATOM   8418  O  OD1  . ASP A 1 18 ? 9.013   -0.352  -2.009  1.00 0.00 ? 18 ASP A OD1  15 
ATOM   8419  O  OD2  . ASP A 1 18 ? 9.938   1.630   -2.054  1.00 0.00 ? 18 ASP A OD2  15 
ATOM   8420  H  H    . ASP A 1 18 ? 5.263   1.683   -1.052  1.00 0.00 ? 18 ASP A H    15 
ATOM   8421  H  HA   . ASP A 1 18 ? 6.849   0.038   -1.140  1.00 0.00 ? 18 ASP A HA   15 
ATOM   8422  H  HB2  . ASP A 1 18 ? 8.475   2.230   -0.152  1.00 0.00 ? 18 ASP A HB2  15 
ATOM   8423  H  HB3  . ASP A 1 18 ? 8.934   0.693   0.579   1.00 0.00 ? 18 ASP A HB3  15 
ATOM   8424  N  N    . ARG A 1 19 ? 5.319   -0.068  1.260   1.00 0.00 ? 19 ARG A N    15 
ATOM   8425  C  CA   . ARG A 1 19 ? 4.780   -0.848  2.362   1.00 0.00 ? 19 ARG A CA   15 
ATOM   8426  C  C    . ARG A 1 19 ? 4.784   -2.322  1.986   1.00 0.00 ? 19 ARG A C    15 
ATOM   8427  O  O    . ARG A 1 19 ? 5.427   -2.709  1.017   1.00 0.00 ? 19 ARG A O    15 
ATOM   8428  C  CB   . ARG A 1 19 ? 3.362   -0.391  2.693   1.00 0.00 ? 19 ARG A CB   15 
ATOM   8429  C  CG   . ARG A 1 19 ? 3.290   0.518   3.905   1.00 0.00 ? 19 ARG A CG   15 
ATOM   8430  C  CD   . ARG A 1 19 ? 2.249   1.608   3.721   1.00 0.00 ? 19 ARG A CD   15 
ATOM   8431  N  NE   . ARG A 1 19 ? 0.902   1.139   4.040   1.00 0.00 ? 19 ARG A NE   15 
ATOM   8432  C  CZ   . ARG A 1 19 ? 0.432   1.025   5.287   1.00 0.00 ? 19 ARG A CZ   15 
ATOM   8433  N  NH1  . ARG A 1 19 ? 1.180   1.400   6.319   1.00 0.00 ? 19 ARG A NH1  15 
ATOM   8434  N  NH2  . ARG A 1 19 ? -0.794  0.563   5.500   1.00 0.00 ? 19 ARG A NH2  15 
ATOM   8435  H  H    . ARG A 1 19 ? 4.702   0.417   0.676   1.00 0.00 ? 19 ARG A H    15 
ATOM   8436  H  HA   . ARG A 1 19 ? 5.417   -0.698  3.223   1.00 0.00 ? 19 ARG A HA   15 
ATOM   8437  H  HB2  . ARG A 1 19 ? 2.958   0.142   1.844   1.00 0.00 ? 19 ARG A HB2  15 
ATOM   8438  H  HB3  . ARG A 1 19 ? 2.750   -1.261  2.886   1.00 0.00 ? 19 ARG A HB3  15 
ATOM   8439  H  HG2  . ARG A 1 19 ? 3.029   -0.071  4.771   1.00 0.00 ? 19 ARG A HG2  15 
ATOM   8440  H  HG3  . ARG A 1 19 ? 4.255   0.976   4.057   1.00 0.00 ? 19 ARG A HG3  15 
ATOM   8441  H  HD2  . ARG A 1 19 ? 2.495   2.434   4.371   1.00 0.00 ? 19 ARG A HD2  15 
ATOM   8442  H  HD3  . ARG A 1 19 ? 2.272   1.940   2.693   1.00 0.00 ? 19 ARG A HD3  15 
ATOM   8443  H  HE   . ARG A 1 19 ? 0.318   0.894   3.282   1.00 0.00 ? 19 ARG A HE   15 
ATOM   8444  H  HH11 . ARG A 1 19 ? 2.102   1.775   6.168   1.00 0.00 ? 19 ARG A HH11 15 
ATOM   8445  H  HH12 . ARG A 1 19 ? 0.833   1.306   7.255   1.00 0.00 ? 19 ARG A HH12 15 
ATOM   8446  H  HH21 . ARG A 1 19 ? -1.374  0.293   4.733   1.00 0.00 ? 19 ARG A HH21 15 
ATOM   8447  H  HH22 . ARG A 1 19 ? -1.146  0.481   6.445   1.00 0.00 ? 19 ARG A HH22 15 
ATOM   8448  N  N    . SER A 1 20 ? 4.127   -3.161  2.760   1.00 0.00 ? 20 SER A N    15 
ATOM   8449  C  CA   . SER A 1 20 ? 4.193   -4.581  2.489   1.00 0.00 ? 20 SER A CA   15 
ATOM   8450  C  C    . SER A 1 20 ? 2.936   -5.320  2.915   1.00 0.00 ? 20 SER A C    15 
ATOM   8451  O  O    . SER A 1 20 ? 2.511   -5.244  4.071   1.00 0.00 ? 20 SER A O    15 
ATOM   8452  C  CB   . SER A 1 20 ? 5.409   -5.160  3.192   1.00 0.00 ? 20 SER A CB   15 
ATOM   8453  O  OG   . SER A 1 20 ? 5.745   -4.405  4.346   1.00 0.00 ? 20 SER A OG   15 
ATOM   8454  H  H    . SER A 1 20 ? 3.666   -2.835  3.568   1.00 0.00 ? 20 SER A H    15 
ATOM   8455  H  HA   . SER A 1 20 ? 4.318   -4.703  1.423   1.00 0.00 ? 20 SER A HA   15 
ATOM   8456  H  HB2  . SER A 1 20 ? 5.198   -6.178  3.483   1.00 0.00 ? 20 SER A HB2  15 
ATOM   8457  H  HB3  . SER A 1 20 ? 6.249   -5.146  2.508   1.00 0.00 ? 20 SER A HB3  15 
ATOM   8458  H  HG   . SER A 1 20 ? 5.185   -3.617  4.387   1.00 0.00 ? 20 SER A HG   15 
ATOM   8459  N  N    . PHE A 1 21 ? 2.339   -6.019  1.961   1.00 0.00 ? 21 PHE A N    15 
ATOM   8460  C  CA   . PHE A 1 21 ? 1.124   -6.780  2.205   1.00 0.00 ? 21 PHE A CA   15 
ATOM   8461  C  C    . PHE A 1 21 ? 1.234   -8.166  1.575   1.00 0.00 ? 21 PHE A C    15 
ATOM   8462  O  O    . PHE A 1 21 ? 1.667   -8.306  0.433   1.00 0.00 ? 21 PHE A O    15 
ATOM   8463  C  CB   . PHE A 1 21 ? -0.092  -6.039  1.631   1.00 0.00 ? 21 PHE A CB   15 
ATOM   8464  C  CG   . PHE A 1 21 ? -0.060  -4.549  1.858   1.00 0.00 ? 21 PHE A CG   15 
ATOM   8465  C  CD1  . PHE A 1 21 ? 0.674   -3.716  1.025   1.00 0.00 ? 21 PHE A CD1  15 
ATOM   8466  C  CD2  . PHE A 1 21 ? -0.757  -3.981  2.911   1.00 0.00 ? 21 PHE A CD2  15 
ATOM   8467  C  CE1  . PHE A 1 21 ? 0.711   -2.354  1.239   1.00 0.00 ? 21 PHE A CE1  15 
ATOM   8468  C  CE2  . PHE A 1 21 ? -0.723  -2.618  3.129   1.00 0.00 ? 21 PHE A CE2  15 
ATOM   8469  C  CZ   . PHE A 1 21 ? 0.011   -1.805  2.291   1.00 0.00 ? 21 PHE A CZ   15 
ATOM   8470  H  H    . PHE A 1 21 ? 2.713   -6.001  1.047   1.00 0.00 ? 21 PHE A H    15 
ATOM   8471  H  HA   . PHE A 1 21 ? 1.004   -6.887  3.273   1.00 0.00 ? 21 PHE A HA   15 
ATOM   8472  H  HB2  . PHE A 1 21 ? -0.136  -6.210  0.566   1.00 0.00 ? 21 PHE A HB2  15 
ATOM   8473  H  HB3  . PHE A 1 21 ? -0.988  -6.428  2.091   1.00 0.00 ? 21 PHE A HB3  15 
ATOM   8474  H  HD1  . PHE A 1 21 ? 1.227   -4.146  0.203   1.00 0.00 ? 21 PHE A HD1  15 
ATOM   8475  H  HD2  . PHE A 1 21 ? -1.333  -4.617  3.568   1.00 0.00 ? 21 PHE A HD2  15 
ATOM   8476  H  HE1  . PHE A 1 21 ? 1.287   -1.720  0.582   1.00 0.00 ? 21 PHE A HE1  15 
ATOM   8477  H  HE2  . PHE A 1 21 ? -1.272  -2.187  3.955   1.00 0.00 ? 21 PHE A HE2  15 
ATOM   8478  H  HZ   . PHE A 1 21 ? 0.040   -0.741  2.460   1.00 0.00 ? 21 PHE A HZ   15 
ATOM   8479  N  N    . SER A 1 22 ? 0.878   -9.192  2.334   1.00 0.00 ? 22 SER A N    15 
ATOM   8480  C  CA   . SER A 1 22 ? 0.936   -10.562 1.851   1.00 0.00 ? 22 SER A CA   15 
ATOM   8481  C  C    . SER A 1 22 ? -0.275  -10.867 0.971   1.00 0.00 ? 22 SER A C    15 
ATOM   8482  O  O    . SER A 1 22 ? -0.219  -11.719 0.082   1.00 0.00 ? 22 SER A O    15 
ATOM   8483  C  CB   . SER A 1 22 ? 0.989   -11.526 3.036   1.00 0.00 ? 22 SER A CB   15 
ATOM   8484  O  OG   . SER A 1 22 ? 1.535   -10.895 4.186   1.00 0.00 ? 22 SER A OG   15 
ATOM   8485  H  H    . SER A 1 22 ? 0.581   -9.030  3.253   1.00 0.00 ? 22 SER A H    15 
ATOM   8486  H  HA   . SER A 1 22 ? 1.835   -10.671 1.263   1.00 0.00 ? 22 SER A HA   15 
ATOM   8487  H  HB2  . SER A 1 22 ? -0.007  -11.871 3.266   1.00 0.00 ? 22 SER A HB2  15 
ATOM   8488  H  HB3  . SER A 1 22 ? 1.609   -12.365 2.778   1.00 0.00 ? 22 SER A HB3  15 
ATOM   8489  H  HG   . SER A 1 22 ? 2.372   -11.331 4.419   1.00 0.00 ? 22 SER A HG   15 
ATOM   8490  N  N    . ARG A 1 23 ? -1.351  -10.127 1.198   1.00 0.00 ? 23 ARG A N    15 
ATOM   8491  C  CA   . ARG A 1 23 ? -2.562  -10.250 0.400   1.00 0.00 ? 23 ARG A CA   15 
ATOM   8492  C  C    . ARG A 1 23 ? -2.806  -8.971  -0.360  1.00 0.00 ? 23 ARG A C    15 
ATOM   8493  O  O    . ARG A 1 23 ? -2.708  -7.871  0.189   1.00 0.00 ? 23 ARG A O    15 
ATOM   8494  C  CB   . ARG A 1 23 ? -3.772  -10.580 1.282   1.00 0.00 ? 23 ARG A CB   15 
ATOM   8495  C  CG   . ARG A 1 23 ? -3.618  -11.865 2.077   1.00 0.00 ? 23 ARG A CG   15 
ATOM   8496  C  CD   . ARG A 1 23 ? -4.961  -12.502 2.417   1.00 0.00 ? 23 ARG A CD   15 
ATOM   8497  N  NE   . ARG A 1 23 ? -6.093  -11.578 2.279   1.00 0.00 ? 23 ARG A NE   15 
ATOM   8498  C  CZ   . ARG A 1 23 ? -7.237  -11.883 1.663   1.00 0.00 ? 23 ARG A CZ   15 
ATOM   8499  N  NH1  . ARG A 1 23 ? -7.418  -13.095 1.146   1.00 0.00 ? 23 ARG A NH1  15 
ATOM   8500  N  NH2  . ARG A 1 23 ? -8.206  -10.979 1.583   1.00 0.00 ? 23 ARG A NH2  15 
ATOM   8501  H  H    . ARG A 1 23 ? -1.316  -9.443  1.903   1.00 0.00 ? 23 ARG A H    15 
ATOM   8502  H  HA   . ARG A 1 23 ? -2.422  -11.034 -0.330  1.00 0.00 ? 23 ARG A HA   15 
ATOM   8503  H  HB2  . ARG A 1 23 ? -3.926  -9.772  1.980   1.00 0.00 ? 23 ARG A HB2  15 
ATOM   8504  H  HB3  . ARG A 1 23 ? -4.645  -10.674 0.654   1.00 0.00 ? 23 ARG A HB3  15 
ATOM   8505  H  HG2  . ARG A 1 23 ? -3.038  -12.567 1.493   1.00 0.00 ? 23 ARG A HG2  15 
ATOM   8506  H  HG3  . ARG A 1 23 ? -3.094  -11.642 2.997   1.00 0.00 ? 23 ARG A HG3  15 
ATOM   8507  H  HD2  . ARG A 1 23 ? -5.120  -13.345 1.760   1.00 0.00 ? 23 ARG A HD2  15 
ATOM   8508  H  HD3  . ARG A 1 23 ? -4.922  -12.851 3.438   1.00 0.00 ? 23 ARG A HD3  15 
ATOM   8509  H  HE   . ARG A 1 23 ? -5.996  -10.680 2.681   1.00 0.00 ? 23 ARG A HE   15 
ATOM   8510  H  HH11 . ARG A 1 23 ? -6.693  -13.789 1.218   1.00 0.00 ? 23 ARG A HH11 15 
ATOM   8511  H  HH12 . ARG A 1 23 ? -8.281  -13.324 0.681   1.00 0.00 ? 23 ARG A HH12 15 
ATOM   8512  H  HH21 . ARG A 1 23 ? -8.078  -10.065 1.980   1.00 0.00 ? 23 ARG A HH21 15 
ATOM   8513  H  HH22 . ARG A 1 23 ? -9.076  -11.203 1.126   1.00 0.00 ? 23 ARG A HH22 15 
ATOM   8514  N  N    . SER A 1 24 ? -3.093  -9.136  -1.632  1.00 0.00 ? 24 SER A N    15 
ATOM   8515  C  CA   . SER A 1 24 ? -3.323  -8.029  -2.527  1.00 0.00 ? 24 SER A CA   15 
ATOM   8516  C  C    . SER A 1 24 ? -4.561  -7.236  -2.105  1.00 0.00 ? 24 SER A C    15 
ATOM   8517  O  O    . SER A 1 24 ? -4.670  -6.037  -2.381  1.00 0.00 ? 24 SER A O    15 
ATOM   8518  C  CB   . SER A 1 24 ? -3.470  -8.578  -3.937  1.00 0.00 ? 24 SER A CB   15 
ATOM   8519  O  OG   . SER A 1 24 ? -3.570  -9.995  -3.921  1.00 0.00 ? 24 SER A OG   15 
ATOM   8520  H  H    . SER A 1 24 ? -3.133  -10.047 -1.999  1.00 0.00 ? 24 SER A H    15 
ATOM   8521  H  HA   . SER A 1 24 ? -2.458  -7.384  -2.488  1.00 0.00 ? 24 SER A HA   15 
ATOM   8522  H  HB2  . SER A 1 24 ? -4.356  -8.173  -4.389  1.00 0.00 ? 24 SER A HB2  15 
ATOM   8523  H  HB3  . SER A 1 24 ? -2.605  -8.304  -4.512  1.00 0.00 ? 24 SER A HB3  15 
ATOM   8524  H  HG   . SER A 1 24 ? -3.578  -10.320 -4.835  1.00 0.00 ? 24 SER A HG   15 
ATOM   8525  N  N    . ASP A 1 25 ? -5.426  -7.887  -1.334  1.00 0.00 ? 25 ASP A N    15 
ATOM   8526  C  CA   . ASP A 1 25 ? -6.586  -7.228  -0.740  1.00 0.00 ? 25 ASP A CA   15 
ATOM   8527  C  C    . ASP A 1 25 ? -6.125  -6.171  0.251   1.00 0.00 ? 25 ASP A C    15 
ATOM   8528  O  O    . ASP A 1 25 ? -6.549  -5.017  0.190   1.00 0.00 ? 25 ASP A O    15 
ATOM   8529  C  CB   . ASP A 1 25 ? -7.473  -8.256  -0.032  1.00 0.00 ? 25 ASP A CB   15 
ATOM   8530  C  CG   . ASP A 1 25 ? -8.418  -7.640  0.986   1.00 0.00 ? 25 ASP A CG   15 
ATOM   8531  O  OD1  . ASP A 1 25 ? -9.261  -6.802  0.600   1.00 0.00 ? 25 ASP A OD1  15 
ATOM   8532  O  OD2  . ASP A 1 25 ? -8.333  -8.017  2.174   1.00 0.00 ? 25 ASP A OD2  15 
ATOM   8533  H  H    . ASP A 1 25 ? -5.246  -8.829  -1.107  1.00 0.00 ? 25 ASP A H    15 
ATOM   8534  H  HA   . ASP A 1 25 ? -7.144  -6.756  -1.533  1.00 0.00 ? 25 ASP A HA   15 
ATOM   8535  H  HB2  . ASP A 1 25 ? -8.061  -8.773  -0.768  1.00 0.00 ? 25 ASP A HB2  15 
ATOM   8536  H  HB3  . ASP A 1 25 ? -6.844  -8.970  0.479   1.00 0.00 ? 25 ASP A HB3  15 
ATOM   8537  N  N    . HIS A 1 26 ? -5.188  -6.562  1.110   1.00 0.00 ? 26 HIS A N    15 
ATOM   8538  C  CA   . HIS A 1 26 ? -4.605  -5.646  2.085   1.00 0.00 ? 26 HIS A CA   15 
ATOM   8539  C  C    . HIS A 1 26 ? -3.950  -4.458  1.396   1.00 0.00 ? 26 HIS A C    15 
ATOM   8540  O  O    . HIS A 1 26 ? -4.042  -3.329  1.880   1.00 0.00 ? 26 HIS A O    15 
ATOM   8541  C  CB   . HIS A 1 26 ? -3.581  -6.359  2.966   1.00 0.00 ? 26 HIS A CB   15 
ATOM   8542  C  CG   . HIS A 1 26 ? -4.055  -6.530  4.370   1.00 0.00 ? 26 HIS A CG   15 
ATOM   8543  N  ND1  . HIS A 1 26 ? -3.395  -6.021  5.466   1.00 0.00 ? 26 HIS A ND1  15 
ATOM   8544  C  CD2  . HIS A 1 26 ? -5.157  -7.141  4.847   1.00 0.00 ? 26 HIS A CD2  15 
ATOM   8545  C  CE1  . HIS A 1 26 ? -4.073  -6.316  6.558   1.00 0.00 ? 26 HIS A CE1  15 
ATOM   8546  N  NE2  . HIS A 1 26 ? -5.151  -6.996  6.212   1.00 0.00 ? 26 HIS A NE2  15 
ATOM   8547  H  H    . HIS A 1 26 ? -4.861  -7.485  1.063   1.00 0.00 ? 26 HIS A H    15 
ATOM   8548  H  HA   . HIS A 1 26 ? -5.408  -5.285  2.712   1.00 0.00 ? 26 HIS A HA   15 
ATOM   8549  H  HB2  . HIS A 1 26 ? -3.380  -7.338  2.557   1.00 0.00 ? 26 HIS A HB2  15 
ATOM   8550  H  HB3  . HIS A 1 26 ? -2.667  -5.784  2.986   1.00 0.00 ? 26 HIS A HB3  15 
ATOM   8551  H  HD1  . HIS A 1 26 ? -2.562  -5.497  5.449   1.00 0.00 ? 26 HIS A HD1  15 
ATOM   8552  H  HD2  . HIS A 1 26 ? -5.911  -7.643  4.253   1.00 0.00 ? 26 HIS A HD2  15 
ATOM   8553  H  HE1  . HIS A 1 26 ? -3.794  -6.046  7.566   1.00 0.00 ? 26 HIS A HE1  15 
ATOM   8554  H  HE2  . HIS A 1 26 ? -5.935  -7.132  6.796   1.00 0.00 ? 26 HIS A HE2  15 
ATOM   8555  N  N    . LEU A 1 27 ? -3.351  -4.709  0.234   1.00 0.00 ? 27 LEU A N    15 
ATOM   8556  C  CA   . LEU A 1 27 ? -2.776  -3.644  -0.579  1.00 0.00 ? 27 LEU A CA   15 
ATOM   8557  C  C    . LEU A 1 27 ? -3.840  -2.595  -0.874  1.00 0.00 ? 27 LEU A C    15 
ATOM   8558  O  O    . LEU A 1 27 ? -3.712  -1.434  -0.483  1.00 0.00 ? 27 LEU A O    15 
ATOM   8559  C  CB   . LEU A 1 27 ? -2.243  -4.196  -1.905  1.00 0.00 ? 27 LEU A CB   15 
ATOM   8560  C  CG   . LEU A 1 27 ? -1.336  -3.252  -2.710  1.00 0.00 ? 27 LEU A CG   15 
ATOM   8561  C  CD1  . LEU A 1 27 ? -0.757  -2.149  -1.840  1.00 0.00 ? 27 LEU A CD1  15 
ATOM   8562  C  CD2  . LEU A 1 27 ? -0.228  -4.017  -3.402  1.00 0.00 ? 27 LEU A CD2  15 
ATOM   8563  H  H    . LEU A 1 27 ? -3.356  -5.626  -0.117  1.00 0.00 ? 27 LEU A H    15 
ATOM   8564  H  HA   . LEU A 1 27 ? -1.967  -3.190  -0.027  1.00 0.00 ? 27 LEU A HA   15 
ATOM   8565  H  HB2  . LEU A 1 27 ? -1.687  -5.098  -1.692  1.00 0.00 ? 27 LEU A HB2  15 
ATOM   8566  H  HB3  . LEU A 1 27 ? -3.089  -4.457  -2.522  1.00 0.00 ? 27 LEU A HB3  15 
ATOM   8567  H  HG   . LEU A 1 27 ? -1.934  -2.777  -3.475  1.00 0.00 ? 27 LEU A HG   15 
ATOM   8568  H  HD11 . LEU A 1 27 ? -1.537  -1.731  -1.221  1.00 0.00 ? 27 LEU A HD11 15 
ATOM   8569  H  HD12 . LEU A 1 27 ? 0.023   -2.558  -1.212  1.00 0.00 ? 27 LEU A HD12 15 
ATOM   8570  H  HD13 . LEU A 1 27 ? -0.344  -1.375  -2.469  1.00 0.00 ? 27 LEU A HD13 15 
ATOM   8571  H  HD21 . LEU A 1 27 ? -0.656  -4.730  -4.088  1.00 0.00 ? 27 LEU A HD21 15 
ATOM   8572  H  HD22 . LEU A 1 27 ? 0.395   -3.320  -3.948  1.00 0.00 ? 27 LEU A HD22 15 
ATOM   8573  H  HD23 . LEU A 1 27 ? 0.369   -4.534  -2.665  1.00 0.00 ? 27 LEU A HD23 15 
ATOM   8574  N  N    . ALA A 1 28 ? -4.891  -3.030  -1.561  1.00 0.00 ? 28 ALA A N    15 
ATOM   8575  C  CA   . ALA A 1 28 ? -5.993  -2.157  -1.935  1.00 0.00 ? 28 ALA A CA   15 
ATOM   8576  C  C    . ALA A 1 28 ? -6.601  -1.470  -0.717  1.00 0.00 ? 28 ALA A C    15 
ATOM   8577  O  O    . ALA A 1 28 ? -6.909  -0.285  -0.770  1.00 0.00 ? 28 ALA A O    15 
ATOM   8578  C  CB   . ALA A 1 28 ? -7.055  -2.942  -2.688  1.00 0.00 ? 28 ALA A CB   15 
ATOM   8579  H  H    . ALA A 1 28 ? -4.923  -3.975  -1.827  1.00 0.00 ? 28 ALA A H    15 
ATOM   8580  H  HA   . ALA A 1 28 ? -5.599  -1.399  -2.605  1.00 0.00 ? 28 ALA A HA   15 
ATOM   8581  H  HB1  . ALA A 1 28 ? -8.018  -2.780  -2.226  1.00 0.00 ? 28 ALA A HB1  15 
ATOM   8582  H  HB2  . ALA A 1 28 ? -7.087  -2.610  -3.716  1.00 0.00 ? 28 ALA A HB2  15 
ATOM   8583  H  HB3  . ALA A 1 28 ? -6.815  -3.993  -2.656  1.00 0.00 ? 28 ALA A HB3  15 
ATOM   8584  N  N    . LEU A 1 29 ? -6.750  -2.216  0.382   1.00 0.00 ? 29 LEU A N    15 
ATOM   8585  C  CA   . LEU A 1 29 ? -7.303  -1.674  1.626   1.00 0.00 ? 29 LEU A CA   15 
ATOM   8586  C  C    . LEU A 1 29 ? -6.560  -0.411  2.055   1.00 0.00 ? 29 LEU A C    15 
ATOM   8587  O  O    . LEU A 1 29 ? -7.175  0.604   2.389   1.00 0.00 ? 29 LEU A O    15 
ATOM   8588  C  CB   . LEU A 1 29 ? -7.227  -2.707  2.750   1.00 0.00 ? 29 LEU A CB   15 
ATOM   8589  C  CG   . LEU A 1 29 ? -8.157  -3.910  2.602   1.00 0.00 ? 29 LEU A CG   15 
ATOM   8590  C  CD1  . LEU A 1 29 ? -7.876  -4.930  3.691   1.00 0.00 ? 29 LEU A CD1  15 
ATOM   8591  C  CD2  . LEU A 1 29 ? -9.611  -3.470  2.650   1.00 0.00 ? 29 LEU A CD2  15 
ATOM   8592  H  H    . LEU A 1 29 ? -6.486  -3.165  0.353   1.00 0.00 ? 29 LEU A H    15 
ATOM   8593  H  HA   . LEU A 1 29 ? -8.338  -1.427  1.452   1.00 0.00 ? 29 LEU A HA   15 
ATOM   8594  H  HB2  . LEU A 1 29 ? -6.212  -3.071  2.809   1.00 0.00 ? 29 LEU A HB2  15 
ATOM   8595  H  HB3  . LEU A 1 29 ? -7.467  -2.210  3.675   1.00 0.00 ? 29 LEU A HB3  15 
ATOM   8596  H  HG   . LEU A 1 29 ? -7.981  -4.381  1.646   1.00 0.00 ? 29 LEU A HG   15 
ATOM   8597  H  HD11 . LEU A 1 29 ? -6.973  -5.471  3.450   1.00 0.00 ? 29 LEU A HD11 15 
ATOM   8598  H  HD12 . LEU A 1 29 ? -7.750  -4.421  4.636   1.00 0.00 ? 29 LEU A HD12 15 
ATOM   8599  H  HD13 . LEU A 1 29 ? -8.703  -5.620  3.760   1.00 0.00 ? 29 LEU A HD13 15 
ATOM   8600  H  HD21 . LEU A 1 29 ? -10.178 -4.166  3.252   1.00 0.00 ? 29 LEU A HD21 15 
ATOM   8601  H  HD22 . LEU A 1 29 ? -9.674  -2.484  3.086   1.00 0.00 ? 29 LEU A HD22 15 
ATOM   8602  H  HD23 . LEU A 1 29 ? -10.013 -3.447  1.648   1.00 0.00 ? 29 LEU A HD23 15 
ATOM   8603  N  N    . HIS A 1 30 ? -5.239  -0.467  1.995   1.00 0.00 ? 30 HIS A N    15 
ATOM   8604  C  CA   . HIS A 1 30 ? -4.417  0.689   2.323   1.00 0.00 ? 30 HIS A CA   15 
ATOM   8605  C  C    . HIS A 1 30 ? -4.473  1.705   1.186   1.00 0.00 ? 30 HIS A C    15 
ATOM   8606  O  O    . HIS A 1 30 ? -4.406  2.913   1.405   1.00 0.00 ? 30 HIS A O    15 
ATOM   8607  C  CB   . HIS A 1 30 ? -2.960  0.259   2.583   1.00 0.00 ? 30 HIS A CB   15 
ATOM   8608  C  CG   . HIS A 1 30 ? -1.941  1.326   2.298   1.00 0.00 ? 30 HIS A CG   15 
ATOM   8609  N  ND1  . HIS A 1 30 ? -1.791  2.458   3.062   1.00 0.00 ? 30 HIS A ND1  15 
ATOM   8610  C  CD2  . HIS A 1 30 ? -1.034  1.430   1.288   1.00 0.00 ? 30 HIS A CD2  15 
ATOM   8611  C  CE1  . HIS A 1 30 ? -0.828  3.203   2.506   1.00 0.00 ? 30 HIS A CE1  15 
ATOM   8612  N  NE2  . HIS A 1 30 ? -0.330  2.626   1.426   1.00 0.00 ? 30 HIS A NE2  15 
ATOM   8613  H  H    . HIS A 1 30 ? -4.807  -1.292  1.682   1.00 0.00 ? 30 HIS A H    15 
ATOM   8614  H  HA   . HIS A 1 30 ? -4.819  1.142   3.217   1.00 0.00 ? 30 HIS A HA   15 
ATOM   8615  H  HB2  . HIS A 1 30 ? -2.856  -0.022  3.621   1.00 0.00 ? 30 HIS A HB2  15 
ATOM   8616  H  HB3  . HIS A 1 30 ? -2.726  -0.594  1.963   1.00 0.00 ? 30 HIS A HB3  15 
ATOM   8617  H  HD1  . HIS A 1 30 ? -2.303  2.688   3.878   1.00 0.00 ? 30 HIS A HD1  15 
ATOM   8618  H  HD2  . HIS A 1 30 ? -0.874  0.707   0.504   1.00 0.00 ? 30 HIS A HD2  15 
ATOM   8619  H  HE1  . HIS A 1 30 ? -0.493  4.153   2.895   1.00 0.00 ? 30 HIS A HE1  15 
ATOM   8620  N  N    . ARG A 1 31 ? -4.496  1.196   -0.034  1.00 0.00 ? 31 ARG A N    15 
ATOM   8621  C  CA   . ARG A 1 31 ? -4.406  2.041   -1.211  1.00 0.00 ? 31 ARG A CA   15 
ATOM   8622  C  C    . ARG A 1 31 ? -5.704  2.795   -1.478  1.00 0.00 ? 31 ARG A C    15 
ATOM   8623  O  O    . ARG A 1 31 ? -5.765  3.622   -2.386  1.00 0.00 ? 31 ARG A O    15 
ATOM   8624  C  CB   . ARG A 1 31 ? -4.040  1.211   -2.431  1.00 0.00 ? 31 ARG A CB   15 
ATOM   8625  C  CG   . ARG A 1 31 ? -2.575  0.814   -2.474  1.00 0.00 ? 31 ARG A CG   15 
ATOM   8626  C  CD   . ARG A 1 31 ? -2.077  0.678   -3.901  1.00 0.00 ? 31 ARG A CD   15 
ATOM   8627  N  NE   . ARG A 1 31 ? -1.939  1.980   -4.547  1.00 0.00 ? 31 ARG A NE   15 
ATOM   8628  C  CZ   . ARG A 1 31 ? -2.843  2.520   -5.370  1.00 0.00 ? 31 ARG A CZ   15 
ATOM   8629  N  NH1  . ARG A 1 31 ? -3.912  1.828   -5.739  1.00 0.00 ? 31 ARG A NH1  15 
ATOM   8630  N  NH2  . ARG A 1 31 ? -2.666  3.753   -5.835  1.00 0.00 ? 31 ARG A NH2  15 
ATOM   8631  H  H    . ARG A 1 31 ? -4.494  0.218   -0.145  1.00 0.00 ? 31 ARG A H    15 
ATOM   8632  H  HA   . ARG A 1 31 ? -3.613  2.757   -1.033  1.00 0.00 ? 31 ARG A HA   15 
ATOM   8633  H  HB2  . ARG A 1 31 ? -4.638  0.311   -2.436  1.00 0.00 ? 31 ARG A HB2  15 
ATOM   8634  H  HB3  . ARG A 1 31 ? -4.262  1.788   -3.316  1.00 0.00 ? 31 ARG A HB3  15 
ATOM   8635  H  HG2  . ARG A 1 31 ? -1.993  1.571   -1.971  1.00 0.00 ? 31 ARG A HG2  15 
ATOM   8636  H  HG3  . ARG A 1 31 ? -2.452  -0.132  -1.966  1.00 0.00 ? 31 ARG A HG3  15 
ATOM   8637  H  HD2  . ARG A 1 31 ? -1.106  0.196   -3.886  1.00 0.00 ? 31 ARG A HD2  15 
ATOM   8638  H  HD3  . ARG A 1 31 ? -2.780  0.074   -4.457  1.00 0.00 ? 31 ARG A HD3  15 
ATOM   8639  H  HE   . ARG A 1 31 ? -1.126  2.497   -4.326  1.00 0.00 ? 31 ARG A HE   15 
ATOM   8640  H  HH11 . ARG A 1 31 ? -4.049  0.889   -5.406  1.00 0.00 ? 31 ARG A HH11 15 
ATOM   8641  H  HH12 . ARG A 1 31 ? -4.597  2.242   -6.355  1.00 0.00 ? 31 ARG A HH12 15 
ATOM   8642  H  HH21 . ARG A 1 31 ? -1.853  4.285   -5.571  1.00 0.00 ? 31 ARG A HH21 15 
ATOM   8643  H  HH22 . ARG A 1 31 ? -3.348  4.167   -6.451  1.00 0.00 ? 31 ARG A HH22 15 
ATOM   8644  N  N    . LYS A 1 32 ? -6.734  2.530   -0.685  1.00 0.00 ? 32 LYS A N    15 
ATOM   8645  C  CA   . LYS A 1 32 ? -8.003  3.229   -0.833  1.00 0.00 ? 32 LYS A CA   15 
ATOM   8646  C  C    . LYS A 1 32 ? -7.811  4.712   -0.544  1.00 0.00 ? 32 LYS A C    15 
ATOM   8647  O  O    . LYS A 1 32 ? -8.410  5.570   -1.194  1.00 0.00 ? 32 LYS A O    15 
ATOM   8648  C  CB   . LYS A 1 32 ? -9.060  2.639   0.103   1.00 0.00 ? 32 LYS A CB   15 
ATOM   8649  C  CG   . LYS A 1 32 ? -10.000 1.657   -0.579  1.00 0.00 ? 32 LYS A CG   15 
ATOM   8650  C  CD   . LYS A 1 32 ? -9.790  0.243   -0.070  1.00 0.00 ? 32 LYS A CD   15 
ATOM   8651  C  CE   . LYS A 1 32 ? -10.349 -0.790  -1.034  1.00 0.00 ? 32 LYS A CE   15 
ATOM   8652  N  NZ   . LYS A 1 32 ? -11.015 -1.910  -0.320  1.00 0.00 ? 32 LYS A NZ   15 
ATOM   8653  H  H    . LYS A 1 32 ? -6.632  1.862   0.026   1.00 0.00 ? 32 LYS A H    15 
ATOM   8654  H  HA   . LYS A 1 32 ? -8.329  3.111   -1.855  1.00 0.00 ? 32 LYS A HA   15 
ATOM   8655  H  HB2  . LYS A 1 32 ? -8.560  2.125   0.912   1.00 0.00 ? 32 LYS A HB2  15 
ATOM   8656  H  HB3  . LYS A 1 32 ? -9.652  3.444   0.512   1.00 0.00 ? 32 LYS A HB3  15 
ATOM   8657  H  HG2  . LYS A 1 32 ? -11.020 1.952   -0.383  1.00 0.00 ? 32 LYS A HG2  15 
ATOM   8658  H  HG3  . LYS A 1 32 ? -9.815  1.677   -1.643  1.00 0.00 ? 32 LYS A HG3  15 
ATOM   8659  H  HD2  . LYS A 1 32 ? -8.729  0.069   0.052   1.00 0.00 ? 32 LYS A HD2  15 
ATOM   8660  H  HD3  . LYS A 1 32 ? -10.286 0.137   0.884   1.00 0.00 ? 32 LYS A HD3  15 
ATOM   8661  H  HE2  . LYS A 1 32 ? -11.066 -0.309  -1.682  1.00 0.00 ? 32 LYS A HE2  15 
ATOM   8662  H  HE3  . LYS A 1 32 ? -9.537  -1.185  -1.629  1.00 0.00 ? 32 LYS A HE3  15 
ATOM   8663  H  HZ1  . LYS A 1 32 ? -10.446 -2.782  -0.402  1.00 0.00 ? 32 LYS A HZ1  15 
ATOM   8664  H  HZ2  . LYS A 1 32 ? -11.959 -2.084  -0.729  1.00 0.00 ? 32 LYS A HZ2  15 
ATOM   8665  H  HZ3  . LYS A 1 32 ? -11.128 -1.674  0.692   1.00 0.00 ? 32 LYS A HZ3  15 
ATOM   8666  N  N    . ARG A 1 33 ? -6.907  5.008   0.381   1.00 0.00 ? 33 ARG A N    15 
ATOM   8667  C  CA   . ARG A 1 33 ? -6.581  6.382   0.727   1.00 0.00 ? 33 ARG A CA   15 
ATOM   8668  C  C    . ARG A 1 33 ? -5.649  7.005   -0.312  1.00 0.00 ? 33 ARG A C    15 
ATOM   8669  O  O    . ARG A 1 33 ? -5.391  8.204   -0.279  1.00 0.00 ? 33 ARG A O    15 
ATOM   8670  C  CB   . ARG A 1 33 ? -5.950  6.442   2.123   1.00 0.00 ? 33 ARG A CB   15 
ATOM   8671  C  CG   . ARG A 1 33 ? -4.475  6.074   2.155   1.00 0.00 ? 33 ARG A CG   15 
ATOM   8672  C  CD   . ARG A 1 33 ? -3.709  6.962   3.118   1.00 0.00 ? 33 ARG A CD   15 
ATOM   8673  N  NE   . ARG A 1 33 ? -3.503  8.302   2.573   1.00 0.00 ? 33 ARG A NE   15 
ATOM   8674  C  CZ   . ARG A 1 33 ? -3.969  9.416   3.132   1.00 0.00 ? 33 ARG A CZ   15 
ATOM   8675  N  NH1  . ARG A 1 33 ? -4.620  9.362   4.288   1.00 0.00 ? 33 ARG A NH1  15 
ATOM   8676  N  NH2  . ARG A 1 33 ? -3.772  10.588  2.540   1.00 0.00 ? 33 ARG A NH2  15 
ATOM   8677  H  H    . ARG A 1 33 ? -6.440  4.276   0.840   1.00 0.00 ? 33 ARG A H    15 
ATOM   8678  H  HA   . ARG A 1 33 ? -7.504  6.941   0.739   1.00 0.00 ? 33 ARG A HA   15 
ATOM   8679  H  HB2  . ARG A 1 33 ? -6.054  7.446   2.509   1.00 0.00 ? 33 ARG A HB2  15 
ATOM   8680  H  HB3  . ARG A 1 33 ? -6.481  5.762   2.773   1.00 0.00 ? 33 ARG A HB3  15 
ATOM   8681  H  HG2  . ARG A 1 33 ? -4.377  5.046   2.471   1.00 0.00 ? 33 ARG A HG2  15 
ATOM   8682  H  HG3  . ARG A 1 33 ? -4.062  6.190   1.164   1.00 0.00 ? 33 ARG A HG3  15 
ATOM   8683  H  HD2  . ARG A 1 33 ? -4.270  7.040   4.038   1.00 0.00 ? 33 ARG A HD2  15 
ATOM   8684  H  HD3  . ARG A 1 33 ? -2.749  6.510   3.317   1.00 0.00 ? 33 ARG A HD3  15 
ATOM   8685  H  HE   . ARG A 1 33 ? -2.994  8.370   1.724   1.00 0.00 ? 33 ARG A HE   15 
ATOM   8686  H  HH11 . ARG A 1 33 ? -4.765  8.480   4.748   1.00 0.00 ? 33 ARG A HH11 15 
ATOM   8687  H  HH12 . ARG A 1 33 ? -4.972  10.205  4.714   1.00 0.00 ? 33 ARG A HH12 15 
ATOM   8688  H  HH21 . ARG A 1 33 ? -3.269  10.641  1.666   1.00 0.00 ? 33 ARG A HH21 15 
ATOM   8689  H  HH22 . ARG A 1 33 ? -4.125  11.433  2.961   1.00 0.00 ? 33 ARG A HH22 15 
ATOM   8690  N  N    . HIS A 1 34 ? -5.220  6.208   -1.289  1.00 0.00 ? 34 HIS A N    15 
ATOM   8691  C  CA   . HIS A 1 34 ? -4.389  6.719   -2.376  1.00 0.00 ? 34 HIS A CA   15 
ATOM   8692  C  C    . HIS A 1 34 ? -5.265  7.233   -3.510  1.00 0.00 ? 34 HIS A C    15 
ATOM   8693  O  O    . HIS A 1 34 ? -4.805  7.420   -4.637  1.00 0.00 ? 34 HIS A O    15 
ATOM   8694  C  CB   . HIS A 1 34 ? -3.438  5.638   -2.891  1.00 0.00 ? 34 HIS A CB   15 
ATOM   8695  C  CG   . HIS A 1 34 ? -2.192  5.495   -2.075  1.00 0.00 ? 34 HIS A CG   15 
ATOM   8696  N  ND1  . HIS A 1 34 ? -1.277  6.503   -1.882  1.00 0.00 ? 34 HIS A ND1  15 
ATOM   8697  C  CD2  . HIS A 1 34 ? -1.726  4.427   -1.380  1.00 0.00 ? 34 HIS A CD2  15 
ATOM   8698  C  CE1  . HIS A 1 34 ? -0.306  6.030   -1.092  1.00 0.00 ? 34 HIS A CE1  15 
ATOM   8699  N  NE2  . HIS A 1 34 ? -0.533  4.774   -0.757  1.00 0.00 ? 34 HIS A NE2  15 
ATOM   8700  H  H    . HIS A 1 34 ? -5.519  5.270   -1.317  1.00 0.00 ? 34 HIS A H    15 
ATOM   8701  H  HA   . HIS A 1 34 ? -3.808  7.543   -1.986  1.00 0.00 ? 34 HIS A HA   15 
ATOM   8702  H  HB2  . HIS A 1 34 ? -3.948  4.688   -2.886  1.00 0.00 ? 34 HIS A HB2  15 
ATOM   8703  H  HB3  . HIS A 1 34 ? -3.147  5.879   -3.903  1.00 0.00 ? 34 HIS A HB3  15 
ATOM   8704  H  HD1  . HIS A 1 34 ? -1.327  7.420   -2.255  1.00 0.00 ? 34 HIS A HD1  15 
ATOM   8705  H  HD2  . HIS A 1 34 ? -2.178  3.447   -1.340  1.00 0.00 ? 34 HIS A HD2  15 
ATOM   8706  H  HE1  . HIS A 1 34 ? 0.552   6.602   -0.771  1.00 0.00 ? 34 HIS A HE1  15 
ATOM   8707  N  N    . MET A 1 35 ? -6.515  7.535   -3.179  1.00 0.00 ? 35 MET A N    15 
ATOM   8708  C  CA   . MET A 1 35 ? -7.443  8.123   -4.133  1.00 0.00 ? 35 MET A CA   15 
ATOM   8709  C  C    . MET A 1 35 ? -7.225  9.629   -4.194  1.00 0.00 ? 35 MET A C    15 
ATOM   8710  O  O    . MET A 1 35 ? -7.779  10.320  -5.047  1.00 0.00 ? 35 MET A O    15 
ATOM   8711  C  CB   . MET A 1 35 ? -8.890  7.819   -3.736  1.00 0.00 ? 35 MET A CB   15 
ATOM   8712  C  CG   . MET A 1 35 ? -9.413  6.507   -4.297  1.00 0.00 ? 35 MET A CG   15 
ATOM   8713  S  SD   . MET A 1 35 ? -11.181 6.554   -4.640  1.00 0.00 ? 35 MET A SD   15 
ATOM   8714  C  CE   . MET A 1 35 ? -11.351 5.140   -5.726  1.00 0.00 ? 35 MET A CE   15 
ATOM   8715  H  H    . MET A 1 35 ? -6.799  7.420   -2.248  1.00 0.00 ? 35 MET A H    15 
ATOM   8716  H  HA   . MET A 1 35 ? -7.241  7.699   -5.105  1.00 0.00 ? 35 MET A HA   15 
ATOM   8717  H  HB2  . MET A 1 35 ? -8.955  7.776   -2.659  1.00 0.00 ? 35 MET A HB2  15 
ATOM   8718  H  HB3  . MET A 1 35 ? -9.525  8.616   -4.094  1.00 0.00 ? 35 MET A HB3  15 
ATOM   8719  H  HG2  . MET A 1 35 ? -8.887  6.288   -5.214  1.00 0.00 ? 35 MET A HG2  15 
ATOM   8720  H  HG3  . MET A 1 35 ? -9.222  5.725   -3.579  1.00 0.00 ? 35 MET A HG3  15 
ATOM   8721  H  HE1  . MET A 1 35 ? -12.368 5.082   -6.087  1.00 0.00 ? 35 MET A HE1  15 
ATOM   8722  H  HE2  . MET A 1 35 ? -10.676 5.245   -6.561  1.00 0.00 ? 35 MET A HE2  15 
ATOM   8723  H  HE3  . MET A 1 35 ? -11.113 4.239   -5.180  1.00 0.00 ? 35 MET A HE3  15 
ATOM   8724  N  N    . LEU A 1 36 ? -6.343  10.105  -3.328  1.00 0.00 ? 36 LEU A N    15 
ATOM   8725  C  CA   . LEU A 1 36 ? -5.949  11.501  -3.299  1.00 0.00 ? 36 LEU A CA   15 
ATOM   8726  C  C    . LEU A 1 36 ? -4.455  11.563  -3.058  1.00 0.00 ? 36 LEU A C    15 
ATOM   8727  O  O    . LEU A 1 36 ? -3.985  12.198  -2.109  1.00 0.00 ? 36 LEU A O    15 
ATOM   8728  C  CB   . LEU A 1 36 ? -6.693  12.265  -2.195  1.00 0.00 ? 36 LEU A CB   15 
ATOM   8729  C  CG   . LEU A 1 36 ? -7.920  11.558  -1.612  1.00 0.00 ? 36 LEU A CG   15 
ATOM   8730  C  CD1  . LEU A 1 36 ? -7.580  10.907  -0.278  1.00 0.00 ? 36 LEU A CD1  15 
ATOM   8731  C  CD2  . LEU A 1 36 ? -9.070  12.541  -1.445  1.00 0.00 ? 36 LEU A CD2  15 
ATOM   8732  H  H    . LEU A 1 36 ? -5.862  9.477   -2.750  1.00 0.00 ? 36 LEU A H    15 
ATOM   8733  H  HA   . LEU A 1 36 ? -6.173  11.938  -4.260  1.00 0.00 ? 36 LEU A HA   15 
ATOM   8734  H  HB2  . LEU A 1 36 ? -5.997  12.451  -1.391  1.00 0.00 ? 36 LEU A HB2  15 
ATOM   8735  H  HB3  . LEU A 1 36 ? -7.012  13.215  -2.597  1.00 0.00 ? 36 LEU A HB3  15 
ATOM   8736  H  HG   . LEU A 1 36 ? -8.236  10.782  -2.293  1.00 0.00 ? 36 LEU A HG   15 
ATOM   8737  H  HD11 . LEU A 1 36 ? -8.375  11.096  0.428   1.00 0.00 ? 36 LEU A HD11 15 
ATOM   8738  H  HD12 . LEU A 1 36 ? -7.467  9.841   -0.415  1.00 0.00 ? 36 LEU A HD12 15 
ATOM   8739  H  HD13 . LEU A 1 36 ? -6.657  11.319  0.099   1.00 0.00 ? 36 LEU A HD13 15 
ATOM   8740  H  HD21 . LEU A 1 36 ? -9.697  12.518  -2.324  1.00 0.00 ? 36 LEU A HD21 15 
ATOM   8741  H  HD22 . LEU A 1 36 ? -9.656  12.267  -0.578  1.00 0.00 ? 36 LEU A HD22 15 
ATOM   8742  H  HD23 . LEU A 1 36 ? -8.674  13.537  -1.311  1.00 0.00 ? 36 LEU A HD23 15 
ATOM   8743  N  N    . VAL A 1 37 ? -3.731  10.828  -3.898  1.00 0.00 ? 37 VAL A N    15 
ATOM   8744  C  CA   . VAL A 1 37 ? -2.284  10.674  -3.792  1.00 0.00 ? 37 VAL A CA   15 
ATOM   8745  C  C    . VAL A 1 37 ? -1.913  9.736   -2.639  1.00 0.00 ? 37 VAL A C    15 
ATOM   8746  O  O    . VAL A 1 37 ? -2.671  9.664   -1.651  1.00 0.00 ? 37 VAL A O    15 
ATOM   8747  C  CB   . VAL A 1 37 ? -1.548  12.030  -3.635  1.00 0.00 ? 37 VAL A CB   15 
ATOM   8748  C  CG1  . VAL A 1 37 ? -0.039  11.836  -3.660  1.00 0.00 ? 37 VAL A CG1  15 
ATOM   8749  C  CG2  . VAL A 1 37 ? -1.975  13.004  -4.726  1.00 0.00 ? 37 VAL A CG2  15 
ATOM   8750  O  OXT  . VAL A 1 37 ? -0.881  9.040   -2.743  1.00 0.00 ? 37 VAL A OXT  15 
ATOM   8751  H  H    . VAL A 1 37 ? -4.202  10.319  -4.593  1.00 0.00 ? 37 VAL A H    15 
ATOM   8752  H  HA   . VAL A 1 37 ? -1.953  10.219  -4.711  1.00 0.00 ? 37 VAL A HA   15 
ATOM   8753  H  HB   . VAL A 1 37 ? -1.815  12.455  -2.678  1.00 0.00 ? 37 VAL A HB   15 
ATOM   8754  H  HG11 . VAL A 1 37 ? 0.421   12.663  -4.180  1.00 0.00 ? 37 VAL A HG11 15 
ATOM   8755  H  HG12 . VAL A 1 37 ? 0.336   11.794  -2.648  1.00 0.00 ? 37 VAL A HG12 15 
ATOM   8756  H  HG13 . VAL A 1 37 ? 0.196   10.913  -4.170  1.00 0.00 ? 37 VAL A HG13 15 
ATOM   8757  H  HG21 . VAL A 1 37 ? -3.054  13.050  -4.766  1.00 0.00 ? 37 VAL A HG21 15 
ATOM   8758  H  HG22 . VAL A 1 37 ? -1.581  13.986  -4.507  1.00 0.00 ? 37 VAL A HG22 15 
ATOM   8759  H  HG23 . VAL A 1 37 ? -1.594  12.668  -5.679  1.00 0.00 ? 37 VAL A HG23 15 
HETATM 8760  ZN ZN   . ZN  B 2 .  ? 0.774   3.582   0.074   1.00 0.00 ? 38 ZN  A ZN   15 
ATOM   8761  N  N    . GLY A 1 1  ? 14.017  3.375   -0.496  1.00 0.00 ? 1  GLY A N    16 
ATOM   8762  C  CA   . GLY A 1 1  ? 13.035  4.484   -0.546  1.00 0.00 ? 1  GLY A CA   16 
ATOM   8763  C  C    . GLY A 1 1  ? 11.691  4.014   -1.048  1.00 0.00 ? 1  GLY A C    16 
ATOM   8764  O  O    . GLY A 1 1  ? 11.502  2.821   -1.274  1.00 0.00 ? 1  GLY A O    16 
ATOM   8765  H  H1   . GLY A 1 1  ? 14.750  3.575   0.216   1.00 0.00 ? 1  GLY A H1   16 
ATOM   8766  H  H2   . GLY A 1 1  ? 14.474  3.258   -1.428  1.00 0.00 ? 1  GLY A H2   16 
ATOM   8767  H  H3   . GLY A 1 1  ? 13.533  2.485   -0.243  1.00 0.00 ? 1  GLY A H3   16 
ATOM   8768  H  HA2  . GLY A 1 1  ? 12.915  4.894   0.446   1.00 0.00 ? 1  GLY A HA2  16 
ATOM   8769  H  HA3  . GLY A 1 1  ? 13.407  5.255   -1.205  1.00 0.00 ? 1  GLY A HA3  16 
ATOM   8770  N  N    . SER A 1 2  ? 10.760  4.942   -1.233  1.00 0.00 ? 2  SER A N    16 
ATOM   8771  C  CA   . SER A 1 2  ? 9.437   4.606   -1.732  1.00 0.00 ? 2  SER A CA   16 
ATOM   8772  C  C    . SER A 1 2  ? 9.527   3.986   -3.126  1.00 0.00 ? 2  SER A C    16 
ATOM   8773  O  O    . SER A 1 2  ? 10.198  4.525   -4.010  1.00 0.00 ? 2  SER A O    16 
ATOM   8774  C  CB   . SER A 1 2  ? 8.561   5.859   -1.751  1.00 0.00 ? 2  SER A CB   16 
ATOM   8775  O  OG   . SER A 1 2  ? 9.031   6.812   -0.809  1.00 0.00 ? 2  SER A OG   16 
ATOM   8776  H  H    . SER A 1 2  ? 10.975  5.883   -1.042  1.00 0.00 ? 2  SER A H    16 
ATOM   8777  H  HA   . SER A 1 2  ? 9.002   3.883   -1.057  1.00 0.00 ? 2  SER A HA   16 
ATOM   8778  H  HB2  . SER A 1 2  ? 8.583   6.300   -2.737  1.00 0.00 ? 2  SER A HB2  16 
ATOM   8779  H  HB3  . SER A 1 2  ? 7.546   5.590   -1.499  1.00 0.00 ? 2  SER A HB3  16 
ATOM   8780  H  HG   . SER A 1 2  ? 8.954   6.441   0.082   1.00 0.00 ? 2  SER A HG   16 
ATOM   8781  N  N    . THR A 1 3  ? 8.957   2.788   -3.263  1.00 0.00 ? 3  THR A N    16 
ATOM   8782  C  CA   . THR A 1 3  ? 9.056   2.007   -4.493  1.00 0.00 ? 3  THR A CA   16 
ATOM   8783  C  C    . THR A 1 3  ? 10.519  1.698   -4.814  1.00 0.00 ? 3  THR A C    16 
ATOM   8784  O  O    . THR A 1 3  ? 11.074  2.195   -5.797  1.00 0.00 ? 3  THR A O    16 
ATOM   8785  C  CB   . THR A 1 3  ? 8.397   2.722   -5.693  1.00 0.00 ? 3  THR A CB   16 
ATOM   8786  O  OG1  . THR A 1 3  ? 7.454   3.715   -5.239  1.00 0.00 ? 3  THR A OG1  16 
ATOM   8787  C  CG2  . THR A 1 3  ? 7.687   1.714   -6.586  1.00 0.00 ? 3  THR A CG2  16 
ATOM   8788  H  H    . THR A 1 3  ? 8.536   2.376   -2.483  1.00 0.00 ? 3  THR A H    16 
ATOM   8789  H  HA   . THR A 1 3  ? 8.535   1.074   -4.329  1.00 0.00 ? 3  THR A HA   16 
ATOM   8790  H  HB   . THR A 1 3  ? 9.169   3.209   -6.272  1.00 0.00 ? 3  THR A HB   16 
ATOM   8791  H  HG1  . THR A 1 3  ? 6.581   3.311   -5.139  1.00 0.00 ? 3  THR A HG1  16 
ATOM   8792  H  HG21 . THR A 1 3  ? 6.650   1.996   -6.692  1.00 0.00 ? 3  THR A HG21 16 
ATOM   8793  H  HG22 . THR A 1 3  ? 7.749   0.731   -6.142  1.00 0.00 ? 3  THR A HG22 16 
ATOM   8794  H  HG23 . THR A 1 3  ? 8.157   1.700   -7.559  1.00 0.00 ? 3  THR A HG23 16 
ATOM   8795  N  N    . ARG A 1 4  ? 11.157  0.940   -3.926  1.00 0.00 ? 4  ARG A N    16 
ATOM   8796  C  CA   . ARG A 1 4  ? 12.583  0.647   -4.047  1.00 0.00 ? 4  ARG A CA   16 
ATOM   8797  C  C    . ARG A 1 4  ? 12.867  -0.291  -5.219  1.00 0.00 ? 4  ARG A C    16 
ATOM   8798  O  O    . ARG A 1 4  ? 13.981  -0.326  -5.740  1.00 0.00 ? 4  ARG A O    16 
ATOM   8799  C  CB   . ARG A 1 4  ? 13.118  0.040   -2.746  1.00 0.00 ? 4  ARG A CB   16 
ATOM   8800  C  CG   . ARG A 1 4  ? 12.524  -1.318  -2.403  1.00 0.00 ? 4  ARG A CG   16 
ATOM   8801  C  CD   . ARG A 1 4  ? 13.579  -2.274  -1.870  1.00 0.00 ? 4  ARG A CD   16 
ATOM   8802  N  NE   . ARG A 1 4  ? 14.167  -1.800  -0.621  1.00 0.00 ? 4  ARG A NE   16 
ATOM   8803  C  CZ   . ARG A 1 4  ? 15.451  -1.488  -0.471  1.00 0.00 ? 4  ARG A CZ   16 
ATOM   8804  N  NH1  . ARG A 1 4  ? 16.302  -1.646  -1.479  1.00 0.00 ? 4  ARG A NH1  16 
ATOM   8805  N  NH2  . ARG A 1 4  ? 15.888  -1.023  0.692   1.00 0.00 ? 4  ARG A NH2  16 
ATOM   8806  H  H    . ARG A 1 4  ? 10.668  0.627   -3.123  1.00 0.00 ? 4  ARG A H    16 
ATOM   8807  H  HA   . ARG A 1 4  ? 13.092  1.582   -4.228  1.00 0.00 ? 4  ARG A HA   16 
ATOM   8808  H  HB2  . ARG A 1 4  ? 14.188  -0.073  -2.833  1.00 0.00 ? 4  ARG A HB2  16 
ATOM   8809  H  HB3  . ARG A 1 4  ? 12.903  0.717   -1.933  1.00 0.00 ? 4  ARG A HB3  16 
ATOM   8810  H  HG2  . ARG A 1 4  ? 11.762  -1.188  -1.650  1.00 0.00 ? 4  ARG A HG2  16 
ATOM   8811  H  HG3  . ARG A 1 4  ? 12.084  -1.742  -3.294  1.00 0.00 ? 4  ARG A HG3  16 
ATOM   8812  H  HD2  . ARG A 1 4  ? 13.118  -3.235  -1.698  1.00 0.00 ? 4  ARG A HD2  16 
ATOM   8813  H  HD3  . ARG A 1 4  ? 14.360  -2.379  -2.609  1.00 0.00 ? 4  ARG A HD3  16 
ATOM   8814  H  HE   . ARG A 1 4  ? 13.560  -1.702  0.152   1.00 0.00 ? 4  ARG A HE   16 
ATOM   8815  H  HH11 . ARG A 1 4  ? 15.980  -2.007  -2.367  1.00 0.00 ? 4  ARG A HH11 16 
ATOM   8816  H  HH12 . ARG A 1 4  ? 17.278  -1.409  -1.366  1.00 0.00 ? 4  ARG A HH12 16 
ATOM   8817  H  HH21 . ARG A 1 4  ? 15.244  -0.902  1.459   1.00 0.00 ? 4  ARG A HH21 16 
ATOM   8818  H  HH22 . ARG A 1 4  ? 16.863  -0.803  0.821   1.00 0.00 ? 4  ARG A HH22 16 
ATOM   8819  N  N    . GLY A 1 5  ? 11.856  -1.039  -5.632  1.00 0.00 ? 5  GLY A N    16 
ATOM   8820  C  CA   . GLY A 1 5  ? 12.023  -1.962  -6.737  1.00 0.00 ? 5  GLY A CA   16 
ATOM   8821  C  C    . GLY A 1 5  ? 10.825  -2.867  -6.911  1.00 0.00 ? 5  GLY A C    16 
ATOM   8822  O  O    . GLY A 1 5  ? 10.879  -4.044  -6.547  1.00 0.00 ? 5  GLY A O    16 
ATOM   8823  H  H    . GLY A 1 5  ? 10.990  -0.967  -5.180  1.00 0.00 ? 5  GLY A H    16 
ATOM   8824  H  HA2  . GLY A 1 5  ? 12.169  -1.397  -7.646  1.00 0.00 ? 5  GLY A HA2  16 
ATOM   8825  H  HA3  . GLY A 1 5  ? 12.898  -2.569  -6.557  1.00 0.00 ? 5  GLY A HA3  16 
ATOM   8826  N  N    . SER A 1 6  ? 9.771   -2.321  -7.522  1.00 0.00 ? 6  SER A N    16 
ATOM   8827  C  CA   . SER A 1 6  ? 8.541   -3.033  -7.799  1.00 0.00 ? 6  SER A CA   16 
ATOM   8828  C  C    . SER A 1 6  ? 7.876   -3.536  -6.530  1.00 0.00 ? 6  SER A C    16 
ATOM   8829  O  O    . SER A 1 6  ? 6.965   -2.903  -6.000  1.00 0.00 ? 6  SER A O    16 
ATOM   8830  C  CB   . SER A 1 6  ? 8.786   -4.160  -8.800  1.00 0.00 ? 6  SER A CB   16 
ATOM   8831  O  OG   . SER A 1 6  ? 9.936   -3.907  -9.589  1.00 0.00 ? 6  SER A OG   16 
ATOM   8832  H  H    . SER A 1 6  ? 9.843   -1.408  -7.848  1.00 0.00 ? 6  SER A H    16 
ATOM   8833  H  HA   . SER A 1 6  ? 7.872   -2.336  -8.246  1.00 0.00 ? 6  SER A HA   16 
ATOM   8834  H  HB2  . SER A 1 6  ? 8.916   -5.093  -8.278  1.00 0.00 ? 6  SER A HB2  16 
ATOM   8835  H  HB3  . SER A 1 6  ? 7.937   -4.227  -9.451  1.00 0.00 ? 6  SER A HB3  16 
ATOM   8836  H  HG   . SER A 1 6  ? 9.663   -3.762  -10.508 1.00 0.00 ? 6  SER A HG   16 
ATOM   8837  N  N    . THR A 1 7  ? 8.369   -4.636  -6.026  1.00 0.00 ? 7  THR A N    16 
ATOM   8838  C  CA   . THR A 1 7  ? 7.882   -5.201  -4.785  1.00 0.00 ? 7  THR A CA   16 
ATOM   8839  C  C    . THR A 1 7  ? 9.041   -5.652  -3.905  1.00 0.00 ? 7  THR A C    16 
ATOM   8840  O  O    . THR A 1 7  ? 9.600   -6.732  -4.101  1.00 0.00 ? 7  THR A O    16 
ATOM   8841  C  CB   . THR A 1 7  ? 6.926   -6.376  -5.054  1.00 0.00 ? 7  THR A CB   16 
ATOM   8842  O  OG1  . THR A 1 7  ? 7.328   -7.078  -6.239  1.00 0.00 ? 7  THR A OG1  16 
ATOM   8843  C  CG2  . THR A 1 7  ? 5.507   -5.864  -5.230  1.00 0.00 ? 7  THR A CG2  16 
ATOM   8844  H  H    . THR A 1 7  ? 9.141   -5.034  -6.464  1.00 0.00 ? 7  THR A H    16 
ATOM   8845  H  HA   . THR A 1 7  ? 7.334   -4.429  -4.264  1.00 0.00 ? 7  THR A HA   16 
ATOM   8846  H  HB   . THR A 1 7  ? 6.951   -7.050  -4.211  1.00 0.00 ? 7  THR A HB   16 
ATOM   8847  H  HG1  . THR A 1 7  ? 7.237   -6.497  -7.001  1.00 0.00 ? 7  THR A HG1  16 
ATOM   8848  H  HG21 . THR A 1 7  ? 4.919   -6.604  -5.750  1.00 0.00 ? 7  THR A HG21 16 
ATOM   8849  H  HG22 . THR A 1 7  ? 5.531   -4.948  -5.809  1.00 0.00 ? 7  THR A HG22 16 
ATOM   8850  H  HG23 . THR A 1 7  ? 5.070   -5.666  -4.261  1.00 0.00 ? 7  THR A HG23 16 
ATOM   8851  N  N    . GLY A 1 8  ? 9.441   -4.782  -2.985  1.00 0.00 ? 8  GLY A N    16 
ATOM   8852  C  CA   . GLY A 1 8  ? 10.541  -5.084  -2.089  1.00 0.00 ? 8  GLY A CA   16 
ATOM   8853  C  C    . GLY A 1 8  ? 10.209  -6.232  -1.157  1.00 0.00 ? 8  GLY A C    16 
ATOM   8854  O  O    . GLY A 1 8  ? 10.311  -7.399  -1.542  1.00 0.00 ? 8  GLY A O    16 
ATOM   8855  H  H    . GLY A 1 8  ? 8.994   -3.905  -2.929  1.00 0.00 ? 8  GLY A H    16 
ATOM   8856  H  HA2  . GLY A 1 8  ? 11.408  -5.349  -2.675  1.00 0.00 ? 8  GLY A HA2  16 
ATOM   8857  H  HA3  . GLY A 1 8  ? 10.768  -4.208  -1.500  1.00 0.00 ? 8  GLY A HA3  16 
ATOM   8858  N  N    . ILE A 1 9  ? 9.726   -5.916  0.036   1.00 0.00 ? 9  ILE A N    16 
ATOM   8859  C  CA   . ILE A 1 9  ? 9.257   -6.956  0.937   1.00 0.00 ? 9  ILE A CA   16 
ATOM   8860  C  C    . ILE A 1 9  ? 7.864   -7.411  0.508   1.00 0.00 ? 9  ILE A C    16 
ATOM   8861  O  O    . ILE A 1 9  ? 7.108   -6.603  -0.036  1.00 0.00 ? 9  ILE A O    16 
ATOM   8862  C  CB   . ILE A 1 9  ? 9.203   -6.446  2.394   1.00 0.00 ? 9  ILE A CB   16 
ATOM   8863  C  CG1  . ILE A 1 9  ? 10.394  -5.531  2.691   1.00 0.00 ? 9  ILE A CG1  16 
ATOM   8864  C  CG2  . ILE A 1 9  ? 9.175   -7.610  3.372   1.00 0.00 ? 9  ILE A CG2  16 
ATOM   8865  C  CD1  . ILE A 1 9  ? 10.274  -4.783  4.002   1.00 0.00 ? 9  ILE A CD1  16 
ATOM   8866  H  H    . ILE A 1 9  ? 9.564   -4.975  0.258   1.00 0.00 ? 9  ILE A H    16 
ATOM   8867  H  HA   . ILE A 1 9  ? 9.938   -7.792  0.885   1.00 0.00 ? 9  ILE A HA   16 
ATOM   8868  H  HB   . ILE A 1 9  ? 8.292   -5.884  2.516   1.00 0.00 ? 9  ILE A HB   16 
ATOM   8869  H  HG12 . ILE A 1 9  ? 11.294  -6.127  2.733   1.00 0.00 ? 9  ILE A HG12 16 
ATOM   8870  H  HG13 . ILE A 1 9  ? 10.489  -4.801  1.899   1.00 0.00 ? 9  ILE A HG13 16 
ATOM   8871  H  HG21 . ILE A 1 9  ? 10.056  -7.578  3.998   1.00 0.00 ? 9  ILE A HG21 16 
ATOM   8872  H  HG22 . ILE A 1 9  ? 8.294   -7.538  3.989   1.00 0.00 ? 9  ILE A HG22 16 
ATOM   8873  H  HG23 . ILE A 1 9  ? 9.156   -8.542  2.822   1.00 0.00 ? 9  ILE A HG23 16 
ATOM   8874  H  HD11 . ILE A 1 9  ? 11.188  -4.237  4.191   1.00 0.00 ? 9  ILE A HD11 16 
ATOM   8875  H  HD12 . ILE A 1 9  ? 9.446   -4.091  3.945   1.00 0.00 ? 9  ILE A HD12 16 
ATOM   8876  H  HD13 . ILE A 1 9  ? 10.100  -5.486  4.804   1.00 0.00 ? 9  ILE A HD13 16 
ATOM   8877  N  N    . LYS A 1 10 ? 7.478   -8.626  0.917   1.00 0.00 ? 10 LYS A N    16 
ATOM   8878  C  CA   . LYS A 1 10 ? 6.130   -9.167  0.679   1.00 0.00 ? 10 LYS A CA   16 
ATOM   8879  C  C    . LYS A 1 10 ? 5.751   -9.192  -0.815  1.00 0.00 ? 10 LYS A C    16 
ATOM   8880  O  O    . LYS A 1 10 ? 6.245   -8.406  -1.620  1.00 0.00 ? 10 LYS A O    16 
ATOM   8881  C  CB   . LYS A 1 10 ? 5.087   -8.394  1.492   1.00 0.00 ? 10 LYS A CB   16 
ATOM   8882  C  CG   . LYS A 1 10 ? 4.616   -9.148  2.729   1.00 0.00 ? 10 LYS A CG   16 
ATOM   8883  C  CD   . LYS A 1 10 ? 4.619   -8.262  3.965   1.00 0.00 ? 10 LYS A CD   16 
ATOM   8884  C  CE   . LYS A 1 10 ? 4.979   -9.044  5.215   1.00 0.00 ? 10 LYS A CE   16 
ATOM   8885  N  NZ   . LYS A 1 10 ? 3.979   -8.847  6.297   1.00 0.00 ? 10 LYS A NZ   16 
ATOM   8886  H  H    . LYS A 1 10 ? 8.109   -9.163  1.450   1.00 0.00 ? 10 LYS A H    16 
ATOM   8887  H  HA   . LYS A 1 10 ? 6.140   -10.188 1.031   1.00 0.00 ? 10 LYS A HA   16 
ATOM   8888  H  HB2  . LYS A 1 10 ? 5.513   -7.452  1.806   1.00 0.00 ? 10 LYS A HB2  16 
ATOM   8889  H  HB3  . LYS A 1 10 ? 4.227   -8.203  0.865   1.00 0.00 ? 10 LYS A HB3  16 
ATOM   8890  H  HG2  . LYS A 1 10 ? 3.610   -9.504  2.560   1.00 0.00 ? 10 LYS A HG2  16 
ATOM   8891  H  HG3  . LYS A 1 10 ? 5.273   -9.988  2.899   1.00 0.00 ? 10 LYS A HG3  16 
ATOM   8892  H  HD2  . LYS A 1 10 ? 5.337   -7.470  3.828   1.00 0.00 ? 10 LYS A HD2  16 
ATOM   8893  H  HD3  . LYS A 1 10 ? 3.632   -7.839  4.090   1.00 0.00 ? 10 LYS A HD3  16 
ATOM   8894  H  HE2  . LYS A 1 10 ? 5.026   -10.094 4.965   1.00 0.00 ? 10 LYS A HE2  16 
ATOM   8895  H  HE3  . LYS A 1 10 ? 5.945   -8.714  5.564   1.00 0.00 ? 10 LYS A HE3  16 
ATOM   8896  H  HZ1  . LYS A 1 10 ? 3.024   -8.726  5.888   1.00 0.00 ? 10 LYS A HZ1  16 
ATOM   8897  H  HZ2  . LYS A 1 10 ? 4.214   -7.996  6.854   1.00 0.00 ? 10 LYS A HZ2  16 
ATOM   8898  H  HZ3  . LYS A 1 10 ? 3.970   -9.672  6.933   1.00 0.00 ? 10 LYS A HZ3  16 
ATOM   8899  N  N    . PRO A 1 11 ? 4.941   -10.173 -1.230  1.00 0.00 ? 11 PRO A N    16 
ATOM   8900  C  CA   . PRO A 1 11 ? 4.544   -10.328 -2.638  1.00 0.00 ? 11 PRO A CA   16 
ATOM   8901  C  C    . PRO A 1 11 ? 3.731   -9.136  -3.151  1.00 0.00 ? 11 PRO A C    16 
ATOM   8902  O  O    . PRO A 1 11 ? 3.653   -8.890  -4.357  1.00 0.00 ? 11 PRO A O    16 
ATOM   8903  C  CB   . PRO A 1 11 ? 3.688   -11.598 -2.638  1.00 0.00 ? 11 PRO A CB   16 
ATOM   8904  C  CG   . PRO A 1 11 ? 3.258   -11.773 -1.223  1.00 0.00 ? 11 PRO A CG   16 
ATOM   8905  C  CD   . PRO A 1 11 ? 4.382   -11.239 -0.384  1.00 0.00 ? 11 PRO A CD   16 
ATOM   8906  H  HA   . PRO A 1 11 ? 5.405   -10.472 -3.274  1.00 0.00 ? 11 PRO A HA   16 
ATOM   8907  H  HB2  . PRO A 1 11 ? 2.841   -11.462 -3.293  1.00 0.00 ? 11 PRO A HB2  16 
ATOM   8908  H  HB3  . PRO A 1 11 ? 4.280   -12.435 -2.975  1.00 0.00 ? 11 PRO A HB3  16 
ATOM   8909  H  HG2  . PRO A 1 11 ? 2.357   -11.209 -1.043  1.00 0.00 ? 11 PRO A HG2  16 
ATOM   8910  H  HG3  . PRO A 1 11 ? 3.097   -12.820 -1.013  1.00 0.00 ? 11 PRO A HG3  16 
ATOM   8911  H  HD2  . PRO A 1 11 ? 4.001   -10.836 0.545   1.00 0.00 ? 11 PRO A HD2  16 
ATOM   8912  H  HD3  . PRO A 1 11 ? 5.115   -12.010 -0.195  1.00 0.00 ? 11 PRO A HD3  16 
ATOM   8913  N  N    . PHE A 1 12 ? 3.120   -8.404  -2.226  1.00 0.00 ? 12 PHE A N    16 
ATOM   8914  C  CA   . PHE A 1 12 ? 2.292   -7.262  -2.576  1.00 0.00 ? 12 PHE A CA   16 
ATOM   8915  C  C    . PHE A 1 12 ? 2.640   -6.059  -1.710  1.00 0.00 ? 12 PHE A C    16 
ATOM   8916  O  O    . PHE A 1 12 ? 2.088   -5.881  -0.630  1.00 0.00 ? 12 PHE A O    16 
ATOM   8917  C  CB   . PHE A 1 12 ? 0.816   -7.609  -2.401  1.00 0.00 ? 12 PHE A CB   16 
ATOM   8918  C  CG   . PHE A 1 12 ? 0.381   -8.804  -3.206  1.00 0.00 ? 12 PHE A CG   16 
ATOM   8919  C  CD1  . PHE A 1 12 ? 0.289   -8.727  -4.587  1.00 0.00 ? 12 PHE A CD1  16 
ATOM   8920  C  CD2  . PHE A 1 12 ? 0.079   -10.003 -2.584  1.00 0.00 ? 12 PHE A CD2  16 
ATOM   8921  C  CE1  . PHE A 1 12 ? -0.100  -9.825  -5.331  1.00 0.00 ? 12 PHE A CE1  16 
ATOM   8922  C  CE2  . PHE A 1 12 ? -0.313  -11.104 -3.324  1.00 0.00 ? 12 PHE A CE2  16 
ATOM   8923  C  CZ   . PHE A 1 12 ? -0.403  -11.015 -4.699  1.00 0.00 ? 12 PHE A CZ   16 
ATOM   8924  H  H    . PHE A 1 12 ? 3.220   -8.646  -1.284  1.00 0.00 ? 12 PHE A H    16 
ATOM   8925  H  HA   . PHE A 1 12 ? 2.478   -7.018  -3.610  1.00 0.00 ? 12 PHE A HA   16 
ATOM   8926  H  HB2  . PHE A 1 12 ? 0.629   -7.821  -1.356  1.00 0.00 ? 12 PHE A HB2  16 
ATOM   8927  H  HB3  . PHE A 1 12 ? 0.217   -6.765  -2.706  1.00 0.00 ? 12 PHE A HB3  16 
ATOM   8928  H  HD1  . PHE A 1 12 ? 0.523   -7.799  -5.083  1.00 0.00 ? 12 PHE A HD1  16 
ATOM   8929  H  HD2  . PHE A 1 12 ? 0.147   -10.074 -1.508  1.00 0.00 ? 12 PHE A HD2  16 
ATOM   8930  H  HE1  . PHE A 1 12 ? -0.169  -9.753  -6.406  1.00 0.00 ? 12 PHE A HE1  16 
ATOM   8931  H  HE2  . PHE A 1 12 ? -0.550  -12.033 -2.825  1.00 0.00 ? 12 PHE A HE2  16 
ATOM   8932  H  HZ   . PHE A 1 12 ? -0.707  -11.873 -5.279  1.00 0.00 ? 12 PHE A HZ   16 
ATOM   8933  N  N    . GLN A 1 13 ? 3.549   -5.234  -2.186  1.00 0.00 ? 13 GLN A N    16 
ATOM   8934  C  CA   . GLN A 1 13 ? 3.942   -4.042  -1.454  1.00 0.00 ? 13 GLN A CA   16 
ATOM   8935  C  C    . GLN A 1 13 ? 3.234   -2.823  -2.037  1.00 0.00 ? 13 GLN A C    16 
ATOM   8936  O  O    . GLN A 1 13 ? 2.839   -2.839  -3.204  1.00 0.00 ? 13 GLN A O    16 
ATOM   8937  C  CB   . GLN A 1 13 ? 5.460   -3.859  -1.523  1.00 0.00 ? 13 GLN A CB   16 
ATOM   8938  C  CG   . GLN A 1 13 ? 5.921   -2.884  -2.594  1.00 0.00 ? 13 GLN A CG   16 
ATOM   8939  C  CD   . GLN A 1 13 ? 7.358   -2.455  -2.408  1.00 0.00 ? 13 GLN A CD   16 
ATOM   8940  O  OE1  . GLN A 1 13 ? 8.118   -2.346  -3.366  1.00 0.00 ? 13 GLN A OE1  16 
ATOM   8941  N  NE2  . GLN A 1 13 ? 7.746   -2.226  -1.171  1.00 0.00 ? 13 GLN A NE2  16 
ATOM   8942  H  H    . GLN A 1 13 ? 3.954   -5.418  -3.054  1.00 0.00 ? 13 GLN A H    16 
ATOM   8943  H  HA   . GLN A 1 13 ? 3.645   -4.165  -0.424  1.00 0.00 ? 13 GLN A HA   16 
ATOM   8944  H  HB2  . GLN A 1 13 ? 5.809   -3.499  -0.566  1.00 0.00 ? 13 GLN A HB2  16 
ATOM   8945  H  HB3  . GLN A 1 13 ? 5.915   -4.818  -1.722  1.00 0.00 ? 13 GLN A HB3  16 
ATOM   8946  H  HG2  . GLN A 1 13 ? 5.815   -3.349  -3.557  1.00 0.00 ? 13 GLN A HG2  16 
ATOM   8947  H  HG3  . GLN A 1 13 ? 5.297   -2.007  -2.548  1.00 0.00 ? 13 GLN A HG3  16 
ATOM   8948  H  HE21 . GLN A 1 13 ? 7.093   -2.352  -0.445  1.00 0.00 ? 13 GLN A HE21 16 
ATOM   8949  H  HE22 . GLN A 1 13 ? 8.664   -1.920  -1.027  1.00 0.00 ? 13 GLN A HE22 16 
ATOM   8950  N  N    . CYS A 1 14 ? 3.151   -1.741  -1.271  1.00 0.00 ? 14 CYS A N    16 
ATOM   8951  C  CA   . CYS A 1 14 ? 2.588   -0.512  -1.803  1.00 0.00 ? 14 CYS A CA   16 
ATOM   8952  C  C    . CYS A 1 14 ? 3.572   0.124   -2.774  1.00 0.00 ? 14 CYS A C    16 
ATOM   8953  O  O    . CYS A 1 14 ? 4.715   0.404   -2.412  1.00 0.00 ? 14 CYS A O    16 
ATOM   8954  C  CB   . CYS A 1 14 ? 2.238   0.506   -0.708  1.00 0.00 ? 14 CYS A CB   16 
ATOM   8955  S  SG   . CYS A 1 14 ? 1.639   2.078   -1.421  1.00 0.00 ? 14 CYS A SG   16 
ATOM   8956  H  H    . CYS A 1 14 ? 3.560   -1.745  -0.389  1.00 0.00 ? 14 CYS A H    16 
ATOM   8957  H  HA   . CYS A 1 14 ? 1.689   -0.773  -2.340  1.00 0.00 ? 14 CYS A HA   16 
ATOM   8958  H  HB2  . CYS A 1 14 ? 1.465   0.100   -0.076  1.00 0.00 ? 14 CYS A HB2  16 
ATOM   8959  H  HB3  . CYS A 1 14 ? 3.117   0.719   -0.118  1.00 0.00 ? 14 CYS A HB3  16 
ATOM   8960  N  N    . PRO A 1 15 ? 3.124   0.408   -4.001  1.00 0.00 ? 15 PRO A N    16 
ATOM   8961  C  CA   . PRO A 1 15 ? 3.956   1.053   -5.010  1.00 0.00 ? 15 PRO A CA   16 
ATOM   8962  C  C    . PRO A 1 15 ? 4.088   2.555   -4.777  1.00 0.00 ? 15 PRO A C    16 
ATOM   8963  O  O    . PRO A 1 15 ? 4.809   3.241   -5.499  1.00 0.00 ? 15 PRO A O    16 
ATOM   8964  C  CB   . PRO A 1 15 ? 3.198   0.782   -6.306  1.00 0.00 ? 15 PRO A CB   16 
ATOM   8965  C  CG   . PRO A 1 15 ? 1.767   0.708   -5.895  1.00 0.00 ? 15 PRO A CG   16 
ATOM   8966  C  CD   . PRO A 1 15 ? 1.754   0.156   -4.492  1.00 0.00 ? 15 PRO A CD   16 
ATOM   8967  H  HA   . PRO A 1 15 ? 4.937   0.605   -5.061  1.00 0.00 ? 15 PRO A HA   16 
ATOM   8968  H  HB2  . PRO A 1 15 ? 3.369   1.592   -6.999  1.00 0.00 ? 15 PRO A HB2  16 
ATOM   8969  H  HB3  . PRO A 1 15 ? 3.535   -0.149  -6.739  1.00 0.00 ? 15 PRO A HB3  16 
ATOM   8970  H  HG2  . PRO A 1 15 ? 1.329   1.696   -5.911  1.00 0.00 ? 15 PRO A HG2  16 
ATOM   8971  H  HG3  . PRO A 1 15 ? 1.230   0.049   -6.561  1.00 0.00 ? 15 PRO A HG3  16 
ATOM   8972  H  HD2  . PRO A 1 15 ? 1.028   0.681   -3.889  1.00 0.00 ? 15 PRO A HD2  16 
ATOM   8973  H  HD3  . PRO A 1 15 ? 1.538   -0.902  -4.506  1.00 0.00 ? 15 PRO A HD3  16 
ATOM   8974  N  N    . ASP A 1 16 ? 3.379   3.061   -3.776  1.00 0.00 ? 16 ASP A N    16 
ATOM   8975  C  CA   . ASP A 1 16 ? 3.400   4.483   -3.470  1.00 0.00 ? 16 ASP A CA   16 
ATOM   8976  C  C    . ASP A 1 16 ? 4.241   4.751   -2.229  1.00 0.00 ? 16 ASP A C    16 
ATOM   8977  O  O    . ASP A 1 16 ? 4.896   5.787   -2.120  1.00 0.00 ? 16 ASP A O    16 
ATOM   8978  C  CB   . ASP A 1 16 ? 1.972   4.995   -3.256  1.00 0.00 ? 16 ASP A CB   16 
ATOM   8979  C  CG   . ASP A 1 16 ? 1.848   6.494   -3.437  1.00 0.00 ? 16 ASP A CG   16 
ATOM   8980  O  OD1  . ASP A 1 16 ? 1.654   6.947   -4.585  1.00 0.00 ? 16 ASP A OD1  16 
ATOM   8981  O  OD2  . ASP A 1 16 ? 1.920   7.230   -2.427  1.00 0.00 ? 16 ASP A OD2  16 
ATOM   8982  H  H    . ASP A 1 16 ? 2.816   2.461   -3.231  1.00 0.00 ? 16 ASP A H    16 
ATOM   8983  H  HA   . ASP A 1 16 ? 3.839   4.999   -4.308  1.00 0.00 ? 16 ASP A HA   16 
ATOM   8984  H  HB2  . ASP A 1 16 ? 1.315   4.515   -3.966  1.00 0.00 ? 16 ASP A HB2  16 
ATOM   8985  H  HB3  . ASP A 1 16 ? 1.655   4.746   -2.254  1.00 0.00 ? 16 ASP A HB3  16 
ATOM   8986  N  N    . CYS A 1 17 ? 4.173   3.837   -1.270  1.00 0.00 ? 17 CYS A N    16 
ATOM   8987  C  CA   . CYS A 1 17 ? 4.857   4.020   0.003   1.00 0.00 ? 17 CYS A CA   16 
ATOM   8988  C  C    . CYS A 1 17 ? 6.125   3.185   0.119   1.00 0.00 ? 17 CYS A C    16 
ATOM   8989  O  O    . CYS A 1 17 ? 6.962   3.468   0.979   1.00 0.00 ? 17 CYS A O    16 
ATOM   8990  C  CB   . CYS A 1 17 ? 3.931   3.662   1.157   1.00 0.00 ? 17 CYS A CB   16 
ATOM   8991  S  SG   . CYS A 1 17 ? 2.426   4.673   1.237   1.00 0.00 ? 17 CYS A SG   16 
ATOM   8992  H  H    . CYS A 1 17 ? 3.592   3.053   -1.397  1.00 0.00 ? 17 CYS A H    16 
ATOM   8993  H  HA   . CYS A 1 17 ? 5.120   5.060   0.080   1.00 0.00 ? 17 CYS A HA   16 
ATOM   8994  H  HB2  . CYS A 1 17 ? 3.630   2.628   1.059   1.00 0.00 ? 17 CYS A HB2  16 
ATOM   8995  H  HB3  . CYS A 1 17 ? 4.463   3.791   2.088   1.00 0.00 ? 17 CYS A HB3  16 
ATOM   8996  N  N    . ASP A 1 18 ? 6.097   2.018   -0.524  1.00 0.00 ? 18 ASP A N    16 
ATOM   8997  C  CA   . ASP A 1 18 ? 7.093   0.966   -0.298  1.00 0.00 ? 18 ASP A CA   16 
ATOM   8998  C  C    . ASP A 1 18 ? 6.725   0.191   0.960   1.00 0.00 ? 18 ASP A C    16 
ATOM   8999  O  O    . ASP A 1 18 ? 7.586   -0.260  1.713   1.00 0.00 ? 18 ASP A O    16 
ATOM   9000  C  CB   . ASP A 1 18 ? 8.525   1.512   -0.192  1.00 0.00 ? 18 ASP A CB   16 
ATOM   9001  C  CG   . ASP A 1 18 ? 9.574   0.470   -0.531  1.00 0.00 ? 18 ASP A CG   16 
ATOM   9002  O  OD1  . ASP A 1 18 ? 9.706   0.118   -1.718  1.00 0.00 ? 18 ASP A OD1  16 
ATOM   9003  O  OD2  . ASP A 1 18 ? 10.276  0.005   0.399   1.00 0.00 ? 18 ASP A OD2  16 
ATOM   9004  H  H    . ASP A 1 18 ? 5.295   1.791   -1.043  1.00 0.00 ? 18 ASP A H    16 
ATOM   9005  H  HA   . ASP A 1 18 ? 7.040   0.288   -1.139  1.00 0.00 ? 18 ASP A HA   16 
ATOM   9006  H  HB2  . ASP A 1 18 ? 8.636   2.341   -0.874  1.00 0.00 ? 18 ASP A HB2  16 
ATOM   9007  H  HB3  . ASP A 1 18 ? 8.697   1.857   0.817   1.00 0.00 ? 18 ASP A HB3  16 
ATOM   9008  N  N    . ARG A 1 19 ? 5.423   -0.003  1.145   1.00 0.00 ? 19 ARG A N    16 
ATOM   9009  C  CA   . ARG A 1 19 ? 4.905   -0.799  2.251   1.00 0.00 ? 19 ARG A CA   16 
ATOM   9010  C  C    . ARG A 1 19 ? 5.034   -2.279  1.914   1.00 0.00 ? 19 ARG A C    16 
ATOM   9011  O  O    . ARG A 1 19 ? 5.820   -2.640  1.044   1.00 0.00 ? 19 ARG A O    16 
ATOM   9012  C  CB   . ARG A 1 19 ? 3.446   -0.436  2.526   1.00 0.00 ? 19 ARG A CB   16 
ATOM   9013  C  CG   . ARG A 1 19 ? 3.273   0.492   3.712   1.00 0.00 ? 19 ARG A CG   16 
ATOM   9014  C  CD   . ARG A 1 19 ? 2.198   1.540   3.459   1.00 0.00 ? 19 ARG A CD   16 
ATOM   9015  N  NE   . ARG A 1 19 ? 0.885   1.121   3.956   1.00 0.00 ? 19 ARG A NE   16 
ATOM   9016  C  CZ   . ARG A 1 19 ? 0.548   1.100   5.250   1.00 0.00 ? 19 ARG A CZ   16 
ATOM   9017  N  NH1  . ARG A 1 19 ? 1.389   1.565   6.169   1.00 0.00 ? 19 ARG A NH1  16 
ATOM   9018  N  NH2  . ARG A 1 19 ? -0.636  0.632   5.628   1.00 0.00 ? 19 ARG A NH2  16 
ATOM   9019  H  H    . ARG A 1 19 ? 4.797   0.353   0.486   1.00 0.00 ? 19 ARG A H    16 
ATOM   9020  H  HA   . ARG A 1 19 ? 5.495   -0.582  3.127   1.00 0.00 ? 19 ARG A HA   16 
ATOM   9021  H  HB2  . ARG A 1 19 ? 3.036   0.049   1.652   1.00 0.00 ? 19 ARG A HB2  16 
ATOM   9022  H  HB3  . ARG A 1 19 ? 2.890   -1.342  2.719   1.00 0.00 ? 19 ARG A HB3  16 
ATOM   9023  H  HG2  . ARG A 1 19 ? 2.996   -0.092  4.574   1.00 0.00 ? 19 ARG A HG2  16 
ATOM   9024  H  HG3  . ARG A 1 19 ? 4.211   0.993   3.900   1.00 0.00 ? 19 ARG A HG3  16 
ATOM   9025  H  HD2  . ARG A 1 19 ? 2.484   2.456   3.955   1.00 0.00 ? 19 ARG A HD2  16 
ATOM   9026  H  HD3  . ARG A 1 19 ? 2.129   1.715   2.397   1.00 0.00 ? 19 ARG A HD3  16 
ATOM   9027  H  HE   . ARG A 1 19 ? 0.218   0.836   3.281   1.00 0.00 ? 19 ARG A HE   16 
ATOM   9028  H  HH11 . ARG A 1 19 ? 2.284   1.936   5.896   1.00 0.00 ? 19 ARG A HH11 16 
ATOM   9029  H  HH12 . ARG A 1 19 ? 1.126   1.569   7.142   1.00 0.00 ? 19 ARG A HH12 16 
ATOM   9030  H  HH21 . ARG A 1 19 ? -1.290  0.291   4.949   1.00 0.00 ? 19 ARG A HH21 16 
ATOM   9031  H  HH22 . ARG A 1 19 ? -0.886  0.613   6.604   1.00 0.00 ? 19 ARG A HH22 16 
ATOM   9032  N  N    . SER A 1 20 ? 4.268   -3.140  2.575   1.00 0.00 ? 20 SER A N    16 
ATOM   9033  C  CA   . SER A 1 20 ? 4.329   -4.568  2.281   1.00 0.00 ? 20 SER A CA   16 
ATOM   9034  C  C    . SER A 1 20 ? 3.142   -5.321  2.880   1.00 0.00 ? 20 SER A C    16 
ATOM   9035  O  O    . SER A 1 20 ? 2.873   -5.228  4.078   1.00 0.00 ? 20 SER A O    16 
ATOM   9036  C  CB   . SER A 1 20 ? 5.643   -5.164  2.793   1.00 0.00 ? 20 SER A CB   16 
ATOM   9037  O  OG   . SER A 1 20 ? 6.219   -4.357  3.813   1.00 0.00 ? 20 SER A OG   16 
ATOM   9038  H  H    . SER A 1 20 ? 3.656   -2.817  3.275   1.00 0.00 ? 20 SER A H    16 
ATOM   9039  H  HA   . SER A 1 20 ? 4.293   -4.678  1.207   1.00 0.00 ? 20 SER A HA   16 
ATOM   9040  H  HB2  . SER A 1 20 ? 5.449   -6.148  3.190   1.00 0.00 ? 20 SER A HB2  16 
ATOM   9041  H  HB3  . SER A 1 20 ? 6.342   -5.240  1.973   1.00 0.00 ? 20 SER A HB3  16 
ATOM   9042  H  HG   . SER A 1 20 ? 6.811   -3.699  3.411   1.00 0.00 ? 20 SER A HG   16 
ATOM   9043  N  N    . PHE A 1 21 ? 2.436   -6.065  2.035   1.00 0.00 ? 21 PHE A N    16 
ATOM   9044  C  CA   . PHE A 1 21 ? 1.284   -6.847  2.460   1.00 0.00 ? 21 PHE A CA   16 
ATOM   9045  C  C    . PHE A 1 21 ? 1.354   -8.244  1.859   1.00 0.00 ? 21 PHE A C    16 
ATOM   9046  O  O    . PHE A 1 21 ? 1.902   -8.434  0.771   1.00 0.00 ? 21 PHE A O    16 
ATOM   9047  C  CB   . PHE A 1 21 ? -0.023  -6.167  2.028   1.00 0.00 ? 21 PHE A CB   16 
ATOM   9048  C  CG   . PHE A 1 21 ? -0.065  -4.694  2.325   1.00 0.00 ? 21 PHE A CG   16 
ATOM   9049  C  CD1  . PHE A 1 21 ? 0.532   -3.782  1.469   1.00 0.00 ? 21 PHE A CD1  16 
ATOM   9050  C  CD2  . PHE A 1 21 ? -0.690  -4.224  3.468   1.00 0.00 ? 21 PHE A CD2  16 
ATOM   9051  C  CE1  . PHE A 1 21 ? 0.509   -2.432  1.751   1.00 0.00 ? 21 PHE A CE1  16 
ATOM   9052  C  CE2  . PHE A 1 21 ? -0.718  -2.875  3.750   1.00 0.00 ? 21 PHE A CE2  16 
ATOM   9053  C  CZ   . PHE A 1 21 ? -0.116  -1.979  2.890   1.00 0.00 ? 21 PHE A CZ   16 
ATOM   9054  H  H    . PHE A 1 21 ? 2.690   -6.085  1.083   1.00 0.00 ? 21 PHE A H    16 
ATOM   9055  H  HA   . PHE A 1 21 ? 1.307   -6.924  3.537   1.00 0.00 ? 21 PHE A HA   16 
ATOM   9056  H  HB2  . PHE A 1 21 ? -0.152  -6.295  0.964   1.00 0.00 ? 21 PHE A HB2  16 
ATOM   9057  H  HB3  . PHE A 1 21 ? -0.849  -6.633  2.545   1.00 0.00 ? 21 PHE A HB3  16 
ATOM   9058  H  HD1  . PHE A 1 21 ? 1.026   -4.137  0.577   1.00 0.00 ? 21 PHE A HD1  16 
ATOM   9059  H  HD2  . PHE A 1 21 ? -1.160  -4.926  4.144   1.00 0.00 ? 21 PHE A HD2  16 
ATOM   9060  H  HE1  . PHE A 1 21 ? 0.978   -1.730  1.076   1.00 0.00 ? 21 PHE A HE1  16 
ATOM   9061  H  HE2  . PHE A 1 21 ? -1.212  -2.519  4.644   1.00 0.00 ? 21 PHE A HE2  16 
ATOM   9062  H  HZ   . PHE A 1 21 ? -0.131  -0.926  3.113   1.00 0.00 ? 21 PHE A HZ   16 
ATOM   9063  N  N    . SER A 1 22 ? 0.834   -9.220  2.578   1.00 0.00 ? 22 SER A N    16 
ATOM   9064  C  CA   . SER A 1 22 ? 0.853   -10.595 2.118   1.00 0.00 ? 22 SER A CA   16 
ATOM   9065  C  C    . SER A 1 22 ? -0.257  -10.839 1.096   1.00 0.00 ? 22 SER A C    16 
ATOM   9066  O  O    . SER A 1 22 ? -0.148  -11.719 0.240   1.00 0.00 ? 22 SER A O    16 
ATOM   9067  C  CB   . SER A 1 22 ? 0.692   -11.532 3.314   1.00 0.00 ? 22 SER A CB   16 
ATOM   9068  O  OG   . SER A 1 22 ? 0.571   -10.789 4.520   1.00 0.00 ? 22 SER A OG   16 
ATOM   9069  H  H    . SER A 1 22 ? 0.449   -9.017  3.458   1.00 0.00 ? 22 SER A H    16 
ATOM   9070  H  HA   . SER A 1 22 ? 1.810   -10.776 1.652   1.00 0.00 ? 22 SER A HA   16 
ATOM   9071  H  HB2  . SER A 1 22 ? -0.196  -12.133 3.184   1.00 0.00 ? 22 SER A HB2  16 
ATOM   9072  H  HB3  . SER A 1 22 ? 1.558   -12.176 3.386   1.00 0.00 ? 22 SER A HB3  16 
ATOM   9073  H  HG   . SER A 1 22 ? 1.315   -11.003 5.104   1.00 0.00 ? 22 SER A HG   16 
ATOM   9074  N  N    . ARG A 1 23 ? -1.332  -10.066 1.211   1.00 0.00 ? 23 ARG A N    16 
ATOM   9075  C  CA   . ARG A 1 23 ? -2.479  -10.198 0.323   1.00 0.00 ? 23 ARG A CA   16 
ATOM   9076  C  C    . ARG A 1 23 ? -2.733  -8.911  -0.420  1.00 0.00 ? 23 ARG A C    16 
ATOM   9077  O  O    . ARG A 1 23 ? -2.720  -7.821  0.153   1.00 0.00 ? 23 ARG A O    16 
ATOM   9078  C  CB   . ARG A 1 23 ? -3.720  -10.614 1.113   1.00 0.00 ? 23 ARG A CB   16 
ATOM   9079  C  CG   . ARG A 1 23 ? -3.592  -11.983 1.758   1.00 0.00 ? 23 ARG A CG   16 
ATOM   9080  C  CD   . ARG A 1 23 ? -4.942  -12.544 2.172   1.00 0.00 ? 23 ARG A CD   16 
ATOM   9081  N  NE   . ARG A 1 23 ? -5.943  -11.500 2.410   1.00 0.00 ? 23 ARG A NE   16 
ATOM   9082  C  CZ   . ARG A 1 23 ? -6.861  -11.555 3.373   1.00 0.00 ? 23 ARG A CZ   16 
ATOM   9083  N  NH1  . ARG A 1 23 ? -6.892  -12.583 4.216   1.00 0.00 ? 23 ARG A NH1  16 
ATOM   9084  N  NH2  . ARG A 1 23 ? -7.751  -10.576 3.495   1.00 0.00 ? 23 ARG A NH2  16 
ATOM   9085  H  H    . ARG A 1 23 ? -1.362  -9.398  1.931   1.00 0.00 ? 23 ARG A H    16 
ATOM   9086  H  HA   . ARG A 1 23 ? -2.261  -10.953 -0.417  1.00 0.00 ? 23 ARG A HA   16 
ATOM   9087  H  HB2  . ARG A 1 23 ? -3.898  -9.891  1.894   1.00 0.00 ? 23 ARG A HB2  16 
ATOM   9088  H  HB3  . ARG A 1 23 ? -4.570  -10.631 0.447   1.00 0.00 ? 23 ARG A HB3  16 
ATOM   9089  H  HG2  . ARG A 1 23 ? -3.136  -12.662 1.052   1.00 0.00 ? 23 ARG A HG2  16 
ATOM   9090  H  HG3  . ARG A 1 23 ? -2.965  -11.897 2.636   1.00 0.00 ? 23 ARG A HG3  16 
ATOM   9091  H  HD2  . ARG A 1 23 ? -5.300  -13.197 1.390   1.00 0.00 ? 23 ARG A HD2  16 
ATOM   9092  H  HD3  . ARG A 1 23 ? -4.814  -13.111 3.078   1.00 0.00 ? 23 ARG A HD3  16 
ATOM   9093  H  HE   . ARG A 1 23 ? -5.937  -10.726 1.809   1.00 0.00 ? 23 ARG A HE   16 
ATOM   9094  H  HH11 . ARG A 1 23 ? -6.222  -13.324 4.136   1.00 0.00 ? 23 ARG A HH11 16 
ATOM   9095  H  HH12 . ARG A 1 23 ? -7.588  -12.621 4.943   1.00 0.00 ? 23 ARG A HH12 16 
ATOM   9096  H  HH21 . ARG A 1 23 ? -7.731  -9.787  2.862   1.00 0.00 ? 23 ARG A HH21 16 
ATOM   9097  H  HH22 . ARG A 1 23 ? -8.455  -10.615 4.217   1.00 0.00 ? 23 ARG A HH22 16 
ATOM   9098  N  N    . SER A 1 24 ? -2.976  -9.067  -1.706  1.00 0.00 ? 24 SER A N    16 
ATOM   9099  C  CA   . SER A 1 24 ? -3.237  -7.960  -2.593  1.00 0.00 ? 24 SER A CA   16 
ATOM   9100  C  C    . SER A 1 24 ? -4.505  -7.227  -2.179  1.00 0.00 ? 24 SER A C    16 
ATOM   9101  O  O    . SER A 1 24 ? -4.642  -6.022  -2.392  1.00 0.00 ? 24 SER A O    16 
ATOM   9102  C  CB   . SER A 1 24 ? -3.363  -8.496  -4.010  1.00 0.00 ? 24 SER A CB   16 
ATOM   9103  O  OG   . SER A 1 24 ? -3.492  -9.909  -4.008  1.00 0.00 ? 24 SER A OG   16 
ATOM   9104  H  H    . SER A 1 24 ? -2.981  -9.979  -2.079  1.00 0.00 ? 24 SER A H    16 
ATOM   9105  H  HA   . SER A 1 24 ? -2.400  -7.279  -2.542  1.00 0.00 ? 24 SER A HA   16 
ATOM   9106  H  HB2  . SER A 1 24 ? -4.231  -8.070  -4.477  1.00 0.00 ? 24 SER A HB2  16 
ATOM   9107  H  HB3  . SER A 1 24 ? -2.479  -8.234  -4.566  1.00 0.00 ? 24 SER A HB3  16 
ATOM   9108  H  HG   . SER A 1 24 ? -3.633  -10.217 -4.915  1.00 0.00 ? 24 SER A HG   16 
ATOM   9109  N  N    . ASP A 1 25 ? -5.390  -7.949  -1.508  1.00 0.00 ? 25 ASP A N    16 
ATOM   9110  C  CA   . ASP A 1 25 ? -6.606  -7.360  -0.973  1.00 0.00 ? 25 ASP A CA   16 
ATOM   9111  C  C    . ASP A 1 25 ? -6.264  -6.322  0.090   1.00 0.00 ? 25 ASP A C    16 
ATOM   9112  O  O    . ASP A 1 25 ? -6.808  -5.220  0.093   1.00 0.00 ? 25 ASP A O    16 
ATOM   9113  C  CB   . ASP A 1 25 ? -7.506  -8.446  -0.391  1.00 0.00 ? 25 ASP A CB   16 
ATOM   9114  C  CG   . ASP A 1 25 ? -8.228  -8.017  0.872   1.00 0.00 ? 25 ASP A CG   16 
ATOM   9115  O  OD1  . ASP A 1 25 ? -9.237  -7.286  0.767   1.00 0.00 ? 25 ASP A OD1  16 
ATOM   9116  O  OD2  . ASP A 1 25 ? -7.791  -8.412  1.972   1.00 0.00 ? 25 ASP A OD2  16 
ATOM   9117  H  H    . ASP A 1 25 ? -5.203  -8.902  -1.342  1.00 0.00 ? 25 ASP A H    16 
ATOM   9118  H  HA   . ASP A 1 25 ? -7.121  -6.878  -1.783  1.00 0.00 ? 25 ASP A HA   16 
ATOM   9119  H  HB2  . ASP A 1 25 ? -8.243  -8.721  -1.126  1.00 0.00 ? 25 ASP A HB2  16 
ATOM   9120  H  HB3  . ASP A 1 25 ? -6.902  -9.307  -0.162  1.00 0.00 ? 25 ASP A HB3  16 
ATOM   9121  N  N    . HIS A 1 26 ? -5.290  -6.652  0.933   1.00 0.00 ? 26 HIS A N    16 
ATOM   9122  C  CA   . HIS A 1 26 ? -4.840  -5.740  1.976   1.00 0.00 ? 26 HIS A CA   16 
ATOM   9123  C  C    . HIS A 1 26 ? -4.137  -4.532  1.371   1.00 0.00 ? 26 HIS A C    16 
ATOM   9124  O  O    . HIS A 1 26 ? -4.310  -3.408  1.842   1.00 0.00 ? 26 HIS A O    16 
ATOM   9125  C  CB   . HIS A 1 26 ? -3.917  -6.466  2.956   1.00 0.00 ? 26 HIS A CB   16 
ATOM   9126  C  CG   . HIS A 1 26 ? -4.631  -6.977  4.170   1.00 0.00 ? 26 HIS A CG   16 
ATOM   9127  N  ND1  . HIS A 1 26 ? -4.104  -6.911  5.439   1.00 0.00 ? 26 HIS A ND1  16 
ATOM   9128  C  CD2  . HIS A 1 26 ? -5.850  -7.555  4.299   1.00 0.00 ? 26 HIS A CD2  16 
ATOM   9129  C  CE1  . HIS A 1 26 ? -4.969  -7.421  6.298   1.00 0.00 ? 26 HIS A CE1  16 
ATOM   9130  N  NE2  . HIS A 1 26 ? -6.039  -7.817  5.633   1.00 0.00 ? 26 HIS A NE2  16 
ATOM   9131  H  H    . HIS A 1 26 ? -4.838  -7.515  0.824   1.00 0.00 ? 26 HIS A H    16 
ATOM   9132  H  HA   . HIS A 1 26 ? -5.713  -5.398  2.510   1.00 0.00 ? 26 HIS A HA   16 
ATOM   9133  H  HB2  . HIS A 1 26 ? -3.463  -7.309  2.456   1.00 0.00 ? 26 HIS A HB2  16 
ATOM   9134  H  HB3  . HIS A 1 26 ? -3.143  -5.786  3.284   1.00 0.00 ? 26 HIS A HB3  16 
ATOM   9135  H  HD1  . HIS A 1 26 ? -3.214  -6.554  5.678   1.00 0.00 ? 26 HIS A HD1  16 
ATOM   9136  H  HD2  . HIS A 1 26 ? -6.539  -7.785  3.495   1.00 0.00 ? 26 HIS A HD2  16 
ATOM   9137  H  HE1  . HIS A 1 26 ? -4.825  -7.502  7.365   1.00 0.00 ? 26 HIS A HE1  16 
ATOM   9138  H  HE2  . HIS A 1 26 ? -6.914  -8.022  6.050   1.00 0.00 ? 26 HIS A HE2  16 
ATOM   9139  N  N    . LEU A 1 27 ? -3.434  -4.759  0.261   1.00 0.00 ? 27 LEU A N    16 
ATOM   9140  C  CA   . LEU A 1 27 ? -2.824  -3.670  -0.496  1.00 0.00 ? 27 LEU A CA   16 
ATOM   9141  C  C    . LEU A 1 27 ? -3.886  -2.643  -0.877  1.00 0.00 ? 27 LEU A C    16 
ATOM   9142  O  O    . LEU A 1 27 ? -3.791  -1.467  -0.522  1.00 0.00 ? 27 LEU A O    16 
ATOM   9143  C  CB   . LEU A 1 27 ? -2.174  -4.198  -1.779  1.00 0.00 ? 27 LEU A CB   16 
ATOM   9144  C  CG   . LEU A 1 27 ? -1.229  -3.227  -2.501  1.00 0.00 ? 27 LEU A CG   16 
ATOM   9145  C  CD1  . LEU A 1 27 ? -0.748  -2.118  -1.578  1.00 0.00 ? 27 LEU A CD1  16 
ATOM   9146  C  CD2  . LEU A 1 27 ? -0.055  -3.966  -3.110  1.00 0.00 ? 27 LEU A CD2  16 
ATOM   9147  H  H    . LEU A 1 27 ? -3.393  -5.670  -0.099  1.00 0.00 ? 27 LEU A H    16 
ATOM   9148  H  HA   . LEU A 1 27 ? -2.073  -3.200  0.124   1.00 0.00 ? 27 LEU A HA   16 
ATOM   9149  H  HB2  . LEU A 1 27 ? -1.615  -5.087  -1.531  1.00 0.00 ? 27 LEU A HB2  16 
ATOM   9150  H  HB3  . LEU A 1 27 ? -2.962  -4.472  -2.466  1.00 0.00 ? 27 LEU A HB3  16 
ATOM   9151  H  HG   . LEU A 1 27 ? -1.777  -2.759  -3.308  1.00 0.00 ? 27 LEU A HG   16 
ATOM   9152  H  HD11 . LEU A 1 27 ? -0.293  -1.333  -2.163  1.00 0.00 ? 27 LEU A HD11 16 
ATOM   9153  H  HD12 . LEU A 1 27 ? -1.586  -1.718  -1.027  1.00 0.00 ? 27 LEU A HD12 16 
ATOM   9154  H  HD13 . LEU A 1 27 ? -0.020  -2.519  -0.886  1.00 0.00 ? 27 LEU A HD13 16 
ATOM   9155  H  HD21 . LEU A 1 27 ? 0.635   -4.250  -2.330  1.00 0.00 ? 27 LEU A HD21 16 
ATOM   9156  H  HD22 . LEU A 1 27 ? -0.409  -4.850  -3.619  1.00 0.00 ? 27 LEU A HD22 16 
ATOM   9157  H  HD23 . LEU A 1 27 ? 0.445   -3.319  -3.818  1.00 0.00 ? 27 LEU A HD23 16 
ATOM   9158  N  N    . ALA A 1 28 ? -4.884  -3.111  -1.619  1.00 0.00 ? 28 ALA A N    16 
ATOM   9159  C  CA   . ALA A 1 28 ? -5.968  -2.259  -2.096  1.00 0.00 ? 28 ALA A CA   16 
ATOM   9160  C  C    . ALA A 1 28 ? -6.652  -1.527  -0.949  1.00 0.00 ? 28 ALA A C    16 
ATOM   9161  O  O    . ALA A 1 28 ? -7.013  -0.359  -1.086  1.00 0.00 ? 28 ALA A O    16 
ATOM   9162  C  CB   . ALA A 1 28 ? -6.983  -3.083  -2.872  1.00 0.00 ? 28 ALA A CB   16 
ATOM   9163  H  H    . ALA A 1 28 ? -4.876  -4.056  -1.879  1.00 0.00 ? 28 ALA A H    16 
ATOM   9164  H  HA   . ALA A 1 28 ? -5.544  -1.528  -2.772  1.00 0.00 ? 28 ALA A HA   16 
ATOM   9165  H  HB1  . ALA A 1 28 ? -7.269  -3.945  -2.286  1.00 0.00 ? 28 ALA A HB1  16 
ATOM   9166  H  HB2  . ALA A 1 28 ? -7.856  -2.480  -3.073  1.00 0.00 ? 28 ALA A HB2  16 
ATOM   9167  H  HB3  . ALA A 1 28 ? -6.545  -3.408  -3.803  1.00 0.00 ? 28 ALA A HB3  16 
ATOM   9168  N  N    . LEU A 1 29 ? -6.803  -2.207  0.186   1.00 0.00 ? 29 LEU A N    16 
ATOM   9169  C  CA   . LEU A 1 29 ? -7.425  -1.611  1.364   1.00 0.00 ? 29 LEU A CA   16 
ATOM   9170  C  C    . LEU A 1 29 ? -6.666  -0.369  1.809   1.00 0.00 ? 29 LEU A C    16 
ATOM   9171  O  O    . LEU A 1 29 ? -7.263  0.670   2.087   1.00 0.00 ? 29 LEU A O    16 
ATOM   9172  C  CB   . LEU A 1 29 ? -7.480  -2.617  2.511   1.00 0.00 ? 29 LEU A CB   16 
ATOM   9173  C  CG   . LEU A 1 29 ? -8.411  -3.805  2.284   1.00 0.00 ? 29 LEU A CG   16 
ATOM   9174  C  CD1  . LEU A 1 29 ? -8.287  -4.799  3.426   1.00 0.00 ? 29 LEU A CD1  16 
ATOM   9175  C  CD2  . LEU A 1 29 ? -9.849  -3.335  2.137   1.00 0.00 ? 29 LEU A CD2  16 
ATOM   9176  H  H    . LEU A 1 29 ? -6.470  -3.130  0.236   1.00 0.00 ? 29 LEU A H    16 
ATOM   9177  H  HA   . LEU A 1 29 ? -8.432  -1.327  1.105   1.00 0.00 ? 29 LEU A HA   16 
ATOM   9178  H  HB2  . LEU A 1 29 ? -6.482  -2.993  2.679   1.00 0.00 ? 29 LEU A HB2  16 
ATOM   9179  H  HB3  . LEU A 1 29 ? -7.805  -2.097  3.397   1.00 0.00 ? 29 LEU A HB3  16 
ATOM   9180  H  HG   . LEU A 1 29 ? -8.126  -4.307  1.373   1.00 0.00 ? 29 LEU A HG   16 
ATOM   9181  H  HD11 . LEU A 1 29 ? -8.591  -4.329  4.349   1.00 0.00 ? 29 LEU A HD11 16 
ATOM   9182  H  HD12 . LEU A 1 29 ? -8.921  -5.652  3.228   1.00 0.00 ? 29 LEU A HD12 16 
ATOM   9183  H  HD13 . LEU A 1 29 ? -7.259  -5.126  3.507   1.00 0.00 ? 29 LEU A HD13 16 
ATOM   9184  H  HD21 . LEU A 1 29 ? -10.490 -4.190  1.973   1.00 0.00 ? 29 LEU A HD21 16 
ATOM   9185  H  HD22 . LEU A 1 29 ? -10.156 -2.823  3.038   1.00 0.00 ? 29 LEU A HD22 16 
ATOM   9186  H  HD23 . LEU A 1 29 ? -9.924  -2.660  1.297   1.00 0.00 ? 29 LEU A HD23 16 
ATOM   9187  N  N    . HIS A 1 30 ? -5.344  -0.470  1.832   1.00 0.00 ? 30 HIS A N    16 
ATOM   9188  C  CA   . HIS A 1 30 ? -4.506  0.662   2.197   1.00 0.00 ? 30 HIS A CA   16 
ATOM   9189  C  C    . HIS A 1 30 ? -4.502  1.697   1.075   1.00 0.00 ? 30 HIS A C    16 
ATOM   9190  O  O    . HIS A 1 30 ? -4.447  2.904   1.319   1.00 0.00 ? 30 HIS A O    16 
ATOM   9191  C  CB   . HIS A 1 30 ? -3.069  0.197   2.495   1.00 0.00 ? 30 HIS A CB   16 
ATOM   9192  C  CG   . HIS A 1 30 ? -2.033  1.258   2.282   1.00 0.00 ? 30 HIS A CG   16 
ATOM   9193  N  ND1  . HIS A 1 30 ? -1.940  2.395   3.045   1.00 0.00 ? 30 HIS A ND1  16 
ATOM   9194  C  CD2  . HIS A 1 30 ? -1.067  1.361   1.333   1.00 0.00 ? 30 HIS A CD2  16 
ATOM   9195  C  CE1  . HIS A 1 30 ? -0.948  3.142   2.547   1.00 0.00 ? 30 HIS A CE1  16 
ATOM   9196  N  NE2  . HIS A 1 30 ? -0.381  2.558   1.503   1.00 0.00 ? 30 HIS A NE2  16 
ATOM   9197  H  H    . HIS A 1 30 ? -4.922  -1.316  1.565   1.00 0.00 ? 30 HIS A H    16 
ATOM   9198  H  HA   . HIS A 1 30 ? -4.924  1.112   3.086   1.00 0.00 ? 30 HIS A HA   16 
ATOM   9199  H  HB2  . HIS A 1 30 ? -3.008  -0.122  3.524   1.00 0.00 ? 30 HIS A HB2  16 
ATOM   9200  H  HB3  . HIS A 1 30 ? -2.825  -0.634  1.853   1.00 0.00 ? 30 HIS A HB3  16 
ATOM   9201  H  HD1  . HIS A 1 30 ? -2.521  2.630   3.815   1.00 0.00 ? 30 HIS A HD1  16 
ATOM   9202  H  HD2  . HIS A 1 30 ? -0.862  0.635   0.560   1.00 0.00 ? 30 HIS A HD2  16 
ATOM   9203  H  HE1  . HIS A 1 30 ? -0.649  4.101   2.948   1.00 0.00 ? 30 HIS A HE1  16 
ATOM   9204  N  N    . ARG A 1 31 ? -4.514  1.213   -0.156  1.00 0.00 ? 31 ARG A N    16 
ATOM   9205  C  CA   . ARG A 1 31 ? -4.404  2.086   -1.313  1.00 0.00 ? 31 ARG A CA   16 
ATOM   9206  C  C    . ARG A 1 31 ? -5.673  2.904   -1.519  1.00 0.00 ? 31 ARG A C    16 
ATOM   9207  O  O    . ARG A 1 31 ? -5.697  3.824   -2.333  1.00 0.00 ? 31 ARG A O    16 
ATOM   9208  C  CB   . ARG A 1 31 ? -4.090  1.282   -2.569  1.00 0.00 ? 31 ARG A CB   16 
ATOM   9209  C  CG   . ARG A 1 31 ? -2.665  0.748   -2.602  1.00 0.00 ? 31 ARG A CG   16 
ATOM   9210  C  CD   . ARG A 1 31 ? -2.237  0.348   -4.006  1.00 0.00 ? 31 ARG A CD   16 
ATOM   9211  N  NE   . ARG A 1 31 ? -2.333  1.461   -4.944  1.00 0.00 ? 31 ARG A NE   16 
ATOM   9212  C  CZ   . ARG A 1 31 ? -3.216  1.527   -5.947  1.00 0.00 ? 31 ARG A CZ   16 
ATOM   9213  N  NH1  . ARG A 1 31 ? -4.049  0.519   -6.170  1.00 0.00 ? 31 ARG A NH1  16 
ATOM   9214  N  NH2  . ARG A 1 31 ? -3.246  2.594   -6.739  1.00 0.00 ? 31 ARG A NH2  16 
ATOM   9215  H  H    . ARG A 1 31 ? -4.558  0.238   -0.289  1.00 0.00 ? 31 ARG A H    16 
ATOM   9216  H  HA   . ARG A 1 31 ? -3.580  2.763   -1.125  1.00 0.00 ? 31 ARG A HA   16 
ATOM   9217  H  HB2  . ARG A 1 31 ? -4.770  0.446   -2.632  1.00 0.00 ? 31 ARG A HB2  16 
ATOM   9218  H  HB3  . ARG A 1 31 ? -4.233  1.924   -3.426  1.00 0.00 ? 31 ARG A HB3  16 
ATOM   9219  H  HG2  . ARG A 1 31 ? -1.997  1.515   -2.240  1.00 0.00 ? 31 ARG A HG2  16 
ATOM   9220  H  HG3  . ARG A 1 31 ? -2.601  -0.117  -1.957  1.00 0.00 ? 31 ARG A HG3  16 
ATOM   9221  H  HD2  . ARG A 1 31 ? -1.208  0.011   -3.973  1.00 0.00 ? 31 ARG A HD2  16 
ATOM   9222  H  HD3  . ARG A 1 31 ? -2.869  -0.459  -4.349  1.00 0.00 ? 31 ARG A HD3  16 
ATOM   9223  H  HE   . ARG A 1 31 ? -1.706  2.211   -4.813  1.00 0.00 ? 31 ARG A HE   16 
ATOM   9224  H  HH11 . ARG A 1 31 ? -4.017  -0.303  -5.590  1.00 0.00 ? 31 ARG A HH11 16 
ATOM   9225  H  HH12 . ARG A 1 31 ? -4.724  0.573   -6.913  1.00 0.00 ? 31 ARG A HH12 16 
ATOM   9226  H  HH21 . ARG A 1 31 ? -2.606  3.355   -6.587  1.00 0.00 ? 31 ARG A HH21 16 
ATOM   9227  H  HH22 . ARG A 1 31 ? -3.913  2.646   -7.492  1.00 0.00 ? 31 ARG A HH22 16 
ATOM   9228  N  N    . LYS A 1 32 ? -6.694  2.621   -0.720  1.00 0.00 ? 32 LYS A N    16 
ATOM   9229  C  CA   . LYS A 1 32 ? -7.926  3.400   -0.742  1.00 0.00 ? 32 LYS A CA   16 
ATOM   9230  C  C    . LYS A 1 32 ? -7.635  4.841   -0.349  1.00 0.00 ? 32 LYS A C    16 
ATOM   9231  O  O    . LYS A 1 32 ? -8.250  5.780   -0.857  1.00 0.00 ? 32 LYS A O    16 
ATOM   9232  C  CB   . LYS A 1 32 ? -8.951  2.799   0.219   1.00 0.00 ? 32 LYS A CB   16 
ATOM   9233  C  CG   . LYS A 1 32 ? -10.094 2.084   -0.476  1.00 0.00 ? 32 LYS A CG   16 
ATOM   9234  C  CD   . LYS A 1 32 ? -9.868  0.584   -0.514  1.00 0.00 ? 32 LYS A CD   16 
ATOM   9235  C  CE   . LYS A 1 32 ? -10.257 -0.002  -1.860  1.00 0.00 ? 32 LYS A CE   16 
ATOM   9236  N  NZ   . LYS A 1 32 ? -11.595 -0.645  -1.824  1.00 0.00 ? 32 LYS A NZ   16 
ATOM   9237  H  H    . LYS A 1 32 ? -6.599  1.901   -0.059  1.00 0.00 ? 32 LYS A H    16 
ATOM   9238  H  HA   . LYS A 1 32 ? -8.322  3.378   -1.744  1.00 0.00 ? 32 LYS A HA   16 
ATOM   9239  H  HB2  . LYS A 1 32 ? -8.450  2.091   0.864   1.00 0.00 ? 32 LYS A HB2  16 
ATOM   9240  H  HB3  . LYS A 1 32 ? -9.365  3.591   0.823   1.00 0.00 ? 32 LYS A HB3  16 
ATOM   9241  H  HG2  . LYS A 1 32 ? -11.011 2.285   0.059   1.00 0.00 ? 32 LYS A HG2  16 
ATOM   9242  H  HG3  . LYS A 1 32 ? -10.176 2.455   -1.488  1.00 0.00 ? 32 LYS A HG3  16 
ATOM   9243  H  HD2  . LYS A 1 32 ? -8.819  0.382   -0.337  1.00 0.00 ? 32 LYS A HD2  16 
ATOM   9244  H  HD3  . LYS A 1 32 ? -10.464 0.120   0.258   1.00 0.00 ? 32 LYS A HD3  16 
ATOM   9245  H  HE2  . LYS A 1 32 ? -10.269 0.790   -2.594  1.00 0.00 ? 32 LYS A HE2  16 
ATOM   9246  H  HE3  . LYS A 1 32 ? -9.521  -0.740  -2.140  1.00 0.00 ? 32 LYS A HE3  16 
ATOM   9247  H  HZ1  . LYS A 1 32 ? -11.493 -1.676  -1.716  1.00 0.00 ? 32 LYS A HZ1  16 
ATOM   9248  H  HZ2  . LYS A 1 32 ? -12.112 -0.450  -2.710  1.00 0.00 ? 32 LYS A HZ2  16 
ATOM   9249  H  HZ3  . LYS A 1 32 ? -12.153 -0.277  -1.024  1.00 0.00 ? 32 LYS A HZ3  16 
ATOM   9250  N  N    . ARG A 1 33 ? -6.635  5.011   0.506   1.00 0.00 ? 33 ARG A N    16 
ATOM   9251  C  CA   . ARG A 1 33 ? -6.214  6.333   0.941   1.00 0.00 ? 33 ARG A CA   16 
ATOM   9252  C  C    . ARG A 1 33 ? -5.451  7.055   -0.159  1.00 0.00 ? 33 ARG A C    16 
ATOM   9253  O  O    . ARG A 1 33 ? -5.282  8.274   -0.117  1.00 0.00 ? 33 ARG A O    16 
ATOM   9254  C  CB   . ARG A 1 33 ? -5.338  6.224   2.186   1.00 0.00 ? 33 ARG A CB   16 
ATOM   9255  C  CG   . ARG A 1 33 ? -6.098  5.797   3.426   1.00 0.00 ? 33 ARG A CG   16 
ATOM   9256  C  CD   . ARG A 1 33 ? -6.290  6.958   4.386   1.00 0.00 ? 33 ARG A CD   16 
ATOM   9257  N  NE   . ARG A 1 33 ? -5.533  6.774   5.621   1.00 0.00 ? 33 ARG A NE   16 
ATOM   9258  C  CZ   . ARG A 1 33 ? -6.076  6.773   6.836   1.00 0.00 ? 33 ARG A CZ   16 
ATOM   9259  N  NH1  . ARG A 1 33 ? -7.386  6.935   6.985   1.00 0.00 ? 33 ARG A NH1  16 
ATOM   9260  N  NH2  . ARG A 1 33 ? -5.305  6.604   7.901   1.00 0.00 ? 33 ARG A NH2  16 
ATOM   9261  H  H    . ARG A 1 33 ? -6.149  4.222   0.833   1.00 0.00 ? 33 ARG A H    16 
ATOM   9262  H  HA   . ARG A 1 33 ? -7.097  6.900   1.181   1.00 0.00 ? 33 ARG A HA   16 
ATOM   9263  H  HB2  . ARG A 1 33 ? -4.557  5.502   2.000   1.00 0.00 ? 33 ARG A HB2  16 
ATOM   9264  H  HB3  . ARG A 1 33 ? -4.886  7.186   2.380   1.00 0.00 ? 33 ARG A HB3  16 
ATOM   9265  H  HG2  . ARG A 1 33 ? -7.067  5.421   3.133   1.00 0.00 ? 33 ARG A HG2  16 
ATOM   9266  H  HG3  . ARG A 1 33 ? -5.542  5.017   3.925   1.00 0.00 ? 33 ARG A HG3  16 
ATOM   9267  H  HD2  . ARG A 1 33 ? -5.961  7.868   3.906   1.00 0.00 ? 33 ARG A HD2  16 
ATOM   9268  H  HD3  . ARG A 1 33 ? -7.340  7.038   4.626   1.00 0.00 ? 33 ARG A HD3  16 
ATOM   9269  H  HE   . ARG A 1 33 ? -4.559  6.642   5.537   1.00 0.00 ? 33 ARG A HE   16 
ATOM   9270  H  HH11 . ARG A 1 33 ? -7.975  7.052   6.178   1.00 0.00 ? 33 ARG A HH11 16 
ATOM   9271  H  HH12 . ARG A 1 33 ? -7.796  6.948   7.905   1.00 0.00 ? 33 ARG A HH12 16 
ATOM   9272  H  HH21 . ARG A 1 33 ? -4.315  6.480   7.792   1.00 0.00 ? 33 ARG A HH21 16 
ATOM   9273  H  HH22 . ARG A 1 33 ? -5.710  6.592   8.827   1.00 0.00 ? 33 ARG A HH22 16 
ATOM   9274  N  N    . HIS A 1 34 ? -5.012  6.304   -1.156  1.00 0.00 ? 34 HIS A N    16 
ATOM   9275  C  CA   . HIS A 1 34 ? -4.248  6.875   -2.257  1.00 0.00 ? 34 HIS A CA   16 
ATOM   9276  C  C    . HIS A 1 34 ? -5.167  7.422   -3.331  1.00 0.00 ? 34 HIS A C    16 
ATOM   9277  O  O    . HIS A 1 34 ? -4.713  8.037   -4.296  1.00 0.00 ? 34 HIS A O    16 
ATOM   9278  C  CB   . HIS A 1 34 ? -3.289  5.837   -2.832  1.00 0.00 ? 34 HIS A CB   16 
ATOM   9279  C  CG   . HIS A 1 34 ? -2.117  5.602   -1.939  1.00 0.00 ? 34 HIS A CG   16 
ATOM   9280  N  ND1  . HIS A 1 34 ? -1.393  6.617   -1.359  1.00 0.00 ? 34 HIS A ND1  16 
ATOM   9281  C  CD2  . HIS A 1 34 ? -1.571  4.445   -1.491  1.00 0.00 ? 34 HIS A CD2  16 
ATOM   9282  C  CE1  . HIS A 1 34 ? -0.448  6.059   -0.594  1.00 0.00 ? 34 HIS A CE1  16 
ATOM   9283  N  NE2  . HIS A 1 34 ? -0.516  4.741   -0.640  1.00 0.00 ? 34 HIS A NE2  16 
ATOM   9284  H  H    . HIS A 1 34 ? -5.208  5.342   -1.156  1.00 0.00 ? 34 HIS A H    16 
ATOM   9285  H  HA   . HIS A 1 34 ? -3.668  7.695   -1.857  1.00 0.00 ? 34 HIS A HA   16 
ATOM   9286  H  HB2  . HIS A 1 34 ? -3.808  4.898   -2.961  1.00 0.00 ? 34 HIS A HB2  16 
ATOM   9287  H  HB3  . HIS A 1 34 ? -2.919  6.178   -3.789  1.00 0.00 ? 34 HIS A HB3  16 
ATOM   9288  H  HD1  . HIS A 1 34 ? -1.560  7.587   -1.466  1.00 0.00 ? 34 HIS A HD1  16 
ATOM   9289  H  HD2  . HIS A 1 34 ? -1.899  3.449   -1.743  1.00 0.00 ? 34 HIS A HD2  16 
ATOM   9290  H  HE1  . HIS A 1 34 ? 0.277   6.613   -0.016  1.00 0.00 ? 34 HIS A HE1  16 
ATOM   9291  N  N    . MET A 1 35 ? -6.467  7.327   -3.080  1.00 0.00 ? 35 MET A N    16 
ATOM   9292  C  CA   . MET A 1 35 ? -7.458  7.943   -3.947  1.00 0.00 ? 35 MET A CA   16 
ATOM   9293  C  C    . MET A 1 35 ? -7.530  9.436   -3.652  1.00 0.00 ? 35 MET A C    16 
ATOM   9294  O  O    . MET A 1 35 ? -8.080  10.214  -4.431  1.00 0.00 ? 35 MET A O    16 
ATOM   9295  C  CB   . MET A 1 35 ? -8.826  7.294   -3.741  1.00 0.00 ? 35 MET A CB   16 
ATOM   9296  C  CG   . MET A 1 35 ? -8.875  5.834   -4.166  1.00 0.00 ? 35 MET A CG   16 
ATOM   9297  S  SD   . MET A 1 35 ? -10.366 4.985   -3.609  1.00 0.00 ? 35 MET A SD   16 
ATOM   9298  C  CE   . MET A 1 35 ? -9.986  3.303   -4.094  1.00 0.00 ? 35 MET A CE   16 
ATOM   9299  H  H    . MET A 1 35 ? -6.761  6.913   -2.240  1.00 0.00 ? 35 MET A H    16 
ATOM   9300  H  HA   . MET A 1 35 ? -7.147  7.800   -4.970  1.00 0.00 ? 35 MET A HA   16 
ATOM   9301  H  HB2  . MET A 1 35 ? -9.082  7.350   -2.693  1.00 0.00 ? 35 MET A HB2  16 
ATOM   9302  H  HB3  . MET A 1 35 ? -9.562  7.839   -4.312  1.00 0.00 ? 35 MET A HB3  16 
ATOM   9303  H  HG2  . MET A 1 35 ? -8.835  5.787   -5.244  1.00 0.00 ? 35 MET A HG2  16 
ATOM   9304  H  HG3  . MET A 1 35 ? -8.014  5.326   -3.755  1.00 0.00 ? 35 MET A HG3  16 
ATOM   9305  H  HE1  . MET A 1 35 ? -9.696  2.734   -3.223  1.00 0.00 ? 35 MET A HE1  16 
ATOM   9306  H  HE2  . MET A 1 35 ? -10.858 2.852   -4.545  1.00 0.00 ? 35 MET A HE2  16 
ATOM   9307  H  HE3  . MET A 1 35 ? -9.174  3.308   -4.805  1.00 0.00 ? 35 MET A HE3  16 
ATOM   9308  N  N    . LEU A 1 36 ? -6.852  9.834   -2.582  1.00 0.00 ? 36 LEU A N    16 
ATOM   9309  C  CA   . LEU A 1 36 ? -6.711  11.231  -2.230  1.00 0.00 ? 36 LEU A CA   16 
ATOM   9310  C  C    . LEU A 1 36 ? -5.272  11.483  -1.813  1.00 0.00 ? 36 LEU A C    16 
ATOM   9311  O  O    . LEU A 1 36 ? -5.010  12.040  -0.745  1.00 0.00 ? 36 LEU A O    16 
ATOM   9312  C  CB   . LEU A 1 36 ? -7.659  11.609  -1.086  1.00 0.00 ? 36 LEU A CB   16 
ATOM   9313  C  CG   . LEU A 1 36 ? -8.687  10.547  -0.697  1.00 0.00 ? 36 LEU A CG   16 
ATOM   9314  C  CD1  . LEU A 1 36 ? -8.234  9.789   0.542   1.00 0.00 ? 36 LEU A CD1  16 
ATOM   9315  C  CD2  . LEU A 1 36 ? -10.040 11.193  -0.462  1.00 0.00 ? 36 LEU A CD2  16 
ATOM   9316  H  H    . LEU A 1 36 ? -6.331  9.172   -2.079  1.00 0.00 ? 36 LEU A H    16 
ATOM   9317  H  HA   . LEU A 1 36 ? -6.940  11.826  -3.101  1.00 0.00 ? 36 LEU A HA   16 
ATOM   9318  H  HB2  . LEU A 1 36 ? -7.062  11.831  -0.216  1.00 0.00 ? 36 LEU A HB2  16 
ATOM   9319  H  HB3  . LEU A 1 36 ? -8.193  12.503  -1.371  1.00 0.00 ? 36 LEU A HB3  16 
ATOM   9320  H  HG   . LEU A 1 36 ? -8.788  9.838   -1.506  1.00 0.00 ? 36 LEU A HG   16 
ATOM   9321  H  HD11 . LEU A 1 36 ? -8.268  10.445  1.399   1.00 0.00 ? 36 LEU A HD11 16 
ATOM   9322  H  HD12 . LEU A 1 36 ? -8.890  8.948   0.707   1.00 0.00 ? 36 LEU A HD12 16 
ATOM   9323  H  HD13 . LEU A 1 36 ? -7.223  9.435   0.399   1.00 0.00 ? 36 LEU A HD13 16 
ATOM   9324  H  HD21 . LEU A 1 36 ? -9.907  12.126  0.066   1.00 0.00 ? 36 LEU A HD21 16 
ATOM   9325  H  HD22 . LEU A 1 36 ? -10.519 11.382  -1.412  1.00 0.00 ? 36 LEU A HD22 16 
ATOM   9326  H  HD23 . LEU A 1 36 ? -10.659 10.530  0.127   1.00 0.00 ? 36 LEU A HD23 16 
ATOM   9327  N  N    . VAL A 1 37 ? -4.354  11.073  -2.683  1.00 0.00 ? 37 VAL A N    16 
ATOM   9328  C  CA   . VAL A 1 37 ? -2.918  11.217  -2.460  1.00 0.00 ? 37 VAL A CA   16 
ATOM   9329  C  C    . VAL A 1 37 ? -2.464  10.488  -1.193  1.00 0.00 ? 37 VAL A C    16 
ATOM   9330  O  O    . VAL A 1 37 ? -2.076  9.302   -1.292  1.00 0.00 ? 37 VAL A O    16 
ATOM   9331  C  CB   . VAL A 1 37 ? -2.489  12.701  -2.386  1.00 0.00 ? 37 VAL A CB   16 
ATOM   9332  C  CG1  . VAL A 1 37 ? -0.975  12.826  -2.436  1.00 0.00 ? 37 VAL A CG1  16 
ATOM   9333  C  CG2  . VAL A 1 37 ? -3.126  13.506  -3.511  1.00 0.00 ? 37 VAL A CG2  16 
ATOM   9334  O  OXT  . VAL A 1 37 ? -2.491  11.099  -0.103  1.00 0.00 ? 37 VAL A OXT  16 
ATOM   9335  H  H    . VAL A 1 37 ? -4.656  10.652  -3.519  1.00 0.00 ? 37 VAL A H    16 
ATOM   9336  H  HA   . VAL A 1 37 ? -2.420  10.766  -3.304  1.00 0.00 ? 37 VAL A HA   16 
ATOM   9337  H  HB   . VAL A 1 37 ? -2.830  13.108  -1.443  1.00 0.00 ? 37 VAL A HB   16 
ATOM   9338  H  HG11 . VAL A 1 37 ? -0.531  11.842  -2.449  1.00 0.00 ? 37 VAL A HG11 16 
ATOM   9339  H  HG12 . VAL A 1 37 ? -0.687  13.364  -3.328  1.00 0.00 ? 37 VAL A HG12 16 
ATOM   9340  H  HG13 . VAL A 1 37 ? -0.628  13.364  -1.565  1.00 0.00 ? 37 VAL A HG13 16 
ATOM   9341  H  HG21 . VAL A 1 37 ? -2.356  13.868  -4.176  1.00 0.00 ? 37 VAL A HG21 16 
ATOM   9342  H  HG22 . VAL A 1 37 ? -3.813  12.879  -4.059  1.00 0.00 ? 37 VAL A HG22 16 
ATOM   9343  H  HG23 . VAL A 1 37 ? -3.661  14.346  -3.092  1.00 0.00 ? 37 VAL A HG23 16 
HETATM 9344  ZN ZN   . ZN  B 2 .  ? 0.759   3.512   0.191   1.00 0.00 ? 38 ZN  A ZN   16 
ATOM   9345  N  N    . GLY A 1 1  ? 8.229   3.100   -3.758  1.00 0.00 ? 1  GLY A N    17 
ATOM   9346  C  CA   . GLY A 1 1  ? 7.394   1.936   -3.369  1.00 0.00 ? 1  GLY A CA   17 
ATOM   9347  C  C    . GLY A 1 1  ? 7.671   0.725   -4.234  1.00 0.00 ? 1  GLY A C    17 
ATOM   9348  O  O    . GLY A 1 1  ? 7.961   0.869   -5.421  1.00 0.00 ? 1  GLY A O    17 
ATOM   9349  H  H1   . GLY A 1 1  ? 7.686   3.749   -4.370  1.00 0.00 ? 1  GLY A H1   17 
ATOM   9350  H  H2   . GLY A 1 1  ? 9.073   2.774   -4.280  1.00 0.00 ? 1  GLY A H2   17 
ATOM   9351  H  H3   . GLY A 1 1  ? 8.543   3.617   -2.909  1.00 0.00 ? 1  GLY A H3   17 
ATOM   9352  H  HA2  . GLY A 1 1  ? 7.600   1.685   -2.340  1.00 0.00 ? 1  GLY A HA2  17 
ATOM   9353  H  HA3  . GLY A 1 1  ? 6.352   2.204   -3.464  1.00 0.00 ? 1  GLY A HA3  17 
ATOM   9354  N  N    . SER A 1 2  ? 7.599   -0.466  -3.632  1.00 0.00 ? 2  SER A N    17 
ATOM   9355  C  CA   . SER A 1 2  ? 7.863   -1.721  -4.336  1.00 0.00 ? 2  SER A CA   17 
ATOM   9356  C  C    . SER A 1 2  ? 9.263   -1.724  -4.948  1.00 0.00 ? 2  SER A C    17 
ATOM   9357  O  O    . SER A 1 2  ? 9.427   -1.883  -6.156  1.00 0.00 ? 2  SER A O    17 
ATOM   9358  C  CB   . SER A 1 2  ? 6.804   -1.962  -5.416  1.00 0.00 ? 2  SER A CB   17 
ATOM   9359  O  OG   . SER A 1 2  ? 5.513   -1.605  -4.950  1.00 0.00 ? 2  SER A OG   17 
ATOM   9360  H  H    . SER A 1 2  ? 7.375   -0.502  -2.677  1.00 0.00 ? 2  SER A H    17 
ATOM   9361  H  HA   . SER A 1 2  ? 7.806   -2.519  -3.610  1.00 0.00 ? 2  SER A HA   17 
ATOM   9362  H  HB2  . SER A 1 2  ? 7.039   -1.365  -6.285  1.00 0.00 ? 2  SER A HB2  17 
ATOM   9363  H  HB3  . SER A 1 2  ? 6.801   -3.008  -5.685  1.00 0.00 ? 2  SER A HB3  17 
ATOM   9364  H  HG   . SER A 1 2  ? 5.587   -1.215  -4.073  1.00 0.00 ? 2  SER A HG   17 
ATOM   9365  N  N    . THR A 1 3  ? 10.265  -1.509  -4.107  1.00 0.00 ? 3  THR A N    17 
ATOM   9366  C  CA   . THR A 1 3  ? 11.646  -1.429  -4.564  1.00 0.00 ? 3  THR A CA   17 
ATOM   9367  C  C    . THR A 1 3  ? 12.279  -2.814  -4.682  1.00 0.00 ? 3  THR A C    17 
ATOM   9368  O  O    . THR A 1 3  ? 13.409  -2.958  -5.149  1.00 0.00 ? 3  THR A O    17 
ATOM   9369  C  CB   . THR A 1 3  ? 12.472  -0.555  -3.605  1.00 0.00 ? 3  THR A CB   17 
ATOM   9370  O  OG1  . THR A 1 3  ? 11.590  0.303   -2.866  1.00 0.00 ? 3  THR A OG1  17 
ATOM   9371  C  CG2  . THR A 1 3  ? 13.494  0.281   -4.356  1.00 0.00 ? 3  THR A CG2  17 
ATOM   9372  H  H    . THR A 1 3  ? 10.070  -1.350  -3.159  1.00 0.00 ? 3  THR A H    17 
ATOM   9373  H  HA   . THR A 1 3  ? 11.643  -0.971  -5.532  1.00 0.00 ? 3  THR A HA   17 
ATOM   9374  H  HB   . THR A 1 3  ? 12.994  -1.201  -2.915  1.00 0.00 ? 3  THR A HB   17 
ATOM   9375  H  HG1  . THR A 1 3  ? 11.337  1.055   -3.422  1.00 0.00 ? 3  THR A HG1  17 
ATOM   9376  H  HG21 . THR A 1 3  ? 13.180  1.314   -4.357  1.00 0.00 ? 3  THR A HG21 17 
ATOM   9377  H  HG22 . THR A 1 3  ? 13.574  -0.074  -5.372  1.00 0.00 ? 3  THR A HG22 17 
ATOM   9378  H  HG23 . THR A 1 3  ? 14.452  0.196   -3.867  1.00 0.00 ? 3  THR A HG23 17 
ATOM   9379  N  N    . ARG A 1 4  ? 11.489  -3.820  -4.334  1.00 0.00 ? 4  ARG A N    17 
ATOM   9380  C  CA   . ARG A 1 4  ? 11.880  -5.230  -4.439  1.00 0.00 ? 4  ARG A CA   17 
ATOM   9381  C  C    . ARG A 1 4  ? 13.225  -5.512  -3.760  1.00 0.00 ? 4  ARG A C    17 
ATOM   9382  O  O    . ARG A 1 4  ? 14.281  -5.470  -4.396  1.00 0.00 ? 4  ARG A O    17 
ATOM   9383  C  CB   . ARG A 1 4  ? 11.920  -5.661  -5.908  1.00 0.00 ? 4  ARG A CB   17 
ATOM   9384  C  CG   . ARG A 1 4  ? 10.547  -5.717  -6.561  1.00 0.00 ? 4  ARG A CG   17 
ATOM   9385  C  CD   . ARG A 1 4  ? 9.777   -6.959  -6.139  1.00 0.00 ? 4  ARG A CD   17 
ATOM   9386  N  NE   . ARG A 1 4  ? 8.465   -6.635  -5.578  1.00 0.00 ? 4  ARG A NE   17 
ATOM   9387  C  CZ   . ARG A 1 4  ? 8.000   -7.128  -4.428  1.00 0.00 ? 4  ARG A CZ   17 
ATOM   9388  N  NH1  . ARG A 1 4  ? 8.760   -7.929  -3.688  1.00 0.00 ? 4  ARG A NH1  17 
ATOM   9389  N  NH2  . ARG A 1 4  ? 6.778   -6.813  -4.010  1.00 0.00 ? 4  ARG A NH2  17 
ATOM   9390  H  H    . ARG A 1 4  ? 10.582  -3.606  -4.050  1.00 0.00 ? 4  ARG A H    17 
ATOM   9391  H  HA   . ARG A 1 4  ? 11.121  -5.810  -3.934  1.00 0.00 ? 4  ARG A HA   17 
ATOM   9392  H  HB2  . ARG A 1 4  ? 12.531  -4.962  -6.460  1.00 0.00 ? 4  ARG A HB2  17 
ATOM   9393  H  HB3  . ARG A 1 4  ? 12.365  -6.643  -5.971  1.00 0.00 ? 4  ARG A HB3  17 
ATOM   9394  H  HG2  . ARG A 1 4  ? 9.983   -4.843  -6.272  1.00 0.00 ? 4  ARG A HG2  17 
ATOM   9395  H  HG3  . ARG A 1 4  ? 10.670  -5.730  -7.635  1.00 0.00 ? 4  ARG A HG3  17 
ATOM   9396  H  HD2  . ARG A 1 4  ? 9.641   -7.592  -7.004  1.00 0.00 ? 4  ARG A HD2  17 
ATOM   9397  H  HD3  . ARG A 1 4  ? 10.356  -7.488  -5.396  1.00 0.00 ? 4  ARG A HD3  17 
ATOM   9398  H  HE   . ARG A 1 4  ? 7.889   -6.019  -6.102  1.00 0.00 ? 4  ARG A HE   17 
ATOM   9399  H  HH11 . ARG A 1 4  ? 9.694   -8.167  -3.988  1.00 0.00 ? 4  ARG A HH11 17 
ATOM   9400  H  HH12 . ARG A 1 4  ? 8.409   -8.302  -2.824  1.00 0.00 ? 4  ARG A HH12 17 
ATOM   9401  H  HH21 . ARG A 1 4  ? 6.191   -6.201  -4.559  1.00 0.00 ? 4  ARG A HH21 17 
ATOM   9402  H  HH22 . ARG A 1 4  ? 6.432   -7.185  -3.138  1.00 0.00 ? 4  ARG A HH22 17 
ATOM   9403  N  N    . GLY A 1 5  ? 13.171  -5.843  -2.478  1.00 0.00 ? 5  GLY A N    17 
ATOM   9404  C  CA   . GLY A 1 5  ? 14.373  -6.162  -1.732  1.00 0.00 ? 5  GLY A CA   17 
ATOM   9405  C  C    . GLY A 1 5  ? 14.163  -5.976  -0.247  1.00 0.00 ? 5  GLY A C    17 
ATOM   9406  O  O    . GLY A 1 5  ? 13.154  -6.427  0.294   1.00 0.00 ? 5  GLY A O    17 
ATOM   9407  H  H    . GLY A 1 5  ? 12.299  -5.890  -2.032  1.00 0.00 ? 5  GLY A H    17 
ATOM   9408  H  HA2  . GLY A 1 5  ? 14.645  -7.189  -1.926  1.00 0.00 ? 5  GLY A HA2  17 
ATOM   9409  H  HA3  . GLY A 1 5  ? 15.173  -5.517  -2.058  1.00 0.00 ? 5  GLY A HA3  17 
ATOM   9410  N  N    . SER A 1 6  ? 15.023  -5.184  0.385   1.00 0.00 ? 6  SER A N    17 
ATOM   9411  C  CA   . SER A 1 6  ? 14.818  -4.809  1.777   1.00 0.00 ? 6  SER A CA   17 
ATOM   9412  C  C    . SER A 1 6  ? 13.732  -3.754  1.843   1.00 0.00 ? 6  SER A C    17 
ATOM   9413  O  O    . SER A 1 6  ? 12.729  -3.905  2.542   1.00 0.00 ? 6  SER A O    17 
ATOM   9414  C  CB   . SER A 1 6  ? 16.122  -4.296  2.385   1.00 0.00 ? 6  SER A CB   17 
ATOM   9415  O  OG   . SER A 1 6  ? 17.223  -4.611  1.547   1.00 0.00 ? 6  SER A OG   17 
ATOM   9416  H  H    . SER A 1 6  ? 15.754  -4.764  -0.119  1.00 0.00 ? 6  SER A H    17 
ATOM   9417  H  HA   . SER A 1 6  ? 14.489  -5.673  2.307   1.00 0.00 ? 6  SER A HA   17 
ATOM   9418  H  HB2  . SER A 1 6  ? 16.066  -3.222  2.502   1.00 0.00 ? 6  SER A HB2  17 
ATOM   9419  H  HB3  . SER A 1 6  ? 16.276  -4.756  3.350   1.00 0.00 ? 6  SER A HB3  17 
ATOM   9420  H  HG   . SER A 1 6  ? 18.025  -4.195  1.901   1.00 0.00 ? 6  SER A HG   17 
ATOM   9421  N  N    . THR A 1 7  ? 13.801  -2.884  0.867   1.00 0.00 ? 7  THR A N    17 
ATOM   9422  C  CA   . THR A 1 7  ? 12.696  -2.013  0.547   1.00 0.00 ? 7  THR A CA   17 
ATOM   9423  C  C    . THR A 1 7  ? 11.900  -2.666  -0.571  1.00 0.00 ? 7  THR A C    17 
ATOM   9424  O  O    . THR A 1 7  ? 12.353  -2.720  -1.706  1.00 0.00 ? 7  THR A O    17 
ATOM   9425  C  CB   . THR A 1 7  ? 13.164  -0.611  0.105   1.00 0.00 ? 7  THR A CB   17 
ATOM   9426  O  OG1  . THR A 1 7  ? 14.559  -0.628  -0.244  1.00 0.00 ? 7  THR A OG1  17 
ATOM   9427  C  CG2  . THR A 1 7  ? 12.935  0.399   1.214   1.00 0.00 ? 7  THR A CG2  17 
ATOM   9428  H  H    . THR A 1 7  ? 14.512  -2.998  0.211   1.00 0.00 ? 7  THR A H    17 
ATOM   9429  H  HA   . THR A 1 7  ? 12.071  -1.917  1.424   1.00 0.00 ? 7  THR A HA   17 
ATOM   9430  H  HB   . THR A 1 7  ? 12.587  -0.311  -0.756  1.00 0.00 ? 7  THR A HB   17 
ATOM   9431  H  HG1  . THR A 1 7  ? 14.749  0.137   -0.814  1.00 0.00 ? 7  THR A HG1  17 
ATOM   9432  H  HG21 . THR A 1 7  ? 13.164  -0.059  2.164   1.00 0.00 ? 7  THR A HG21 17 
ATOM   9433  H  HG22 . THR A 1 7  ? 11.902  0.717   1.205   1.00 0.00 ? 7  THR A HG22 17 
ATOM   9434  H  HG23 . THR A 1 7  ? 13.578  1.253   1.060   1.00 0.00 ? 7  THR A HG23 17 
ATOM   9435  N  N    . GLY A 1 8  ? 10.849  -3.366  -0.201  1.00 0.00 ? 8  GLY A N    17 
ATOM   9436  C  CA   . GLY A 1 8  ? 10.124  -4.166  -1.163  1.00 0.00 ? 8  GLY A CA   17 
ATOM   9437  C  C    . GLY A 1 8  ? 9.927   -5.588  -0.698  1.00 0.00 ? 8  GLY A C    17 
ATOM   9438  O  O    . GLY A 1 8  ? 10.119  -6.534  -1.465  1.00 0.00 ? 8  GLY A O    17 
ATOM   9439  H  H    . GLY A 1 8  ? 10.615  -3.406  0.750   1.00 0.00 ? 8  GLY A H    17 
ATOM   9440  H  HA2  . GLY A 1 8  ? 9.155   -3.721  -1.322  1.00 0.00 ? 8  GLY A HA2  17 
ATOM   9441  H  HA3  . GLY A 1 8  ? 10.668  -4.173  -2.096  1.00 0.00 ? 8  GLY A HA3  17 
ATOM   9442  N  N    . ILE A 1 9  ? 9.496   -5.730  0.545   1.00 0.00 ? 9  ILE A N    17 
ATOM   9443  C  CA   . ILE A 1 9  ? 9.165   -7.030  1.106   1.00 0.00 ? 9  ILE A CA   17 
ATOM   9444  C  C    . ILE A 1 9  ? 7.796   -7.482  0.604   1.00 0.00 ? 9  ILE A C    17 
ATOM   9445  O  O    . ILE A 1 9  ? 6.978   -6.643  0.236   1.00 0.00 ? 9  ILE A O    17 
ATOM   9446  C  CB   . ILE A 1 9  ? 9.129   -6.966  2.647   1.00 0.00 ? 9  ILE A CB   17 
ATOM   9447  C  CG1  . ILE A 1 9  ? 10.153  -5.958  3.173   1.00 0.00 ? 9  ILE A CG1  17 
ATOM   9448  C  CG2  . ILE A 1 9  ? 9.375   -8.339  3.251   1.00 0.00 ? 9  ILE A CG2  17 
ATOM   9449  C  CD1  . ILE A 1 9  ? 9.682   -5.213  4.402   1.00 0.00 ? 9  ILE A CD1  17 
ATOM   9450  H  H    . ILE A 1 9  ? 9.304   -4.928  1.071   1.00 0.00 ? 9  ILE A H    17 
ATOM   9451  H  HA   . ILE A 1 9  ? 9.918   -7.742  0.802   1.00 0.00 ? 9  ILE A HA   17 
ATOM   9452  H  HB   . ILE A 1 9  ? 8.143   -6.642  2.938   1.00 0.00 ? 9  ILE A HB   17 
ATOM   9453  H  HG12 . ILE A 1 9  ? 11.064  -6.479  3.428   1.00 0.00 ? 9  ILE A HG12 17 
ATOM   9454  H  HG13 . ILE A 1 9  ? 10.361  -5.230  2.402   1.00 0.00 ? 9  ILE A HG13 17 
ATOM   9455  H  HG21 . ILE A 1 9  ? 8.828   -9.083  2.691   1.00 0.00 ? 9  ILE A HG21 17 
ATOM   9456  H  HG22 . ILE A 1 9  ? 10.431  -8.566  3.213   1.00 0.00 ? 9  ILE A HG22 17 
ATOM   9457  H  HG23 . ILE A 1 9  ? 9.042   -8.346  4.277   1.00 0.00 ? 9  ILE A HG23 17 
ATOM   9458  H  HD11 . ILE A 1 9  ? 8.680   -5.527  4.652   1.00 0.00 ? 9  ILE A HD11 17 
ATOM   9459  H  HD12 . ILE A 1 9  ? 10.343  -5.428  5.229   1.00 0.00 ? 9  ILE A HD12 17 
ATOM   9460  H  HD13 . ILE A 1 9  ? 9.687   -4.150  4.204   1.00 0.00 ? 9  ILE A HD13 17 
ATOM   9461  N  N    . LYS A 1 10 ? 7.498   -8.777  0.730   1.00 0.00 ? 10 LYS A N    17 
ATOM   9462  C  CA   . LYS A 1 10 ? 6.170   -9.313  0.406   1.00 0.00 ? 10 LYS A CA   17 
ATOM   9463  C  C    . LYS A 1 10 ? 5.830   -9.166  -1.083  1.00 0.00 ? 10 LYS A C    17 
ATOM   9464  O  O    . LYS A 1 10 ? 6.297   -8.252  -1.763  1.00 0.00 ? 10 LYS A O    17 
ATOM   9465  C  CB   . LYS A 1 10 ? 5.090   -8.649  1.273   1.00 0.00 ? 10 LYS A CB   17 
ATOM   9466  C  CG   . LYS A 1 10 ? 4.686   -9.484  2.475   1.00 0.00 ? 10 LYS A CG   17 
ATOM   9467  C  CD   . LYS A 1 10 ? 4.756   -8.683  3.765   1.00 0.00 ? 10 LYS A CD   17 
ATOM   9468  C  CE   . LYS A 1 10 ? 5.912   -9.137  4.644   1.00 0.00 ? 10 LYS A CE   17 
ATOM   9469  N  NZ   . LYS A 1 10 ? 5.447   -9.574  5.986   1.00 0.00 ? 10 LYS A NZ   17 
ATOM   9470  H  H    . LYS A 1 10 ? 8.165   -9.378  1.121   1.00 0.00 ? 10 LYS A H    17 
ATOM   9471  H  HA   . LYS A 1 10 ? 6.188   -10.369 0.640   1.00 0.00 ? 10 LYS A HA   17 
ATOM   9472  H  HB2  . LYS A 1 10 ? 5.464   -7.700  1.630   1.00 0.00 ? 10 LYS A HB2  17 
ATOM   9473  H  HB3  . LYS A 1 10 ? 4.211   -8.476  0.669   1.00 0.00 ? 10 LYS A HB3  17 
ATOM   9474  H  HG2  . LYS A 1 10 ? 3.674   -9.835  2.334   1.00 0.00 ? 10 LYS A HG2  17 
ATOM   9475  H  HG3  . LYS A 1 10 ? 5.354   -10.330 2.551   1.00 0.00 ? 10 LYS A HG3  17 
ATOM   9476  H  HD2  . LYS A 1 10 ? 4.889   -7.641  3.521   1.00 0.00 ? 10 LYS A HD2  17 
ATOM   9477  H  HD3  . LYS A 1 10 ? 3.831   -8.814  4.306   1.00 0.00 ? 10 LYS A HD3  17 
ATOM   9478  H  HE2  . LYS A 1 10 ? 6.412   -9.962  4.161   1.00 0.00 ? 10 LYS A HE2  17 
ATOM   9479  H  HE3  . LYS A 1 10 ? 6.604   -8.315  4.761   1.00 0.00 ? 10 LYS A HE3  17 
ATOM   9480  H  HZ1  . LYS A 1 10 ? 4.632   -10.216 5.891   1.00 0.00 ? 10 LYS A HZ1  17 
ATOM   9481  H  HZ2  . LYS A 1 10 ? 5.162   -8.747  6.555   1.00 0.00 ? 10 LYS A HZ2  17 
ATOM   9482  H  HZ3  . LYS A 1 10 ? 6.213   -10.073 6.487   1.00 0.00 ? 10 LYS A HZ3  17 
ATOM   9483  N  N    . PRO A 1 11 ? 5.069   -10.122 -1.634  1.00 0.00 ? 11 PRO A N    17 
ATOM   9484  C  CA   . PRO A 1 11 ? 4.719   -10.131 -3.060  1.00 0.00 ? 11 PRO A CA   17 
ATOM   9485  C  C    . PRO A 1 11 ? 3.798   -8.976  -3.456  1.00 0.00 ? 11 PRO A C    17 
ATOM   9486  O  O    . PRO A 1 11 ? 3.643   -8.678  -4.639  1.00 0.00 ? 11 PRO A O    17 
ATOM   9487  C  CB   . PRO A 1 11 ? 3.999   -11.469 -3.247  1.00 0.00 ? 11 PRO A CB   17 
ATOM   9488  C  CG   . PRO A 1 11 ? 3.509   -11.832 -1.889  1.00 0.00 ? 11 PRO A CG   17 
ATOM   9489  C  CD   . PRO A 1 11 ? 4.537   -11.303 -0.932  1.00 0.00 ? 11 PRO A CD   17 
ATOM   9490  H  HA   . PRO A 1 11 ? 5.601   -10.109 -3.679  1.00 0.00 ? 11 PRO A HA   17 
ATOM   9491  H  HB2  . PRO A 1 11 ? 3.182   -11.347 -3.943  1.00 0.00 ? 11 PRO A HB2  17 
ATOM   9492  H  HB3  . PRO A 1 11 ? 4.694   -12.203 -3.624  1.00 0.00 ? 11 PRO A HB3  17 
ATOM   9493  H  HG2  . PRO A 1 11 ? 2.554   -11.366 -1.708  1.00 0.00 ? 11 PRO A HG2  17 
ATOM   9494  H  HG3  . PRO A 1 11 ? 3.429   -12.905 -1.799  1.00 0.00 ? 11 PRO A HG3  17 
ATOM   9495  H  HD2  . PRO A 1 11 ? 4.075   -11.023 0.003   1.00 0.00 ? 11 PRO A HD2  17 
ATOM   9496  H  HD3  . PRO A 1 11 ? 5.314   -12.037 -0.768  1.00 0.00 ? 11 PRO A HD3  17 
ATOM   9497  N  N    . PHE A 1 12 ? 3.177   -8.339  -2.468  1.00 0.00 ? 12 PHE A N    17 
ATOM   9498  C  CA   . PHE A 1 12 ? 2.252   -7.245  -2.717  1.00 0.00 ? 12 PHE A CA   17 
ATOM   9499  C  C    . PHE A 1 12 ? 2.615   -6.030  -1.877  1.00 0.00 ? 12 PHE A C    17 
ATOM   9500  O  O    . PHE A 1 12 ? 2.211   -5.916  -0.724  1.00 0.00 ? 12 PHE A O    17 
ATOM   9501  C  CB   . PHE A 1 12 ? 0.823   -7.679  -2.395  1.00 0.00 ? 12 PHE A CB   17 
ATOM   9502  C  CG   . PHE A 1 12 ? 0.350   -8.846  -3.213  1.00 0.00 ? 12 PHE A CG   17 
ATOM   9503  C  CD1  . PHE A 1 12 ? 0.284   -8.760  -4.595  1.00 0.00 ? 12 PHE A CD1  17 
ATOM   9504  C  CD2  . PHE A 1 12 ? -0.028  -10.028 -2.601  1.00 0.00 ? 12 PHE A CD2  17 
ATOM   9505  C  CE1  . PHE A 1 12 ? -0.149  -9.834  -5.350  1.00 0.00 ? 12 PHE A CE1  17 
ATOM   9506  C  CE2  . PHE A 1 12 ? -0.463  -11.103 -3.350  1.00 0.00 ? 12 PHE A CE2  17 
ATOM   9507  C  CZ   . PHE A 1 12 ? -0.526  -11.006 -4.727  1.00 0.00 ? 12 PHE A CZ   17 
ATOM   9508  H  H    . PHE A 1 12 ? 3.337   -8.617  -1.546  1.00 0.00 ? 12 PHE A H    17 
ATOM   9509  H  HA   . PHE A 1 12 ? 2.317   -6.983  -3.762  1.00 0.00 ? 12 PHE A HA   17 
ATOM   9510  H  HB2  . PHE A 1 12 ? 0.770   -7.956  -1.350  1.00 0.00 ? 12 PHE A HB2  17 
ATOM   9511  H  HB3  . PHE A 1 12 ? 0.154   -6.850  -2.574  1.00 0.00 ? 12 PHE A HB3  17 
ATOM   9512  H  HD1  . PHE A 1 12 ? 0.578   -7.843  -5.084  1.00 0.00 ? 12 PHE A HD1  17 
ATOM   9513  H  HD2  . PHE A 1 12 ? 0.022   -10.106 -1.525  1.00 0.00 ? 12 PHE A HD2  17 
ATOM   9514  H  HE1  . PHE A 1 12 ? -0.196  -9.754  -6.426  1.00 0.00 ? 12 PHE A HE1  17 
ATOM   9515  H  HE2  . PHE A 1 12 ? -0.758  -12.019 -2.860  1.00 0.00 ? 12 PHE A HE2  17 
ATOM   9516  H  HZ   . PHE A 1 12 ? -0.865  -11.845 -5.314  1.00 0.00 ? 12 PHE A HZ   17 
ATOM   9517  N  N    . GLN A 1 13 ? 3.397   -5.140  -2.442  1.00 0.00 ? 13 GLN A N    17 
ATOM   9518  C  CA   . GLN A 1 13 ? 3.809   -3.944  -1.733  1.00 0.00 ? 13 GLN A CA   17 
ATOM   9519  C  C    . GLN A 1 13 ? 3.074   -2.723  -2.246  1.00 0.00 ? 13 GLN A C    17 
ATOM   9520  O  O    . GLN A 1 13 ? 2.651   -2.691  -3.401  1.00 0.00 ? 13 GLN A O    17 
ATOM   9521  C  CB   . GLN A 1 13 ? 5.305   -3.739  -1.888  1.00 0.00 ? 13 GLN A CB   17 
ATOM   9522  C  CG   . GLN A 1 13 ? 6.052   -4.000  -0.609  1.00 0.00 ? 13 GLN A CG   17 
ATOM   9523  C  CD   . GLN A 1 13 ? 7.223   -3.074  -0.392  1.00 0.00 ? 13 GLN A CD   17 
ATOM   9524  O  OE1  . GLN A 1 13 ? 7.583   -2.276  -1.263  1.00 0.00 ? 13 GLN A OE1  17 
ATOM   9525  N  NE2  . GLN A 1 13 ? 7.829   -3.174  0.779   1.00 0.00 ? 13 GLN A NE2  17 
ATOM   9526  H  H    . GLN A 1 13 ? 3.724   -5.297  -3.353  1.00 0.00 ? 13 GLN A H    17 
ATOM   9527  H  HA   . GLN A 1 13 ? 3.580   -4.078  -0.688  1.00 0.00 ? 13 GLN A HA   17 
ATOM   9528  H  HB2  . GLN A 1 13 ? 5.673   -4.415  -2.644  1.00 0.00 ? 13 GLN A HB2  17 
ATOM   9529  H  HB3  . GLN A 1 13 ? 5.494   -2.722  -2.194  1.00 0.00 ? 13 GLN A HB3  17 
ATOM   9530  H  HG2  . GLN A 1 13 ? 5.364   -3.877  0.218   1.00 0.00 ? 13 GLN A HG2  17 
ATOM   9531  H  HG3  . GLN A 1 13 ? 6.404   -5.008  -0.623  1.00 0.00 ? 13 GLN A HG3  17 
ATOM   9532  H  HE21 . GLN A 1 13 ? 7.489   -3.835  1.422   1.00 0.00 ? 13 GLN A HE21 17 
ATOM   9533  H  HE22 . GLN A 1 13 ? 8.571   -2.555  0.977   1.00 0.00 ? 13 GLN A HE22 17 
ATOM   9534  N  N    . CYS A 1 14 ? 3.060   -1.669  -1.442  1.00 0.00 ? 14 CYS A N    17 
ATOM   9535  C  CA   . CYS A 1 14 ? 2.530   -0.401  -1.900  1.00 0.00 ? 14 CYS A CA   17 
ATOM   9536  C  C    . CYS A 1 14 ? 3.504   0.212   -2.895  1.00 0.00 ? 14 CYS A C    17 
ATOM   9537  O  O    . CYS A 1 14 ? 4.682   0.408   -2.579  1.00 0.00 ? 14 CYS A O    17 
ATOM   9538  C  CB   . CYS A 1 14 ? 2.288   0.603   -0.768  1.00 0.00 ? 14 CYS A CB   17 
ATOM   9539  S  SG   . CYS A 1 14 ? 1.696   2.205   -1.424  1.00 0.00 ? 14 CYS A SG   17 
ATOM   9540  H  H    . CYS A 1 14 ? 3.542   -1.720  -0.582  1.00 0.00 ? 14 CYS A H    17 
ATOM   9541  H  HA   . CYS A 1 14 ? 1.589   -0.595  -2.397  1.00 0.00 ? 14 CYS A HA   17 
ATOM   9542  H  HB2  . CYS A 1 14 ? 1.548   0.209   -0.089  1.00 0.00 ? 14 CYS A HB2  17 
ATOM   9543  H  HB3  . CYS A 1 14 ? 3.210   0.781   -0.238  1.00 0.00 ? 14 CYS A HB3  17 
ATOM   9544  N  N    . PRO A 1 15 ? 3.041   0.502   -4.113  1.00 0.00 ? 15 PRO A N    17 
ATOM   9545  C  CA   . PRO A 1 15 ? 3.883   1.083   -5.151  1.00 0.00 ? 15 PRO A CA   17 
ATOM   9546  C  C    . PRO A 1 15 ? 4.204   2.547   -4.888  1.00 0.00 ? 15 PRO A C    17 
ATOM   9547  O  O    . PRO A 1 15 ? 4.933   3.176   -5.653  1.00 0.00 ? 15 PRO A O    17 
ATOM   9548  C  CB   . PRO A 1 15 ? 3.049   0.930   -6.422  1.00 0.00 ? 15 PRO A CB   17 
ATOM   9549  C  CG   . PRO A 1 15 ? 1.639   0.886   -5.948  1.00 0.00 ? 15 PRO A CG   17 
ATOM   9550  C  CD   . PRO A 1 15 ? 1.674   0.233   -4.593  1.00 0.00 ? 15 PRO A CD   17 
ATOM   9551  H  HA   . PRO A 1 15 ? 4.806   0.538   -5.251  1.00 0.00 ? 15 PRO A HA   17 
ATOM   9552  H  HB2  . PRO A 1 15 ? 3.221   1.776   -7.071  1.00 0.00 ? 15 PRO A HB2  17 
ATOM   9553  H  HB3  . PRO A 1 15 ? 3.324   0.017   -6.930  1.00 0.00 ? 15 PRO A HB3  17 
ATOM   9554  H  HG2  . PRO A 1 15 ? 1.247   1.890   -5.871  1.00 0.00 ? 15 PRO A HG2  17 
ATOM   9555  H  HG3  . PRO A 1 15 ? 1.041   0.301   -6.631  1.00 0.00 ? 15 PRO A HG3  17 
ATOM   9556  H  HD2  . PRO A 1 15 ? 0.940   0.683   -3.940  1.00 0.00 ? 15 PRO A HD2  17 
ATOM   9557  H  HD3  . PRO A 1 15 ? 1.500   -0.827  -4.683  1.00 0.00 ? 15 PRO A HD3  17 
ATOM   9558  N  N    . ASP A 1 16 ? 3.679   3.085   -3.795  1.00 0.00 ? 16 ASP A N    17 
ATOM   9559  C  CA   . ASP A 1 16 ? 3.929   4.476   -3.448  1.00 0.00 ? 16 ASP A CA   17 
ATOM   9560  C  C    . ASP A 1 16 ? 4.710   4.598   -2.144  1.00 0.00 ? 16 ASP A C    17 
ATOM   9561  O  O    . ASP A 1 16 ? 5.562   5.476   -2.004  1.00 0.00 ? 16 ASP A O    17 
ATOM   9562  C  CB   . ASP A 1 16 ? 2.609   5.242   -3.329  1.00 0.00 ? 16 ASP A CB   17 
ATOM   9563  C  CG   . ASP A 1 16 ? 2.821   6.706   -2.995  1.00 0.00 ? 16 ASP A CG   17 
ATOM   9564  O  OD1  . ASP A 1 16 ? 3.123   7.493   -3.917  1.00 0.00 ? 16 ASP A OD1  17 
ATOM   9565  O  OD2  . ASP A 1 16 ? 2.682   7.075   -1.813  1.00 0.00 ? 16 ASP A OD2  17 
ATOM   9566  H  H    . ASP A 1 16 ? 3.100   2.534   -3.214  1.00 0.00 ? 16 ASP A H    17 
ATOM   9567  H  HA   . ASP A 1 16 ? 4.512   4.911   -4.243  1.00 0.00 ? 16 ASP A HA   17 
ATOM   9568  H  HB2  . ASP A 1 16 ? 2.077   5.179   -4.267  1.00 0.00 ? 16 ASP A HB2  17 
ATOM   9569  H  HB3  . ASP A 1 16 ? 2.011   4.795   -2.549  1.00 0.00 ? 16 ASP A HB3  17 
ATOM   9570  N  N    . CYS A 1 17 ? 4.359   3.773   -1.165  1.00 0.00 ? 17 CYS A N    17 
ATOM   9571  C  CA   . CYS A 1 17 ? 4.938   3.898   0.171   1.00 0.00 ? 17 CYS A CA   17 
ATOM   9572  C  C    . CYS A 1 17 ? 6.138   2.995   0.386   1.00 0.00 ? 17 CYS A C    17 
ATOM   9573  O  O    . CYS A 1 17 ? 6.897   3.233   1.313   1.00 0.00 ? 17 CYS A O    17 
ATOM   9574  C  CB   . CYS A 1 17 ? 3.910   3.575   1.255   1.00 0.00 ? 17 CYS A CB   17 
ATOM   9575  S  SG   . CYS A 1 17 ? 2.473   4.679   1.294   1.00 0.00 ? 17 CYS A SG   17 
ATOM   9576  H  H    . CYS A 1 17 ? 3.639   3.118   -1.327  1.00 0.00 ? 17 CYS A H    17 
ATOM   9577  H  HA   . CYS A 1 17 ? 5.254   4.922   0.291   1.00 0.00 ? 17 CYS A HA   17 
ATOM   9578  H  HB2  . CYS A 1 17 ? 3.545   2.571   1.103   1.00 0.00 ? 17 CYS A HB2  17 
ATOM   9579  H  HB3  . CYS A 1 17 ? 4.392   3.630   2.220   1.00 0.00 ? 17 CYS A HB3  17 
ATOM   9580  N  N    . ASP A 1 18 ? 6.104   1.829   -0.252  1.00 0.00 ? 18 ASP A N    17 
ATOM   9581  C  CA   . ASP A 1 18 ? 7.007   0.715   0.073   1.00 0.00 ? 18 ASP A CA   17 
ATOM   9582  C  C    . ASP A 1 18 ? 6.528   0.036   1.355   1.00 0.00 ? 18 ASP A C    17 
ATOM   9583  O  O    . ASP A 1 18 ? 7.198   -0.823  1.916   1.00 0.00 ? 18 ASP A O    17 
ATOM   9584  C  CB   . ASP A 1 18 ? 8.510   1.129   0.093   1.00 0.00 ? 18 ASP A CB   17 
ATOM   9585  C  CG   . ASP A 1 18 ? 9.104   1.501   1.453   1.00 0.00 ? 18 ASP A CG   17 
ATOM   9586  O  OD1  . ASP A 1 18 ? 9.275   0.616   2.312   1.00 0.00 ? 18 ASP A OD1  17 
ATOM   9587  O  OD2  . ASP A 1 18 ? 9.465   2.684   1.641   1.00 0.00 ? 18 ASP A OD2  17 
ATOM   9588  H  H    . ASP A 1 18 ? 5.331   1.642   -0.826  1.00 0.00 ? 18 ASP A H    17 
ATOM   9589  H  HA   . ASP A 1 18 ? 6.882   -0.010  -0.724  1.00 0.00 ? 18 ASP A HA   17 
ATOM   9590  H  HB2  . ASP A 1 18 ? 9.091   0.310   -0.297  1.00 0.00 ? 18 ASP A HB2  17 
ATOM   9591  H  HB3  . ASP A 1 18 ? 8.633   1.978   -0.566  1.00 0.00 ? 18 ASP A HB3  17 
ATOM   9592  N  N    . ARG A 1 19 ? 5.230   0.204   1.613   1.00 0.00 ? 19 ARG A N    17 
ATOM   9593  C  CA   . ARG A 1 19 ? 4.534   -0.624  2.587   1.00 0.00 ? 19 ARG A CA   17 
ATOM   9594  C  C    . ARG A 1 19 ? 4.388   -2.015  2.005   1.00 0.00 ? 19 ARG A C    17 
ATOM   9595  O  O    . ARG A 1 19 ? 4.423   -2.166  0.795   1.00 0.00 ? 19 ARG A O    17 
ATOM   9596  C  CB   . ARG A 1 19 ? 3.157   -0.053  2.895   1.00 0.00 ? 19 ARG A CB   17 
ATOM   9597  C  CG   . ARG A 1 19 ? 3.064   0.575   4.264   1.00 0.00 ? 19 ARG A CG   17 
ATOM   9598  C  CD   . ARG A 1 19 ? 1.931   1.572   4.319   1.00 0.00 ? 19 ARG A CD   17 
ATOM   9599  N  NE   . ARG A 1 19 ? 0.631   0.911   4.325   1.00 0.00 ? 19 ARG A NE   17 
ATOM   9600  C  CZ   . ARG A 1 19 ? -0.056  0.640   5.443   1.00 0.00 ? 19 ARG A CZ   17 
ATOM   9601  N  NH1  . ARG A 1 19 ? 0.423   1.014   6.625   1.00 0.00 ? 19 ARG A NH1  17 
ATOM   9602  N  NH2  . ARG A 1 19 ? -1.226  0.016   5.379   1.00 0.00 ? 19 ARG A NH2  17 
ATOM   9603  H  H    . ARG A 1 19 ? 4.700   0.744   1.000   1.00 0.00 ? 19 ARG A H    17 
ATOM   9604  H  HA   . ARG A 1 19 ? 5.126   -0.668  3.490   1.00 0.00 ? 19 ARG A HA   17 
ATOM   9605  H  HB2  . ARG A 1 19 ? 2.919   0.701   2.159   1.00 0.00 ? 19 ARG A HB2  17 
ATOM   9606  H  HB3  . ARG A 1 19 ? 2.428   -0.848  2.835   1.00 0.00 ? 19 ARG A HB3  17 
ATOM   9607  H  HG2  . ARG A 1 19 ? 2.894   -0.198  5.000   1.00 0.00 ? 19 ARG A HG2  17 
ATOM   9608  H  HG3  . ARG A 1 19 ? 3.987   1.082   4.475   1.00 0.00 ? 19 ARG A HG3  17 
ATOM   9609  H  HD2  . ARG A 1 19 ? 2.030   2.165   5.216   1.00 0.00 ? 19 ARG A HD2  17 
ATOM   9610  H  HD3  . ARG A 1 19 ? 1.997   2.210   3.453   1.00 0.00 ? 19 ARG A HD3  17 
ATOM   9611  H  HE   . ARG A 1 19 ? 0.256   0.647   3.445   1.00 0.00 ? 19 ARG A HE   17 
ATOM   9612  H  HH11 . ARG A 1 19 ? 1.303   1.506   6.686   1.00 0.00 ? 19 ARG A HH11 17 
ATOM   9613  H  HH12 . ARG A 1 19 ? -0.085  0.805   7.470   1.00 0.00 ? 19 ARG A HH12 17 
ATOM   9614  H  HH21 . ARG A 1 19 ? -1.603  -0.257  4.495   1.00 0.00 ? 19 ARG A HH21 17 
ATOM   9615  H  HH22 . ARG A 1 19 ? -1.739  -0.194  6.225   1.00 0.00 ? 19 ARG A HH22 17 
ATOM   9616  N  N    . SER A 1 20 ? 4.218   -3.022  2.838   1.00 0.00 ? 20 SER A N    17 
ATOM   9617  C  CA   . SER A 1 20 ? 4.172   -4.397  2.335   1.00 0.00 ? 20 SER A CA   17 
ATOM   9618  C  C    . SER A 1 20 ? 2.966   -5.170  2.847   1.00 0.00 ? 20 SER A C    17 
ATOM   9619  O  O    . SER A 1 20 ? 2.532   -4.990  3.988   1.00 0.00 ? 20 SER A O    17 
ATOM   9620  C  CB   . SER A 1 20 ? 5.451   -5.139  2.710   1.00 0.00 ? 20 SER A CB   17 
ATOM   9621  O  OG   . SER A 1 20 ? 6.462   -4.237  3.133   1.00 0.00 ? 20 SER A OG   17 
ATOM   9622  H  H    . SER A 1 20 ? 4.110   -2.842  3.804   1.00 0.00 ? 20 SER A H    17 
ATOM   9623  H  HA   . SER A 1 20 ? 4.109   -4.345  1.259   1.00 0.00 ? 20 SER A HA   17 
ATOM   9624  H  HB2  . SER A 1 20 ? 5.240   -5.830  3.510   1.00 0.00 ? 20 SER A HB2  17 
ATOM   9625  H  HB3  . SER A 1 20 ? 5.811   -5.685  1.850   1.00 0.00 ? 20 SER A HB3  17 
ATOM   9626  H  HG   . SER A 1 20 ? 6.083   -3.356  3.227   1.00 0.00 ? 20 SER A HG   17 
ATOM   9627  N  N    . PHE A 1 21 ? 2.415   -6.009  1.976   1.00 0.00 ? 21 PHE A N    17 
ATOM   9628  C  CA   . PHE A 1 21 ? 1.238   -6.804  2.296   1.00 0.00 ? 21 PHE A CA   17 
ATOM   9629  C  C    . PHE A 1 21 ? 1.366   -8.198  1.693   1.00 0.00 ? 21 PHE A C    17 
ATOM   9630  O  O    . PHE A 1 21 ? 1.916   -8.368  0.606   1.00 0.00 ? 21 PHE A O    17 
ATOM   9631  C  CB   . PHE A 1 21 ? -0.028  -6.119  1.769   1.00 0.00 ? 21 PHE A CB   17 
ATOM   9632  C  CG   . PHE A 1 21 ? -0.147  -4.689  2.210   1.00 0.00 ? 21 PHE A CG   17 
ATOM   9633  C  CD1  . PHE A 1 21 ? 0.416   -3.669  1.459   1.00 0.00 ? 21 PHE A CD1  17 
ATOM   9634  C  CD2  . PHE A 1 21 ? -0.779  -4.368  3.399   1.00 0.00 ? 21 PHE A CD2  17 
ATOM   9635  C  CE1  . PHE A 1 21 ? 0.346   -2.359  1.885   1.00 0.00 ? 21 PHE A CE1  17 
ATOM   9636  C  CE2  . PHE A 1 21 ? -0.857  -3.059  3.824   1.00 0.00 ? 21 PHE A CE2  17 
ATOM   9637  C  CZ   . PHE A 1 21 ? -0.288  -2.055  3.069   1.00 0.00 ? 21 PHE A CZ   17 
ATOM   9638  H  H    . PHE A 1 21 ? 2.793   -6.074  1.063   1.00 0.00 ? 21 PHE A H    17 
ATOM   9639  H  HA   . PHE A 1 21 ? 1.173   -6.891  3.370   1.00 0.00 ? 21 PHE A HA   17 
ATOM   9640  H  HB2  . PHE A 1 21 ? -0.017  -6.137  0.690   1.00 0.00 ? 21 PHE A HB2  17 
ATOM   9641  H  HB3  . PHE A 1 21 ? -0.896  -6.653  2.126   1.00 0.00 ? 21 PHE A HB3  17 
ATOM   9642  H  HD1  . PHE A 1 21 ? 0.912   -3.907  0.528   1.00 0.00 ? 21 PHE A HD1  17 
ATOM   9643  H  HD2  . PHE A 1 21 ? -1.223  -5.155  3.992   1.00 0.00 ? 21 PHE A HD2  17 
ATOM   9644  H  HE1  . PHE A 1 21 ? 0.789   -1.573  1.292   1.00 0.00 ? 21 PHE A HE1  17 
ATOM   9645  H  HE2  . PHE A 1 21 ? -1.356  -2.821  4.752   1.00 0.00 ? 21 PHE A HE2  17 
ATOM   9646  H  HZ   . PHE A 1 21 ? -0.335  -1.033  3.409   1.00 0.00 ? 21 PHE A HZ   17 
ATOM   9647  N  N    . SER A 1 22 ? 0.885   -9.192  2.414   1.00 0.00 ? 22 SER A N    17 
ATOM   9648  C  CA   . SER A 1 22 ? 0.936   -10.567 1.958   1.00 0.00 ? 22 SER A CA   17 
ATOM   9649  C  C    . SER A 1 22 ? -0.260  -10.875 1.064   1.00 0.00 ? 22 SER A C    17 
ATOM   9650  O  O    . SER A 1 22 ? -0.232  -11.804 0.260   1.00 0.00 ? 22 SER A O    17 
ATOM   9651  C  CB   . SER A 1 22 ? 0.958   -11.498 3.167   1.00 0.00 ? 22 SER A CB   17 
ATOM   9652  O  OG   . SER A 1 22 ? 1.267   -10.778 4.351   1.00 0.00 ? 22 SER A OG   17 
ATOM   9653  H  H    . SER A 1 22 ? 0.480   -9.001  3.286   1.00 0.00 ? 22 SER A H    17 
ATOM   9654  H  HA   . SER A 1 22 ? 1.848   -10.700 1.391   1.00 0.00 ? 22 SER A HA   17 
ATOM   9655  H  HB2  . SER A 1 22 ? -0.012  -11.961 3.283   1.00 0.00 ? 22 SER A HB2  17 
ATOM   9656  H  HB3  . SER A 1 22 ? 1.705   -12.257 3.019   1.00 0.00 ? 22 SER A HB3  17 
ATOM   9657  H  HG   . SER A 1 22 ? 2.119   -11.089 4.697   1.00 0.00 ? 22 SER A HG   17 
ATOM   9658  N  N    . ARG A 1 23 ? -1.299  -10.059 1.192   1.00 0.00 ? 23 ARG A N    17 
ATOM   9659  C  CA   . ARG A 1 23 ? -2.497  -10.194 0.372   1.00 0.00 ? 23 ARG A CA   17 
ATOM   9660  C  C    . ARG A 1 23 ? -2.783  -8.884  -0.344  1.00 0.00 ? 23 ARG A C    17 
ATOM   9661  O  O    . ARG A 1 23 ? -2.775  -7.817  0.274   1.00 0.00 ? 23 ARG A O    17 
ATOM   9662  C  CB   . ARG A 1 23 ? -3.695  -10.607 1.236   1.00 0.00 ? 23 ARG A CB   17 
ATOM   9663  C  CG   . ARG A 1 23 ? -3.462  -11.894 2.015   1.00 0.00 ? 23 ARG A CG   17 
ATOM   9664  C  CD   . ARG A 1 23 ? -4.760  -12.521 2.521   1.00 0.00 ? 23 ARG A CD   17 
ATOM   9665  N  NE   . ARG A 1 23 ? -5.953  -11.752 2.156   1.00 0.00 ? 23 ARG A NE   17 
ATOM   9666  C  CZ   . ARG A 1 23 ? -6.958  -12.235 1.423   1.00 0.00 ? 23 ARG A CZ   17 
ATOM   9667  N  NH1  . ARG A 1 23 ? -6.891  -13.458 0.913   1.00 0.00 ? 23 ARG A NH1  17 
ATOM   9668  N  NH2  . ARG A 1 23 ? -8.031  -11.487 1.206   1.00 0.00 ? 23 ARG A NH2  17 
ATOM   9669  H  H    . ARG A 1 23 ? -1.245  -9.319  1.836   1.00 0.00 ? 23 ARG A H    17 
ATOM   9670  H  HA   . ARG A 1 23 ? -2.318  -10.957 -0.369  1.00 0.00 ? 23 ARG A HA   17 
ATOM   9671  H  HB2  . ARG A 1 23 ? -3.908  -9.816  1.941   1.00 0.00 ? 23 ARG A HB2  17 
ATOM   9672  H  HB3  . ARG A 1 23 ? -4.554  -10.748 0.597   1.00 0.00 ? 23 ARG A HB3  17 
ATOM   9673  H  HG2  . ARG A 1 23 ? -2.966  -12.603 1.368   1.00 0.00 ? 23 ARG A HG2  17 
ATOM   9674  H  HG3  . ARG A 1 23 ? -2.828  -11.674 2.862   1.00 0.00 ? 23 ARG A HG3  17 
ATOM   9675  H  HD2  . ARG A 1 23 ? -4.849  -13.512 2.101   1.00 0.00 ? 23 ARG A HD2  17 
ATOM   9676  H  HD3  . ARG A 1 23 ? -4.710  -12.595 3.598   1.00 0.00 ? 23 ARG A HD3  17 
ATOM   9677  H  HE   . ARG A 1 23 ? -6.022  -10.829 2.505   1.00 0.00 ? 23 ARG A HE   17 
ATOM   9678  H  HH11 . ARG A 1 23 ? -6.081  -14.035 1.078   1.00 0.00 ? 23 ARG A HH11 17 
ATOM   9679  H  HH12 . ARG A 1 23 ? -7.647  -13.815 0.349   1.00 0.00 ? 23 ARG A HH12 17 
ATOM   9680  H  HH21 . ARG A 1 23 ? -8.084  -10.565 1.597   1.00 0.00 ? 23 ARG A HH21 17 
ATOM   9681  H  HH22 . ARG A 1 23 ? -8.794  -11.834 0.648   1.00 0.00 ? 23 ARG A HH22 17 
ATOM   9682  N  N    . SER A 1 24 ? -3.028  -8.968  -1.646  1.00 0.00 ? 24 SER A N    17 
ATOM   9683  C  CA   . SER A 1 24 ? -3.314  -7.789  -2.455  1.00 0.00 ? 24 SER A CA   17 
ATOM   9684  C  C    . SER A 1 24 ? -4.588  -7.098  -1.969  1.00 0.00 ? 24 SER A C    17 
ATOM   9685  O  O    . SER A 1 24 ? -4.770  -5.892  -2.152  1.00 0.00 ? 24 SER A O    17 
ATOM   9686  C  CB   . SER A 1 24 ? -3.453  -8.175  -3.928  1.00 0.00 ? 24 SER A CB   17 
ATOM   9687  O  OG   . SER A 1 24 ? -2.715  -7.288  -4.756  1.00 0.00 ? 24 SER A OG   17 
ATOM   9688  H  H    . SER A 1 24 ? -3.020  -9.852  -2.077  1.00 0.00 ? 24 SER A H    17 
ATOM   9689  H  HA   . SER A 1 24 ? -2.481  -7.107  -2.348  1.00 0.00 ? 24 SER A HA   17 
ATOM   9690  H  HB2  . SER A 1 24 ? -3.078  -9.178  -4.073  1.00 0.00 ? 24 SER A HB2  17 
ATOM   9691  H  HB3  . SER A 1 24 ? -4.493  -8.136  -4.212  1.00 0.00 ? 24 SER A HB3  17 
ATOM   9692  H  HG   . SER A 1 24 ? -2.659  -7.656  -5.652  1.00 0.00 ? 24 SER A HG   17 
ATOM   9693  N  N    . ASP A 1 25 ? -5.434  -7.859  -1.287  1.00 0.00 ? 25 ASP A N    17 
ATOM   9694  C  CA   . ASP A 1 25 ? -6.642  -7.326  -0.683  1.00 0.00 ? 25 ASP A CA   17 
ATOM   9695  C  C    . ASP A 1 25 ? -6.289  -6.295  0.383   1.00 0.00 ? 25 ASP A C    17 
ATOM   9696  O  O    . ASP A 1 25 ? -6.795  -5.174  0.372   1.00 0.00 ? 25 ASP A O    17 
ATOM   9697  C  CB   . ASP A 1 25 ? -7.461  -8.484  -0.100  1.00 0.00 ? 25 ASP A CB   17 
ATOM   9698  C  CG   . ASP A 1 25 ? -7.682  -8.416  1.403   1.00 0.00 ? 25 ASP A CG   17 
ATOM   9699  O  OD1  . ASP A 1 25 ? -6.843  -8.958  2.151   1.00 0.00 ? 25 ASP A OD1  17 
ATOM   9700  O  OD2  . ASP A 1 25 ? -8.720  -7.876  1.837   1.00 0.00 ? 25 ASP A OD2  17 
ATOM   9701  H  H    . ASP A 1 25 ? -5.226  -8.814  -1.161  1.00 0.00 ? 25 ASP A H    17 
ATOM   9702  H  HA   . ASP A 1 25 ? -7.215  -6.844  -1.459  1.00 0.00 ? 25 ASP A HA   17 
ATOM   9703  H  HB2  . ASP A 1 25 ? -8.412  -8.498  -0.576  1.00 0.00 ? 25 ASP A HB2  17 
ATOM   9704  H  HB3  . ASP A 1 25 ? -6.950  -9.411  -0.320  1.00 0.00 ? 25 ASP A HB3  17 
ATOM   9705  N  N    . HIS A 1 26 ? -5.332  -6.654  1.225   1.00 0.00 ? 26 HIS A N    17 
ATOM   9706  C  CA   . HIS A 1 26 ? -4.827  -5.753  2.257   1.00 0.00 ? 26 HIS A CA   17 
ATOM   9707  C  C    . HIS A 1 26 ? -4.125  -4.555  1.624   1.00 0.00 ? 26 HIS A C    17 
ATOM   9708  O  O    . HIS A 1 26 ? -4.265  -3.424  2.093   1.00 0.00 ? 26 HIS A O    17 
ATOM   9709  C  CB   . HIS A 1 26 ? -3.864  -6.487  3.191   1.00 0.00 ? 26 HIS A CB   17 
ATOM   9710  C  CG   . HIS A 1 26 ? -4.506  -6.965  4.455   1.00 0.00 ? 26 HIS A CG   17 
ATOM   9711  N  ND1  . HIS A 1 26 ? -3.888  -6.910  5.687   1.00 0.00 ? 26 HIS A ND1  17 
ATOM   9712  C  CD2  . HIS A 1 26 ? -5.717  -7.522  4.673   1.00 0.00 ? 26 HIS A CD2  17 
ATOM   9713  C  CE1  . HIS A 1 26 ? -4.693  -7.414  6.603   1.00 0.00 ? 26 HIS A CE1  17 
ATOM   9714  N  NE2  . HIS A 1 26 ? -5.809  -7.791  6.013   1.00 0.00 ? 26 HIS A NE2  17 
ATOM   9715  H  H    . HIS A 1 26 ? -4.935  -7.542  1.124   1.00 0.00 ? 26 HIS A H    17 
ATOM   9716  H  HA   . HIS A 1 26 ? -5.671  -5.399  2.827   1.00 0.00 ? 26 HIS A HA   17 
ATOM   9717  H  HB2  . HIS A 1 26 ? -3.462  -7.348  2.679   1.00 0.00 ? 26 HIS A HB2  17 
ATOM   9718  H  HB3  . HIS A 1 26 ? -3.056  -5.821  3.457   1.00 0.00 ? 26 HIS A HB3  17 
ATOM   9719  H  HD1  . HIS A 1 26 ? -2.982  -6.556  5.864   1.00 0.00 ? 26 HIS A HD1  17 
ATOM   9720  H  HD2  . HIS A 1 26 ? -6.471  -7.729  3.925   1.00 0.00 ? 26 HIS A HD2  17 
ATOM   9721  H  HE1  . HIS A 1 26 ? -4.475  -7.500  7.658   1.00 0.00 ? 26 HIS A HE1  17 
ATOM   9722  H  HE2  . HIS A 1 26 ? -6.636  -8.053  6.484   1.00 0.00 ? 26 HIS A HE2  17 
ATOM   9723  N  N    . LEU A 1 27 ? -3.441  -4.804  0.505   1.00 0.00 ? 27 LEU A N    17 
ATOM   9724  C  CA   . LEU A 1 27 ? -2.811  -3.741  -0.271  1.00 0.00 ? 27 LEU A CA   17 
ATOM   9725  C  C    . LEU A 1 27 ? -3.846  -2.688  -0.647  1.00 0.00 ? 27 LEU A C    17 
ATOM   9726  O  O    . LEU A 1 27 ? -3.713  -1.515  -0.299  1.00 0.00 ? 27 LEU A O    17 
ATOM   9727  C  CB   . LEU A 1 27 ? -2.192  -4.305  -1.559  1.00 0.00 ? 27 LEU A CB   17 
ATOM   9728  C  CG   . LEU A 1 27 ? -1.253  -3.362  -2.332  1.00 0.00 ? 27 LEU A CG   17 
ATOM   9729  C  CD1  . LEU A 1 27 ? -0.733  -2.236  -1.452  1.00 0.00 ? 27 LEU A CD1  17 
ATOM   9730  C  CD2  . LEU A 1 27 ? -0.105  -4.131  -2.952  1.00 0.00 ? 27 LEU A CD2  17 
ATOM   9731  H  H    . LEU A 1 27 ? -3.416  -5.722  0.162   1.00 0.00 ? 27 LEU A H    17 
ATOM   9732  H  HA   . LEU A 1 27 ? -2.039  -3.288  0.331   1.00 0.00 ? 27 LEU A HA   17 
ATOM   9733  H  HB2  . LEU A 1 27 ? -1.635  -5.192  -1.300  1.00 0.00 ? 27 LEU A HB2  17 
ATOM   9734  H  HB3  . LEU A 1 27 ? -2.998  -4.590  -2.219  1.00 0.00 ? 27 LEU A HB3  17 
ATOM   9735  H  HG   . LEU A 1 27 ? -1.811  -2.909  -3.138  1.00 0.00 ? 27 LEU A HG   17 
ATOM   9736  H  HD11 . LEU A 1 27 ? 0.132   -2.580  -0.901  1.00 0.00 ? 27 LEU A HD11 17 
ATOM   9737  H  HD12 . LEU A 1 27 ? -0.455  -1.396  -2.070  1.00 0.00 ? 27 LEU A HD12 17 
ATOM   9738  H  HD13 . LEU A 1 27 ? -1.504  -1.936  -0.759  1.00 0.00 ? 27 LEU A HD13 17 
ATOM   9739  H  HD21 . LEU A 1 27 ? -0.304  -5.191  -2.888  1.00 0.00 ? 27 LEU A HD21 17 
ATOM   9740  H  HD22 . LEU A 1 27 ? -0.001  -3.843  -3.987  1.00 0.00 ? 27 LEU A HD22 17 
ATOM   9741  H  HD23 . LEU A 1 27 ? 0.807   -3.901  -2.422  1.00 0.00 ? 27 LEU A HD23 17 
ATOM   9742  N  N    . ALA A 1 28 ? -4.856  -3.127  -1.390  1.00 0.00 ? 28 ALA A N    17 
ATOM   9743  C  CA   . ALA A 1 28 ? -5.910  -2.247  -1.873  1.00 0.00 ? 28 ALA A CA   17 
ATOM   9744  C  C    . ALA A 1 28 ? -6.593  -1.506  -0.730  1.00 0.00 ? 28 ALA A C    17 
ATOM   9745  O  O    . ALA A 1 28 ? -6.906  -0.328  -0.859  1.00 0.00 ? 28 ALA A O    17 
ATOM   9746  C  CB   . ALA A 1 28 ? -6.926  -3.041  -2.679  1.00 0.00 ? 28 ALA A CB   17 
ATOM   9747  H  H    . ALA A 1 28 ? -4.878  -4.078  -1.643  1.00 0.00 ? 28 ALA A H    17 
ATOM   9748  H  HA   . ALA A 1 28 ? -5.452  -1.519  -2.532  1.00 0.00 ? 28 ALA A HA   17 
ATOM   9749  H  HB1  . ALA A 1 28 ? -6.418  -3.805  -3.249  1.00 0.00 ? 28 ALA A HB1  17 
ATOM   9750  H  HB2  . ALA A 1 28 ? -7.635  -3.504  -2.010  1.00 0.00 ? 28 ALA A HB2  17 
ATOM   9751  H  HB3  . ALA A 1 28 ? -7.448  -2.378  -3.354  1.00 0.00 ? 28 ALA A HB3  17 
ATOM   9752  N  N    . LEU A 1 29 ? -6.787  -2.186  0.397   1.00 0.00 ? 29 LEU A N    17 
ATOM   9753  C  CA   . LEU A 1 29 ? -7.395  -1.565  1.574   1.00 0.00 ? 29 LEU A CA   17 
ATOM   9754  C  C    . LEU A 1 29 ? -6.619  -0.320  1.985   1.00 0.00 ? 29 LEU A C    17 
ATOM   9755  O  O    . LEU A 1 29 ? -7.198  0.728   2.267   1.00 0.00 ? 29 LEU A O    17 
ATOM   9756  C  CB   . LEU A 1 29 ? -7.438  -2.550  2.737   1.00 0.00 ? 29 LEU A CB   17 
ATOM   9757  C  CG   . LEU A 1 29 ? -8.381  -3.734  2.547   1.00 0.00 ? 29 LEU A CG   17 
ATOM   9758  C  CD1  . LEU A 1 29 ? -8.187  -4.749  3.659   1.00 0.00 ? 29 LEU A CD1  17 
ATOM   9759  C  CD2  . LEU A 1 29 ? -9.822  -3.255  2.497   1.00 0.00 ? 29 LEU A CD2  17 
ATOM   9760  H  H    . LEU A 1 29 ? -6.501  -3.123  0.447   1.00 0.00 ? 29 LEU A H    17 
ATOM   9761  H  HA   . LEU A 1 29 ? -8.403  -1.280  1.320   1.00 0.00 ? 29 LEU A HA   17 
ATOM   9762  H  HB2  . LEU A 1 29 ? -6.441  -2.932  2.894   1.00 0.00 ? 29 LEU A HB2  17 
ATOM   9763  H  HB3  . LEU A 1 29 ? -7.746  -2.014  3.620   1.00 0.00 ? 29 LEU A HB3  17 
ATOM   9764  H  HG   . LEU A 1 29 ? -8.155  -4.219  1.608   1.00 0.00 ? 29 LEU A HG   17 
ATOM   9765  H  HD11 . LEU A 1 29 ? -7.199  -5.181  3.583   1.00 0.00 ? 29 LEU A HD11 17 
ATOM   9766  H  HD12 . LEU A 1 29 ? -8.292  -4.258  4.616   1.00 0.00 ? 29 LEU A HD12 17 
ATOM   9767  H  HD13 . LEU A 1 29 ? -8.928  -5.529  3.571   1.00 0.00 ? 29 LEU A HD13 17 
ATOM   9768  H  HD21 . LEU A 1 29 ? -10.351 -3.618  3.366   1.00 0.00 ? 29 LEU A HD21 17 
ATOM   9769  H  HD22 . LEU A 1 29 ? -9.843  -2.176  2.487   1.00 0.00 ? 29 LEU A HD22 17 
ATOM   9770  H  HD23 . LEU A 1 29 ? -10.297 -3.632  1.603   1.00 0.00 ? 29 LEU A HD23 17 
ATOM   9771  N  N    . HIS A 1 30 ? -5.300  -0.426  1.935   1.00 0.00 ? 30 HIS A N    17 
ATOM   9772  C  CA   . HIS A 1 30 ? -4.437  0.700   2.231   1.00 0.00 ? 30 HIS A CA   17 
ATOM   9773  C  C    . HIS A 1 30 ? -4.432  1.692   1.071   1.00 0.00 ? 30 HIS A C    17 
ATOM   9774  O  O    . HIS A 1 30 ? -4.354  2.904   1.275   1.00 0.00 ? 30 HIS A O    17 
ATOM   9775  C  CB   . HIS A 1 30 ? -3.004  0.217   2.516   1.00 0.00 ? 30 HIS A CB   17 
ATOM   9776  C  CG   . HIS A 1 30 ? -1.958  1.271   2.299   1.00 0.00 ? 30 HIS A CG   17 
ATOM   9777  N  ND1  . HIS A 1 30 ? -1.820  2.375   3.101   1.00 0.00 ? 30 HIS A ND1  17 
ATOM   9778  C  CD2  . HIS A 1 30 ? -1.023  1.398   1.319   1.00 0.00 ? 30 HIS A CD2  17 
ATOM   9779  C  CE1  . HIS A 1 30 ? -0.836  3.129   2.598   1.00 0.00 ? 30 HIS A CE1  17 
ATOM   9780  N  NE2  . HIS A 1 30 ? -0.315  2.583   1.513   1.00 0.00 ? 30 HIS A NE2  17 
ATOM   9781  H  H    . HIS A 1 30 ? -4.900  -1.276  1.647   1.00 0.00 ? 30 HIS A H    17 
ATOM   9782  H  HA   . HIS A 1 30 ? -4.823  1.193   3.109   1.00 0.00 ? 30 HIS A HA   17 
ATOM   9783  H  HB2  . HIS A 1 30 ? -2.941  -0.105  3.544   1.00 0.00 ? 30 HIS A HB2  17 
ATOM   9784  H  HB3  . HIS A 1 30 ? -2.776  -0.615  1.869   1.00 0.00 ? 30 HIS A HB3  17 
ATOM   9785  H  HD1  . HIS A 1 30 ? -2.367  2.588   3.902   1.00 0.00 ? 30 HIS A HD1  17 
ATOM   9786  H  HD2  . HIS A 1 30 ? -0.853  0.703   0.510   1.00 0.00 ? 30 HIS A HD2  17 
ATOM   9787  H  HE1  . HIS A 1 30 ? -0.508  4.065   3.026   1.00 0.00 ? 30 HIS A HE1  17 
ATOM   9788  N  N    . ARG A 1 31 ? -4.391  1.166   -0.145  1.00 0.00 ? 31 ARG A N    17 
ATOM   9789  C  CA   . ARG A 1 31 ? -4.214  2.004   -1.318  1.00 0.00 ? 31 ARG A CA   17 
ATOM   9790  C  C    . ARG A 1 31 ? -5.482  2.774   -1.655  1.00 0.00 ? 31 ARG A C    17 
ATOM   9791  O  O    . ARG A 1 31 ? -5.458  3.695   -2.468  1.00 0.00 ? 31 ARG A O    17 
ATOM   9792  C  CB   . ARG A 1 31 ? -3.774  1.178   -2.521  1.00 0.00 ? 31 ARG A CB   17 
ATOM   9793  C  CG   . ARG A 1 31 ? -2.359  0.644   -2.394  1.00 0.00 ? 31 ARG A CG   17 
ATOM   9794  C  CD   . ARG A 1 31 ? -1.794  0.183   -3.728  1.00 0.00 ? 31 ARG A CD   17 
ATOM   9795  N  NE   . ARG A 1 31 ? -1.703  1.269   -4.699  1.00 0.00 ? 31 ARG A NE   17 
ATOM   9796  C  CZ   . ARG A 1 31 ? -2.203  1.212   -5.933  1.00 0.00 ? 31 ARG A CZ   17 
ATOM   9797  N  NH1  . ARG A 1 31 ? -2.894  0.150   -6.329  1.00 0.00 ? 31 ARG A NH1  17 
ATOM   9798  N  NH2  . ARG A 1 31 ? -2.025  2.232   -6.760  1.00 0.00 ? 31 ARG A NH2  17 
ATOM   9799  H  H    . ARG A 1 31 ? -4.401  0.187   -0.251  1.00 0.00 ? 31 ARG A H    17 
ATOM   9800  H  HA   . ARG A 1 31 ? -3.431  2.712   -1.080  1.00 0.00 ? 31 ARG A HA   17 
ATOM   9801  H  HB2  . ARG A 1 31 ? -4.448  0.341   -2.639  1.00 0.00 ? 31 ARG A HB2  17 
ATOM   9802  H  HB3  . ARG A 1 31 ? -3.827  1.803   -3.399  1.00 0.00 ? 31 ARG A HB3  17 
ATOM   9803  H  HG2  . ARG A 1 31 ? -1.730  1.426   -2.003  1.00 0.00 ? 31 ARG A HG2  17 
ATOM   9804  H  HG3  . ARG A 1 31 ? -2.362  -0.191  -1.708  1.00 0.00 ? 31 ARG A HG3  17 
ATOM   9805  H  HD2  . ARG A 1 31 ? -0.801  -0.214  -3.562  1.00 0.00 ? 31 ARG A HD2  17 
ATOM   9806  H  HD3  . ARG A 1 31 ? -2.431  -0.594  -4.128  1.00 0.00 ? 31 ARG A HD3  17 
ATOM   9807  H  HE   . ARG A 1 31 ? -1.215  2.081   -4.423  1.00 0.00 ? 31 ARG A HE   17 
ATOM   9808  H  HH11 . ARG A 1 31 ? -3.047  -0.621  -5.696  1.00 0.00 ? 31 ARG A HH11 17 
ATOM   9809  H  HH12 . ARG A 1 31 ? -3.268  0.106   -7.263  1.00 0.00 ? 31 ARG A HH12 17 
ATOM   9810  H  HH21 . ARG A 1 31 ? -1.516  3.044   -6.455  1.00 0.00 ? 31 ARG A HH21 17 
ATOM   9811  H  HH22 . ARG A 1 31 ? -2.384  2.196   -7.699  1.00 0.00 ? 31 ARG A HH22 17 
ATOM   9812  N  N    . LYS A 1 32 ? -6.569  2.443   -0.978  1.00 0.00 ? 32 LYS A N    17 
ATOM   9813  C  CA   . LYS A 1 32 ? -7.821  3.160   -1.150  1.00 0.00 ? 32 LYS A CA   17 
ATOM   9814  C  C    . LYS A 1 32 ? -7.637  4.614   -0.746  1.00 0.00 ? 32 LYS A C    17 
ATOM   9815  O  O    . LYS A 1 32 ? -8.218  5.520   -1.341  1.00 0.00 ? 32 LYS A O    17 
ATOM   9816  C  CB   . LYS A 1 32 ? -8.923  2.516   -0.311  1.00 0.00 ? 32 LYS A CB   17 
ATOM   9817  C  CG   . LYS A 1 32 ? -10.006 1.854   -1.143  1.00 0.00 ? 32 LYS A CG   17 
ATOM   9818  C  CD   . LYS A 1 32 ? -9.420  0.836   -2.107  1.00 0.00 ? 32 LYS A CD   17 
ATOM   9819  C  CE   . LYS A 1 32 ? -10.246 -0.437  -2.137  1.00 0.00 ? 32 LYS A CE   17 
ATOM   9820  N  NZ   . LYS A 1 32 ? -10.096 -1.165  -3.423  1.00 0.00 ? 32 LYS A NZ   17 
ATOM   9821  H  H    . LYS A 1 32 ? -6.521  1.716   -0.317  1.00 0.00 ? 32 LYS A H    17 
ATOM   9822  H  HA   . LYS A 1 32 ? -8.096  3.115   -2.192  1.00 0.00 ? 32 LYS A HA   17 
ATOM   9823  H  HB2  . LYS A 1 32 ? -8.479  1.767   0.327   1.00 0.00 ? 32 LYS A HB2  17 
ATOM   9824  H  HB3  . LYS A 1 32 ? -9.382  3.276   0.303   1.00 0.00 ? 32 LYS A HB3  17 
ATOM   9825  H  HG2  . LYS A 1 32 ? -10.697 1.352   -0.482  1.00 0.00 ? 32 LYS A HG2  17 
ATOM   9826  H  HG3  . LYS A 1 32 ? -10.529 2.613   -1.706  1.00 0.00 ? 32 LYS A HG3  17 
ATOM   9827  H  HD2  . LYS A 1 32 ? -9.400  1.262   -3.099  1.00 0.00 ? 32 LYS A HD2  17 
ATOM   9828  H  HD3  . LYS A 1 32 ? -8.410  0.594   -1.794  1.00 0.00 ? 32 LYS A HD3  17 
ATOM   9829  H  HE2  . LYS A 1 32 ? -9.924  -1.078  -1.330  1.00 0.00 ? 32 LYS A HE2  17 
ATOM   9830  H  HE3  . LYS A 1 32 ? -11.285 -0.178  -1.998  1.00 0.00 ? 32 LYS A HE3  17 
ATOM   9831  H  HZ1  . LYS A 1 32 ? -9.203  -0.893  -3.891  1.00 0.00 ? 32 LYS A HZ1  17 
ATOM   9832  H  HZ2  . LYS A 1 32 ? -10.890 -0.935  -4.059  1.00 0.00 ? 32 LYS A HZ2  17 
ATOM   9833  H  HZ3  . LYS A 1 32 ? -10.088 -2.197  -3.255  1.00 0.00 ? 32 LYS A HZ3  17 
ATOM   9834  N  N    . ARG A 1 33 ? -6.742  4.830   0.208   1.00 0.00 ? 33 ARG A N    17 
ATOM   9835  C  CA   . ARG A 1 33 ? -6.418  6.171   0.664   1.00 0.00 ? 33 ARG A CA   17 
ATOM   9836  C  C    . ARG A 1 33 ? -5.602  6.925   -0.378  1.00 0.00 ? 33 ARG A C    17 
ATOM   9837  O  O    . ARG A 1 33 ? -5.537  8.152   -0.354  1.00 0.00 ? 33 ARG A O    17 
ATOM   9838  C  CB   . ARG A 1 33 ? -5.642  6.109   1.979   1.00 0.00 ? 33 ARG A CB   17 
ATOM   9839  C  CG   . ARG A 1 33 ? -6.524  5.946   3.204   1.00 0.00 ? 33 ARG A CG   17 
ATOM   9840  C  CD   . ARG A 1 33 ? -5.692  5.757   4.460   1.00 0.00 ? 33 ARG A CD   17 
ATOM   9841  N  NE   . ARG A 1 33 ? -5.015  6.992   4.863   1.00 0.00 ? 33 ARG A NE   17 
ATOM   9842  C  CZ   . ARG A 1 33 ? -4.729  7.303   6.127   1.00 0.00 ? 33 ARG A CZ   17 
ATOM   9843  N  NH1  . ARG A 1 33 ? -5.053  6.471   7.108   1.00 0.00 ? 33 ARG A NH1  17 
ATOM   9844  N  NH2  . ARG A 1 33 ? -4.106  8.439   6.410   1.00 0.00 ? 33 ARG A NH2  17 
ATOM   9845  H  H    . ARG A 1 33 ? -6.261  4.064   0.593   1.00 0.00 ? 33 ARG A H    17 
ATOM   9846  H  HA   . ARG A 1 33 ? -7.343  6.694   0.821   1.00 0.00 ? 33 ARG A HA   17 
ATOM   9847  H  HB2  . ARG A 1 33 ? -4.959  5.275   1.940   1.00 0.00 ? 33 ARG A HB2  17 
ATOM   9848  H  HB3  . ARG A 1 33 ? -5.076  7.022   2.092   1.00 0.00 ? 33 ARG A HB3  17 
ATOM   9849  H  HG2  . ARG A 1 33 ? -7.132  6.829   3.317   1.00 0.00 ? 33 ARG A HG2  17 
ATOM   9850  H  HG3  . ARG A 1 33 ? -7.158  5.082   3.069   1.00 0.00 ? 33 ARG A HG3  17 
ATOM   9851  H  HD2  . ARG A 1 33 ? -6.343  5.437   5.262   1.00 0.00 ? 33 ARG A HD2  17 
ATOM   9852  H  HD3  . ARG A 1 33 ? -4.951  4.996   4.275   1.00 0.00 ? 33 ARG A HD3  17 
ATOM   9853  H  HE   . ARG A 1 33 ? -4.761  7.620   4.151   1.00 0.00 ? 33 ARG A HE   17 
ATOM   9854  H  HH11 . ARG A 1 33 ? -5.516  5.600   6.905   1.00 0.00 ? 33 ARG A HH11 17 
ATOM   9855  H  HH12 . ARG A 1 33 ? -4.834  6.704   8.065   1.00 0.00 ? 33 ARG A HH12 17 
ATOM   9856  H  HH21 . ARG A 1 33 ? -3.841  9.074   5.672   1.00 0.00 ? 33 ARG A HH21 17 
ATOM   9857  H  HH22 . ARG A 1 33 ? -3.892  8.671   7.371   1.00 0.00 ? 33 ARG A HH22 17 
ATOM   9858  N  N    . HIS A 1 34 ? -5.026  6.193   -1.319  1.00 0.00 ? 34 HIS A N    17 
ATOM   9859  C  CA   . HIS A 1 34 ? -4.229  6.804   -2.373  1.00 0.00 ? 34 HIS A CA   17 
ATOM   9860  C  C    . HIS A 1 34 ? -5.124  7.312   -3.496  1.00 0.00 ? 34 HIS A C    17 
ATOM   9861  O  O    . HIS A 1 34 ? -4.683  8.054   -4.373  1.00 0.00 ? 34 HIS A O    17 
ATOM   9862  C  CB   . HIS A 1 34 ? -3.203  5.808   -2.914  1.00 0.00 ? 34 HIS A CB   17 
ATOM   9863  C  CG   . HIS A 1 34 ? -2.025  5.613   -2.010  1.00 0.00 ? 34 HIS A CG   17 
ATOM   9864  N  ND1  . HIS A 1 34 ? -1.108  6.598   -1.727  1.00 0.00 ? 34 HIS A ND1  17 
ATOM   9865  C  CD2  . HIS A 1 34 ? -1.633  4.523   -1.301  1.00 0.00 ? 34 HIS A CD2  17 
ATOM   9866  C  CE1  . HIS A 1 34 ? -0.210  6.089   -0.873  1.00 0.00 ? 34 HIS A CE1  17 
ATOM   9867  N  NE2  . HIS A 1 34 ? -0.481  4.831   -0.581  1.00 0.00 ? 34 HIS A NE2  17 
ATOM   9868  H  H    . HIS A 1 34 ? -5.164  5.218   -1.325  1.00 0.00 ? 34 HIS A H    17 
ATOM   9869  H  HA   . HIS A 1 34 ? -3.706  7.645   -1.942  1.00 0.00 ? 34 HIS A HA   17 
ATOM   9870  H  HB2  . HIS A 1 34 ? -3.680  4.849   -3.047  1.00 0.00 ? 34 HIS A HB2  17 
ATOM   9871  H  HB3  . HIS A 1 34 ? -2.838  6.159   -3.867  1.00 0.00 ? 34 HIS A HB3  17 
ATOM   9872  H  HD1  . HIS A 1 34 ? -1.098  7.515   -2.104  1.00 0.00 ? 34 HIS A HD1  17 
ATOM   9873  H  HD2  . HIS A 1 34 ? -2.116  3.556   -1.300  1.00 0.00 ? 34 HIS A HD2  17 
ATOM   9874  H  HE1  . HIS A 1 34 ? 0.630   6.639   -0.473  1.00 0.00 ? 34 HIS A HE1  17 
ATOM   9875  N  N    . MET A 1 35 ? -6.400  6.959   -3.420  1.00 0.00 ? 35 MET A N    17 
ATOM   9876  C  CA   . MET A 1 35 ? -7.384  7.432   -4.384  1.00 0.00 ? 35 MET A CA   17 
ATOM   9877  C  C    . MET A 1 35 ? -8.141  8.622   -3.812  1.00 0.00 ? 35 MET A C    17 
ATOM   9878  O  O    . MET A 1 35 ? -8.903  9.289   -4.512  1.00 0.00 ? 35 MET A O    17 
ATOM   9879  C  CB   . MET A 1 35 ? -8.368  6.317   -4.745  1.00 0.00 ? 35 MET A CB   17 
ATOM   9880  C  CG   . MET A 1 35 ? -7.703  4.981   -5.028  1.00 0.00 ? 35 MET A CG   17 
ATOM   9881  S  SD   . MET A 1 35 ? -8.676  3.579   -4.446  1.00 0.00 ? 35 MET A SD   17 
ATOM   9882  C  CE   . MET A 1 35 ? -10.003 3.563   -5.651  1.00 0.00 ? 35 MET A CE   17 
ATOM   9883  H  H    . MET A 1 35 ? -6.697  6.400   -2.668  1.00 0.00 ? 35 MET A H    17 
ATOM   9884  H  HA   . MET A 1 35 ? -6.858  7.744   -5.272  1.00 0.00 ? 35 MET A HA   17 
ATOM   9885  H  HB2  . MET A 1 35 ? -9.058  6.184   -3.925  1.00 0.00 ? 35 MET A HB2  17 
ATOM   9886  H  HB3  . MET A 1 35 ? -8.921  6.612   -5.624  1.00 0.00 ? 35 MET A HB3  17 
ATOM   9887  H  HG2  . MET A 1 35 ? -7.561  4.884   -6.092  1.00 0.00 ? 35 MET A HG2  17 
ATOM   9888  H  HG3  . MET A 1 35 ? -6.742  4.962   -4.535  1.00 0.00 ? 35 MET A HG3  17 
ATOM   9889  H  HE1  . MET A 1 35 ? -9.656  3.099   -6.563  1.00 0.00 ? 35 MET A HE1  17 
ATOM   9890  H  HE2  . MET A 1 35 ? -10.839 3.003   -5.258  1.00 0.00 ? 35 MET A HE2  17 
ATOM   9891  H  HE3  . MET A 1 35 ? -10.313 4.576   -5.856  1.00 0.00 ? 35 MET A HE3  17 
ATOM   9892  N  N    . LEU A 1 36 ? -7.917  8.877   -2.530  1.00 0.00 ? 36 LEU A N    17 
ATOM   9893  C  CA   . LEU A 1 36 ? -8.553  9.989   -1.841  1.00 0.00 ? 36 LEU A CA   17 
ATOM   9894  C  C    . LEU A 1 36 ? -7.546  10.666  -0.919  1.00 0.00 ? 36 LEU A C    17 
ATOM   9895  O  O    . LEU A 1 36 ? -7.685  10.632  0.307   1.00 0.00 ? 36 LEU A O    17 
ATOM   9896  C  CB   . LEU A 1 36 ? -9.768  9.508   -1.033  1.00 0.00 ? 36 LEU A CB   17 
ATOM   9897  C  CG   . LEU A 1 36 ? -10.612 8.420   -1.704  1.00 0.00 ? 36 LEU A CG   17 
ATOM   9898  C  CD1  . LEU A 1 36 ? -10.850 7.263   -0.748  1.00 0.00 ? 36 LEU A CD1  17 
ATOM   9899  C  CD2  . LEU A 1 36 ? -11.933 8.990   -2.194  1.00 0.00 ? 36 LEU A CD2  17 
ATOM   9900  H  H    . LEU A 1 36 ? -7.288  8.312   -2.037  1.00 0.00 ? 36 LEU A H    17 
ATOM   9901  H  HA   . LEU A 1 36 ? -8.880  10.700  -2.586  1.00 0.00 ? 36 LEU A HA   17 
ATOM   9902  H  HB2  . LEU A 1 36 ? -9.413  9.126   -0.088  1.00 0.00 ? 36 LEU A HB2  17 
ATOM   9903  H  HB3  . LEU A 1 36 ? -10.404 10.358  -0.843  1.00 0.00 ? 36 LEU A HB3  17 
ATOM   9904  H  HG   . LEU A 1 36 ? -10.076 8.035   -2.559  1.00 0.00 ? 36 LEU A HG   17 
ATOM   9905  H  HD11 . LEU A 1 36 ? -11.313 7.633   0.154   1.00 0.00 ? 36 LEU A HD11 17 
ATOM   9906  H  HD12 . LEU A 1 36 ? -11.498 6.537   -1.216  1.00 0.00 ? 36 LEU A HD12 17 
ATOM   9907  H  HD13 . LEU A 1 36 ? -9.907  6.799   -0.504  1.00 0.00 ? 36 LEU A HD13 17 
ATOM   9908  H  HD21 . LEU A 1 36 ? -11.804 10.031  -2.451  1.00 0.00 ? 36 LEU A HD21 17 
ATOM   9909  H  HD22 . LEU A 1 36 ? -12.261 8.442   -3.065  1.00 0.00 ? 36 LEU A HD22 17 
ATOM   9910  H  HD23 . LEU A 1 36 ? -12.675 8.903   -1.414  1.00 0.00 ? 36 LEU A HD23 17 
ATOM   9911  N  N    . VAL A 1 37 ? -6.497  11.218  -1.512  1.00 0.00 ? 37 VAL A N    17 
ATOM   9912  C  CA   . VAL A 1 37 ? -5.434  11.853  -0.745  1.00 0.00 ? 37 VAL A CA   17 
ATOM   9913  C  C    . VAL A 1 37 ? -5.792  13.297  -0.419  1.00 0.00 ? 37 VAL A C    17 
ATOM   9914  O  O    . VAL A 1 37 ? -6.877  13.754  -0.842  1.00 0.00 ? 37 VAL A O    17 
ATOM   9915  C  CB   . VAL A 1 37 ? -4.085  11.824  -1.496  1.00 0.00 ? 37 VAL A CB   17 
ATOM   9916  C  CG1  . VAL A 1 37 ? -3.542  10.407  -1.568  1.00 0.00 ? 37 VAL A CG1  17 
ATOM   9917  C  CG2  . VAL A 1 37 ? -4.222  12.418  -2.890  1.00 0.00 ? 37 VAL A CG2  17 
ATOM   9918  O  OXT  . VAL A 1 37 ? -4.992  13.973  0.262   1.00 0.00 ? 37 VAL A OXT  17 
ATOM   9919  H  H    . VAL A 1 37 ? -6.428  11.187  -2.491  1.00 0.00 ? 37 VAL A H    17 
ATOM   9920  H  HA   . VAL A 1 37 ? -5.320  11.304  0.180   1.00 0.00 ? 37 VAL A HA   17 
ATOM   9921  H  HB   . VAL A 1 37 ? -3.377  12.426  -0.943  1.00 0.00 ? 37 VAL A HB   17 
ATOM   9922  H  HG11 . VAL A 1 37 ? -2.536  10.386  -1.179  1.00 0.00 ? 37 VAL A HG11 17 
ATOM   9923  H  HG12 . VAL A 1 37 ? -4.170  9.752   -0.983  1.00 0.00 ? 37 VAL A HG12 17 
ATOM   9924  H  HG13 . VAL A 1 37 ? -3.538  10.076  -2.596  1.00 0.00 ? 37 VAL A HG13 17 
ATOM   9925  H  HG21 . VAL A 1 37 ? -4.880  11.800  -3.481  1.00 0.00 ? 37 VAL A HG21 17 
ATOM   9926  H  HG22 . VAL A 1 37 ? -4.632  13.416  -2.818  1.00 0.00 ? 37 VAL A HG22 17 
ATOM   9927  H  HG23 . VAL A 1 37 ? -3.250  12.462  -3.359  1.00 0.00 ? 37 VAL A HG23 17 
HETATM 9928  ZN ZN   . ZN  B 2 .  ? 0.804   3.578   0.215   1.00 0.00 ? 38 ZN  A ZN   17 
ATOM   9929  N  N    . GLY A 1 1  ? 10.386  -7.039  -4.944  1.00 0.00 ? 1  GLY A N    18 
ATOM   9930  C  CA   . GLY A 1 1  ? 11.506  -6.077  -4.812  1.00 0.00 ? 1  GLY A CA   18 
ATOM   9931  C  C    . GLY A 1 1  ? 11.158  -4.937  -3.880  1.00 0.00 ? 1  GLY A C    18 
ATOM   9932  O  O    . GLY A 1 1  ? 9.983   -4.641  -3.676  1.00 0.00 ? 1  GLY A O    18 
ATOM   9933  H  H1   . GLY A 1 1  ? 10.624  -7.772  -5.642  1.00 0.00 ? 1  GLY A H1   18 
ATOM   9934  H  H2   . GLY A 1 1  ? 9.527   -6.543  -5.255  1.00 0.00 ? 1  GLY A H2   18 
ATOM   9935  H  H3   . GLY A 1 1  ? 10.198  -7.497  -4.025  1.00 0.00 ? 1  GLY A H3   18 
ATOM   9936  H  HA2  . GLY A 1 1  ? 12.374  -6.593  -4.427  1.00 0.00 ? 1  GLY A HA2  18 
ATOM   9937  H  HA3  . GLY A 1 1  ? 11.740  -5.675  -5.785  1.00 0.00 ? 1  GLY A HA3  18 
ATOM   9938  N  N    . SER A 1 2  ? 12.167  -4.296  -3.319  1.00 0.00 ? 2  SER A N    18 
ATOM   9939  C  CA   . SER A 1 2  ? 11.951  -3.178  -2.415  1.00 0.00 ? 2  SER A CA   18 
ATOM   9940  C  C    . SER A 1 2  ? 12.792  -1.981  -2.837  1.00 0.00 ? 2  SER A C    18 
ATOM   9941  O  O    . SER A 1 2  ? 13.758  -2.122  -3.590  1.00 0.00 ? 2  SER A O    18 
ATOM   9942  C  CB   . SER A 1 2  ? 12.292  -3.587  -0.984  1.00 0.00 ? 2  SER A CB   18 
ATOM   9943  O  OG   . SER A 1 2  ? 11.610  -4.775  -0.621  1.00 0.00 ? 2  SER A OG   18 
ATOM   9944  H  H    . SER A 1 2  ? 13.091  -4.570  -3.529  1.00 0.00 ? 2  SER A H    18 
ATOM   9945  H  HA   . SER A 1 2  ? 10.908  -2.906  -2.464  1.00 0.00 ? 2  SER A HA   18 
ATOM   9946  H  HB2  . SER A 1 2  ? 13.355  -3.758  -0.904  1.00 0.00 ? 2  SER A HB2  18 
ATOM   9947  H  HB3  . SER A 1 2  ? 12.000  -2.797  -0.307  1.00 0.00 ? 2  SER A HB3  18 
ATOM   9948  H  HG   . SER A 1 2  ? 10.720  -4.762  -1.006  1.00 0.00 ? 2  SER A HG   18 
ATOM   9949  N  N    . THR A 1 3  ? 12.400  -0.804  -2.384  1.00 0.00 ? 3  THR A N    18 
ATOM   9950  C  CA   . THR A 1 3  ? 13.105  0.419   -2.730  1.00 0.00 ? 3  THR A CA   18 
ATOM   9951  C  C    . THR A 1 3  ? 14.273  0.653   -1.774  1.00 0.00 ? 3  THR A C    18 
ATOM   9952  O  O    . THR A 1 3  ? 14.415  -0.050  -0.772  1.00 0.00 ? 3  THR A O    18 
ATOM   9953  C  CB   . THR A 1 3  ? 12.158  1.634   -2.687  1.00 0.00 ? 3  THR A CB   18 
ATOM   9954  O  OG1  . THR A 1 3  ? 11.558  1.747   -1.389  1.00 0.00 ? 3  THR A OG1  18 
ATOM   9955  C  CG2  . THR A 1 3  ? 11.068  1.510   -3.742  1.00 0.00 ? 3  THR A CG2  18 
ATOM   9956  H  H    . THR A 1 3  ? 11.593  -0.749  -1.815  1.00 0.00 ? 3  THR A H    18 
ATOM   9957  H  HA   . THR A 1 3  ? 13.486  0.314   -3.736  1.00 0.00 ? 3  THR A HA   18 
ATOM   9958  H  HB   . THR A 1 3  ? 12.734  2.526   -2.889  1.00 0.00 ? 3  THR A HB   18 
ATOM   9959  H  HG1  . THR A 1 3  ? 11.056  0.935   -1.188  1.00 0.00 ? 3  THR A HG1  18 
ATOM   9960  H  HG21 . THR A 1 3  ? 10.637  2.482   -3.930  1.00 0.00 ? 3  THR A HG21 18 
ATOM   9961  H  HG22 . THR A 1 3  ? 10.300  0.839   -3.387  1.00 0.00 ? 3  THR A HG22 18 
ATOM   9962  H  HG23 . THR A 1 3  ? 11.492  1.120   -4.655  1.00 0.00 ? 3  THR A HG23 18 
ATOM   9963  N  N    . ARG A 1 4  ? 15.105  1.637   -2.084  1.00 0.00 ? 4  ARG A N    18 
ATOM   9964  C  CA   . ARG A 1 4  ? 16.239  1.972   -1.238  1.00 0.00 ? 4  ARG A CA   18 
ATOM   9965  C  C    . ARG A 1 4  ? 15.807  2.908   -0.118  1.00 0.00 ? 4  ARG A C    18 
ATOM   9966  O  O    . ARG A 1 4  ? 16.015  4.118   -0.192  1.00 0.00 ? 4  ARG A O    18 
ATOM   9967  C  CB   . ARG A 1 4  ? 17.343  2.624   -2.068  1.00 0.00 ? 4  ARG A CB   18 
ATOM   9968  C  CG   . ARG A 1 4  ? 18.703  1.977   -1.882  1.00 0.00 ? 4  ARG A CG   18 
ATOM   9969  C  CD   . ARG A 1 4  ? 19.756  2.995   -1.465  1.00 0.00 ? 4  ARG A CD   18 
ATOM   9970  N  NE   . ARG A 1 4  ? 19.307  3.822   -0.342  1.00 0.00 ? 4  ARG A NE   18 
ATOM   9971  C  CZ   . ARG A 1 4  ? 19.716  3.657   0.917   1.00 0.00 ? 4  ARG A CZ   18 
ATOM   9972  N  NH1  . ARG A 1 4  ? 20.626  2.736   1.210   1.00 0.00 ? 4  ARG A NH1  18 
ATOM   9973  N  NH2  . ARG A 1 4  ? 19.222  4.419   1.882   1.00 0.00 ? 4  ARG A NH2  18 
ATOM   9974  H  H    . ARG A 1 4  ? 14.951  2.158   -2.903  1.00 0.00 ? 4  ARG A H    18 
ATOM   9975  H  HA   . ARG A 1 4  ? 16.614  1.055   -0.806  1.00 0.00 ? 4  ARG A HA   18 
ATOM   9976  H  HB2  . ARG A 1 4  ? 17.077  2.563   -3.112  1.00 0.00 ? 4  ARG A HB2  18 
ATOM   9977  H  HB3  . ARG A 1 4  ? 17.422  3.663   -1.785  1.00 0.00 ? 4  ARG A HB3  18 
ATOM   9978  H  HG2  . ARG A 1 4  ? 18.626  1.218   -1.118  1.00 0.00 ? 4  ARG A HG2  18 
ATOM   9979  H  HG3  . ARG A 1 4  ? 19.001  1.523   -2.815  1.00 0.00 ? 4  ARG A HG3  18 
ATOM   9980  H  HD2  . ARG A 1 4  ? 20.653  2.467   -1.175  1.00 0.00 ? 4  ARG A HD2  18 
ATOM   9981  H  HD3  . ARG A 1 4  ? 19.972  3.635   -2.308  1.00 0.00 ? 4  ARG A HD3  18 
ATOM   9982  H  HE   . ARG A 1 4  ? 18.651  4.535   -0.542  1.00 0.00 ? 4  ARG A HE   18 
ATOM   9983  H  HH11 . ARG A 1 4  ? 21.020  2.158   0.484   1.00 0.00 ? 4  ARG A HH11 18 
ATOM   9984  H  HH12 . ARG A 1 4  ? 20.928  2.606   2.165   1.00 0.00 ? 4  ARG A HH12 18 
ATOM   9985  H  HH21 . ARG A 1 4  ? 18.535  5.125   1.672   1.00 0.00 ? 4  ARG A HH21 18 
ATOM   9986  H  HH22 . ARG A 1 4  ? 19.534  4.300   2.833   1.00 0.00 ? 4  ARG A HH22 18 
ATOM   9987  N  N    . GLY A 1 5  ? 15.148  2.354   0.883   1.00 0.00 ? 5  GLY A N    18 
ATOM   9988  C  CA   . GLY A 1 5  ? 14.649  3.153   1.980   1.00 0.00 ? 5  GLY A CA   18 
ATOM   9989  C  C    . GLY A 1 5  ? 13.528  2.455   2.715   1.00 0.00 ? 5  GLY A C    18 
ATOM   9990  O  O    . GLY A 1 5  ? 13.755  1.805   3.736   1.00 0.00 ? 5  GLY A O    18 
ATOM   9991  H  H    . GLY A 1 5  ? 14.964  1.389   0.859   1.00 0.00 ? 5  GLY A H    18 
ATOM   9992  H  HA2  . GLY A 1 5  ? 15.457  3.347   2.671   1.00 0.00 ? 5  GLY A HA2  18 
ATOM   9993  H  HA3  . GLY A 1 5  ? 14.284  4.094   1.593   1.00 0.00 ? 5  GLY A HA3  18 
ATOM   9994  N  N    . SER A 1 6  ? 12.337  2.513   2.143   1.00 0.00 ? 6  SER A N    18 
ATOM   9995  C  CA   . SER A 1 6  ? 11.183  1.830   2.700   1.00 0.00 ? 6  SER A CA   18 
ATOM   9996  C  C    . SER A 1 6  ? 11.253  0.341   2.380   1.00 0.00 ? 6  SER A C    18 
ATOM   9997  O  O    . SER A 1 6  ? 11.871  -0.061  1.391   1.00 0.00 ? 6  SER A O    18 
ATOM   9998  C  CB   . SER A 1 6  ? 9.904   2.441   2.132   1.00 0.00 ? 6  SER A CB   18 
ATOM   9999  O  OG   . SER A 1 6  ? 10.177  3.693   1.520   1.00 0.00 ? 6  SER A OG   18 
ATOM   10000 H  H    . SER A 1 6  ? 12.241  2.981   1.288   1.00 0.00 ? 6  SER A H    18 
ATOM   10001 H  HA   . SER A 1 6  ? 11.197  1.962   3.771   1.00 0.00 ? 6  SER A HA   18 
ATOM   10002 H  HB2  . SER A 1 6  ? 9.486   1.774   1.392   1.00 0.00 ? 6  SER A HB2  18 
ATOM   10003 H  HB3  . SER A 1 6  ? 9.190   2.591   2.929   1.00 0.00 ? 6  SER A HB3  18 
ATOM   10004 H  HG   . SER A 1 6  ? 10.422  4.337   2.207   1.00 0.00 ? 6  SER A HG   18 
ATOM   10005 N  N    . THR A 1 7  ? 10.765  -0.479  3.293   1.00 0.00 ? 7  THR A N    18 
ATOM   10006 C  CA   . THR A 1 7  ? 10.883  -1.917  3.155   1.00 0.00 ? 7  THR A CA   18 
ATOM   10007 C  C    . THR A 1 7  ? 9.652   -2.518  2.484   1.00 0.00 ? 7  THR A C    18 
ATOM   10008 O  O    . THR A 1 7  ? 8.718   -2.976  3.153   1.00 0.00 ? 7  THR A O    18 
ATOM   10009 C  CB   . THR A 1 7  ? 11.112  -2.575  4.524   1.00 0.00 ? 7  THR A CB   18 
ATOM   10010 O  OG1  . THR A 1 7  ? 10.563  -1.753  5.564   1.00 0.00 ? 7  THR A OG1  18 
ATOM   10011 C  CG2  . THR A 1 7  ? 12.596  -2.775  4.768   1.00 0.00 ? 7  THR A CG2  18 
ATOM   10012 H  H    . THR A 1 7  ? 10.404  -0.106  4.127   1.00 0.00 ? 7  THR A H    18 
ATOM   10013 H  HA   . THR A 1 7  ? 11.745  -2.119  2.536   1.00 0.00 ? 7  THR A HA   18 
ATOM   10014 H  HB   . THR A 1 7  ? 10.626  -3.539  4.537   1.00 0.00 ? 7  THR A HB   18 
ATOM   10015 H  HG1  . THR A 1 7  ? 10.071  -2.316  6.185   1.00 0.00 ? 7  THR A HG1  18 
ATOM   10016 H  HG21 . THR A 1 7  ? 12.917  -3.696  4.304   1.00 0.00 ? 7  THR A HG21 18 
ATOM   10017 H  HG22 . THR A 1 7  ? 12.783  -2.821  5.831   1.00 0.00 ? 7  THR A HG22 18 
ATOM   10018 H  HG23 . THR A 1 7  ? 13.142  -1.946  4.340   1.00 0.00 ? 7  THR A HG23 18 
ATOM   10019 N  N    . GLY A 1 8  ? 9.647   -2.477  1.158   1.00 0.00 ? 8  GLY A N    18 
ATOM   10020 C  CA   . GLY A 1 8  ? 8.539   -3.000  0.388   1.00 0.00 ? 8  GLY A CA   18 
ATOM   10021 C  C    . GLY A 1 8  ? 8.613   -4.502  0.230   1.00 0.00 ? 8  GLY A C    18 
ATOM   10022 O  O    . GLY A 1 8  ? 8.730   -5.017  -0.880  1.00 0.00 ? 8  GLY A O    18 
ATOM   10023 H  H    . GLY A 1 8  ? 10.398  -2.058  0.693   1.00 0.00 ? 8  GLY A H    18 
ATOM   10024 H  HA2  . GLY A 1 8  ? 7.615   -2.746  0.888   1.00 0.00 ? 8  GLY A HA2  18 
ATOM   10025 H  HA3  . GLY A 1 8  ? 8.545   -2.544  -0.592  1.00 0.00 ? 8  GLY A HA3  18 
ATOM   10026 N  N    . ILE A 1 9  ? 8.588   -5.196  1.353   1.00 0.00 ? 9  ILE A N    18 
ATOM   10027 C  CA   . ILE A 1 9  ? 8.638   -6.648  1.372   1.00 0.00 ? 9  ILE A CA   18 
ATOM   10028 C  C    . ILE A 1 9  ? 7.276   -7.223  0.977   1.00 0.00 ? 9  ILE A C    18 
ATOM   10029 O  O    . ILE A 1 9  ? 6.304   -6.474  0.864   1.00 0.00 ? 9  ILE A O    18 
ATOM   10030 C  CB   . ILE A 1 9  ? 9.045   -7.165  2.772   1.00 0.00 ? 9  ILE A CB   18 
ATOM   10031 C  CG1  . ILE A 1 9  ? 10.076  -6.228  3.412   1.00 0.00 ? 9  ILE A CG1  18 
ATOM   10032 C  CG2  . ILE A 1 9  ? 9.609   -8.577  2.682   1.00 0.00 ? 9  ILE A CG2  18 
ATOM   10033 C  CD1  . ILE A 1 9  ? 10.117  -6.311  4.922   1.00 0.00 ? 9  ILE A CD1  18 
ATOM   10034 H  H    . ILE A 1 9  ? 8.511   -4.710  2.201   1.00 0.00 ? 9  ILE A H    18 
ATOM   10035 H  HA   . ILE A 1 9  ? 9.381   -6.969  0.657   1.00 0.00 ? 9  ILE A HA   18 
ATOM   10036 H  HB   . ILE A 1 9  ? 8.162   -7.191  3.389   1.00 0.00 ? 9  ILE A HB   18 
ATOM   10037 H  HG12 . ILE A 1 9  ? 11.059  -6.476  3.042   1.00 0.00 ? 9  ILE A HG12 18 
ATOM   10038 H  HG13 . ILE A 1 9  ? 9.842   -5.209  3.143   1.00 0.00 ? 9  ILE A HG13 18 
ATOM   10039 H  HG21 . ILE A 1 9  ? 9.118   -9.210  3.408   1.00 0.00 ? 9  ILE A HG21 18 
ATOM   10040 H  HG22 . ILE A 1 9  ? 9.440   -8.969  1.690   1.00 0.00 ? 9  ILE A HG22 18 
ATOM   10041 H  HG23 . ILE A 1 9  ? 10.669  -8.553  2.884   1.00 0.00 ? 9  ILE A HG23 18 
ATOM   10042 H  HD11 . ILE A 1 9  ? 10.421  -7.305  5.219   1.00 0.00 ? 9  ILE A HD11 18 
ATOM   10043 H  HD12 . ILE A 1 9  ? 10.824  -5.589  5.305   1.00 0.00 ? 9  ILE A HD12 18 
ATOM   10044 H  HD13 . ILE A 1 9  ? 9.137   -6.101  5.321   1.00 0.00 ? 9  ILE A HD13 18 
ATOM   10045 N  N    . LYS A 1 10 ? 7.216   -8.541  0.746   1.00 0.00 ? 10 LYS A N    18 
ATOM   10046 C  CA   . LYS A 1 10 ? 5.977   -9.215  0.344   1.00 0.00 ? 10 LYS A CA   18 
ATOM   10047 C  C    . LYS A 1 10 ? 5.616   -8.870  -1.103  1.00 0.00 ? 10 LYS A C    18 
ATOM   10048 O  O    . LYS A 1 10 ? 5.982   -7.812  -1.614  1.00 0.00 ? 10 LYS A O    18 
ATOM   10049 C  CB   . LYS A 1 10 ? 4.823   -8.871  1.300   1.00 0.00 ? 10 LYS A CB   18 
ATOM   10050 C  CG   . LYS A 1 10 ? 4.657   -9.879  2.429   1.00 0.00 ? 10 LYS A CG   18 
ATOM   10051 C  CD   . LYS A 1 10 ? 4.712   -9.211  3.796   1.00 0.00 ? 10 LYS A CD   18 
ATOM   10052 C  CE   . LYS A 1 10 ? 4.813   -10.240 4.915   1.00 0.00 ? 10 LYS A CE   18 
ATOM   10053 N  NZ   . LYS A 1 10 ? 5.510   -9.697  6.112   1.00 0.00 ? 10 LYS A NZ   18 
ATOM   10054 H  H    . LYS A 1 10 ? 8.037   -9.072  0.826   1.00 0.00 ? 10 LYS A H    18 
ATOM   10055 H  HA   . LYS A 1 10 ? 6.156   -10.280 0.400   1.00 0.00 ? 10 LYS A HA   18 
ATOM   10056 H  HB2  . LYS A 1 10 ? 5.005   -7.900  1.735   1.00 0.00 ? 10 LYS A HB2  18 
ATOM   10057 H  HB3  . LYS A 1 10 ? 3.901   -8.840  0.738   1.00 0.00 ? 10 LYS A HB3  18 
ATOM   10058 H  HG2  . LYS A 1 10 ? 3.701   -10.372 2.322   1.00 0.00 ? 10 LYS A HG2  18 
ATOM   10059 H  HG3  . LYS A 1 10 ? 5.450   -10.611 2.365   1.00 0.00 ? 10 LYS A HG3  18 
ATOM   10060 H  HD2  . LYS A 1 10 ? 5.578   -8.567  3.834   1.00 0.00 ? 10 LYS A HD2  18 
ATOM   10061 H  HD3  . LYS A 1 10 ? 3.817   -8.624  3.936   1.00 0.00 ? 10 LYS A HD3  18 
ATOM   10062 H  HE2  . LYS A 1 10 ? 3.816   -10.545 5.197   1.00 0.00 ? 10 LYS A HE2  18 
ATOM   10063 H  HE3  . LYS A 1 10 ? 5.360   -11.098 4.548   1.00 0.00 ? 10 LYS A HE3  18 
ATOM   10064 H  HZ1  . LYS A 1 10 ? 5.077   -8.794  6.404   1.00 0.00 ? 10 LYS A HZ1  18 
ATOM   10065 H  HZ2  . LYS A 1 10 ? 6.520   -9.532  5.900   1.00 0.00 ? 10 LYS A HZ2  18 
ATOM   10066 H  HZ3  . LYS A 1 10 ? 5.444   -10.374 6.904   1.00 0.00 ? 10 LYS A HZ3  18 
ATOM   10067 N  N    . PRO A 1 11 ? 5.001   -9.814  -1.833  1.00 0.00 ? 11 PRO A N    18 
ATOM   10068 C  CA   . PRO A 1 11 ? 4.671   -9.631  -3.254  1.00 0.00 ? 11 PRO A CA   18 
ATOM   10069 C  C    . PRO A 1 11 ? 3.703   -8.472  -3.490  1.00 0.00 ? 11 PRO A C    18 
ATOM   10070 O  O    . PRO A 1 11 ? 3.551   -7.991  -4.615  1.00 0.00 ? 11 PRO A O    18 
ATOM   10071 C  CB   . PRO A 1 11 ? 4.018   -10.962 -3.652  1.00 0.00 ? 11 PRO A CB   18 
ATOM   10072 C  CG   . PRO A 1 11 ? 3.614   -11.591 -2.363  1.00 0.00 ? 11 PRO A CG   18 
ATOM   10073 C  CD   . PRO A 1 11 ? 4.644   -11.160 -1.362  1.00 0.00 ? 11 PRO A CD   18 
ATOM   10074 H  HA   . PRO A 1 11 ? 5.559   -9.476  -3.844  1.00 0.00 ? 11 PRO A HA   18 
ATOM   10075 H  HB2  . PRO A 1 11 ? 3.162   -10.771 -4.282  1.00 0.00 ? 11 PRO A HB2  18 
ATOM   10076 H  HB3  . PRO A 1 11 ? 4.733   -11.573 -4.181  1.00 0.00 ? 11 PRO A HB3  18 
ATOM   10077 H  HG2  . PRO A 1 11 ? 2.637   -11.234 -2.075  1.00 0.00 ? 11 PRO A HG2  18 
ATOM   10078 H  HG3  . PRO A 1 11 ? 3.610   -12.666 -2.463  1.00 0.00 ? 11 PRO A HG3  18 
ATOM   10079 H  HD2  . PRO A 1 11 ? 4.217   -11.125 -0.372  1.00 0.00 ? 11 PRO A HD2  18 
ATOM   10080 H  HD3  . PRO A 1 11 ? 5.497   -11.819 -1.389  1.00 0.00 ? 11 PRO A HD3  18 
ATOM   10081 N  N    . PHE A 1 12 ? 3.041   -8.032  -2.427  1.00 0.00 ? 12 PHE A N    18 
ATOM   10082 C  CA   . PHE A 1 12 ? 2.077   -6.951  -2.523  1.00 0.00 ? 12 PHE A CA   18 
ATOM   10083 C  C    . PHE A 1 12 ? 2.478   -5.779  -1.641  1.00 0.00 ? 12 PHE A C    18 
ATOM   10084 O  O    . PHE A 1 12 ? 1.913   -5.568  -0.574  1.00 0.00 ? 12 PHE A O    18 
ATOM   10085 C  CB   . PHE A 1 12 ? 0.690   -7.449  -2.124  1.00 0.00 ? 12 PHE A CB   18 
ATOM   10086 C  CG   . PHE A 1 12 ? 0.228   -8.631  -2.927  1.00 0.00 ? 12 PHE A CG   18 
ATOM   10087 C  CD1  . PHE A 1 12 ? 0.021   -8.521  -4.292  1.00 0.00 ? 12 PHE A CD1  18 
ATOM   10088 C  CD2  . PHE A 1 12 ? 0.013   -9.852  -2.316  1.00 0.00 ? 12 PHE A CD2  18 
ATOM   10089 C  CE1  . PHE A 1 12 ? -0.397  -9.610  -5.032  1.00 0.00 ? 12 PHE A CE1  18 
ATOM   10090 C  CE2  . PHE A 1 12 ? -0.408  -10.944 -3.050  1.00 0.00 ? 12 PHE A CE2  18 
ATOM   10091 C  CZ   . PHE A 1 12 ? -0.611  -10.823 -4.410  1.00 0.00 ? 12 PHE A CZ   18 
ATOM   10092 H  H    . PHE A 1 12 ? 3.205   -8.448  -1.554  1.00 0.00 ? 12 PHE A H    18 
ATOM   10093 H  HA   . PHE A 1 12 ? 2.048   -6.619  -3.551  1.00 0.00 ? 12 PHE A HA   18 
ATOM   10094 H  HB2  . PHE A 1 12 ? 0.709   -7.737  -1.081  1.00 0.00 ? 12 PHE A HB2  18 
ATOM   10095 H  HB3  . PHE A 1 12 ? -0.025  -6.651  -2.258  1.00 0.00 ? 12 PHE A HB3  18 
ATOM   10096 H  HD1  . PHE A 1 12 ? 0.188   -7.571  -4.781  1.00 0.00 ? 12 PHE A HD1  18 
ATOM   10097 H  HD2  . PHE A 1 12 ? 0.171   -9.949  -1.253  1.00 0.00 ? 12 PHE A HD2  18 
ATOM   10098 H  HE1  . PHE A 1 12 ? -0.556  -9.513  -6.097  1.00 0.00 ? 12 PHE A HE1  18 
ATOM   10099 H  HE2  . PHE A 1 12 ? -0.578  -11.892 -2.560  1.00 0.00 ? 12 PHE A HE2  18 
ATOM   10100 H  HZ   . PHE A 1 12 ? -0.938  -11.676 -4.987  1.00 0.00 ? 12 PHE A HZ   18 
ATOM   10101 N  N    . GLN A 1 13 ? 3.438   -5.002  -2.107  1.00 0.00 ? 13 GLN A N    18 
ATOM   10102 C  CA   . GLN A 1 13 ? 3.863   -3.811  -1.411  1.00 0.00 ? 13 GLN A CA   18 
ATOM   10103 C  C    . GLN A 1 13 ? 3.227   -2.590  -2.063  1.00 0.00 ? 13 GLN A C    18 
ATOM   10104 O  O    . GLN A 1 13 ? 2.876   -2.629  -3.243  1.00 0.00 ? 13 GLN A O    18 
ATOM   10105 C  CB   . GLN A 1 13 ? 5.379   -3.722  -1.465  1.00 0.00 ? 13 GLN A CB   18 
ATOM   10106 C  CG   . GLN A 1 13 ? 5.910   -3.276  -2.811  1.00 0.00 ? 13 GLN A CG   18 
ATOM   10107 C  CD   . GLN A 1 13 ? 6.336   -4.444  -3.677  1.00 0.00 ? 13 GLN A CD   18 
ATOM   10108 O  OE1  . GLN A 1 13 ? 5.907   -4.576  -4.820  1.00 0.00 ? 13 GLN A OE1  18 
ATOM   10109 N  NE2  . GLN A 1 13 ? 7.185   -5.300  -3.141  1.00 0.00 ? 13 GLN A NE2  18 
ATOM   10110 H  H    . GLN A 1 13 ? 3.861   -5.217  -2.959  1.00 0.00 ? 13 GLN A H    18 
ATOM   10111 H  HA   . GLN A 1 13 ? 3.540   -3.879  -0.385  1.00 0.00 ? 13 GLN A HA   18 
ATOM   10112 H  HB2  . GLN A 1 13 ? 5.722   -3.029  -0.713  1.00 0.00 ? 13 GLN A HB2  18 
ATOM   10113 H  HB3  . GLN A 1 13 ? 5.782   -4.701  -1.257  1.00 0.00 ? 13 GLN A HB3  18 
ATOM   10114 H  HG2  . GLN A 1 13 ? 5.129   -2.734  -3.324  1.00 0.00 ? 13 GLN A HG2  18 
ATOM   10115 H  HG3  . GLN A 1 13 ? 6.751   -2.629  -2.651  1.00 0.00 ? 13 GLN A HG3  18 
ATOM   10116 H  HE21 . GLN A 1 13 ? 7.502   -5.133  -2.223  1.00 0.00 ? 13 GLN A HE21 18 
ATOM   10117 H  HE22 . GLN A 1 13 ? 7.447   -6.087  -3.668  1.00 0.00 ? 13 GLN A HE22 18 
ATOM   10118 N  N    . CYS A 1 14 ? 3.095   -1.503  -1.313  1.00 0.00 ? 14 CYS A N    18 
ATOM   10119 C  CA   . CYS A 1 14 ? 2.532   -0.286  -1.870  1.00 0.00 ? 14 CYS A CA   18 
ATOM   10120 C  C    . CYS A 1 14 ? 3.498   0.315   -2.882  1.00 0.00 ? 14 CYS A C    18 
ATOM   10121 O  O    . CYS A 1 14 ? 4.666   0.534   -2.573  1.00 0.00 ? 14 CYS A O    18 
ATOM   10122 C  CB   . CYS A 1 14 ? 2.210   0.754   -0.786  1.00 0.00 ? 14 CYS A CB   18 
ATOM   10123 S  SG   . CYS A 1 14 ? 1.598   2.323   -1.491  1.00 0.00 ? 14 CYS A SG   18 
ATOM   10124 H  H    . CYS A 1 14 ? 3.423   -1.509  -0.396  1.00 0.00 ? 14 CYS A H    18 
ATOM   10125 H  HA   . CYS A 1 14 ? 1.619   -0.551  -2.380  1.00 0.00 ? 14 CYS A HA   18 
ATOM   10126 H  HB2  . CYS A 1 14 ? 1.449   0.362   -0.129  1.00 0.00 ? 14 CYS A HB2  18 
ATOM   10127 H  HB3  . CYS A 1 14 ? 3.103   0.970   -0.220  1.00 0.00 ? 14 CYS A HB3  18 
ATOM   10128 N  N    . PRO A 1 15 ? 3.028   0.601   -4.099  1.00 0.00 ? 15 PRO A N    18 
ATOM   10129 C  CA   . PRO A 1 15 ? 3.865   1.193   -5.141  1.00 0.00 ? 15 PRO A CA   18 
ATOM   10130 C  C    . PRO A 1 15 ? 4.159   2.670   -4.887  1.00 0.00 ? 15 PRO A C    18 
ATOM   10131 O  O    . PRO A 1 15 ? 4.883   3.306   -5.653  1.00 0.00 ? 15 PRO A O    18 
ATOM   10132 C  CB   . PRO A 1 15 ? 3.028   1.020   -6.409  1.00 0.00 ? 15 PRO A CB   18 
ATOM   10133 C  CG   . PRO A 1 15 ? 1.618   0.984   -5.931  1.00 0.00 ? 15 PRO A CG   18 
ATOM   10134 C  CD   . PRO A 1 15 ? 1.650   0.355   -4.565  1.00 0.00 ? 15 PRO A CD   18 
ATOM   10135 H  HA   . PRO A 1 15 ? 4.795   0.660   -5.244  1.00 0.00 ? 15 PRO A HA   18 
ATOM   10136 H  HB2  . PRO A 1 15 ? 3.200   1.856   -7.070  1.00 0.00 ? 15 PRO A HB2  18 
ATOM   10137 H  HB3  . PRO A 1 15 ? 3.301   0.099   -6.904  1.00 0.00 ? 15 PRO A HB3  18 
ATOM   10138 H  HG2  . PRO A 1 15 ? 1.226   1.988   -5.871  1.00 0.00 ? 15 PRO A HG2  18 
ATOM   10139 H  HG3  . PRO A 1 15 ? 1.019   0.388   -6.605  1.00 0.00 ? 15 PRO A HG3  18 
ATOM   10140 H  HD2  . PRO A 1 15 ? 0.933   0.834   -3.916  1.00 0.00 ? 15 PRO A HD2  18 
ATOM   10141 H  HD3  . PRO A 1 15 ? 1.449   -0.705  -4.633  1.00 0.00 ? 15 PRO A HD3  18 
ATOM   10142 N  N    . ASP A 1 16 ? 3.591   3.216   -3.816  1.00 0.00 ? 16 ASP A N    18 
ATOM   10143 C  CA   . ASP A 1 16 ? 3.796   4.622   -3.486  1.00 0.00 ? 16 ASP A CA   18 
ATOM   10144 C  C    . ASP A 1 16 ? 4.573   4.775   -2.184  1.00 0.00 ? 16 ASP A C    18 
ATOM   10145 O  O    . ASP A 1 16 ? 5.391   5.684   -2.039  1.00 0.00 ? 16 ASP A O    18 
ATOM   10146 C  CB   . ASP A 1 16 ? 2.451   5.340   -3.375  1.00 0.00 ? 16 ASP A CB   18 
ATOM   10147 C  CG   . ASP A 1 16 ? 2.596   6.850   -3.335  1.00 0.00 ? 16 ASP A CG   18 
ATOM   10148 O  OD1  . ASP A 1 16 ? 3.631   7.372   -3.803  1.00 0.00 ? 16 ASP A OD1  18 
ATOM   10149 O  OD2  . ASP A 1 16 ? 1.671   7.522   -2.842  1.00 0.00 ? 16 ASP A OD2  18 
ATOM   10150 H  H    . ASP A 1 16 ? 3.014   2.664   -3.242  1.00 0.00 ? 16 ASP A H    18 
ATOM   10151 H  HA   . ASP A 1 16 ? 4.365   5.068   -4.284  1.00 0.00 ? 16 ASP A HA   18 
ATOM   10152 H  HB2  . ASP A 1 16 ? 1.840   5.079   -4.227  1.00 0.00 ? 16 ASP A HB2  18 
ATOM   10153 H  HB3  . ASP A 1 16 ? 1.953   5.021   -2.471  1.00 0.00 ? 16 ASP A HB3  18 
ATOM   10154 N  N    . CYS A 1 17 ? 4.297   3.902   -1.226  1.00 0.00 ? 17 CYS A N    18 
ATOM   10155 C  CA   . CYS A 1 17 ? 4.949   3.971   0.079   1.00 0.00 ? 17 CYS A CA   18 
ATOM   10156 C  C    . CYS A 1 17 ? 6.050   2.925   0.214   1.00 0.00 ? 17 CYS A C    18 
ATOM   10157 O  O    . CYS A 1 17 ? 6.959   3.081   1.031   1.00 0.00 ? 17 CYS A O    18 
ATOM   10158 C  CB   . CYS A 1 17 ? 3.931   3.794   1.205   1.00 0.00 ? 17 CYS A CB   18 
ATOM   10159 S  SG   . CYS A 1 17 ? 2.497   4.911   1.096   1.00 0.00 ? 17 CYS A SG   18 
ATOM   10160 H  H    . CYS A 1 17 ? 3.625   3.204   -1.394  1.00 0.00 ? 17 CYS A H    18 
ATOM   10161 H  HA   . CYS A 1 17 ? 5.395   4.950   0.165   1.00 0.00 ? 17 CYS A HA   18 
ATOM   10162 H  HB2  . CYS A 1 17 ? 3.559   2.781   1.187   1.00 0.00 ? 17 CYS A HB2  18 
ATOM   10163 H  HB3  . CYS A 1 17 ? 4.419   3.975   2.152   1.00 0.00 ? 17 CYS A HB3  18 
ATOM   10164 N  N    . ASP A 1 18 ? 5.845   1.790   -0.448  1.00 0.00 ? 18 ASP A N    18 
ATOM   10165 C  CA   . ASP A 1 18 ? 6.718   0.620   -0.320  1.00 0.00 ? 18 ASP A CA   18 
ATOM   10166 C  C    . ASP A 1 18 ? 6.508   -0.041  1.033   1.00 0.00 ? 18 ASP A C    18 
ATOM   10167 O  O    . ASP A 1 18 ? 7.452   -0.292  1.783   1.00 0.00 ? 18 ASP A O    18 
ATOM   10168 C  CB   . ASP A 1 18 ? 8.196   0.967   -0.534  1.00 0.00 ? 18 ASP A CB   18 
ATOM   10169 C  CG   . ASP A 1 18 ? 8.923   -0.090  -1.344  1.00 0.00 ? 18 ASP A CG   18 
ATOM   10170 O  OD1  . ASP A 1 18 ? 8.342   -0.597  -2.325  1.00 0.00 ? 18 ASP A OD1  18 
ATOM   10171 O  OD2  . ASP A 1 18 ? 10.087  -0.408  -1.017  1.00 0.00 ? 18 ASP A OD2  18 
ATOM   10172 H  H    . ASP A 1 18 ? 5.033   1.703   -0.988  1.00 0.00 ? 18 ASP A H    18 
ATOM   10173 H  HA   . ASP A 1 18 ? 6.419   -0.087  -1.083  1.00 0.00 ? 18 ASP A HA   18 
ATOM   10174 H  HB2  . ASP A 1 18 ? 8.267   1.908   -1.060  1.00 0.00 ? 18 ASP A HB2  18 
ATOM   10175 H  HB3  . ASP A 1 18 ? 8.681   1.058   0.427   1.00 0.00 ? 18 ASP A HB3  18 
ATOM   10176 N  N    . ARG A 1 19 ? 5.245   -0.335  1.324   1.00 0.00 ? 19 ARG A N    18 
ATOM   10177 C  CA   . ARG A 1 19 ? 4.873   -1.046  2.539   1.00 0.00 ? 19 ARG A CA   18 
ATOM   10178 C  C    . ARG A 1 19 ? 4.992   -2.546  2.305   1.00 0.00 ? 19 ARG A C    18 
ATOM   10179 O  O    . ARG A 1 19 ? 5.727   -2.975  1.426   1.00 0.00 ? 19 ARG A O    18 
ATOM   10180 C  CB   . ARG A 1 19 ? 3.448   -0.683  2.947   1.00 0.00 ? 19 ARG A CB   18 
ATOM   10181 C  CG   . ARG A 1 19 ? 3.385   0.445   3.955   1.00 0.00 ? 19 ARG A CG   18 
ATOM   10182 C  CD   . ARG A 1 19 ? 2.328   1.469   3.582   1.00 0.00 ? 19 ARG A CD   18 
ATOM   10183 N  NE   . ARG A 1 19 ? 0.996   1.083   4.048   1.00 0.00 ? 19 ARG A NE   18 
ATOM   10184 C  CZ   . ARG A 1 19 ? 0.634   1.041   5.337   1.00 0.00 ? 19 ARG A CZ   18 
ATOM   10185 N  NH1  . ARG A 1 19 ? 1.445   1.505   6.277   1.00 0.00 ? 19 ARG A NH1  18 
ATOM   10186 N  NH2  . ARG A 1 19 ? -0.564  0.585   5.684   1.00 0.00 ? 19 ARG A NH2  18 
ATOM   10187 H  H    . ARG A 1 19 ? 4.549   -0.113  0.675   1.00 0.00 ? 19 ARG A H    18 
ATOM   10188 H  HA   . ARG A 1 19 ? 5.557   -0.754  3.324   1.00 0.00 ? 19 ARG A HA   18 
ATOM   10189 H  HB2  . ARG A 1 19 ? 2.896   -0.382  2.068   1.00 0.00 ? 19 ARG A HB2  18 
ATOM   10190 H  HB3  . ARG A 1 19 ? 2.975   -1.552  3.381   1.00 0.00 ? 19 ARG A HB3  18 
ATOM   10191 H  HG2  . ARG A 1 19 ? 3.149   0.034   4.925   1.00 0.00 ? 19 ARG A HG2  18 
ATOM   10192 H  HG3  . ARG A 1 19 ? 4.347   0.930   3.991   1.00 0.00 ? 19 ARG A HG3  18 
ATOM   10193 H  HD2  . ARG A 1 19 ? 2.593   2.417   4.025   1.00 0.00 ? 19 ARG A HD2  18 
ATOM   10194 H  HD3  . ARG A 1 19 ? 2.307   1.570   2.506   1.00 0.00 ? 19 ARG A HD3  18 
ATOM   10195 H  HE   . ARG A 1 19 ? 0.341   0.823   3.361   1.00 0.00 ? 19 ARG A HE   18 
ATOM   10196 H  HH11 . ARG A 1 19 ? 2.338   1.902   6.031   1.00 0.00 ? 19 ARG A HH11 18 
ATOM   10197 H  HH12 . ARG A 1 19 ? 1.169   1.462   7.244   1.00 0.00 ? 19 ARG A HH12 18 
ATOM   10198 H  HH21 . ARG A 1 19 ? -1.211  0.268   4.990   1.00 0.00 ? 19 ARG A HH21 18 
ATOM   10199 H  HH22 . ARG A 1 19 ? -0.828  0.556   6.658   1.00 0.00 ? 19 ARG A HH22 18 
ATOM   10200 N  N    . SER A 1 20 ? 4.245   -3.349  3.047   1.00 0.00 ? 20 SER A N    18 
ATOM   10201 C  CA   . SER A 1 20 ? 4.275   -4.787  2.829   1.00 0.00 ? 20 SER A CA   18 
ATOM   10202 C  C    . SER A 1 20 ? 2.978   -5.455  3.247   1.00 0.00 ? 20 SER A C    18 
ATOM   10203 O  O    . SER A 1 20 ? 2.547   -5.351  4.397   1.00 0.00 ? 20 SER A O    18 
ATOM   10204 C  CB   . SER A 1 20 ? 5.436   -5.428  3.580   1.00 0.00 ? 20 SER A CB   18 
ATOM   10205 O  OG   . SER A 1 20 ? 6.089   -4.491  4.424   1.00 0.00 ? 20 SER A OG   18 
ATOM   10206 H  H    . SER A 1 20 ? 3.653   -2.972  3.735   1.00 0.00 ? 20 SER A H    18 
ATOM   10207 H  HA   . SER A 1 20 ? 4.413   -4.949  1.771   1.00 0.00 ? 20 SER A HA   18 
ATOM   10208 H  HB2  . SER A 1 20 ? 5.058   -6.241  4.180   1.00 0.00 ? 20 SER A HB2  18 
ATOM   10209 H  HB3  . SER A 1 20 ? 6.153   -5.812  2.867   1.00 0.00 ? 20 SER A HB3  18 
ATOM   10210 H  HG   . SER A 1 20 ? 6.553   -3.846  3.878   1.00 0.00 ? 20 SER A HG   18 
ATOM   10211 N  N    . PHE A 1 21 ? 2.389   -6.172  2.306   1.00 0.00 ? 21 PHE A N    18 
ATOM   10212 C  CA   . PHE A 1 21 ? 1.172   -6.928  2.543   1.00 0.00 ? 21 PHE A CA   18 
ATOM   10213 C  C    . PHE A 1 21 ? 1.284   -8.277  1.850   1.00 0.00 ? 21 PHE A C    18 
ATOM   10214 O  O    . PHE A 1 21 ? 1.727   -8.359  0.706   1.00 0.00 ? 21 PHE A O    18 
ATOM   10215 C  CB   . PHE A 1 21 ? -0.063  -6.179  2.017   1.00 0.00 ? 21 PHE A CB   18 
ATOM   10216 C  CG   . PHE A 1 21 ? -0.059  -4.699  2.298   1.00 0.00 ? 21 PHE A CG   18 
ATOM   10217 C  CD1  . PHE A 1 21 ? 0.680   -3.833  1.508   1.00 0.00 ? 21 PHE A CD1  18 
ATOM   10218 C  CD2  . PHE A 1 21 ? -0.791  -4.179  3.351   1.00 0.00 ? 21 PHE A CD2  18 
ATOM   10219 C  CE1  . PHE A 1 21 ? 0.686   -2.480  1.760   1.00 0.00 ? 21 PHE A CE1  18 
ATOM   10220 C  CE2  . PHE A 1 21 ? -0.788  -2.821  3.607   1.00 0.00 ? 21 PHE A CE2  18 
ATOM   10221 C  CZ   . PHE A 1 21 ? -0.045  -1.973  2.813   1.00 0.00 ? 21 PHE A CZ   18 
ATOM   10222 H  H    . PHE A 1 21 ? 2.804   -6.217  1.420   1.00 0.00 ? 21 PHE A H    18 
ATOM   10223 H  HA   . PHE A 1 21 ? 1.072   -7.084  3.608   1.00 0.00 ? 21 PHE A HA   18 
ATOM   10224 H  HB2  . PHE A 1 21 ? -0.126  -6.312  0.946   1.00 0.00 ? 21 PHE A HB2  18 
ATOM   10225 H  HB3  . PHE A 1 21 ? -0.946  -6.600  2.475   1.00 0.00 ? 21 PHE A HB3  18 
ATOM   10226 H  HD1  . PHE A 1 21 ? 1.264   -4.229  0.687   1.00 0.00 ? 21 PHE A HD1  18 
ATOM   10227 H  HD2  . PHE A 1 21 ? -1.373  -4.843  3.972   1.00 0.00 ? 21 PHE A HD2  18 
ATOM   10228 H  HE1  . PHE A 1 21 ? 1.266   -1.816  1.134   1.00 0.00 ? 21 PHE A HE1  18 
ATOM   10229 H  HE2  . PHE A 1 21 ? -1.361  -2.426  4.433   1.00 0.00 ? 21 PHE A HE2  18 
ATOM   10230 H  HZ   . PHE A 1 21 ? -0.036  -0.916  3.014   1.00 0.00 ? 21 PHE A HZ   18 
ATOM   10231 N  N    . SER A 1 22 ? 0.895   -9.334  2.539   1.00 0.00 ? 22 SER A N    18 
ATOM   10232 C  CA   . SER A 1 22 ? 0.937   -10.667 1.962   1.00 0.00 ? 22 SER A CA   18 
ATOM   10233 C  C    . SER A 1 22 ? -0.348  -10.934 1.181   1.00 0.00 ? 22 SER A C    18 
ATOM   10234 O  O    . SER A 1 22 ? -0.454  -11.907 0.433   1.00 0.00 ? 22 SER A O    18 
ATOM   10235 C  CB   . SER A 1 22 ? 1.108   -11.705 3.070   1.00 0.00 ? 22 SER A CB   18 
ATOM   10236 O  OG   . SER A 1 22 ? 0.860   -11.128 4.345   1.00 0.00 ? 22 SER A OG   18 
ATOM   10237 H  H    . SER A 1 22 ? 0.556   -9.219  3.456   1.00 0.00 ? 22 SER A H    18 
ATOM   10238 H  HA   . SER A 1 22 ? 1.785   -10.719 1.288   1.00 0.00 ? 22 SER A HA   18 
ATOM   10239 H  HB2  . SER A 1 22 ? 0.411   -12.514 2.913   1.00 0.00 ? 22 SER A HB2  18 
ATOM   10240 H  HB3  . SER A 1 22 ? 2.119   -12.088 3.051   1.00 0.00 ? 22 SER A HB3  18 
ATOM   10241 H  HG   . SER A 1 22 ? 0.215   -11.674 4.821   1.00 0.00 ? 22 SER A HG   18 
ATOM   10242 N  N    . ARG A 1 23 ? -1.325  -10.059 1.382   1.00 0.00 ? 23 ARG A N    18 
ATOM   10243 C  CA   . ARG A 1 23 ? -2.622  -10.175 0.731   1.00 0.00 ? 23 ARG A CA   18 
ATOM   10244 C  C    . ARG A 1 23 ? -2.818  -9.078  -0.287  1.00 0.00 ? 23 ARG A C    18 
ATOM   10245 O  O    . ARG A 1 23 ? -2.603  -7.895  -0.012  1.00 0.00 ? 23 ARG A O    18 
ATOM   10246 C  CB   . ARG A 1 23 ? -3.748  -10.138 1.763   1.00 0.00 ? 23 ARG A CB   18 
ATOM   10247 C  CG   . ARG A 1 23 ? -3.521  -11.052 2.953   1.00 0.00 ? 23 ARG A CG   18 
ATOM   10248 C  CD   . ARG A 1 23 ? -4.708  -11.963 3.180   1.00 0.00 ? 23 ARG A CD   18 
ATOM   10249 N  NE   . ARG A 1 23 ? -5.936  -11.212 3.429   1.00 0.00 ? 23 ARG A NE   18 
ATOM   10250 C  CZ   . ARG A 1 23 ? -6.450  -10.993 4.640   1.00 0.00 ? 23 ARG A CZ   18 
ATOM   10251 N  NH1  . ARG A 1 23 ? -5.777  -11.340 5.729   1.00 0.00 ? 23 ARG A NH1  18 
ATOM   10252 N  NH2  . ARG A 1 23 ? -7.616  -10.373 4.758   1.00 0.00 ? 23 ARG A NH2  18 
ATOM   10253 H  H    . ARG A 1 23 ? -1.169  -9.312  1.998   1.00 0.00 ? 23 ARG A H    18 
ATOM   10254 H  HA   . ARG A 1 23 ? -2.661  -11.115 0.201   1.00 0.00 ? 23 ARG A HA   18 
ATOM   10255 H  HB2  . ARG A 1 23 ? -3.856  -9.131  2.129   1.00 0.00 ? 23 ARG A HB2  18 
ATOM   10256 H  HB3  . ARG A 1 23 ? -4.669  -10.435 1.282   1.00 0.00 ? 23 ARG A HB3  18 
ATOM   10257 H  HG2  . ARG A 1 23 ? -2.648  -11.659 2.766   1.00 0.00 ? 23 ARG A HG2  18 
ATOM   10258 H  HG3  . ARG A 1 23 ? -3.365  -10.449 3.838   1.00 0.00 ? 23 ARG A HG3  18 
ATOM   10259 H  HD2  . ARG A 1 23 ? -4.845  -12.569 2.300   1.00 0.00 ? 23 ARG A HD2  18 
ATOM   10260 H  HD3  . ARG A 1 23 ? -4.504  -12.597 4.029   1.00 0.00 ? 23 ARG A HD3  18 
ATOM   10261 H  HE   . ARG A 1 23 ? -6.426  -10.879 2.640   1.00 0.00 ? 23 ARG A HE   18 
ATOM   10262 H  HH11 . ARG A 1 23 ? -4.867  -11.767 5.652   1.00 0.00 ? 23 ARG A HH11 18 
ATOM   10263 H  HH12 . ARG A 1 23 ? -6.172  -11.177 6.645   1.00 0.00 ? 23 ARG A HH12 18 
ATOM   10264 H  HH21 . ARG A 1 23 ? -8.108  -10.061 3.938   1.00 0.00 ? 23 ARG A HH21 18 
ATOM   10265 H  HH22 . ARG A 1 23 ? -8.022  -10.222 5.671   1.00 0.00 ? 23 ARG A HH22 18 
ATOM   10266 N  N    . SER A 1 24 ? -3.243  -9.498  -1.459  1.00 0.00 ? 24 SER A N    18 
ATOM   10267 C  CA   . SER A 1 24 ? -3.487  -8.613  -2.571  1.00 0.00 ? 24 SER A CA   18 
ATOM   10268 C  C    . SER A 1 24 ? -4.618  -7.634  -2.260  1.00 0.00 ? 24 SER A C    18 
ATOM   10269 O  O    . SER A 1 24 ? -4.658  -6.521  -2.788  1.00 0.00 ? 24 SER A O    18 
ATOM   10270 C  CB   . SER A 1 24 ? -3.829  -9.475  -3.777  1.00 0.00 ? 24 SER A CB   18 
ATOM   10271 O  OG   . SER A 1 24 ? -4.070  -10.819 -3.375  1.00 0.00 ? 24 SER A OG   18 
ATOM   10272 H  H    . SER A 1 24 ? -3.390  -10.460 -1.592  1.00 0.00 ? 24 SER A H    18 
ATOM   10273 H  HA   . SER A 1 24 ? -2.582  -8.062  -2.773  1.00 0.00 ? 24 SER A HA   18 
ATOM   10274 H  HB2  . SER A 1 24 ? -4.710  -9.088  -4.258  1.00 0.00 ? 24 SER A HB2  18 
ATOM   10275 H  HB3  . SER A 1 24 ? -3.000  -9.466  -4.463  1.00 0.00 ? 24 SER A HB3  18 
ATOM   10276 H  HG   . SER A 1 24 ? -4.636  -11.253 -4.032  1.00 0.00 ? 24 SER A HG   18 
ATOM   10277 N  N    . ASP A 1 25 ? -5.511  -8.040  -1.372  1.00 0.00 ? 25 ASP A N    18 
ATOM   10278 C  CA   . ASP A 1 25 ? -6.616  -7.187  -0.959  1.00 0.00 ? 25 ASP A CA   18 
ATOM   10279 C  C    . ASP A 1 25 ? -6.157  -6.195  0.099   1.00 0.00 ? 25 ASP A C    18 
ATOM   10280 O  O    . ASP A 1 25 ? -6.621  -5.056  0.144   1.00 0.00 ? 25 ASP A O    18 
ATOM   10281 C  CB   . ASP A 1 25 ? -7.766  -8.024  -0.410  1.00 0.00 ? 25 ASP A CB   18 
ATOM   10282 C  CG   . ASP A 1 25 ? -9.032  -7.212  -0.220  1.00 0.00 ? 25 ASP A CG   18 
ATOM   10283 O  OD1  . ASP A 1 25 ? -9.445  -6.509  -1.168  1.00 0.00 ? 25 ASP A OD1  18 
ATOM   10284 O  OD2  . ASP A 1 25 ? -9.622  -7.273  0.879   1.00 0.00 ? 25 ASP A OD2  18 
ATOM   10285 H  H    . ASP A 1 25 ? -5.418  -8.936  -0.973  1.00 0.00 ? 25 ASP A H    18 
ATOM   10286 H  HA   . ASP A 1 25 ? -6.954  -6.645  -1.825  1.00 0.00 ? 25 ASP A HA   18 
ATOM   10287 H  HB2  . ASP A 1 25 ? -7.972  -8.829  -1.093  1.00 0.00 ? 25 ASP A HB2  18 
ATOM   10288 H  HB3  . ASP A 1 25 ? -7.475  -8.434  0.547   1.00 0.00 ? 25 ASP A HB3  18 
ATOM   10289 N  N    . HIS A 1 26 ? -5.206  -6.632  0.920   1.00 0.00 ? 26 HIS A N    18 
ATOM   10290 C  CA   . HIS A 1 26 ? -4.642  -5.788  1.969   1.00 0.00 ? 26 HIS A CA   18 
ATOM   10291 C  C    . HIS A 1 26 ? -3.940  -4.580  1.366   1.00 0.00 ? 26 HIS A C    18 
ATOM   10292 O  O    . HIS A 1 26 ? -4.056  -3.467  1.879   1.00 0.00 ? 26 HIS A O    18 
ATOM   10293 C  CB   . HIS A 1 26 ? -3.664  -6.586  2.834   1.00 0.00 ? 26 HIS A CB   18 
ATOM   10294 C  CG   . HIS A 1 26 ? -4.221  -6.959  4.172   1.00 0.00 ? 26 HIS A CG   18 
ATOM   10295 N  ND1  . HIS A 1 26 ? -3.516  -6.835  5.349   1.00 0.00 ? 26 HIS A ND1  18 
ATOM   10296 C  CD2  . HIS A 1 26 ? -5.433  -7.450  4.515   1.00 0.00 ? 26 HIS A CD2  18 
ATOM   10297 C  CE1  . HIS A 1 26 ? -4.270  -7.230  6.356   1.00 0.00 ? 26 HIS A CE1  18 
ATOM   10298 N  NE2  . HIS A 1 26 ? -5.439  -7.609  5.878   1.00 0.00 ? 26 HIS A NE2  18 
ATOM   10299 H  H    . HIS A 1 26 ? -4.861  -7.542  0.801   1.00 0.00 ? 26 HIS A H    18 
ATOM   10300 H  HA   . HIS A 1 26 ? -5.457  -5.441  2.588   1.00 0.00 ? 26 HIS A HA   18 
ATOM   10301 H  HB2  . HIS A 1 26 ? -3.398  -7.497  2.318   1.00 0.00 ? 26 HIS A HB2  18 
ATOM   10302 H  HB3  . HIS A 1 26 ? -2.772  -5.997  2.997   1.00 0.00 ? 26 HIS A HB3  18 
ATOM   10303 H  HD1  . HIS A 1 26 ? -2.585  -6.511  5.435   1.00 0.00 ? 26 HIS A HD1  18 
ATOM   10304 H  HD2  . HIS A 1 26 ? -6.242  -7.686  3.839   1.00 0.00 ? 26 HIS A HD2  18 
ATOM   10305 H  HE1  . HIS A 1 26 ? -3.980  -7.238  7.397   1.00 0.00 ? 26 HIS A HE1  18 
ATOM   10306 H  HE2  . HIS A 1 26 ? -6.250  -7.754  6.429   1.00 0.00 ? 26 HIS A HE2  18 
ATOM   10307 N  N    . LEU A 1 27 ? -3.292  -4.791  0.223   1.00 0.00 ? 27 LEU A N    18 
ATOM   10308 C  CA   . LEU A 1 27 ? -2.681  -3.698  -0.523  1.00 0.00 ? 27 LEU A CA   18 
ATOM   10309 C  C    . LEU A 1 27 ? -3.726  -2.632  -0.826  1.00 0.00 ? 27 LEU A C    18 
ATOM   10310 O  O    . LEU A 1 27 ? -3.593  -1.473  -0.425  1.00 0.00 ? 27 LEU A O    18 
ATOM   10311 C  CB   . LEU A 1 27 ? -2.101  -4.203  -1.846  1.00 0.00 ? 27 LEU A CB   18 
ATOM   10312 C  CG   . LEU A 1 27 ? -1.110  -3.255  -2.535  1.00 0.00 ? 27 LEU A CG   18 
ATOM   10313 C  CD1  . LEU A 1 27 ? -0.536  -2.241  -1.557  1.00 0.00 ? 27 LEU A CD1  18 
ATOM   10314 C  CD2  . LEU A 1 27 ? -0.002  -4.030  -3.217  1.00 0.00 ? 27 LEU A CD2  18 
ATOM   10315 H  H    . LEU A 1 27 ? -3.290  -5.693  -0.165  1.00 0.00 ? 27 LEU A H    18 
ATOM   10316 H  HA   . LEU A 1 27 ? -1.892  -3.269  0.079   1.00 0.00 ? 27 LEU A HA   18 
ATOM   10317 H  HB2  . LEU A 1 27 ? -1.597  -5.139  -1.658  1.00 0.00 ? 27 LEU A HB2  18 
ATOM   10318 H  HB3  . LEU A 1 27 ? -2.920  -4.385  -2.524  1.00 0.00 ? 27 LEU A HB3  18 
ATOM   10319 H  HG   . LEU A 1 27 ? -1.643  -2.703  -3.295  1.00 0.00 ? 27 LEU A HG   18 
ATOM   10320 H  HD11 . LEU A 1 27 ? -1.342  -1.782  -1.001  1.00 0.00 ? 27 LEU A HD11 18 
ATOM   10321 H  HD12 . LEU A 1 27 ? 0.135   -2.743  -0.871  1.00 0.00 ? 27 LEU A HD12 18 
ATOM   10322 H  HD13 . LEU A 1 27 ? 0.005   -1.481  -2.101  1.00 0.00 ? 27 LEU A HD13 18 
ATOM   10323 H  HD21 . LEU A 1 27 ? -0.429  -4.821  -3.816  1.00 0.00 ? 27 LEU A HD21 18 
ATOM   10324 H  HD22 . LEU A 1 27 ? 0.564   -3.362  -3.851  1.00 0.00 ? 27 LEU A HD22 18 
ATOM   10325 H  HD23 . LEU A 1 27 ? 0.651   -4.455  -2.468  1.00 0.00 ? 27 LEU A HD23 18 
ATOM   10326 N  N    . ALA A 1 28 ? -4.750  -3.047  -1.563  1.00 0.00 ? 28 ALA A N    18 
ATOM   10327 C  CA   . ALA A 1 28 ? -5.824  -2.159  -1.985  1.00 0.00 ? 28 ALA A CA   18 
ATOM   10328 C  C    . ALA A 1 28 ? -6.475  -1.453  -0.799  1.00 0.00 ? 28 ALA A C    18 
ATOM   10329 O  O    . ALA A 1 28 ? -6.828  -0.283  -0.898  1.00 0.00 ? 28 ALA A O    18 
ATOM   10330 C  CB   . ALA A 1 28 ? -6.866  -2.934  -2.776  1.00 0.00 ? 28 ALA A CB   18 
ATOM   10331 H  H    . ALA A 1 28 ? -4.759  -3.979  -1.869  1.00 0.00 ? 28 ALA A H    18 
ATOM   10332 H  HA   . ALA A 1 28 ? -5.396  -1.414  -2.641  1.00 0.00 ? 28 ALA A HA   18 
ATOM   10333 H  HB1  . ALA A 1 28 ? -7.634  -3.292  -2.106  1.00 0.00 ? 28 ALA A HB1  18 
ATOM   10334 H  HB2  . ALA A 1 28 ? -7.310  -2.288  -3.519  1.00 0.00 ? 28 ALA A HB2  18 
ATOM   10335 H  HB3  . ALA A 1 28 ? -6.395  -3.776  -3.263  1.00 0.00 ? 28 ALA A HB3  18 
ATOM   10336 N  N    . LEU A 1 29 ? -6.612  -2.163  0.321   1.00 0.00 ? 29 LEU A N    18 
ATOM   10337 C  CA   . LEU A 1 29 ? -7.199  -1.592  1.533   1.00 0.00 ? 29 LEU A CA   18 
ATOM   10338 C  C    . LEU A 1 29 ? -6.475  -0.318  1.949   1.00 0.00 ? 29 LEU A C    18 
ATOM   10339 O  O    . LEU A 1 29 ? -7.102  0.724   2.149   1.00 0.00 ? 29 LEU A O    18 
ATOM   10340 C  CB   . LEU A 1 29 ? -7.161  -2.600  2.676   1.00 0.00 ? 29 LEU A CB   18 
ATOM   10341 C  CG   . LEU A 1 29 ? -8.165  -3.743  2.568   1.00 0.00 ? 29 LEU A CG   18 
ATOM   10342 C  CD1  . LEU A 1 29 ? -7.978  -4.716  3.714   1.00 0.00 ? 29 LEU A CD1  18 
ATOM   10343 C  CD2  . LEU A 1 29 ? -9.585  -3.204  2.547   1.00 0.00 ? 29 LEU A CD2  18 
ATOM   10344 H  H    . LEU A 1 29 ? -6.301  -3.096  0.337   1.00 0.00 ? 29 LEU A H    18 
ATOM   10345 H  HA   . LEU A 1 29 ? -8.227  -1.351  1.320   1.00 0.00 ? 29 LEU A HA   18 
ATOM   10346 H  HB2  . LEU A 1 29 ? -6.170  -3.022  2.725   1.00 0.00 ? 29 LEU A HB2  18 
ATOM   10347 H  HB3  . LEU A 1 29 ? -7.356  -2.071  3.594   1.00 0.00 ? 29 LEU A HB3  18 
ATOM   10348 H  HG   . LEU A 1 29 ? -7.995  -4.277  1.644   1.00 0.00 ? 29 LEU A HG   18 
ATOM   10349 H  HD11 . LEU A 1 29 ? -7.051  -5.255  3.581   1.00 0.00 ? 29 LEU A HD11 18 
ATOM   10350 H  HD12 . LEU A 1 29 ? -7.947  -4.172  4.646   1.00 0.00 ? 29 LEU A HD12 18 
ATOM   10351 H  HD13 . LEU A 1 29 ? -8.801  -5.414  3.731   1.00 0.00 ? 29 LEU A HD13 18 
ATOM   10352 H  HD21 . LEU A 1 29 ? -10.218 -3.882  1.995   1.00 0.00 ? 29 LEU A HD21 18 
ATOM   10353 H  HD22 . LEU A 1 29 ? -9.952  -3.111  3.558   1.00 0.00 ? 29 LEU A HD22 18 
ATOM   10354 H  HD23 . LEU A 1 29 ? -9.591  -2.235  2.071   1.00 0.00 ? 29 LEU A HD23 18 
ATOM   10355 N  N    . HIS A 1 30 ? -5.153  -0.394  2.015   1.00 0.00 ? 30 HIS A N    18 
ATOM   10356 C  CA   . HIS A 1 30 ? -4.335  0.768   2.340   1.00 0.00 ? 30 HIS A CA   18 
ATOM   10357 C  C    . HIS A 1 30 ? -4.348  1.760   1.184   1.00 0.00 ? 30 HIS A C    18 
ATOM   10358 O  O    . HIS A 1 30 ? -4.289  2.975   1.383   1.00 0.00 ? 30 HIS A O    18 
ATOM   10359 C  CB   . HIS A 1 30 ? -2.889  0.335   2.647   1.00 0.00 ? 30 HIS A CB   18 
ATOM   10360 C  CG   . HIS A 1 30 ? -1.855  1.402   2.392   1.00 0.00 ? 30 HIS A CG   18 
ATOM   10361 N  ND1  . HIS A 1 30 ? -1.681  2.507   3.190   1.00 0.00 ? 30 HIS A ND1  18 
ATOM   10362 C  CD2  . HIS A 1 30 ? -0.956  1.530   1.378   1.00 0.00 ? 30 HIS A CD2  18 
ATOM   10363 C  CE1  . HIS A 1 30 ? -0.713  3.260   2.648   1.00 0.00 ? 30 HIS A CE1  18 
ATOM   10364 N  NE2  . HIS A 1 30 ? -0.235  2.713   1.545   1.00 0.00 ? 30 HIS A NE2  18 
ATOM   10365 H  H    . HIS A 1 30 ? -4.712  -1.247  1.805   1.00 0.00 ? 30 HIS A H    18 
ATOM   10366 H  HA   . HIS A 1 30 ? -4.758  1.241   3.213   1.00 0.00 ? 30 HIS A HA   18 
ATOM   10367 H  HB2  . HIS A 1 30 ? -2.820  0.054   3.686   1.00 0.00 ? 30 HIS A HB2  18 
ATOM   10368 H  HB3  . HIS A 1 30 ? -2.643  -0.519  2.032   1.00 0.00 ? 30 HIS A HB3  18 
ATOM   10369 H  HD1  . HIS A 1 30 ? -2.183  2.715   4.021   1.00 0.00 ? 30 HIS A HD1  18 
ATOM   10370 H  HD2  . HIS A 1 30 ? -0.814  0.832   0.567   1.00 0.00 ? 30 HIS A HD2  18 
ATOM   10371 H  HE1  . HIS A 1 30 ? -0.365  4.193   3.063   1.00 0.00 ? 30 HIS A HE1  18 
ATOM   10372 N  N    . ARG A 1 31 ? -4.360  1.229   -0.028  1.00 0.00 ? 31 ARG A N    18 
ATOM   10373 C  CA   . ARG A 1 31 ? -4.250  2.051   -1.216  1.00 0.00 ? 31 ARG A CA   18 
ATOM   10374 C  C    . ARG A 1 31 ? -5.545  2.797   -1.502  1.00 0.00 ? 31 ARG A C    18 
ATOM   10375 O  O    . ARG A 1 31 ? -5.592  3.646   -2.388  1.00 0.00 ? 31 ARG A O    18 
ATOM   10376 C  CB   . ARG A 1 31 ? -3.856  1.203   -2.422  1.00 0.00 ? 31 ARG A CB   18 
ATOM   10377 C  CG   . ARG A 1 31 ? -2.395  0.785   -2.406  1.00 0.00 ? 31 ARG A CG   18 
ATOM   10378 C  CD   . ARG A 1 31 ? -1.857  0.546   -3.808  1.00 0.00 ? 31 ARG A CD   18 
ATOM   10379 N  NE   . ARG A 1 31 ? -1.643  1.795   -4.534  1.00 0.00 ? 31 ARG A NE   18 
ATOM   10380 C  CZ   . ARG A 1 31 ? -2.375  2.186   -5.579  1.00 0.00 ? 31 ARG A CZ   18 
ATOM   10381 N  NH1  . ARG A 1 31 ? -3.402  1.455   -5.991  1.00 0.00 ? 31 ARG A NH1  18 
ATOM   10382 N  NH2  . ARG A 1 31 ? -2.083  3.322   -6.198  1.00 0.00 ? 31 ARG A NH2  18 
ATOM   10383 H  H    . ARG A 1 31 ? -4.398  0.249   -0.121  1.00 0.00 ? 31 ARG A H    18 
ATOM   10384 H  HA   . ARG A 1 31 ? -3.464  2.773   -1.031  1.00 0.00 ? 31 ARG A HA   18 
ATOM   10385 H  HB2  . ARG A 1 31 ? -4.468  0.313   -2.440  1.00 0.00 ? 31 ARG A HB2  18 
ATOM   10386 H  HB3  . ARG A 1 31 ? -4.038  1.775   -3.320  1.00 0.00 ? 31 ARG A HB3  18 
ATOM   10387 H  HG2  . ARG A 1 31 ? -1.813  1.566   -1.939  1.00 0.00 ? 31 ARG A HG2  18 
ATOM   10388 H  HG3  . ARG A 1 31 ? -2.299  -0.126  -1.834  1.00 0.00 ? 31 ARG A HG3  18 
ATOM   10389 H  HD2  . ARG A 1 31 ? -0.912  0.028   -3.730  1.00 0.00 ? 31 ARG A HD2  18 
ATOM   10390 H  HD3  . ARG A 1 31 ? -2.561  -0.064  -4.353  1.00 0.00 ? 31 ARG A HD3  18 
ATOM   10391 H  HE   . ARG A 1 31 ? -0.903  2.366   -4.234  1.00 0.00 ? 31 ARG A HE   18 
ATOM   10392 H  HH11 . ARG A 1 31 ? -3.639  0.594   -5.519  1.00 0.00 ? 31 ARG A HH11 18 
ATOM   10393 H  HH12 . ARG A 1 31 ? -3.957  1.756   -6.777  1.00 0.00 ? 31 ARG A HH12 18 
ATOM   10394 H  HH21 . ARG A 1 31 ? -1.313  3.889   -5.879  1.00 0.00 ? 31 ARG A HH21 18 
ATOM   10395 H  HH22 . ARG A 1 31 ? -2.625  3.620   -6.995  1.00 0.00 ? 31 ARG A HH22 18 
ATOM   10396 N  N    . LYS A 1 32 ? -6.575  2.526   -0.709  1.00 0.00 ? 32 LYS A N    18 
ATOM   10397 C  CA   . LYS A 1 32 ? -7.845  3.228   -0.840  1.00 0.00 ? 32 LYS A CA   18 
ATOM   10398 C  C    . LYS A 1 32 ? -7.653  4.710   -0.554  1.00 0.00 ? 32 LYS A C    18 
ATOM   10399 O  O    . LYS A 1 32 ? -8.336  5.557   -1.126  1.00 0.00 ? 32 LYS A O    18 
ATOM   10400 C  CB   . LYS A 1 32 ? -8.881  2.645   0.119   1.00 0.00 ? 32 LYS A CB   18 
ATOM   10401 C  CG   . LYS A 1 32 ? -9.962  1.830   -0.567  1.00 0.00 ? 32 LYS A CG   18 
ATOM   10402 C  CD   . LYS A 1 32 ? -9.725  0.341   -0.391  1.00 0.00 ? 32 LYS A CD   18 
ATOM   10403 C  CE   . LYS A 1 32 ? -10.004 -0.417  -1.677  1.00 0.00 ? 32 LYS A CE   18 
ATOM   10404 N  NZ   . LYS A 1 32 ? -10.998 -1.502  -1.481  1.00 0.00 ? 32 LYS A NZ   18 
ATOM   10405 H  H    . LYS A 1 32 ? -6.471  1.853   0.000   1.00 0.00 ? 32 LYS A H    18 
ATOM   10406 H  HA   . LYS A 1 32 ? -8.193  3.108   -1.855  1.00 0.00 ? 32 LYS A HA   18 
ATOM   10407 H  HB2  . LYS A 1 32 ? -8.376  2.007   0.828   1.00 0.00 ? 32 LYS A HB2  18 
ATOM   10408 H  HB3  . LYS A 1 32 ? -9.353  3.457   0.651   1.00 0.00 ? 32 LYS A HB3  18 
ATOM   10409 H  HG2  . LYS A 1 32 ? -10.920 2.086   -0.138  1.00 0.00 ? 32 LYS A HG2  18 
ATOM   10410 H  HG3  . LYS A 1 32 ? -9.964  2.064   -1.621  1.00 0.00 ? 32 LYS A HG3  18 
ATOM   10411 H  HD2  . LYS A 1 32 ? -8.691  0.181   -0.110  1.00 0.00 ? 32 LYS A HD2  18 
ATOM   10412 H  HD3  . LYS A 1 32 ? -10.376 -0.031  0.389   1.00 0.00 ? 32 LYS A HD3  18 
ATOM   10413 H  HE2  . LYS A 1 32 ? -10.383 0.276   -2.414  1.00 0.00 ? 32 LYS A HE2  18 
ATOM   10414 H  HE3  . LYS A 1 32 ? -9.078  -0.848  -2.033  1.00 0.00 ? 32 LYS A HE3  18 
ATOM   10415 H  HZ1  . LYS A 1 32 ? -11.572 -1.319  -0.629  1.00 0.00 ? 32 LYS A HZ1  18 
ATOM   10416 H  HZ2  . LYS A 1 32 ? -10.516 -2.420  -1.366  1.00 0.00 ? 32 LYS A HZ2  18 
ATOM   10417 H  HZ3  . LYS A 1 32 ? -11.636 -1.556  -2.307  1.00 0.00 ? 32 LYS A HZ3  18 
ATOM   10418 N  N    . ARG A 1 33 ? -6.657  5.015   0.268   1.00 0.00 ? 33 ARG A N    18 
ATOM   10419 C  CA   . ARG A 1 33 ? -6.323  6.393   0.596   1.00 0.00 ? 33 ARG A CA   18 
ATOM   10420 C  C    . ARG A 1 33 ? -5.521  7.038   -0.529  1.00 0.00 ? 33 ARG A C    18 
ATOM   10421 O  O    . ARG A 1 33 ? -5.386  8.257   -0.589  1.00 0.00 ? 33 ARG A O    18 
ATOM   10422 C  CB   . ARG A 1 33 ? -5.533  6.453   1.904   1.00 0.00 ? 33 ARG A CB   18 
ATOM   10423 C  CG   . ARG A 1 33 ? -6.258  5.820   3.082   1.00 0.00 ? 33 ARG A CG   18 
ATOM   10424 C  CD   . ARG A 1 33 ? -5.295  5.092   4.009   1.00 0.00 ? 33 ARG A CD   18 
ATOM   10425 N  NE   . ARG A 1 33 ? -4.172  5.939   4.411   1.00 0.00 ? 33 ARG A NE   18 
ATOM   10426 C  CZ   . ARG A 1 33 ? -4.141  6.653   5.538   1.00 0.00 ? 33 ARG A CZ   18 
ATOM   10427 N  NH1  . ARG A 1 33 ? -5.131  6.556   6.419   1.00 0.00 ? 33 ARG A NH1  18 
ATOM   10428 N  NH2  . ARG A 1 33 ? -3.103  7.442   5.796   1.00 0.00 ? 33 ARG A NH2  18 
ATOM   10429 H  H    . ARG A 1 33 ? -6.109  4.290   0.639   1.00 0.00 ? 33 ARG A H    18 
ATOM   10430 H  HA   . ARG A 1 33 ? -7.246  6.936   0.714   1.00 0.00 ? 33 ARG A HA   18 
ATOM   10431 H  HB2  . ARG A 1 33 ? -4.595  5.936   1.766   1.00 0.00 ? 33 ARG A HB2  18 
ATOM   10432 H  HB3  . ARG A 1 33 ? -5.333  7.486   2.144   1.00 0.00 ? 33 ARG A HB3  18 
ATOM   10433 H  HG2  . ARG A 1 33 ? -6.764  6.594   3.641   1.00 0.00 ? 33 ARG A HG2  18 
ATOM   10434 H  HG3  . ARG A 1 33 ? -6.983  5.113   2.707   1.00 0.00 ? 33 ARG A HG3  18 
ATOM   10435 H  HD2  . ARG A 1 33 ? -5.832  4.780   4.892   1.00 0.00 ? 33 ARG A HD2  18 
ATOM   10436 H  HD3  . ARG A 1 33 ? -4.912  4.223   3.495   1.00 0.00 ? 33 ARG A HD3  18 
ATOM   10437 H  HE   . ARG A 1 33 ? -3.405  5.993   3.791   1.00 0.00 ? 33 ARG A HE   18 
ATOM   10438 H  HH11 . ARG A 1 33 ? -5.910  5.942   6.243   1.00 0.00 ? 33 ARG A HH11 18 
ATOM   10439 H  HH12 . ARG A 1 33 ? -5.102  7.090   7.274   1.00 0.00 ? 33 ARG A HH12 18 
ATOM   10440 H  HH21 . ARG A 1 33 ? -2.337  7.495   5.148   1.00 0.00 ? 33 ARG A HH21 18 
ATOM   10441 H  HH22 . ARG A 1 33 ? -3.085  8.001   6.633   1.00 0.00 ? 33 ARG A HH22 18 
ATOM   10442 N  N    . HIS A 1 34 ? -5.063  6.218   -1.462  1.00 0.00 ? 34 HIS A N    18 
ATOM   10443 C  CA   . HIS A 1 34 ? -4.339  6.713   -2.625  1.00 0.00 ? 34 HIS A CA   18 
ATOM   10444 C  C    . HIS A 1 34 ? -5.296  6.901   -3.788  1.00 0.00 ? 34 HIS A C    18 
ATOM   10445 O  O    . HIS A 1 34 ? -4.924  7.421   -4.840  1.00 0.00 ? 34 HIS A O    18 
ATOM   10446 C  CB   . HIS A 1 34 ? -3.228  5.744   -3.027  1.00 0.00 ? 34 HIS A CB   18 
ATOM   10447 C  CG   . HIS A 1 34 ? -2.128  5.629   -2.024  1.00 0.00 ? 34 HIS A CG   18 
ATOM   10448 N  ND1  . HIS A 1 34 ? -1.372  6.687   -1.582  1.00 0.00 ? 34 HIS A ND1  18 
ATOM   10449 C  CD2  . HIS A 1 34 ? -1.649  4.536   -1.390  1.00 0.00 ? 34 HIS A CD2  18 
ATOM   10450 C  CE1  . HIS A 1 34 ? -0.468  6.210   -0.713  1.00 0.00 ? 34 HIS A CE1  18 
ATOM   10451 N  NE2  . HIS A 1 34 ? -0.597  4.901   -0.563  1.00 0.00 ? 34 HIS A NE2  18 
ATOM   10452 H  H    . HIS A 1 34 ? -5.269  5.259   -1.400  1.00 0.00 ? 34 HIS A H    18 
ATOM   10453 H  HA   . HIS A 1 34 ? -3.904  7.669   -2.367  1.00 0.00 ? 34 HIS A HA   18 
ATOM   10454 H  HB2  . HIS A 1 34 ? -3.650  4.760   -3.166  1.00 0.00 ? 34 HIS A HB2  18 
ATOM   10455 H  HB3  . HIS A 1 34 ? -2.793  6.077   -3.960  1.00 0.00 ? 34 HIS A HB3  18 
ATOM   10456 H  HD1  . HIS A 1 34 ? -1.469  7.634   -1.858  1.00 0.00 ? 34 HIS A HD1  18 
ATOM   10457 H  HD2  . HIS A 1 34 ? -2.023  3.528   -1.497  1.00 0.00 ? 34 HIS A HD2  18 
ATOM   10458 H  HE1  . HIS A 1 34 ? 0.267   6.813   -0.203  1.00 0.00 ? 34 HIS A HE1  18 
ATOM   10459 N  N    . MET A 1 35 ? -6.540  6.489   -3.584  1.00 0.00 ? 35 MET A N    18 
ATOM   10460 C  CA   . MET A 1 35 ? -7.566  6.604   -4.611  1.00 0.00 ? 35 MET A CA   18 
ATOM   10461 C  C    . MET A 1 35 ? -8.339  7.904   -4.435  1.00 0.00 ? 35 MET A C    18 
ATOM   10462 O  O    . MET A 1 35 ? -9.441  8.071   -4.962  1.00 0.00 ? 35 MET A O    18 
ATOM   10463 C  CB   . MET A 1 35 ? -8.509  5.400   -4.553  1.00 0.00 ? 35 MET A CB   18 
ATOM   10464 C  CG   . MET A 1 35 ? -7.803  4.071   -4.774  1.00 0.00 ? 35 MET A CG   18 
ATOM   10465 S  SD   . MET A 1 35 ? -8.822  2.647   -4.340  1.00 0.00 ? 35 MET A SD   18 
ATOM   10466 C  CE   . MET A 1 35 ? -7.572  1.368   -4.227  1.00 0.00 ? 35 MET A CE   18 
ATOM   10467 H  H    . MET A 1 35 ? -6.781  6.106   -2.709  1.00 0.00 ? 35 MET A H    18 
ATOM   10468 H  HA   . MET A 1 35 ? -7.074  6.620   -5.570  1.00 0.00 ? 35 MET A HA   18 
ATOM   10469 H  HB2  . MET A 1 35 ? -8.980  5.377   -3.583  1.00 0.00 ? 35 MET A HB2  18 
ATOM   10470 H  HB3  . MET A 1 35 ? -9.267  5.514   -5.313  1.00 0.00 ? 35 MET A HB3  18 
ATOM   10471 H  HG2  . MET A 1 35 ? -7.527  3.993   -5.814  1.00 0.00 ? 35 MET A HG2  18 
ATOM   10472 H  HG3  . MET A 1 35 ? -6.910  4.050   -4.167  1.00 0.00 ? 35 MET A HG3  18 
ATOM   10473 H  HE1  . MET A 1 35 ? -6.948  1.548   -3.362  1.00 0.00 ? 35 MET A HE1  18 
ATOM   10474 H  HE2  . MET A 1 35 ? -8.050  0.405   -4.131  1.00 0.00 ? 35 MET A HE2  18 
ATOM   10475 H  HE3  . MET A 1 35 ? -6.963  1.381   -5.118  1.00 0.00 ? 35 MET A HE3  18 
ATOM   10476 N  N    . LEU A 1 36 ? -7.723  8.837   -3.720  1.00 0.00 ? 36 LEU A N    18 
ATOM   10477 C  CA   . LEU A 1 36 ? -8.293  10.153  -3.513  1.00 0.00 ? 36 LEU A CA   18 
ATOM   10478 C  C    . LEU A 1 36 ? -7.169  11.179  -3.485  1.00 0.00 ? 36 LEU A C    18 
ATOM   10479 O  O    . LEU A 1 36 ? -7.064  11.978  -2.554  1.00 0.00 ? 36 LEU A O    18 
ATOM   10480 C  CB   . LEU A 1 36 ? -9.073  10.208  -2.193  1.00 0.00 ? 36 LEU A CB   18 
ATOM   10481 C  CG   . LEU A 1 36 ? -9.184  8.886   -1.428  1.00 0.00 ? 36 LEU A CG   18 
ATOM   10482 C  CD1  . LEU A 1 36 ? -8.747  9.069   0.019   1.00 0.00 ? 36 LEU A CD1  18 
ATOM   10483 C  CD2  . LEU A 1 36 ? -10.602 8.349   -1.488  1.00 0.00 ? 36 LEU A CD2  18 
ATOM   10484 H  H    . LEU A 1 36 ? -6.831  8.655   -3.366  1.00 0.00 ? 36 LEU A H    18 
ATOM   10485 H  HA   . LEU A 1 36 ? -8.956  10.371  -4.335  1.00 0.00 ? 36 LEU A HA   18 
ATOM   10486 H  HB2  . LEU A 1 36 ? -8.588  10.924  -1.550  1.00 0.00 ? 36 LEU A HB2  18 
ATOM   10487 H  HB3  . LEU A 1 36 ? -10.071 10.559  -2.407  1.00 0.00 ? 36 LEU A HB3  18 
ATOM   10488 H  HG   . LEU A 1 36 ? -8.530  8.156   -1.886  1.00 0.00 ? 36 LEU A HG   18 
ATOM   10489 H  HD11 . LEU A 1 36 ? -9.617  9.106   0.657   1.00 0.00 ? 36 LEU A HD11 18 
ATOM   10490 H  HD12 . LEU A 1 36 ? -8.118  8.242   0.316   1.00 0.00 ? 36 LEU A HD12 18 
ATOM   10491 H  HD13 . LEU A 1 36 ? -8.194  9.993   0.113   1.00 0.00 ? 36 LEU A HD13 18 
ATOM   10492 H  HD21 . LEU A 1 36 ? -11.070 8.457   -0.522  1.00 0.00 ? 36 LEU A HD21 18 
ATOM   10493 H  HD22 . LEU A 1 36 ? -11.166 8.903   -2.225  1.00 0.00 ? 36 LEU A HD22 18 
ATOM   10494 H  HD23 . LEU A 1 36 ? -10.581 7.305   -1.765  1.00 0.00 ? 36 LEU A HD23 18 
ATOM   10495 N  N    . VAL A 1 37 ? -6.336  11.131  -4.523  1.00 0.00 ? 37 VAL A N    18 
ATOM   10496 C  CA   . VAL A 1 37 ? -5.175  12.012  -4.660  1.00 0.00 ? 37 VAL A CA   18 
ATOM   10497 C  C    . VAL A 1 37 ? -4.181  11.810  -3.514  1.00 0.00 ? 37 VAL A C    18 
ATOM   10498 O  O    . VAL A 1 37 ? -3.234  11.015  -3.689  1.00 0.00 ? 37 VAL A O    18 
ATOM   10499 C  CB   . VAL A 1 37 ? -5.578  13.502  -4.748  1.00 0.00 ? 37 VAL A CB   18 
ATOM   10500 C  CG1  . VAL A 1 37 ? -4.354  14.382  -4.972  1.00 0.00 ? 37 VAL A CG1  18 
ATOM   10501 C  CG2  . VAL A 1 37 ? -6.594  13.714  -5.860  1.00 0.00 ? 37 VAL A CG2  18 
ATOM   10502 O  OXT  . VAL A 1 37 ? -4.341  12.448  -2.450  1.00 0.00 ? 37 VAL A OXT  18 
ATOM   10503 H  H    . VAL A 1 37 ? -6.490  10.454  -5.215  1.00 0.00 ? 37 VAL A H    18 
ATOM   10504 H  HA   . VAL A 1 37 ? -4.684  11.747  -5.585  1.00 0.00 ? 37 VAL A HA   18 
ATOM   10505 H  HB   . VAL A 1 37 ? -6.036  13.786  -3.811  1.00 0.00 ? 37 VAL A HB   18 
ATOM   10506 H  HG11 . VAL A 1 37 ? -4.405  15.245  -4.324  1.00 0.00 ? 37 VAL A HG11 18 
ATOM   10507 H  HG12 . VAL A 1 37 ? -3.461  13.817  -4.750  1.00 0.00 ? 37 VAL A HG12 18 
ATOM   10508 H  HG13 . VAL A 1 37 ? -4.327  14.707  -6.002  1.00 0.00 ? 37 VAL A HG13 18 
ATOM   10509 H  HG21 . VAL A 1 37 ? -6.511  12.914  -6.582  1.00 0.00 ? 37 VAL A HG21 18 
ATOM   10510 H  HG22 . VAL A 1 37 ? -7.589  13.720  -5.440  1.00 0.00 ? 37 VAL A HG22 18 
ATOM   10511 H  HG23 . VAL A 1 37 ? -6.401  14.660  -6.346  1.00 0.00 ? 37 VAL A HG23 18 
HETATM 10512 ZN ZN   . ZN  B 2 .  ? 0.784   3.728   0.167   1.00 0.00 ? 38 ZN  A ZN   18 
ATOM   10513 N  N    . GLY A 1 1  ? 3.907   9.771   0.884   1.00 0.00 ? 1  GLY A N    19 
ATOM   10514 C  CA   . GLY A 1 1  ? 5.269   10.060  0.380   1.00 0.00 ? 1  GLY A CA   19 
ATOM   10515 C  C    . GLY A 1 1  ? 5.930   8.828   -0.197  1.00 0.00 ? 1  GLY A C    19 
ATOM   10516 O  O    . GLY A 1 1  ? 5.800   7.735   0.353   1.00 0.00 ? 1  GLY A O    19 
ATOM   10517 H  H1   . GLY A 1 1  ? 3.292   10.601  0.750   1.00 0.00 ? 1  GLY A H1   19 
ATOM   10518 H  H2   . GLY A 1 1  ? 3.942   9.538   1.900   1.00 0.00 ? 1  GLY A H2   19 
ATOM   10519 H  H3   . GLY A 1 1  ? 3.499   8.959   0.370   1.00 0.00 ? 1  GLY A H3   19 
ATOM   10520 H  HA2  . GLY A 1 1  ? 5.208   10.818  -0.385  1.00 0.00 ? 1  GLY A HA2  19 
ATOM   10521 H  HA3  . GLY A 1 1  ? 5.871   10.431  1.196   1.00 0.00 ? 1  GLY A HA3  19 
ATOM   10522 N  N    . SER A 1 2  ? 6.604   8.995   -1.327  1.00 0.00 ? 2  SER A N    19 
ATOM   10523 C  CA   . SER A 1 2  ? 7.246   7.882   -2.010  1.00 0.00 ? 2  SER A CA   19 
ATOM   10524 C  C    . SER A 1 2  ? 8.336   7.253   -1.145  1.00 0.00 ? 2  SER A C    19 
ATOM   10525 O  O    . SER A 1 2  ? 9.177   7.956   -0.582  1.00 0.00 ? 2  SER A O    19 
ATOM   10526 C  CB   . SER A 1 2  ? 7.832   8.363   -3.336  1.00 0.00 ? 2  SER A CB   19 
ATOM   10527 O  OG   . SER A 1 2  ? 7.590   9.749   -3.525  1.00 0.00 ? 2  SER A OG   19 
ATOM   10528 H  H    . SER A 1 2  ? 6.640   9.885   -1.738  1.00 0.00 ? 2  SER A H    19 
ATOM   10529 H  HA   . SER A 1 2  ? 6.489   7.139   -2.211  1.00 0.00 ? 2  SER A HA   19 
ATOM   10530 H  HB2  . SER A 1 2  ? 8.898   8.189   -3.342  1.00 0.00 ? 2  SER A HB2  19 
ATOM   10531 H  HB3  . SER A 1 2  ? 7.375   7.817   -4.149  1.00 0.00 ? 2  SER A HB3  19 
ATOM   10532 H  HG   . SER A 1 2  ? 8.267   10.258  -3.054  1.00 0.00 ? 2  SER A HG   19 
ATOM   10533 N  N    . THR A 1 3  ? 8.300   5.925   -1.046  1.00 0.00 ? 3  THR A N    19 
ATOM   10534 C  CA   . THR A 1 3  ? 9.280   5.160   -0.275  1.00 0.00 ? 3  THR A CA   19 
ATOM   10535 C  C    . THR A 1 3  ? 9.380   5.645   1.174   1.00 0.00 ? 3  THR A C    19 
ATOM   10536 O  O    . THR A 1 3  ? 10.466  5.698   1.749   1.00 0.00 ? 3  THR A O    19 
ATOM   10537 C  CB   . THR A 1 3  ? 10.675  5.215   -0.929  1.00 0.00 ? 3  THR A CB   19 
ATOM   10538 O  OG1  . THR A 1 3  ? 10.556  5.563   -2.318  1.00 0.00 ? 3  THR A OG1  19 
ATOM   10539 C  CG2  . THR A 1 3  ? 11.385  3.875   -0.801  1.00 0.00 ? 3  THR A CG2  19 
ATOM   10540 H  H    . THR A 1 3  ? 7.594   5.437   -1.525  1.00 0.00 ? 3  THR A H    19 
ATOM   10541 H  HA   . THR A 1 3  ? 8.957   4.129   -0.270  1.00 0.00 ? 3  THR A HA   19 
ATOM   10542 H  HB   . THR A 1 3  ? 11.264  5.968   -0.426  1.00 0.00 ? 3  THR A HB   19 
ATOM   10543 H  HG1  . THR A 1 3  ? 9.721   5.209   -2.666  1.00 0.00 ? 3  THR A HG1  19 
ATOM   10544 H  HG21 . THR A 1 3  ? 10.673  3.117   -0.507  1.00 0.00 ? 3  THR A HG21 19 
ATOM   10545 H  HG22 . THR A 1 3  ? 12.159  3.951   -0.052  1.00 0.00 ? 3  THR A HG22 19 
ATOM   10546 H  HG23 . THR A 1 3  ? 11.826  3.606   -1.749  1.00 0.00 ? 3  THR A HG23 19 
ATOM   10547 N  N    . ARG A 1 4  ? 8.240   5.972   1.771   1.00 0.00 ? 4  ARG A N    19 
ATOM   10548 C  CA   . ARG A 1 4  ? 8.215   6.418   3.161   1.00 0.00 ? 4  ARG A CA   19 
ATOM   10549 C  C    . ARG A 1 4  ? 8.421   5.242   4.106   1.00 0.00 ? 4  ARG A C    19 
ATOM   10550 O  O    . ARG A 1 4  ? 8.902   5.412   5.227   1.00 0.00 ? 4  ARG A O    19 
ATOM   10551 C  CB   . ARG A 1 4  ? 6.896   7.130   3.485   1.00 0.00 ? 4  ARG A CB   19 
ATOM   10552 C  CG   . ARG A 1 4  ? 5.658   6.331   3.113   1.00 0.00 ? 4  ARG A CG   19 
ATOM   10553 C  CD   . ARG A 1 4  ? 4.793   6.035   4.325   1.00 0.00 ? 4  ARG A CD   19 
ATOM   10554 N  NE   . ARG A 1 4  ? 4.916   4.643   4.750   1.00 0.00 ? 4  ARG A NE   19 
ATOM   10555 C  CZ   . ARG A 1 4  ? 4.792   4.236   6.013   1.00 0.00 ? 4  ARG A CZ   19 
ATOM   10556 N  NH1  . ARG A 1 4  ? 4.508   5.107   6.972   1.00 0.00 ? 4  ARG A NH1  19 
ATOM   10557 N  NH2  . ARG A 1 4  ? 4.952   2.952   6.320   1.00 0.00 ? 4  ARG A NH2  19 
ATOM   10558 H  H    . ARG A 1 4  ? 7.399   5.904   1.269   1.00 0.00 ? 4  ARG A H    19 
ATOM   10559 H  HA   . ARG A 1 4  ? 9.029   7.116   3.296   1.00 0.00 ? 4  ARG A HA   19 
ATOM   10560 H  HB2  . ARG A 1 4  ? 6.864   7.328   4.546   1.00 0.00 ? 4  ARG A HB2  19 
ATOM   10561 H  HB3  . ARG A 1 4  ? 6.866   8.069   2.953   1.00 0.00 ? 4  ARG A HB3  19 
ATOM   10562 H  HG2  . ARG A 1 4  ? 5.078   6.895   2.400   1.00 0.00 ? 4  ARG A HG2  19 
ATOM   10563 H  HG3  . ARG A 1 4  ? 5.969   5.396   2.669   1.00 0.00 ? 4  ARG A HG3  19 
ATOM   10564 H  HD2  . ARG A 1 4  ? 5.100   6.681   5.137   1.00 0.00 ? 4  ARG A HD2  19 
ATOM   10565 H  HD3  . ARG A 1 4  ? 3.763   6.238   4.076   1.00 0.00 ? 4  ARG A HD3  19 
ATOM   10566 H  HE   . ARG A 1 4  ? 5.107   3.978   4.055   1.00 0.00 ? 4  ARG A HE   19 
ATOM   10567 H  HH11 . ARG A 1 4  ? 4.388   6.080   6.755   1.00 0.00 ? 4  ARG A HH11 19 
ATOM   10568 H  HH12 . ARG A 1 4  ? 4.396   4.793   7.925   1.00 0.00 ? 4  ARG A HH12 19 
ATOM   10569 H  HH21 . ARG A 1 4  ? 5.168   2.277   5.607   1.00 0.00 ? 4  ARG A HH21 19 
ATOM   10570 H  HH22 . ARG A 1 4  ? 4.868   2.647   7.277   1.00 0.00 ? 4  ARG A HH22 19 
ATOM   10571 N  N    . GLY A 1 5  ? 8.062   4.049   3.650   1.00 0.00 ? 5  GLY A N    19 
ATOM   10572 C  CA   . GLY A 1 5  ? 8.212   2.869   4.476   1.00 0.00 ? 5  GLY A CA   19 
ATOM   10573 C  C    . GLY A 1 5  ? 9.503   2.129   4.196   1.00 0.00 ? 5  GLY A C    19 
ATOM   10574 O  O    . GLY A 1 5  ? 10.082  1.527   5.101   1.00 0.00 ? 5  GLY A O    19 
ATOM   10575 H  H    . GLY A 1 5  ? 7.695   3.970   2.740   1.00 0.00 ? 5  GLY A H    19 
ATOM   10576 H  HA2  . GLY A 1 5  ? 8.199   3.167   5.514   1.00 0.00 ? 5  GLY A HA2  19 
ATOM   10577 H  HA3  . GLY A 1 5  ? 7.381   2.205   4.290   1.00 0.00 ? 5  GLY A HA3  19 
ATOM   10578 N  N    . SER A 1 6  ? 9.964   2.206   2.945   1.00 0.00 ? 6  SER A N    19 
ATOM   10579 C  CA   . SER A 1 6  ? 11.194  1.553   2.514   1.00 0.00 ? 6  SER A CA   19 
ATOM   10580 C  C    . SER A 1 6  ? 11.185  0.063   2.861   1.00 0.00 ? 6  SER A C    19 
ATOM   10581 O  O    . SER A 1 6  ? 12.208  -0.508  3.246   1.00 0.00 ? 6  SER A O    19 
ATOM   10582 C  CB   . SER A 1 6  ? 12.392  2.242   3.156   1.00 0.00 ? 6  SER A CB   19 
ATOM   10583 O  OG   . SER A 1 6  ? 12.198  3.646   3.243   1.00 0.00 ? 6  SER A OG   19 
ATOM   10584 H  H    . SER A 1 6  ? 9.487   2.756   2.306   1.00 0.00 ? 6  SER A H    19 
ATOM   10585 H  HA   . SER A 1 6  ? 11.264  1.658   1.441   1.00 0.00 ? 6  SER A HA   19 
ATOM   10586 H  HB2  . SER A 1 6  ? 12.524  1.853   4.149   1.00 0.00 ? 6  SER A HB2  19 
ATOM   10587 H  HB3  . SER A 1 6  ? 13.271  2.045   2.567   1.00 0.00 ? 6  SER A HB3  19 
ATOM   10588 H  HG   . SER A 1 6  ? 12.540  4.072   2.440   1.00 0.00 ? 6  SER A HG   19 
ATOM   10589 N  N    . THR A 1 7  ? 10.011  -0.546  2.776   1.00 0.00 ? 7  THR A N    19 
ATOM   10590 C  CA   . THR A 1 7  ? 9.842   -1.938  3.151   1.00 0.00 ? 7  THR A CA   19 
ATOM   10591 C  C    . THR A 1 7  ? 9.190   -2.732  2.025   1.00 0.00 ? 7  THR A C    19 
ATOM   10592 O  O    . THR A 1 7  ? 8.021   -3.109  2.121   1.00 0.00 ? 7  THR A O    19 
ATOM   10593 C  CB   . THR A 1 7  ? 8.970   -2.059  4.419   1.00 0.00 ? 7  THR A CB   19 
ATOM   10594 O  OG1  . THR A 1 7  ? 7.992   -1.008  4.437   1.00 0.00 ? 7  THR A OG1  19 
ATOM   10595 C  CG2  . THR A 1 7  ? 9.822   -1.980  5.676   1.00 0.00 ? 7  THR A CG2  19 
ATOM   10596 H  H    . THR A 1 7  ? 9.227   -0.031  2.493   1.00 0.00 ? 7  THR A H    19 
ATOM   10597 H  HA   . THR A 1 7  ? 10.816  -2.355  3.364   1.00 0.00 ? 7  THR A HA   19 
ATOM   10598 H  HB   . THR A 1 7  ? 8.465   -3.014  4.400   1.00 0.00 ? 7  THR A HB   19 
ATOM   10599 H  HG1  . THR A 1 7  ? 7.662   -0.867  3.536   1.00 0.00 ? 7  THR A HG1  19 
ATOM   10600 H  HG21 . THR A 1 7  ? 10.799  -2.393  5.475   1.00 0.00 ? 7  THR A HG21 19 
ATOM   10601 H  HG22 . THR A 1 7  ? 9.350   -2.543  6.467   1.00 0.00 ? 7  THR A HG22 19 
ATOM   10602 H  HG23 . THR A 1 7  ? 9.923   -0.948  5.978   1.00 0.00 ? 7  THR A HG23 19 
ATOM   10603 N  N    . GLY A 1 8  ? 9.955   -3.005  0.976   1.00 0.00 ? 8  GLY A N    19 
ATOM   10604 C  CA   . GLY A 1 8  ? 9.438   -3.757  -0.155  1.00 0.00 ? 8  GLY A CA   19 
ATOM   10605 C  C    . GLY A 1 8  ? 9.396   -5.250  0.102   1.00 0.00 ? 8  GLY A C    19 
ATOM   10606 O  O    . GLY A 1 8  ? 9.673   -6.056  -0.787  1.00 0.00 ? 8  GLY A O    19 
ATOM   10607 H  H    . GLY A 1 8  ? 10.875  -2.675  0.958   1.00 0.00 ? 8  GLY A H    19 
ATOM   10608 H  HA2  . GLY A 1 8  ? 8.436   -3.418  -0.363  1.00 0.00 ? 8  GLY A HA2  19 
ATOM   10609 H  HA3  . GLY A 1 8  ? 10.060  -3.567  -1.015  1.00 0.00 ? 8  GLY A HA3  19 
ATOM   10610 N  N    . ILE A 1 9  ? 8.958   -5.601  1.296   1.00 0.00 ? 9  ILE A N    19 
ATOM   10611 C  CA   . ILE A 1 9  ? 8.737   -6.988  1.675   1.00 0.00 ? 9  ILE A CA   19 
ATOM   10612 C  C    . ILE A 1 9  ? 7.420   -7.482  1.083   1.00 0.00 ? 9  ILE A C    19 
ATOM   10613 O  O    . ILE A 1 9  ? 6.571   -6.671  0.721   1.00 0.00 ? 9  ILE A O    19 
ATOM   10614 C  CB   . ILE A 1 9  ? 8.692   -7.137  3.214   1.00 0.00 ? 9  ILE A CB   19 
ATOM   10615 C  CG1  . ILE A 1 9  ? 9.693   -6.182  3.875   1.00 0.00 ? 9  ILE A CG1  19 
ATOM   10616 C  CG2  . ILE A 1 9  ? 8.971   -8.574  3.629   1.00 0.00 ? 9  ILE A CG2  19 
ATOM   10617 C  CD1  . ILE A 1 9  ? 9.289   -5.755  5.269   1.00 0.00 ? 9  ILE A CD1  19 
ATOM   10618 H  H    . ILE A 1 9  ? 8.651   -4.891  1.899   1.00 0.00 ? 9  ILE A H    19 
ATOM   10619 H  HA   . ILE A 1 9  ? 9.550   -7.585  1.290   1.00 0.00 ? 9  ILE A HA   19 
ATOM   10620 H  HB   . ILE A 1 9  ? 7.697   -6.881  3.544   1.00 0.00 ? 9  ILE A HB   19 
ATOM   10621 H  HG12 . ILE A 1 9  ? 10.656  -6.669  3.944   1.00 0.00 ? 9  ILE A HG12 19 
ATOM   10622 H  HG13 . ILE A 1 9  ? 9.787   -5.294  3.269   1.00 0.00 ? 9  ILE A HG13 19 
ATOM   10623 H  HG21 . ILE A 1 9  ? 9.003   -9.201  2.750   1.00 0.00 ? 9  ILE A HG21 19 
ATOM   10624 H  HG22 . ILE A 1 9  ? 9.922   -8.623  4.141   1.00 0.00 ? 9  ILE A HG22 19 
ATOM   10625 H  HG23 . ILE A 1 9  ? 8.188   -8.917  4.289   1.00 0.00 ? 9  ILE A HG23 19 
ATOM   10626 H  HD11 . ILE A 1 9  ? 9.158   -4.682  5.293   1.00 0.00 ? 9  ILE A HD11 19 
ATOM   10627 H  HD12 . ILE A 1 9  ? 8.359   -6.237  5.536   1.00 0.00 ? 9  ILE A HD12 19 
ATOM   10628 H  HD13 . ILE A 1 9  ? 10.057  -6.039  5.972   1.00 0.00 ? 9  ILE A HD13 19 
ATOM   10629 N  N    . LYS A 1 10 ? 7.215   -8.801  1.067   1.00 0.00 ? 10 LYS A N    19 
ATOM   10630 C  CA   . LYS A 1 10 ? 5.945   -9.387  0.628   1.00 0.00 ? 10 LYS A CA   19 
ATOM   10631 C  C    . LYS A 1 10 ? 5.699   -9.163  -0.868  1.00 0.00 ? 10 LYS A C    19 
ATOM   10632 O  O    . LYS A 1 10 ? 6.202   -8.213  -1.459  1.00 0.00 ? 10 LYS A O    19 
ATOM   10633 C  CB   . LYS A 1 10 ? 4.779   -8.828  1.456   1.00 0.00 ? 10 LYS A CB   19 
ATOM   10634 C  CG   . LYS A 1 10 ? 4.582   -9.538  2.787   1.00 0.00 ? 10 LYS A CG   19 
ATOM   10635 C  CD   . LYS A 1 10 ? 4.077   -8.592  3.865   1.00 0.00 ? 10 LYS A CD   19 
ATOM   10636 C  CE   . LYS A 1 10 ? 4.980   -8.599  5.088   1.00 0.00 ? 10 LYS A CE   19 
ATOM   10637 N  NZ   . LYS A 1 10 ? 4.320   -9.232  6.259   1.00 0.00 ? 10 LYS A NZ   19 
ATOM   10638 H  H    . LYS A 1 10 ? 7.915   -9.395  1.416   1.00 0.00 ? 10 LYS A H    19 
ATOM   10639 H  HA   . LYS A 1 10 ? 6.008   -10.451 0.801   1.00 0.00 ? 10 LYS A HA   19 
ATOM   10640 H  HB2  . LYS A 1 10 ? 4.962   -7.783  1.653   1.00 0.00 ? 10 LYS A HB2  19 
ATOM   10641 H  HB3  . LYS A 1 10 ? 3.867   -8.922  0.883   1.00 0.00 ? 10 LYS A HB3  19 
ATOM   10642 H  HG2  . LYS A 1 10 ? 3.858   -10.330 2.655   1.00 0.00 ? 10 LYS A HG2  19 
ATOM   10643 H  HG3  . LYS A 1 10 ? 5.525   -9.961  3.102   1.00 0.00 ? 10 LYS A HG3  19 
ATOM   10644 H  HD2  . LYS A 1 10 ? 4.043   -7.590  3.461   1.00 0.00 ? 10 LYS A HD2  19 
ATOM   10645 H  HD3  . LYS A 1 10 ? 3.084   -8.896  4.160   1.00 0.00 ? 10 LYS A HD3  19 
ATOM   10646 H  HE2  . LYS A 1 10 ? 5.878   -9.149  4.854   1.00 0.00 ? 10 LYS A HE2  19 
ATOM   10647 H  HE3  . LYS A 1 10 ? 5.237   -7.579  5.338   1.00 0.00 ? 10 LYS A HE3  19 
ATOM   10648 H  HZ1  . LYS A 1 10 ? 3.932   -10.163 5.991   1.00 0.00 ? 10 LYS A HZ1  19 
ATOM   10649 H  HZ2  . LYS A 1 10 ? 3.539   -8.632  6.606   1.00 0.00 ? 10 LYS A HZ2  19 
ATOM   10650 H  HZ3  . LYS A 1 10 ? 5.006   -9.365  7.033   1.00 0.00 ? 10 LYS A HZ3  19 
ATOM   10651 N  N    . PRO A 1 11 ? 5.019   -10.107 -1.531  1.00 0.00 ? 11 PRO A N    19 
ATOM   10652 C  CA   . PRO A 1 11 ? 4.795   -10.049 -2.983  1.00 0.00 ? 11 PRO A CA   19 
ATOM   10653 C  C    . PRO A 1 11 ? 3.947   -8.849  -3.417  1.00 0.00 ? 11 PRO A C    19 
ATOM   10654 O  O    . PRO A 1 11 ? 3.917   -8.497  -4.597  1.00 0.00 ? 11 PRO A O    19 
ATOM   10655 C  CB   . PRO A 1 11 ? 4.057   -11.359 -3.288  1.00 0.00 ? 11 PRO A CB   19 
ATOM   10656 C  CG   . PRO A 1 11 ? 3.498   -11.802 -1.980  1.00 0.00 ? 11 PRO A CG   19 
ATOM   10657 C  CD   . PRO A 1 11 ? 4.479   -11.342 -0.943  1.00 0.00 ? 11 PRO A CD   19 
ATOM   10658 H  HA   . PRO A 1 11 ? 5.731   -10.034 -3.520  1.00 0.00 ? 11 PRO A HA   19 
ATOM   10659 H  HB2  . PRO A 1 11 ? 3.274   -11.171 -4.009  1.00 0.00 ? 11 PRO A HB2  19 
ATOM   10660 H  HB3  . PRO A 1 11 ? 4.751   -12.084 -3.686  1.00 0.00 ? 11 PRO A HB3  19 
ATOM   10661 H  HG2  . PRO A 1 11 ? 2.538   -11.339 -1.819  1.00 0.00 ? 11 PRO A HG2  19 
ATOM   10662 H  HG3  . PRO A 1 11 ? 3.407   -12.878 -1.961  1.00 0.00 ? 11 PRO A HG3  19 
ATOM   10663 H  HD2  . PRO A 1 11 ? 3.976   -11.138 -0.009  1.00 0.00 ? 11 PRO A HD2  19 
ATOM   10664 H  HD3  . PRO A 1 11 ? 5.258   -12.076 -0.803  1.00 0.00 ? 11 PRO A HD3  19 
ATOM   10665 N  N    . PHE A 1 12 ? 3.235   -8.244  -2.469  1.00 0.00 ? 12 PHE A N    19 
ATOM   10666 C  CA   . PHE A 1 12 ? 2.351   -7.128  -2.763  1.00 0.00 ? 12 PHE A CA   19 
ATOM   10667 C  C    . PHE A 1 12 ? 2.677   -5.932  -1.881  1.00 0.00 ? 12 PHE A C    19 
ATOM   10668 O  O    . PHE A 1 12 ? 2.150   -5.804  -0.781  1.00 0.00 ? 12 PHE A O    19 
ATOM   10669 C  CB   . PHE A 1 12 ? 0.895   -7.534  -2.538  1.00 0.00 ? 12 PHE A CB   19 
ATOM   10670 C  CG   . PHE A 1 12 ? 0.481   -8.767  -3.293  1.00 0.00 ? 12 PHE A CG   19 
ATOM   10671 C  CD1  . PHE A 1 12 ? 0.531   -8.795  -4.678  1.00 0.00 ? 12 PHE A CD1  19 
ATOM   10672 C  CD2  . PHE A 1 12 ? 0.046   -9.895  -2.618  1.00 0.00 ? 12 PHE A CD2  19 
ATOM   10673 C  CE1  . PHE A 1 12 ? 0.153   -9.926  -5.374  1.00 0.00 ? 12 PHE A CE1  19 
ATOM   10674 C  CE2  . PHE A 1 12 ? -0.335  -11.028 -3.310  1.00 0.00 ? 12 PHE A CE2  19 
ATOM   10675 C  CZ   . PHE A 1 12 ? -0.278  -11.045 -4.690  1.00 0.00 ? 12 PHE A CZ   19 
ATOM   10676 H  H    . PHE A 1 12 ? 3.292   -8.566  -1.549  1.00 0.00 ? 12 PHE A H    19 
ATOM   10677 H  HA   . PHE A 1 12 ? 2.488   -6.853  -3.797  1.00 0.00 ? 12 PHE A HA   19 
ATOM   10678 H  HB2  . PHE A 1 12 ? 0.746   -7.721  -1.482  1.00 0.00 ? 12 PHE A HB2  19 
ATOM   10679 H  HB3  . PHE A 1 12 ? 0.252   -6.722  -2.848  1.00 0.00 ? 12 PHE A HB3  19 
ATOM   10680 H  HD1  . PHE A 1 12 ? 0.869   -7.922  -5.214  1.00 0.00 ? 12 PHE A HD1  19 
ATOM   10681 H  HD2  . PHE A 1 12 ? 0.002   -9.883  -1.539  1.00 0.00 ? 12 PHE A HD2  19 
ATOM   10682 H  HE1  . PHE A 1 12 ? 0.193   -9.934  -6.453  1.00 0.00 ? 12 PHE A HE1  19 
ATOM   10683 H  HE2  . PHE A 1 12 ? -0.675  -11.901 -2.772  1.00 0.00 ? 12 PHE A HE2  19 
ATOM   10684 H  HZ   . PHE A 1 12 ? -0.572  -11.931 -5.234  1.00 0.00 ? 12 PHE A HZ   19 
ATOM   10685 N  N    . GLN A 1 13 ? 3.525   -5.051  -2.369  1.00 0.00 ? 13 GLN A N    19 
ATOM   10686 C  CA   . GLN A 1 13 ? 3.856   -3.842  -1.633  1.00 0.00 ? 13 GLN A CA   19 
ATOM   10687 C  C    . GLN A 1 13 ? 3.005   -2.686  -2.089  1.00 0.00 ? 13 GLN A C    19 
ATOM   10688 O  O    . GLN A 1 13 ? 2.520   -2.676  -3.220  1.00 0.00 ? 13 GLN A O    19 
ATOM   10689 C  CB   . GLN A 1 13 ? 5.299   -3.439  -1.847  1.00 0.00 ? 13 GLN A CB   19 
ATOM   10690 C  CG   . GLN A 1 13 ? 6.291   -4.490  -1.464  1.00 0.00 ? 13 GLN A CG   19 
ATOM   10691 C  CD   . GLN A 1 13 ? 7.108   -4.930  -2.653  1.00 0.00 ? 13 GLN A CD   19 
ATOM   10692 O  OE1  . GLN A 1 13 ? 7.867   -4.150  -3.224  1.00 0.00 ? 13 GLN A OE1  19 
ATOM   10693 N  NE2  . GLN A 1 13 ? 6.943   -6.172  -3.045  1.00 0.00 ? 13 GLN A NE2  19 
ATOM   10694 H  H    . GLN A 1 13 ? 3.912   -5.198  -3.263  1.00 0.00 ? 13 GLN A H    19 
ATOM   10695 H  HA   . GLN A 1 13 ? 3.687   -4.023  -0.582  1.00 0.00 ? 13 GLN A HA   19 
ATOM   10696 H  HB2  . GLN A 1 13 ? 5.440   -3.207  -2.889  1.00 0.00 ? 13 GLN A HB2  19 
ATOM   10697 H  HB3  . GLN A 1 13 ? 5.496   -2.560  -1.255  1.00 0.00 ? 13 GLN A HB3  19 
ATOM   10698 H  HG2  . GLN A 1 13 ? 6.949   -4.085  -0.709  1.00 0.00 ? 13 GLN A HG2  19 
ATOM   10699 H  HG3  . GLN A 1 13 ? 5.757   -5.335  -1.067  1.00 0.00 ? 13 GLN A HG3  19 
ATOM   10700 H  HE21 . GLN A 1 13 ? 6.309   -6.731  -2.541  1.00 0.00 ? 13 GLN A HE21 19 
ATOM   10701 H  HE22 . GLN A 1 13 ? 7.446   -6.485  -3.830  1.00 0.00 ? 13 GLN A HE22 19 
ATOM   10702 N  N    . CYS A 1 14 ? 3.080   -1.609  -1.333  1.00 0.00 ? 14 CYS A N    19 
ATOM   10703 C  CA   . CYS A 1 14 ? 2.557   -0.350  -1.815  1.00 0.00 ? 14 CYS A CA   19 
ATOM   10704 C  C    . CYS A 1 14 ? 3.526   0.259   -2.822  1.00 0.00 ? 14 CYS A C    19 
ATOM   10705 O  O    . CYS A 1 14 ? 4.690   0.506   -2.497  1.00 0.00 ? 14 CYS A O    19 
ATOM   10706 C  CB   . CYS A 1 14 ? 2.309   0.656   -0.691  1.00 0.00 ? 14 CYS A CB   19 
ATOM   10707 S  SG   . CYS A 1 14 ? 1.651   2.231   -1.340  1.00 0.00 ? 14 CYS A SG   19 
ATOM   10708 H  H    . CYS A 1 14 ? 3.689   -1.621  -0.564  1.00 0.00 ? 14 CYS A H    19 
ATOM   10709 H  HA   . CYS A 1 14 ? 1.621   -0.554  -2.315  1.00 0.00 ? 14 CYS A HA   19 
ATOM   10710 H  HB2  . CYS A 1 14 ? 1.602   0.240   0.008   1.00 0.00 ? 14 CYS A HB2  19 
ATOM   10711 H  HB3  . CYS A 1 14 ? 3.238   0.866   -0.182  1.00 0.00 ? 14 CYS A HB3  19 
ATOM   10712 N  N    . PRO A 1 15 ? 3.053   0.553   -4.037  1.00 0.00 ? 15 PRO A N    19 
ATOM   10713 C  CA   . PRO A 1 15 ? 3.870   1.201   -5.059  1.00 0.00 ? 15 PRO A CA   19 
ATOM   10714 C  C    . PRO A 1 15 ? 4.017   2.704   -4.809  1.00 0.00 ? 15 PRO A C    19 
ATOM   10715 O  O    . PRO A 1 15 ? 4.547   3.436   -5.645  1.00 0.00 ? 15 PRO A O    19 
ATOM   10716 C  CB   . PRO A 1 15 ? 3.083   0.945   -6.341  1.00 0.00 ? 15 PRO A CB   19 
ATOM   10717 C  CG   . PRO A 1 15 ? 1.662   0.868   -5.899  1.00 0.00 ? 15 PRO A CG   19 
ATOM   10718 C  CD   . PRO A 1 15 ? 1.684   0.280   -4.511  1.00 0.00 ? 15 PRO A CD   19 
ATOM   10719 H  HA   . PRO A 1 15 ? 4.848   0.752   -5.131  1.00 0.00 ? 15 PRO A HA   19 
ATOM   10720 H  HB2  . PRO A 1 15 ? 3.239   1.760   -7.032  1.00 0.00 ? 15 PRO A HB2  19 
ATOM   10721 H  HB3  . PRO A 1 15 ? 3.408   0.018   -6.788  1.00 0.00 ? 15 PRO A HB3  19 
ATOM   10722 H  HG2  . PRO A 1 15 ? 1.229   1.857   -5.878  1.00 0.00 ? 15 PRO A HG2  19 
ATOM   10723 H  HG3  . PRO A 1 15 ? 1.105   0.228   -6.568  1.00 0.00 ? 15 PRO A HG3  19 
ATOM   10724 H  HD2  . PRO A 1 15 ? 0.954   0.767   -3.884  1.00 0.00 ? 15 PRO A HD2  19 
ATOM   10725 H  HD3  . PRO A 1 15 ? 1.497   -0.783  -4.552  1.00 0.00 ? 15 PRO A HD3  19 
ATOM   10726 N  N    . ASP A 1 16 ? 3.490   3.168   -3.683  1.00 0.00 ? 16 ASP A N    19 
ATOM   10727 C  CA   . ASP A 1 16 ? 3.544   4.585   -3.341  1.00 0.00 ? 16 ASP A CA   19 
ATOM   10728 C  C    . ASP A 1 16 ? 4.408   4.812   -2.112  1.00 0.00 ? 16 ASP A C    19 
ATOM   10729 O  O    . ASP A 1 16 ? 5.135   5.798   -2.020  1.00 0.00 ? 16 ASP A O    19 
ATOM   10730 C  CB   . ASP A 1 16 ? 2.137   5.123   -3.079  1.00 0.00 ? 16 ASP A CB   19 
ATOM   10731 C  CG   . ASP A 1 16 ? 1.983   6.574   -3.483  1.00 0.00 ? 16 ASP A CG   19 
ATOM   10732 O  OD1  . ASP A 1 16 ? 1.915   6.852   -4.699  1.00 0.00 ? 16 ASP A OD1  19 
ATOM   10733 O  OD2  . ASP A 1 16 ? 1.899   7.443   -2.587  1.00 0.00 ? 16 ASP A OD2  19 
ATOM   10734 H  H    . ASP A 1 16 ? 3.028   2.544   -3.077  1.00 0.00 ? 16 ASP A H    19 
ATOM   10735 H  HA   . ASP A 1 16 ? 3.976   5.114   -4.175  1.00 0.00 ? 16 ASP A HA   19 
ATOM   10736 H  HB2  . ASP A 1 16 ? 1.424   4.536   -3.639  1.00 0.00 ? 16 ASP A HB2  19 
ATOM   10737 H  HB3  . ASP A 1 16 ? 1.916   5.038   -2.025  1.00 0.00 ? 16 ASP A HB3  19 
ATOM   10738 N  N    . CYS A 1 17 ? 4.268   3.929   -1.139  1.00 0.00 ? 17 CYS A N    19 
ATOM   10739 C  CA   . CYS A 1 17 ? 4.954   4.080   0.134   1.00 0.00 ? 17 CYS A CA   19 
ATOM   10740 C  C    . CYS A 1 17 ? 6.143   3.141   0.265   1.00 0.00 ? 17 CYS A C    19 
ATOM   10741 O  O    . CYS A 1 17 ? 6.995   3.361   1.130   1.00 0.00 ? 17 CYS A O    19 
ATOM   10742 C  CB   . CYS A 1 17 ? 3.996   3.825   1.292   1.00 0.00 ? 17 CYS A CB   19 
ATOM   10743 S  SG   . CYS A 1 17 ? 2.502   4.852   1.261   1.00 0.00 ? 17 CYS A SG   19 
ATOM   10744 H  H    . CYS A 1 17 ? 3.629   3.191   -1.256  1.00 0.00 ? 17 CYS A H    19 
ATOM   10745 H  HA   . CYS A 1 17 ? 5.307   5.096   0.195   1.00 0.00 ? 17 CYS A HA   19 
ATOM   10746 H  HB2  . CYS A 1 17 ? 3.683   2.792   1.270   1.00 0.00 ? 17 CYS A HB2  19 
ATOM   10747 H  HB3  . CYS A 1 17 ? 4.507   4.020   2.222   1.00 0.00 ? 17 CYS A HB3  19 
ATOM   10748 N  N    . ASP A 1 18 ? 6.023   1.975   -0.371  1.00 0.00 ? 18 ASP A N    19 
ATOM   10749 C  CA   . ASP A 1 18 ? 6.928   0.846   -0.130  1.00 0.00 ? 18 ASP A CA   19 
ATOM   10750 C  C    . ASP A 1 18 ? 6.512   0.164   1.157   1.00 0.00 ? 18 ASP A C    19 
ATOM   10751 O  O    . ASP A 1 18 ? 7.342   -0.275  1.950   1.00 0.00 ? 18 ASP A O    19 
ATOM   10752 C  CB   . ASP A 1 18 ? 8.403   1.267   -0.073  1.00 0.00 ? 18 ASP A CB   19 
ATOM   10753 C  CG   . ASP A 1 18 ? 9.201   0.742   -1.246  1.00 0.00 ? 18 ASP A CG   19 
ATOM   10754 O  OD1  . ASP A 1 18 ? 9.110   1.330   -2.342  1.00 0.00 ? 18 ASP A OD1  19 
ATOM   10755 O  OD2  . ASP A 1 18 ? 9.932   -0.256  -1.079  1.00 0.00 ? 18 ASP A OD2  19 
ATOM   10756 H  H    . ASP A 1 18 ? 5.214   1.816   -0.901  1.00 0.00 ? 18 ASP A H    19 
ATOM   10757 H  HA   . ASP A 1 18 ? 6.801   0.134   -0.940  1.00 0.00 ? 18 ASP A HA   19 
ATOM   10758 H  HB2  . ASP A 1 18 ? 8.465   2.344   -0.077  1.00 0.00 ? 18 ASP A HB2  19 
ATOM   10759 H  HB3  . ASP A 1 18 ? 8.844   0.889   0.837   1.00 0.00 ? 18 ASP A HB3  19 
ATOM   10760 N  N    . ARG A 1 19 ? 5.201   -0.001  1.299   1.00 0.00 ? 19 ARG A N    19 
ATOM   10761 C  CA   . ARG A 1 19 ? 4.639   -0.789  2.381   1.00 0.00 ? 19 ARG A CA   19 
ATOM   10762 C  C    . ARG A 1 19 ? 4.733   -2.251  1.986   1.00 0.00 ? 19 ARG A C    19 
ATOM   10763 O  O    . ARG A 1 19 ? 5.278   -2.561  0.935   1.00 0.00 ? 19 ARG A O    19 
ATOM   10764 C  CB   . ARG A 1 19 ? 3.176   -0.408  2.630   1.00 0.00 ? 19 ARG A CB   19 
ATOM   10765 C  CG   . ARG A 1 19 ? 2.964   1.058   2.960   1.00 0.00 ? 19 ARG A CG   19 
ATOM   10766 C  CD   . ARG A 1 19 ? 2.283   1.235   4.307   1.00 0.00 ? 19 ARG A CD   19 
ATOM   10767 N  NE   . ARG A 1 19 ? 0.896   0.749   4.304   1.00 0.00 ? 19 ARG A NE   19 
ATOM   10768 C  CZ   . ARG A 1 19 ? 0.293   0.240   5.386   1.00 0.00 ? 19 ARG A CZ   19 
ATOM   10769 N  NH1  . ARG A 1 19 ? 0.941   0.178   6.543   1.00 0.00 ? 19 ARG A NH1  19 
ATOM   10770 N  NH2  . ARG A 1 19 ? -0.963  -0.189  5.315   1.00 0.00 ? 19 ARG A NH2  19 
ATOM   10771 H  H    . ARG A 1 19 ? 4.610   0.312   0.589   1.00 0.00 ? 19 ARG A H    19 
ATOM   10772 H  HA   . ARG A 1 19 ? 5.222   -0.618  3.273   1.00 0.00 ? 19 ARG A HA   19 
ATOM   10773 H  HB2  . ARG A 1 19 ? 2.602   -0.640  1.745   1.00 0.00 ? 19 ARG A HB2  19 
ATOM   10774 H  HB3  . ARG A 1 19 ? 2.803   -0.997  3.453   1.00 0.00 ? 19 ARG A HB3  19 
ATOM   10775 H  HG2  . ARG A 1 19 ? 3.922   1.554   2.986   1.00 0.00 ? 19 ARG A HG2  19 
ATOM   10776 H  HG3  . ARG A 1 19 ? 2.345   1.503   2.194   1.00 0.00 ? 19 ARG A HG3  19 
ATOM   10777 H  HD2  . ARG A 1 19 ? 2.843   0.686   5.048   1.00 0.00 ? 19 ARG A HD2  19 
ATOM   10778 H  HD3  . ARG A 1 19 ? 2.287   2.285   4.560   1.00 0.00 ? 19 ARG A HD3  19 
ATOM   10779 H  HE   . ARG A 1 19 ? 0.391   0.808   3.449   1.00 0.00 ? 19 ARG A HE   19 
ATOM   10780 H  HH11 . ARG A 1 19 ? 1.887   0.517   6.617   1.00 0.00 ? 19 ARG A HH11 19 
ATOM   10781 H  HH12 . ARG A 1 19 ? 0.496   -0.222  7.355   1.00 0.00 ? 19 ARG A HH12 19 
ATOM   10782 H  HH21 . ARG A 1 19 ? -1.467  -0.134  4.455   1.00 0.00 ? 19 ARG A HH21 19 
ATOM   10783 H  HH22 . ARG A 1 19 ? -1.417  -0.570  6.136   1.00 0.00 ? 19 ARG A HH22 19 
ATOM   10784 N  N    . SER A 1 20 ? 4.178   -3.148  2.774   1.00 0.00 ? 20 SER A N    19 
ATOM   10785 C  CA   . SER A 1 20 ? 4.230   -4.553  2.413   1.00 0.00 ? 20 SER A CA   19 
ATOM   10786 C  C    . SER A 1 20 ? 2.995   -5.310  2.871   1.00 0.00 ? 20 SER A C    19 
ATOM   10787 O  O    . SER A 1 20 ? 2.579   -5.218  4.028   1.00 0.00 ? 20 SER A O    19 
ATOM   10788 C  CB   . SER A 1 20 ? 5.483   -5.196  2.986   1.00 0.00 ? 20 SER A CB   19 
ATOM   10789 O  OG   . SER A 1 20 ? 6.204   -4.290  3.809   1.00 0.00 ? 20 SER A OG   19 
ATOM   10790 H  H    . SER A 1 20 ? 3.713   -2.867  3.596   1.00 0.00 ? 20 SER A H    19 
ATOM   10791 H  HA   . SER A 1 20 ? 4.278   -4.606  1.336   1.00 0.00 ? 20 SER A HA   19 
ATOM   10792 H  HB2  . SER A 1 20 ? 5.204   -6.058  3.569   1.00 0.00 ? 20 SER A HB2  19 
ATOM   10793 H  HB3  . SER A 1 20 ? 6.122   -5.505  2.171   1.00 0.00 ? 20 SER A HB3  19 
ATOM   10794 H  HG   . SER A 1 20 ? 6.688   -3.667  3.244   1.00 0.00 ? 20 SER A HG   19 
ATOM   10795 N  N    . PHE A 1 21 ? 2.400   -6.038  1.941   1.00 0.00 ? 21 PHE A N    19 
ATOM   10796 C  CA   . PHE A 1 21 ? 1.196   -6.803  2.215   1.00 0.00 ? 21 PHE A CA   19 
ATOM   10797 C  C    . PHE A 1 21 ? 1.319   -8.207  1.643   1.00 0.00 ? 21 PHE A C    19 
ATOM   10798 O  O    . PHE A 1 21 ? 1.818   -8.399  0.531   1.00 0.00 ? 21 PHE A O    19 
ATOM   10799 C  CB   . PHE A 1 21 ? -0.031  -6.107  1.621   1.00 0.00 ? 21 PHE A CB   19 
ATOM   10800 C  CG   . PHE A 1 21 ? -0.122  -4.648  1.970   1.00 0.00 ? 21 PHE A CG   19 
ATOM   10801 C  CD1  . PHE A 1 21 ? 0.536   -3.699  1.207   1.00 0.00 ? 21 PHE A CD1  19 
ATOM   10802 C  CD2  . PHE A 1 21 ? -0.863  -4.230  3.062   1.00 0.00 ? 21 PHE A CD2  19 
ATOM   10803 C  CE1  . PHE A 1 21 ? 0.460   -2.360  1.529   1.00 0.00 ? 21 PHE A CE1  19 
ATOM   10804 C  CE2  . PHE A 1 21 ? -0.942  -2.892  3.387   1.00 0.00 ? 21 PHE A CE2  19 
ATOM   10805 C  CZ   . PHE A 1 21 ? -0.280  -1.957  2.621   1.00 0.00 ? 21 PHE A CZ   19 
ATOM   10806 H  H    . PHE A 1 21 ? 2.767   -6.041  1.024   1.00 0.00 ? 21 PHE A H    19 
ATOM   10807 H  HA   . PHE A 1 21 ? 1.081   -6.868  3.286   1.00 0.00 ? 21 PHE A HA   19 
ATOM   10808 H  HB2  . PHE A 1 21 ? 0.004   -6.190  0.545   1.00 0.00 ? 21 PHE A HB2  19 
ATOM   10809 H  HB3  . PHE A 1 21 ? -0.924  -6.594  1.985   1.00 0.00 ? 21 PHE A HB3  19 
ATOM   10810 H  HD1  . PHE A 1 21 ? 1.120   -4.017  0.353   1.00 0.00 ? 21 PHE A HD1  19 
ATOM   10811 H  HD2  . PHE A 1 21 ? -1.381  -4.961  3.662   1.00 0.00 ? 21 PHE A HD2  19 
ATOM   10812 H  HE1  . PHE A 1 21 ? 0.978   -1.628  0.926   1.00 0.00 ? 21 PHE A HE1  19 
ATOM   10813 H  HE2  . PHE A 1 21 ? -1.523  -2.577  4.242   1.00 0.00 ? 21 PHE A HE2  19 
ATOM   10814 H  HZ   . PHE A 1 21 ? -0.340  -0.909  2.877   1.00 0.00 ? 21 PHE A HZ   19 
ATOM   10815 N  N    . SER A 1 22 ? 0.854   -9.183  2.400   1.00 0.00 ? 22 SER A N    19 
ATOM   10816 C  CA   . SER A 1 22 ? 0.865   -10.563 1.960   1.00 0.00 ? 22 SER A CA   19 
ATOM   10817 C  C    . SER A 1 22 ? -0.353  -10.833 1.082   1.00 0.00 ? 22 SER A C    19 
ATOM   10818 O  O    . SER A 1 22 ? -0.344  -11.716 0.225   1.00 0.00 ? 22 SER A O    19 
ATOM   10819 C  CB   . SER A 1 22 ? 0.857   -11.486 3.178   1.00 0.00 ? 22 SER A CB   19 
ATOM   10820 O  OG   . SER A 1 22 ? 0.344   -10.810 4.317   1.00 0.00 ? 22 SER A OG   19 
ATOM   10821 H  H    . SER A 1 22 ? 0.448   -8.964  3.269   1.00 0.00 ? 22 SER A H    19 
ATOM   10822 H  HA   . SER A 1 22 ? 1.764   -10.732 1.386   1.00 0.00 ? 22 SER A HA   19 
ATOM   10823 H  HB2  . SER A 1 22 ? 0.234   -12.345 2.973   1.00 0.00 ? 22 SER A HB2  19 
ATOM   10824 H  HB3  . SER A 1 22 ? 1.865   -11.811 3.391   1.00 0.00 ? 22 SER A HB3  19 
ATOM   10825 H  HG   . SER A 1 22 ? 1.024   -10.776 5.008   1.00 0.00 ? 22 SER A HG   19 
ATOM   10826 N  N    . ARG A 1 23 ? -1.396  -10.044 1.302   1.00 0.00 ? 23 ARG A N    19 
ATOM   10827 C  CA   . ARG A 1 23 ? -2.629  -10.167 0.547   1.00 0.00 ? 23 ARG A CA   19 
ATOM   10828 C  C    . ARG A 1 23 ? -2.831  -8.954  -0.347  1.00 0.00 ? 23 ARG A C    19 
ATOM   10829 O  O    . ARG A 1 23 ? -2.750  -7.813  0.112   1.00 0.00 ? 23 ARG A O    19 
ATOM   10830 C  CB   . ARG A 1 23 ? -3.814  -10.311 1.502   1.00 0.00 ? 23 ARG A CB   19 
ATOM   10831 C  CG   . ARG A 1 23 ? -3.712  -11.519 2.419   1.00 0.00 ? 23 ARG A CG   19 
ATOM   10832 C  CD   . ARG A 1 23 ? -5.000  -11.750 3.198   1.00 0.00 ? 23 ARG A CD   19 
ATOM   10833 N  NE   . ARG A 1 23 ? -6.195  -11.540 2.381   1.00 0.00 ? 23 ARG A NE   19 
ATOM   10834 C  CZ   . ARG A 1 23 ? -6.623  -12.386 1.444   1.00 0.00 ? 23 ARG A CZ   19 
ATOM   10835 N  NH1  . ARG A 1 23 ? -5.959  -13.510 1.200   1.00 0.00 ? 23 ARG A NH1  19 
ATOM   10836 N  NH2  . ARG A 1 23 ? -7.730  -12.114 0.769   1.00 0.00 ? 23 ARG A NH2  19 
ATOM   10837 H  H    . ARG A 1 23 ? -1.326  -9.348  1.994   1.00 0.00 ? 23 ARG A H    19 
ATOM   10838 H  HA   . ARG A 1 23 ? -2.564  -11.049 -0.072  1.00 0.00 ? 23 ARG A HA   19 
ATOM   10839 H  HB2  . ARG A 1 23 ? -3.876  -9.426  2.115   1.00 0.00 ? 23 ARG A HB2  19 
ATOM   10840 H  HB3  . ARG A 1 23 ? -4.721  -10.402 0.921   1.00 0.00 ? 23 ARG A HB3  19 
ATOM   10841 H  HG2  . ARG A 1 23 ? -3.506  -12.396 1.819   1.00 0.00 ? 23 ARG A HG2  19 
ATOM   10842 H  HG3  . ARG A 1 23 ? -2.903  -11.360 3.118   1.00 0.00 ? 23 ARG A HG3  19 
ATOM   10843 H  HD2  . ARG A 1 23 ? -5.005  -12.764 3.566   1.00 0.00 ? 23 ARG A HD2  19 
ATOM   10844 H  HD3  . ARG A 1 23 ? -5.024  -11.066 4.034   1.00 0.00 ? 23 ARG A HD3  19 
ATOM   10845 H  HE   . ARG A 1 23 ? -6.716  -10.716 2.548   1.00 0.00 ? 23 ARG A HE   19 
ATOM   10846 H  HH11 . ARG A 1 23 ? -5.135  -13.737 1.726   1.00 0.00 ? 23 ARG A HH11 19 
ATOM   10847 H  HH12 . ARG A 1 23 ? -6.269  -14.131 0.470   1.00 0.00 ? 23 ARG A HH12 19 
ATOM   10848 H  HH21 . ARG A 1 23 ? -8.251  -11.274 0.963   1.00 0.00 ? 23 ARG A HH21 19 
ATOM   10849 H  HH22 . ARG A 1 23 ? -8.060  -12.749 0.058   1.00 0.00 ? 23 ARG A HH22 19 
ATOM   10850 N  N    . SER A 1 24 ? -3.155  -9.208  -1.606  1.00 0.00 ? 24 SER A N    19 
ATOM   10851 C  CA   . SER A 1 24 ? -3.436  -8.141  -2.560  1.00 0.00 ? 24 SER A CA   19 
ATOM   10852 C  C    . SER A 1 24 ? -4.653  -7.334  -2.108  1.00 0.00 ? 24 SER A C    19 
ATOM   10853 O  O    . SER A 1 24 ? -4.765  -6.137  -2.386  1.00 0.00 ? 24 SER A O    19 
ATOM   10854 C  CB   . SER A 1 24 ? -3.677  -8.737  -3.950  1.00 0.00 ? 24 SER A CB   19 
ATOM   10855 O  OG   . SER A 1 24 ? -2.951  -8.033  -4.943  1.00 0.00 ? 24 SER A OG   19 
ATOM   10856 H  H    . SER A 1 24 ? -3.247  -10.141 -1.897  1.00 0.00 ? 24 SER A H    19 
ATOM   10857 H  HA   . SER A 1 24 ? -2.571  -7.492  -2.596  1.00 0.00 ? 24 SER A HA   19 
ATOM   10858 H  HB2  . SER A 1 24 ? -3.358  -9.768  -3.957  1.00 0.00 ? 24 SER A HB2  19 
ATOM   10859 H  HB3  . SER A 1 24 ? -4.729  -8.685  -4.185  1.00 0.00 ? 24 SER A HB3  19 
ATOM   10860 H  HG   . SER A 1 24 ? -3.407  -7.196  -5.136  1.00 0.00 ? 24 SER A HG   19 
ATOM   10861 N  N    . ASP A 1 25 ? -5.530  -7.986  -1.353  1.00 0.00 ? 25 ASP A N    19 
ATOM   10862 C  CA   . ASP A 1 25 ? -6.705  -7.325  -0.806  1.00 0.00 ? 25 ASP A CA   19 
ATOM   10863 C  C    . ASP A 1 25 ? -6.292  -6.309  0.247   1.00 0.00 ? 25 ASP A C    19 
ATOM   10864 O  O    . ASP A 1 25 ? -6.784  -5.182  0.269   1.00 0.00 ? 25 ASP A O    19 
ATOM   10865 C  CB   . ASP A 1 25 ? -7.651  -8.355  -0.193  1.00 0.00 ? 25 ASP A CB   19 
ATOM   10866 C  CG   . ASP A 1 25 ? -8.920  -7.734  0.358   1.00 0.00 ? 25 ASP A CG   19 
ATOM   10867 O  OD1  . ASP A 1 25 ? -9.715  -7.179  -0.429  1.00 0.00 ? 25 ASP A OD1  19 
ATOM   10868 O  OD2  . ASP A 1 25 ? -9.145  -7.825  1.581   1.00 0.00 ? 25 ASP A OD2  19 
ATOM   10869 H  H    . ASP A 1 25 ? -5.371  -8.937  -1.144  1.00 0.00 ? 25 ASP A H    19 
ATOM   10870 H  HA   . ASP A 1 25 ? -7.208  -6.813  -1.613  1.00 0.00 ? 25 ASP A HA   19 
ATOM   10871 H  HB2  . ASP A 1 25 ? -7.925  -9.075  -0.948  1.00 0.00 ? 25 ASP A HB2  19 
ATOM   10872 H  HB3  . ASP A 1 25 ? -7.143  -8.865  0.613   1.00 0.00 ? 25 ASP A HB3  19 
ATOM   10873 N  N    . HIS A 1 26 ? -5.318  -6.696  1.065   1.00 0.00 ? 26 HIS A N    19 
ATOM   10874 C  CA   . HIS A 1 26 ? -4.775  -5.811  2.091   1.00 0.00 ? 26 HIS A CA   19 
ATOM   10875 C  C    . HIS A 1 26 ? -4.074  -4.618  1.457   1.00 0.00 ? 26 HIS A C    19 
ATOM   10876 O  O    . HIS A 1 26 ? -4.164  -3.498  1.964   1.00 0.00 ? 26 HIS A O    19 
ATOM   10877 C  CB   . HIS A 1 26 ? -3.806  -6.568  3.002   1.00 0.00 ? 26 HIS A CB   19 
ATOM   10878 C  CG   . HIS A 1 26 ? -4.401  -6.939  4.324   1.00 0.00 ? 26 HIS A CG   19 
ATOM   10879 N  ND1  . HIS A 1 26 ? -3.721  -6.839  5.519   1.00 0.00 ? 26 HIS A ND1  19 
ATOM   10880 C  CD2  . HIS A 1 26 ? -5.628  -7.412  4.631   1.00 0.00 ? 26 HIS A CD2  19 
ATOM   10881 C  CE1  . HIS A 1 26 ? -4.507  -7.235  6.503   1.00 0.00 ? 26 HIS A CE1  19 
ATOM   10882 N  NE2  . HIS A 1 26 ? -5.672  -7.587  5.990   1.00 0.00 ? 26 HIS A NE2  19 
ATOM   10883 H  H    . HIS A 1 26 ? -4.928  -7.586  0.945   1.00 0.00 ? 26 HIS A H    19 
ATOM   10884 H  HA   . HIS A 1 26 ? -5.602  -5.450  2.684   1.00 0.00 ? 26 HIS A HA   19 
ATOM   10885 H  HB2  . HIS A 1 26 ? -3.495  -7.479  2.510   1.00 0.00 ? 26 HIS A HB2  19 
ATOM   10886 H  HB3  . HIS A 1 26 ? -2.940  -5.951  3.187   1.00 0.00 ? 26 HIS A HB3  19 
ATOM   10887 H  HD1  . HIS A 1 26 ? -2.788  -6.529  5.629   1.00 0.00 ? 26 HIS A HD1  19 
ATOM   10888 H  HD2  . HIS A 1 26 ? -6.425  -7.620  3.929   1.00 0.00 ? 26 HIS A HD2  19 
ATOM   10889 H  HE1  . HIS A 1 26 ? -4.242  -7.264  7.550   1.00 0.00 ? 26 HIS A HE1  19 
ATOM   10890 H  HE2  . HIS A 1 26 ? -6.388  -8.064  6.478   1.00 0.00 ? 26 HIS A HE2  19 
ATOM   10891 N  N    . LEU A 1 27 ? -3.439  -4.854  0.309   1.00 0.00 ? 27 LEU A N    19 
ATOM   10892 C  CA   . LEU A 1 27 ? -2.814  -3.784  -0.460  1.00 0.00 ? 27 LEU A CA   19 
ATOM   10893 C  C    . LEU A 1 27 ? -3.839  -2.699  -0.762  1.00 0.00 ? 27 LEU A C    19 
ATOM   10894 O  O    . LEU A 1 27 ? -3.686  -1.546  -0.355  1.00 0.00 ? 27 LEU A O    19 
ATOM   10895 C  CB   . LEU A 1 27 ? -2.258  -4.318  -1.790  1.00 0.00 ? 27 LEU A CB   19 
ATOM   10896 C  CG   . LEU A 1 27 ? -1.352  -3.356  -2.583  1.00 0.00 ? 27 LEU A CG   19 
ATOM   10897 C  CD1  . LEU A 1 27 ? -0.788  -2.253  -1.700  1.00 0.00 ? 27 LEU A CD1  19 
ATOM   10898 C  CD2  . LEU A 1 27 ? -0.232  -4.104  -3.278  1.00 0.00 ? 27 LEU A CD2  19 
ATOM   10899 H  H    . LEU A 1 27 ? -3.433  -5.766  -0.053  1.00 0.00 ? 27 LEU A H    19 
ATOM   10900 H  HA   . LEU A 1 27 ? -2.011  -3.363  0.124   1.00 0.00 ? 27 LEU A HA   19 
ATOM   10901 H  HB2  . LEU A 1 27 ? -1.691  -5.213  -1.578  1.00 0.00 ? 27 LEU A HB2  19 
ATOM   10902 H  HB3  . LEU A 1 27 ? -3.093  -4.588  -2.420  1.00 0.00 ? 27 LEU A HB3  19 
ATOM   10903 H  HG   . LEU A 1 27 ? -1.949  -2.881  -3.349  1.00 0.00 ? 27 LEU A HG   19 
ATOM   10904 H  HD11 . LEU A 1 27 ? -1.535  -1.943  -0.985  1.00 0.00 ? 27 LEU A HD11 19 
ATOM   10905 H  HD12 . LEU A 1 27 ? 0.081   -2.622  -1.174  1.00 0.00 ? 27 LEU A HD12 19 
ATOM   10906 H  HD13 . LEU A 1 27 ? -0.505  -1.410  -2.312  1.00 0.00 ? 27 LEU A HD13 19 
ATOM   10907 H  HD21 . LEU A 1 27 ? -0.273  -5.149  -3.011  1.00 0.00 ? 27 LEU A HD21 19 
ATOM   10908 H  HD22 . LEU A 1 27 ? -0.341  -3.998  -4.348  1.00 0.00 ? 27 LEU A HD22 19 
ATOM   10909 H  HD23 . LEU A 1 27 ? 0.717   -3.688  -2.973  1.00 0.00 ? 27 LEU A HD23 19 
ATOM   10910 N  N    . ALA A 1 28 ? -4.872  -3.085  -1.504  1.00 0.00 ? 28 ALA A N    19 
ATOM   10911 C  CA   . ALA A 1 28 ? -5.915  -2.162  -1.923  1.00 0.00 ? 28 ALA A CA   19 
ATOM   10912 C  C    . ALA A 1 28 ? -6.563  -1.463  -0.734  1.00 0.00 ? 28 ALA A C    19 
ATOM   10913 O  O    . ALA A 1 28 ? -6.902  -0.289  -0.819  1.00 0.00 ? 28 ALA A O    19 
ATOM   10914 C  CB   . ALA A 1 28 ? -6.959  -2.886  -2.750  1.00 0.00 ? 28 ALA A CB   19 
ATOM   10915 H  H    . ALA A 1 28 ? -4.914  -4.018  -1.808  1.00 0.00 ? 28 ALA A H    19 
ATOM   10916 H  HA   . ALA A 1 28 ? -5.455  -1.413  -2.552  1.00 0.00 ? 28 ALA A HA   19 
ATOM   10917 H  HB1  . ALA A 1 28 ? -6.843  -2.623  -3.790  1.00 0.00 ? 28 ALA A HB1  19 
ATOM   10918 H  HB2  . ALA A 1 28 ? -6.835  -3.952  -2.632  1.00 0.00 ? 28 ALA A HB2  19 
ATOM   10919 H  HB3  . ALA A 1 28 ? -7.943  -2.599  -2.413  1.00 0.00 ? 28 ALA A HB3  19 
ATOM   10920 N  N    . LEU A 1 29 ? -6.707  -2.177  0.381   1.00 0.00 ? 29 LEU A N    19 
ATOM   10921 C  CA   . LEU A 1 29 ? -7.289  -1.598  1.590   1.00 0.00 ? 29 LEU A CA   19 
ATOM   10922 C  C    . LEU A 1 29 ? -6.522  -0.350  2.022   1.00 0.00 ? 29 LEU A C    19 
ATOM   10923 O  O    . LEU A 1 29 ? -7.114  0.696   2.284   1.00 0.00 ? 29 LEU A O    19 
ATOM   10924 C  CB   . LEU A 1 29 ? -7.301  -2.618  2.722   1.00 0.00 ? 29 LEU A CB   19 
ATOM   10925 C  CG   . LEU A 1 29 ? -8.345  -3.725  2.583   1.00 0.00 ? 29 LEU A CG   19 
ATOM   10926 C  CD1  . LEU A 1 29 ? -8.027  -4.874  3.522   1.00 0.00 ? 29 LEU A CD1  19 
ATOM   10927 C  CD2  . LEU A 1 29 ? -9.736  -3.179  2.855   1.00 0.00 ? 29 LEU A CD2  19 
ATOM   10928 H  H    . LEU A 1 29 ? -6.404  -3.111  0.395   1.00 0.00 ? 29 LEU A H    19 
ATOM   10929 H  HA   . LEU A 1 29 ? -8.306  -1.319  1.366   1.00 0.00 ? 29 LEU A HA   19 
ATOM   10930 H  HB2  . LEU A 1 29 ? -6.325  -3.075  2.780   1.00 0.00 ? 29 LEU A HB2  19 
ATOM   10931 H  HB3  . LEU A 1 29 ? -7.490  -2.093  3.644   1.00 0.00 ? 29 LEU A HB3  19 
ATOM   10932 H  HG   . LEU A 1 29 ? -8.326  -4.106  1.572   1.00 0.00 ? 29 LEU A HG   19 
ATOM   10933 H  HD11 . LEU A 1 29 ? -8.925  -5.444  3.711   1.00 0.00 ? 29 LEU A HD11 19 
ATOM   10934 H  HD12 . LEU A 1 29 ? -7.282  -5.513  3.066   1.00 0.00 ? 29 LEU A HD12 19 
ATOM   10935 H  HD13 . LEU A 1 29 ? -7.645  -4.483  4.454   1.00 0.00 ? 29 LEU A HD13 19 
ATOM   10936 H  HD21 . LEU A 1 29 ? -10.428 -4.001  2.976   1.00 0.00 ? 29 LEU A HD21 19 
ATOM   10937 H  HD22 . LEU A 1 29 ? -9.720  -2.587  3.758   1.00 0.00 ? 29 LEU A HD22 19 
ATOM   10938 H  HD23 . LEU A 1 29 ? -10.049 -2.562  2.026   1.00 0.00 ? 29 LEU A HD23 19 
ATOM   10939 N  N    . HIS A 1 30 ? -5.198  -0.445  2.008   1.00 0.00 ? 30 HIS A N    19 
ATOM   10940 C  CA   . HIS A 1 30 ? -4.349  0.696   2.328   1.00 0.00 ? 30 HIS A CA   19 
ATOM   10941 C  C    . HIS A 1 30 ? -4.312  1.676   1.160   1.00 0.00 ? 30 HIS A C    19 
ATOM   10942 O  O    . HIS A 1 30 ? -4.247  2.892   1.354   1.00 0.00 ? 30 HIS A O    19 
ATOM   10943 C  CB   . HIS A 1 30 ? -2.924  0.225   2.674   1.00 0.00 ? 30 HIS A CB   19 
ATOM   10944 C  CG   . HIS A 1 30 ? -1.860  1.269   2.472   1.00 0.00 ? 30 HIS A CG   19 
ATOM   10945 N  ND1  . HIS A 1 30 ? -1.668  2.340   3.309   1.00 0.00 ? 30 HIS A ND1  19 
ATOM   10946 C  CD2  . HIS A 1 30 ? -0.937  1.398   1.483   1.00 0.00 ? 30 HIS A CD2  19 
ATOM   10947 C  CE1  . HIS A 1 30 ? -0.665  3.077   2.812   1.00 0.00 ? 30 HIS A CE1  19 
ATOM   10948 N  NE2  . HIS A 1 30 ? -0.181  2.551   1.699   1.00 0.00 ? 30 HIS A NE2  19 
ATOM   10949 H  H    . HIS A 1 30 ? -4.785  -1.286  1.719   1.00 0.00 ? 30 HIS A H    19 
ATOM   10950 H  HA   . HIS A 1 30 ? -4.772  1.195   3.187   1.00 0.00 ? 30 HIS A HA   19 
ATOM   10951 H  HB2  . HIS A 1 30 ? -2.896  -0.074  3.711   1.00 0.00 ? 30 HIS A HB2  19 
ATOM   10952 H  HB3  . HIS A 1 30 ? -2.673  -0.625  2.058   1.00 0.00 ? 30 HIS A HB3  19 
ATOM   10953 H  HD1  . HIS A 1 30 ? -2.184  2.535   4.129   1.00 0.00 ? 30 HIS A HD1  19 
ATOM   10954 H  HD2  . HIS A 1 30 ? -0.805  0.721   0.653   1.00 0.00 ? 30 HIS A HD2  19 
ATOM   10955 H  HE1  . HIS A 1 30 ? -0.295  3.985   3.267   1.00 0.00 ? 30 HIS A HE1  19 
ATOM   10956 N  N    . ARG A 1 31 ? -4.299  1.142   -0.052  1.00 0.00 ? 31 ARG A N    19 
ATOM   10957 C  CA   . ARG A 1 31 ? -4.163  1.967   -1.238  1.00 0.00 ? 31 ARG A CA   19 
ATOM   10958 C  C    . ARG A 1 31 ? -5.438  2.749   -1.518  1.00 0.00 ? 31 ARG A C    19 
ATOM   10959 O  O    . ARG A 1 31 ? -5.472  3.588   -2.414  1.00 0.00 ? 31 ARG A O    19 
ATOM   10960 C  CB   . ARG A 1 31 ? -3.800  1.119   -2.450  1.00 0.00 ? 31 ARG A CB   19 
ATOM   10961 C  CG   . ARG A 1 31 ? -2.341  0.702   -2.476  1.00 0.00 ? 31 ARG A CG   19 
ATOM   10962 C  CD   . ARG A 1 31 ? -1.871  0.358   -3.882  1.00 0.00 ? 31 ARG A CD   19 
ATOM   10963 N  NE   . ARG A 1 31 ? -1.860  1.525   -4.759  1.00 0.00 ? 31 ARG A NE   19 
ATOM   10964 C  CZ   . ARG A 1 31 ? -2.673  1.684   -5.805  1.00 0.00 ? 31 ARG A CZ   19 
ATOM   10965 N  NH1  . ARG A 1 31 ? -3.539  0.731   -6.130  1.00 0.00 ? 31 ARG A NH1  19 
ATOM   10966 N  NH2  . ARG A 1 31 ? -2.601  2.792   -6.530  1.00 0.00 ? 31 ARG A NH2  19 
ATOM   10967 H  H    . ARG A 1 31 ? -4.343  0.163   -0.148  1.00 0.00 ? 31 ARG A H    19 
ATOM   10968 H  HA   . ARG A 1 31 ? -3.356  2.664   -1.049  1.00 0.00 ? 31 ARG A HA   19 
ATOM   10969 H  HB2  . ARG A 1 31 ? -4.409  0.227   -2.448  1.00 0.00 ? 31 ARG A HB2  19 
ATOM   10970 H  HB3  . ARG A 1 31 ? -4.008  1.690   -3.342  1.00 0.00 ? 31 ARG A HB3  19 
ATOM   10971 H  HG2  . ARG A 1 31 ? -1.740  1.512   -2.095  1.00 0.00 ? 31 ARG A HG2  19 
ATOM   10972 H  HG3  . ARG A 1 31 ? -2.217  -0.164  -1.843  1.00 0.00 ? 31 ARG A HG3  19 
ATOM   10973 H  HD2  . ARG A 1 31 ? -0.869  -0.040  -3.823  1.00 0.00 ? 31 ARG A HD2  19 
ATOM   10974 H  HD3  . ARG A 1 31 ? -2.531  -0.388  -4.297  1.00 0.00 ? 31 ARG A HD3  19 
ATOM   10975 H  HE   . ARG A 1 31 ? -1.208  2.232   -4.554  1.00 0.00 ? 31 ARG A HE   19 
ATOM   10976 H  HH11 . ARG A 1 31 ? -3.586  -0.120  -5.589  1.00 0.00 ? 31 ARG A HH11 19 
ATOM   10977 H  HH12 . ARG A 1 31 ? -4.158  0.852   -6.918  1.00 0.00 ? 31 ARG A HH12 19 
ATOM   10978 H  HH21 . ARG A 1 31 ? -1.933  3.508   -6.292  1.00 0.00 ? 31 ARG A HH21 19 
ATOM   10979 H  HH22 . ARG A 1 31 ? -3.218  2.929   -7.317  1.00 0.00 ? 31 ARG A HH22 19 
ATOM   10980 N  N    . LYS A 1 32 ? -6.470  2.504   -0.722  1.00 0.00 ? 32 LYS A N    19 
ATOM   10981 C  CA   . LYS A 1 32 ? -7.723  3.227   -0.852  1.00 0.00 ? 32 LYS A CA   19 
ATOM   10982 C  C    . LYS A 1 32 ? -7.513  4.697   -0.520  1.00 0.00 ? 32 LYS A C    19 
ATOM   10983 O  O    . LYS A 1 32 ? -8.153  5.574   -1.098  1.00 0.00 ? 32 LYS A O    19 
ATOM   10984 C  CB   . LYS A 1 32 ? -8.787  2.622   0.062   1.00 0.00 ? 32 LYS A CB   19 
ATOM   10985 C  CG   . LYS A 1 32 ? -9.903  1.912   -0.688  1.00 0.00 ? 32 LYS A CG   19 
ATOM   10986 C  CD   . LYS A 1 32 ? -9.362  1.061   -1.826  1.00 0.00 ? 32 LYS A CD   19 
ATOM   10987 C  CE   . LYS A 1 32 ? -10.182 -0.204  -2.018  1.00 0.00 ? 32 LYS A CE   19 
ATOM   10988 N  NZ   . LYS A 1 32 ? -11.398 0.043   -2.837  1.00 0.00 ? 32 LYS A NZ   19 
ATOM   10989 H  H    . LYS A 1 32 ? -6.378  1.829   -0.017  1.00 0.00 ? 32 LYS A H    19 
ATOM   10990 H  HA   . LYS A 1 32 ? -8.049  3.146   -1.877  1.00 0.00 ? 32 LYS A HA   19 
ATOM   10991 H  HB2  . LYS A 1 32 ? -8.317  1.909   0.721   1.00 0.00 ? 32 LYS A HB2  19 
ATOM   10992 H  HB3  . LYS A 1 32 ? -9.228  3.411   0.654   1.00 0.00 ? 32 LYS A HB3  19 
ATOM   10993 H  HG2  . LYS A 1 32 ? -10.438 1.275   0.000   1.00 0.00 ? 32 LYS A HG2  19 
ATOM   10994 H  HG3  . LYS A 1 32 ? -10.577 2.651   -1.095  1.00 0.00 ? 32 LYS A HG3  19 
ATOM   10995 H  HD2  . LYS A 1 32 ? -9.389  1.637   -2.739  1.00 0.00 ? 32 LYS A HD2  19 
ATOM   10996 H  HD3  . LYS A 1 32 ? -8.337  0.785   -1.600  1.00 0.00 ? 32 LYS A HD3  19 
ATOM   10997 H  HE2  . LYS A 1 32 ? -9.572  -0.944  -2.513  1.00 0.00 ? 32 LYS A HE2  19 
ATOM   10998 H  HE3  . LYS A 1 32 ? -10.481 -0.575  -1.049  1.00 0.00 ? 32 LYS A HE3  19 
ATOM   10999 H  HZ1  . LYS A 1 32 ? -12.252 -0.020  -2.241  1.00 0.00 ? 32 LYS A HZ1  19 
ATOM   11000 H  HZ2  . LYS A 1 32 ? -11.472 -0.666  -3.599  1.00 0.00 ? 32 LYS A HZ2  19 
ATOM   11001 H  HZ3  . LYS A 1 32 ? -11.355 0.992   -3.268  1.00 0.00 ? 32 LYS A HZ3  19 
ATOM   11002 N  N    . ARG A 1 33 ? -6.515  4.958   0.317   1.00 0.00 ? 33 ARG A N    19 
ATOM   11003 C  CA   . ARG A 1 33 ? -6.138  6.322   0.652   1.00 0.00 ? 33 ARG A CA   19 
ATOM   11004 C  C    . ARG A 1 33 ? -5.338  6.958   -0.479  1.00 0.00 ? 33 ARG A C    19 
ATOM   11005 O  O    . ARG A 1 33 ? -5.082  8.161   -0.472  1.00 0.00 ? 33 ARG A O    19 
ATOM   11006 C  CB   . ARG A 1 33 ? -5.324  6.344   1.946   1.00 0.00 ? 33 ARG A CB   19 
ATOM   11007 C  CG   . ARG A 1 33 ? -5.936  7.212   3.029   1.00 0.00 ? 33 ARG A CG   19 
ATOM   11008 C  CD   . ARG A 1 33 ? -5.283  6.964   4.378   1.00 0.00 ? 33 ARG A CD   19 
ATOM   11009 N  NE   . ARG A 1 33 ? -3.894  7.423   4.419   1.00 0.00 ? 33 ARG A NE   19 
ATOM   11010 C  CZ   . ARG A 1 33 ? -2.894  6.718   4.953   1.00 0.00 ? 33 ARG A CZ   19 
ATOM   11011 N  NH1  . ARG A 1 33 ? -3.124  5.505   5.447   1.00 0.00 ? 33 ARG A NH1  19 
ATOM   11012 N  NH2  . ARG A 1 33 ? -1.665  7.215   4.984   1.00 0.00 ? 33 ARG A NH2  19 
ATOM   11013 H  H    . ARG A 1 33 ? -5.985  4.216   0.675   1.00 0.00 ? 33 ARG A H    19 
ATOM   11014 H  HA   . ARG A 1 33 ? -7.044  6.888   0.794   1.00 0.00 ? 33 ARG A HA   19 
ATOM   11015 H  HB2  . ARG A 1 33 ? -5.247  5.336   2.323   1.00 0.00 ? 33 ARG A HB2  19 
ATOM   11016 H  HB3  . ARG A 1 33 ? -4.333  6.716   1.731   1.00 0.00 ? 33 ARG A HB3  19 
ATOM   11017 H  HG2  . ARG A 1 33 ? -5.805  8.250   2.761   1.00 0.00 ? 33 ARG A HG2  19 
ATOM   11018 H  HG3  . ARG A 1 33 ? -6.989  6.988   3.100   1.00 0.00 ? 33 ARG A HG3  19 
ATOM   11019 H  HD2  . ARG A 1 33 ? -5.847  7.485   5.139   1.00 0.00 ? 33 ARG A HD2  19 
ATOM   11020 H  HD3  . ARG A 1 33 ? -5.307  5.902   4.580   1.00 0.00 ? 33 ARG A HD3  19 
ATOM   11021 H  HE   . ARG A 1 33 ? -3.703  8.311   4.036   1.00 0.00 ? 33 ARG A HE   19 
ATOM   11022 H  HH11 . ARG A 1 33 ? -4.051  5.119   5.419   1.00 0.00 ? 33 ARG A HH11 19 
ATOM   11023 H  HH12 . ARG A 1 33 ? -2.372  4.969   5.849   1.00 0.00 ? 33 ARG A HH12 19 
ATOM   11024 H  HH21 . ARG A 1 33 ? -1.474  8.131   4.600   1.00 0.00 ? 33 ARG A HH21 19 
ATOM   11025 H  HH22 . ARG A 1 33 ? -0.913  6.686   5.396   1.00 0.00 ? 33 ARG A HH22 19 
ATOM   11026 N  N    . HIS A 1 34 ? -4.982  6.151   -1.468  1.00 0.00 ? 34 HIS A N    19 
ATOM   11027 C  CA   . HIS A 1 34 ? -4.249  6.645   -2.620  1.00 0.00 ? 34 HIS A CA   19 
ATOM   11028 C  C    . HIS A 1 34 ? -5.196  6.823   -3.801  1.00 0.00 ? 34 HIS A C    19 
ATOM   11029 O  O    . HIS A 1 34 ? -4.787  7.224   -4.892  1.00 0.00 ? 34 HIS A O    19 
ATOM   11030 C  CB   . HIS A 1 34 ? -3.113  5.685   -2.988  1.00 0.00 ? 34 HIS A CB   19 
ATOM   11031 C  CG   . HIS A 1 34 ? -2.078  5.528   -1.914  1.00 0.00 ? 34 HIS A CG   19 
ATOM   11032 N  ND1  . HIS A 1 34 ? -1.447  6.581   -1.293  1.00 0.00 ? 34 HIS A ND1  19 
ATOM   11033 C  CD2  . HIS A 1 34 ? -1.557  4.404   -1.361  1.00 0.00 ? 34 HIS A CD2  19 
ATOM   11034 C  CE1  . HIS A 1 34 ? -0.575  6.073   -0.409  1.00 0.00 ? 34 HIS A CE1  19 
ATOM   11035 N  NE2  . HIS A 1 34 ? -0.603  4.753   -0.412  1.00 0.00 ? 34 HIS A NE2  19 
ATOM   11036 H  H    . HIS A 1 34 ? -5.248  5.204   -1.440  1.00 0.00 ? 34 HIS A H    19 
ATOM   11037 H  HA   . HIS A 1 34 ? -3.831  7.605   -2.361  1.00 0.00 ? 34 HIS A HA   19 
ATOM   11038 H  HB2  . HIS A 1 34 ? -3.526  4.708   -3.191  1.00 0.00 ? 34 HIS A HB2  19 
ATOM   11039 H  HB3  . HIS A 1 34 ? -2.617  6.050   -3.876  1.00 0.00 ? 34 HIS A HB3  19 
ATOM   11040 H  HD1  . HIS A 1 34 ? -1.617  7.541   -1.455  1.00 0.00 ? 34 HIS A HD1  19 
ATOM   11041 H  HD2  . HIS A 1 34 ? -1.843  3.390   -1.594  1.00 0.00 ? 34 HIS A HD2  19 
ATOM   11042 H  HE1  . HIS A 1 34 ? 0.062   6.669   0.228   1.00 0.00 ? 34 HIS A HE1  19 
ATOM   11043 N  N    . MET A 1 35 ? -6.475  6.548   -3.568  1.00 0.00 ? 35 MET A N    19 
ATOM   11044 C  CA   . MET A 1 35 ? -7.487  6.710   -4.601  1.00 0.00 ? 35 MET A CA   19 
ATOM   11045 C  C    . MET A 1 35 ? -8.035  8.130   -4.580  1.00 0.00 ? 35 MET A C    19 
ATOM   11046 O  O    . MET A 1 35 ? -8.500  8.644   -5.596  1.00 0.00 ? 35 MET A O    19 
ATOM   11047 C  CB   . MET A 1 35 ? -8.632  5.707   -4.421  1.00 0.00 ? 35 MET A CB   19 
ATOM   11048 C  CG   . MET A 1 35 ? -8.175  4.286   -4.135  1.00 0.00 ? 35 MET A CG   19 
ATOM   11049 S  SD   . MET A 1 35 ? -7.944  3.311   -5.633  1.00 0.00 ? 35 MET A SD   19 
ATOM   11050 C  CE   . MET A 1 35 ? -6.848  2.027   -5.029  1.00 0.00 ? 35 MET A CE   19 
ATOM   11051 H  H    . MET A 1 35 ? -6.747  6.251   -2.670  1.00 0.00 ? 35 MET A H    19 
ATOM   11052 H  HA   . MET A 1 35 ? -7.014  6.534   -5.555  1.00 0.00 ? 35 MET A HA   19 
ATOM   11053 H  HB2  . MET A 1 35 ? -9.251  6.033   -3.599  1.00 0.00 ? 35 MET A HB2  19 
ATOM   11054 H  HB3  . MET A 1 35 ? -9.226  5.693   -5.323  1.00 0.00 ? 35 MET A HB3  19 
ATOM   11055 H  HG2  . MET A 1 35 ? -7.239  4.324   -3.598  1.00 0.00 ? 35 MET A HG2  19 
ATOM   11056 H  HG3  . MET A 1 35 ? -8.920  3.802   -3.519  1.00 0.00 ? 35 MET A HG3  19 
ATOM   11057 H  HE1  . MET A 1 35 ? -6.343  2.376   -4.138  1.00 0.00 ? 35 MET A HE1  19 
ATOM   11058 H  HE2  . MET A 1 35 ? -7.423  1.145   -4.794  1.00 0.00 ? 35 MET A HE2  19 
ATOM   11059 H  HE3  . MET A 1 35 ? -6.118  1.789   -5.787  1.00 0.00 ? 35 MET A HE3  19 
ATOM   11060 N  N    . LEU A 1 36 ? -7.908  8.783   -3.436  1.00 0.00 ? 36 LEU A N    19 
ATOM   11061 C  CA   . LEU A 1 36 ? -8.328  10.163  -3.291  1.00 0.00 ? 36 LEU A CA   19 
ATOM   11062 C  C    . LEU A 1 36 ? -7.184  10.972  -2.713  1.00 0.00 ? 36 LEU A C    19 
ATOM   11063 O  O    . LEU A 1 36 ? -7.001  11.030  -1.498  1.00 0.00 ? 36 LEU A O    19 
ATOM   11064 C  CB   . LEU A 1 36 ? -9.558  10.266  -2.386  1.00 0.00 ? 36 LEU A CB   19 
ATOM   11065 C  CG   . LEU A 1 36 ? -10.660 9.238   -2.660  1.00 0.00 ? 36 LEU A CG   19 
ATOM   11066 C  CD1  . LEU A 1 36 ? -11.195 8.676   -1.355  1.00 0.00 ? 36 LEU A CD1  19 
ATOM   11067 C  CD2  . LEU A 1 36 ? -11.782 9.863   -3.476  1.00 0.00 ? 36 LEU A CD2  19 
ATOM   11068 H  H    . LEU A 1 36 ? -7.453  8.349   -2.684  1.00 0.00 ? 36 LEU A H    19 
ATOM   11069 H  HA   . LEU A 1 36 ? -8.570  10.546  -4.273  1.00 0.00 ? 36 LEU A HA   19 
ATOM   11070 H  HB2  . LEU A 1 36 ? -9.234  10.152  -1.362  1.00 0.00 ? 36 LEU A HB2  19 
ATOM   11071 H  HB3  . LEU A 1 36 ? -9.981  11.254  -2.503  1.00 0.00 ? 36 LEU A HB3  19 
ATOM   11072 H  HG   . LEU A 1 36 ? -10.247 8.419   -3.232  1.00 0.00 ? 36 LEU A HG   19 
ATOM   11073 H  HD11 . LEU A 1 36 ? -11.069 7.604   -1.347  1.00 0.00 ? 36 LEU A HD11 19 
ATOM   11074 H  HD12 . LEU A 1 36 ? -10.648 9.106   -0.527  1.00 0.00 ? 36 LEU A HD12 19 
ATOM   11075 H  HD13 . LEU A 1 36 ? -12.242 8.916   -1.259  1.00 0.00 ? 36 LEU A HD13 19 
ATOM   11076 H  HD21 . LEU A 1 36 ? -12.300 9.091   -4.026  1.00 0.00 ? 36 LEU A HD21 19 
ATOM   11077 H  HD22 . LEU A 1 36 ? -12.475 10.361  -2.816  1.00 0.00 ? 36 LEU A HD22 19 
ATOM   11078 H  HD23 . LEU A 1 36 ? -11.367 10.579  -4.169  1.00 0.00 ? 36 LEU A HD23 19 
ATOM   11079 N  N    . VAL A 1 37 ? -6.347  11.497  -3.587  1.00 0.00 ? 37 VAL A N    19 
ATOM   11080 C  CA   . VAL A 1 37 ? -5.171  12.223  -3.155  1.00 0.00 ? 37 VAL A CA   19 
ATOM   11081 C  C    . VAL A 1 37 ? -5.448  13.717  -3.149  1.00 0.00 ? 37 VAL A C    19 
ATOM   11082 O  O    . VAL A 1 37 ? -5.355  14.330  -2.068  1.00 0.00 ? 37 VAL A O    19 
ATOM   11083 C  CB   . VAL A 1 37 ? -3.951  11.923  -4.049  1.00 0.00 ? 37 VAL A CB   19 
ATOM   11084 C  CG1  . VAL A 1 37 ? -2.718  12.653  -3.538  1.00 0.00 ? 37 VAL A CG1  19 
ATOM   11085 C  CG2  . VAL A 1 37 ? -3.697  10.424  -4.116  1.00 0.00 ? 37 VAL A CG2  19 
ATOM   11086 O  OXT  . VAL A 1 37 ? -5.773  14.269  -4.221  1.00 0.00 ? 37 VAL A OXT  19 
ATOM   11087 H  H    . VAL A 1 37 ? -6.508  11.370  -4.547  1.00 0.00 ? 37 VAL A H    19 
ATOM   11088 H  HA   . VAL A 1 37 ? -4.943  11.902  -2.149  1.00 0.00 ? 37 VAL A HA   19 
ATOM   11089 H  HB   . VAL A 1 37 ? -4.163  12.278  -5.048  1.00 0.00 ? 37 VAL A HB   19 
ATOM   11090 H  HG11 . VAL A 1 37 ? -2.041  11.943  -3.088  1.00 0.00 ? 37 VAL A HG11 19 
ATOM   11091 H  HG12 . VAL A 1 37 ? -2.224  13.148  -4.362  1.00 0.00 ? 37 VAL A HG12 19 
ATOM   11092 H  HG13 . VAL A 1 37 ? -3.013  13.386  -2.802  1.00 0.00 ? 37 VAL A HG13 19 
ATOM   11093 H  HG21 . VAL A 1 37 ? -3.393  10.155  -5.117  1.00 0.00 ? 37 VAL A HG21 19 
ATOM   11094 H  HG22 . VAL A 1 37 ? -2.914  10.162  -3.419  1.00 0.00 ? 37 VAL A HG22 19 
ATOM   11095 H  HG23 . VAL A 1 37 ? -4.602  9.892   -3.858  1.00 0.00 ? 37 VAL A HG23 19 
HETATM 11096 ZN ZN   . ZN  B 2 .  ? 0.818   3.601   0.332   1.00 0.00 ? 38 ZN  A ZN   19 
ATOM   11097 N  N    . GLY A 1 1  ? 8.479   1.961   -3.507  1.00 0.00 ? 1  GLY A N    20 
ATOM   11098 C  CA   . GLY A 1 1  ? 7.505   0.847   -3.612  1.00 0.00 ? 1  GLY A CA   20 
ATOM   11099 C  C    . GLY A 1 1  ? 7.253   0.464   -5.052  1.00 0.00 ? 1  GLY A C    20 
ATOM   11100 O  O    . GLY A 1 1  ? 7.131   1.342   -5.907  1.00 0.00 ? 1  GLY A O    20 
ATOM   11101 H  H1   . GLY A 1 1  ? 8.126   2.691   -2.851  1.00 0.00 ? 1  GLY A H1   20 
ATOM   11102 H  H2   . GLY A 1 1  ? 8.629   2.398   -4.443  1.00 0.00 ? 1  GLY A H2   20 
ATOM   11103 H  H3   . GLY A 1 1  ? 9.394   1.606   -3.153  1.00 0.00 ? 1  GLY A H3   20 
ATOM   11104 H  HA2  . GLY A 1 1  ? 7.893   -0.011  -3.084  1.00 0.00 ? 1  GLY A HA2  20 
ATOM   11105 H  HA3  . GLY A 1 1  ? 6.572   1.149   -3.159  1.00 0.00 ? 1  GLY A HA3  20 
ATOM   11106 N  N    . SER A 1 2  ? 7.230   -0.841  -5.330  1.00 0.00 ? 2  SER A N    20 
ATOM   11107 C  CA   . SER A 1 2  ? 7.059   -1.345  -6.693  1.00 0.00 ? 2  SER A CA   20 
ATOM   11108 C  C    . SER A 1 2  ? 8.097   -0.725  -7.623  1.00 0.00 ? 2  SER A C    20 
ATOM   11109 O  O    . SER A 1 2  ? 7.770   -0.133  -8.652  1.00 0.00 ? 2  SER A O    20 
ATOM   11110 C  CB   . SER A 1 2  ? 5.642   -1.066  -7.199  1.00 0.00 ? 2  SER A CB   20 
ATOM   11111 O  OG   . SER A 1 2  ? 4.715   -1.979  -6.638  1.00 0.00 ? 2  SER A OG   20 
ATOM   11112 H  H    . SER A 1 2  ? 7.360   -1.485  -4.599  1.00 0.00 ? 2  SER A H    20 
ATOM   11113 H  HA   . SER A 1 2  ? 7.217   -2.414  -6.669  1.00 0.00 ? 2  SER A HA   20 
ATOM   11114 H  HB2  . SER A 1 2  ? 5.354   -0.063  -6.923  1.00 0.00 ? 2  SER A HB2  20 
ATOM   11115 H  HB3  . SER A 1 2  ? 5.620   -1.164  -8.275  1.00 0.00 ? 2  SER A HB3  20 
ATOM   11116 H  HG   . SER A 1 2  ? 4.836   -2.853  -7.047  1.00 0.00 ? 2  SER A HG   20 
ATOM   11117 N  N    . THR A 1 3  ? 9.343   -0.777  -7.187  1.00 0.00 ? 3  THR A N    20 
ATOM   11118 C  CA   . THR A 1 3  ? 10.439  -0.130  -7.882  1.00 0.00 ? 3  THR A CA   20 
ATOM   11119 C  C    . THR A 1 3  ? 10.939  -0.972  -9.060  1.00 0.00 ? 3  THR A C    20 
ATOM   11120 O  O    . THR A 1 3  ? 12.132  -0.975  -9.366  1.00 0.00 ? 3  THR A O    20 
ATOM   11121 C  CB   . THR A 1 3  ? 11.580  0.121   -6.887  1.00 0.00 ? 3  THR A CB   20 
ATOM   11122 O  OG1  . THR A 1 3  ? 11.227  -0.460  -5.619  1.00 0.00 ? 3  THR A OG1  20 
ATOM   11123 C  CG2  . THR A 1 3  ? 11.833  1.604   -6.706  1.00 0.00 ? 3  THR A CG2  20 
ATOM   11124 H  H    . THR A 1 3  ? 9.523   -1.182  -6.312  1.00 0.00 ? 3  THR A H    20 
ATOM   11125 H  HA   . THR A 1 3  ? 10.090  0.824   -8.249  1.00 0.00 ? 3  THR A HA   20 
ATOM   11126 H  HB   . THR A 1 3  ? 12.480  -0.347  -7.258  1.00 0.00 ? 3  THR A HB   20 
ATOM   11127 H  HG1  . THR A 1 3  ? 11.943  -0.299  -4.980  1.00 0.00 ? 3  THR A HG1  20 
ATOM   11128 H  HG21 . THR A 1 3  ? 12.773  1.748   -6.196  1.00 0.00 ? 3  THR A HG21 20 
ATOM   11129 H  HG22 . THR A 1 3  ? 11.035  2.032   -6.118  1.00 0.00 ? 3  THR A HG22 20 
ATOM   11130 H  HG23 . THR A 1 3  ? 11.869  2.085   -7.672  1.00 0.00 ? 3  THR A HG23 20 
ATOM   11131 N  N    . ARG A 1 4  ? 10.000  -1.628  -9.749  1.00 0.00 ? 4  ARG A N    20 
ATOM   11132 C  CA   . ARG A 1 4  ? 10.299  -2.424  -10.941 1.00 0.00 ? 4  ARG A CA   20 
ATOM   11133 C  C    . ARG A 1 4  ? 11.374  -3.472  -10.660 1.00 0.00 ? 4  ARG A C    20 
ATOM   11134 O  O    . ARG A 1 4  ? 12.498  -3.377  -11.154 1.00 0.00 ? 4  ARG A O    20 
ATOM   11135 C  CB   . ARG A 1 4  ? 10.734  -1.516  -12.093 1.00 0.00 ? 4  ARG A CB   20 
ATOM   11136 C  CG   . ARG A 1 4  ? 9.577   -0.855  -12.825 1.00 0.00 ? 4  ARG A CG   20 
ATOM   11137 C  CD   . ARG A 1 4  ? 9.183   0.468   -12.181 1.00 0.00 ? 4  ARG A CD   20 
ATOM   11138 N  NE   . ARG A 1 4  ? 10.344  1.224   -11.703 1.00 0.00 ? 4  ARG A NE   20 
ATOM   11139 C  CZ   . ARG A 1 4  ? 10.272  2.231   -10.836 1.00 0.00 ? 4  ARG A CZ   20 
ATOM   11140 N  NH1  . ARG A 1 4  ? 9.100   2.607   -10.340 1.00 0.00 ? 4  ARG A NH1  20 
ATOM   11141 N  NH2  . ARG A 1 4  ? 11.377  2.863   -10.466 1.00 0.00 ? 4  ARG A NH2  20 
ATOM   11142 H  H    . ARG A 1 4  ? 9.061   -1.524  -9.477  1.00 0.00 ? 4  ARG A H    20 
ATOM   11143 H  HA   . ARG A 1 4  ? 9.391   -2.936  -11.227 1.00 0.00 ? 4  ARG A HA   20 
ATOM   11144 H  HB2  . ARG A 1 4  ? 11.372  -0.739  -11.700 1.00 0.00 ? 4  ARG A HB2  20 
ATOM   11145 H  HB3  . ARG A 1 4  ? 11.294  -2.102  -12.806 1.00 0.00 ? 4  ARG A HB3  20 
ATOM   11146 H  HG2  . ARG A 1 4  ? 9.871   -0.671  -13.847 1.00 0.00 ? 4  ARG A HG2  20 
ATOM   11147 H  HG3  . ARG A 1 4  ? 8.727   -1.520  -12.807 1.00 0.00 ? 4  ARG A HG3  20 
ATOM   11148 H  HD2  . ARG A 1 4  ? 8.656   1.063   -12.911 1.00 0.00 ? 4  ARG A HD2  20 
ATOM   11149 H  HD3  . ARG A 1 4  ? 8.531   0.264   -11.346 1.00 0.00 ? 4  ARG A HD3  20 
ATOM   11150 H  HE   . ARG A 1 4  ? 11.229  0.964   -12.052 1.00 0.00 ? 4  ARG A HE   20 
ATOM   11151 H  HH11 . ARG A 1 4  ? 8.255   2.135   -10.624 1.00 0.00 ? 4  ARG A HH11 20 
ATOM   11152 H  HH12 . ARG A 1 4  ? 9.047   3.364   -9.672  1.00 0.00 ? 4  ARG A HH12 20 
ATOM   11153 H  HH21 . ARG A 1 4  ? 12.265  2.584   -10.842 1.00 0.00 ? 4  ARG A HH21 20 
ATOM   11154 H  HH22 . ARG A 1 4  ? 11.332  3.633   -9.812  1.00 0.00 ? 4  ARG A HH22 20 
ATOM   11155 N  N    . GLY A 1 5  ? 11.024  -4.466  -9.859  1.00 0.00 ? 5  GLY A N    20 
ATOM   11156 C  CA   . GLY A 1 5  ? 11.966  -5.516  -9.528  1.00 0.00 ? 5  GLY A CA   20 
ATOM   11157 C  C    . GLY A 1 5  ? 12.716  -5.226  -8.248  1.00 0.00 ? 5  GLY A C    20 
ATOM   11158 O  O    . GLY A 1 5  ? 13.712  -5.881  -7.933  1.00 0.00 ? 5  GLY A O    20 
ATOM   11159 H  H    . GLY A 1 5  ? 10.108  -4.496  -9.493  1.00 0.00 ? 5  GLY A H    20 
ATOM   11160 H  HA2  . GLY A 1 5  ? 11.427  -6.443  -9.413  1.00 0.00 ? 5  GLY A HA2  20 
ATOM   11161 H  HA3  . GLY A 1 5  ? 12.676  -5.620  -10.335 1.00 0.00 ? 5  GLY A HA3  20 
ATOM   11162 N  N    . SER A 1 6  ? 12.212  -4.267  -7.494  1.00 0.00 ? 6  SER A N    20 
ATOM   11163 C  CA   . SER A 1 6  ? 12.819  -3.874  -6.234  1.00 0.00 ? 6  SER A CA   20 
ATOM   11164 C  C    . SER A 1 6  ? 11.752  -3.766  -5.155  1.00 0.00 ? 6  SER A C    20 
ATOM   11165 O  O    . SER A 1 6  ? 11.843  -2.945  -4.242  1.00 0.00 ? 6  SER A O    20 
ATOM   11166 C  CB   . SER A 1 6  ? 13.557  -2.545  -6.389  1.00 0.00 ? 6  SER A CB   20 
ATOM   11167 O  OG   . SER A 1 6  ? 14.415  -2.560  -7.519  1.00 0.00 ? 6  SER A OG   20 
ATOM   11168 H  H    . SER A 1 6  ? 11.408  -3.804  -7.796  1.00 0.00 ? 6  SER A H    20 
ATOM   11169 H  HA   . SER A 1 6  ? 13.526  -4.640  -5.952  1.00 0.00 ? 6  SER A HA   20 
ATOM   11170 H  HB2  . SER A 1 6  ? 12.838  -1.747  -6.511  1.00 0.00 ? 6  SER A HB2  20 
ATOM   11171 H  HB3  . SER A 1 6  ? 14.148  -2.362  -5.507  1.00 0.00 ? 6  SER A HB3  20 
ATOM   11172 H  HG   . SER A 1 6  ? 14.732  -1.656  -7.692  1.00 0.00 ? 6  SER A HG   20 
ATOM   11173 N  N    . THR A 1 7  ? 10.785  -4.662  -5.228  1.00 0.00 ? 7  THR A N    20 
ATOM   11174 C  CA   . THR A 1 7  ? 9.721   -4.737  -4.245  1.00 0.00 ? 7  THR A CA   20 
ATOM   11175 C  C    . THR A 1 7  ? 10.213  -5.492  -3.032  1.00 0.00 ? 7  THR A C    20 
ATOM   11176 O  O    . THR A 1 7  ? 10.418  -6.706  -3.088  1.00 0.00 ? 7  THR A O    20 
ATOM   11177 C  CB   . THR A 1 7  ? 8.494   -5.439  -4.845  1.00 0.00 ? 7  THR A CB   20 
ATOM   11178 O  OG1  . THR A 1 7  ? 8.879   -6.097  -6.060  1.00 0.00 ? 7  THR A OG1  20 
ATOM   11179 C  CG2  . THR A 1 7  ? 7.385   -4.447  -5.145  1.00 0.00 ? 7  THR A CG2  20 
ATOM   11180 H  H    . THR A 1 7  ? 10.812  -5.335  -5.943  1.00 0.00 ? 7  THR A H    20 
ATOM   11181 H  HA   . THR A 1 7  ? 9.446   -3.737  -3.946  1.00 0.00 ? 7  THR A HA   20 
ATOM   11182 H  HB   . THR A 1 7  ? 8.129   -6.173  -4.140  1.00 0.00 ? 7  THR A HB   20 
ATOM   11183 H  HG1  . THR A 1 7  ? 8.711   -7.047  -5.979  1.00 0.00 ? 7  THR A HG1  20 
ATOM   11184 H  HG21 . THR A 1 7  ? 6.521   -4.974  -5.521  1.00 0.00 ? 7  THR A HG21 20 
ATOM   11185 H  HG22 . THR A 1 7  ? 7.726   -3.739  -5.886  1.00 0.00 ? 7  THR A HG22 20 
ATOM   11186 H  HG23 . THR A 1 7  ? 7.120   -3.920  -4.240  1.00 0.00 ? 7  THR A HG23 20 
ATOM   11187 N  N    . GLY A 1 8  ? 10.639  -4.722  -2.039  1.00 0.00 ? 8  GLY A N    20 
ATOM   11188 C  CA   . GLY A 1 8  ? 11.325  -5.278  -0.896  1.00 0.00 ? 8  GLY A CA   20 
ATOM   11189 C  C    . GLY A 1 8  ? 10.538  -6.354  -0.177  1.00 0.00 ? 8  GLY A C    20 
ATOM   11190 O  O    . GLY A 1 8  ? 10.651  -7.538  -0.498  1.00 0.00 ? 8  GLY A O    20 
ATOM   11191 H  H    . GLY A 1 8  ? 10.587  -3.739  -2.140  1.00 0.00 ? 8  GLY A H    20 
ATOM   11192 H  HA2  . GLY A 1 8  ? 12.262  -5.701  -1.229  1.00 0.00 ? 8  GLY A HA2  20 
ATOM   11193 H  HA3  . GLY A 1 8  ? 11.537  -4.479  -0.199  1.00 0.00 ? 8  GLY A HA3  20 
ATOM   11194 N  N    . ILE A 1 9  ? 9.814   -5.963  0.852   1.00 0.00 ? 9  ILE A N    20 
ATOM   11195 C  CA   . ILE A 1 9  ? 9.089   -6.933  1.665   1.00 0.00 ? 9  ILE A CA   20 
ATOM   11196 C  C    . ILE A 1 9  ? 7.790   -7.365  0.989   1.00 0.00 ? 9  ILE A C    20 
ATOM   11197 O  O    . ILE A 1 9  ? 7.156   -6.550  0.321   1.00 0.00 ? 9  ILE A O    20 
ATOM   11198 C  CB   . ILE A 1 9  ? 8.782   -6.345  3.063   1.00 0.00 ? 9  ILE A CB   20 
ATOM   11199 C  CG1  . ILE A 1 9  ? 9.988   -5.561  3.587   1.00 0.00 ? 9  ILE A CG1  20 
ATOM   11200 C  CG2  . ILE A 1 9  ? 8.396   -7.439  4.048   1.00 0.00 ? 9  ILE A CG2  20 
ATOM   11201 C  CD1  . ILE A 1 9  ? 9.644   -4.597  4.702   1.00 0.00 ? 9  ILE A CD1  20 
ATOM   11202 H  H    . ILE A 1 9  ? 9.757   -5.002  1.064   1.00 0.00 ? 9  ILE A H    20 
ATOM   11203 H  HA   . ILE A 1 9  ? 9.722   -7.798  1.794   1.00 0.00 ? 9  ILE A HA   20 
ATOM   11204 H  HB   . ILE A 1 9  ? 7.943   -5.673  2.966   1.00 0.00 ? 9  ILE A HB   20 
ATOM   11205 H  HG12 . ILE A 1 9  ? 10.725  -6.255  3.964   1.00 0.00 ? 9  ILE A HG12 20 
ATOM   11206 H  HG13 . ILE A 1 9  ? 10.419  -4.991  2.776   1.00 0.00 ? 9  ILE A HG13 20 
ATOM   11207 H  HG21 . ILE A 1 9  ? 9.212   -8.140  4.149   1.00 0.00 ? 9  ILE A HG21 20 
ATOM   11208 H  HG22 . ILE A 1 9  ? 8.181   -6.998  5.011   1.00 0.00 ? 9  ILE A HG22 20 
ATOM   11209 H  HG23 . ILE A 1 9  ? 7.520   -7.956  3.685   1.00 0.00 ? 9  ILE A HG23 20 
ATOM   11210 H  HD11 . ILE A 1 9  ? 10.465  -4.553  5.404   1.00 0.00 ? 9  ILE A HD11 20 
ATOM   11211 H  HD12 . ILE A 1 9  ? 9.470   -3.615  4.289   1.00 0.00 ? 9  ILE A HD12 20 
ATOM   11212 H  HD13 . ILE A 1 9  ? 8.754   -4.938  5.211   1.00 0.00 ? 9  ILE A HD13 20 
ATOM   11213 N  N    . LYS A 1 10 ? 7.292   -8.545  1.387   1.00 0.00 ? 10 LYS A N    20 
ATOM   11214 C  CA   . LYS A 1 10 ? 5.958   -9.044  1.016   1.00 0.00 ? 10 LYS A CA   20 
ATOM   11215 C  C    . LYS A 1 10 ? 5.686   -9.067  -0.503  1.00 0.00 ? 10 LYS A C    20 
ATOM   11216 O  O    . LYS A 1 10 ? 6.242   -8.291  -1.282  1.00 0.00 ? 10 LYS A O    20 
ATOM   11217 C  CB   . LYS A 1 10 ? 4.881   -8.255  1.753   1.00 0.00 ? 10 LYS A CB   20 
ATOM   11218 C  CG   . LYS A 1 10 ? 4.467   -8.900  3.069   1.00 0.00 ? 10 LYS A CG   20 
ATOM   11219 C  CD   . LYS A 1 10 ? 4.577   -7.924  4.227   1.00 0.00 ? 10 LYS A CD   20 
ATOM   11220 C  CE   . LYS A 1 10 ? 4.079   -8.533  5.526   1.00 0.00 ? 10 LYS A CE   20 
ATOM   11221 N  NZ   . LYS A 1 10 ? 4.857   -8.052  6.697   1.00 0.00 ? 10 LYS A NZ   20 
ATOM   11222 H  H    . LYS A 1 10 ? 7.802   -9.058  2.053   1.00 0.00 ? 10 LYS A H    20 
ATOM   11223 H  HA   . LYS A 1 10 ? 5.908   -10.064 1.364   1.00 0.00 ? 10 LYS A HA   20 
ATOM   11224 H  HB2  . LYS A 1 10 ? 5.254   -7.264  1.961   1.00 0.00 ? 10 LYS A HB2  20 
ATOM   11225 H  HB3  . LYS A 1 10 ? 4.007   -8.178  1.123   1.00 0.00 ? 10 LYS A HB3  20 
ATOM   11226 H  HG2  . LYS A 1 10 ? 3.445   -9.238  2.991   1.00 0.00 ? 10 LYS A HG2  20 
ATOM   11227 H  HG3  . LYS A 1 10 ? 5.113   -9.744  3.261   1.00 0.00 ? 10 LYS A HG3  20 
ATOM   11228 H  HD2  . LYS A 1 10 ? 5.610   -7.641  4.351   1.00 0.00 ? 10 LYS A HD2  20 
ATOM   11229 H  HD3  . LYS A 1 10 ? 3.986   -7.048  4.003   1.00 0.00 ? 10 LYS A HD3  20 
ATOM   11230 H  HE2  . LYS A 1 10 ? 3.041   -8.267  5.660   1.00 0.00 ? 10 LYS A HE2  20 
ATOM   11231 H  HE3  . LYS A 1 10 ? 4.169   -9.608  5.462   1.00 0.00 ? 10 LYS A HE3  20 
ATOM   11232 H  HZ1  . LYS A 1 10 ? 5.073   -7.034  6.596   1.00 0.00 ? 10 LYS A HZ1  20 
ATOM   11233 H  HZ2  . LYS A 1 10 ? 5.755   -8.579  6.771   1.00 0.00 ? 10 LYS A HZ2  20 
ATOM   11234 H  HZ3  . LYS A 1 10 ? 4.313   -8.196  7.574   1.00 0.00 ? 10 LYS A HZ3  20 
ATOM   11235 N  N    . PRO A 1 11 ? 4.878   -10.042 -0.954  1.00 0.00 ? 11 PRO A N    20 
ATOM   11236 C  CA   . PRO A 1 11 ? 4.566   -10.226 -2.379  1.00 0.00 ? 11 PRO A CA   20 
ATOM   11237 C  C    . PRO A 1 11 ? 3.707   -9.099  -2.959  1.00 0.00 ? 11 PRO A C    20 
ATOM   11238 O  O    . PRO A 1 11 ? 3.601   -8.954  -4.178  1.00 0.00 ? 11 PRO A O    20 
ATOM   11239 C  CB   . PRO A 1 11 ? 3.796   -11.549 -2.410  1.00 0.00 ? 11 PRO A CB   20 
ATOM   11240 C  CG   . PRO A 1 11 ? 3.242   -11.700 -1.037  1.00 0.00 ? 11 PRO A CG   20 
ATOM   11241 C  CD   . PRO A 1 11 ? 4.255   -11.085 -0.118  1.00 0.00 ? 11 PRO A CD   20 
ATOM   11242 H  HA   . PRO A 1 11 ? 5.466   -10.321 -2.965  1.00 0.00 ? 11 PRO A HA   20 
ATOM   11243 H  HB2  . PRO A 1 11 ? 3.012   -11.496 -3.150  1.00 0.00 ? 11 PRO A HB2  20 
ATOM   11244 H  HB3  . PRO A 1 11 ? 4.472   -12.355 -2.652  1.00 0.00 ? 11 PRO A HB3  20 
ATOM   11245 H  HG2  . PRO A 1 11 ? 2.300   -11.176 -0.963  1.00 0.00 ? 11 PRO A HG2  20 
ATOM   11246 H  HG3  . PRO A 1 11 ? 3.112   -12.746 -0.803  1.00 0.00 ? 11 PRO A HG3  20 
ATOM   11247 H  HD2  . PRO A 1 11 ? 3.768   -10.651 0.742   1.00 0.00 ? 11 PRO A HD2  20 
ATOM   11248 H  HD3  . PRO A 1 11 ? 4.983   -11.820 0.189   1.00 0.00 ? 11 PRO A HD3  20 
ATOM   11249 N  N    . PHE A 1 12 ? 3.079   -8.314  -2.093  1.00 0.00 ? 12 PHE A N    20 
ATOM   11250 C  CA   . PHE A 1 12 ? 2.229   -7.221  -2.539  1.00 0.00 ? 12 PHE A CA   20 
ATOM   11251 C  C    . PHE A 1 12 ? 2.583   -5.925  -1.821  1.00 0.00 ? 12 PHE A C    20 
ATOM   11252 O  O    . PHE A 1 12 ? 2.082   -5.642  -0.739  1.00 0.00 ? 12 PHE A O    20 
ATOM   11253 C  CB   . PHE A 1 12 ? 0.756   -7.566  -2.315  1.00 0.00 ? 12 PHE A CB   20 
ATOM   11254 C  CG   . PHE A 1 12 ? 0.320   -8.812  -3.035  1.00 0.00 ? 12 PHE A CG   20 
ATOM   11255 C  CD1  . PHE A 1 12 ? 0.184   -8.821  -4.413  1.00 0.00 ? 12 PHE A CD1  20 
ATOM   11256 C  CD2  . PHE A 1 12 ? 0.052   -9.974  -2.332  1.00 0.00 ? 12 PHE A CD2  20 
ATOM   11257 C  CE1  . PHE A 1 12 ? -0.208  -9.968  -5.077  1.00 0.00 ? 12 PHE A CE1  20 
ATOM   11258 C  CE2  . PHE A 1 12 ? -0.338  -11.124 -2.991  1.00 0.00 ? 12 PHE A CE2  20 
ATOM   11259 C  CZ   . PHE A 1 12 ? -0.470  -11.120 -4.365  1.00 0.00 ? 12 PHE A CZ   20 
ATOM   11260 H  H    . PHE A 1 12 ? 3.173   -8.483  -1.132  1.00 0.00 ? 12 PHE A H    20 
ATOM   11261 H  HA   . PHE A 1 12 ? 2.398   -7.085  -3.597  1.00 0.00 ? 12 PHE A HA   20 
ATOM   11262 H  HB2  . PHE A 1 12 ? 0.585   -7.714  -1.258  1.00 0.00 ? 12 PHE A HB2  20 
ATOM   11263 H  HB3  . PHE A 1 12 ? 0.144   -6.745  -2.663  1.00 0.00 ? 12 PHE A HB3  20 
ATOM   11264 H  HD1  . PHE A 1 12 ? 0.387   -7.920  -4.971  1.00 0.00 ? 12 PHE A HD1  20 
ATOM   11265 H  HD2  . PHE A 1 12 ? 0.151   -9.978  -1.256  1.00 0.00 ? 12 PHE A HD2  20 
ATOM   11266 H  HE1  . PHE A 1 12 ? -0.314  -9.961  -6.153  1.00 0.00 ? 12 PHE A HE1  20 
ATOM   11267 H  HE2  . PHE A 1 12 ? -0.548  -12.022 -2.428  1.00 0.00 ? 12 PHE A HE2  20 
ATOM   11268 H  HZ   . PHE A 1 12 ? -0.774  -12.019 -4.882  1.00 0.00 ? 12 PHE A HZ   20 
ATOM   11269 N  N    . GLN A 1 13 ? 3.502   -5.182  -2.404  1.00 0.00 ? 13 GLN A N    20 
ATOM   11270 C  CA   . GLN A 1 13 ? 3.978   -3.928  -1.847  1.00 0.00 ? 13 GLN A CA   20 
ATOM   11271 C  C    . GLN A 1 13 ? 3.135   -2.753  -2.339  1.00 0.00 ? 13 GLN A C    20 
ATOM   11272 O  O    . GLN A 1 13 ? 2.704   -2.742  -3.495  1.00 0.00 ? 13 GLN A O    20 
ATOM   11273 C  CB   . GLN A 1 13 ? 5.418   -3.727  -2.294  1.00 0.00 ? 13 GLN A CB   20 
ATOM   11274 C  CG   . GLN A 1 13 ? 6.409   -3.475  -1.178  1.00 0.00 ? 13 GLN A CG   20 
ATOM   11275 C  CD   . GLN A 1 13 ? 7.657   -2.758  -1.667  1.00 0.00 ? 13 GLN A CD   20 
ATOM   11276 O  OE1  . GLN A 1 13 ? 7.727   -2.308  -2.813  1.00 0.00 ? 13 GLN A OE1  20 
ATOM   11277 N  NE2  . GLN A 1 13 ? 8.644   -2.624  -0.799  1.00 0.00 ? 13 GLN A NE2  20 
ATOM   11278 H  H    . GLN A 1 13 ? 3.917   -5.509  -3.226  1.00 0.00 ? 13 GLN A H    20 
ATOM   11279 H  HA   . GLN A 1 13 ? 3.936   -3.985  -0.772  1.00 0.00 ? 13 GLN A HA   20 
ATOM   11280 H  HB2  . GLN A 1 13 ? 5.731   -4.617  -2.812  1.00 0.00 ? 13 GLN A HB2  20 
ATOM   11281 H  HB3  . GLN A 1 13 ? 5.454   -2.892  -2.974  1.00 0.00 ? 13 GLN A HB3  20 
ATOM   11282 H  HG2  . GLN A 1 13 ? 5.934   -2.869  -0.420  1.00 0.00 ? 13 GLN A HG2  20 
ATOM   11283 H  HG3  . GLN A 1 13 ? 6.695   -4.423  -0.754  1.00 0.00 ? 13 GLN A HG3  20 
ATOM   11284 H  HE21 . GLN A 1 13 ? 8.518   -2.982  0.109   1.00 0.00 ? 13 GLN A HE21 20 
ATOM   11285 H  HE22 . GLN A 1 13 ? 9.470   -2.176  -1.095  1.00 0.00 ? 13 GLN A HE22 20 
ATOM   11286 N  N    . CYS A 1 14 ? 3.076   -1.689  -1.541  1.00 0.00 ? 14 CYS A N    20 
ATOM   11287 C  CA   . CYS A 1 14 ? 2.488   -0.444  -2.004  1.00 0.00 ? 14 CYS A CA   20 
ATOM   11288 C  C    . CYS A 1 14 ? 3.409   0.195   -3.038  1.00 0.00 ? 14 CYS A C    20 
ATOM   11289 O  O    . CYS A 1 14 ? 4.607   0.358   -2.790  1.00 0.00 ? 14 CYS A O    20 
ATOM   11290 C  CB   . CYS A 1 14 ? 2.254   0.560   -0.873  1.00 0.00 ? 14 CYS A CB   20 
ATOM   11291 S  SG   . CYS A 1 14 ? 1.668   2.168   -1.517  1.00 0.00 ? 14 CYS A SG   20 
ATOM   11292 H  H    . CYS A 1 14 ? 3.567   -1.703  -0.692  1.00 0.00 ? 14 CYS A H    20 
ATOM   11293 H  HA   . CYS A 1 14 ? 1.541   -0.675  -2.465  1.00 0.00 ? 14 CYS A HA   20 
ATOM   11294 H  HB2  . CYS A 1 14 ? 1.516   0.169   -0.192  1.00 0.00 ? 14 CYS A HB2  20 
ATOM   11295 H  HB3  . CYS A 1 14 ? 3.181   0.731   -0.345  1.00 0.00 ? 14 CYS A HB3  20 
ATOM   11296 N  N    . PRO A 1 15 ? 2.866   0.593   -4.192  1.00 0.00 ? 15 PRO A N    20 
ATOM   11297 C  CA   . PRO A 1 15 ? 3.650   1.221   -5.252  1.00 0.00 ? 15 PRO A CA   20 
ATOM   11298 C  C    . PRO A 1 15 ? 4.028   2.665   -4.931  1.00 0.00 ? 15 PRO A C    20 
ATOM   11299 O  O    . PRO A 1 15 ? 4.741   3.310   -5.700  1.00 0.00 ? 15 PRO A O    20 
ATOM   11300 C  CB   . PRO A 1 15 ? 2.716   1.166   -6.460  1.00 0.00 ? 15 PRO A CB   20 
ATOM   11301 C  CG   . PRO A 1 15 ? 1.345   1.168   -5.880  1.00 0.00 ? 15 PRO A CG   20 
ATOM   11302 C  CD   . PRO A 1 15 ? 1.446   0.453   -4.559  1.00 0.00 ? 15 PRO A CD   20 
ATOM   11303 H  HA   . PRO A 1 15 ? 4.548   0.658   -5.462  1.00 0.00 ? 15 PRO A HA   20 
ATOM   11304 H  HB2  . PRO A 1 15 ? 2.881   2.029   -7.088  1.00 0.00 ? 15 PRO A HB2  20 
ATOM   11305 H  HB3  . PRO A 1 15 ? 2.904   0.263   -7.022  1.00 0.00 ? 15 PRO A HB3  20 
ATOM   11306 H  HG2  . PRO A 1 15 ? 1.013   2.185   -5.731  1.00 0.00 ? 15 PRO A HG2  20 
ATOM   11307 H  HG3  . PRO A 1 15 ? 0.668   0.645   -6.537  1.00 0.00 ? 15 PRO A HG3  20 
ATOM   11308 H  HD2  . PRO A 1 15 ? 0.812   0.927   -3.827  1.00 0.00 ? 15 PRO A HD2  20 
ATOM   11309 H  HD3  . PRO A 1 15 ? 1.179   -0.588  -4.673  1.00 0.00 ? 15 PRO A HD3  20 
ATOM   11310 N  N    . ASP A 1 16 ? 3.526   3.186   -3.817  1.00 0.00 ? 16 ASP A N    20 
ATOM   11311 C  CA   . ASP A 1 16 ? 3.790   4.575   -3.450  1.00 0.00 ? 16 ASP A CA   20 
ATOM   11312 C  C    . ASP A 1 16 ? 4.592   4.680   -2.158  1.00 0.00 ? 16 ASP A C    20 
ATOM   11313 O  O    . ASP A 1 16 ? 5.303   5.662   -1.944  1.00 0.00 ? 16 ASP A O    20 
ATOM   11314 C  CB   . ASP A 1 16 ? 2.479   5.347   -3.300  1.00 0.00 ? 16 ASP A CB   20 
ATOM   11315 C  CG   . ASP A 1 16 ? 2.670   6.849   -3.414  1.00 0.00 ? 16 ASP A CG   20 
ATOM   11316 O  OD1  . ASP A 1 16 ? 2.772   7.360   -4.551  1.00 0.00 ? 16 ASP A OD1  20 
ATOM   11317 O  OD2  . ASP A 1 16 ? 2.688   7.530   -2.367  1.00 0.00 ? 16 ASP A OD2  20 
ATOM   11318 H  H    . ASP A 1 16 ? 2.930   2.636   -3.250  1.00 0.00 ? 16 ASP A H    20 
ATOM   11319 H  HA   . ASP A 1 16 ? 4.363   5.019   -4.250  1.00 0.00 ? 16 ASP A HA   20 
ATOM   11320 H  HB2  . ASP A 1 16 ? 1.793   5.033   -4.070  1.00 0.00 ? 16 ASP A HB2  20 
ATOM   11321 H  HB3  . ASP A 1 16 ? 2.052   5.130   -2.333  1.00 0.00 ? 16 ASP A HB3  20 
ATOM   11322 N  N    . CYS A 1 17 ? 4.393   3.730   -1.252  1.00 0.00 ? 17 CYS A N    20 
ATOM   11323 C  CA   . CYS A 1 17 ? 5.014   3.808   0.067   1.00 0.00 ? 17 CYS A CA   20 
ATOM   11324 C  C    . CYS A 1 17 ? 6.207   2.870   0.225   1.00 0.00 ? 17 CYS A C    20 
ATOM   11325 O  O    . CYS A 1 17 ? 7.002   3.070   1.134   1.00 0.00 ? 17 CYS A O    20 
ATOM   11326 C  CB   . CYS A 1 17 ? 3.996   3.497   1.159   1.00 0.00 ? 17 CYS A CB   20 
ATOM   11327 S  SG   . CYS A 1 17 ? 2.569   4.616   1.184   1.00 0.00 ? 17 CYS A SG   20 
ATOM   11328 H  H    . CYS A 1 17 ? 3.737   3.019   -1.439  1.00 0.00 ? 17 CYS A H    20 
ATOM   11329 H  HA   . CYS A 1 17 ? 5.358   4.820   0.199   1.00 0.00 ? 17 CYS A HA   20 
ATOM   11330 H  HB2  . CYS A 1 17 ? 3.623   2.494   1.018   1.00 0.00 ? 17 CYS A HB2  20 
ATOM   11331 H  HB3  . CYS A 1 17 ? 4.482   3.564   2.122   1.00 0.00 ? 17 CYS A HB3  20 
ATOM   11332 N  N    . ASP A 1 18 ? 6.141   1.728   -0.459  1.00 0.00 ? 18 ASP A N    20 
ATOM   11333 C  CA   . ASP A 1 18 ? 7.054   0.585   -0.242  1.00 0.00 ? 18 ASP A CA   20 
ATOM   11334 C  C    . ASP A 1 18 ? 6.586   -0.171  0.997   1.00 0.00 ? 18 ASP A C    20 
ATOM   11335 O  O    . ASP A 1 18 ? 7.179   -1.171  1.399   1.00 0.00 ? 18 ASP A O    20 
ATOM   11336 C  CB   . ASP A 1 18 ? 8.560   0.981   -0.167  1.00 0.00 ? 18 ASP A CB   20 
ATOM   11337 C  CG   . ASP A 1 18 ? 9.164   1.072   1.233   1.00 0.00 ? 18 ASP A CG   20 
ATOM   11338 O  OD1  . ASP A 1 18 ? 9.519   0.018   1.803   1.00 0.00 ? 18 ASP A OD1  20 
ATOM   11339 O  OD2  . ASP A 1 18 ? 9.385   2.199   1.728   1.00 0.00 ? 18 ASP A OD2  20 
ATOM   11340 H  H    . ASP A 1 18 ? 5.353   1.581   -1.027  1.00 0.00 ? 18 ASP A H    20 
ATOM   11341 H  HA   . ASP A 1 18 ? 6.927   -0.085  -1.086  1.00 0.00 ? 18 ASP A HA   20 
ATOM   11342 H  HB2  . ASP A 1 18 ? 9.130   0.251   -0.718  1.00 0.00 ? 18 ASP A HB2  20 
ATOM   11343 H  HB3  . ASP A 1 18 ? 8.682   1.943   -0.647  1.00 0.00 ? 18 ASP A HB3  20 
ATOM   11344 N  N    . ARG A 1 19 ? 5.352   0.148   1.393   1.00 0.00 ? 19 ARG A N    20 
ATOM   11345 C  CA   . ARG A 1 19 ? 4.630   -0.637  2.384   1.00 0.00 ? 19 ARG A CA   20 
ATOM   11346 C  C    . ARG A 1 19 ? 4.415   -2.033  1.841   1.00 0.00 ? 19 ARG A C    20 
ATOM   11347 O  O    . ARG A 1 19 ? 4.531   -2.247  0.643   1.00 0.00 ? 19 ARG A O    20 
ATOM   11348 C  CB   . ARG A 1 19 ? 3.289   0.010   2.700   1.00 0.00 ? 19 ARG A CB   20 
ATOM   11349 C  CG   . ARG A 1 19 ? 3.253   0.679   4.054   1.00 0.00 ? 19 ARG A CG   20 
ATOM   11350 C  CD   . ARG A 1 19 ? 2.035   1.559   4.197   1.00 0.00 ? 19 ARG A CD   20 
ATOM   11351 N  NE   . ARG A 1 19 ? 0.801   0.779   4.239   1.00 0.00 ? 19 ARG A NE   20 
ATOM   11352 C  CZ   . ARG A 1 19 ? 0.303   0.235   5.359   1.00 0.00 ? 19 ARG A CZ   20 
ATOM   11353 N  NH1  . ARG A 1 19 ? 1.009   0.258   6.485   1.00 0.00 ? 19 ARG A NH1  20 
ATOM   11354 N  NH2  . ARG A 1 19 ? -0.882  -0.361  5.346   1.00 0.00 ? 19 ARG A NH2  20 
ATOM   11355 H  H    . ARG A 1 19 ? 4.860   0.818   0.880   1.00 0.00 ? 19 ARG A H    20 
ATOM   11356 H  HA   . ARG A 1 19 ? 5.228   -0.691  3.282   1.00 0.00 ? 19 ARG A HA   20 
ATOM   11357 H  HB2  . ARG A 1 19 ? 3.073   0.755   1.947   1.00 0.00 ? 19 ARG A HB2  20 
ATOM   11358 H  HB3  . ARG A 1 19 ? 2.520   -0.749  2.675   1.00 0.00 ? 19 ARG A HB3  20 
ATOM   11359 H  HG2  . ARG A 1 19 ? 3.229   -0.081  4.820   1.00 0.00 ? 19 ARG A HG2  20 
ATOM   11360 H  HG3  . ARG A 1 19 ? 4.137   1.282   4.169   1.00 0.00 ? 19 ARG A HG3  20 
ATOM   11361 H  HD2  . ARG A 1 19 ? 2.123   2.132   5.109   1.00 0.00 ? 19 ARG A HD2  20 
ATOM   11362 H  HD3  . ARG A 1 19 ? 1.995   2.230   3.353   1.00 0.00 ? 19 ARG A HD3  20 
ATOM   11363 H  HE   . ARG A 1 19 ? 0.297   0.686   3.390   1.00 0.00 ? 19 ARG A HE   20 
ATOM   11364 H  HH11 . ARG A 1 19 ? 1.917   0.682   6.506   1.00 0.00 ? 19 ARG A HH11 20 
ATOM   11365 H  HH12 . ARG A 1 19 ? 0.638   -0.159  7.324   1.00 0.00 ? 19 ARG A HH12 20 
ATOM   11366 H  HH21 . ARG A 1 19 ? -1.416  -0.407  4.503   1.00 0.00 ? 19 ARG A HH21 20 
ATOM   11367 H  HH22 . ARG A 1 19 ? -1.250  -0.774  6.195   1.00 0.00 ? 19 ARG A HH22 20 
ATOM   11368 N  N    . SER A 1 20 ? 4.196   -2.995  2.703   1.00 0.00 ? 20 SER A N    20 
ATOM   11369 C  CA   . SER A 1 20 ? 4.186   -4.373  2.245   1.00 0.00 ? 20 SER A CA   20 
ATOM   11370 C  C    . SER A 1 20 ? 3.018   -5.172  2.798   1.00 0.00 ? 20 SER A C    20 
ATOM   11371 O  O    . SER A 1 20 ? 2.676   -5.072  3.979   1.00 0.00 ? 20 SER A O    20 
ATOM   11372 C  CB   . SER A 1 20 ? 5.511   -5.032  2.618   1.00 0.00 ? 20 SER A CB   20 
ATOM   11373 O  OG   . SER A 1 20 ? 6.159   -4.321  3.662   1.00 0.00 ? 20 SER A OG   20 
ATOM   11374 H  H    . SER A 1 20 ? 4.112   -2.784  3.665   1.00 0.00 ? 20 SER A H    20 
ATOM   11375 H  HA   . SER A 1 20 ? 4.105   -4.355  1.168   1.00 0.00 ? 20 SER A HA   20 
ATOM   11376 H  HB2  . SER A 1 20 ? 5.329   -6.045  2.947   1.00 0.00 ? 20 SER A HB2  20 
ATOM   11377 H  HB3  . SER A 1 20 ? 6.158   -5.046  1.751   1.00 0.00 ? 20 SER A HB3  20 
ATOM   11378 H  HG   . SER A 1 20 ? 6.428   -3.451  3.338   1.00 0.00 ? 20 SER A HG   20 
ATOM   11379 N  N    . PHE A 1 21 ? 2.394   -5.951  1.921   1.00 0.00 ? 21 PHE A N    20 
ATOM   11380 C  CA   . PHE A 1 21 ? 1.239   -6.761  2.290   1.00 0.00 ? 21 PHE A CA   20 
ATOM   11381 C  C    . PHE A 1 21 ? 1.366   -8.167  1.718   1.00 0.00 ? 21 PHE A C    20 
ATOM   11382 O  O    . PHE A 1 21 ? 1.923   -8.362  0.638   1.00 0.00 ? 21 PHE A O    20 
ATOM   11383 C  CB   . PHE A 1 21 ? -0.054  -6.105  1.793   1.00 0.00 ? 21 PHE A CB   20 
ATOM   11384 C  CG   . PHE A 1 21 ? -0.060  -4.616  1.973   1.00 0.00 ? 21 PHE A CG   20 
ATOM   11385 C  CD1  . PHE A 1 21 ? 0.497   -3.789  1.011   1.00 0.00 ? 21 PHE A CD1  20 
ATOM   11386 C  CD2  . PHE A 1 21 ? -0.589  -4.048  3.117   1.00 0.00 ? 21 PHE A CD2  20 
ATOM   11387 C  CE1  . PHE A 1 21 ? 0.525   -2.423  1.188   1.00 0.00 ? 21 PHE A CE1  20 
ATOM   11388 C  CE2  . PHE A 1 21 ? -0.559  -2.685  3.300   1.00 0.00 ? 21 PHE A CE2  20 
ATOM   11389 C  CZ   . PHE A 1 21 ? -0.003  -1.872  2.332   1.00 0.00 ? 21 PHE A CZ   20 
ATOM   11390 H  H    . PHE A 1 21 ? 2.699   -5.952  0.974   1.00 0.00 ? 21 PHE A H    20 
ATOM   11391 H  HA   . PHE A 1 21 ? 1.210   -6.824  3.368   1.00 0.00 ? 21 PHE A HA   20 
ATOM   11392 H  HB2  . PHE A 1 21 ? -0.178  -6.314  0.740   1.00 0.00 ? 21 PHE A HB2  20 
ATOM   11393 H  HB3  . PHE A 1 21 ? -0.892  -6.512  2.339   1.00 0.00 ? 21 PHE A HB3  20 
ATOM   11394 H  HD1  . PHE A 1 21 ? 0.914   -4.224  0.114   1.00 0.00 ? 21 PHE A HD1  20 
ATOM   11395 H  HD2  . PHE A 1 21 ? -1.027  -4.684  3.873   1.00 0.00 ? 21 PHE A HD2  20 
ATOM   11396 H  HE1  . PHE A 1 21 ? 0.960   -1.788  0.431   1.00 0.00 ? 21 PHE A HE1  20 
ATOM   11397 H  HE2  . PHE A 1 21 ? -0.975  -2.251  4.197   1.00 0.00 ? 21 PHE A HE2  20 
ATOM   11398 H  HZ   . PHE A 1 21 ? 0.025   -0.805  2.475   1.00 0.00 ? 21 PHE A HZ   20 
ATOM   11399 N  N    . SER A 1 22 ? 0.851   -9.143  2.445   1.00 0.00 ? 22 SER A N    20 
ATOM   11400 C  CA   . SER A 1 22 ? 0.884   -10.527 2.003   1.00 0.00 ? 22 SER A CA   20 
ATOM   11401 C  C    . SER A 1 22 ? -0.327  -10.821 1.124   1.00 0.00 ? 22 SER A C    20 
ATOM   11402 O  O    . SER A 1 22 ? -0.417  -11.872 0.488   1.00 0.00 ? 22 SER A O    20 
ATOM   11403 C  CB   . SER A 1 22 ? 0.891   -11.453 3.219   1.00 0.00 ? 22 SER A CB   20 
ATOM   11404 O  OG   . SER A 1 22 ? 0.867   -10.700 4.423   1.00 0.00 ? 22 SER A OG   20 
ATOM   11405 H  H    . SER A 1 22 ? 0.413   -8.929  3.300   1.00 0.00 ? 22 SER A H    20 
ATOM   11406 H  HA   . SER A 1 22 ? 1.787   -10.676 1.429   1.00 0.00 ? 22 SER A HA   20 
ATOM   11407 H  HB2  . SER A 1 22 ? 0.021   -12.093 3.188   1.00 0.00 ? 22 SER A HB2  20 
ATOM   11408 H  HB3  . SER A 1 22 ? 1.786   -12.058 3.206   1.00 0.00 ? 22 SER A HB3  20 
ATOM   11409 H  HG   . SER A 1 22 ? 1.658   -10.914 4.948   1.00 0.00 ? 22 SER A HG   20 
ATOM   11410 N  N    . ARG A 1 23 ? -1.272  -9.891  1.134   1.00 0.00 ? 23 ARG A N    20 
ATOM   11411 C  CA   . ARG A 1 23 ? -2.497  -10.015 0.368   1.00 0.00 ? 23 ARG A CA   20 
ATOM   11412 C  C    . ARG A 1 23 ? -2.682  -8.828  -0.534  1.00 0.00 ? 23 ARG A C    20 
ATOM   11413 O  O    . ARG A 1 23 ? -2.539  -7.676  -0.119  1.00 0.00 ? 23 ARG A O    20 
ATOM   11414 C  CB   . ARG A 1 23 ? -3.694  -10.131 1.304   1.00 0.00 ? 23 ARG A CB   20 
ATOM   11415 C  CG   . ARG A 1 23 ? -3.694  -11.395 2.133   1.00 0.00 ? 23 ARG A CG   20 
ATOM   11416 C  CD   . ARG A 1 23 ? -5.092  -11.938 2.304   1.00 0.00 ? 23 ARG A CD   20 
ATOM   11417 N  NE   . ARG A 1 23 ? -5.926  -11.041 3.090   1.00 0.00 ? 23 ARG A NE   20 
ATOM   11418 C  CZ   . ARG A 1 23 ? -6.094  -11.138 4.406   1.00 0.00 ? 23 ARG A CZ   20 
ATOM   11419 N  NH1  . ARG A 1 23 ? -5.387  -12.014 5.110   1.00 0.00 ? 23 ARG A NH1  20 
ATOM   11420 N  NH2  . ARG A 1 23 ? -6.939  -10.325 5.026   1.00 0.00 ? 23 ARG A NH2  20 
ATOM   11421 H  H    . ARG A 1 23 ? -1.147  -9.097  1.692   1.00 0.00 ? 23 ARG A H    20 
ATOM   11422 H  HA   . ARG A 1 23 ? -2.437  -10.896 -0.255  1.00 0.00 ? 23 ARG A HA   20 
ATOM   11423 H  HB2  . ARG A 1 23 ? -3.693  -9.286  1.977   1.00 0.00 ? 23 ARG A HB2  20 
ATOM   11424 H  HB3  . ARG A 1 23 ? -4.599  -10.111 0.715   1.00 0.00 ? 23 ARG A HB3  20 
ATOM   11425 H  HG2  . ARG A 1 23 ? -3.094  -12.139 1.636   1.00 0.00 ? 23 ARG A HG2  20 
ATOM   11426 H  HG3  . ARG A 1 23 ? -3.278  -11.177 3.108   1.00 0.00 ? 23 ARG A HG3  20 
ATOM   11427 H  HD2  . ARG A 1 23 ? -5.533  -12.058 1.328   1.00 0.00 ? 23 ARG A HD2  20 
ATOM   11428 H  HD3  . ARG A 1 23 ? -5.039  -12.896 2.798   1.00 0.00 ? 23 ARG A HD3  20 
ATOM   11429 H  HE   . ARG A 1 23 ? -6.402  -10.321 2.597   1.00 0.00 ? 23 ARG A HE   20 
ATOM   11430 H  HH11 . ARG A 1 23 ? -4.719  -12.610 4.655   1.00 0.00 ? 23 ARG A HH11 20 
ATOM   11431 H  HH12 . ARG A 1 23 ? -5.508  -12