data_1P84
# 
_entry.id   1P84 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1P84         
RCSB  RCSB019126   
WWPDB D_1000019126 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1kb9 'Tightly bound phospholipids in stigmatellin inhibited cytochrome bc1 complex, ubiquinone at Qi site, Fv fragment' 
unspecified 
PDB 1ezv 'Stigmatellin inhibited cytochrome bc1 complex, ubiquinone at Qi site, Fv fragment'                                
unspecified 
PDB 1kyo 'cytochrome c bound to yeast cytochrome bc1 complex, Fv fragment'                                                  
unspecified 
# 
_pdbx_database_status.entry_id                        1P84 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-06 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Palsdottir, H.'  1 
'Lojero, C.G.'    2 
'Trumpower, B.L.' 3 
'Hunte, C.'       4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                31303 
_citation.page_last                 31311 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12782631 
_citation.pdbx_database_id_DOI      10.1074/jbc.M302195200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Palsdottir, H.'  1 ? 
primary 'Lojero, C.G.'    2 ? 
primary 'Trumpower, B.L.' 3 ? 
primary 'Hunte, C.'       4 ? 
# 
_cell.entry_id           1P84 
_cell.length_a           214.998 
_cell.length_b           165.091 
_cell.length_c           147.525 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.33 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1P84 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Ubiquinol-cytochrome C reductase complex core protein I'                                                   
47445.242 1   1.10.2.2 ? ? ? 
2  polymer     nat 'Ubiquinol-cytochrome C reductase complex core protein 2'                                                   
38751.918 1   1.10.2.2 ? ? ? 
3  polymer     nat 'cytochrome b'                                                                                              
43674.535 1   1.10.2.2 ? ? ? 
4  polymer     nat 'Cytochrome c1, heme protein'                                                                               
27521.020 1   1.10.2.2 ? ? ? 
5  polymer     nat 'Ubiquinol-cytochrome C reductase iron-sulfur subunit'                                                      
20122.955 1   1.10.2.2 ? ? ? 
6  polymer     nat 'Ubiquinol-cytochrome C reductase complex 17 kDa protein'                                                   
8854.792  1   1.10.2.2 ? ? ? 
7  polymer     nat 'Ubiquinol-cytochrome C reductase complex 14 kDa protein'                                                   
14355.443 1   1.10.2.2 ? ? ? 
8  polymer     nat 'Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C'                                  
10856.314 1   1.10.2.2 ? ? ? 
9  polymer     nat 'Ubiquinol-cytochrome C reductase complex 7.3 kDa protein'                                                  
6301.232  1   1.10.2.2 ? ? ? 
10 polymer     man 'Heavy Chain (Vh) Of Fv-Fragment'                                                                           
14365.817 1   ?        ? ? ? 
11 polymer     man 'Light Chain (Vl) Of Fv-Fragment'                                                                           
11926.350 1   ?        ? ? ? 
12 non-polymer syn 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE                                                                          
704.998   2   ?        ? ? ? 
13 non-polymer syn UNDECYL-MALTOSIDE                                                                                           
496.589   1   ?        ? ? ? 
14 non-polymer syn 'HEME C'                                                                                                    
618.503   3   ?        ? ? ? 
15 non-polymer syn 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE                                                              
279.355   1   ?        ? ? ? 
16 non-polymer syn '5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL' 
592.891   1   ?        ? ? ? 
17 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE                                                                 
748.065   2   ?        ? ? ? 
18 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE                                                                      
790.145   1   ?        ? ? ? 
19 non-polymer syn CARDIOLIPIN                                                                                                 
1464.043  1   ?        ? ? ? 
20 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                                                                
175.820   1   ?        ? ? ? 
21 water       nat water                                                                                                       
18.015    326 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
5 'Rieske iron-sulfur protein, RISP'                        
6 'Mitochondrial hinge protein, Complex III polypeptide VI' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIV
SSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEDNDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLE
NLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVE
GEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHF
TLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRL
WDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW
;
;AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIV
SSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEDNDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLE
NLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVE
GEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHF
TLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRL
WDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW
;
A ? 
2  'polypeptide(L)' no no 
;LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKD
DLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFA
DKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVL
ANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPI
ELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL
;
;LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKD
DLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFA
DKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVL
ANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPI
ELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL
;
B ? 
3  'polypeptide(L)' no no 
;MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRY
LHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFTLTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGND
IVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLIL
ALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKV
LSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK
;
;MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRY
LHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFTLTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGND
IVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLIL
ALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKV
LSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK
;
C ? 
4  'polypeptide(L)' no no 
;MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQ
GNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGG
SIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFV
FNPPKP
;
;MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQ
GNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGG
SIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFV
FNPPKP
;
D ? 
5  'polypeptide(L)' no no 
;KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVK
WQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGR
IRKGPAPLNLEIPAYEFDGDKVIVG
;
;KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVK
WQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGR
IRKGPAPLNLEIPAYEFDGDKVIVG
;
E ? 
6  'polypeptide(L)' no no VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK 
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK F ? 
7  'polypeptide(L)' no no 
;QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTE
LTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK
;
;QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTE
LTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK
;
G ? 
8  'polypeptide(L)' no no 
;GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLY
SKAGREELERVNV
;
;GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLY
SKAGREELERVNV
;
H ? 
9  'polypeptide(L)' no no SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA 
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA I ? 
10 'polypeptide(L)' no no 
;EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFF
LKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
;
;EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFF
LKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
;
J ? 
11 'polypeptide(L)' no no 
;DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEP
EDIATYFCQHHIKFPWTFGAGTKLEIK
;
;DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEP
EDIATYFCQHHIKFPWTFGAGTKLEIK
;
K ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   ALA n 
1  2   GLU n 
1  3   VAL n 
1  4   THR n 
1  5   GLN n 
1  6   LEU n 
1  7   SER n 
1  8   ASN n 
1  9   GLY n 
1  10  ILE n 
1  11  VAL n 
1  12  VAL n 
1  13  ALA n 
1  14  THR n 
1  15  GLU n 
1  16  HIS n 
1  17  ASN n 
1  18  PRO n 
1  19  SER n 
1  20  ALA n 
1  21  HIS n 
1  22  THR n 
1  23  ALA n 
1  24  SER n 
1  25  VAL n 
1  26  GLY n 
1  27  VAL n 
1  28  VAL n 
1  29  PHE n 
1  30  GLY n 
1  31  SER n 
1  32  GLY n 
1  33  ALA n 
1  34  ALA n 
1  35  ASN n 
1  36  GLU n 
1  37  ASN n 
1  38  PRO n 
1  39  TYR n 
1  40  ASN n 
1  41  ASN n 
1  42  GLY n 
1  43  VAL n 
1  44  SER n 
1  45  ASN n 
1  46  LEU n 
1  47  TRP n 
1  48  LYS n 
1  49  ASN n 
1  50  ILE n 
1  51  PHE n 
1  52  LEU n 
1  53  SER n 
1  54  LYS n 
1  55  GLU n 
1  56  ASN n 
1  57  SER n 
1  58  ALA n 
1  59  VAL n 
1  60  ALA n 
1  61  ALA n 
1  62  LYS n 
1  63  GLU n 
1  64  GLY n 
1  65  LEU n 
1  66  ALA n 
1  67  LEU n 
1  68  SER n 
1  69  SER n 
1  70  ASN n 
1  71  ILE n 
1  72  SER n 
1  73  ARG n 
1  74  ASP n 
1  75  PHE n 
1  76  GLN n 
1  77  SER n 
1  78  TYR n 
1  79  ILE n 
1  80  VAL n 
1  81  SER n 
1  82  SER n 
1  83  LEU n 
1  84  PRO n 
1  85  GLY n 
1  86  SER n 
1  87  THR n 
1  88  ASP n 
1  89  LYS n 
1  90  SER n 
1  91  LEU n 
1  92  ASP n 
1  93  PHE n 
1  94  LEU n 
1  95  ASN n 
1  96  GLN n 
1  97  SER n 
1  98  PHE n 
1  99  ILE n 
1  100 GLN n 
1  101 GLN n 
1  102 LYS n 
1  103 ALA n 
1  104 ASN n 
1  105 LEU n 
1  106 LEU n 
1  107 SER n 
1  108 SER n 
1  109 SER n 
1  110 ASN n 
1  111 PHE n 
1  112 GLU n 
1  113 ALA n 
1  114 THR n 
1  115 LYS n 
1  116 LYS n 
1  117 SER n 
1  118 VAL n 
1  119 LEU n 
1  120 LYS n 
1  121 GLN n 
1  122 VAL n 
1  123 GLN n 
1  124 ASP n 
1  125 PHE n 
1  126 GLU n 
1  127 ASP n 
1  128 ASN n 
1  129 ASP n 
1  130 HIS n 
1  131 PRO n 
1  132 ASN n 
1  133 ARG n 
1  134 VAL n 
1  135 LEU n 
1  136 GLU n 
1  137 HIS n 
1  138 LEU n 
1  139 HIS n 
1  140 SER n 
1  141 THR n 
1  142 ALA n 
1  143 PHE n 
1  144 GLN n 
1  145 ASN n 
1  146 THR n 
1  147 PRO n 
1  148 LEU n 
1  149 SER n 
1  150 LEU n 
1  151 PRO n 
1  152 THR n 
1  153 ARG n 
1  154 GLY n 
1  155 THR n 
1  156 LEU n 
1  157 GLU n 
1  158 SER n 
1  159 LEU n 
1  160 GLU n 
1  161 ASN n 
1  162 LEU n 
1  163 VAL n 
1  164 VAL n 
1  165 ALA n 
1  166 ASP n 
1  167 LEU n 
1  168 GLU n 
1  169 SER n 
1  170 PHE n 
1  171 ALA n 
1  172 ASN n 
1  173 ASN n 
1  174 HIS n 
1  175 PHE n 
1  176 LEU n 
1  177 ASN n 
1  178 SER n 
1  179 ASN n 
1  180 ALA n 
1  181 VAL n 
1  182 VAL n 
1  183 VAL n 
1  184 GLY n 
1  185 THR n 
1  186 GLY n 
1  187 ASN n 
1  188 ILE n 
1  189 LYS n 
1  190 HIS n 
1  191 GLU n 
1  192 ASP n 
1  193 LEU n 
1  194 VAL n 
1  195 ASN n 
1  196 SER n 
1  197 ILE n 
1  198 GLU n 
1  199 SER n 
1  200 LYS n 
1  201 ASN n 
1  202 LEU n 
1  203 SER n 
1  204 LEU n 
1  205 GLN n 
1  206 THR n 
1  207 GLY n 
1  208 THR n 
1  209 LYS n 
1  210 PRO n 
1  211 VAL n 
1  212 LEU n 
1  213 LYS n 
1  214 LYS n 
1  215 LYS n 
1  216 ALA n 
1  217 ALA n 
1  218 PHE n 
1  219 LEU n 
1  220 GLY n 
1  221 SER n 
1  222 GLU n 
1  223 VAL n 
1  224 ARG n 
1  225 LEU n 
1  226 ARG n 
1  227 ASP n 
1  228 ASP n 
1  229 THR n 
1  230 LEU n 
1  231 PRO n 
1  232 LYS n 
1  233 ALA n 
1  234 TRP n 
1  235 ILE n 
1  236 SER n 
1  237 LEU n 
1  238 ALA n 
1  239 VAL n 
1  240 GLU n 
1  241 GLY n 
1  242 GLU n 
1  243 PRO n 
1  244 VAL n 
1  245 ASN n 
1  246 SER n 
1  247 PRO n 
1  248 ASN n 
1  249 TYR n 
1  250 PHE n 
1  251 VAL n 
1  252 ALA n 
1  253 LYS n 
1  254 LEU n 
1  255 ALA n 
1  256 ALA n 
1  257 GLN n 
1  258 ILE n 
1  259 PHE n 
1  260 GLY n 
1  261 SER n 
1  262 TYR n 
1  263 ASN n 
1  264 ALA n 
1  265 PHE n 
1  266 GLU n 
1  267 PRO n 
1  268 ALA n 
1  269 SER n 
1  270 ARG n 
1  271 LEU n 
1  272 GLN n 
1  273 GLY n 
1  274 ILE n 
1  275 LYS n 
1  276 LEU n 
1  277 LEU n 
1  278 ASP n 
1  279 ASN n 
1  280 ILE n 
1  281 GLN n 
1  282 GLU n 
1  283 TYR n 
1  284 GLN n 
1  285 LEU n 
1  286 CYS n 
1  287 ASP n 
1  288 ASN n 
1  289 PHE n 
1  290 ASN n 
1  291 HIS n 
1  292 PHE n 
1  293 SER n 
1  294 LEU n 
1  295 SER n 
1  296 TYR n 
1  297 LYS n 
1  298 ASP n 
1  299 SER n 
1  300 GLY n 
1  301 LEU n 
1  302 TRP n 
1  303 GLY n 
1  304 PHE n 
1  305 SER n 
1  306 THR n 
1  307 ALA n 
1  308 THR n 
1  309 ARG n 
1  310 ASN n 
1  311 VAL n 
1  312 THR n 
1  313 MET n 
1  314 ILE n 
1  315 ASP n 
1  316 ASP n 
1  317 LEU n 
1  318 ILE n 
1  319 HIS n 
1  320 PHE n 
1  321 THR n 
1  322 LEU n 
1  323 LYS n 
1  324 GLN n 
1  325 TRP n 
1  326 ASN n 
1  327 ARG n 
1  328 LEU n 
1  329 THR n 
1  330 ILE n 
1  331 SER n 
1  332 VAL n 
1  333 THR n 
1  334 ASP n 
1  335 THR n 
1  336 GLU n 
1  337 VAL n 
1  338 GLU n 
1  339 ARG n 
1  340 ALA n 
1  341 LYS n 
1  342 SER n 
1  343 LEU n 
1  344 LEU n 
1  345 LYS n 
1  346 LEU n 
1  347 GLN n 
1  348 LEU n 
1  349 GLY n 
1  350 GLN n 
1  351 LEU n 
1  352 TYR n 
1  353 GLU n 
1  354 SER n 
1  355 GLY n 
1  356 ASN n 
1  357 PRO n 
1  358 VAL n 
1  359 ASN n 
1  360 ASP n 
1  361 ALA n 
1  362 ASN n 
1  363 LEU n 
1  364 LEU n 
1  365 GLY n 
1  366 ALA n 
1  367 GLU n 
1  368 VAL n 
1  369 LEU n 
1  370 ILE n 
1  371 LYS n 
1  372 GLY n 
1  373 SER n 
1  374 LYS n 
1  375 LEU n 
1  376 SER n 
1  377 LEU n 
1  378 GLY n 
1  379 GLU n 
1  380 ALA n 
1  381 PHE n 
1  382 LYS n 
1  383 LYS n 
1  384 ILE n 
1  385 ASP n 
1  386 ALA n 
1  387 ILE n 
1  388 THR n 
1  389 VAL n 
1  390 LYS n 
1  391 ASP n 
1  392 VAL n 
1  393 LYS n 
1  394 ALA n 
1  395 TRP n 
1  396 ALA n 
1  397 GLY n 
1  398 LYS n 
1  399 ARG n 
1  400 LEU n 
1  401 TRP n 
1  402 ASP n 
1  403 GLN n 
1  404 ASP n 
1  405 ILE n 
1  406 ALA n 
1  407 ILE n 
1  408 ALA n 
1  409 GLY n 
1  410 THR n 
1  411 GLY n 
1  412 GLN n 
1  413 ILE n 
1  414 GLU n 
1  415 GLY n 
1  416 LEU n 
1  417 LEU n 
1  418 ASP n 
1  419 TYR n 
1  420 MET n 
1  421 ARG n 
1  422 ILE n 
1  423 ARG n 
1  424 SER n 
1  425 ASP n 
1  426 MET n 
1  427 SER n 
1  428 MET n 
1  429 MET n 
1  430 ARG n 
1  431 TRP n 
2  1   LEU n 
2  2   THR n 
2  3   VAL n 
2  4   SER n 
2  5   ALA n 
2  6   ARG n 
2  7   ASP n 
2  8   ALA n 
2  9   PRO n 
2  10  THR n 
2  11  LYS n 
2  12  ILE n 
2  13  SER n 
2  14  THR n 
2  15  LEU n 
2  16  ALA n 
2  17  VAL n 
2  18  LYS n 
2  19  VAL n 
2  20  HIS n 
2  21  GLY n 
2  22  GLY n 
2  23  SER n 
2  24  ARG n 
2  25  TYR n 
2  26  ALA n 
2  27  THR n 
2  28  LYS n 
2  29  ASP n 
2  30  GLY n 
2  31  VAL n 
2  32  ALA n 
2  33  HIS n 
2  34  LEU n 
2  35  LEU n 
2  36  ASN n 
2  37  ARG n 
2  38  PHE n 
2  39  ASN n 
2  40  PHE n 
2  41  GLN n 
2  42  ASN n 
2  43  THR n 
2  44  ASN n 
2  45  THR n 
2  46  ARG n 
2  47  SER n 
2  48  ALA n 
2  49  LEU n 
2  50  LYS n 
2  51  LEU n 
2  52  VAL n 
2  53  ARG n 
2  54  GLU n 
2  55  SER n 
2  56  GLU n 
2  57  LEU n 
2  58  LEU n 
2  59  GLY n 
2  60  GLY n 
2  61  THR n 
2  62  PHE n 
2  63  LYS n 
2  64  SER n 
2  65  THR n 
2  66  LEU n 
2  67  ASP n 
2  68  ARG n 
2  69  GLU n 
2  70  TYR n 
2  71  ILE n 
2  72  THR n 
2  73  LEU n 
2  74  LYS n 
2  75  ALA n 
2  76  THR n 
2  77  PHE n 
2  78  LEU n 
2  79  LYS n 
2  80  ASP n 
2  81  ASP n 
2  82  LEU n 
2  83  PRO n 
2  84  TYR n 
2  85  TYR n 
2  86  VAL n 
2  87  ASN n 
2  88  ALA n 
2  89  LEU n 
2  90  ALA n 
2  91  ASP n 
2  92  VAL n 
2  93  LEU n 
2  94  TYR n 
2  95  LYS n 
2  96  THR n 
2  97  ALA n 
2  98  PHE n 
2  99  LYS n 
2  100 PRO n 
2  101 HIS n 
2  102 GLU n 
2  103 LEU n 
2  104 THR n 
2  105 GLU n 
2  106 SER n 
2  107 VAL n 
2  108 LEU n 
2  109 PRO n 
2  110 ALA n 
2  111 ALA n 
2  112 ARG n 
2  113 TYR n 
2  114 ASP n 
2  115 TYR n 
2  116 ALA n 
2  117 VAL n 
2  118 ALA n 
2  119 GLU n 
2  120 GLN n 
2  121 CYS n 
2  122 PRO n 
2  123 VAL n 
2  124 LYS n 
2  125 SER n 
2  126 ALA n 
2  127 GLU n 
2  128 ASP n 
2  129 GLN n 
2  130 LEU n 
2  131 TYR n 
2  132 ALA n 
2  133 ILE n 
2  134 THR n 
2  135 PHE n 
2  136 ARG n 
2  137 LYS n 
2  138 GLY n 
2  139 LEU n 
2  140 GLY n 
2  141 ASN n 
2  142 PRO n 
2  143 LEU n 
2  144 LEU n 
2  145 TYR n 
2  146 ASP n 
2  147 GLY n 
2  148 VAL n 
2  149 GLU n 
2  150 ARG n 
2  151 VAL n 
2  152 SER n 
2  153 LEU n 
2  154 GLN n 
2  155 ASP n 
2  156 ILE n 
2  157 LYS n 
2  158 ASP n 
2  159 PHE n 
2  160 ALA n 
2  161 ASP n 
2  162 LYS n 
2  163 VAL n 
2  164 TYR n 
2  165 THR n 
2  166 LYS n 
2  167 GLU n 
2  168 ASN n 
2  169 LEU n 
2  170 GLU n 
2  171 VAL n 
2  172 SER n 
2  173 GLY n 
2  174 GLU n 
2  175 ASN n 
2  176 VAL n 
2  177 VAL n 
2  178 GLU n 
2  179 ALA n 
2  180 ASP n 
2  181 LEU n 
2  182 LYS n 
2  183 ARG n 
2  184 PHE n 
2  185 VAL n 
2  186 ASP n 
2  187 GLU n 
2  188 SER n 
2  189 LEU n 
2  190 LEU n 
2  191 SER n 
2  192 THR n 
2  193 LEU n 
2  194 PRO n 
2  195 ALA n 
2  196 GLY n 
2  197 LYS n 
2  198 SER n 
2  199 LEU n 
2  200 VAL n 
2  201 SER n 
2  202 LYS n 
2  203 SER n 
2  204 GLU n 
2  205 PRO n 
2  206 LYS n 
2  207 PHE n 
2  208 PHE n 
2  209 LEU n 
2  210 GLY n 
2  211 GLU n 
2  212 GLU n 
2  213 ASN n 
2  214 ARG n 
2  215 VAL n 
2  216 ARG n 
2  217 PHE n 
2  218 ILE n 
2  219 GLY n 
2  220 ASP n 
2  221 SER n 
2  222 VAL n 
2  223 ALA n 
2  224 ALA n 
2  225 ILE n 
2  226 GLY n 
2  227 ILE n 
2  228 PRO n 
2  229 VAL n 
2  230 ASN n 
2  231 LYS n 
2  232 ALA n 
2  233 SER n 
2  234 LEU n 
2  235 ALA n 
2  236 GLN n 
2  237 TYR n 
2  238 GLU n 
2  239 VAL n 
2  240 LEU n 
2  241 ALA n 
2  242 ASN n 
2  243 TYR n 
2  244 LEU n 
2  245 THR n 
2  246 SER n 
2  247 ALA n 
2  248 LEU n 
2  249 SER n 
2  250 GLU n 
2  251 LEU n 
2  252 SER n 
2  253 GLY n 
2  254 LEU n 
2  255 ILE n 
2  256 SER n 
2  257 SER n 
2  258 ALA n 
2  259 LYS n 
2  260 LEU n 
2  261 ASP n 
2  262 LYS n 
2  263 PHE n 
2  264 THR n 
2  265 ASP n 
2  266 GLY n 
2  267 GLY n 
2  268 LEU n 
2  269 PHE n 
2  270 THR n 
2  271 LEU n 
2  272 PHE n 
2  273 VAL n 
2  274 ARG n 
2  275 ASP n 
2  276 GLN n 
2  277 ASP n 
2  278 SER n 
2  279 ALA n 
2  280 VAL n 
2  281 VAL n 
2  282 SER n 
2  283 SER n 
2  284 ASN n 
2  285 ILE n 
2  286 LYS n 
2  287 LYS n 
2  288 ILE n 
2  289 VAL n 
2  290 ALA n 
2  291 ASP n 
2  292 LEU n 
2  293 LYS n 
2  294 LYS n 
2  295 GLY n 
2  296 LYS n 
2  297 ASP n 
2  298 LEU n 
2  299 SER n 
2  300 PRO n 
2  301 ALA n 
2  302 ILE n 
2  303 ASN n 
2  304 TYR n 
2  305 THR n 
2  306 LYS n 
2  307 LEU n 
2  308 LYS n 
2  309 ASN n 
2  310 ALA n 
2  311 VAL n 
2  312 GLN n 
2  313 ASN n 
2  314 GLU n 
2  315 SER n 
2  316 VAL n 
2  317 SER n 
2  318 SER n 
2  319 PRO n 
2  320 ILE n 
2  321 GLU n 
2  322 LEU n 
2  323 ASN n 
2  324 PHE n 
2  325 ASP n 
2  326 ALA n 
2  327 VAL n 
2  328 LYS n 
2  329 ASP n 
2  330 PHE n 
2  331 LYS n 
2  332 LEU n 
2  333 GLY n 
2  334 LYS n 
2  335 PHE n 
2  336 ASN n 
2  337 TYR n 
2  338 VAL n 
2  339 ALA n 
2  340 VAL n 
2  341 GLY n 
2  342 ASP n 
2  343 VAL n 
2  344 SER n 
2  345 ASN n 
2  346 LEU n 
2  347 PRO n 
2  348 TYR n 
2  349 LEU n 
2  350 ASP n 
2  351 GLU n 
2  352 LEU n 
3  1   MET n 
3  2   ALA n 
3  3   PHE n 
3  4   ARG n 
3  5   LYS n 
3  6   SER n 
3  7   ASN n 
3  8   VAL n 
3  9   TYR n 
3  10  LEU n 
3  11  SER n 
3  12  LEU n 
3  13  VAL n 
3  14  ASN n 
3  15  SER n 
3  16  TYR n 
3  17  ILE n 
3  18  ILE n 
3  19  ASP n 
3  20  SER n 
3  21  PRO n 
3  22  GLN n 
3  23  PRO n 
3  24  SER n 
3  25  SER n 
3  26  ILE n 
3  27  ASN n 
3  28  TYR n 
3  29  TRP n 
3  30  TRP n 
3  31  ASN n 
3  32  MET n 
3  33  GLY n 
3  34  SER n 
3  35  LEU n 
3  36  LEU n 
3  37  GLY n 
3  38  LEU n 
3  39  CYS n 
3  40  LEU n 
3  41  VAL n 
3  42  ILE n 
3  43  GLN n 
3  44  ILE n 
3  45  VAL n 
3  46  THR n 
3  47  GLY n 
3  48  ILE n 
3  49  PHE n 
3  50  MET n 
3  51  ALA n 
3  52  MET n 
3  53  HIS n 
3  54  TYR n 
3  55  SER n 
3  56  SER n 
3  57  ASN n 
3  58  ILE n 
3  59  GLU n 
3  60  LEU n 
3  61  ALA n 
3  62  PHE n 
3  63  SER n 
3  64  SER n 
3  65  VAL n 
3  66  GLU n 
3  67  HIS n 
3  68  ILE n 
3  69  MET n 
3  70  ARG n 
3  71  ASP n 
3  72  VAL n 
3  73  HIS n 
3  74  ASN n 
3  75  GLY n 
3  76  TYR n 
3  77  ILE n 
3  78  LEU n 
3  79  ARG n 
3  80  TYR n 
3  81  LEU n 
3  82  HIS n 
3  83  ALA n 
3  84  ASN n 
3  85  GLY n 
3  86  ALA n 
3  87  SER n 
3  88  PHE n 
3  89  PHE n 
3  90  PHE n 
3  91  MET n 
3  92  VAL n 
3  93  MET n 
3  94  PHE n 
3  95  MET n 
3  96  HIS n 
3  97  MET n 
3  98  ALA n 
3  99  LYS n 
3  100 GLY n 
3  101 LEU n 
3  102 TYR n 
3  103 TYR n 
3  104 GLY n 
3  105 SER n 
3  106 TYR n 
3  107 ARG n 
3  108 SER n 
3  109 PRO n 
3  110 ARG n 
3  111 VAL n 
3  112 THR n 
3  113 LEU n 
3  114 TRP n 
3  115 ASN n 
3  116 VAL n 
3  117 GLY n 
3  118 VAL n 
3  119 ILE n 
3  120 ILE n 
3  121 PHE n 
3  122 THR n 
3  123 LEU n 
3  124 THR n 
3  125 ILE n 
3  126 ALA n 
3  127 THR n 
3  128 ALA n 
3  129 PHE n 
3  130 LEU n 
3  131 GLY n 
3  132 TYR n 
3  133 CYS n 
3  134 CYS n 
3  135 VAL n 
3  136 TYR n 
3  137 GLY n 
3  138 GLN n 
3  139 MET n 
3  140 SER n 
3  141 HIS n 
3  142 TRP n 
3  143 GLY n 
3  144 ALA n 
3  145 THR n 
3  146 VAL n 
3  147 ILE n 
3  148 THR n 
3  149 ASN n 
3  150 LEU n 
3  151 PHE n 
3  152 SER n 
3  153 ALA n 
3  154 ILE n 
3  155 PRO n 
3  156 PHE n 
3  157 VAL n 
3  158 GLY n 
3  159 ASN n 
3  160 ASP n 
3  161 ILE n 
3  162 VAL n 
3  163 SER n 
3  164 TRP n 
3  165 LEU n 
3  166 TRP n 
3  167 GLY n 
3  168 GLY n 
3  169 PHE n 
3  170 SER n 
3  171 VAL n 
3  172 SER n 
3  173 ASN n 
3  174 PRO n 
3  175 THR n 
3  176 ILE n 
3  177 GLN n 
3  178 ARG n 
3  179 PHE n 
3  180 PHE n 
3  181 ALA n 
3  182 LEU n 
3  183 HIS n 
3  184 TYR n 
3  185 LEU n 
3  186 VAL n 
3  187 PRO n 
3  188 PHE n 
3  189 ILE n 
3  190 ILE n 
3  191 ALA n 
3  192 ALA n 
3  193 MET n 
3  194 VAL n 
3  195 ILE n 
3  196 MET n 
3  197 HIS n 
3  198 LEU n 
3  199 MET n 
3  200 ALA n 
3  201 LEU n 
3  202 HIS n 
3  203 ILE n 
3  204 HIS n 
3  205 GLY n 
3  206 SER n 
3  207 SER n 
3  208 ASN n 
3  209 PRO n 
3  210 LEU n 
3  211 GLY n 
3  212 ILE n 
3  213 THR n 
3  214 GLY n 
3  215 ASN n 
3  216 LEU n 
3  217 ASP n 
3  218 ARG n 
3  219 ILE n 
3  220 PRO n 
3  221 MET n 
3  222 HIS n 
3  223 SER n 
3  224 TYR n 
3  225 PHE n 
3  226 ILE n 
3  227 PHE n 
3  228 LYS n 
3  229 ASP n 
3  230 LEU n 
3  231 VAL n 
3  232 THR n 
3  233 VAL n 
3  234 PHE n 
3  235 LEU n 
3  236 PHE n 
3  237 MET n 
3  238 LEU n 
3  239 ILE n 
3  240 LEU n 
3  241 ALA n 
3  242 LEU n 
3  243 PHE n 
3  244 VAL n 
3  245 PHE n 
3  246 TYR n 
3  247 SER n 
3  248 PRO n 
3  249 ASN n 
3  250 THR n 
3  251 LEU n 
3  252 GLY n 
3  253 HIS n 
3  254 PRO n 
3  255 ASP n 
3  256 ASN n 
3  257 TYR n 
3  258 ILE n 
3  259 PRO n 
3  260 GLY n 
3  261 ASN n 
3  262 PRO n 
3  263 LEU n 
3  264 VAL n 
3  265 THR n 
3  266 PRO n 
3  267 ALA n 
3  268 SER n 
3  269 ILE n 
3  270 VAL n 
3  271 PRO n 
3  272 GLU n 
3  273 TRP n 
3  274 TYR n 
3  275 LEU n 
3  276 LEU n 
3  277 PRO n 
3  278 PHE n 
3  279 TYR n 
3  280 ALA n 
3  281 ILE n 
3  282 LEU n 
3  283 ARG n 
3  284 SER n 
3  285 ILE n 
3  286 PRO n 
3  287 ASP n 
3  288 LYS n 
3  289 LEU n 
3  290 LEU n 
3  291 GLY n 
3  292 VAL n 
3  293 ILE n 
3  294 THR n 
3  295 MET n 
3  296 PHE n 
3  297 ALA n 
3  298 ALA n 
3  299 ILE n 
3  300 LEU n 
3  301 VAL n 
3  302 LEU n 
3  303 LEU n 
3  304 VAL n 
3  305 LEU n 
3  306 PRO n 
3  307 PHE n 
3  308 THR n 
3  309 ASP n 
3  310 ARG n 
3  311 SER n 
3  312 VAL n 
3  313 VAL n 
3  314 ARG n 
3  315 GLY n 
3  316 ASN n 
3  317 THR n 
3  318 PHE n 
3  319 LYS n 
3  320 VAL n 
3  321 LEU n 
3  322 SER n 
3  323 LYS n 
3  324 PHE n 
3  325 PHE n 
3  326 PHE n 
3  327 PHE n 
3  328 ILE n 
3  329 PHE n 
3  330 VAL n 
3  331 PHE n 
3  332 ASN n 
3  333 PHE n 
3  334 VAL n 
3  335 LEU n 
3  336 LEU n 
3  337 GLY n 
3  338 GLN n 
3  339 ILE n 
3  340 GLY n 
3  341 ALA n 
3  342 CYS n 
3  343 HIS n 
3  344 VAL n 
3  345 GLU n 
3  346 VAL n 
3  347 PRO n 
3  348 TYR n 
3  349 VAL n 
3  350 LEU n 
3  351 MET n 
3  352 GLY n 
3  353 GLN n 
3  354 ILE n 
3  355 ALA n 
3  356 THR n 
3  357 PHE n 
3  358 ILE n 
3  359 TYR n 
3  360 PHE n 
3  361 ALA n 
3  362 TYR n 
3  363 PHE n 
3  364 LEU n 
3  365 ILE n 
3  366 ILE n 
3  367 VAL n 
3  368 PRO n 
3  369 VAL n 
3  370 ILE n 
3  371 SER n 
3  372 THR n 
3  373 ILE n 
3  374 GLU n 
3  375 ASN n 
3  376 VAL n 
3  377 LEU n 
3  378 PHE n 
3  379 TYR n 
3  380 ILE n 
3  381 GLY n 
3  382 ARG n 
3  383 VAL n 
3  384 ASN n 
3  385 LYS n 
4  1   MET n 
4  2   THR n 
4  3   ALA n 
4  4   ALA n 
4  5   GLU n 
4  6   HIS n 
4  7   GLY n 
4  8   LEU n 
4  9   HIS n 
4  10  ALA n 
4  11  PRO n 
4  12  ALA n 
4  13  TYR n 
4  14  ALA n 
4  15  TRP n 
4  16  SER n 
4  17  HIS n 
4  18  ASN n 
4  19  GLY n 
4  20  PRO n 
4  21  PHE n 
4  22  GLU n 
4  23  THR n 
4  24  PHE n 
4  25  ASP n 
4  26  HIS n 
4  27  ALA n 
4  28  SER n 
4  29  ILE n 
4  30  ARG n 
4  31  ARG n 
4  32  GLY n 
4  33  TYR n 
4  34  GLN n 
4  35  VAL n 
4  36  TYR n 
4  37  ARG n 
4  38  GLU n 
4  39  VAL n 
4  40  CYS n 
4  41  ALA n 
4  42  ALA n 
4  43  CYS n 
4  44  HIS n 
4  45  SER n 
4  46  LEU n 
4  47  ASP n 
4  48  ARG n 
4  49  VAL n 
4  50  ALA n 
4  51  TRP n 
4  52  ARG n 
4  53  THR n 
4  54  LEU n 
4  55  VAL n 
4  56  GLY n 
4  57  VAL n 
4  58  SER n 
4  59  HIS n 
4  60  THR n 
4  61  ASN n 
4  62  GLU n 
4  63  GLU n 
4  64  VAL n 
4  65  ARG n 
4  66  ASN n 
4  67  MET n 
4  68  ALA n 
4  69  GLU n 
4  70  GLU n 
4  71  PHE n 
4  72  GLU n 
4  73  TYR n 
4  74  ASP n 
4  75  ASP n 
4  76  GLU n 
4  77  PRO n 
4  78  ASP n 
4  79  GLU n 
4  80  GLN n 
4  81  GLY n 
4  82  ASN n 
4  83  PRO n 
4  84  LYS n 
4  85  LYS n 
4  86  ARG n 
4  87  PRO n 
4  88  GLY n 
4  89  LYS n 
4  90  LEU n 
4  91  SER n 
4  92  ASP n 
4  93  TYR n 
4  94  ILE n 
4  95  PRO n 
4  96  GLY n 
4  97  PRO n 
4  98  TYR n 
4  99  PRO n 
4  100 ASN n 
4  101 GLU n 
4  102 GLN n 
4  103 ALA n 
4  104 ALA n 
4  105 ARG n 
4  106 ALA n 
4  107 ALA n 
4  108 ASN n 
4  109 GLN n 
4  110 GLY n 
4  111 ALA n 
4  112 LEU n 
4  113 PRO n 
4  114 PRO n 
4  115 ASP n 
4  116 LEU n 
4  117 SER n 
4  118 LEU n 
4  119 ILE n 
4  120 VAL n 
4  121 LYS n 
4  122 ALA n 
4  123 ARG n 
4  124 HIS n 
4  125 GLY n 
4  126 GLY n 
4  127 CYS n 
4  128 ASP n 
4  129 TYR n 
4  130 ILE n 
4  131 PHE n 
4  132 SER n 
4  133 LEU n 
4  134 LEU n 
4  135 THR n 
4  136 GLY n 
4  137 TYR n 
4  138 PRO n 
4  139 ASP n 
4  140 GLU n 
4  141 PRO n 
4  142 PRO n 
4  143 ALA n 
4  144 GLY n 
4  145 VAL n 
4  146 ALA n 
4  147 LEU n 
4  148 PRO n 
4  149 PRO n 
4  150 GLY n 
4  151 SER n 
4  152 ASN n 
4  153 TYR n 
4  154 ASN n 
4  155 PRO n 
4  156 TYR n 
4  157 PHE n 
4  158 PRO n 
4  159 GLY n 
4  160 GLY n 
4  161 SER n 
4  162 ILE n 
4  163 ALA n 
4  164 MET n 
4  165 ALA n 
4  166 ARG n 
4  167 VAL n 
4  168 LEU n 
4  169 PHE n 
4  170 ASP n 
4  171 ASP n 
4  172 MET n 
4  173 VAL n 
4  174 GLU n 
4  175 TYR n 
4  176 GLU n 
4  177 ASP n 
4  178 GLY n 
4  179 THR n 
4  180 PRO n 
4  181 ALA n 
4  182 THR n 
4  183 THR n 
4  184 SER n 
4  185 GLN n 
4  186 MET n 
4  187 ALA n 
4  188 LYS n 
4  189 ASP n 
4  190 VAL n 
4  191 THR n 
4  192 THR n 
4  193 PHE n 
4  194 LEU n 
4  195 ASN n 
4  196 TRP n 
4  197 CYS n 
4  198 ALA n 
4  199 GLU n 
4  200 PRO n 
4  201 GLU n 
4  202 HIS n 
4  203 ASP n 
4  204 GLU n 
4  205 ARG n 
4  206 LYS n 
4  207 ARG n 
4  208 LEU n 
4  209 GLY n 
4  210 LEU n 
4  211 LYS n 
4  212 THR n 
4  213 VAL n 
4  214 ILE n 
4  215 ILE n 
4  216 LEU n 
4  217 SER n 
4  218 SER n 
4  219 LEU n 
4  220 TYR n 
4  221 LEU n 
4  222 LEU n 
4  223 SER n 
4  224 ILE n 
4  225 TRP n 
4  226 VAL n 
4  227 LYS n 
4  228 LYS n 
4  229 PHE n 
4  230 LYS n 
4  231 TRP n 
4  232 ALA n 
4  233 GLY n 
4  234 ILE n 
4  235 LYS n 
4  236 THR n 
4  237 ARG n 
4  238 LYS n 
4  239 PHE n 
4  240 VAL n 
4  241 PHE n 
4  242 ASN n 
4  243 PRO n 
4  244 PRO n 
4  245 LYS n 
4  246 PRO n 
5  1   LYS n 
5  2   SER n 
5  3   THR n 
5  4   TYR n 
5  5   ARG n 
5  6   THR n 
5  7   PRO n 
5  8   ASN n 
5  9   PHE n 
5  10  ASP n 
5  11  ASP n 
5  12  VAL n 
5  13  LEU n 
5  14  LYS n 
5  15  GLU n 
5  16  ASN n 
5  17  ASN n 
5  18  ASP n 
5  19  ALA n 
5  20  ASP n 
5  21  LYS n 
5  22  GLY n 
5  23  ARG n 
5  24  SER n 
5  25  TYR n 
5  26  ALA n 
5  27  TYR n 
5  28  PHE n 
5  29  MET n 
5  30  VAL n 
5  31  GLY n 
5  32  ALA n 
5  33  MET n 
5  34  GLY n 
5  35  LEU n 
5  36  LEU n 
5  37  SER n 
5  38  SER n 
5  39  ALA n 
5  40  GLY n 
5  41  ALA n 
5  42  LYS n 
5  43  SER n 
5  44  THR n 
5  45  VAL n 
5  46  GLU n 
5  47  THR n 
5  48  PHE n 
5  49  ILE n 
5  50  SER n 
5  51  SER n 
5  52  MET n 
5  53  THR n 
5  54  ALA n 
5  55  THR n 
5  56  ALA n 
5  57  ASP n 
5  58  VAL n 
5  59  LEU n 
5  60  ALA n 
5  61  MET n 
5  62  ALA n 
5  63  LYS n 
5  64  VAL n 
5  65  GLU n 
5  66  VAL n 
5  67  ASN n 
5  68  LEU n 
5  69  ALA n 
5  70  ALA n 
5  71  ILE n 
5  72  PRO n 
5  73  LEU n 
5  74  GLY n 
5  75  LYS n 
5  76  ASN n 
5  77  VAL n 
5  78  VAL n 
5  79  VAL n 
5  80  LYS n 
5  81  TRP n 
5  82  GLN n 
5  83  GLY n 
5  84  LYS n 
5  85  PRO n 
5  86  VAL n 
5  87  PHE n 
5  88  ILE n 
5  89  ARG n 
5  90  HIS n 
5  91  ARG n 
5  92  THR n 
5  93  PRO n 
5  94  HIS n 
5  95  GLU n 
5  96  ILE n 
5  97  GLN n 
5  98  GLU n 
5  99  ALA n 
5  100 ASN n 
5  101 SER n 
5  102 VAL n 
5  103 ASP n 
5  104 MET n 
5  105 SER n 
5  106 ALA n 
5  107 LEU n 
5  108 LYS n 
5  109 ASP n 
5  110 PRO n 
5  111 GLN n 
5  112 THR n 
5  113 ASP n 
5  114 ALA n 
5  115 ASP n 
5  116 ARG n 
5  117 VAL n 
5  118 LYS n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 TRP n 
5  123 LEU n 
5  124 ILE n 
5  125 MET n 
5  126 LEU n 
5  127 GLY n 
5  128 ILE n 
5  129 CYS n 
5  130 THR n 
5  131 HIS n 
5  132 LEU n 
5  133 GLY n 
5  134 CYS n 
5  135 VAL n 
5  136 PRO n 
5  137 ILE n 
5  138 GLY n 
5  139 GLU n 
5  140 ALA n 
5  141 GLY n 
5  142 ASP n 
5  143 PHE n 
5  144 GLY n 
5  145 GLY n 
5  146 TRP n 
5  147 PHE n 
5  148 CYS n 
5  149 PRO n 
5  150 CYS n 
5  151 HIS n 
5  152 GLY n 
5  153 SER n 
5  154 HIS n 
5  155 TYR n 
5  156 ASP n 
5  157 ILE n 
5  158 SER n 
5  159 GLY n 
5  160 ARG n 
5  161 ILE n 
5  162 ARG n 
5  163 LYS n 
5  164 GLY n 
5  165 PRO n 
5  166 ALA n 
5  167 PRO n 
5  168 LEU n 
5  169 ASN n 
5  170 LEU n 
5  171 GLU n 
5  172 ILE n 
5  173 PRO n 
5  174 ALA n 
5  175 TYR n 
5  176 GLU n 
5  177 PHE n 
5  178 ASP n 
5  179 GLY n 
5  180 ASP n 
5  181 LYS n 
5  182 VAL n 
5  183 ILE n 
5  184 VAL n 
5  185 GLY n 
6  1   VAL n 
6  2   THR n 
6  3   ASP n 
6  4   GLN n 
6  5   LEU n 
6  6   GLU n 
6  7   ASP n 
6  8   LEU n 
6  9   ARG n 
6  10  GLU n 
6  11  HIS n 
6  12  PHE n 
6  13  LYS n 
6  14  ASN n 
6  15  THR n 
6  16  GLU n 
6  17  GLU n 
6  18  GLY n 
6  19  LYS n 
6  20  ALA n 
6  21  LEU n 
6  22  VAL n 
6  23  HIS n 
6  24  HIS n 
6  25  TYR n 
6  26  GLU n 
6  27  GLU n 
6  28  CYS n 
6  29  ALA n 
6  30  GLU n 
6  31  ARG n 
6  32  VAL n 
6  33  LYS n 
6  34  ILE n 
6  35  GLN n 
6  36  GLN n 
6  37  GLN n 
6  38  GLN n 
6  39  PRO n 
6  40  GLY n 
6  41  TYR n 
6  42  ALA n 
6  43  ASP n 
6  44  LEU n 
6  45  GLU n 
6  46  HIS n 
6  47  LYS n 
6  48  GLU n 
6  49  ASP n 
6  50  CYS n 
6  51  VAL n 
6  52  GLU n 
6  53  GLU n 
6  54  PHE n 
6  55  PHE n 
6  56  HIS n 
6  57  LEU n 
6  58  GLN n 
6  59  HIS n 
6  60  TYR n 
6  61  LEU n 
6  62  ASP n 
6  63  THR n 
6  64  ALA n 
6  65  THR n 
6  66  ALA n 
6  67  PRO n 
6  68  ARG n 
6  69  LEU n 
6  70  PHE n 
6  71  ASP n 
6  72  LYS n 
6  73  LEU n 
6  74  LYS n 
7  1   GLN n 
7  2   SER n 
7  3   PHE n 
7  4   THR n 
7  5   SER n 
7  6   ILE n 
7  7   ALA n 
7  8   ARG n 
7  9   ILE n 
7  10  GLY n 
7  11  ASP n 
7  12  TYR n 
7  13  ILE n 
7  14  LEU n 
7  15  LYS n 
7  16  SER n 
7  17  PRO n 
7  18  VAL n 
7  19  LEU n 
7  20  SER n 
7  21  LYS n 
7  22  LEU n 
7  23  CYS n 
7  24  VAL n 
7  25  PRO n 
7  26  VAL n 
7  27  ALA n 
7  28  ASN n 
7  29  GLN n 
7  30  PHE n 
7  31  ILE n 
7  32  ASN n 
7  33  LEU n 
7  34  ALA n 
7  35  GLY n 
7  36  TYR n 
7  37  LYS n 
7  38  LYS n 
7  39  LEU n 
7  40  GLY n 
7  41  LEU n 
7  42  LYS n 
7  43  PHE n 
7  44  ASP n 
7  45  ASP n 
7  46  LEU n 
7  47  ILE n 
7  48  ALA n 
7  49  GLU n 
7  50  GLU n 
7  51  ASN n 
7  52  PRO n 
7  53  ILE n 
7  54  MET n 
7  55  GLN n 
7  56  THR n 
7  57  ALA n 
7  58  LEU n 
7  59  ARG n 
7  60  ARG n 
7  61  LEU n 
7  62  PRO n 
7  63  GLU n 
7  64  ASP n 
7  65  GLU n 
7  66  SER n 
7  67  TYR n 
7  68  ALA n 
7  69  ARG n 
7  70  ALA n 
7  71  TYR n 
7  72  ARG n 
7  73  ILE n 
7  74  ILE n 
7  75  ARG n 
7  76  ALA n 
7  77  HIS n 
7  78  GLN n 
7  79  THR n 
7  80  GLU n 
7  81  LEU n 
7  82  THR n 
7  83  HIS n 
7  84  HIS n 
7  85  LEU n 
7  86  LEU n 
7  87  PRO n 
7  88  ARG n 
7  89  ASN n 
7  90  GLU n 
7  91  TRP n 
7  92  ILE n 
7  93  LYS n 
7  94  ALA n 
7  95  GLN n 
7  96  GLU n 
7  97  ASP n 
7  98  VAL n 
7  99  PRO n 
7  100 TYR n 
7  101 LEU n 
7  102 LEU n 
7  103 PRO n 
7  104 TYR n 
7  105 ILE n 
7  106 LEU n 
7  107 GLU n 
7  108 ALA n 
7  109 GLU n 
7  110 ALA n 
7  111 ALA n 
7  112 ALA n 
7  113 LYS n 
7  114 GLU n 
7  115 LYS n 
7  116 ASP n 
7  117 GLU n 
7  118 LEU n 
7  119 ASP n 
7  120 ASN n 
7  121 ILE n 
7  122 GLU n 
7  123 VAL n 
7  124 SER n 
7  125 LYS n 
8  1   GLY n 
8  2   PRO n 
8  3   PRO n 
8  4   SER n 
8  5   GLY n 
8  6   LYS n 
8  7   THR n 
8  8   TYR n 
8  9   MET n 
8  10  GLY n 
8  11  TRP n 
8  12  TRP n 
8  13  GLY n 
8  14  HIS n 
8  15  MET n 
8  16  GLY n 
8  17  GLY n 
8  18  PRO n 
8  19  LYS n 
8  20  GLN n 
8  21  LYS n 
8  22  GLY n 
8  23  ILE n 
8  24  THR n 
8  25  SER n 
8  26  TYR n 
8  27  ALA n 
8  28  VAL n 
8  29  SER n 
8  30  PRO n 
8  31  TYR n 
8  32  ALA n 
8  33  GLN n 
8  34  LYS n 
8  35  PRO n 
8  36  LEU n 
8  37  GLN n 
8  38  GLY n 
8  39  ILE n 
8  40  PHE n 
8  41  HIS n 
8  42  ASN n 
8  43  ALA n 
8  44  VAL n 
8  45  PHE n 
8  46  ASN n 
8  47  SER n 
8  48  PHE n 
8  49  ARG n 
8  50  ARG n 
8  51  PHE n 
8  52  LYS n 
8  53  SER n 
8  54  GLN n 
8  55  PHE n 
8  56  LEU n 
8  57  TYR n 
8  58  VAL n 
8  59  LEU n 
8  60  ILE n 
8  61  PRO n 
8  62  ALA n 
8  63  GLY n 
8  64  ILE n 
8  65  TYR n 
8  66  TRP n 
8  67  TYR n 
8  68  TRP n 
8  69  TRP n 
8  70  LYS n 
8  71  ASN n 
8  72  GLY n 
8  73  ASN n 
8  74  GLU n 
8  75  TYR n 
8  76  ASN n 
8  77  GLU n 
8  78  PHE n 
8  79  LEU n 
8  80  TYR n 
8  81  SER n 
8  82  LYS n 
8  83  ALA n 
8  84  GLY n 
8  85  ARG n 
8  86  GLU n 
8  87  GLU n 
8  88  LEU n 
8  89  GLU n 
8  90  ARG n 
8  91  VAL n 
8  92  ASN n 
8  93  VAL n 
9  1   SER n 
9  2   SER n 
9  3   LEU n 
9  4   TYR n 
9  5   LYS n 
9  6   THR n 
9  7   PHE n 
9  8   PHE n 
9  9   LYS n 
9  10  ARG n 
9  11  ASN n 
9  12  ALA n 
9  13  VAL n 
9  14  PHE n 
9  15  VAL n 
9  16  GLY n 
9  17  THR n 
9  18  ILE n 
9  19  PHE n 
9  20  ALA n 
9  21  GLY n 
9  22  ALA n 
9  23  PHE n 
9  24  VAL n 
9  25  PHE n 
9  26  GLN n 
9  27  THR n 
9  28  VAL n 
9  29  PHE n 
9  30  ASP n 
9  31  THR n 
9  32  ALA n 
9  33  ILE n 
9  34  THR n 
9  35  SER n 
9  36  TRP n 
9  37  TYR n 
9  38  GLU n 
9  39  ASN n 
9  40  HIS n 
9  41  ASN n 
9  42  LYS n 
9  43  GLY n 
9  44  LYS n 
9  45  LEU n 
9  46  TRP n 
9  47  LYS n 
9  48  ASP n 
9  49  VAL n 
9  50  LYS n 
9  51  ALA n 
9  52  ARG n 
9  53  ILE n 
9  54  ALA n 
9  55  ALA n 
10 1   GLU n 
10 2   VAL n 
10 3   LYS n 
10 4   LEU n 
10 5   GLN n 
10 6   GLU n 
10 7   SER n 
10 8   GLY n 
10 9   ALA n 
10 10  GLY n 
10 11  LEU n 
10 12  VAL n 
10 13  GLN n 
10 14  PRO n 
10 15  SER n 
10 16  GLN n 
10 17  SER n 
10 18  LEU n 
10 19  SER n 
10 20  LEU n 
10 21  THR n 
10 22  CYS n 
10 23  SER n 
10 24  VAL n 
10 25  THR n 
10 26  GLY n 
10 27  TYR n 
10 28  SER n 
10 29  ILE n 
10 30  THR n 
10 31  SER n 
10 32  GLY n 
10 33  TYR n 
10 34  TYR n 
10 35  TRP n 
10 36  ASN n 
10 37  TRP n 
10 38  ILE n 
10 39  ARG n 
10 40  LEU n 
10 41  PHE n 
10 42  PRO n 
10 43  GLY n 
10 44  ASN n 
10 45  LYS n 
10 46  LEU n 
10 47  GLU n 
10 48  TRP n 
10 49  VAL n 
10 50  GLY n 
10 51  TYR n 
10 52  ILE n 
10 53  SER n 
10 54  ASN n 
10 55  VAL n 
10 56  GLY n 
10 57  ASP n 
10 58  ASN n 
10 59  ASN n 
10 60  TYR n 
10 61  ASN n 
10 62  PRO n 
10 63  SER n 
10 64  LEU n 
10 65  LYS n 
10 66  ASP n 
10 67  ARG n 
10 68  LEU n 
10 69  SER n 
10 70  ILE n 
10 71  THR n 
10 72  ARG n 
10 73  ASP n 
10 74  THR n 
10 75  SER n 
10 76  LYS n 
10 77  ASN n 
10 78  GLN n 
10 79  PHE n 
10 80  PHE n 
10 81  LEU n 
10 82  LYS n 
10 83  LEU n 
10 84  ASN n 
10 85  SER n 
10 86  VAL n 
10 87  THR n 
10 88  THR n 
10 89  GLU n 
10 90  ASP n 
10 91  THR n 
10 92  ALA n 
10 93  THR n 
10 94  TYR n 
10 95  TYR n 
10 96  CYS n 
10 97  ALA n 
10 98  ARG n 
10 99  SER n 
10 100 GLU n 
10 101 TYR n 
10 102 TYR n 
10 103 SER n 
10 104 VAL n 
10 105 THR n 
10 106 GLY n 
10 107 TYR n 
10 108 ALA n 
10 109 MET n 
10 110 ASP n 
10 111 TYR n 
10 112 TRP n 
10 113 GLY n 
10 114 GLN n 
10 115 GLY n 
10 116 THR n 
10 117 THR n 
10 118 VAL n 
10 119 THR n 
10 120 VAL n 
10 121 SER n 
10 122 SER n 
10 123 ALA n 
10 124 TRP n 
10 125 ARG n 
10 126 HIS n 
10 127 PRO n 
11 1   ASP n 
11 2   ILE n 
11 3   GLU n 
11 4   LEU n 
11 5   THR n 
11 6   GLN n 
11 7   THR n 
11 8   PRO n 
11 9   VAL n 
11 10  SER n 
11 11  LEU n 
11 12  ALA n 
11 13  ALA n 
11 14  SER n 
11 15  LEU n 
11 16  GLY n 
11 17  ASP n 
11 18  ARG n 
11 19  VAL n 
11 20  THR n 
11 21  ILE n 
11 22  SER n 
11 23  CYS n 
11 24  ARG n 
11 25  ALA n 
11 26  SER n 
11 27  GLN n 
11 28  ASP n 
11 29  ILE n 
11 30  ASN n 
11 31  ASN n 
11 32  PHE n 
11 33  LEU n 
11 34  ASN n 
11 35  TRP n 
11 36  TYR n 
11 37  GLN n 
11 38  GLN n 
11 39  LYS n 
11 40  PRO n 
11 41  ASP n 
11 42  GLY n 
11 43  THR n 
11 44  ILE n 
11 45  LYS n 
11 46  LEU n 
11 47  LEU n 
11 48  ILE n 
11 49  TYR n 
11 50  TYR n 
11 51  THR n 
11 52  SER n 
11 53  ARG n 
11 54  LEU n 
11 55  HIS n 
11 56  ALA n 
11 57  GLY n 
11 58  VAL n 
11 59  PRO n 
11 60  SER n 
11 61  ARG n 
11 62  PHE n 
11 63  SER n 
11 64  GLY n 
11 65  SER n 
11 66  GLY n 
11 67  SER n 
11 68  GLY n 
11 69  THR n 
11 70  ASP n 
11 71  TYR n 
11 72  SER n 
11 73  LEU n 
11 74  THR n 
11 75  ILE n 
11 76  SER n 
11 77  ASN n 
11 78  LEU n 
11 79  GLU n 
11 80  PRO n 
11 81  GLU n 
11 82  ASP n 
11 83  ILE n 
11 84  ALA n 
11 85  THR n 
11 86  TYR n 
11 87  PHE n 
11 88  CYS n 
11 89  GLN n 
11 90  HIS n 
11 91  HIS n 
11 92  ILE n 
11 93  LYS n 
11 94  PHE n 
11 95  PRO n 
11 96  TRP n 
11 97  THR n 
11 98  PHE n 
11 99  GLY n 
11 100 ALA n 
11 101 GLY n 
11 102 THR n 
11 103 LYS n 
11 104 LEU n 
11 105 GLU n 
11 106 ILE n 
11 107 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
10 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? 
? JM83 ? ? ? ? ? ? ? plasmid ? ? ? pASK68 ? ? 
11 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? 
? JM83 ? ? ? ? ? ? ? plasmid ? ? ? pASK68 ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
2 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
3 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
4 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
5 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
6 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
7 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
8 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
9 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? MITOCHONDRIA ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP UQCR1_YEAST P07256 1  
;AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIV
SSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLE
NLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVE
GEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHF
TLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRL
WDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW
;
27 ? 
2  UNP UQCR2_YEAST P07257 2  
;LTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKD
DLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFA
DKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVL
ANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPI
ELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL
;
17 ? 
3  UNP CYB_YEAST   P00163 3  
;MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRY
LHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGND
IVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLIL
ALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKV
LSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK
;
1  ? 
4  UNP CY1_YEAST   P07143 4  
;MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQ
GNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGG
SIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFV
FNPPKP
;
62 ? 
5  UNP UCRI_YEAST  P08067 5  
;KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVK
WQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGR
IRKGPAPLNLEIPAYEFDGDKVIVG
;
31 ? 
6  UNP UCRH_YEAST  P00127 6  VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK 74 ? 
7  UNP UCR7_YEAST  P00128 7  
;QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTE
LTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK
;
3  ? 
8  UNP UCRQ_YEAST  P08525 8  
;GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLY
SKAGREELERVNV
;
2  ? 
9  UNP UCR9_YEAST  P22289 9  SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA 3  ? 
10 PDB 1P84        1P84   10 ? ?  ? 
11 PDB 1P84        1P84   11 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1P84 A 1 ? 431 ? P07256 27 ? 457 ? 27 457 
2  2  1P84 B 1 ? 352 ? P07257 17 ? 368 ? 17 368 
3  3  1P84 C 1 ? 385 ? P00163 1  ? 385 ? 1  385 
4  4  1P84 D 1 ? 246 ? P07143 62 ? 307 ? 62 307 
5  5  1P84 E 1 ? 185 ? P08067 31 ? 215 ? 31 215 
6  6  1P84 F 1 ? 74  ? P00127 74 ? 147 ? 74 147 
7  7  1P84 G 1 ? 125 ? P00128 3  ? 127 ? 3  127 
8  8  1P84 H 1 ? 93  ? P08525 2  ? 94  ? 2  94  
9  9  1P84 I 1 ? 55  ? P22289 3  ? 57  ? 4  58  
10 10 1P84 J 1 ? 127 ? 1P84   1  ? 127 ? 1  127 
11 11 1P84 K 1 ? 107 ? 1P84   1  ? 107 ? 1  107 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1P84 ASP A 127 ? UNP P07256 GLU 153 conflict 153 1 
3 1P84 THR C 122 ? UNP P00163 ILE 122 conflict 122 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3PE non-polymer         . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE 3-SN-PHOSPHATIDYLETHANOLAMINE 'C41 H82 N O8 P'     748.065  
3PH non-polymer         . 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE 'PHOSPHATIDIC ACID' 'C39 H77 O8 P'       704.998  
ALA 'L-peptide linking' y ALANINE ?                                                                                  'C3 H7 N O2' 
89.093   
ARG 'L-peptide linking' y ARGININE ?                                                                                  
'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE ?                                                                                  
'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                                  
'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN 
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CYS 'L-peptide linking' y CYSTEINE ?                                                                                  
'C3 H7 N O2 S'       121.158  
DBT non-polymer         . 5-HEPTYL-6-HYDROXY-1,3-BENZOTHIAZOLE-4,7-DIONE ? 'C14 H17 N O3 S'     279.355  
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'             175.820  
GLN 'L-peptide linking' y GLUTAMINE ?                                                                                  
'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                                  
'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE ?                                                                                  'C2 H5 N O2' 
75.067   
HEC non-polymer         . 'HEME C' ?                                                                                  
'C34 H34 Fe N4 O4'   618.503  
HIS 'L-peptide linking' y HISTIDINE ?                                                                                  
'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER ?                                                                                  'H2 O' 18.015   
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                                  
'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE ?                                                                                  'C6 H13 N O2' 
131.173  
LYS 'L-peptide linking' y LYSINE ?                                                                                  
'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE ?                                                                                  
'C5 H11 N O2 S'      149.211  
PC1 non-polymer         . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 3-SN-PHOSPHATIDYLCHOLINE 'C44 H88 N O8 P'     790.145  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                                  
'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE ?                                                                                  'C5 H9 N O2' 
115.130  
SER 'L-peptide linking' y SERINE ?                                                                                  'C3 H7 N O3' 
105.093  
THR 'L-peptide linking' y THREONINE ?                                                                                  
'C4 H9 N O3'         119.119  
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                                  
'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE ?                                                                                  
'C9 H11 N O3'        181.189  
UMQ non-polymer         . UNDECYL-MALTOSIDE UNDECYL-BETA-D-MALTOPYRANOSIDE                                                     
'C23 H44 O11'        496.589  
UQ6 non-polymer         . 
'5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL' ? 'C39 H60 O4'         
592.891  
VAL 'L-peptide linking' y VALINE ?                                                                                  'C5 H11 N O2' 
117.146  
# 
_exptl.entry_id          1P84 
_exptl.crystals_number   7 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   74.16 
_exptl_crystal.density_Matthews      4.76 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'PEG4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-12-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_wavelength             0.93 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
# 
_reflns.entry_id                     1P84 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             25.0 
_reflns.limit_h_max                  76 
_reflns.limit_h_min                  -86 
_reflns.limit_k_max                  66 
_reflns.limit_k_min                  -86 
_reflns.limit_l_max                  59 
_reflns.limit_l_min                  0 
_reflns.number_all                   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_F_max     315600.93 
_reflns.observed_criterion_F_min     0.320000 
_reflns.B_iso_Wilson_estimate        50.3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_obs                   149103 
_reflns.percent_possible_obs         92.4 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.4 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.56 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   84.6 
_reflns_shell.Rmerge_I_obs           0.374 
_reflns_shell.meanI_over_sigI_obs    1.2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      9128 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1P84 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     145617 
_refine.ls_percent_reflns_obs                    92.5 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             25.0 
_refine.B_iso_min                                19.77 
_refine.B_iso_max                                173.40 
_refine.B_iso_mean                               71.95 
_refine.occupancy_min                            0.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_param_bsol                 31.4444 
_refine.solvent_model_param_ksol                 0.245901 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_number_reflns_R_free                  3677 
_refine.ls_percent_reflns_R_free                 2.5 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'Positional and B-factor refinement' 
_refine.pdbx_starting_model                      'pdb entry 1KB9, protein only' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1P84 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.50 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17235 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         508 
_refine_hist.number_atoms_solvent             326 
_refine_hist.number_atoms_total               18069 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        25.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 . ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   . ? ? 'X-RAY DIFFRACTION' ? 
c_torsion_deg      23.2  . ? ? 'X-RAY DIFFRACTION' ? 
c_torsion_impr_deg 1.21  . ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.50 2.52  3110 2575 2508 82.8 0.41  0.411 0.050 67 2.2 50 . 'X-RAY DIFFRACTION' . 
2.52 2.53  3141 2645 2564 84.2 0.41  0.41  0.046 81 2.6 50 . 'X-RAY DIFFRACTION' . 
2.53 2.55  3217 2697 2637 83.8 0.403 0.404 0.052 60 1.9 50 . 'X-RAY DIFFRACTION' . 
2.55 2.57  3188 2693 2636 84.5 0.386 0.386 0.051 57 1.8 50 . 'X-RAY DIFFRACTION' . 
2.57 2.59  3170 2680 2630 84.5 0.383 0.383 0.054 50 1.6 50 . 'X-RAY DIFFRACTION' . 
2.59 2.61  3161 2730 2662 86.3 0.361 0.36  0.044 68 2.2 50 . 'X-RAY DIFFRACTION' . 
2.61 2.63  3182 2737 2669 86.0 0.353 0.353 0.043 68 2.1 50 . 'X-RAY DIFFRACTION' . 
2.63 2.65  3179 2725 2642 85.7 0.371 0.37  0.041 83 2.6 50 . 'X-RAY DIFFRACTION' . 
2.65 2.67  3201 2781 2703 86.9 0.359 0.358 0.041 78 2.4 50 . 'X-RAY DIFFRACTION' . 
2.67 2.69  3110 2704 2641 86.9 0.34  0.34  0.043 63 2.0 50 . 'X-RAY DIFFRACTION' . 
2.69 2.72  3235 2821 2754 87.2 0.337 0.336 0.041 67 2.1 50 . 'X-RAY DIFFRACTION' . 
2.72 2.74  3140 2753 2682 87.6 0.325 0.324 0.038 71 2.3 50 . 'X-RAY DIFFRACTION' . 
2.74 2.76  3201 2837 2755 88.6 0.319 0.317 0.035 82 2.6 50 . 'X-RAY DIFFRACTION' . 
2.76 2.79  3145 2795 2725 88.9 0.312 0.311 0.037 70 2.2 50 . 'X-RAY DIFFRACTION' . 
2.79 2.82  3161 2866 2796 90.7 0.314 0.313 0.037 70 2.2 50 . 'X-RAY DIFFRACTION' . 
2.82 2.84  3169 2852 2780 90.0 0.301 0.3   0.035 72 2.3 50 . 'X-RAY DIFFRACTION' . 
2.84 2.87  3152 2833 2754 89.9 0.298 0.297 0.033 79 2.5 50 . 'X-RAY DIFFRACTION' . 
2.87 2.90  3180 2873 2800 90.3 0.286 0.284 0.033 73 2.3 50 . 'X-RAY DIFFRACTION' . 
2.90 2.93  3116 2853 2795 91.5 0.292 0.29  0.038 58 1.9 50 . 'X-RAY DIFFRACTION' . 
2.93 2.96  3211 2958 2894 92.1 0.281 0.28  0.035 64 2.0 50 . 'X-RAY DIFFRACTION' . 
2.96 3.00  3142 2917 2845 92.8 0.271 0.27  0.032 72 2.3 50 . 'X-RAY DIFFRACTION' . 
3.00 3.03  3190 2953 2874 92.6 0.279 0.278 0.031 79 2.5 50 . 'X-RAY DIFFRACTION' . 
3.03 3.07  3178 2937 2850 92.4 0.268 0.267 0.029 87 2.7 50 . 'X-RAY DIFFRACTION' . 
3.07 3.11  3114 2919 2846 93.7 0.253 0.251 0.029 73 2.3 50 . 'X-RAY DIFFRACTION' . 
3.11 3.15  3198 2992 2923 93.5 0.256 0.255 0.031 69 2.2 50 . 'X-RAY DIFFRACTION' . 
3.15 3.19  3111 2913 2842 93.6 0.254 0.253 0.030 71 2.3 50 . 'X-RAY DIFFRACTION' . 
3.19 3.24  3161 2987 2923 94.5 0.254 0.253 0.032 64 2.0 50 . 'X-RAY DIFFRACTION' . 
3.24 3.29  3174 3012 2932 94.9 0.243 0.243 0.027 80 2.5 50 . 'X-RAY DIFFRACTION' . 
3.29 3.34  3159 2980 2912 94.3 0.228 0.228 0.028 68 2.2 50 . 'X-RAY DIFFRACTION' . 
3.34 3.39  3156 3009 2945 95.3 0.226 0.226 0.028 64 2.0 50 . 'X-RAY DIFFRACTION' . 
3.39 3.45  3153 3005 2927 95.3 0.224 0.225 0.025 78 2.5 50 . 'X-RAY DIFFRACTION' . 
3.45 3.51  3178 3032 2953 95.4 0.223 0.224 0.025 79 2.5 50 . 'X-RAY DIFFRACTION' . 
3.51 3.58  3154 3020 2937 95.8 0.223 0.223 0.025 83 2.6 50 . 'X-RAY DIFFRACTION' . 
3.58 3.65  3166 3034 2952 95.8 0.21  0.21  0.023 82 2.6 50 . 'X-RAY DIFFRACTION' . 
3.65 3.73  3127 2988 2910 95.6 0.202 0.203 0.023 78 2.5 50 . 'X-RAY DIFFRACTION' . 
3.73 3.82  3160 3037 2951 96.1 0.201 0.202 0.022 86 2.7 50 . 'X-RAY DIFFRACTION' . 
3.82 3.91  3165 3042 2956 96.1 0.197 0.198 0.021 86 2.7 50 . 'X-RAY DIFFRACTION' . 
3.91 4.02  3164 3057 2992 96.6 0.191 0.192 0.024 65 2.1 50 . 'X-RAY DIFFRACTION' . 
4.02 4.14  3135 3027 2929 96.5 0.19  0.191 0.019 98 3.1 50 . 'X-RAY DIFFRACTION' . 
4.14 4.27  3162 3061 2982 96.8 0.194 0.195 0.022 79 2.5 50 . 'X-RAY DIFFRACTION' . 
4.27 4.42  3162 3066 2992 97.0 0.196 0.197 0.023 74 2.3 50 . 'X-RAY DIFFRACTION' . 
4.42 4.60  3165 3044 2961 96.2 0.183 0.185 0.020 83 2.6 50 . 'X-RAY DIFFRACTION' . 
4.60 4.80  3167 3033 2962 95.8 0.185 0.186 0.022 71 2.2 50 . 'X-RAY DIFFRACTION' . 
4.80 5.06  3161 3057 2984 96.7 0.204 0.204 0.024 73 2.3 50 . 'X-RAY DIFFRACTION' . 
5.06 5.37  3157 3049 2963 96.6 0.2   0.199 0.021 86 2.7 50 . 'X-RAY DIFFRACTION' . 
5.37 5.78  3157 3057 2993 96.8 0.214 0.212 0.026 64 2.0 50 . 'X-RAY DIFFRACTION' . 
5.78 6.35  3202 3121 3044 97.5 0.208 0.206 0.024 77 2.4 50 . 'X-RAY DIFFRACTION' . 
6.35 7.25  3171 3064 2980 96.6 0.205 0.203 0.022 84 2.6 50 . 'X-RAY DIFFRACTION' . 
7.25 9.06  3193 3030 2955 94.9 0.161 0.162 0.019 75 2.3 50 . 'X-RAY DIFFRACTION' . 
9.06 24.58 3234 2766 2698 85.5 0.201 0.203 0.025 68 2.1 50 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein.param                    protein.top                      'X-RAY DIFFRACTION' 
2 water.1.param                    water_mod.1.top                  'X-RAY DIFFRACTION' 
3 070303parhcsdx_iub.+lip_trun.bc1 070303tophcsdx_iub.+lip_trun.bc1 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1P84 
_struct.title                     'HDBT inhibited Yeast Cytochrome bc1 Complex' 
_struct.pdbx_descriptor           
;Ubiquinol-cytochrome C reductase complex core protein I (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase complex core protein 2 (E.C.1.10.2.2), cytochrome b (E.C.1.10.2.2), Cytochrome c1, heme protein (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase iron-sulfur subunit (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase complex 17 kDa protein (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase complex 14 kDa protein (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C (E.C.1.10.2.2), Ubiquinol-cytochrome C reductase complex 7.3 kDa protein (E.C.1.10.2.2), Heavy Chain (Vh) Of Fv-Fragment, Light Chain (Vl) Of Fv-Fragment
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1P84 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;cytochrome bc1 complex, complex III, ubiquinol, cytochrome c oxidoreductase, hydroxyquinone, HHDBT, Qo site, phospholipid, membrane protein, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 14 ? 
P  N N 15 ? 
Q  N N 16 ? 
R  N N 17 ? 
S  N N 17 ? 
T  N N 14 ? 
U  N N 12 ? 
V  N N 18 ? 
W  N N 19 ? 
X  N N 20 ? 
Y  N N 21 ? 
Z  N N 21 ? 
AA N N 21 ? 
BA N N 21 ? 
CA N N 21 ? 
DA N N 21 ? 
EA N N 21 ? 
FA N N 21 ? 
GA N N 21 ? 
HA N N 21 ? 
IA N N 21 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 32  ? GLU A 36  ? GLY A 58  GLU A 62  5 ? 5  
HELX_P HELX_P2  2  GLY A 42  ? LEU A 52  ? GLY A 68  LEU A 78  1 ? 11 
HELX_P HELX_P3  3  SER A 53  ? GLU A 63  ? SER A 79  GLU A 89  1 ? 11 
HELX_P HELX_P4  4  ASP A 88  ? ILE A 99  ? ASP A 114 ILE A 125 1 ? 12 
HELX_P HELX_P5  5  SER A 109 ? ASP A 129 ? SER A 135 ASP A 155 1 ? 21 
HELX_P HELX_P6  6  ASP A 129 ? PHE A 143 ? ASP A 155 PHE A 169 1 ? 15 
HELX_P HELX_P7  7  THR A 146 ? LEU A 150 ? THR A 172 LEU A 176 5 ? 5  
HELX_P HELX_P8  8  THR A 155 ? GLU A 160 ? THR A 181 GLU A 186 1 ? 6  
HELX_P HELX_P9  9  VAL A 163 ? PHE A 175 ? VAL A 189 PHE A 201 1 ? 13 
HELX_P HELX_P10 10 LYS A 189 ? LYS A 200 ? LYS A 215 LYS A 226 1 ? 12 
HELX_P HELX_P11 11 ASN A 248 ? GLY A 260 ? ASN A 274 GLY A 286 1 ? 13 
HELX_P HELX_P12 12 GLU A 266 ? LEU A 271 ? GLU A 292 LEU A 297 1 ? 6  
HELX_P HELX_P13 13 LYS A 275 ? GLN A 281 ? LYS A 301 GLN A 307 1 ? 7  
HELX_P HELX_P14 14 MET A 313 ? SER A 331 ? MET A 339 SER A 357 1 ? 19 
HELX_P HELX_P15 15 THR A 333 ? GLU A 353 ? THR A 359 GLU A 379 1 ? 21 
HELX_P HELX_P16 16 ASN A 356 ? GLY A 372 ? ASN A 382 GLY A 398 1 ? 17 
HELX_P HELX_P17 17 SER A 376 ? ALA A 386 ? SER A 402 ALA A 412 1 ? 11 
HELX_P HELX_P18 18 THR A 388 ? LEU A 400 ? THR A 414 LEU A 426 1 ? 13 
HELX_P HELX_P19 19 ASP A 418 ? ASP A 425 ? ASP A 444 ASP A 451 1 ? 8  
HELX_P HELX_P20 20 GLY B 22  ? ALA B 26  ? GLY B 38  ALA B 42  5 ? 5  
HELX_P HELX_P21 21 GLY B 30  ? ASN B 39  ? GLY B 46  ASN B 55  1 ? 10 
HELX_P HELX_P22 22 SER B 47  ? GLY B 59  ? SER B 63  GLY B 75  1 ? 13 
HELX_P HELX_P23 23 ASP B 81  ? THR B 96  ? ASP B 97  THR B 112 1 ? 16 
HELX_P HELX_P24 24 LYS B 99  ? SER B 106 ? LYS B 115 SER B 122 1 ? 8  
HELX_P HELX_P25 25 SER B 106 ? GLU B 119 ? SER B 122 GLU B 135 1 ? 14 
HELX_P HELX_P26 26 CYS B 121 ? PHE B 135 ? CYS B 137 PHE B 151 1 ? 15 
HELX_P HELX_P27 27 SER B 152 ? TYR B 164 ? SER B 168 TYR B 180 1 ? 13 
HELX_P HELX_P28 28 VAL B 177 ? SER B 188 ? VAL B 193 SER B 204 1 ? 12 
HELX_P HELX_P29 29 LEU B 189 ? LEU B 193 ? LEU B 205 LEU B 209 5 ? 5  
HELX_P HELX_P30 30 SER B 233 ? THR B 245 ? SER B 249 THR B 261 1 ? 13 
HELX_P HELX_P31 31 SER B 249 ? ILE B 255 ? SER B 265 ILE B 271 5 ? 7  
HELX_P HELX_P32 32 ASP B 277 ? LYS B 294 ? ASP B 293 LYS B 310 1 ? 18 
HELX_P HELX_P33 33 SER B 299 ? ILE B 302 ? SER B 315 ILE B 318 5 ? 4  
HELX_P HELX_P34 34 ASN B 303 ? LYS B 308 ? ASN B 319 LYS B 324 1 ? 6  
HELX_P HELX_P35 35 ASP B 342 ? LEU B 346 ? ASP B 358 LEU B 362 5 ? 5  
HELX_P HELX_P36 36 ALA C 2   ? ASN C 7   ? ALA C 2   ASN C 7   1 ? 6  
HELX_P HELX_P37 37 ASN C 7   ? ILE C 18  ? ASN C 7   ILE C 18  1 ? 12 
HELX_P HELX_P38 38 ASN C 27  ? TRP C 30  ? ASN C 27  TRP C 30  5 ? 4  
HELX_P HELX_P39 39 ASN C 31  ? MET C 52  ? ASN C 31  MET C 52  1 ? 22 
HELX_P HELX_P40 40 LEU C 60  ? ASP C 71  ? LEU C 60  ASP C 71  1 ? 12 
HELX_P HELX_P41 41 ASN C 74  ? TYR C 103 ? ASN C 74  TYR C 103 1 ? 30 
HELX_P HELX_P42 42 ARG C 110 ? VAL C 135 ? ARG C 110 VAL C 135 1 ? 26 
HELX_P HELX_P43 43 GLY C 137 ? LEU C 150 ? GLY C 137 LEU C 150 1 ? 14 
HELX_P HELX_P44 44 PHE C 151 ? ILE C 154 ? PHE C 151 ILE C 154 5 ? 4  
HELX_P HELX_P45 45 VAL C 157 ? GLY C 167 ? VAL C 157 GLY C 167 1 ? 11 
HELX_P HELX_P46 46 SER C 172 ? GLY C 205 ? SER C 172 GLY C 205 1 ? 34 
HELX_P HELX_P47 47 SER C 223 ? SER C 247 ? SER C 223 SER C 247 1 ? 25 
HELX_P HELX_P48 48 HIS C 253 ? ILE C 258 ? HIS C 253 ILE C 258 5 ? 6  
HELX_P HELX_P49 49 LEU C 275 ? SER C 284 ? LEU C 275 SER C 284 1 ? 10 
HELX_P HELX_P50 50 ASP C 287 ? VAL C 301 ? ASP C 287 VAL C 301 1 ? 15 
HELX_P HELX_P51 51 VAL C 304 ? ASP C 309 ? VAL C 304 ASP C 309 1 ? 6  
HELX_P HELX_P52 52 LYS C 319 ? ALA C 341 ? LYS C 319 ALA C 341 1 ? 23 
HELX_P HELX_P53 53 GLU C 345 ? ILE C 365 ? GLU C 345 ILE C 365 1 ? 21 
HELX_P HELX_P54 54 ILE C 365 ? GLY C 381 ? ILE C 365 GLY C 381 1 ? 17 
HELX_P HELX_P55 55 THR D 2   ? GLY D 7   ? THR D 63  GLY D 68  1 ? 6  
HELX_P HELX_P56 56 ASP D 25  ? VAL D 39  ? ASP D 86  VAL D 100 1 ? 15 
HELX_P HELX_P57 57 CYS D 40  ? CYS D 43  ? CYS D 101 CYS D 104 5 ? 4  
HELX_P HELX_P58 58 ALA D 50  ? VAL D 55  ? ALA D 111 VAL D 116 5 ? 6  
HELX_P HELX_P59 59 THR D 60  ? GLU D 70  ? THR D 121 GLU D 131 1 ? 11 
HELX_P HELX_P60 60 ASN D 100 ? ALA D 107 ? ASN D 161 ALA D 168 1 ? 8  
HELX_P HELX_P61 61 GLY D 125 ? THR D 135 ? GLY D 186 THR D 196 1 ? 11 
HELX_P HELX_P62 62 THR D 182 ? GLU D 199 ? THR D 243 GLU D 260 1 ? 18 
HELX_P HELX_P63 63 GLU D 201 ? THR D 236 ? GLU D 262 THR D 297 1 ? 36 
HELX_P HELX_P64 64 LYS E 21  ? SER E 50  ? LYS E 51  SER E 80  1 ? 30 
HELX_P HELX_P65 65 SER E 51  ? THR E 53  ? SER E 81  THR E 83  5 ? 3  
HELX_P HELX_P66 66 THR E 55  ? LEU E 59  ? THR E 85  LEU E 89  5 ? 5  
HELX_P HELX_P67 67 ALA E 69  ? ILE E 71  ? ALA E 99  ILE E 101 5 ? 3  
HELX_P HELX_P68 68 THR E 92  ? SER E 101 ? THR E 122 SER E 131 1 ? 10 
HELX_P HELX_P69 69 VAL E 102 ? VAL E 102 ? VAL E 132 VAL E 132 5 ? 1  
HELX_P HELX_P70 70 ASP E 103 ? LEU E 107 ? ASP E 133 LEU E 137 5 ? 5  
HELX_P HELX_P71 71 THR E 112 ? VAL E 117 ? THR E 142 VAL E 147 1 ? 6  
HELX_P HELX_P72 72 ASP F 3   ? ASN F 14  ? ASP F 76  ASN F 87  1 ? 12 
HELX_P HELX_P73 73 THR F 15  ? GLN F 38  ? THR F 88  GLN F 111 1 ? 24 
HELX_P HELX_P74 74 CYS F 50  ? ALA F 66  ? CYS F 123 ALA F 139 1 ? 17 
HELX_P HELX_P75 75 ARG F 68  ? LEU F 73  ? ARG F 141 LEU F 146 1 ? 6  
HELX_P HELX_P76 76 SER G 2   ? SER G 16  ? SER G 4   SER G 18  1 ? 15 
HELX_P HELX_P77 77 SER G 16  ? LYS G 21  ? SER G 18  LYS G 23  1 ? 6  
HELX_P HELX_P78 78 CYS G 23  ? GLY G 35  ? CYS G 25  GLY G 37  1 ? 13 
HELX_P HELX_P79 79 TYR G 36  ? GLY G 40  ? TYR G 38  GLY G 42  5 ? 5  
HELX_P HELX_P80 80 LYS G 42  ? ILE G 47  ? LYS G 44  ILE G 49  5 ? 6  
HELX_P HELX_P81 81 ASN G 51  ? LEU G 61  ? ASN G 53  LEU G 63  1 ? 11 
HELX_P HELX_P82 82 PRO G 62  ? THR G 82  ? PRO G 64  THR G 84  1 ? 21 
HELX_P HELX_P83 83 PRO G 87  ? TRP G 91  ? PRO G 89  TRP G 93  5 ? 5  
HELX_P HELX_P84 84 LEU G 101 ? ASN G 120 ? LEU G 103 ASN G 122 1 ? 20 
HELX_P HELX_P85 85 PRO H 30  ? GLN H 33  ? PRO H 31  GLN H 34  5 ? 4  
HELX_P HELX_P86 86 PHE H 48  ? LYS H 52  ? PHE H 49  LYS H 53  5 ? 5  
HELX_P HELX_P87 87 GLN H 54  ? TYR H 80  ? GLN H 55  TYR H 81  1 ? 27 
HELX_P HELX_P88 88 GLY H 84  ? ASN H 92  ? GLY H 85  ASN H 93  1 ? 9  
HELX_P HELX_P89 89 SER I 1   ? PHE I 8   ? SER I 4   PHE I 11  1 ? 8  
HELX_P HELX_P90 90 PHE I 14  ? ASN I 41  ? PHE I 17  ASN I 44  1 ? 28 
HELX_P HELX_P91 91 LEU I 45  ? ARG I 52  ? LEU I 48  ARG I 55  1 ? 8  
HELX_P HELX_P92 92 THR J 87  ? THR J 91  ? THR J 87  THR J 91  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? E CYS 134 SG  ? ? ? 1_555 E CYS 150 SG  ? ? E CYS 164 E CYS 180 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
disulf2  disulf ?    ? F CYS 28  SG  ? ? ? 1_555 F CYS 50  SG  ? ? F CYS 101 F CYS 123 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3  disulf ?    ? J CYS 22  SG  ? ? ? 1_555 J CYS 96  SG  ? ? J CYS 22  J CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf4  disulf ?    ? K CYS 23  SG  ? ? ? 1_555 K CYS 88  SG  ? ? K CYS 23  K CYS 88  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale1  covale none ? D CYS 40  SG  ? ? ? 1_555 T HEC .   CAB ? ? D CYS 101 D HEC 703 1_555 ? ? ? ? ? ? ? 1.781 ? ? 
covale2  covale none ? D CYS 43  SG  ? ? ? 1_555 T HEC .   CAC ? ? D CYS 104 D HEC 703 1_555 ? ? ? ? ? ? ? 1.792 ? ? 
metalc1  metalc ?    ? C HIS 82  NE2 ? ? ? 1_555 N HEC .   FE  ? ? C HIS 82  C HEC 701 1_555 ? ? ? ? ? ? ? 1.955 ? ? 
metalc2  metalc ?    ? C HIS 96  NE2 ? ? ? 1_555 O HEC .   FE  ? ? C HIS 96  C HEC 702 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
metalc3  metalc ?    ? C HIS 183 NE2 ? ? ? 1_555 N HEC .   FE  ? ? C HIS 183 C HEC 701 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc4  metalc ?    ? C HIS 197 NE2 ? ? ? 1_555 O HEC .   FE  ? ? C HIS 197 C HEC 702 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc5  metalc ?    ? D HIS 44  NE2 ? ? ? 1_555 T HEC .   FE  ? ? D HIS 105 D HEC 703 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc6  metalc ?    ? D MET 164 SD  ? ? ? 1_555 T HEC .   FE  ? ? D MET 225 D HEC 703 1_555 ? ? ? ? ? ? ? 2.121 ? ? 
metalc7  metalc ?    ? E CYS 129 SG  ? ? ? 1_555 X FES .   FE1 ? ? E CYS 159 E FES 704 1_555 ? ? ? ? ? ? ? 2.239 ? ? 
metalc8  metalc ?    ? E HIS 131 ND1 ? ? ? 1_555 X FES .   FE2 ? ? E HIS 161 E FES 704 1_555 ? ? ? ? ? ? ? 2.112 ? ? 
metalc9  metalc ?    ? E CYS 148 SG  ? ? ? 1_555 X FES .   FE1 ? ? E CYS 178 E FES 704 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc10 metalc ?    ? E HIS 151 ND1 ? ? ? 1_555 X FES .   FE2 ? ? E HIS 181 E FES 704 1_555 ? ? ? ? ? ? ? 2.108 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 108 C . ? SER 108 C PRO 109 C ? PRO 109 C 1 0.33  
2 THR 7   K . ? THR 7   K PRO 8   K ? PRO 8   K 1 -0.32 
3 GLU 79  K . ? GLU 79  K PRO 80  K ? PRO 80  K 1 -0.76 
4 PHE 94  K . ? PHE 94  K PRO 95  K ? PRO 95  K 1 0.26  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 5 ? 
D ? 5 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 3 ? 
I ? 3 ? 
J ? 4 ? 
K ? 4 ? 
L ? 6 ? 
M ? 4 ? 
N ? 4 ? 
O ? 2 ? 
P ? 4 ? 
Q ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 4   ? SER A 7   ? THR A 30  SER A 33  
A 2 VAL A 11  ? GLU A 15  ? VAL A 37  GLU A 41  
A 3 ALA A 180 ? THR A 185 ? ALA A 206 THR A 211 
A 4 ALA A 23  ? PHE A 29  ? ALA A 49  PHE A 55  
A 5 GLN A 76  ? SER A 82  ? GLN A 102 SER A 108 
A 6 ALA A 66  ? ILE A 71  ? ALA A 92  ILE A 97  
B 1 SER A 261 ? ASN A 263 ? SER A 287 ASN A 289 
B 2 ASN A 288 ? SER A 295 ? ASN A 314 SER A 321 
B 3 GLY A 300 ? THR A 308 ? GLY A 326 THR A 334 
B 4 ALA A 233 ? GLU A 240 ? ALA A 259 GLU A 266 
B 5 ALA A 406 ? GLY A 411 ? ALA A 432 GLY A 437 
B 6 SER A 221 ? ARG A 226 ? SER A 247 ARG A 252 
B 7 ILE H 23  ? VAL H 28  ? ILE H 24  VAL H 29  
B 8 LYS D 238 ? PHE D 241 ? LYS D 299 PHE D 302 
C 1 THR B 2   ? SER B 4   ? THR B 18  SER B 20  
C 2 LEU B 169 ? GLU B 174 ? LEU B 185 GLU B 190 
C 3 ILE B 12  ? VAL B 19  ? ILE B 28  VAL B 35  
C 4 ILE B 71  ? LEU B 78  ? ILE B 87  LEU B 94  
C 5 GLY B 60  ? LEU B 66  ? GLY B 76  LEU B 82  
D 1 GLU B 212 ? ARG B 216 ? GLU B 228 ARG B 232 
D 2 ASN B 336 ? GLY B 341 ? ASN B 352 GLY B 357 
D 3 SER B 221 ? VAL B 229 ? SER B 237 VAL B 245 
D 4 GLY B 267 ? ASP B 275 ? GLY B 283 ASP B 291 
D 5 SER B 257 ? LYS B 262 ? SER B 273 LYS B 278 
E 1 PRO C 21  ? PRO C 23  ? PRO C 21  PRO C 23  
E 2 ARG C 218 ? PRO C 220 ? ARG C 218 PRO C 220 
F 1 GLU D 72  ? ASP D 74  ? GLU D 133 ASP D 135 
F 2 LYS D 85  ? PRO D 87  ? LYS D 146 PRO D 148 
G 1 ASN D 152 ? TYR D 153 ? ASN D 213 TYR D 214 
G 2 SER D 161 ? ILE D 162 ? SER D 222 ILE D 223 
H 1 VAL E 64  ? ASN E 67  ? VAL E 94  ASN E 97  
H 2 LYS E 181 ? VAL E 184 ? LYS E 211 VAL E 214 
H 3 TYR E 175 ? ASP E 178 ? TYR E 205 ASP E 208 
I 1 ASN E 76  ? TRP E 81  ? ASN E 106 TRP E 111 
I 2 LYS E 84  ? HIS E 90  ? LYS E 114 HIS E 120 
I 3 TRP E 122 ? LEU E 126 ? TRP E 152 LEU E 156 
J 1 ILE E 137 ? ALA E 140 ? ILE E 167 ALA E 170 
J 2 GLY E 145 ? CYS E 148 ? GLY E 175 CYS E 178 
J 3 SER E 153 ? TYR E 155 ? SER E 183 TYR E 185 
J 4 ILE E 161 ? LYS E 163 ? ILE E 191 LYS E 193 
K 1 LYS J 3   ? GLY J 8   ? LYS J 3   GLY J 8   
K 2 LEU J 18  ? THR J 25  ? LEU J 18  THR J 25  
K 3 GLN J 78  ? LEU J 83  ? GLN J 78  LEU J 83  
K 4 THR J 71  ? ASP J 73  ? THR J 71  ASP J 73  
L 1 LEU J 11  ? VAL J 12  ? LEU J 11  VAL J 12  
L 2 THR J 116 ? VAL J 120 ? THR J 116 VAL J 120 
L 3 ALA J 92  ? TYR J 102 ? ALA J 92  TYR J 102 
L 4 TYR J 34  ? LEU J 40  ? TYR J 34  LEU J 40  
L 5 LEU J 46  ? SER J 53  ? LEU J 46  SER J 53  
L 6 ASN J 58  ? TYR J 60  ? ASN J 58  TYR J 60  
M 1 LEU J 11  ? VAL J 12  ? LEU J 11  VAL J 12  
M 2 THR J 116 ? VAL J 120 ? THR J 116 VAL J 120 
M 3 ALA J 92  ? TYR J 102 ? ALA J 92  TYR J 102 
M 4 GLY J 106 ? TRP J 112 ? GLY J 106 TRP J 112 
N 1 LEU K 4   ? THR K 7   ? LEU K 4   THR K 7   
N 2 THR K 20  ? ALA K 25  ? THR K 20  ALA K 25  
N 3 ASP K 70  ? THR K 74  ? ASP K 70  THR K 74  
N 4 GLY K 66  ? SER K 67  ? GLY K 66  SER K 67  
O 1 ALA K 12  ? ALA K 13  ? ALA K 12  ALA K 13  
O 2 GLU K 105 ? ILE K 106 ? GLU K 105 ILE K 106 
P 1 ARG K 53  ? LEU K 54  ? ARG K 53  LEU K 54  
P 2 ILE K 44  ? TYR K 49  ? ILE K 44  TYR K 49  
P 3 LEU K 33  ? GLN K 38  ? LEU K 33  GLN K 38  
P 4 GLN K 89  ? HIS K 90  ? GLN K 89  HIS K 90  
Q 1 ARG K 53  ? LEU K 54  ? ARG K 53  LEU K 54  
Q 2 ILE K 44  ? TYR K 49  ? ILE K 44  TYR K 49  
Q 3 LEU K 33  ? GLN K 38  ? LEU K 33  GLN K 38  
Q 4 THR K 85  ? TYR K 86  ? THR K 85  TYR K 86  
Q 5 THR K 102 ? LYS K 103 ? THR K 102 LYS K 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 4   ? N THR A 30  O THR A 14  ? O THR A 40  
A 2 3 N ALA A 13  ? N ALA A 39  O VAL A 182 ? O VAL A 208 
A 3 4 O THR A 185 ? O THR A 211 N SER A 24  ? N SER A 50  
A 4 5 N VAL A 25  ? N VAL A 51  O VAL A 80  ? O VAL A 106 
A 5 6 O ILE A 79  ? O ILE A 105 N SER A 68  ? N SER A 94  
B 1 2 N TYR A 262 ? N TYR A 288 O PHE A 289 ? O PHE A 315 
B 2 3 N LEU A 294 ? N LEU A 320 O LEU A 301 ? O LEU A 327 
B 3 4 O TRP A 302 ? O TRP A 328 N VAL A 239 ? N VAL A 265 
B 4 5 N ALA A 238 ? N ALA A 264 O ALA A 406 ? O ALA A 432 
B 5 6 O GLY A 409 ? O GLY A 435 N LEU A 225 ? N LEU A 251 
B 6 7 N ARG A 224 ? N ARG A 250 O SER H 25  ? O SER H 26  
B 7 8 O TYR H 26  ? O TYR H 27  N LYS D 238 ? N LYS D 299 
C 1 2 N SER B 4   ? N SER B 20  O VAL B 171 ? O VAL B 187 
C 2 3 O GLU B 174 ? O GLU B 190 N THR B 14  ? N THR B 30  
C 3 4 N SER B 13  ? N SER B 29  O PHE B 77  ? O PHE B 93  
C 4 5 O THR B 76  ? O THR B 92  N THR B 61  ? N THR B 77  
D 1 2 N VAL B 215 ? N VAL B 231 O ALA B 339 ? O ALA B 355 
D 2 3 O VAL B 340 ? O VAL B 356 N VAL B 222 ? N VAL B 238 
D 3 4 N ILE B 227 ? N ILE B 243 O PHE B 269 ? O PHE B 285 
D 4 5 O PHE B 272 ? O PHE B 288 N SER B 257 ? N SER B 273 
E 1 2 N GLN C 22  ? N GLN C 22  O ILE C 219 ? O ILE C 219 
F 1 2 N TYR D 73  ? N TYR D 134 O ARG D 86  ? O ARG D 147 
G 1 2 N ASN D 152 ? N ASN D 213 O ILE D 162 ? O ILE D 223 
H 1 2 N VAL E 66  ? N VAL E 96  O VAL E 182 ? O VAL E 212 
H 2 3 O ILE E 183 ? O ILE E 213 N GLU E 176 ? N GLU E 206 
I 1 2 N VAL E 79  ? N VAL E 109 O VAL E 86  ? O VAL E 116 
I 2 3 N PHE E 87  ? N PHE E 117 O MET E 125 ? O MET E 155 
J 1 2 N ILE E 137 ? N ILE E 167 O PHE E 147 ? O PHE E 177 
J 2 3 N TRP E 146 ? N TRP E 176 O TYR E 155 ? O TYR E 185 
J 3 4 N HIS E 154 ? N HIS E 184 O ARG E 162 ? O ARG E 192 
K 1 2 N GLN J 5   ? N GLN J 5   O SER J 23  ? O SER J 23  
K 2 3 N LEU J 20  ? N LEU J 20  O LEU J 81  ? O LEU J 81  
K 3 4 O PHE J 80  ? O PHE J 80  N THR J 71  ? N THR J 71  
L 1 2 N VAL J 12  ? N VAL J 12  O THR J 119 ? O THR J 119 
L 2 3 O THR J 116 ? O THR J 116 N TYR J 94  ? N TYR J 94  
L 3 4 O ALA J 97  ? O ALA J 97  N ASN J 36  ? N ASN J 36  
L 4 5 N TRP J 37  ? N TRP J 37  O VAL J 49  ? O VAL J 49  
L 5 6 N TYR J 51  ? N TYR J 51  O ASN J 59  ? O ASN J 59  
M 1 2 N VAL J 12  ? N VAL J 12  O THR J 119 ? O THR J 119 
M 2 3 O THR J 116 ? O THR J 116 N TYR J 94  ? N TYR J 94  
M 3 4 N GLU J 100 ? N GLU J 100 O ALA J 108 ? O ALA J 108 
N 1 2 N THR K 7   ? N THR K 7   O SER K 22  ? O SER K 22  
N 2 3 N CYS K 23  ? N CYS K 23  O TYR K 71  ? O TYR K 71  
N 3 4 O ASP K 70  ? O ASP K 70  N SER K 67  ? N SER K 67  
O 1 2 N ALA K 13  ? N ALA K 13  O GLU K 105 ? O GLU K 105 
P 1 2 O ARG K 53  ? O ARG K 53  N TYR K 49  ? N TYR K 49  
P 2 3 O LYS K 45  ? O LYS K 45  N GLN K 37  ? N GLN K 37  
P 3 4 N ASN K 34  ? N ASN K 34  O GLN K 89  ? O GLN K 89  
Q 1 2 O ARG K 53  ? O ARG K 53  N TYR K 49  ? N TYR K 49  
Q 2 3 O LYS K 45  ? O LYS K 45  N GLN K 37  ? N GLN K 37  
Q 3 4 N GLN K 38  ? N GLN K 38  O THR K 85  ? O THR K 85  
Q 4 5 N TYR K 86  ? N TYR K 86  O THR K 102 ? O THR K 102 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C HEC 701 ? 16 'BINDING SITE FOR RESIDUE HEC C 701' 
AC2 Software C HEC 702 ? 18 'BINDING SITE FOR RESIDUE HEC C 702' 
AC3 Software D HEC 703 ? 13 'BINDING SITE FOR RESIDUE HEC D 703' 
AC4 Software E FES 704 ? 6  'BINDING SITE FOR RESIDUE FES E 704' 
AC5 Software C DBT 705 ? 9  'BINDING SITE FOR RESIDUE DBT C 705' 
AC6 Software C UQ6 706 ? 12 'BINDING SITE FOR RESIDUE UQ6 C 706' 
AC7 Software C 3PE 710 ? 8  'BINDING SITE FOR RESIDUE 3PE C 710' 
AC8 Software C 3PE 711 ? 7  'BINDING SITE FOR RESIDUE 3PE C 711' 
AC9 Software A 3PH 713 ? 7  'BINDING SITE FOR RESIDUE 3PH A 713' 
BC1 Software D 3PH 714 ? 7  'BINDING SITE FOR RESIDUE 3PH D 714' 
BC2 Software D PC1 715 ? 7  'BINDING SITE FOR RESIDUE PC1 D 715' 
BC3 Software A UMQ 721 ? 15 'BINDING SITE FOR RESIDUE UMQ A 721' 
BC4 Software D CDL 731 ? 12 'BINDING SITE FOR RESIDUE CDL D 731' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 16 LEU C  40  ? LEU C 40  . ? 1_555 ? 
2   AC1 16 GLN C  43  ? GLN C 43  . ? 1_555 ? 
3   AC1 16 GLY C  47  ? GLY C 47  . ? 1_555 ? 
4   AC1 16 MET C  50  ? MET C 50  . ? 1_555 ? 
5   AC1 16 ARG C  79  ? ARG C 79  . ? 1_555 ? 
6   AC1 16 HIS C  82  ? HIS C 82  . ? 1_555 ? 
7   AC1 16 PHE C  89  ? PHE C 89  . ? 1_555 ? 
8   AC1 16 THR C  127 ? THR C 127 . ? 1_555 ? 
9   AC1 16 ALA C  128 ? ALA C 128 . ? 1_555 ? 
10  AC1 16 GLY C  131 ? GLY C 131 . ? 1_555 ? 
11  AC1 16 VAL C  135 ? VAL C 135 . ? 1_555 ? 
12  AC1 16 HIS C  183 ? HIS C 183 . ? 1_555 ? 
13  AC1 16 TYR C  184 ? TYR C 184 . ? 1_555 ? 
14  AC1 16 PRO C  187 ? PRO C 187 . ? 1_555 ? 
15  AC1 16 HOH AA .   ? HOH C 729 . ? 1_555 ? 
16  AC1 16 HOH AA .   ? HOH C 739 . ? 1_555 ? 
17  AC2 18 TRP C  30  ? TRP C 30  . ? 1_555 ? 
18  AC2 18 GLY C  33  ? GLY C 33  . ? 1_555 ? 
19  AC2 18 LEU C  36  ? LEU C 36  . ? 1_555 ? 
20  AC2 18 HIS C  96  ? HIS C 96  . ? 1_555 ? 
21  AC2 18 MET C  97  ? MET C 97  . ? 1_555 ? 
22  AC2 18 LYS C  99  ? LYS C 99  . ? 1_555 ? 
23  AC2 18 SER C  105 ? SER C 105 . ? 1_555 ? 
24  AC2 18 LEU C  113 ? LEU C 113 . ? 1_555 ? 
25  AC2 18 GLY C  117 ? GLY C 117 . ? 1_555 ? 
26  AC2 18 ILE C  120 ? ILE C 120 . ? 1_555 ? 
27  AC2 18 VAL C  194 ? VAL C 194 . ? 1_555 ? 
28  AC2 18 HIS C  197 ? HIS C 197 . ? 1_555 ? 
29  AC2 18 LEU C  201 ? LEU C 201 . ? 1_555 ? 
30  AC2 18 SER C  206 ? SER C 206 . ? 1_555 ? 
31  AC2 18 SER C  207 ? SER C 207 . ? 1_555 ? 
32  AC2 18 UQ6 Q  .   ? UQ6 C 706 . ? 1_555 ? 
33  AC2 18 HOH AA .   ? HOH C 713 . ? 1_555 ? 
34  AC2 18 HOH AA .   ? HOH C 730 . ? 1_555 ? 
35  AC3 13 VAL D  39  ? VAL D 100 . ? 1_555 ? 
36  AC3 13 CYS D  40  ? CYS D 101 . ? 1_555 ? 
37  AC3 13 CYS D  43  ? CYS D 104 . ? 1_555 ? 
38  AC3 13 HIS D  44  ? HIS D 105 . ? 1_555 ? 
39  AC3 13 ARG D  123 ? ARG D 184 . ? 1_555 ? 
40  AC3 13 TYR D  129 ? TYR D 190 . ? 1_555 ? 
41  AC3 13 ILE D  130 ? ILE D 191 . ? 1_555 ? 
42  AC3 13 PHE D  157 ? PHE D 218 . ? 1_555 ? 
43  AC3 13 ILE D  162 ? ILE D 223 . ? 1_555 ? 
44  AC3 13 ALA D  163 ? ALA D 224 . ? 1_555 ? 
45  AC3 13 MET D  164 ? MET D 225 . ? 1_555 ? 
46  AC3 13 VAL D  167 ? VAL D 228 . ? 1_555 ? 
47  AC3 13 HOH BA .   ? HOH D 739 . ? 1_555 ? 
48  AC4 6  CYS E  129 ? CYS E 159 . ? 1_555 ? 
49  AC4 6  HIS E  131 ? HIS E 161 . ? 1_555 ? 
50  AC4 6  LEU E  132 ? LEU E 162 . ? 1_555 ? 
51  AC4 6  CYS E  148 ? CYS E 178 . ? 1_555 ? 
52  AC4 6  HIS E  151 ? HIS E 181 . ? 1_555 ? 
53  AC4 6  SER E  153 ? SER E 183 . ? 1_555 ? 
54  AC5 9  MET C  139 ? MET C 139 . ? 1_555 ? 
55  AC5 9  GLY C  143 ? GLY C 143 . ? 1_555 ? 
56  AC5 9  VAL C  146 ? VAL C 146 . ? 1_555 ? 
57  AC5 9  ILE C  147 ? ILE C 147 . ? 1_555 ? 
58  AC5 9  ILE C  269 ? ILE C 269 . ? 1_555 ? 
59  AC5 9  PRO C  271 ? PRO C 271 . ? 1_555 ? 
60  AC5 9  TYR C  279 ? TYR C 279 . ? 1_555 ? 
61  AC5 9  HOH AA .   ? HOH C 790 . ? 1_555 ? 
62  AC5 9  HIS E  151 ? HIS E 181 . ? 2_555 ? 
63  AC6 12 TYR C  16  ? TYR C 16  . ? 1_555 ? 
64  AC6 12 GLN C  22  ? GLN C 22  . ? 1_555 ? 
65  AC6 12 ILE C  26  ? ILE C 26  . ? 1_555 ? 
66  AC6 12 SER C  34  ? SER C 34  . ? 1_555 ? 
67  AC6 12 ILE C  44  ? ILE C 44  . ? 1_555 ? 
68  AC6 12 LEU C  201 ? LEU C 201 . ? 1_555 ? 
69  AC6 12 SER C  206 ? SER C 206 . ? 1_555 ? 
70  AC6 12 MET C  221 ? MET C 221 . ? 1_555 ? 
71  AC6 12 ASP C  229 ? ASP C 229 . ? 1_555 ? 
72  AC6 12 HEC O  .   ? HEC C 702 . ? 1_555 ? 
73  AC6 12 HOH AA .   ? HOH C 721 . ? 1_555 ? 
74  AC6 12 HOH AA .   ? HOH C 802 . ? 1_555 ? 
75  AC7 8  TRP C  29  ? TRP C 29  . ? 1_555 ? 
76  AC7 8  MET C  97  ? MET C 97  . ? 1_555 ? 
77  AC7 8  TYR C  102 ? TYR C 102 . ? 1_555 ? 
78  AC7 8  TYR C  103 ? TYR C 103 . ? 1_555 ? 
79  AC7 8  TYR C  359 ? TYR C 359 . ? 1_555 ? 
80  AC7 8  GLU G  80  ? GLU G 82  . ? 1_555 ? 
81  AC7 8  ARG H  50  ? ARG H 51  . ? 1_555 ? 
82  AC7 8  PHE H  51  ? PHE H 52  . ? 1_555 ? 
83  AC8 7  PHE C  3   ? PHE C 3   . ? 1_555 ? 
84  AC8 7  ASN C  7   ? ASN C 7   . ? 1_555 ? 
85  AC8 7  TYR C  9   ? TYR C 9   . ? 1_555 ? 
86  AC8 7  VAL C  13  ? VAL C 13  . ? 1_555 ? 
87  AC8 7  THR C  112 ? THR C 112 . ? 2_555 ? 
88  AC8 7  ASN C  115 ? ASN C 115 . ? 2_555 ? 
89  AC8 7  HOH AA .   ? HOH C 779 . ? 1_555 ? 
90  AC9 7  SER A  424 ? SER A 450 . ? 1_555 ? 
91  AC9 7  UMQ M  .   ? UMQ A 721 . ? 1_555 ? 
92  AC9 7  HOH Y  .   ? HOH A 775 . ? 1_555 ? 
93  AC9 7  LEU C  230 ? LEU C 230 . ? 1_555 ? 
94  AC9 7  3PH U  .   ? 3PH D 714 . ? 1_555 ? 
95  AC9 7  VAL E  30  ? VAL E 60  . ? 1_555 ? 
96  AC9 7  SER E  37  ? SER E 67  . ? 1_555 ? 
97  BC1 7  3PH L  .   ? 3PH A 713 . ? 1_555 ? 
98  BC1 7  MET C  237 ? MET C 237 . ? 1_555 ? 
99  BC1 7  LYS D  211 ? LYS D 272 . ? 1_555 ? 
100 BC1 7  THR D  212 ? THR D 273 . ? 1_555 ? 
101 BC1 7  ILE D  215 ? ILE D 276 . ? 1_555 ? 
102 BC1 7  GLY E  40  ? GLY E 70  . ? 1_555 ? 
103 BC1 7  SER E  43  ? SER E 73  . ? 1_555 ? 
104 BC2 7  HIS C  253 ? HIS C 253 . ? 1_555 ? 
105 BC2 7  SER C  268 ? SER C 268 . ? 1_555 ? 
106 BC2 7  TRP C  273 ? TRP C 273 . ? 1_555 ? 
107 BC2 7  GLY C  337 ? GLY C 337 . ? 1_555 ? 
108 BC2 7  HIS D  124 ? HIS D 185 . ? 1_555 ? 
109 BC2 7  HOH BA .   ? HOH D 792 . ? 1_555 ? 
110 BC2 7  HOH BA .   ? HOH D 793 . ? 1_555 ? 
111 BC3 15 TRP A  401 ? TRP A 427 . ? 1_555 ? 
112 BC3 15 ASP A  402 ? ASP A 428 . ? 1_555 ? 
113 BC3 15 SER A  427 ? SER A 453 . ? 1_555 ? 
114 BC3 15 MET A  428 ? MET A 454 . ? 1_555 ? 
115 BC3 15 MET A  429 ? MET A 455 . ? 1_555 ? 
116 BC3 15 ARG A  430 ? ARG A 456 . ? 1_555 ? 
117 BC3 15 3PH L  .   ? 3PH A 713 . ? 1_555 ? 
118 BC3 15 HOH Y  .   ? HOH A 752 . ? 1_555 ? 
119 BC3 15 TYR E  27  ? TYR E 57  . ? 1_555 ? 
120 BC3 15 SER E  38  ? SER E 68  . ? 1_555 ? 
121 BC3 15 ASN I  11  ? ASN I 14  . ? 1_555 ? 
122 BC3 15 ALA I  12  ? ALA I 15  . ? 1_555 ? 
123 BC3 15 VAL I  13  ? VAL I 16  . ? 1_555 ? 
124 BC3 15 PHE I  14  ? PHE I 17  . ? 1_555 ? 
125 BC3 15 VAL I  15  ? VAL I 18  . ? 1_555 ? 
126 BC4 12 ASN C  27  ? ASN C 27  . ? 1_555 ? 
127 BC4 12 TYR C  28  ? TYR C 28  . ? 1_555 ? 
128 BC4 12 MET C  32  ? MET C 32  . ? 1_555 ? 
129 BC4 12 MET C  95  ? MET C 95  . ? 1_555 ? 
130 BC4 12 LEU C  235 ? LEU C 235 . ? 1_555 ? 
131 BC4 12 TYR D  220 ? TYR D 281 . ? 1_555 ? 
132 BC4 12 LYS D  227 ? LYS D 288 . ? 1_555 ? 
133 BC4 12 LYS D  228 ? LYS D 289 . ? 1_555 ? 
134 BC4 12 HOH BA .   ? HOH D 746 . ? 1_555 ? 
135 BC4 12 HOH BA .   ? HOH D 759 . ? 1_555 ? 
136 BC4 12 HOH BA .   ? HOH D 768 . ? 1_555 ? 
137 BC4 12 HIS G  83  ? HIS G 85  . ? 1_555 ? 
# 
_atom_sites.entry_id                    1P84 
_atom_sites.fract_transf_matrix[1][1]   0.004651 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002404 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006057 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007630 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1  1   ? -17.845 110.920 49.473  1.00 154.76 ? 27  ALA A N     1 
ATOM   2     C  CA    . ALA A  1  1   ? -18.277 109.492 49.450  1.00 154.89 ? 27  ALA A CA    1 
ATOM   3     C  C     . ALA A  1  1   ? -19.584 109.289 50.223  1.00 154.91 ? 27  ALA A C     1 
ATOM   4     O  O     . ALA A  1  1   ? -19.754 108.289 50.928  1.00 154.95 ? 27  ALA A O     1 
ATOM   5     C  CB    . ALA A  1  1   ? -17.173 108.605 50.023  1.00 154.64 ? 27  ALA A CB    1 
ATOM   6     N  N     . GLU A  1  2   ? -20.507 110.240 50.080  1.00 154.54 ? 28  GLU A N     1 
ATOM   7     C  CA    . GLU A  1  2   ? -21.796 110.171 50.764  1.00 153.88 ? 28  GLU A CA    1 
ATOM   8     C  C     . GLU A  1  2   ? -22.991 109.976 49.841  1.00 153.26 ? 28  GLU A C     1 
ATOM   9     O  O     . GLU A  1  2   ? -23.216 110.758 48.916  1.00 153.17 ? 28  GLU A O     1 
ATOM   10    C  CB    . GLU A  1  2   ? -22.027 111.413 51.625  1.00 154.18 ? 28  GLU A CB    1 
ATOM   11    C  CG    . GLU A  1  2   ? -21.334 111.377 52.979  1.00 154.35 ? 28  GLU A CG    1 
ATOM   12    C  CD    . GLU A  1  2   ? -22.119 112.102 54.067  1.00 154.51 ? 28  GLU A CD    1 
ATOM   13    O  OE1   . GLU A  1  2   ? -21.638 112.132 55.220  1.00 154.32 ? 28  GLU A OE1   1 
ATOM   14    O  OE2   . GLU A  1  2   ? -23.219 112.627 53.783  1.00 154.21 ? 28  GLU A OE2   1 
ATOM   15    N  N     . VAL A  1  3   ? -23.771 108.941 50.129  1.00 152.59 ? 29  VAL A N     1 
ATOM   16    C  CA    . VAL A  1  3   ? -24.962 108.620 49.353  1.00 152.20 ? 29  VAL A CA    1 
ATOM   17    C  C     . VAL A  1  3   ? -26.203 109.018 50.158  1.00 151.40 ? 29  VAL A C     1 
ATOM   18    O  O     . VAL A  1  3   ? -26.705 108.240 50.973  1.00 151.54 ? 29  VAL A O     1 
ATOM   19    C  CB    . VAL A  1  3   ? -25.021 107.105 49.017  1.00 152.85 ? 29  VAL A CB    1 
ATOM   20    C  CG1   . VAL A  1  3   ? -26.237 106.799 48.149  1.00 152.76 ? 29  VAL A CG1   1 
ATOM   21    C  CG2   . VAL A  1  3   ? -23.734 106.664 48.321  1.00 152.84 ? 29  VAL A CG2   1 
ATOM   22    N  N     . THR A  1  4   ? -26.679 110.241 49.937  1.00 150.37 ? 30  THR A N     1 
ATOM   23    C  CA    . THR A  1  4   ? -27.855 110.760 50.637  1.00 149.36 ? 30  THR A CA    1 
ATOM   24    C  C     . THR A  1  4   ? -29.110 110.754 49.761  1.00 148.45 ? 30  THR A C     1 
ATOM   25    O  O     . THR A  1  4   ? -29.103 111.288 48.650  1.00 148.38 ? 30  THR A O     1 
ATOM   26    C  CB    . THR A  1  4   ? -27.606 112.192 51.160  1.00 149.57 ? 30  THR A CB    1 
ATOM   27    O  OG1   . THR A  1  4   ? -27.073 113.004 50.105  1.00 149.57 ? 30  THR A OG1   1 
ATOM   28    C  CG2   . THR A  1  4   ? -26.630 112.177 52.329  1.00 149.48 ? 30  THR A CG2   1 
ATOM   29    N  N     . GLN A  1  5   ? -30.194 110.182 50.286  1.00 147.25 ? 31  GLN A N     1 
ATOM   30    C  CA    . GLN A  1  5   ? -31.455 110.090 49.553  1.00 146.27 ? 31  GLN A CA    1 
ATOM   31    C  C     . GLN A  1  5   ? -32.672 110.057 50.485  1.00 145.26 ? 31  GLN A C     1 
ATOM   32    O  O     . GLN A  1  5   ? -32.759 109.205 51.368  1.00 145.08 ? 31  GLN A O     1 
ATOM   33    C  CB    . GLN A  1  5   ? -31.435 108.835 48.673  1.00 146.76 ? 31  GLN A CB    1 
ATOM   34    C  CG    . GLN A  1  5   ? -32.693 108.605 47.859  1.00 147.86 ? 31  GLN A CG    1 
ATOM   35    C  CD    . GLN A  1  5   ? -33.250 107.206 48.044  1.00 148.79 ? 31  GLN A CD    1 
ATOM   36    O  OE1   . GLN A  1  5   ? -33.389 106.726 49.171  1.00 148.96 ? 31  GLN A OE1   1 
ATOM   37    N  NE2   . GLN A  1  5   ? -33.577 106.545 46.937  1.00 149.28 ? 31  GLN A NE2   1 
ATOM   38    N  N     . LEU A  1  6   ? -33.617 110.974 50.266  1.00 144.44 ? 32  LEU A N     1 
ATOM   39    C  CA    . LEU A  1  6   ? -34.837 111.064 51.080  1.00 143.91 ? 32  LEU A CA    1 
ATOM   40    C  C     . LEU A  1  6   ? -36.118 111.236 50.256  1.00 143.45 ? 32  LEU A C     1 
ATOM   41    O  O     . LEU A  1  6   ? -36.122 111.927 49.235  1.00 143.28 ? 32  LEU A O     1 
ATOM   42    C  CB    . LEU A  1  6   ? -34.722 112.208 52.091  1.00 143.97 ? 32  LEU A CB    1 
ATOM   43    C  CG    . LEU A  1  6   ? -33.815 111.975 53.303  1.00 144.16 ? 32  LEU A CG    1 
ATOM   44    C  CD1   . LEU A  1  6   ? -33.684 113.258 54.110  1.00 144.21 ? 32  LEU A CD1   1 
ATOM   45    C  CD2   . LEU A  1  6   ? -34.379 110.852 54.166  1.00 143.99 ? 32  LEU A CD2   1 
ATOM   46    N  N     . SER A  1  7   ? -37.211 110.642 50.738  1.00 142.88 ? 33  SER A N     1 
ATOM   47    C  CA    . SER A  1  7   ? -38.507 110.696 50.054  1.00 142.33 ? 33  SER A CA    1 
ATOM   48    C  C     . SER A  1  7   ? -39.595 111.461 50.818  1.00 142.23 ? 33  SER A C     1 
ATOM   49    O  O     . SER A  1  7   ? -39.868 111.171 51.984  1.00 141.88 ? 33  SER A O     1 
ATOM   50    C  CB    . SER A  1  7   ? -38.996 109.272 49.754  1.00 141.85 ? 33  SER A CB    1 
ATOM   51    O  OG    . SER A  1  7   ? -40.235 109.275 49.063  1.00 140.77 ? 33  SER A OG    1 
ATOM   52    N  N     . ASN A  1  8   ? -40.222 112.422 50.138  1.00 142.08 ? 34  ASN A N     1 
ATOM   53    C  CA    . ASN A  1  8   ? -41.299 113.244 50.711  1.00 141.71 ? 34  ASN A CA    1 
ATOM   54    C  C     . ASN A  1  8   ? -42.575 113.053 49.883  1.00 141.42 ? 34  ASN A C     1 
ATOM   55    O  O     . ASN A  1  8   ? -43.648 112.754 50.413  1.00 141.36 ? 34  ASN A O     1 
ATOM   56    C  CB    . ASN A  1  8   ? -40.920 114.735 50.714  1.00 141.49 ? 34  ASN A CB    1 
ATOM   57    C  CG    . ASN A  1  8   ? -39.516 114.993 50.187  1.00 141.31 ? 34  ASN A CG    1 
ATOM   58    O  OD1   . ASN A  1  8   ? -39.337 115.608 49.134  1.00 140.77 ? 34  ASN A OD1   1 
ATOM   59    N  ND2   . ASN A  1  8   ? -38.512 114.532 50.927  1.00 141.38 ? 34  ASN A ND2   1 
ATOM   60    N  N     . GLY A  1  9   ? -42.433 113.284 48.583  1.00 140.95 ? 35  GLY A N     1 
ATOM   61    C  CA    . GLY A  1  9   ? -43.508 113.127 47.619  1.00 139.19 ? 35  GLY A CA    1 
ATOM   62    C  C     . GLY A  1  9   ? -42.783 112.579 46.404  1.00 138.09 ? 35  GLY A C     1 
ATOM   63    O  O     . GLY A  1  9   ? -43.250 111.667 45.719  1.00 138.30 ? 35  GLY A O     1 
ATOM   64    N  N     . ILE A  1  10  ? -41.597 113.140 46.180  1.00 136.55 ? 36  ILE A N     1 
ATOM   65    C  CA    . ILE A  1  10  ? -40.698 112.760 45.099  1.00 134.95 ? 36  ILE A CA    1 
ATOM   66    C  C     . ILE A  1  10  ? -39.449 112.231 45.800  1.00 134.12 ? 36  ILE A C     1 
ATOM   67    O  O     . ILE A  1  10  ? -39.015 112.800 46.803  1.00 134.21 ? 36  ILE A O     1 
ATOM   68    C  CB    . ILE A  1  10  ? -40.252 113.989 44.274  1.00 134.59 ? 36  ILE A CB    1 
ATOM   69    C  CG1   . ILE A  1  10  ? -41.454 114.852 43.887  1.00 134.08 ? 36  ILE A CG1   1 
ATOM   70    C  CG2   . ILE A  1  10  ? -39.493 113.538 43.035  1.00 135.01 ? 36  ILE A CG2   1 
ATOM   71    C  CD1   . ILE A  1  10  ? -41.066 116.186 43.279  1.00 133.29 ? 36  ILE A CD1   1 
ATOM   72    N  N     . VAL A  1  11  ? -38.880 111.143 45.295  1.00 132.94 ? 37  VAL A N     1 
ATOM   73    C  CA    . VAL A  1  11  ? -37.670 110.588 45.892  1.00 131.39 ? 37  VAL A CA    1 
ATOM   74    C  C     . VAL A  1  11  ? -36.442 111.358 45.385  1.00 130.69 ? 37  VAL A C     1 
ATOM   75    O  O     . VAL A  1  11  ? -36.072 111.270 44.212  1.00 130.71 ? 37  VAL A O     1 
ATOM   76    C  CB    . VAL A  1  11  ? -37.556 109.061 45.634  1.00 131.03 ? 37  VAL A CB    1 
ATOM   77    C  CG1   . VAL A  1  11  ? -37.814 108.738 44.175  1.00 131.40 ? 37  VAL A CG1   1 
ATOM   78    C  CG2   . VAL A  1  11  ? -36.197 108.546 46.074  1.00 130.99 ? 37  VAL A CG2   1 
ATOM   79    N  N     . VAL A  1  12  ? -35.856 112.158 46.276  1.00 130.02 ? 38  VAL A N     1 
ATOM   80    C  CA    . VAL A  1  12  ? -34.687 112.984 45.959  1.00 129.18 ? 38  VAL A CA    1 
ATOM   81    C  C     . VAL A  1  12  ? -33.365 112.326 46.347  1.00 128.67 ? 38  VAL A C     1 
ATOM   82    O  O     . VAL A  1  12  ? -33.171 111.938 47.500  1.00 128.77 ? 38  VAL A O     1 
ATOM   83    C  CB    . VAL A  1  12  ? -34.763 114.359 46.671  1.00 128.75 ? 38  VAL A CB    1 
ATOM   84    C  CG1   . VAL A  1  12  ? -33.631 115.264 46.200  1.00 128.35 ? 38  VAL A CG1   1 
ATOM   85    C  CG2   . VAL A  1  12  ? -36.114 115.014 46.425  1.00 128.85 ? 38  VAL A CG2   1 
ATOM   86    N  N     . ALA A  1  13  ? -32.445 112.244 45.387  1.00 127.87 ? 39  ALA A N     1 
ATOM   87    C  CA    . ALA A  1  13  ? -31.135 111.642 45.619  1.00 126.72 ? 39  ALA A CA    1 
ATOM   88    C  C     . ALA A  1  13  ? -30.011 112.594 45.222  1.00 125.88 ? 39  ALA A C     1 
ATOM   89    O  O     . ALA A  1  13  ? -30.070 113.239 44.174  1.00 125.01 ? 39  ALA A O     1 
ATOM   90    C  CB    . ALA A  1  13  ? -31.011 110.330 44.852  1.00 126.77 ? 39  ALA A CB    1 
ATOM   91    N  N     . THR A  1  14  ? -28.998 112.685 46.079  1.00 125.45 ? 40  THR A N     1 
ATOM   92    C  CA    . THR A  1  14  ? -27.849 113.551 45.838  1.00 125.49 ? 40  THR A CA    1 
ATOM   93    C  C     . THR A  1  14  ? -26.557 112.944 46.369  1.00 125.86 ? 40  THR A C     1 
ATOM   94    O  O     . THR A  1  14  ? -26.563 112.149 47.310  1.00 125.48 ? 40  THR A O     1 
ATOM   95    C  CB    . THR A  1  14  ? -28.008 114.929 46.518  1.00 125.18 ? 40  THR A CB    1 
ATOM   96    O  OG1   . THR A  1  14  ? -28.235 114.745 47.919  1.00 125.19 ? 40  THR A OG1   1 
ATOM   97    C  CG2   . THR A  1  14  ? -29.154 115.714 45.916  1.00 125.42 ? 40  THR A CG2   1 
ATOM   98    N  N     . GLU A  1  15  ? -25.448 113.346 45.758  1.00 126.77 ? 41  GLU A N     1 
ATOM   99    C  CA    . GLU A  1  15  ? -24.123 112.891 46.153  1.00 127.89 ? 41  GLU A CA    1 
ATOM   100   C  C     . GLU A  1  15  ? -23.220 114.109 46.036  1.00 128.48 ? 41  GLU A C     1 
ATOM   101   O  O     . GLU A  1  15  ? -22.780 114.477 44.944  1.00 128.00 ? 41  GLU A O     1 
ATOM   102   C  CB    . GLU A  1  15  ? -23.639 111.758 45.242  1.00 129.00 ? 41  GLU A CB    1 
ATOM   103   C  CG    . GLU A  1  15  ? -22.355 111.083 45.710  1.00 129.65 ? 41  GLU A CG    1 
ATOM   104   C  CD    . GLU A  1  15  ? -22.073 109.785 44.978  1.00 129.76 ? 41  GLU A CD    1 
ATOM   105   O  OE1   . GLU A  1  15  ? -21.667 109.844 43.797  1.00 130.30 ? 41  GLU A OE1   1 
ATOM   106   O  OE2   . GLU A  1  15  ? -22.260 108.708 45.585  1.00 129.47 ? 41  GLU A OE2   1 
ATOM   107   N  N     . HIS A  1  16  ? -23.009 114.766 47.170  1.00 129.75 ? 42  HIS A N     1 
ATOM   108   C  CA    . HIS A  1  16  ? -22.190 115.968 47.235  1.00 131.28 ? 42  HIS A CA    1 
ATOM   109   C  C     . HIS A  1  16  ? -20.690 115.720 47.240  1.00 131.26 ? 42  HIS A C     1 
ATOM   110   O  O     . HIS A  1  16  ? -20.204 114.741 47.807  1.00 131.14 ? 42  HIS A O     1 
ATOM   111   C  CB    . HIS A  1  16  ? -22.593 116.832 48.438  1.00 132.96 ? 42  HIS A CB    1 
ATOM   112   C  CG    . HIS A  1  16  ? -22.813 116.057 49.702  1.00 134.95 ? 42  HIS A CG    1 
ATOM   113   N  ND1   . HIS A  1  16  ? -22.133 116.330 50.870  1.00 135.51 ? 42  HIS A ND1   1 
ATOM   114   C  CD2   . HIS A  1  16  ? -23.657 115.036 49.989  1.00 135.85 ? 42  HIS A CD2   1 
ATOM   115   C  CE1   . HIS A  1  16  ? -22.549 115.511 51.821  1.00 136.09 ? 42  HIS A CE1   1 
ATOM   116   N  NE2   . HIS A  1  16  ? -23.473 114.716 51.312  1.00 136.44 ? 42  HIS A NE2   1 
ATOM   117   N  N     . ASN A  1  17  ? -19.972 116.625 46.584  1.00 131.12 ? 43  ASN A N     1 
ATOM   118   C  CA    . ASN A  1  17  ? -18.520 116.572 46.480  1.00 131.13 ? 43  ASN A CA    1 
ATOM   119   C  C     . ASN A  1  17  ? -18.063 118.031 46.436  1.00 131.20 ? 43  ASN A C     1 
ATOM   120   O  O     . ASN A  1  17  ? -18.126 118.677 45.389  1.00 130.72 ? 43  ASN A O     1 
ATOM   121   C  CB    . ASN A  1  17  ? -18.107 115.836 45.200  1.00 131.12 ? 43  ASN A CB    1 
ATOM   122   C  CG    . ASN A  1  17  ? -16.623 115.517 45.159  1.00 131.50 ? 43  ASN A CG    1 
ATOM   123   O  OD1   . ASN A  1  17  ? -15.877 116.076 44.354  1.00 131.38 ? 43  ASN A OD1   1 
ATOM   124   N  ND2   . ASN A  1  17  ? -16.189 114.605 46.023  1.00 131.32 ? 43  ASN A ND2   1 
ATOM   125   N  N     . PRO A  1  18  ? -17.576 118.557 47.578  1.00 131.37 ? 44  PRO A N     1 
ATOM   126   C  CA    . PRO A  1  18  ? -17.093 119.934 47.760  1.00 131.11 ? 44  PRO A CA    1 
ATOM   127   C  C     . PRO A  1  18  ? -16.396 120.540 46.543  1.00 130.64 ? 44  PRO A C     1 
ATOM   128   O  O     . PRO A  1  18  ? -17.012 121.295 45.790  1.00 130.63 ? 44  PRO A O     1 
ATOM   129   C  CB    . PRO A  1  18  ? -16.162 119.818 48.975  1.00 131.36 ? 44  PRO A CB    1 
ATOM   130   C  CG    . PRO A  1  18  ? -15.831 118.335 49.049  1.00 131.74 ? 44  PRO A CG    1 
ATOM   131   C  CD    . PRO A  1  18  ? -17.151 117.721 48.710  1.00 131.57 ? 44  PRO A CD    1 
ATOM   132   N  N     . SER A  1  19  ? -15.119 120.217 46.358  1.00 130.29 ? 45  SER A N     1 
ATOM   133   C  CA    . SER A  1  19  ? -14.368 120.724 45.215  1.00 129.68 ? 45  SER A CA    1 
ATOM   134   C  C     . SER A  1  19  ? -14.968 120.097 43.960  1.00 128.88 ? 45  SER A C     1 
ATOM   135   O  O     . SER A  1  19  ? -14.901 118.878 43.771  1.00 129.20 ? 45  SER A O     1 
ATOM   136   C  CB    . SER A  1  19  ? -12.883 120.359 45.334  1.00 130.22 ? 45  SER A CB    1 
ATOM   137   O  OG    . SER A  1  19  ? -12.685 118.953 45.334  1.00 130.59 ? 45  SER A OG    1 
ATOM   138   N  N     . ALA A  1  20  ? -15.588 120.927 43.127  1.00 127.34 ? 46  ALA A N     1 
ATOM   139   C  CA    . ALA A  1  20  ? -16.216 120.439 41.907  1.00 125.36 ? 46  ALA A CA    1 
ATOM   140   C  C     . ALA A  1  20  ? -16.241 121.456 40.778  1.00 123.64 ? 46  ALA A C     1 
ATOM   141   O  O     . ALA A  1  20  ? -16.173 121.074 39.607  1.00 124.20 ? 46  ALA A O     1 
ATOM   142   C  CB    . ALA A  1  20  ? -17.630 119.961 42.204  1.00 125.75 ? 46  ALA A CB    1 
ATOM   143   N  N     . HIS A  1  21  ? -16.346 122.739 41.132  1.00 120.73 ? 47  HIS A N     1 
ATOM   144   C  CA    . HIS A  1  21  ? -16.405 123.839 40.162  1.00 118.25 ? 47  HIS A CA    1 
ATOM   145   C  C     . HIS A  1  21  ? -17.793 124.005 39.547  1.00 115.25 ? 47  HIS A C     1 
ATOM   146   O  O     . HIS A  1  21  ? -18.211 125.124 39.257  1.00 115.39 ? 47  HIS A O     1 
ATOM   147   C  CB    . HIS A  1  21  ? -15.380 123.665 39.031  1.00 120.20 ? 47  HIS A CB    1 
ATOM   148   C  CG    . HIS A  1  21  ? -14.064 124.329 39.286  1.00 121.93 ? 47  HIS A CG    1 
ATOM   149   N  ND1   . HIS A  1  21  ? -13.150 123.852 40.202  1.00 122.54 ? 47  HIS A ND1   1 
ATOM   150   C  CD2   . HIS A  1  21  ? -13.489 125.413 38.713  1.00 122.67 ? 47  HIS A CD2   1 
ATOM   151   C  CE1   . HIS A  1  21  ? -12.070 124.611 40.179  1.00 122.98 ? 47  HIS A CE1   1 
ATOM   152   N  NE2   . HIS A  1  21  ? -12.250 125.566 39.283  1.00 123.26 ? 47  HIS A NE2   1 
ATOM   153   N  N     . THR A  1  22  ? -18.484 122.892 39.311  1.00 111.58 ? 48  THR A N     1 
ATOM   154   C  CA    . THR A  1  22  ? -19.825 122.919 38.726  1.00 107.77 ? 48  THR A CA    1 
ATOM   155   C  C     . THR A  1  22  ? -20.802 122.040 39.505  1.00 105.21 ? 48  THR A C     1 
ATOM   156   O  O     . THR A  1  22  ? -20.441 121.415 40.506  1.00 104.81 ? 48  THR A O     1 
ATOM   157   C  CB    . THR A  1  22  ? -19.828 122.467 37.233  1.00 107.83 ? 48  THR A CB    1 
ATOM   158   O  OG1   . THR A  1  22  ? -19.315 121.133 37.125  1.00 108.33 ? 48  THR A OG1   1 
ATOM   159   C  CG2   . THR A  1  22  ? -18.988 123.404 36.374  1.00 107.19 ? 48  THR A CG2   1 
ATOM   160   N  N     . ALA A  1  23  ? -22.046 122.012 39.038  1.00 102.31 ? 49  ALA A N     1 
ATOM   161   C  CA    . ALA A  1  23  ? -23.099 121.221 39.662  1.00 99.88  ? 49  ALA A CA    1 
ATOM   162   C  C     . ALA A  1  23  ? -24.148 120.867 38.615  1.00 97.92  ? 49  ALA A C     1 
ATOM   163   O  O     . ALA A  1  23  ? -24.440 121.665 37.721  1.00 98.37  ? 49  ALA A O     1 
ATOM   164   C  CB    . ALA A  1  23  ? -23.735 121.999 40.807  1.00 100.41 ? 49  ALA A CB    1 
ATOM   165   N  N     . SER A  1  24  ? -24.714 119.671 38.728  1.00 94.78  ? 50  SER A N     1 
ATOM   166   C  CA    . SER A  1  24  ? -25.722 119.224 37.778  1.00 91.57  ? 50  SER A CA    1 
ATOM   167   C  C     . SER A  1  24  ? -26.980 118.710 38.459  1.00 89.30  ? 50  SER A C     1 
ATOM   168   O  O     . SER A  1  24  ? -26.918 118.003 39.471  1.00 87.66  ? 50  SER A O     1 
ATOM   169   C  CB    . SER A  1  24  ? -25.138 118.159 36.848  1.00 92.10  ? 50  SER A CB    1 
ATOM   170   O  OG    . SER A  1  24  ? -24.082 118.697 36.069  1.00 91.18  ? 50  SER A OG    1 
ATOM   171   N  N     . VAL A  1  25  ? -28.122 119.084 37.890  1.00 86.98  ? 51  VAL A N     1 
ATOM   172   C  CA    . VAL A  1  25  ? -29.421 118.694 38.421  1.00 85.30  ? 51  VAL A CA    1 
ATOM   173   C  C     . VAL A  1  25  ? -30.292 118.126 37.307  1.00 83.78  ? 51  VAL A C     1 
ATOM   174   O  O     . VAL A  1  25  ? -30.155 118.497 36.138  1.00 82.72  ? 51  VAL A O     1 
ATOM   175   C  CB    . VAL A  1  25  ? -30.167 119.913 39.043  1.00 85.58  ? 51  VAL A CB    1 
ATOM   176   C  CG1   . VAL A  1  25  ? -31.378 119.447 39.845  1.00 85.08  ? 51  VAL A CG1   1 
ATOM   177   C  CG2   . VAL A  1  25  ? -29.229 120.730 39.920  1.00 85.54  ? 51  VAL A CG2   1 
ATOM   178   N  N     . GLY A  1  26  ? -31.199 117.232 37.682  1.00 82.14  ? 52  GLY A N     1 
ATOM   179   C  CA    . GLY A  1  26  ? -32.087 116.646 36.704  1.00 80.68  ? 52  GLY A CA    1 
ATOM   180   C  C     . GLY A  1  26  ? -32.893 115.502 37.269  1.00 80.28  ? 52  GLY A C     1 
ATOM   181   O  O     . GLY A  1  26  ? -32.781 115.161 38.449  1.00 78.54  ? 52  GLY A O     1 
ATOM   182   N  N     . VAL A  1  27  ? -33.726 114.922 36.413  1.00 79.67  ? 53  VAL A N     1 
ATOM   183   C  CA    . VAL A  1  27  ? -34.562 113.795 36.787  1.00 79.46  ? 53  VAL A CA    1 
ATOM   184   C  C     . VAL A  1  27  ? -34.148 112.586 35.943  1.00 78.80  ? 53  VAL A C     1 
ATOM   185   O  O     . VAL A  1  27  ? -33.641 112.736 34.826  1.00 78.57  ? 53  VAL A O     1 
ATOM   186   C  CB    . VAL A  1  27  ? -36.066 114.124 36.577  1.00 80.10  ? 53  VAL A CB    1 
ATOM   187   C  CG1   . VAL A  1  27  ? -36.324 114.531 35.134  1.00 80.88  ? 53  VAL A CG1   1 
ATOM   188   C  CG2   . VAL A  1  27  ? -36.944 112.939 36.973  1.00 80.26  ? 53  VAL A CG2   1 
ATOM   189   N  N     . VAL A  1  28  ? -34.309 111.397 36.514  1.00 77.51  ? 54  VAL A N     1 
ATOM   190   C  CA    . VAL A  1  28  ? -33.973 110.148 35.845  1.00 76.24  ? 54  VAL A CA    1 
ATOM   191   C  C     . VAL A  1  28  ? -35.167 109.219 36.024  1.00 75.57  ? 54  VAL A C     1 
ATOM   192   O  O     . VAL A  1  28  ? -35.589 108.948 37.149  1.00 74.39  ? 54  VAL A O     1 
ATOM   193   C  CB    . VAL A  1  28  ? -32.701 109.498 36.457  1.00 76.25  ? 54  VAL A CB    1 
ATOM   194   C  CG1   . VAL A  1  28  ? -32.364 108.210 35.732  1.00 75.07  ? 54  VAL A CG1   1 
ATOM   195   C  CG2   . VAL A  1  28  ? -31.524 110.461 36.381  1.00 74.98  ? 54  VAL A CG2   1 
ATOM   196   N  N     . PHE A  1  29  ? -35.720 108.753 34.908  1.00 75.68  ? 55  PHE A N     1 
ATOM   197   C  CA    . PHE A  1  29  ? -36.884 107.872 34.938  1.00 76.47  ? 55  PHE A CA    1 
ATOM   198   C  C     . PHE A  1  29  ? -36.557 106.381 34.838  1.00 75.75  ? 55  PHE A C     1 
ATOM   199   O  O     . PHE A  1  29  ? -35.712 105.970 34.040  1.00 75.42  ? 55  PHE A O     1 
ATOM   200   C  CB    . PHE A  1  29  ? -37.848 108.247 33.815  1.00 78.47  ? 55  PHE A CB    1 
ATOM   201   C  CG    . PHE A  1  29  ? -38.312 109.675 33.856  1.00 80.22  ? 55  PHE A CG    1 
ATOM   202   C  CD1   . PHE A  1  29  ? -37.778 110.618 32.977  1.00 80.75  ? 55  PHE A CD1   1 
ATOM   203   C  CD2   . PHE A  1  29  ? -39.297 110.077 34.756  1.00 80.78  ? 55  PHE A CD2   1 
ATOM   204   C  CE1   . PHE A  1  29  ? -38.221 111.941 32.993  1.00 81.15  ? 55  PHE A CE1   1 
ATOM   205   C  CE2   . PHE A  1  29  ? -39.746 111.398 34.780  1.00 81.02  ? 55  PHE A CE2   1 
ATOM   206   C  CZ    . PHE A  1  29  ? -39.206 112.331 33.897  1.00 81.17  ? 55  PHE A CZ    1 
ATOM   207   N  N     . GLY A  1  30  ? -37.279 105.574 35.617  1.00 75.12  ? 56  GLY A N     1 
ATOM   208   C  CA    . GLY A  1  30  ? -37.076 104.133 35.616  1.00 74.11  ? 56  GLY A CA    1 
ATOM   209   C  C     . GLY A  1  30  ? -37.702 103.413 34.430  1.00 73.84  ? 56  GLY A C     1 
ATOM   210   O  O     . GLY A  1  30  ? -38.345 102.368 34.590  1.00 72.72  ? 56  GLY A O     1 
ATOM   211   N  N     . SER A  1  31  ? -37.520 103.980 33.239  1.00 72.86  ? 57  SER A N     1 
ATOM   212   C  CA    . SER A  1  31  ? -38.050 103.404 32.010  1.00 72.34  ? 57  SER A CA    1 
ATOM   213   C  C     . SER A  1  31  ? -37.273 103.890 30.790  1.00 72.70  ? 57  SER A C     1 
ATOM   214   O  O     . SER A  1  31  ? -37.090 105.097 30.593  1.00 71.84  ? 57  SER A O     1 
ATOM   215   C  CB    . SER A  1  31  ? -39.538 103.725 31.853  1.00 72.85  ? 57  SER A CB    1 
ATOM   216   O  OG    . SER A  1  31  ? -40.322 102.964 32.761  1.00 73.61  ? 57  SER A OG    1 
ATOM   217   N  N     . GLY A  1  32  ? -36.806 102.930 29.987  1.00 71.95  ? 58  GLY A N     1 
ATOM   218   C  CA    . GLY A  1  32  ? -36.047 103.240 28.787  1.00 70.83  ? 58  GLY A CA    1 
ATOM   219   C  C     . GLY A  1  32  ? -36.533 102.440 27.591  1.00 70.40  ? 58  GLY A C     1 
ATOM   220   O  O     . GLY A  1  32  ? -37.719 102.105 27.501  1.00 71.31  ? 58  GLY A O     1 
ATOM   221   N  N     . ALA A  1  33  ? -35.609 102.108 26.689  1.00 68.73  ? 59  ALA A N     1 
ATOM   222   C  CA    . ALA A  1  33  ? -35.917 101.348 25.480  1.00 65.60  ? 59  ALA A CA    1 
ATOM   223   C  C     . ALA A  1  33  ? -36.551 99.989  25.761  1.00 64.85  ? 59  ALA A C     1 
ATOM   224   O  O     . ALA A  1  33  ? -37.280 99.462  24.929  1.00 65.49  ? 59  ALA A O     1 
ATOM   225   C  CB    . ALA A  1  33  ? -34.671 101.182 24.640  1.00 65.60  ? 59  ALA A CB    1 
ATOM   226   N  N     . ALA A  1  34  ? -36.282 99.433  26.936  1.00 64.13  ? 60  ALA A N     1 
ATOM   227   C  CA    . ALA A  1  34  ? -36.839 98.144  27.323  1.00 65.69  ? 60  ALA A CA    1 
ATOM   228   C  C     . ALA A  1  34  ? -38.326 98.228  27.671  1.00 67.87  ? 60  ALA A C     1 
ATOM   229   O  O     . ALA A  1  34  ? -38.939 97.228  28.059  1.00 69.67  ? 60  ALA A O     1 
ATOM   230   C  CB    . ALA A  1  34  ? -36.068 97.585  28.499  1.00 64.92  ? 60  ALA A CB    1 
ATOM   231   N  N     . ASN A  1  35  ? -38.903 99.420  27.539  1.00 69.45  ? 61  ASN A N     1 
ATOM   232   C  CA    . ASN A  1  35  ? -40.313 99.630  27.861  1.00 70.20  ? 61  ASN A CA    1 
ATOM   233   C  C     . ASN A  1  35  ? -41.145 99.965  26.632  1.00 70.15  ? 61  ASN A C     1 
ATOM   234   O  O     . ASN A  1  35  ? -42.379 100.023 26.696  1.00 71.66  ? 61  ASN A O     1 
ATOM   235   C  CB    . ASN A  1  35  ? -40.451 100.733 28.912  1.00 70.69  ? 61  ASN A CB    1 
ATOM   236   C  CG    . ASN A  1  35  ? -39.651 100.435 30.170  1.00 72.05  ? 61  ASN A CG    1 
ATOM   237   O  OD1   . ASN A  1  35  ? -40.157 99.831  31.119  1.00 71.93  ? 61  ASN A OD1   1 
ATOM   238   N  ND2   . ASN A  1  35  ? -38.384 100.841 30.172  1.00 70.39  ? 61  ASN A ND2   1 
ATOM   239   N  N     . GLU A  1  36  ? -40.461 100.181 25.513  1.00 68.58  ? 62  GLU A N     1 
ATOM   240   C  CA    . GLU A  1  36  ? -41.116 100.498 24.255  1.00 67.17  ? 62  GLU A CA    1 
ATOM   241   C  C     . GLU A  1  36  ? -41.605 99.211  23.580  1.00 67.50  ? 62  GLU A C     1 
ATOM   242   O  O     . GLU A  1  36  ? -41.482 98.123  24.143  1.00 68.70  ? 62  GLU A O     1 
ATOM   243   C  CB    . GLU A  1  36  ? -40.133 101.242 23.354  1.00 65.60  ? 62  GLU A CB    1 
ATOM   244   C  CG    . GLU A  1  36  ? -39.432 102.392 24.070  1.00 64.27  ? 62  GLU A CG    1 
ATOM   245   C  CD    . GLU A  1  36  ? -38.437 103.150 23.198  1.00 66.19  ? 62  GLU A CD    1 
ATOM   246   O  OE1   . GLU A  1  36  ? -38.153 102.721 22.060  1.00 66.30  ? 62  GLU A OE1   1 
ATOM   247   O  OE2   . GLU A  1  36  ? -37.933 104.195 23.656  1.00 65.50  ? 62  GLU A OE2   1 
ATOM   248   N  N     . ASN A  1  37  ? -42.231 99.353  22.417  1.00 67.63  ? 63  ASN A N     1 
ATOM   249   C  CA    . ASN A  1  37  ? -42.724 98.215  21.639  1.00 68.20  ? 63  ASN A CA    1 
ATOM   250   C  C     . ASN A  1  37  ? -41.964 98.248  20.327  1.00 66.89  ? 63  ASN A C     1 
ATOM   251   O  O     . ASN A  1  37  ? -41.291 99.232  20.016  1.00 65.11  ? 63  ASN A O     1 
ATOM   252   C  CB    . ASN A  1  37  ? -44.221 98.355  21.314  1.00 73.36  ? 63  ASN A CB    1 
ATOM   253   C  CG    . ASN A  1  37  ? -45.109 98.103  22.506  1.00 78.81  ? 63  ASN A CG    1 
ATOM   254   O  OD1   . ASN A  1  37  ? -45.824 99.002  22.966  1.00 81.01  ? 63  ASN A OD1   1 
ATOM   255   N  ND2   . ASN A  1  37  ? -45.090 96.867  23.008  1.00 81.39  ? 63  ASN A ND2   1 
ATOM   256   N  N     . PRO A  1  38  ? -42.085 97.183  19.523  1.00 66.16  ? 64  PRO A N     1 
ATOM   257   C  CA    . PRO A  1  38  ? -41.391 97.128  18.234  1.00 65.08  ? 64  PRO A CA    1 
ATOM   258   C  C     . PRO A  1  38  ? -41.819 98.261  17.305  1.00 64.98  ? 64  PRO A C     1 
ATOM   259   O  O     . PRO A  1  38  ? -41.047 98.702  16.455  1.00 63.76  ? 64  PRO A O     1 
ATOM   260   C  CB    . PRO A  1  38  ? -41.841 95.779  17.673  1.00 64.35  ? 64  PRO A CB    1 
ATOM   261   C  CG    . PRO A  1  38  ? -42.043 94.950  18.903  1.00 65.45  ? 64  PRO A CG    1 
ATOM   262   C  CD    . PRO A  1  38  ? -42.761 95.904  19.814  1.00 66.09  ? 64  PRO A CD    1 
ATOM   263   N  N     . TYR A  1  39  ? -43.032 98.770  17.517  1.00 66.24  ? 65  TYR A N     1 
ATOM   264   C  CA    . TYR A  1  39  ? -43.581 99.818  16.660  1.00 66.30  ? 65  TYR A CA    1 
ATOM   265   C  C     . TYR A  1  39  ? -43.416 101.269 17.100  1.00 67.30  ? 65  TYR A C     1 
ATOM   266   O  O     . TYR A  1  39  ? -43.436 102.168 16.252  1.00 67.27  ? 65  TYR A O     1 
ATOM   267   C  CB    . TYR A  1  39  ? -45.023 99.479  16.283  1.00 63.67  ? 65  TYR A CB    1 
ATOM   268   C  CG    . TYR A  1  39  ? -45.125 98.099  15.659  1.00 62.39  ? 65  TYR A CG    1 
ATOM   269   C  CD1   . TYR A  1  39  ? -45.558 97.001  16.412  1.00 61.96  ? 65  TYR A CD1   1 
ATOM   270   C  CD2   . TYR A  1  39  ? -44.708 97.873  14.341  1.00 61.48  ? 65  TYR A CD2   1 
ATOM   271   C  CE1   . TYR A  1  39  ? -45.566 95.712  15.874  1.00 62.69  ? 65  TYR A CE1   1 
ATOM   272   C  CE2   . TYR A  1  39  ? -44.714 96.587  13.791  1.00 62.07  ? 65  TYR A CE2   1 
ATOM   273   C  CZ    . TYR A  1  39  ? -45.140 95.510  14.562  1.00 63.52  ? 65  TYR A CZ    1 
ATOM   274   O  OH    . TYR A  1  39  ? -45.119 94.232  14.036  1.00 65.23  ? 65  TYR A OH    1 
ATOM   275   N  N     . ASN A  1  40  ? -43.252 101.508 18.402  1.00 67.63  ? 66  ASN A N     1 
ATOM   276   C  CA    . ASN A  1  40  ? -43.023 102.876 18.882  1.00 69.21  ? 66  ASN A CA    1 
ATOM   277   C  C     . ASN A  1  40  ? -41.580 103.026 19.353  1.00 69.79  ? 66  ASN A C     1 
ATOM   278   O  O     . ASN A  1  40  ? -41.213 104.022 19.982  1.00 69.70  ? 66  ASN A O     1 
ATOM   279   C  CB    . ASN A  1  40  ? -44.011 103.292 19.979  1.00 69.90  ? 66  ASN A CB    1 
ATOM   280   C  CG    . ASN A  1  40  ? -43.926 102.425 21.211  1.00 70.96  ? 66  ASN A CG    1 
ATOM   281   O  OD1   . ASN A  1  40  ? -43.647 102.905 22.314  1.00 69.12  ? 66  ASN A OD1   1 
ATOM   282   N  ND2   . ASN A  1  40  ? -44.201 101.142 21.038  1.00 72.82  ? 66  ASN A ND2   1 
ATOM   283   N  N     . ASN A  1  41  ? -40.768 102.033 18.985  1.00 70.81  ? 67  ASN A N     1 
ATOM   284   C  CA    . ASN A  1  41  ? -39.343 101.963 19.303  1.00 69.59  ? 67  ASN A CA    1 
ATOM   285   C  C     . ASN A  1  41  ? -38.652 103.198 18.750  1.00 69.29  ? 67  ASN A C     1 
ATOM   286   O  O     . ASN A  1  41  ? -38.732 103.482 17.556  1.00 67.55  ? 67  ASN A O     1 
ATOM   287   C  CB    . ASN A  1  41  ? -38.745 100.688 18.677  1.00 70.59  ? 67  ASN A CB    1 
ATOM   288   C  CG    . ASN A  1  41  ? -37.259 100.492 18.992  1.00 69.93  ? 67  ASN A CG    1 
ATOM   289   O  OD1   . ASN A  1  41  ? -36.865 100.389 20.149  1.00 70.64  ? 67  ASN A OD1   1 
ATOM   290   N  ND2   . ASN A  1  41  ? -36.440 100.405 17.949  1.00 68.29  ? 67  ASN A ND2   1 
ATOM   291   N  N     . GLY A  1  42  ? -38.005 103.949 19.636  1.00 70.32  ? 68  GLY A N     1 
ATOM   292   C  CA    . GLY A  1  42  ? -37.308 105.155 19.218  1.00 71.56  ? 68  GLY A CA    1 
ATOM   293   C  C     . GLY A  1  42  ? -37.925 106.426 19.765  1.00 71.70  ? 68  GLY A C     1 
ATOM   294   O  O     . GLY A  1  42  ? -37.437 107.528 19.497  1.00 71.00  ? 68  GLY A O     1 
ATOM   295   N  N     . VAL A  1  43  ? -38.997 106.266 20.539  1.00 72.35  ? 69  VAL A N     1 
ATOM   296   C  CA    . VAL A  1  43  ? -39.698 107.390 21.142  1.00 72.82  ? 69  VAL A CA    1 
ATOM   297   C  C     . VAL A  1  43  ? -38.803 108.120 22.152  1.00 73.07  ? 69  VAL A C     1 
ATOM   298   O  O     . VAL A  1  43  ? -38.687 109.349 22.111  1.00 73.04  ? 69  VAL A O     1 
ATOM   299   C  CB    . VAL A  1  43  ? -41.017 106.930 21.823  1.00 73.02  ? 69  VAL A CB    1 
ATOM   300   C  CG1   . VAL A  1  43  ? -40.733 105.926 22.932  1.00 72.81  ? 69  VAL A CG1   1 
ATOM   301   C  CG2   . VAL A  1  43  ? -41.776 108.129 22.369  1.00 73.53  ? 69  VAL A CG2   1 
ATOM   302   N  N     . SER A  1  44  ? -38.143 107.354 23.022  1.00 72.44  ? 70  SER A N     1 
ATOM   303   C  CA    . SER A  1  44  ? -37.257 107.909 24.038  1.00 71.91  ? 70  SER A CA    1 
ATOM   304   C  C     . SER A  1  44  ? -36.092 108.680 23.436  1.00 73.08  ? 70  SER A C     1 
ATOM   305   O  O     . SER A  1  44  ? -35.702 109.720 23.953  1.00 74.19  ? 70  SER A O     1 
ATOM   306   C  CB    . SER A  1  44  ? -36.726 106.799 24.942  1.00 70.45  ? 70  SER A CB    1 
ATOM   307   O  OG    . SER A  1  44  ? -37.774 106.174 25.662  1.00 69.17  ? 70  SER A OG    1 
ATOM   308   N  N     . ASN A  1  45  ? -35.532 108.166 22.346  1.00 75.34  ? 71  ASN A N     1 
ATOM   309   C  CA    . ASN A  1  45  ? -34.411 108.826 21.687  1.00 76.84  ? 71  ASN A CA    1 
ATOM   310   C  C     . ASN A  1  45  ? -34.902 110.143 21.112  1.00 77.88  ? 71  ASN A C     1 
ATOM   311   O  O     . ASN A  1  45  ? -34.172 111.134 21.090  1.00 77.64  ? 71  ASN A O     1 
ATOM   312   C  CB    . ASN A  1  45  ? -33.837 107.944 20.567  1.00 77.00  ? 71  ASN A CB    1 
ATOM   313   C  CG    . ASN A  1  45  ? -32.571 108.533 19.948  1.00 77.62  ? 71  ASN A CG    1 
ATOM   314   O  OD1   . ASN A  1  45  ? -31.724 109.090 20.653  1.00 78.98  ? 71  ASN A OD1   1 
ATOM   315   N  ND2   . ASN A  1  45  ? -32.440 108.414 18.629  1.00 76.04  ? 71  ASN A ND2   1 
ATOM   316   N  N     . LEU A  1  46  ? -36.154 110.147 20.666  1.00 79.56  ? 72  LEU A N     1 
ATOM   317   C  CA    . LEU A  1  46  ? -36.765 111.339 20.085  1.00 81.67  ? 72  LEU A CA    1 
ATOM   318   C  C     . LEU A  1  46  ? -36.940 112.424 21.160  1.00 81.61  ? 72  LEU A C     1 
ATOM   319   O  O     . LEU A  1  46  ? -36.595 113.588 20.943  1.00 79.80  ? 72  LEU A O     1 
ATOM   320   C  CB    . LEU A  1  46  ? -38.106 110.969 19.432  1.00 81.69  ? 72  LEU A CB    1 
ATOM   321   C  CG    . LEU A  1  46  ? -38.541 111.787 18.213  1.00 82.51  ? 72  LEU A CG    1 
ATOM   322   C  CD1   . LEU A  1  46  ? -37.342 112.190 17.359  1.00 82.05  ? 72  LEU A CD1   1 
ATOM   323   C  CD2   . LEU A  1  46  ? -39.527 110.974 17.400  1.00 83.02  ? 72  LEU A CD2   1 
ATOM   324   N  N     . TRP A  1  47  ? -37.441 112.021 22.326  1.00 82.79  ? 73  TRP A N     1 
ATOM   325   C  CA    . TRP A  1  47  ? -37.628 112.939 23.442  1.00 84.62  ? 73  TRP A CA    1 
ATOM   326   C  C     . TRP A  1  47  ? -36.311 113.633 23.743  1.00 85.86  ? 73  TRP A C     1 
ATOM   327   O  O     . TRP A  1  47  ? -36.235 114.863 23.744  1.00 86.93  ? 73  TRP A O     1 
ATOM   328   C  CB    . TRP A  1  47  ? -38.109 112.192 24.687  1.00 85.18  ? 73  TRP A CB    1 
ATOM   329   C  CG    . TRP A  1  47  ? -39.593 112.200 24.838  1.00 87.76  ? 73  TRP A CG    1 
ATOM   330   C  CD1   . TRP A  1  47  ? -40.425 111.121 24.837  1.00 89.02  ? 73  TRP A CD1   1 
ATOM   331   C  CD2   . TRP A  1  47  ? -40.430 113.352 24.986  1.00 89.34  ? 73  TRP A CD2   1 
ATOM   332   N  NE1   . TRP A  1  47  ? -41.733 111.528 24.968  1.00 89.09  ? 73  TRP A NE1   1 
ATOM   333   C  CE2   . TRP A  1  47  ? -41.763 112.893 25.062  1.00 89.53  ? 73  TRP A CE2   1 
ATOM   334   C  CE3   . TRP A  1  47  ? -40.183 114.731 25.059  1.00 89.83  ? 73  TRP A CE3   1 
ATOM   335   C  CZ2   . TRP A  1  47  ? -42.847 113.761 25.204  1.00 90.54  ? 73  TRP A CZ2   1 
ATOM   336   C  CZ3   . TRP A  1  47  ? -41.260 115.594 25.198  1.00 90.10  ? 73  TRP A CZ3   1 
ATOM   337   C  CH2   . TRP A  1  47  ? -42.577 115.104 25.270  1.00 90.86  ? 73  TRP A CH2   1 
ATOM   338   N  N     . LYS A  1  48  ? -35.270 112.830 23.950  1.00 86.03  ? 74  LYS A N     1 
ATOM   339   C  CA    . LYS A  1  48  ? -33.937 113.337 24.236  1.00 85.70  ? 74  LYS A CA    1 
ATOM   340   C  C     . LYS A  1  48  ? -33.531 114.399 23.221  1.00 86.39  ? 74  LYS A C     1 
ATOM   341   O  O     . LYS A  1  48  ? -32.998 115.443 23.588  1.00 87.53  ? 74  LYS A O     1 
ATOM   342   C  CB    . LYS A  1  48  ? -32.920 112.193 24.202  1.00 85.10  ? 74  LYS A CB    1 
ATOM   343   C  CG    . LYS A  1  48  ? -31.476 112.656 24.311  1.00 84.72  ? 74  LYS A CG    1 
ATOM   344   C  CD    . LYS A  1  48  ? -30.489 111.580 23.899  1.00 83.82  ? 74  LYS A CD    1 
ATOM   345   C  CE    . LYS A  1  48  ? -29.116 112.187 23.666  1.00 83.10  ? 74  LYS A CE    1 
ATOM   346   N  NZ    . LYS A  1  48  ? -28.112 111.177 23.242  1.00 83.42  ? 74  LYS A NZ    1 
ATOM   347   N  N     . ASN A  1  49  ? -33.815 114.141 21.949  1.00 86.91  ? 75  ASN A N     1 
ATOM   348   C  CA    . ASN A  1  49  ? -33.456 115.072 20.886  1.00 88.05  ? 75  ASN A CA    1 
ATOM   349   C  C     . ASN A  1  49  ? -34.223 116.393 20.853  1.00 88.82  ? 75  ASN A C     1 
ATOM   350   O  O     . ASN A  1  49  ? -33.690 117.403 20.381  1.00 88.06  ? 75  ASN A O     1 
ATOM   351   C  CB    . ASN A  1  49  ? -33.504 114.377 19.524  1.00 87.74  ? 75  ASN A CB    1 
ATOM   352   C  CG    . ASN A  1  49  ? -32.287 113.511 19.274  1.00 86.70  ? 75  ASN A CG    1 
ATOM   353   O  OD1   . ASN A  1  49  ? -31.269 113.983 18.765  1.00 85.64  ? 75  ASN A OD1   1 
ATOM   354   N  ND2   . ASN A  1  49  ? -32.383 112.237 19.632  1.00 86.03  ? 75  ASN A ND2   1 
ATOM   355   N  N     . ILE A  1  50  ? -35.475 116.394 21.307  1.00 89.64  ? 76  ILE A N     1 
ATOM   356   C  CA    . ILE A  1  50  ? -36.229 117.647 21.328  1.00 91.17  ? 76  ILE A CA    1 
ATOM   357   C  C     . ILE A  1  50  ? -35.850 118.431 22.590  1.00 92.20  ? 76  ILE A C     1 
ATOM   358   O  O     . ILE A  1  50  ? -35.724 119.658 22.560  1.00 92.04  ? 76  ILE A O     1 
ATOM   359   C  CB    . ILE A  1  50  ? -37.778 117.448 21.238  1.00 90.90  ? 76  ILE A CB    1 
ATOM   360   C  CG1   . ILE A  1  50  ? -38.305 116.635 22.417  1.00 90.53  ? 76  ILE A CG1   1 
ATOM   361   C  CG2   . ILE A  1  50  ? -38.163 116.796 19.916  1.00 89.98  ? 76  ILE A CG2   1 
ATOM   362   C  CD1   . ILE A  1  50  ? -39.786 116.439 22.362  1.00 90.85  ? 76  ILE A CD1   1 
ATOM   363   N  N     . PHE A  1  51  ? -35.616 117.703 23.681  1.00 93.14  ? 77  PHE A N     1 
ATOM   364   C  CA    . PHE A  1  51  ? -35.219 118.299 24.951  1.00 94.42  ? 77  PHE A CA    1 
ATOM   365   C  C     . PHE A  1  51  ? -33.904 119.051 24.753  1.00 95.16  ? 77  PHE A C     1 
ATOM   366   O  O     . PHE A  1  51  ? -33.598 119.982 25.491  1.00 95.26  ? 77  PHE A O     1 
ATOM   367   C  CB    . PHE A  1  51  ? -35.062 117.200 26.007  1.00 95.62  ? 77  PHE A CB    1 
ATOM   368   C  CG    . PHE A  1  51  ? -34.581 117.694 27.346  1.00 98.28  ? 77  PHE A CG    1 
ATOM   369   C  CD1   . PHE A  1  51  ? -35.480 117.921 28.384  1.00 99.17  ? 77  PHE A CD1   1 
ATOM   370   C  CD2   . PHE A  1  51  ? -33.225 117.918 27.576  1.00 98.94  ? 77  PHE A CD2   1 
ATOM   371   C  CE1   . PHE A  1  51  ? -35.031 118.362 29.633  1.00 100.09 ? 77  PHE A CE1   1 
ATOM   372   C  CE2   . PHE A  1  51  ? -32.769 118.359 28.818  1.00 99.76  ? 77  PHE A CE2   1 
ATOM   373   C  CZ    . PHE A  1  51  ? -33.673 118.582 29.848  1.00 99.85  ? 77  PHE A CZ    1 
ATOM   374   N  N     . LEU A  1  52  ? -33.137 118.637 23.748  1.00 96.46  ? 78  LEU A N     1 
ATOM   375   C  CA    . LEU A  1  52  ? -31.856 119.258 23.423  1.00 98.36  ? 78  LEU A CA    1 
ATOM   376   C  C     . LEU A  1  52  ? -31.963 120.121 22.168  1.00 99.80  ? 78  LEU A C     1 
ATOM   377   O  O     . LEU A  1  52  ? -30.953 120.630 21.673  1.00 99.25  ? 78  LEU A O     1 
ATOM   378   C  CB    . LEU A  1  52  ? -30.787 118.186 23.179  1.00 98.69  ? 78  LEU A CB    1 
ATOM   379   C  CG    . LEU A  1  52  ? -30.421 117.191 24.283  1.00 99.06  ? 78  LEU A CG    1 
ATOM   380   C  CD1   . LEU A  1  52  ? -29.286 116.302 23.796  1.00 98.51  ? 78  LEU A CD1   1 
ATOM   381   C  CD2   . LEU A  1  52  ? -30.005 117.925 25.543  1.00 99.21  ? 78  LEU A CD2   1 
ATOM   382   N  N     . SER A  1  53  ? -33.181 120.281 21.654  1.00 101.95 ? 79  SER A N     1 
ATOM   383   C  CA    . SER A  1  53  ? -33.412 121.058 20.436  1.00 104.35 ? 79  SER A CA    1 
ATOM   384   C  C     . SER A  1  53  ? -32.944 122.500 20.524  1.00 104.93 ? 79  SER A C     1 
ATOM   385   O  O     . SER A  1  53  ? -32.909 123.085 21.604  1.00 104.77 ? 79  SER A O     1 
ATOM   386   C  CB    . SER A  1  53  ? -34.886 121.022 20.038  1.00 105.50 ? 79  SER A CB    1 
ATOM   387   O  OG    . SER A  1  53  ? -35.082 121.657 18.785  1.00 109.15 ? 79  SER A OG    1 
ATOM   388   N  N     . LYS A  1  54  ? -32.630 123.071 19.363  1.00 106.48 ? 80  LYS A N     1 
ATOM   389   C  CA    . LYS A  1  54  ? -32.143 124.442 19.251  1.00 108.17 ? 80  LYS A CA    1 
ATOM   390   C  C     . LYS A  1  54  ? -32.964 125.462 20.037  1.00 108.64 ? 80  LYS A C     1 
ATOM   391   O  O     . LYS A  1  54  ? -32.401 126.353 20.673  1.00 108.47 ? 80  LYS A O     1 
ATOM   392   C  CB    . LYS A  1  54  ? -32.043 124.848 17.777  1.00 108.97 ? 80  LYS A CB    1 
ATOM   393   C  CG    . LYS A  1  54  ? -31.412 126.213 17.550  1.00 111.08 ? 80  LYS A CG    1 
ATOM   394   C  CD    . LYS A  1  54  ? -30.927 126.376 16.117  1.00 113.63 ? 80  LYS A CD    1 
ATOM   395   C  CE    . LYS A  1  54  ? -29.735 125.466 15.818  1.00 115.02 ? 80  LYS A CE    1 
ATOM   396   N  NZ    . LYS A  1  54  ? -29.161 125.707 14.462  1.00 115.41 ? 80  LYS A NZ    1 
ATOM   397   N  N     . GLU A  1  55  ? -34.287 125.318 20.011  1.00 109.32 ? 81  GLU A N     1 
ATOM   398   C  CA    . GLU A  1  55  ? -35.167 126.230 20.739  1.00 109.96 ? 81  GLU A CA    1 
ATOM   399   C  C     . GLU A  1  55  ? -34.935 126.145 22.244  1.00 109.26 ? 81  GLU A C     1 
ATOM   400   O  O     . GLU A  1  55  ? -34.463 127.097 22.862  1.00 109.80 ? 81  GLU A O     1 
ATOM   401   C  CB    . GLU A  1  55  ? -36.639 125.923 20.455  1.00 111.70 ? 81  GLU A CB    1 
ATOM   402   C  CG    . GLU A  1  55  ? -37.146 126.358 19.092  1.00 114.57 ? 81  GLU A CG    1 
ATOM   403   C  CD    . GLU A  1  55  ? -38.668 126.310 19.005  1.00 116.33 ? 81  GLU A CD    1 
ATOM   404   O  OE1   . GLU A  1  55  ? -39.254 125.227 19.234  1.00 117.15 ? 81  GLU A OE1   1 
ATOM   405   O  OE2   . GLU A  1  55  ? -39.281 127.361 18.719  1.00 117.23 ? 81  GLU A OE2   1 
ATOM   406   N  N     . ASN A  1  56  ? -35.258 124.989 22.816  1.00 108.06 ? 82  ASN A N     1 
ATOM   407   C  CA    . ASN A  1  56  ? -35.121 124.746 24.247  1.00 106.70 ? 82  ASN A CA    1 
ATOM   408   C  C     . ASN A  1  56  ? -33.699 124.946 24.752  1.00 106.46 ? 82  ASN A C     1 
ATOM   409   O  O     . ASN A  1  56  ? -33.494 125.441 25.858  1.00 106.01 ? 82  ASN A O     1 
ATOM   410   C  CB    . ASN A  1  56  ? -35.590 123.326 24.576  1.00 106.16 ? 82  ASN A CB    1 
ATOM   411   C  CG    . ASN A  1  56  ? -35.819 123.113 26.058  1.00 105.55 ? 82  ASN A CG    1 
ATOM   412   O  OD1   . ASN A  1  56  ? -36.473 123.918 26.717  1.00 106.05 ? 82  ASN A OD1   1 
ATOM   413   N  ND2   . ASN A  1  56  ? -35.292 122.018 26.586  1.00 105.53 ? 82  ASN A ND2   1 
ATOM   414   N  N     . SER A  1  57  ? -32.723 124.579 23.929  1.00 106.89 ? 83  SER A N     1 
ATOM   415   C  CA    . SER A  1  57  ? -31.315 124.700 24.301  1.00 107.32 ? 83  SER A CA    1 
ATOM   416   C  C     . SER A  1  57  ? -30.840 126.153 24.347  1.00 106.92 ? 83  SER A C     1 
ATOM   417   O  O     . SER A  1  57  ? -29.958 126.494 25.134  1.00 107.18 ? 83  SER A O     1 
ATOM   418   C  CB    . SER A  1  57  ? -30.438 123.874 23.347  1.00 107.61 ? 83  SER A CB    1 
ATOM   419   O  OG    . SER A  1  57  ? -29.176 123.568 23.921  1.00 107.04 ? 83  SER A OG    1 
ATOM   420   N  N     . ALA A  1  58  ? -31.424 127.002 23.504  1.00 106.54 ? 84  ALA A N     1 
ATOM   421   C  CA    . ALA A  1  58  ? -31.059 128.419 23.460  1.00 106.25 ? 84  ALA A CA    1 
ATOM   422   C  C     . ALA A  1  58  ? -31.571 129.172 24.688  1.00 106.04 ? 84  ALA A C     1 
ATOM   423   O  O     . ALA A  1  58  ? -30.966 130.157 25.121  1.00 105.56 ? 84  ALA A O     1 
ATOM   424   C  CB    . ALA A  1  58  ? -31.589 129.066 22.185  1.00 105.84 ? 84  ALA A CB    1 
ATOM   425   N  N     . VAL A  1  59  ? -32.681 128.696 25.247  1.00 105.64 ? 85  VAL A N     1 
ATOM   426   C  CA    . VAL A  1  59  ? -33.288 129.308 26.425  1.00 105.22 ? 85  VAL A CA    1 
ATOM   427   C  C     . VAL A  1  59  ? -32.396 129.151 27.651  1.00 105.53 ? 85  VAL A C     1 
ATOM   428   O  O     . VAL A  1  59  ? -32.168 130.115 28.379  1.00 106.27 ? 85  VAL A O     1 
ATOM   429   C  CB    . VAL A  1  59  ? -34.680 128.703 26.721  1.00 104.90 ? 85  VAL A CB    1 
ATOM   430   C  CG1   . VAL A  1  59  ? -35.266 129.308 27.981  1.00 104.15 ? 85  VAL A CG1   1 
ATOM   431   C  CG2   . VAL A  1  59  ? -35.614 128.937 25.547  1.00 104.99 ? 85  VAL A CG2   1 
ATOM   432   N  N     . ALA A  1  60  ? -31.891 127.940 27.873  1.00 105.88 ? 86  ALA A N     1 
ATOM   433   C  CA    . ALA A  1  60  ? -31.017 127.663 29.014  1.00 106.09 ? 86  ALA A CA    1 
ATOM   434   C  C     . ALA A  1  60  ? -29.608 128.218 28.819  1.00 106.10 ? 86  ALA A C     1 
ATOM   435   O  O     . ALA A  1  60  ? -28.894 128.453 29.791  1.00 105.28 ? 86  ALA A O     1 
ATOM   436   C  CB    . ALA A  1  60  ? -30.952 126.168 29.278  1.00 106.14 ? 86  ALA A CB    1 
ATOM   437   N  N     . ALA A  1  61  ? -29.213 128.416 27.562  1.00 106.64 ? 87  ALA A N     1 
ATOM   438   C  CA    . ALA A  1  61  ? -27.889 128.943 27.236  1.00 107.50 ? 87  ALA A CA    1 
ATOM   439   C  C     . ALA A  1  61  ? -27.767 130.414 27.613  1.00 108.40 ? 87  ALA A C     1 
ATOM   440   O  O     . ALA A  1  61  ? -26.714 130.852 28.078  1.00 109.14 ? 87  ALA A O     1 
ATOM   441   C  CB    . ALA A  1  61  ? -27.586 128.744 25.761  1.00 107.51 ? 87  ALA A CB    1 
ATOM   442   N  N     . LYS A  1  62  ? -28.836 131.176 27.386  1.00 109.18 ? 88  LYS A N     1 
ATOM   443   C  CA    . LYS A  1  62  ? -28.863 132.598 27.740  1.00 109.53 ? 88  LYS A CA    1 
ATOM   444   C  C     . LYS A  1  62  ? -28.627 132.682 29.245  1.00 108.96 ? 88  LYS A C     1 
ATOM   445   O  O     . LYS A  1  62  ? -27.830 133.489 29.726  1.00 108.33 ? 88  LYS A O     1 
ATOM   446   C  CB    . LYS A  1  62  ? -30.241 133.203 27.432  1.00 110.63 ? 88  LYS A CB    1 
ATOM   447   C  CG    . LYS A  1  62  ? -30.531 133.494 25.964  1.00 112.04 ? 88  LYS A CG    1 
ATOM   448   C  CD    . LYS A  1  62  ? -29.852 134.775 25.493  1.00 112.42 ? 88  LYS A CD    1 
ATOM   449   C  CE    . LYS A  1  62  ? -30.316 135.158 24.091  1.00 112.97 ? 88  LYS A CE    1 
ATOM   450   N  NZ    . LYS A  1  62  ? -29.651 136.393 23.590  1.00 112.46 ? 88  LYS A NZ    1 
ATOM   451   N  N     . GLU A  1  63  ? -29.307 131.789 29.960  1.00 108.93 ? 89  GLU A N     1 
ATOM   452   C  CA    . GLU A  1  63  ? -29.249 131.688 31.411  1.00 109.12 ? 89  GLU A CA    1 
ATOM   453   C  C     . GLU A  1  63  ? -27.910 131.145 31.925  1.00 108.92 ? 89  GLU A C     1 
ATOM   454   O  O     . GLU A  1  63  ? -27.652 131.155 33.132  1.00 108.71 ? 89  GLU A O     1 
ATOM   455   C  CB    . GLU A  1  63  ? -30.386 130.781 31.892  1.00 109.63 ? 89  GLU A CB    1 
ATOM   456   C  CG    . GLU A  1  63  ? -30.842 131.035 33.313  1.00 111.34 ? 89  GLU A CG    1 
ATOM   457   C  CD    . GLU A  1  63  ? -31.606 132.339 33.452  1.00 112.78 ? 89  GLU A CD    1 
ATOM   458   O  OE1   . GLU A  1  63  ? -32.854 132.291 33.492  1.00 113.62 ? 89  GLU A OE1   1 
ATOM   459   O  OE2   . GLU A  1  63  ? -30.964 133.411 33.521  1.00 113.06 ? 89  GLU A OE2   1 
ATOM   460   N  N     . GLY A  1  64  ? -27.067 130.673 31.009  1.00 108.63 ? 90  GLY A N     1 
ATOM   461   C  CA    . GLY A  1  64  ? -25.774 130.124 31.391  1.00 107.94 ? 90  GLY A CA    1 
ATOM   462   C  C     . GLY A  1  64  ? -25.860 128.681 31.861  1.00 107.21 ? 90  GLY A C     1 
ATOM   463   O  O     . GLY A  1  64  ? -25.158 128.276 32.791  1.00 106.72 ? 90  GLY A O     1 
ATOM   464   N  N     . LEU A  1  65  ? -26.747 127.917 31.228  1.00 106.55 ? 91  LEU A N     1 
ATOM   465   C  CA    . LEU A  1  65  ? -26.956 126.508 31.548  1.00 106.08 ? 91  LEU A CA    1 
ATOM   466   C  C     . LEU A  1  65  ? -26.625 125.619 30.345  1.00 105.42 ? 91  LEU A C     1 
ATOM   467   O  O     . LEU A  1  65  ? -26.735 126.048 29.193  1.00 105.49 ? 91  LEU A O     1 
ATOM   468   C  CB    . LEU A  1  65  ? -28.409 126.274 31.979  1.00 106.10 ? 91  LEU A CB    1 
ATOM   469   C  CG    . LEU A  1  65  ? -28.829 126.544 33.428  1.00 106.39 ? 91  LEU A CG    1 
ATOM   470   C  CD1   . LEU A  1  65  ? -28.379 127.913 33.892  1.00 106.33 ? 91  LEU A CD1   1 
ATOM   471   C  CD2   . LEU A  1  65  ? -30.338 126.404 33.549  1.00 105.77 ? 91  LEU A CD2   1 
ATOM   472   N  N     . ALA A  1  66  ? -26.205 124.387 30.624  1.00 104.53 ? 92  ALA A N     1 
ATOM   473   C  CA    . ALA A  1  66  ? -25.862 123.423 29.579  1.00 103.16 ? 92  ALA A CA    1 
ATOM   474   C  C     . ALA A  1  66  ? -26.766 122.197 29.694  1.00 102.37 ? 92  ALA A C     1 
ATOM   475   O  O     . ALA A  1  66  ? -27.124 121.780 30.797  1.00 102.23 ? 92  ALA A O     1 
ATOM   476   C  CB    . ALA A  1  66  ? -24.403 123.020 29.692  1.00 102.83 ? 92  ALA A CB    1 
ATOM   477   N  N     . LEU A  1  67  ? -27.126 121.616 28.555  1.00 101.68 ? 93  LEU A N     1 
ATOM   478   C  CA    . LEU A  1  67  ? -28.008 120.450 28.543  1.00 100.56 ? 93  LEU A CA    1 
ATOM   479   C  C     . LEU A  1  67  ? -27.347 119.120 28.176  1.00 99.37  ? 93  LEU A C     1 
ATOM   480   O  O     . LEU A  1  67  ? -26.435 119.068 27.346  1.00 99.01  ? 93  LEU A O     1 
ATOM   481   C  CB    . LEU A  1  67  ? -29.201 120.713 27.621  1.00 100.82 ? 93  LEU A CB    1 
ATOM   482   C  CG    . LEU A  1  67  ? -30.128 121.857 28.038  1.00 100.21 ? 93  LEU A CG    1 
ATOM   483   C  CD1   . LEU A  1  67  ? -31.202 122.065 26.987  1.00 100.16 ? 93  LEU A CD1   1 
ATOM   484   C  CD2   . LEU A  1  67  ? -30.748 121.543 29.385  1.00 100.43 ? 93  LEU A CD2   1 
ATOM   485   N  N     . SER A  1  68  ? -27.839 118.048 28.797  1.00 98.04  ? 94  SER A N     1 
ATOM   486   C  CA    . SER A  1  68  ? -27.342 116.690 28.570  1.00 97.41  ? 94  SER A CA    1 
ATOM   487   C  C     . SER A  1  68  ? -28.420 115.650 28.866  1.00 96.11  ? 94  SER A C     1 
ATOM   488   O  O     . SER A  1  68  ? -29.179 115.784 29.831  1.00 95.81  ? 94  SER A O     1 
ATOM   489   C  CB    . SER A  1  68  ? -26.110 116.403 29.440  1.00 98.18  ? 94  SER A CB    1 
ATOM   490   O  OG    . SER A  1  68  ? -24.936 116.966 28.875  1.00 100.70 ? 94  SER A OG    1 
ATOM   491   N  N     . SER A  1  69  ? -28.473 114.610 28.034  1.00 94.44  ? 95  SER A N     1 
ATOM   492   C  CA    . SER A  1  69  ? -29.449 113.534 28.196  1.00 91.86  ? 95  SER A CA    1 
ATOM   493   C  C     . SER A  1  69  ? -28.917 112.219 27.638  1.00 89.97  ? 95  SER A C     1 
ATOM   494   O  O     . SER A  1  69  ? -28.100 112.210 26.717  1.00 89.27  ? 95  SER A O     1 
ATOM   495   C  CB    . SER A  1  69  ? -30.764 113.897 27.502  1.00 91.53  ? 95  SER A CB    1 
ATOM   496   O  OG    . SER A  1  69  ? -31.720 112.863 27.658  1.00 90.81  ? 95  SER A OG    1 
ATOM   497   N  N     . ASN A  1  70  ? -29.388 111.110 28.201  1.00 88.38  ? 96  ASN A N     1 
ATOM   498   C  CA    . ASN A  1  70  ? -28.959 109.788 27.763  1.00 87.35  ? 96  ASN A CA    1 
ATOM   499   C  C     . ASN A  1  70  ? -30.059 108.738 27.851  1.00 84.96  ? 96  ASN A C     1 
ATOM   500   O  O     . ASN A  1  70  ? -30.711 108.585 28.891  1.00 83.72  ? 96  ASN A O     1 
ATOM   501   C  CB    . ASN A  1  70  ? -27.741 109.321 28.572  1.00 89.95  ? 96  ASN A CB    1 
ATOM   502   C  CG    . ASN A  1  70  ? -27.391 107.857 28.317  1.00 91.87  ? 96  ASN A CG    1 
ATOM   503   O  OD1   . ASN A  1  70  ? -27.592 107.003 29.184  1.00 93.27  ? 96  ASN A OD1   1 
ATOM   504   N  ND2   . ASN A  1  70  ? -26.894 107.560 27.116  1.00 92.56  ? 96  ASN A ND2   1 
ATOM   505   N  N     . ILE A  1  71  ? -30.233 108.004 26.752  1.00 82.71  ? 97  ILE A N     1 
ATOM   506   C  CA    . ILE A  1  71  ? -31.228 106.935 26.667  1.00 80.12  ? 97  ILE A CA    1 
ATOM   507   C  C     . ILE A  1  71  ? -30.526 105.591 26.823  1.00 78.14  ? 97  ILE A C     1 
ATOM   508   O  O     . ILE A  1  71  ? -29.537 105.314 26.147  1.00 78.61  ? 97  ILE A O     1 
ATOM   509   C  CB    . ILE A  1  71  ? -31.956 106.928 25.302  1.00 79.77  ? 97  ILE A CB    1 
ATOM   510   C  CG1   . ILE A  1  71  ? -32.543 108.308 24.998  1.00 79.97  ? 97  ILE A CG1   1 
ATOM   511   C  CG2   . ILE A  1  71  ? -33.047 105.862 25.292  1.00 78.08  ? 97  ILE A CG2   1 
ATOM   512   C  CD1   . ILE A  1  71  ? -33.534 108.804 26.028  1.00 79.95  ? 97  ILE A CD1   1 
ATOM   513   N  N     . SER A  1  72  ? -31.039 104.770 27.727  1.00 75.58  ? 98  SER A N     1 
ATOM   514   C  CA    . SER A  1  72  ? -30.477 103.454 27.970  1.00 75.17  ? 98  SER A CA    1 
ATOM   515   C  C     . SER A  1  72  ? -31.613 102.434 27.877  1.00 75.26  ? 98  SER A C     1 
ATOM   516   O  O     . SER A  1  72  ? -32.716 102.762 27.446  1.00 76.04  ? 98  SER A O     1 
ATOM   517   C  CB    . SER A  1  72  ? -29.812 103.412 29.349  1.00 75.06  ? 98  SER A CB    1 
ATOM   518   O  OG    . SER A  1  72  ? -29.112 102.195 29.556  1.00 75.13  ? 98  SER A OG    1 
ATOM   519   N  N     . ARG A  1  73  ? -31.346 101.198 28.275  1.00 75.01  ? 99  ARG A N     1 
ATOM   520   C  CA    . ARG A  1  73  ? -32.358 100.163 28.209  1.00 74.38  ? 99  ARG A CA    1 
ATOM   521   C  C     . ARG A  1  73  ? -33.340 100.207 29.362  1.00 75.00  ? 99  ARG A C     1 
ATOM   522   O  O     . ARG A  1  73  ? -34.545 100.232 29.133  1.00 75.78  ? 99  ARG A O     1 
ATOM   523   C  CB    . ARG A  1  73  ? -31.710 98.780  28.084  1.00 73.85  ? 99  ARG A CB    1 
ATOM   524   C  CG    . ARG A  1  73  ? -31.144 98.515  26.686  1.00 72.46  ? 99  ARG A CG    1 
ATOM   525   C  CD    . ARG A  1  73  ? -30.595 97.097  26.517  1.00 68.93  ? 99  ARG A CD    1 
ATOM   526   N  NE    . ARG A  1  73  ? -30.599 96.673  25.119  1.00 64.69  ? 99  ARG A NE    1 
ATOM   527   C  CZ    . ARG A  1  73  ? -29.927 97.273  24.138  1.00 63.34  ? 99  ARG A CZ    1 
ATOM   528   N  NH1   . ARG A  1  73  ? -30.009 96.806  22.900  1.00 62.36  ? 99  ARG A NH1   1 
ATOM   529   N  NH2   . ARG A  1  73  ? -29.165 98.329  24.390  1.00 61.72  ? 99  ARG A NH2   1 
ATOM   530   N  N     . ASP A  1  74  ? -32.830 100.249 30.592  1.00 75.56  ? 100 ASP A N     1 
ATOM   531   C  CA    . ASP A  1  74  ? -33.684 100.279 31.783  1.00 75.78  ? 100 ASP A CA    1 
ATOM   532   C  C     . ASP A  1  74  ? -34.079 101.676 32.251  1.00 75.24  ? 100 ASP A C     1 
ATOM   533   O  O     . ASP A  1  74  ? -35.027 101.819 33.020  1.00 73.70  ? 100 ASP A O     1 
ATOM   534   C  CB    . ASP A  1  74  ? -32.994 99.601  32.970  1.00 77.22  ? 100 ASP A CB    1 
ATOM   535   C  CG    . ASP A  1  74  ? -32.621 98.174  32.700  1.00 78.58  ? 100 ASP A CG    1 
ATOM   536   O  OD1   . ASP A  1  74  ? -33.464 97.421  32.168  1.00 80.30  ? 100 ASP A OD1   1 
ATOM   537   O  OD2   . ASP A  1  74  ? -31.480 97.807  33.049  1.00 78.75  ? 100 ASP A OD2   1 
ATOM   538   N  N     . PHE A  1  75  ? -33.336 102.696 31.828  1.00 75.11  ? 101 PHE A N     1 
ATOM   539   C  CA    . PHE A  1  75  ? -33.620 104.049 32.287  1.00 76.07  ? 101 PHE A CA    1 
ATOM   540   C  C     . PHE A  1  75  ? -33.449 105.151 31.255  1.00 76.66  ? 101 PHE A C     1 
ATOM   541   O  O     . PHE A  1  75  ? -32.955 104.930 30.153  1.00 76.35  ? 101 PHE A O     1 
ATOM   542   C  CB    . PHE A  1  75  ? -32.772 104.372 33.527  1.00 76.87  ? 101 PHE A CB    1 
ATOM   543   C  CG    . PHE A  1  75  ? -31.307 104.542 33.235  1.00 77.27  ? 101 PHE A CG    1 
ATOM   544   C  CD1   . PHE A  1  75  ? -30.808 105.778 32.828  1.00 77.32  ? 101 PHE A CD1   1 
ATOM   545   C  CD2   . PHE A  1  75  ? -30.434 103.463 33.338  1.00 76.65  ? 101 PHE A CD2   1 
ATOM   546   C  CE1   . PHE A  1  75  ? -29.464 105.940 32.522  1.00 77.62  ? 101 PHE A CE1   1 
ATOM   547   C  CE2   . PHE A  1  75  ? -29.088 103.613 33.035  1.00 76.34  ? 101 PHE A CE2   1 
ATOM   548   C  CZ    . PHE A  1  75  ? -28.601 104.857 32.625  1.00 77.37  ? 101 PHE A CZ    1 
ATOM   549   N  N     . GLN A  1  76  ? -33.764 106.366 31.693  1.00 77.11  ? 102 GLN A N     1 
ATOM   550   C  CA    . GLN A  1  76  ? -33.714 107.553 30.854  1.00 77.66  ? 102 GLN A CA    1 
ATOM   551   C  C     . GLN A  1  76  ? -33.382 108.736 31.761  1.00 78.40  ? 102 GLN A C     1 
ATOM   552   O  O     . GLN A  1  76  ? -33.817 108.771 32.915  1.00 78.57  ? 102 GLN A O     1 
ATOM   553   C  CB    . GLN A  1  76  ? -35.101 107.734 30.251  1.00 77.40  ? 102 GLN A CB    1 
ATOM   554   C  CG    . GLN A  1  76  ? -35.176 108.574 29.022  1.00 77.03  ? 102 GLN A CG    1 
ATOM   555   C  CD    . GLN A  1  76  ? -36.464 108.329 28.270  1.00 77.76  ? 102 GLN A CD    1 
ATOM   556   O  OE1   . GLN A  1  76  ? -36.796 109.061 27.342  1.00 79.35  ? 102 GLN A OE1   1 
ATOM   557   N  NE2   . GLN A  1  76  ? -37.191 107.279 28.655  1.00 75.95  ? 102 GLN A NE2   1 
ATOM   558   N  N     . SER A  1  77  ? -32.649 109.719 31.246  1.00 78.46  ? 103 SER A N     1 
ATOM   559   C  CA    . SER A  1  77  ? -32.287 110.861 32.077  1.00 79.87  ? 103 SER A CA    1 
ATOM   560   C  C     . SER A  1  77  ? -32.146 112.199 31.366  1.00 80.80  ? 103 SER A C     1 
ATOM   561   O  O     . SER A  1  77  ? -31.576 112.287 30.276  1.00 80.14  ? 103 SER A O     1 
ATOM   562   C  CB    . SER A  1  77  ? -30.991 110.568 32.826  1.00 80.56  ? 103 SER A CB    1 
ATOM   563   O  OG    . SER A  1  77  ? -29.897 110.541 31.930  1.00 83.04  ? 103 SER A OG    1 
ATOM   564   N  N     . TYR A  1  78  ? -32.631 113.244 32.036  1.00 82.48  ? 104 TYR A N     1 
ATOM   565   C  CA    . TYR A  1  78  ? -32.573 114.621 31.538  1.00 83.90  ? 104 TYR A CA    1 
ATOM   566   C  C     . TYR A  1  78  ? -31.820 115.439 32.578  1.00 85.57  ? 104 TYR A C     1 
ATOM   567   O  O     . TYR A  1  78  ? -32.219 115.494 33.746  1.00 85.85  ? 104 TYR A O     1 
ATOM   568   C  CB    . TYR A  1  78  ? -33.986 115.154 31.305  1.00 81.46  ? 104 TYR A CB    1 
ATOM   569   C  CG    . TYR A  1  78  ? -34.733 114.308 30.309  1.00 77.63  ? 104 TYR A CG    1 
ATOM   570   C  CD1   . TYR A  1  78  ? -35.409 113.156 30.717  1.00 75.64  ? 104 TYR A CD1   1 
ATOM   571   C  CD2   . TYR A  1  78  ? -34.688 114.602 28.949  1.00 75.05  ? 104 TYR A CD2   1 
ATOM   572   C  CE1   . TYR A  1  78  ? -36.013 112.313 29.795  1.00 74.29  ? 104 TYR A CE1   1 
ATOM   573   C  CE2   . TYR A  1  78  ? -35.288 113.769 28.019  1.00 74.33  ? 104 TYR A CE2   1 
ATOM   574   C  CZ    . TYR A  1  78  ? -35.947 112.624 28.449  1.00 74.46  ? 104 TYR A CZ    1 
ATOM   575   O  OH    . TYR A  1  78  ? -36.525 111.782 27.531  1.00 76.02  ? 104 TYR A OH    1 
ATOM   576   N  N     . ILE A  1  79  ? -30.719 116.052 32.149  1.00 87.44  ? 105 ILE A N     1 
ATOM   577   C  CA    . ILE A  1  79  ? -29.852 116.803 33.051  1.00 89.76  ? 105 ILE A CA    1 
ATOM   578   C  C     . ILE A  1  79  ? -29.472 118.209 32.590  1.00 91.54  ? 105 ILE A C     1 
ATOM   579   O  O     . ILE A  1  79  ? -29.232 118.449 31.401  1.00 90.99  ? 105 ILE A O     1 
ATOM   580   C  CB    . ILE A  1  79  ? -28.544 116.000 33.300  1.00 89.58  ? 105 ILE A CB    1 
ATOM   581   C  CG1   . ILE A  1  79  ? -28.867 114.661 33.968  1.00 89.15  ? 105 ILE A CG1   1 
ATOM   582   C  CG2   . ILE A  1  79  ? -27.563 116.795 34.156  1.00 89.89  ? 105 ILE A CG2   1 
ATOM   583   C  CD1   . ILE A  1  79  ? -27.726 113.673 33.928  1.00 90.03  ? 105 ILE A CD1   1 
ATOM   584   N  N     . VAL A  1  80  ? -29.393 119.122 33.562  1.00 93.65  ? 106 VAL A N     1 
ATOM   585   C  CA    . VAL A  1  80  ? -29.018 120.512 33.319  1.00 95.28  ? 106 VAL A CA    1 
ATOM   586   C  C     . VAL A  1  80  ? -27.820 120.854 34.199  1.00 96.89  ? 106 VAL A C     1 
ATOM   587   O  O     . VAL A  1  80  ? -27.893 120.754 35.425  1.00 96.73  ? 106 VAL A O     1 
ATOM   588   C  CB    . VAL A  1  80  ? -30.162 121.500 33.665  1.00 94.86  ? 106 VAL A CB    1 
ATOM   589   C  CG1   . VAL A  1  80  ? -29.857 122.870 33.075  1.00 94.07  ? 106 VAL A CG1   1 
ATOM   590   C  CG2   . VAL A  1  80  ? -31.502 120.985 33.160  1.00 95.01  ? 106 VAL A CG2   1 
ATOM   591   N  N     . SER A  1  81  ? -26.711 121.222 33.565  1.00 99.97  ? 107 SER A N     1 
ATOM   592   C  CA    . SER A  1  81  ? -25.489 121.589 34.281  1.00 103.17 ? 107 SER A CA    1 
ATOM   593   C  C     . SER A  1  81  ? -25.423 123.099 34.485  1.00 104.95 ? 107 SER A C     1 
ATOM   594   O  O     . SER A  1  81  ? -25.857 123.871 33.626  1.00 104.63 ? 107 SER A O     1 
ATOM   595   C  CB    . SER A  1  81  ? -24.244 121.124 33.514  1.00 103.18 ? 107 SER A CB    1 
ATOM   596   O  OG    . SER A  1  81  ? -24.122 119.714 33.533  1.00 104.54 ? 107 SER A OG    1 
ATOM   597   N  N     . SER A  1  82  ? -24.850 123.510 35.613  1.00 106.96 ? 108 SER A N     1 
ATOM   598   C  CA    . SER A  1  82  ? -24.723 124.928 35.942  1.00 109.58 ? 108 SER A CA    1 
ATOM   599   C  C     . SER A  1  82  ? -23.587 125.157 36.930  1.00 111.08 ? 108 SER A C     1 
ATOM   600   O  O     . SER A  1  82  ? -22.910 124.212 37.340  1.00 111.44 ? 108 SER A O     1 
ATOM   601   C  CB    . SER A  1  82  ? -26.029 125.444 36.560  1.00 109.92 ? 108 SER A CB    1 
ATOM   602   O  OG    . SER A  1  82  ? -26.306 124.800 37.798  1.00 108.91 ? 108 SER A OG    1 
ATOM   603   N  N     . LEU A  1  83  ? -23.373 126.422 37.290  1.00 112.56 ? 109 LEU A N     1 
ATOM   604   C  CA    . LEU A  1  83  ? -22.344 126.783 38.260  1.00 114.15 ? 109 LEU A CA    1 
ATOM   605   C  C     . LEU A  1  83  ? -22.899 126.461 39.652  1.00 115.72 ? 109 LEU A C     1 
ATOM   606   O  O     . LEU A  1  83  ? -24.106 126.259 39.810  1.00 116.38 ? 109 LEU A O     1 
ATOM   607   C  CB    . LEU A  1  83  ? -21.998 128.268 38.143  1.00 113.60 ? 109 LEU A CB    1 
ATOM   608   C  CG    . LEU A  1  83  ? -20.532 128.578 37.827  1.00 114.07 ? 109 LEU A CG    1 
ATOM   609   C  CD1   . LEU A  1  83  ? -20.162 128.054 36.453  1.00 113.55 ? 109 LEU A CD1   1 
ATOM   610   C  CD2   . LEU A  1  83  ? -20.293 130.072 37.895  1.00 115.20 ? 109 LEU A CD2   1 
ATOM   611   N  N     . PRO A  1  84  ? -22.033 126.395 40.678  1.00 117.22 ? 110 PRO A N     1 
ATOM   612   C  CA    . PRO A  1  84  ? -22.500 126.086 42.037  1.00 118.82 ? 110 PRO A CA    1 
ATOM   613   C  C     . PRO A  1  84  ? -23.507 127.077 42.628  1.00 120.21 ? 110 PRO A C     1 
ATOM   614   O  O     . PRO A  1  84  ? -24.192 126.760 43.603  1.00 120.17 ? 110 PRO A O     1 
ATOM   615   C  CB    . PRO A  1  84  ? -21.200 126.051 42.841  1.00 118.71 ? 110 PRO A CB    1 
ATOM   616   C  CG    . PRO A  1  84  ? -20.315 127.011 42.098  1.00 119.03 ? 110 PRO A CG    1 
ATOM   617   C  CD    . PRO A  1  84  ? -20.579 126.626 40.670  1.00 117.84 ? 110 PRO A CD    1 
ATOM   618   N  N     . GLY A  1  85  ? -23.605 128.261 42.025  1.00 121.54 ? 111 GLY A N     1 
ATOM   619   C  CA    . GLY A  1  85  ? -24.526 129.274 42.510  1.00 122.97 ? 111 GLY A CA    1 
ATOM   620   C  C     . GLY A  1  85  ? -25.930 129.206 41.931  1.00 124.03 ? 111 GLY A C     1 
ATOM   621   O  O     . GLY A  1  85  ? -26.913 129.415 42.649  1.00 124.33 ? 111 GLY A O     1 
ATOM   622   N  N     . SER A  1  86  ? -26.028 128.915 40.636  1.00 124.44 ? 112 SER A N     1 
ATOM   623   C  CA    . SER A  1  86  ? -27.319 128.834 39.954  1.00 125.01 ? 112 SER A CA    1 
ATOM   624   C  C     . SER A  1  86  ? -28.027 127.486 40.119  1.00 125.49 ? 112 SER A C     1 
ATOM   625   O  O     . SER A  1  86  ? -28.822 127.088 39.267  1.00 125.15 ? 112 SER A O     1 
ATOM   626   C  CB    . SER A  1  86  ? -27.146 129.152 38.465  1.00 124.90 ? 112 SER A CB    1 
ATOM   627   O  OG    . SER A  1  86  ? -26.614 130.452 38.276  1.00 124.23 ? 112 SER A OG    1 
ATOM   628   N  N     . THR A  1  87  ? -27.767 126.810 41.235  1.00 126.55 ? 113 THR A N     1 
ATOM   629   C  CA    . THR A  1  87  ? -28.373 125.510 41.523  1.00 128.08 ? 113 THR A CA    1 
ATOM   630   C  C     . THR A  1  87  ? -29.901 125.574 41.604  1.00 128.95 ? 113 THR A C     1 
ATOM   631   O  O     . THR A  1  87  ? -30.572 124.548 41.737  1.00 128.48 ? 113 THR A O     1 
ATOM   632   C  CB    . THR A  1  87  ? -27.807 124.908 42.832  1.00 128.56 ? 113 THR A CB    1 
ATOM   633   O  OG1   . THR A  1  87  ? -28.397 123.624 43.069  1.00 128.69 ? 113 THR A OG1   1 
ATOM   634   C  CG2   . THR A  1  87  ? -28.090 125.825 44.021  1.00 128.81 ? 113 THR A CG2   1 
ATOM   635   N  N     . ASP A  1  88  ? -30.440 126.787 41.529  1.00 130.70 ? 114 ASP A N     1 
ATOM   636   C  CA    . ASP A  1  88  ? -31.880 126.998 41.582  1.00 132.39 ? 114 ASP A CA    1 
ATOM   637   C  C     . ASP A  1  88  ? -32.445 127.220 40.179  1.00 132.46 ? 114 ASP A C     1 
ATOM   638   O  O     . ASP A  1  88  ? -33.514 126.703 39.847  1.00 132.56 ? 114 ASP A O     1 
ATOM   639   C  CB    . ASP A  1  88  ? -32.215 128.191 42.486  1.00 133.87 ? 114 ASP A CB    1 
ATOM   640   C  CG    . ASP A  1  88  ? -33.710 128.328 42.748  1.00 135.34 ? 114 ASP A CG    1 
ATOM   641   O  OD1   . ASP A  1  88  ? -34.218 127.666 43.681  1.00 135.72 ? 114 ASP A OD1   1 
ATOM   642   O  OD2   . ASP A  1  88  ? -34.378 129.093 42.018  1.00 136.14 ? 114 ASP A OD2   1 
ATOM   643   N  N     . LYS A  1  89  ? -31.722 127.980 39.356  1.00 132.39 ? 115 LYS A N     1 
ATOM   644   C  CA    . LYS A  1  89  ? -32.156 128.263 37.990  1.00 132.58 ? 115 LYS A CA    1 
ATOM   645   C  C     . LYS A  1  89  ? -32.255 127.018 37.112  1.00 132.84 ? 115 LYS A C     1 
ATOM   646   O  O     . LYS A  1  89  ? -32.863 127.052 36.040  1.00 132.84 ? 115 LYS A O     1 
ATOM   647   C  CB    . LYS A  1  89  ? -31.257 129.316 37.343  1.00 132.75 ? 115 LYS A CB    1 
ATOM   648   C  CG    . LYS A  1  89  ? -31.936 130.670 37.199  1.00 133.44 ? 115 LYS A CG    1 
ATOM   649   C  CD    . LYS A  1  89  ? -32.463 131.172 38.540  1.00 134.28 ? 115 LYS A CD    1 
ATOM   650   C  CE    . LYS A  1  89  ? -33.552 132.224 38.362  1.00 133.96 ? 115 LYS A CE    1 
ATOM   651   N  NZ    . LYS A  1  89  ? -33.080 133.414 37.603  1.00 133.80 ? 115 LYS A NZ    1 
ATOM   652   N  N     . SER A  1  90  ? -31.645 125.926 37.567  1.00 132.95 ? 116 SER A N     1 
ATOM   653   C  CA    . SER A  1  90  ? -31.692 124.657 36.849  1.00 132.54 ? 116 SER A CA    1 
ATOM   654   C  C     . SER A  1  90  ? -33.047 124.019 37.139  1.00 132.70 ? 116 SER A C     1 
ATOM   655   O  O     . SER A  1  90  ? -33.680 123.451 36.247  1.00 133.26 ? 116 SER A O     1 
ATOM   656   C  CB    . SER A  1  90  ? -30.568 123.726 37.313  1.00 132.14 ? 116 SER A CB    1 
ATOM   657   O  OG    . SER A  1  90  ? -29.298 124.216 36.920  1.00 131.21 ? 116 SER A OG    1 
ATOM   658   N  N     . LEU A  1  91  ? -33.495 124.148 38.387  1.00 132.25 ? 117 LEU A N     1 
ATOM   659   C  CA    . LEU A  1  91  ? -34.776 123.604 38.824  1.00 132.42 ? 117 LEU A CA    1 
ATOM   660   C  C     . LEU A  1  91  ? -35.961 124.290 38.153  1.00 133.00 ? 117 LEU A C     1 
ATOM   661   O  O     . LEU A  1  91  ? -37.046 123.712 38.059  1.00 133.04 ? 117 LEU A O     1 
ATOM   662   C  CB    . LEU A  1  91  ? -34.897 123.696 40.344  1.00 131.89 ? 117 LEU A CB    1 
ATOM   663   C  CG    . LEU A  1  91  ? -34.016 122.705 41.105  1.00 131.87 ? 117 LEU A CG    1 
ATOM   664   C  CD1   . LEU A  1  91  ? -33.977 123.052 42.578  1.00 131.91 ? 117 LEU A CD1   1 
ATOM   665   C  CD2   . LEU A  1  91  ? -34.542 121.294 40.894  1.00 131.82 ? 117 LEU A CD2   1 
ATOM   666   N  N     . ASP A  1  92  ? -35.753 125.526 37.701  1.00 133.95 ? 118 ASP A N     1 
ATOM   667   C  CA    . ASP A  1  92  ? -36.795 126.285 37.013  1.00 135.12 ? 118 ASP A CA    1 
ATOM   668   C  C     . ASP A  1  92  ? -36.921 125.767 35.591  1.00 135.65 ? 118 ASP A C     1 
ATOM   669   O  O     . ASP A  1  92  ? -38.023 125.517 35.104  1.00 135.50 ? 118 ASP A O     1 
ATOM   670   C  CB    . ASP A  1  92  ? -36.456 127.781 36.971  1.00 135.80 ? 118 ASP A CB    1 
ATOM   671   C  CG    . ASP A  1  92  ? -36.695 128.480 38.301  1.00 136.66 ? 118 ASP A CG    1 
ATOM   672   O  OD1   . ASP A  1  92  ? -35.793 129.216 38.755  1.00 136.85 ? 118 ASP A OD1   1 
ATOM   673   O  OD2   . ASP A  1  92  ? -37.788 128.308 38.884  1.00 136.44 ? 118 ASP A OD2   1 
ATOM   674   N  N     . PHE A  1  93  ? -35.774 125.595 34.940  1.00 136.61 ? 119 PHE A N     1 
ATOM   675   C  CA    . PHE A  1  93  ? -35.715 125.110 33.568  1.00 137.37 ? 119 PHE A CA    1 
ATOM   676   C  C     . PHE A  1  93  ? -36.196 123.666 33.469  1.00 138.24 ? 119 PHE A C     1 
ATOM   677   O  O     . PHE A  1  93  ? -36.735 123.254 32.442  1.00 138.26 ? 119 PHE A O     1 
ATOM   678   C  CB    . PHE A  1  93  ? -34.287 125.226 33.033  1.00 136.75 ? 119 PHE A CB    1 
ATOM   679   C  CG    . PHE A  1  93  ? -34.194 125.127 31.542  1.00 136.49 ? 119 PHE A CG    1 
ATOM   680   C  CD1   . PHE A  1  93  ? -34.389 126.250 30.748  1.00 136.44 ? 119 PHE A CD1   1 
ATOM   681   C  CD2   . PHE A  1  93  ? -33.933 123.909 30.926  1.00 136.50 ? 119 PHE A CD2   1 
ATOM   682   C  CE1   . PHE A  1  93  ? -34.332 126.161 29.362  1.00 136.60 ? 119 PHE A CE1   1 
ATOM   683   C  CE2   . PHE A  1  93  ? -33.874 123.811 29.539  1.00 136.74 ? 119 PHE A CE2   1 
ATOM   684   C  CZ    . PHE A  1  93  ? -34.074 124.940 28.756  1.00 136.52 ? 119 PHE A CZ    1 
ATOM   685   N  N     . LEU A  1  94  ? -36.006 122.908 34.546  1.00 139.57 ? 120 LEU A N     1 
ATOM   686   C  CA    . LEU A  1  94  ? -36.417 121.508 34.599  1.00 141.46 ? 120 LEU A CA    1 
ATOM   687   C  C     . LEU A  1  94  ? -37.947 121.416 34.634  1.00 142.58 ? 120 LEU A C     1 
ATOM   688   O  O     . LEU A  1  94  ? -38.551 120.685 33.847  1.00 142.89 ? 120 LEU A O     1 
ATOM   689   C  CB    . LEU A  1  94  ? -35.809 120.832 35.838  1.00 141.68 ? 120 LEU A CB    1 
ATOM   690   C  CG    . LEU A  1  94  ? -35.403 119.350 35.807  1.00 142.02 ? 120 LEU A CG    1 
ATOM   691   C  CD1   . LEU A  1  94  ? -36.617 118.441 35.667  1.00 142.19 ? 120 LEU A CD1   1 
ATOM   692   C  CD2   . LEU A  1  94  ? -34.408 119.110 34.679  1.00 142.18 ? 120 LEU A CD2   1 
ATOM   693   N  N     . ASN A  1  95  ? -38.564 122.180 35.534  1.00 143.87 ? 121 ASN A N     1 
ATOM   694   C  CA    . ASN A  1  95  ? -40.020 122.199 35.681  1.00 145.22 ? 121 ASN A CA    1 
ATOM   695   C  C     . ASN A  1  95  ? -40.705 122.872 34.491  1.00 145.70 ? 121 ASN A C     1 
ATOM   696   O  O     . ASN A  1  95  ? -41.807 122.486 34.095  1.00 145.39 ? 121 ASN A O     1 
ATOM   697   C  CB    . ASN A  1  95  ? -40.409 122.919 36.977  1.00 146.07 ? 121 ASN A CB    1 
ATOM   698   C  CG    . ASN A  1  95  ? -41.913 122.948 37.206  1.00 147.07 ? 121 ASN A CG    1 
ATOM   699   O  OD1   . ASN A  1  95  ? -42.614 123.832 36.708  1.00 147.34 ? 121 ASN A OD1   1 
ATOM   700   N  ND2   . ASN A  1  95  ? -42.416 121.978 37.963  1.00 147.48 ? 121 ASN A ND2   1 
ATOM   701   N  N     . GLN A  1  96  ? -40.047 123.886 33.939  1.00 146.59 ? 122 GLN A N     1 
ATOM   702   C  CA    . GLN A  1  96  ? -40.561 124.633 32.797  1.00 147.81 ? 122 GLN A CA    1 
ATOM   703   C  C     . GLN A  1  96  ? -40.690 123.764 31.544  1.00 148.88 ? 122 GLN A C     1 
ATOM   704   O  O     . GLN A  1  96  ? -41.607 123.955 30.747  1.00 149.28 ? 122 GLN A O     1 
ATOM   705   C  CB    . GLN A  1  96  ? -39.645 125.827 32.512  1.00 147.84 ? 122 GLN A CB    1 
ATOM   706   C  CG    . GLN A  1  96  ? -40.045 126.683 31.320  1.00 148.09 ? 122 GLN A CG    1 
ATOM   707   C  CD    . GLN A  1  96  ? -39.032 127.774 31.026  1.00 148.15 ? 122 GLN A CD    1 
ATOM   708   O  OE1   . GLN A  1  96  ? -37.967 127.515 30.462  1.00 147.73 ? 122 GLN A OE1   1 
ATOM   709   N  NE2   . GLN A  1  96  ? -39.357 129.002 31.414  1.00 148.01 ? 122 GLN A NE2   1 
ATOM   710   N  N     . SER A  1  97  ? -39.778 122.806 31.382  1.00 149.77 ? 123 SER A N     1 
ATOM   711   C  CA    . SER A  1  97  ? -39.783 121.919 30.220  1.00 150.25 ? 123 SER A CA    1 
ATOM   712   C  C     . SER A  1  97  ? -40.584 120.628 30.394  1.00 150.69 ? 123 SER A C     1 
ATOM   713   O  O     . SER A  1  97  ? -40.981 120.006 29.406  1.00 150.67 ? 123 SER A O     1 
ATOM   714   C  CB    . SER A  1  97  ? -38.348 121.583 29.803  1.00 150.06 ? 123 SER A CB    1 
ATOM   715   O  OG    . SER A  1  97  ? -37.658 122.743 29.373  1.00 149.79 ? 123 SER A OG    1 
ATOM   716   N  N     . PHE A  1  98  ? -40.820 120.225 31.640  1.00 151.16 ? 124 PHE A N     1 
ATOM   717   C  CA    . PHE A  1  98  ? -41.563 118.997 31.909  1.00 151.94 ? 124 PHE A CA    1 
ATOM   718   C  C     . PHE A  1  98  ? -43.015 119.179 32.344  1.00 152.31 ? 124 PHE A C     1 
ATOM   719   O  O     . PHE A  1  98  ? -43.723 118.197 32.586  1.00 152.31 ? 124 PHE A O     1 
ATOM   720   C  CB    . PHE A  1  98  ? -40.805 118.116 32.907  1.00 152.31 ? 124 PHE A CB    1 
ATOM   721   C  CG    . PHE A  1  98  ? -39.715 117.292 32.276  1.00 152.48 ? 124 PHE A CG    1 
ATOM   722   C  CD1   . PHE A  1  98  ? -38.599 117.904 31.713  1.00 152.37 ? 124 PHE A CD1   1 
ATOM   723   C  CD2   . PHE A  1  98  ? -39.820 115.906 32.215  1.00 152.34 ? 124 PHE A CD2   1 
ATOM   724   C  CE1   . PHE A  1  98  ? -37.611 117.149 31.098  1.00 152.07 ? 124 PHE A CE1   1 
ATOM   725   C  CE2   . PHE A  1  98  ? -38.834 115.144 31.599  1.00 152.13 ? 124 PHE A CE2   1 
ATOM   726   C  CZ    . PHE A  1  98  ? -37.728 115.769 31.040  1.00 152.26 ? 124 PHE A CZ    1 
ATOM   727   N  N     . ILE A  1  99  ? -43.460 120.431 32.428  1.00 152.74 ? 125 ILE A N     1 
ATOM   728   C  CA    . ILE A  1  99  ? -44.836 120.735 32.818  1.00 152.98 ? 125 ILE A CA    1 
ATOM   729   C  C     . ILE A  1  99  ? -45.418 121.857 31.959  1.00 153.01 ? 125 ILE A C     1 
ATOM   730   O  O     . ILE A  1  99  ? -46.474 121.696 31.347  1.00 152.90 ? 125 ILE A O     1 
ATOM   731   C  CB    . ILE A  1  99  ? -44.945 121.124 34.322  1.00 152.83 ? 125 ILE A CB    1 
ATOM   732   C  CG1   . ILE A  1  99  ? -44.656 119.906 35.206  1.00 152.73 ? 125 ILE A CG1   1 
ATOM   733   C  CG2   . ILE A  1  99  ? -46.336 121.675 34.634  1.00 152.62 ? 125 ILE A CG2   1 
ATOM   734   C  CD1   . ILE A  1  99  ? -44.813 120.164 36.690  1.00 152.67 ? 125 ILE A CD1   1 
ATOM   735   N  N     . GLN A  1  100 ? -44.716 122.985 31.907  1.00 153.10 ? 126 GLN A N     1 
ATOM   736   C  CA    . GLN A  1  100 ? -45.167 124.137 31.137  1.00 153.20 ? 126 GLN A CA    1 
ATOM   737   C  C     . GLN A  1  100 ? -44.981 123.957 29.629  1.00 153.58 ? 126 GLN A C     1 
ATOM   738   O  O     . GLN A  1  100 ? -45.914 124.181 28.858  1.00 153.29 ? 126 GLN A O     1 
ATOM   739   C  CB    . GLN A  1  100 ? -44.453 125.401 31.630  1.00 152.80 ? 126 GLN A CB    1 
ATOM   740   C  CG    . GLN A  1  100 ? -44.962 126.711 31.036  1.00 152.40 ? 126 GLN A CG    1 
ATOM   741   C  CD    . GLN A  1  100 ? -44.344 127.038 29.688  1.00 152.21 ? 126 GLN A CD    1 
ATOM   742   O  OE1   . GLN A  1  100 ? -44.950 126.809 28.641  1.00 151.75 ? 126 GLN A OE1   1 
ATOM   743   N  NE2   . GLN A  1  100 ? -43.130 127.578 29.710  1.00 151.98 ? 126 GLN A NE2   1 
ATOM   744   N  N     . GLN A  1  101 ? -43.780 123.561 29.213  1.00 154.26 ? 127 GLN A N     1 
ATOM   745   C  CA    . GLN A  1  101 ? -43.487 123.368 27.792  1.00 154.97 ? 127 GLN A CA    1 
ATOM   746   C  C     . GLN A  1  101 ? -43.616 121.931 27.287  1.00 154.76 ? 127 GLN A C     1 
ATOM   747   O  O     . GLN A  1  101 ? -43.034 121.576 26.257  1.00 154.85 ? 127 GLN A O     1 
ATOM   748   C  CB    . GLN A  1  101 ? -42.103 123.926 27.435  1.00 155.93 ? 127 GLN A CB    1 
ATOM   749   C  CG    . GLN A  1  101 ? -42.032 125.448 27.392  1.00 156.82 ? 127 GLN A CG    1 
ATOM   750   C  CD    . GLN A  1  101 ? -40.735 125.961 26.793  1.00 157.32 ? 127 GLN A CD    1 
ATOM   751   O  OE1   . GLN A  1  101 ? -40.680 126.313 25.614  1.00 157.19 ? 127 GLN A OE1   1 
ATOM   752   N  NE2   . GLN A  1  101 ? -39.684 126.011 27.606  1.00 157.81 ? 127 GLN A NE2   1 
ATOM   753   N  N     . LYS A  1  102 ? -44.394 121.111 27.992  1.00 154.23 ? 128 LYS A N     1 
ATOM   754   C  CA    . LYS A  1  102 ? -44.602 119.724 27.578  1.00 153.45 ? 128 LYS A CA    1 
ATOM   755   C  C     . LYS A  1  102 ? -45.629 119.706 26.440  1.00 152.59 ? 128 LYS A C     1 
ATOM   756   O  O     . LYS A  1  102 ? -46.300 118.698 26.199  1.00 152.71 ? 128 LYS A O     1 
ATOM   757   C  CB    . LYS A  1  102 ? -45.092 118.876 28.759  1.00 153.73 ? 128 LYS A CB    1 
ATOM   758   C  CG    . LYS A  1  102 ? -44.718 117.397 28.672  1.00 153.61 ? 128 LYS A CG    1 
ATOM   759   C  CD    . LYS A  1  102 ? -43.204 117.220 28.690  1.00 153.92 ? 128 LYS A CD    1 
ATOM   760   C  CE    . LYS A  1  102 ? -42.807 115.755 28.739  1.00 154.18 ? 128 LYS A CE    1 
ATOM   761   N  NZ    . LYS A  1  102 ? -41.324 115.588 28.729  1.00 154.80 ? 128 LYS A NZ    1 
ATOM   762   N  N     . ALA A  1  103 ? -45.731 120.841 25.748  1.00 151.17 ? 129 ALA A N     1 
ATOM   763   C  CA    . ALA A  1  103 ? -46.649 121.031 24.629  1.00 149.28 ? 129 ALA A CA    1 
ATOM   764   C  C     . ALA A  1  103 ? -46.102 122.090 23.664  1.00 147.71 ? 129 ALA A C     1 
ATOM   765   O  O     . ALA A  1  103 ? -46.607 122.241 22.548  1.00 147.57 ? 129 ALA A O     1 
ATOM   766   C  CB    . ALA A  1  103 ? -48.027 121.441 25.142  1.00 149.42 ? 129 ALA A CB    1 
ATOM   767   N  N     . ASN A  1  104 ? -45.089 122.832 24.109  1.00 145.61 ? 130 ASN A N     1 
ATOM   768   C  CA    . ASN A  1  104 ? -44.457 123.868 23.289  1.00 143.40 ? 130 ASN A CA    1 
ATOM   769   C  C     . ASN A  1  104 ? -43.266 123.299 22.529  1.00 141.43 ? 130 ASN A C     1 
ATOM   770   O  O     . ASN A  1  104 ? -42.885 123.810 21.472  1.00 141.29 ? 130 ASN A O     1 
ATOM   771   C  CB    . ASN A  1  104 ? -44.001 125.047 24.152  1.00 144.06 ? 130 ASN A CB    1 
ATOM   772   C  CG    . ASN A  1  104 ? -45.160 125.885 24.655  1.00 144.62 ? 130 ASN A CG    1 
ATOM   773   O  OD1   . ASN A  1  104 ? -45.537 125.806 25.825  1.00 144.71 ? 130 ASN A OD1   1 
ATOM   774   N  ND2   . ASN A  1  104 ? -45.732 126.695 23.770  1.00 144.53 ? 130 ASN A ND2   1 
ATOM   775   N  N     . LEU A  1  105 ? -42.668 122.253 23.093  1.00 138.76 ? 131 LEU A N     1 
ATOM   776   C  CA    . LEU A  1  105 ? -41.527 121.580 22.482  1.00 135.83 ? 131 LEU A CA    1 
ATOM   777   C  C     . LEU A  1  105 ? -42.022 120.682 21.353  1.00 134.01 ? 131 LEU A C     1 
ATOM   778   O  O     . LEU A  1  105 ? -41.254 120.290 20.473  1.00 133.97 ? 131 LEU A O     1 
ATOM   779   C  CB    . LEU A  1  105 ? -40.802 120.726 23.526  1.00 135.28 ? 131 LEU A CB    1 
ATOM   780   C  CG    . LEU A  1  105 ? -40.189 121.443 24.732  1.00 134.41 ? 131 LEU A CG    1 
ATOM   781   C  CD1   . LEU A  1  105 ? -39.694 120.430 25.756  1.00 133.97 ? 131 LEU A CD1   1 
ATOM   782   C  CD2   . LEU A  1  105 ? -39.059 122.342 24.274  1.00 134.05 ? 131 LEU A CD2   1 
ATOM   783   N  N     . LEU A  1  106 ? -43.321 120.393 21.375  1.00 131.57 ? 132 LEU A N     1 
ATOM   784   C  CA    . LEU A  1  106 ? -43.956 119.524 20.393  1.00 129.17 ? 132 LEU A CA    1 
ATOM   785   C  C     . LEU A  1  106 ? -44.750 120.239 19.294  1.00 127.62 ? 132 LEU A C     1 
ATOM   786   O  O     . LEU A  1  106 ? -45.851 119.813 18.939  1.00 127.42 ? 132 LEU A O     1 
ATOM   787   C  CB    . LEU A  1  106 ? -44.855 118.522 21.121  1.00 128.93 ? 132 LEU A CB    1 
ATOM   788   C  CG    . LEU A  1  106 ? -44.161 117.678 22.193  1.00 128.62 ? 132 LEU A CG    1 
ATOM   789   C  CD1   . LEU A  1  106 ? -45.189 116.902 22.998  1.00 128.58 ? 132 LEU A CD1   1 
ATOM   790   C  CD2   . LEU A  1  106 ? -43.161 116.740 21.539  1.00 128.68 ? 132 LEU A CD2   1 
ATOM   791   N  N     . SER A  1  107 ? -44.193 121.318 18.751  1.00 125.83 ? 133 SER A N     1 
ATOM   792   C  CA    . SER A  1  107 ? -44.862 122.054 17.680  1.00 124.31 ? 133 SER A CA    1 
ATOM   793   C  C     . SER A  1  107 ? -44.644 121.325 16.354  1.00 123.72 ? 133 SER A C     1 
ATOM   794   O  O     . SER A  1  107 ? -43.729 120.512 16.234  1.00 123.99 ? 133 SER A O     1 
ATOM   795   C  CB    . SER A  1  107 ? -44.329 123.488 17.589  1.00 123.56 ? 133 SER A CB    1 
ATOM   796   O  OG    . SER A  1  107 ? -42.962 123.514 17.223  1.00 122.25 ? 133 SER A OG    1 
ATOM   797   N  N     . SER A  1  108 ? -45.479 121.618 15.360  1.00 122.96 ? 134 SER A N     1 
ATOM   798   C  CA    . SER A  1  108 ? -45.363 120.980 14.049  1.00 121.86 ? 134 SER A CA    1 
ATOM   799   C  C     . SER A  1  108 ? -44.187 121.472 13.207  1.00 121.18 ? 134 SER A C     1 
ATOM   800   O  O     . SER A  1  108 ? -44.024 121.053 12.060  1.00 121.66 ? 134 SER A O     1 
ATOM   801   C  CB    . SER A  1  108 ? -46.666 121.122 13.262  1.00 121.85 ? 134 SER A CB    1 
ATOM   802   O  OG    . SER A  1  108 ? -47.662 120.255 13.774  1.00 122.34 ? 134 SER A OG    1 
ATOM   803   N  N     . SER A  1  109 ? -43.377 122.364 13.770  1.00 119.93 ? 135 SER A N     1 
ATOM   804   C  CA    . SER A  1  109 ? -42.209 122.888 13.068  1.00 118.74 ? 135 SER A CA    1 
ATOM   805   C  C     . SER A  1  109 ? -40.924 122.432 13.747  1.00 117.58 ? 135 SER A C     1 
ATOM   806   O  O     . SER A  1  109 ? -39.869 122.356 13.116  1.00 117.35 ? 135 SER A O     1 
ATOM   807   C  CB    . SER A  1  109 ? -42.257 124.416 13.003  1.00 119.41 ? 135 SER A CB    1 
ATOM   808   O  OG    . SER A  1  109 ? -43.272 124.854 12.115  1.00 120.16 ? 135 SER A OG    1 
ATOM   809   N  N     . ASN A  1  110 ? -41.027 122.125 15.037  1.00 116.17 ? 136 ASN A N     1 
ATOM   810   C  CA    . ASN A  1  110 ? -39.888 121.669 15.825  1.00 114.61 ? 136 ASN A CA    1 
ATOM   811   C  C     . ASN A  1  110 ? -39.734 120.155 15.665  1.00 113.64 ? 136 ASN A C     1 
ATOM   812   O  O     . ASN A  1  110 ? -38.652 119.661 15.341  1.00 113.85 ? 136 ASN A O     1 
ATOM   813   C  CB    . ASN A  1  110 ? -40.103 122.029 17.302  1.00 114.04 ? 136 ASN A CB    1 
ATOM   814   C  CG    . ASN A  1  110 ? -38.821 121.972 18.116  1.00 113.66 ? 136 ASN A CG    1 
ATOM   815   O  OD1   . ASN A  1  110 ? -37.790 122.514 17.711  1.00 112.42 ? 136 ASN A OD1   1 
ATOM   816   N  ND2   . ASN A  1  110 ? -38.886 121.331 19.280  1.00 112.82 ? 136 ASN A ND2   1 
ATOM   817   N  N     . PHE A  1  111 ? -40.838 119.438 15.860  1.00 112.14 ? 137 PHE A N     1 
ATOM   818   C  CA    . PHE A  1  111 ? -40.877 117.983 15.754  1.00 110.92 ? 137 PHE A CA    1 
ATOM   819   C  C     . PHE A  1  111 ? -40.421 117.475 14.387  1.00 110.24 ? 137 PHE A C     1 
ATOM   820   O  O     . PHE A  1  111 ? -39.764 116.442 14.298  1.00 110.39 ? 137 PHE A O     1 
ATOM   821   C  CB    . PHE A  1  111 ? -42.293 117.482 16.052  1.00 110.38 ? 137 PHE A CB    1 
ATOM   822   C  CG    . PHE A  1  111 ? -42.420 115.984 16.092  1.00 109.94 ? 137 PHE A CG    1 
ATOM   823   C  CD1   . PHE A  1  111 ? -41.953 115.263 17.187  1.00 110.09 ? 137 PHE A CD1   1 
ATOM   824   C  CD2   . PHE A  1  111 ? -43.045 115.295 15.055  1.00 109.56 ? 137 PHE A CD2   1 
ATOM   825   C  CE1   . PHE A  1  111 ? -42.107 113.880 17.250  1.00 109.64 ? 137 PHE A CE1   1 
ATOM   826   C  CE2   . PHE A  1  111 ? -43.204 113.911 15.109  1.00 109.19 ? 137 PHE A CE2   1 
ATOM   827   C  CZ    . PHE A  1  111 ? -42.736 113.203 16.209  1.00 109.43 ? 137 PHE A CZ    1 
ATOM   828   N  N     . GLU A  1  112 ? -40.772 118.197 13.327  1.00 109.50 ? 138 GLU A N     1 
ATOM   829   C  CA    . GLU A  1  112 ? -40.389 117.802 11.975  1.00 109.00 ? 138 GLU A CA    1 
ATOM   830   C  C     . GLU A  1  112 ? -38.906 118.046 11.685  1.00 108.00 ? 138 GLU A C     1 
ATOM   831   O  O     . GLU A  1  112 ? -38.291 117.304 10.916  1.00 108.59 ? 138 GLU A O     1 
ATOM   832   C  CB    . GLU A  1  112 ? -41.266 118.505 10.928  1.00 109.71 ? 138 GLU A CB    1 
ATOM   833   C  CG    . GLU A  1  112 ? -42.748 118.105 10.966  1.00 110.97 ? 138 GLU A CG    1 
ATOM   834   C  CD    . GLU A  1  112 ? -42.984 116.610 10.754  1.00 112.04 ? 138 GLU A CD    1 
ATOM   835   O  OE1   . GLU A  1  112 ? -42.444 116.045 9.775   1.00 112.34 ? 138 GLU A OE1   1 
ATOM   836   O  OE2   . GLU A  1  112 ? -43.719 116.002 11.565  1.00 111.15 ? 138 GLU A OE2   1 
ATOM   837   N  N     . ALA A  1  113 ? -38.338 119.085 12.294  1.00 106.33 ? 139 ALA A N     1 
ATOM   838   C  CA    . ALA A  1  113 ? -36.925 119.405 12.103  1.00 104.84 ? 139 ALA A CA    1 
ATOM   839   C  C     . ALA A  1  113 ? -36.061 118.490 12.967  1.00 103.68 ? 139 ALA A C     1 
ATOM   840   O  O     . ALA A  1  113 ? -34.894 118.245 12.655  1.00 103.87 ? 139 ALA A O     1 
ATOM   841   C  CB    . ALA A  1  113 ? -36.658 120.866 12.441  1.00 105.04 ? 139 ALA A CB    1 
ATOM   842   N  N     . THR A  1  114 ? -36.638 118.009 14.065  1.00 101.63 ? 140 THR A N     1 
ATOM   843   C  CA    . THR A  1  114 ? -35.952 117.104 14.978  1.00 100.25 ? 140 THR A CA    1 
ATOM   844   C  C     . THR A  1  114 ? -35.975 115.680 14.416  1.00 99.44  ? 140 THR A C     1 
ATOM   845   O  O     . THR A  1  114 ? -34.955 114.985 14.413  1.00 99.78  ? 140 THR A O     1 
ATOM   846   C  CB    . THR A  1  114 ? -36.608 117.126 16.376  1.00 100.05 ? 140 THR A CB    1 
ATOM   847   O  OG1   . THR A  1  114 ? -36.270 118.350 17.039  1.00 99.43  ? 140 THR A OG1   1 
ATOM   848   C  CG2   . THR A  1  114 ? -36.144 115.942 17.219  1.00 100.26 ? 140 THR A CG2   1 
ATOM   849   N  N     . LYS A  1  115 ? -37.146 115.261 13.941  1.00 97.65  ? 141 LYS A N     1 
ATOM   850   C  CA    . LYS A  1  115 ? -37.342 113.938 13.355  1.00 95.41  ? 141 LYS A CA    1 
ATOM   851   C  C     . LYS A  1  115 ? -36.376 113.747 12.192  1.00 94.26  ? 141 LYS A C     1 
ATOM   852   O  O     . LYS A  1  115 ? -35.839 112.665 12.001  1.00 93.96  ? 141 LYS A O     1 
ATOM   853   C  CB    . LYS A  1  115 ? -38.779 113.811 12.849  1.00 95.42  ? 141 LYS A CB    1 
ATOM   854   C  CG    . LYS A  1  115 ? -39.186 112.438 12.340  1.00 94.47  ? 141 LYS A CG    1 
ATOM   855   C  CD    . LYS A  1  115 ? -40.203 112.579 11.213  1.00 93.63  ? 141 LYS A CD    1 
ATOM   856   C  CE    . LYS A  1  115 ? -40.953 111.291 10.943  1.00 92.51  ? 141 LYS A CE    1 
ATOM   857   N  NZ    . LYS A  1  115 ? -41.921 110.993 12.034  1.00 91.98  ? 141 LYS A NZ    1 
ATOM   858   N  N     . LYS A  1  116 ? -36.147 114.811 11.431  1.00 94.26  ? 142 LYS A N     1 
ATOM   859   C  CA    . LYS A  1  116 ? -35.243 114.764 10.289  1.00 95.27  ? 142 LYS A CA    1 
ATOM   860   C  C     . LYS A  1  116 ? -33.782 114.603 10.726  1.00 95.06  ? 142 LYS A C     1 
ATOM   861   O  O     . LYS A  1  116 ? -32.943 114.147 9.945   1.00 95.59  ? 142 LYS A O     1 
ATOM   862   C  CB    . LYS A  1  116 ? -35.414 116.021 9.424   1.00 96.25  ? 142 LYS A CB    1 
ATOM   863   C  CG    . LYS A  1  116 ? -34.643 115.988 8.105   1.00 98.18  ? 142 LYS A CG    1 
ATOM   864   C  CD    . LYS A  1  116 ? -35.023 117.137 7.166   1.00 99.41  ? 142 LYS A CD    1 
ATOM   865   C  CE    . LYS A  1  116 ? -36.350 116.885 6.439   1.00 99.77  ? 142 LYS A CE    1 
ATOM   866   N  NZ    . LYS A  1  116 ? -37.534 116.853 7.350   1.00 99.14  ? 142 LYS A NZ    1 
ATOM   867   N  N     . SER A  1  117 ? -33.487 114.971 11.973  1.00 94.29  ? 143 SER A N     1 
ATOM   868   C  CA    . SER A  1  117 ? -32.132 114.854 12.512  1.00 93.30  ? 143 SER A CA    1 
ATOM   869   C  C     . SER A  1  117 ? -31.824 113.473 13.079  1.00 92.50  ? 143 SER A C     1 
ATOM   870   O  O     . SER A  1  117 ? -30.725 112.960 12.886  1.00 93.18  ? 143 SER A O     1 
ATOM   871   C  CB    . SER A  1  117 ? -31.862 115.924 13.569  1.00 93.08  ? 143 SER A CB    1 
ATOM   872   O  OG    . SER A  1  117 ? -31.505 117.146 12.954  1.00 94.45  ? 143 SER A OG    1 
ATOM   873   N  N     . VAL A  1  118 ? -32.783 112.879 13.786  1.00 90.83  ? 144 VAL A N     1 
ATOM   874   C  CA    . VAL A  1  118 ? -32.581 111.550 14.353  1.00 90.23  ? 144 VAL A CA    1 
ATOM   875   C  C     . VAL A  1  118 ? -32.564 110.512 13.237  1.00 89.94  ? 144 VAL A C     1 
ATOM   876   O  O     . VAL A  1  118 ? -31.960 109.451 13.374  1.00 91.02  ? 144 VAL A O     1 
ATOM   877   C  CB    . VAL A  1  118 ? -33.672 111.172 15.386  1.00 90.21  ? 144 VAL A CB    1 
ATOM   878   C  CG1   . VAL A  1  118 ? -33.753 112.222 16.474  1.00 90.51  ? 144 VAL A CG1   1 
ATOM   879   C  CG2   . VAL A  1  118 ? -35.019 110.990 14.709  1.00 91.49  ? 144 VAL A CG2   1 
ATOM   880   N  N     . LEU A  1  119 ? -33.227 110.831 12.130  1.00 88.55  ? 145 LEU A N     1 
ATOM   881   C  CA    . LEU A  1  119 ? -33.281 109.937 10.987  1.00 87.74  ? 145 LEU A CA    1 
ATOM   882   C  C     . LEU A  1  119 ? -31.940 109.894 10.264  1.00 87.77  ? 145 LEU A C     1 
ATOM   883   O  O     . LEU A  1  119 ? -31.531 108.842 9.780   1.00 87.99  ? 145 LEU A O     1 
ATOM   884   C  CB    . LEU A  1  119 ? -34.410 110.350 10.037  1.00 87.03  ? 145 LEU A CB    1 
ATOM   885   C  CG    . LEU A  1  119 ? -35.641 109.434 10.066  1.00 86.76  ? 145 LEU A CG    1 
ATOM   886   C  CD1   . LEU A  1  119 ? -36.065 109.132 11.496  1.00 85.65  ? 145 LEU A CD1   1 
ATOM   887   C  CD2   . LEU A  1  119 ? -36.780 110.060 9.281   1.00 86.70  ? 145 LEU A CD2   1 
ATOM   888   N  N     . LYS A  1  120 ? -31.263 111.036 10.182  1.00 87.63  ? 146 LYS A N     1 
ATOM   889   C  CA    . LYS A  1  120 ? -29.952 111.098 9.539   1.00 88.45  ? 146 LYS A CA    1 
ATOM   890   C  C     . LYS A  1  120 ? -28.927 110.557 10.541  1.00 87.99  ? 146 LYS A C     1 
ATOM   891   O  O     . LYS A  1  120 ? -27.853 110.073 10.170  1.00 88.07  ? 146 LYS A O     1 
ATOM   892   C  CB    . LYS A  1  120 ? -29.601 112.546 9.176   1.00 89.53  ? 146 LYS A CB    1 
ATOM   893   C  CG    . LYS A  1  120 ? -28.322 112.701 8.356   1.00 91.31  ? 146 LYS A CG    1 
ATOM   894   C  CD    . LYS A  1  120 ? -27.936 114.168 8.191   1.00 94.05  ? 146 LYS A CD    1 
ATOM   895   C  CE    . LYS A  1  120 ? -26.722 114.337 7.276   1.00 95.71  ? 146 LYS A CE    1 
ATOM   896   N  NZ    . LYS A  1  120 ? -25.514 113.611 7.774   1.00 96.62  ? 146 LYS A NZ    1 
ATOM   897   N  N     . GLN A  1  121 ? -29.301 110.630 11.814  1.00 86.76  ? 147 GLN A N     1 
ATOM   898   C  CA    . GLN A  1  121 ? -28.477 110.190 12.929  1.00 86.23  ? 147 GLN A CA    1 
ATOM   899   C  C     . GLN A  1  121 ? -28.427 108.665 13.019  1.00 85.16  ? 147 GLN A C     1 
ATOM   900   O  O     . GLN A  1  121 ? -27.358 108.069 12.908  1.00 85.17  ? 147 GLN A O     1 
ATOM   901   C  CB    . GLN A  1  121 ? -29.055 110.782 14.216  1.00 87.21  ? 147 GLN A CB    1 
ATOM   902   C  CG    . GLN A  1  121 ? -28.174 110.732 15.439  1.00 88.30  ? 147 GLN A CG    1 
ATOM   903   C  CD    . GLN A  1  121 ? -28.825 111.431 16.617  1.00 89.90  ? 147 GLN A CD    1 
ATOM   904   O  OE1   . GLN A  1  121 ? -29.034 110.834 17.676  1.00 91.40  ? 147 GLN A OE1   1 
ATOM   905   N  NE2   . GLN A  1  121 ? -29.177 112.698 16.427  1.00 89.24  ? 147 GLN A NE2   1 
ATOM   906   N  N     . VAL A  1  122 ? -29.585 108.044 13.223  1.00 83.87  ? 148 VAL A N     1 
ATOM   907   C  CA    . VAL A  1  122 ? -29.676 106.591 13.325  1.00 82.64  ? 148 VAL A CA    1 
ATOM   908   C  C     . VAL A  1  122 ? -29.210 105.915 12.040  1.00 82.60  ? 148 VAL A C     1 
ATOM   909   O  O     . VAL A  1  122 ? -28.627 104.834 12.080  1.00 83.43  ? 148 VAL A O     1 
ATOM   910   C  CB    . VAL A  1  122 ? -31.111 106.140 13.667  1.00 82.02  ? 148 VAL A CB    1 
ATOM   911   C  CG1   . VAL A  1  122 ? -31.232 104.623 13.573  1.00 82.97  ? 148 VAL A CG1   1 
ATOM   912   C  CG2   . VAL A  1  122 ? -31.474 106.598 15.073  1.00 81.28  ? 148 VAL A CG2   1 
ATOM   913   N  N     . GLN A  1  123 ? -29.458 106.559 10.906  1.00 82.12  ? 149 GLN A N     1 
ATOM   914   C  CA    . GLN A  1  123 ? -29.044 106.021 9.619   1.00 82.46  ? 149 GLN A CA    1 
ATOM   915   C  C     . GLN A  1  123 ? -27.527 105.999 9.555   1.00 81.64  ? 149 GLN A C     1 
ATOM   916   O  O     . GLN A  1  123 ? -26.930 105.003 9.156   1.00 82.23  ? 149 GLN A O     1 
ATOM   917   C  CB    . GLN A  1  123 ? -29.586 106.883 8.481   1.00 84.91  ? 149 GLN A CB    1 
ATOM   918   C  CG    . GLN A  1  123 ? -29.135 106.449 7.097   1.00 88.71  ? 149 GLN A CG    1 
ATOM   919   C  CD    . GLN A  1  123 ? -29.604 107.397 6.013   1.00 91.48  ? 149 GLN A CD    1 
ATOM   920   O  OE1   . GLN A  1  123 ? -30.784 107.754 5.950   1.00 92.13  ? 149 GLN A OE1   1 
ATOM   921   N  NE2   . GLN A  1  123 ? -28.677 107.815 5.150   1.00 92.34  ? 149 GLN A NE2   1 
ATOM   922   N  N     . ASP A  1  124 ? -26.912 107.101 9.971   1.00 80.99  ? 150 ASP A N     1 
ATOM   923   C  CA    . ASP A  1  124 ? -25.459 107.237 9.971   1.00 80.56  ? 150 ASP A CA    1 
ATOM   924   C  C     . ASP A  1  124 ? -24.810 106.150 10.829  1.00 78.87  ? 150 ASP A C     1 
ATOM   925   O  O     . ASP A  1  124 ? -23.753 105.616 10.484  1.00 77.62  ? 150 ASP A O     1 
ATOM   926   C  CB    . ASP A  1  124 ? -25.074 108.616 10.507  1.00 82.60  ? 150 ASP A CB    1 
ATOM   927   C  CG    . ASP A  1  124 ? -24.076 109.324 9.622   1.00 85.59  ? 150 ASP A CG    1 
ATOM   928   O  OD1   . ASP A  1  124 ? -22.856 109.117 9.820   1.00 86.66  ? 150 ASP A OD1   1 
ATOM   929   O  OD2   . ASP A  1  124 ? -24.517 110.088 8.732   1.00 86.07  ? 150 ASP A OD2   1 
ATOM   930   N  N     . PHE A  1  125 ? -25.472 105.831 11.939  1.00 77.17  ? 151 PHE A N     1 
ATOM   931   C  CA    . PHE A  1  125 ? -25.023 104.821 12.891  1.00 76.01  ? 151 PHE A CA    1 
ATOM   932   C  C     . PHE A  1  125 ? -24.946 103.446 12.237  1.00 76.09  ? 151 PHE A C     1 
ATOM   933   O  O     . PHE A  1  125 ? -23.919 102.770 12.313  1.00 76.65  ? 151 PHE A O     1 
ATOM   934   C  CB    . PHE A  1  125 ? -25.992 104.778 14.075  1.00 74.00  ? 151 PHE A CB    1 
ATOM   935   C  CG    . PHE A  1  125 ? -25.679 103.718 15.090  1.00 72.39  ? 151 PHE A CG    1 
ATOM   936   C  CD1   . PHE A  1  125 ? -24.553 103.816 15.896  1.00 71.58  ? 151 PHE A CD1   1 
ATOM   937   C  CD2   . PHE A  1  125 ? -26.532 102.635 15.265  1.00 72.02  ? 151 PHE A CD2   1 
ATOM   938   C  CE1   . PHE A  1  125 ? -24.283 102.853 16.869  1.00 70.49  ? 151 PHE A CE1   1 
ATOM   939   C  CE2   . PHE A  1  125 ? -26.271 101.668 16.234  1.00 71.25  ? 151 PHE A CE2   1 
ATOM   940   C  CZ    . PHE A  1  125 ? -25.142 101.780 17.037  1.00 69.86  ? 151 PHE A CZ    1 
ATOM   941   N  N     . GLU A  1  126 ? -26.031 103.057 11.577  1.00 75.69  ? 152 GLU A N     1 
ATOM   942   C  CA    . GLU A  1  126 ? -26.129 101.767 10.905  1.00 75.75  ? 152 GLU A CA    1 
ATOM   943   C  C     . GLU A  1  126 ? -25.197 101.650 9.696   1.00 75.83  ? 152 GLU A C     1 
ATOM   944   O  O     . GLU A  1  126 ? -24.816 100.549 9.306   1.00 76.14  ? 152 GLU A O     1 
ATOM   945   C  CB    . GLU A  1  126 ? -27.572 101.533 10.467  1.00 76.66  ? 152 GLU A CB    1 
ATOM   946   C  CG    . GLU A  1  126 ? -28.076 100.129 10.717  1.00 78.22  ? 152 GLU A CG    1 
ATOM   947   C  CD    . GLU A  1  126 ? -28.212 99.810  12.191  1.00 79.31  ? 152 GLU A CD    1 
ATOM   948   O  OE1   . GLU A  1  126 ? -28.821 100.612 12.937  1.00 78.62  ? 152 GLU A OE1   1 
ATOM   949   O  OE2   . GLU A  1  126 ? -27.714 98.744  12.603  1.00 81.40  ? 152 GLU A OE2   1 
ATOM   950   N  N     . ASP A  1  127 ? -24.837 102.787 9.109   1.00 75.47  ? 153 ASP A N     1 
ATOM   951   C  CA    . ASP A  1  127 ? -23.953 102.817 7.948   1.00 74.94  ? 153 ASP A CA    1 
ATOM   952   C  C     . ASP A  1  127 ? -22.460 102.837 8.290   1.00 73.49  ? 153 ASP A C     1 
ATOM   953   O  O     . ASP A  1  127 ? -21.638 102.454 7.456   1.00 73.41  ? 153 ASP A O     1 
ATOM   954   C  CB    . ASP A  1  127 ? -24.257 104.049 7.080   1.00 77.82  ? 153 ASP A CB    1 
ATOM   955   C  CG    . ASP A  1  127 ? -25.217 103.753 5.936   1.00 82.19  ? 153 ASP A CG    1 
ATOM   956   O  OD1   . ASP A  1  127 ? -26.413 103.480 6.198   1.00 83.95  ? 153 ASP A OD1   1 
ATOM   957   O  OD2   . ASP A  1  127 ? -24.774 103.818 4.765   1.00 83.78  ? 153 ASP A OD2   1 
ATOM   958   N  N     . ASN A  1  128 ? -22.098 103.277 9.498   1.00 70.81  ? 154 ASN A N     1 
ATOM   959   C  CA    . ASN A  1  128 ? -20.676 103.380 9.834   1.00 68.60  ? 154 ASN A CA    1 
ATOM   960   C  C     . ASN A  1  128 ? -20.155 102.893 11.185  1.00 66.56  ? 154 ASN A C     1 
ATOM   961   O  O     . ASN A  1  128 ? -19.011 102.444 11.269  1.00 67.22  ? 154 ASN A O     1 
ATOM   962   C  CB    . ASN A  1  128 ? -20.200 104.815 9.604   1.00 69.53  ? 154 ASN A CB    1 
ATOM   963   C  CG    . ASN A  1  128 ? -20.563 105.332 8.227   1.00 70.84  ? 154 ASN A CG    1 
ATOM   964   O  OD1   . ASN A  1  128 ? -20.017 104.888 7.214   1.00 71.46  ? 154 ASN A OD1   1 
ATOM   965   N  ND2   . ASN A  1  128 ? -21.521 106.252 8.181   1.00 71.46  ? 154 ASN A ND2   1 
ATOM   966   N  N     . ASP A  1  129 ? -20.942 103.018 12.248  1.00 63.07  ? 155 ASP A N     1 
ATOM   967   C  CA    . ASP A  1  129 ? -20.479 102.561 13.554  1.00 60.72  ? 155 ASP A CA    1 
ATOM   968   C  C     . ASP A  1  129 ? -20.685 101.054 13.673  1.00 58.75  ? 155 ASP A C     1 
ATOM   969   O  O     . ASP A  1  129 ? -21.570 100.581 14.396  1.00 57.61  ? 155 ASP A O     1 
ATOM   970   C  CB    . ASP A  1  129 ? -21.202 103.301 14.681  1.00 62.35  ? 155 ASP A CB    1 
ATOM   971   C  CG    . ASP A  1  129 ? -20.592 103.037 16.059  1.00 63.71  ? 155 ASP A CG    1 
ATOM   972   O  OD1   . ASP A  1  129 ? -19.661 102.209 16.193  1.00 64.79  ? 155 ASP A OD1   1 
ATOM   973   O  OD2   . ASP A  1  129 ? -21.056 103.674 17.024  1.00 64.82  ? 155 ASP A OD2   1 
ATOM   974   N  N     . HIS A  1  130 ? -19.803 100.309 13.010  1.00 55.86  ? 156 HIS A N     1 
ATOM   975   C  CA    . HIS A  1  130 ? -19.867 98.849  12.987  1.00 51.66  ? 156 HIS A CA    1 
ATOM   976   C  C     . HIS A  1  130 ? -19.748 98.146  14.338  1.00 49.87  ? 156 HIS A C     1 
ATOM   977   O  O     . HIS A  1  130 ? -20.576 97.300  14.656  1.00 47.57  ? 156 HIS A O     1 
ATOM   978   C  CB    . HIS A  1  130 ? -18.874 98.311  11.966  1.00 47.90  ? 156 HIS A CB    1 
ATOM   979   C  CG    . HIS A  1  130 ? -19.048 98.912  10.606  1.00 46.32  ? 156 HIS A CG    1 
ATOM   980   N  ND1   . HIS A  1  130 ? -18.031 99.567  9.943   1.00 46.57  ? 156 HIS A ND1   1 
ATOM   981   C  CD2   . HIS A  1  130 ? -20.130 98.980  9.794   1.00 44.18  ? 156 HIS A CD2   1 
ATOM   982   C  CE1   . HIS A  1  130 ? -18.477 100.012 8.782   1.00 44.76  ? 156 HIS A CE1   1 
ATOM   983   N  NE2   . HIS A  1  130 ? -19.749 99.669  8.666   1.00 43.98  ? 156 HIS A NE2   1 
ATOM   984   N  N     . PRO A  1  131 ? -18.733 98.487  15.156  1.00 50.28  ? 157 PRO A N     1 
ATOM   985   C  CA    . PRO A  1  131 ? -18.656 97.795  16.446  1.00 50.39  ? 157 PRO A CA    1 
ATOM   986   C  C     . PRO A  1  131 ? -19.894 97.951  17.326  1.00 52.39  ? 157 PRO A C     1 
ATOM   987   O  O     . PRO A  1  131 ? -20.358 96.970  17.920  1.00 54.16  ? 157 PRO A O     1 
ATOM   988   C  CB    . PRO A  1  131 ? -17.381 98.369  17.088  1.00 47.58  ? 157 PRO A CB    1 
ATOM   989   C  CG    . PRO A  1  131 ? -17.068 99.586  16.307  1.00 48.15  ? 157 PRO A CG    1 
ATOM   990   C  CD    . PRO A  1  131 ? -17.505 99.261  14.912  1.00 50.09  ? 157 PRO A CD    1 
ATOM   991   N  N     . ASN A  1  132 ? -20.458 99.158  17.385  1.00 54.06  ? 158 ASN A N     1 
ATOM   992   C  CA    . ASN A  1  132 ? -21.657 99.388  18.205  1.00 55.49  ? 158 ASN A CA    1 
ATOM   993   C  C     . ASN A  1  132 ? -22.892 98.799  17.534  1.00 54.54  ? 158 ASN A C     1 
ATOM   994   O  O     . ASN A  1  132 ? -23.810 98.305  18.197  1.00 54.50  ? 158 ASN A O     1 
ATOM   995   C  CB    . ASN A  1  132 ? -21.854 100.885 18.488  1.00 56.71  ? 158 ASN A CB    1 
ATOM   996   C  CG    . ASN A  1  132 ? -20.853 101.417 19.488  1.00 57.87  ? 158 ASN A CG    1 
ATOM   997   O  OD1   . ASN A  1  132 ? -20.887 101.053 20.667  1.00 58.23  ? 158 ASN A OD1   1 
ATOM   998   N  ND2   . ASN A  1  132 ? -19.933 102.254 19.021  1.00 56.46  ? 158 ASN A ND2   1 
ATOM   999   N  N     . ARG A  1  133 ? -22.900 98.870  16.209  1.00 53.25  ? 159 ARG A N     1 
ATOM   1000  C  CA    . ARG A  1  133 ? -23.974 98.327  15.396  1.00 53.79  ? 159 ARG A CA    1 
ATOM   1001  C  C     . ARG A  1  133 ? -24.065 96.813  15.689  1.00 53.30  ? 159 ARG A C     1 
ATOM   1002  O  O     . ARG A  1  133 ? -25.155 96.261  15.865  1.00 53.01  ? 159 ARG A O     1 
ATOM   1003  C  CB    . ARG A  1  133 ? -23.627 98.593  13.929  1.00 55.05  ? 159 ARG A CB    1 
ATOM   1004  C  CG    . ARG A  1  133 ? -24.586 98.077  12.910  1.00 58.09  ? 159 ARG A CG    1 
ATOM   1005  C  CD    . ARG A  1  133 ? -24.066 98.401  11.524  1.00 60.20  ? 159 ARG A CD    1 
ATOM   1006  N  NE    . ARG A  1  133 ? -24.646 97.512  10.517  1.00 64.44  ? 159 ARG A NE    1 
ATOM   1007  C  CZ    . ARG A  1  133 ? -23.952 96.942  9.532   1.00 65.11  ? 159 ARG A CZ    1 
ATOM   1008  N  NH1   . ARG A  1  133 ? -24.569 96.146  8.670   1.00 66.25  ? 159 ARG A NH1   1 
ATOM   1009  N  NH2   . ARG A  1  133 ? -22.648 97.180  9.397   1.00 63.50  ? 159 ARG A NH2   1 
ATOM   1010  N  N     . VAL A  1  134 ? -22.908 96.164  15.800  1.00 51.21  ? 160 VAL A N     1 
ATOM   1011  C  CA    . VAL A  1  134 ? -22.860 94.741  16.087  1.00 51.28  ? 160 VAL A CA    1 
ATOM   1012  C  C     . VAL A  1  134 ? -23.287 94.431  17.527  1.00 51.96  ? 160 VAL A C     1 
ATOM   1013  O  O     . VAL A  1  134 ? -24.051 93.489  17.770  1.00 52.62  ? 160 VAL A O     1 
ATOM   1014  C  CB    . VAL A  1  134 ? -21.454 94.154  15.804  1.00 52.22  ? 160 VAL A CB    1 
ATOM   1015  C  CG1   . VAL A  1  134 ? -21.302 92.785  16.453  1.00 52.63  ? 160 VAL A CG1   1 
ATOM   1016  C  CG2   . VAL A  1  134 ? -21.240 94.017  14.310  1.00 50.80  ? 160 VAL A CG2   1 
ATOM   1017  N  N     . LEU A  1  135 ? -22.804 95.219  18.483  1.00 51.79  ? 161 LEU A N     1 
ATOM   1018  C  CA    . LEU A  1  135 ? -23.170 94.991  19.876  1.00 51.97  ? 161 LEU A CA    1 
ATOM   1019  C  C     . LEU A  1  135 ? -24.677 95.203  20.055  1.00 51.97  ? 161 LEU A C     1 
ATOM   1020  O  O     . LEU A  1  135 ? -25.339 94.484  20.811  1.00 51.47  ? 161 LEU A O     1 
ATOM   1021  C  CB    . LEU A  1  135 ? -22.362 95.898  20.813  1.00 51.69  ? 161 LEU A CB    1 
ATOM   1022  C  CG    . LEU A  1  135 ? -22.483 95.562  22.308  1.00 52.76  ? 161 LEU A CG    1 
ATOM   1023  C  CD1   . LEU A  1  135 ? -21.985 94.147  22.579  1.00 52.16  ? 161 LEU A CD1   1 
ATOM   1024  C  CD2   . LEU A  1  135 ? -21.699 96.565  23.138  1.00 53.02  ? 161 LEU A CD2   1 
ATOM   1025  N  N     . GLU A  1  136 ? -25.226 96.160  19.316  1.00 53.12  ? 162 GLU A N     1 
ATOM   1026  C  CA    . GLU A  1  136 ? -26.655 96.427  19.389  1.00 55.72  ? 162 GLU A CA    1 
ATOM   1027  C  C     . GLU A  1  136 ? -27.430 95.211  18.856  1.00 54.91  ? 162 GLU A C     1 
ATOM   1028  O  O     . GLU A  1  136 ? -28.409 94.771  19.467  1.00 54.15  ? 162 GLU A O     1 
ATOM   1029  C  CB    . GLU A  1  136 ? -27.004 97.702  18.611  1.00 58.48  ? 162 GLU A CB    1 
ATOM   1030  C  CG    . GLU A  1  136 ? -28.348 98.324  18.997  1.00 63.11  ? 162 GLU A CG    1 
ATOM   1031  C  CD    . GLU A  1  136 ? -28.328 99.060  20.340  1.00 64.32  ? 162 GLU A CD    1 
ATOM   1032  O  OE1   . GLU A  1  136 ? -28.142 98.409  21.397  1.00 62.97  ? 162 GLU A OE1   1 
ATOM   1033  O  OE2   . GLU A  1  136 ? -28.532 100.297 20.330  1.00 66.17  ? 162 GLU A OE2   1 
ATOM   1034  N  N     . HIS A  1  137 ? -26.959 94.644  17.743  1.00 54.60  ? 163 HIS A N     1 
ATOM   1035  C  CA    . HIS A  1  137 ? -27.589 93.455  17.159  1.00 54.21  ? 163 HIS A CA    1 
ATOM   1036  C  C     . HIS A  1  137 ? -27.437 92.229  18.058  1.00 55.02  ? 163 HIS A C     1 
ATOM   1037  O  O     . HIS A  1  137 ? -28.278 91.319  18.019  1.00 56.21  ? 163 HIS A O     1 
ATOM   1038  C  CB    . HIS A  1  137 ? -27.009 93.141  15.786  1.00 52.69  ? 163 HIS A CB    1 
ATOM   1039  C  CG    . HIS A  1  137 ? -27.649 93.905  14.673  1.00 53.18  ? 163 HIS A CG    1 
ATOM   1040  N  ND1   . HIS A  1  137 ? -27.062 95.011  14.097  1.00 52.74  ? 163 HIS A ND1   1 
ATOM   1041  C  CD2   . HIS A  1  137 ? -28.819 93.714  14.018  1.00 52.51  ? 163 HIS A CD2   1 
ATOM   1042  C  CE1   . HIS A  1  137 ? -27.841 95.467  13.133  1.00 53.52  ? 163 HIS A CE1   1 
ATOM   1043  N  NE2   . HIS A  1  137 ? -28.913 94.698  13.064  1.00 52.55  ? 163 HIS A NE2   1 
ATOM   1044  N  N     . LEU A  1  138 ? -26.360 92.198  18.846  1.00 53.26  ? 164 LEU A N     1 
ATOM   1045  C  CA    . LEU A  1  138 ? -26.110 91.093  19.765  1.00 52.10  ? 164 LEU A CA    1 
ATOM   1046  C  C     . LEU A  1  138 ? -27.270 91.023  20.761  1.00 51.94  ? 164 LEU A C     1 
ATOM   1047  O  O     . LEU A  1  138 ? -27.802 89.944  21.034  1.00 50.99  ? 164 LEU A O     1 
ATOM   1048  C  CB    . LEU A  1  138 ? -24.798 91.316  20.513  1.00 53.49  ? 164 LEU A CB    1 
ATOM   1049  C  CG    . LEU A  1  138 ? -23.921 90.110  20.873  1.00 54.09  ? 164 LEU A CG    1 
ATOM   1050  C  CD1   . LEU A  1  138 ? -23.062 90.497  22.058  1.00 54.49  ? 164 LEU A CD1   1 
ATOM   1051  C  CD2   . LEU A  1  138 ? -24.743 88.876  21.209  1.00 53.01  ? 164 LEU A CD2   1 
ATOM   1052  N  N     . HIS A  1  139 ? -27.663 92.184  21.291  1.00 52.42  ? 165 HIS A N     1 
ATOM   1053  C  CA    . HIS A  1  139 ? -28.783 92.269  22.240  1.00 51.73  ? 165 HIS A CA    1 
ATOM   1054  C  C     . HIS A  1  139 ? -30.059 91.880  21.517  1.00 49.57  ? 165 HIS A C     1 
ATOM   1055  O  O     . HIS A  1  139 ? -30.946 91.233  22.084  1.00 47.73  ? 165 HIS A O     1 
ATOM   1056  C  CB    . HIS A  1  139 ? -28.952 93.703  22.767  1.00 53.32  ? 165 HIS A CB    1 
ATOM   1057  C  CG    . HIS A  1  139 ? -27.907 94.123  23.750  1.00 53.41  ? 165 HIS A CG    1 
ATOM   1058  N  ND1   . HIS A  1  139 ? -26.819 94.889  23.395  1.00 53.76  ? 165 HIS A ND1   1 
ATOM   1059  C  CD2   . HIS A  1  139 ? -27.794 93.899  25.082  1.00 53.84  ? 165 HIS A CD2   1 
ATOM   1060  C  CE1   . HIS A  1  139 ? -26.079 95.121  24.465  1.00 53.38  ? 165 HIS A CE1   1 
ATOM   1061  N  NE2   . HIS A  1  139 ? -26.648 94.532  25.502  1.00 53.28  ? 165 HIS A NE2   1 
ATOM   1062  N  N     . SER A  1  140 ? -30.132 92.299  20.256  1.00 48.55  ? 166 SER A N     1 
ATOM   1063  C  CA    . SER A  1  140 ? -31.274 92.029  19.398  1.00 49.31  ? 166 SER A CA    1 
ATOM   1064  C  C     . SER A  1  140 ? -31.607 90.545  19.236  1.00 50.98  ? 166 SER A C     1 
ATOM   1065  O  O     . SER A  1  140 ? -32.780 90.161  19.313  1.00 52.56  ? 166 SER A O     1 
ATOM   1066  C  CB    . SER A  1  140 ? -31.045 92.659  18.030  1.00 48.19  ? 166 SER A CB    1 
ATOM   1067  O  OG    . SER A  1  140 ? -32.169 92.458  17.204  1.00 52.17  ? 166 SER A OG    1 
ATOM   1068  N  N     . THR A  1  141 ? -30.591 89.710  19.003  1.00 50.28  ? 167 THR A N     1 
ATOM   1069  C  CA    . THR A  1  141 ? -30.839 88.282  18.833  1.00 50.75  ? 167 THR A CA    1 
ATOM   1070  C  C     . THR A  1  141 ? -30.815 87.512  20.147  1.00 50.46  ? 167 THR A C     1 
ATOM   1071  O  O     . THR A  1  141 ? -31.584 86.572  20.329  1.00 50.00  ? 167 THR A O     1 
ATOM   1072  C  CB    . THR A  1  141 ? -29.859 87.635  17.817  1.00 52.84  ? 167 THR A CB    1 
ATOM   1073  O  OG1   . THR A  1  141 ? -30.150 86.234  17.689  1.00 51.70  ? 167 THR A OG1   1 
ATOM   1074  C  CG2   . THR A  1  141 ? -28.414 87.822  18.254  1.00 52.31  ? 167 THR A CG2   1 
ATOM   1075  N  N     . ALA A  1  142 ? -29.953 87.938  21.066  1.00 50.76  ? 168 ALA A N     1 
ATOM   1076  C  CA    . ALA A  1  142 ? -29.814 87.296  22.373  1.00 51.61  ? 168 ALA A CA    1 
ATOM   1077  C  C     . ALA A  1  142 ? -31.101 87.324  23.184  1.00 53.73  ? 168 ALA A C     1 
ATOM   1078  O  O     . ALA A  1  142 ? -31.437 86.349  23.872  1.00 53.40  ? 168 ALA A O     1 
ATOM   1079  C  CB    . ALA A  1  142 ? -28.705 87.966  23.161  1.00 48.91  ? 168 ALA A CB    1 
ATOM   1080  N  N     . PHE A  1  143 ? -31.825 88.440  23.081  1.00 55.76  ? 169 PHE A N     1 
ATOM   1081  C  CA    . PHE A  1  143 ? -33.068 88.636  23.821  1.00 57.99  ? 169 PHE A CA    1 
ATOM   1082  C  C     . PHE A  1  143 ? -34.310 88.771  22.940  1.00 60.23  ? 169 PHE A C     1 
ATOM   1083  O  O     . PHE A  1  143 ? -35.339 89.254  23.408  1.00 61.13  ? 169 PHE A O     1 
ATOM   1084  C  CB    . PHE A  1  143 ? -32.959 89.897  24.690  1.00 56.51  ? 169 PHE A CB    1 
ATOM   1085  C  CG    . PHE A  1  143 ? -31.884 89.839  25.735  1.00 53.34  ? 169 PHE A CG    1 
ATOM   1086  C  CD1   . PHE A  1  143 ? -30.771 90.667  25.644  1.00 52.23  ? 169 PHE A CD1   1 
ATOM   1087  C  CD2   . PHE A  1  143 ? -31.997 88.983  26.826  1.00 53.75  ? 169 PHE A CD2   1 
ATOM   1088  C  CE1   . PHE A  1  143 ? -29.782 90.647  26.628  1.00 53.00  ? 169 PHE A CE1   1 
ATOM   1089  C  CE2   . PHE A  1  143 ? -31.010 88.954  27.819  1.00 54.73  ? 169 PHE A CE2   1 
ATOM   1090  C  CZ    . PHE A  1  143 ? -29.901 89.789  27.720  1.00 53.03  ? 169 PHE A CZ    1 
ATOM   1091  N  N     . GLN A  1  144 ? -34.220 88.346  21.682  1.00 62.10  ? 170 GLN A N     1 
ATOM   1092  C  CA    . GLN A  1  144 ? -35.329 88.445  20.723  1.00 62.39  ? 170 GLN A CA    1 
ATOM   1093  C  C     . GLN A  1  144 ? -36.732 88.209  21.292  1.00 63.14  ? 170 GLN A C     1 
ATOM   1094  O  O     . GLN A  1  144 ? -36.925 87.332  22.147  1.00 60.13  ? 170 GLN A O     1 
ATOM   1095  C  CB    . GLN A  1  144 ? -35.091 87.495  19.546  1.00 63.58  ? 170 GLN A CB    1 
ATOM   1096  C  CG    . GLN A  1  144 ? -35.173 86.011  19.902  1.00 63.97  ? 170 GLN A CG    1 
ATOM   1097  C  CD    . GLN A  1  144 ? -34.759 85.123  18.747  1.00 64.69  ? 170 GLN A CD    1 
ATOM   1098  O  OE1   . GLN A  1  144 ? -33.606 85.144  18.320  1.00 65.49  ? 170 GLN A OE1   1 
ATOM   1099  N  NE2   . GLN A  1  144 ? -35.699 84.337  18.234  1.00 65.07  ? 170 GLN A NE2   1 
ATOM   1100  N  N     . ASN A  1  145 ? -37.698 88.998  20.796  1.00 64.49  ? 171 ASN A N     1 
ATOM   1101  C  CA    . ASN A  1  145 ? -39.111 88.928  21.214  1.00 65.79  ? 171 ASN A CA    1 
ATOM   1102  C  C     . ASN A  1  145 ? -39.237 89.158  22.714  1.00 66.21  ? 171 ASN A C     1 
ATOM   1103  O  O     . ASN A  1  145 ? -40.095 88.578  23.389  1.00 66.84  ? 171 ASN A O     1 
ATOM   1104  C  CB    . ASN A  1  145 ? -39.724 87.571  20.847  1.00 66.71  ? 171 ASN A CB    1 
ATOM   1105  C  CG    . ASN A  1  145 ? -39.826 87.363  19.350  1.00 68.50  ? 171 ASN A CG    1 
ATOM   1106  O  OD1   . ASN A  1  145 ? -40.306 86.325  18.896  1.00 71.29  ? 171 ASN A OD1   1 
ATOM   1107  N  ND2   . ASN A  1  145 ? -39.385 88.355  18.572  1.00 67.29  ? 171 ASN A ND2   1 
ATOM   1108  N  N     . THR A  1  146 ? -38.390 90.046  23.215  1.00 65.30  ? 172 THR A N     1 
ATOM   1109  C  CA    . THR A  1  146 ? -38.337 90.354  24.626  1.00 64.61  ? 172 THR A CA    1 
ATOM   1110  C  C     . THR A  1  146 ? -37.693 91.736  24.757  1.00 66.01  ? 172 THR A C     1 
ATOM   1111  O  O     . THR A  1  146 ? -36.832 92.092  23.953  1.00 67.31  ? 172 THR A O     1 
ATOM   1112  C  CB    . THR A  1  146 ? -37.537 89.239  25.329  1.00 64.21  ? 172 THR A CB    1 
ATOM   1113  O  OG1   . THR A  1  146 ? -38.442 88.253  25.837  1.00 63.31  ? 172 THR A OG1   1 
ATOM   1114  C  CG2   . THR A  1  146 ? -36.642 89.774  26.411  1.00 64.32  ? 172 THR A CG2   1 
ATOM   1115  N  N     . PRO A  1  147 ? -38.113 92.534  25.766  1.00 66.34  ? 173 PRO A N     1 
ATOM   1116  C  CA    . PRO A  1  147 ? -37.651 93.898  26.082  1.00 64.83  ? 173 PRO A CA    1 
ATOM   1117  C  C     . PRO A  1  147 ? -36.222 94.330  25.731  1.00 64.04  ? 173 PRO A C     1 
ATOM   1118  O  O     . PRO A  1  147 ? -36.033 95.315  25.005  1.00 62.94  ? 173 PRO A O     1 
ATOM   1119  C  CB    . PRO A  1  147 ? -37.914 93.994  27.574  1.00 65.79  ? 173 PRO A CB    1 
ATOM   1120  C  CG    . PRO A  1  147 ? -39.230 93.280  27.685  1.00 67.28  ? 173 PRO A CG    1 
ATOM   1121  C  CD    . PRO A  1  147 ? -39.021 92.046  26.826  1.00 66.13  ? 173 PRO A CD    1 
ATOM   1122  N  N     . LEU A  1  148 ? -35.222 93.608  26.235  1.00 62.30  ? 174 LEU A N     1 
ATOM   1123  C  CA    . LEU A  1  148 ? -33.834 93.965  25.963  1.00 61.47  ? 174 LEU A CA    1 
ATOM   1124  C  C     . LEU A  1  148 ? -33.404 93.935  24.494  1.00 62.11  ? 174 LEU A C     1 
ATOM   1125  O  O     . LEU A  1  148 ? -32.329 94.441  24.152  1.00 62.60  ? 174 LEU A O     1 
ATOM   1126  C  CB    . LEU A  1  148 ? -32.873 93.109  26.787  1.00 61.60  ? 174 LEU A CB    1 
ATOM   1127  C  CG    . LEU A  1  148 ? -32.641 93.371  28.278  1.00 62.70  ? 174 LEU A CG    1 
ATOM   1128  C  CD1   . LEU A  1  148 ? -32.585 94.869  28.556  1.00 62.16  ? 174 LEU A CD1   1 
ATOM   1129  C  CD2   . LEU A  1  148 ? -33.732 92.730  29.086  1.00 63.59  ? 174 LEU A CD2   1 
ATOM   1130  N  N     . SER A  1  149 ? -34.233 93.363  23.622  1.00 61.60  ? 175 SER A N     1 
ATOM   1131  C  CA    . SER A  1  149 ? -33.893 93.284  22.204  1.00 61.18  ? 175 SER A CA    1 
ATOM   1132  C  C     . SER A  1  149 ? -34.058 94.592  21.446  1.00 61.34  ? 175 SER A C     1 
ATOM   1133  O  O     . SER A  1  149 ? -33.489 94.753  20.364  1.00 61.81  ? 175 SER A O     1 
ATOM   1134  C  CB    . SER A  1  149 ? -34.681 92.173  21.512  1.00 60.76  ? 175 SER A CB    1 
ATOM   1135  O  OG    . SER A  1  149 ? -36.070 92.431  21.529  1.00 63.33  ? 175 SER A OG    1 
ATOM   1136  N  N     . LEU A  1  150 ? -34.819 95.528  22.012  1.00 61.68  ? 176 LEU A N     1 
ATOM   1137  C  CA    . LEU A  1  150 ? -35.052 96.826  21.367  1.00 61.21  ? 176 LEU A CA    1 
ATOM   1138  C  C     . LEU A  1  150 ? -33.857 97.783  21.427  1.00 60.05  ? 176 LEU A C     1 
ATOM   1139  O  O     . LEU A  1  150 ? -33.415 98.173  22.510  1.00 59.72  ? 176 LEU A O     1 
ATOM   1140  C  CB    . LEU A  1  150 ? -36.279 97.525  21.967  1.00 63.31  ? 176 LEU A CB    1 
ATOM   1141  C  CG    . LEU A  1  150 ? -37.696 97.031  21.661  1.00 64.92  ? 176 LEU A CG    1 
ATOM   1142  C  CD1   . LEU A  1  150 ? -37.821 96.774  20.169  1.00 65.63  ? 176 LEU A CD1   1 
ATOM   1143  C  CD2   . LEU A  1  150 ? -38.013 95.775  22.454  1.00 66.49  ? 176 LEU A CD2   1 
ATOM   1144  N  N     . PRO A  1  151 ? -33.335 98.187  20.256  1.00 58.49  ? 177 PRO A N     1 
ATOM   1145  C  CA    . PRO A  1  151 ? -32.192 99.106  20.171  1.00 59.36  ? 177 PRO A CA    1 
ATOM   1146  C  C     . PRO A  1  151 ? -32.536 100.491 20.736  1.00 61.28  ? 177 PRO A C     1 
ATOM   1147  O  O     . PRO A  1  151 ? -33.596 101.058 20.436  1.00 61.61  ? 177 PRO A O     1 
ATOM   1148  C  CB    . PRO A  1  151 ? -31.900 99.149  18.667  1.00 57.93  ? 177 PRO A CB    1 
ATOM   1149  C  CG    . PRO A  1  151 ? -33.231 98.869  18.045  1.00 55.91  ? 177 PRO A CG    1 
ATOM   1150  C  CD    . PRO A  1  151 ? -33.776 97.771  18.915  1.00 56.28  ? 177 PRO A CD    1 
ATOM   1151  N  N     . THR A  1  152 ? -31.623 101.043 21.534  1.00 63.13  ? 178 THR A N     1 
ATOM   1152  C  CA    . THR A  1  152 ? -31.829 102.344 22.178  1.00 62.40  ? 178 THR A CA    1 
ATOM   1153  C  C     . THR A  1  152 ? -32.130 103.510 21.238  1.00 63.93  ? 178 THR A C     1 
ATOM   1154  O  O     . THR A  1  152 ? -32.996 104.332 21.534  1.00 64.54  ? 178 THR A O     1 
ATOM   1155  C  CB    . THR A  1  152 ? -30.642 102.720 23.085  1.00 60.08  ? 178 THR A CB    1 
ATOM   1156  O  OG1   . THR A  1  152 ? -29.456 102.843 22.297  1.00 58.23  ? 178 THR A OG1   1 
ATOM   1157  C  CG2   . THR A  1  152 ? -30.434 101.666 24.157  1.00 58.64  ? 178 THR A CG2   1 
ATOM   1158  N  N     . ARG A  1  153 ? -31.420 103.588 20.117  1.00 65.21  ? 179 ARG A N     1 
ATOM   1159  C  CA    . ARG A  1  153 ? -31.639 104.670 19.159  1.00 67.29  ? 179 ARG A CA    1 
ATOM   1160  C  C     . ARG A  1  153 ? -32.903 104.455 18.317  1.00 69.10  ? 179 ARG A C     1 
ATOM   1161  O  O     . ARG A  1  153 ? -33.333 105.359 17.592  1.00 68.61  ? 179 ARG A O     1 
ATOM   1162  C  CB    . ARG A  1  153 ? -30.435 104.833 18.225  1.00 68.58  ? 179 ARG A CB    1 
ATOM   1163  C  CG    . ARG A  1  153 ? -29.103 105.018 18.921  1.00 70.17  ? 179 ARG A CG    1 
ATOM   1164  C  CD    . ARG A  1  153 ? -28.401 103.676 19.102  1.00 73.65  ? 179 ARG A CD    1 
ATOM   1165  N  NE    . ARG A  1  153 ? -27.169 103.769 19.886  1.00 73.56  ? 179 ARG A NE    1 
ATOM   1166  C  CZ    . ARG A  1  153 ? -26.123 104.527 19.566  1.00 74.66  ? 179 ARG A CZ    1 
ATOM   1167  N  NH1   . ARG A  1  153 ? -25.053 104.534 20.348  1.00 75.26  ? 179 ARG A NH1   1 
ATOM   1168  N  NH2   . ARG A  1  153 ? -26.147 105.286 18.476  1.00 76.16  ? 179 ARG A NH2   1 
ATOM   1169  N  N     . GLY A  1  154 ? -33.489 103.260 18.421  1.00 69.92  ? 180 GLY A N     1 
ATOM   1170  C  CA    . GLY A  1  154 ? -34.684 102.936 17.659  1.00 70.22  ? 180 GLY A CA    1 
ATOM   1171  C  C     . GLY A  1  154 ? -34.394 102.581 16.208  1.00 71.38  ? 180 GLY A C     1 
ATOM   1172  O  O     . GLY A  1  154 ? -33.343 102.932 15.668  1.00 71.24  ? 180 GLY A O     1 
ATOM   1173  N  N     . THR A  1  155 ? -35.340 101.902 15.564  1.00 72.76  ? 181 THR A N     1 
ATOM   1174  C  CA    . THR A  1  155 ? -35.177 101.489 14.170  1.00 73.55  ? 181 THR A CA    1 
ATOM   1175  C  C     . THR A  1  155 ? -35.708 102.546 13.199  1.00 74.25  ? 181 THR A C     1 
ATOM   1176  O  O     . THR A  1  155 ? -36.721 103.188 13.469  1.00 74.78  ? 181 THR A O     1 
ATOM   1177  C  CB    . THR A  1  155 ? -35.891 100.140 13.900  1.00 73.49  ? 181 THR A CB    1 
ATOM   1178  O  OG1   . THR A  1  155 ? -37.305 100.346 13.814  1.00 75.23  ? 181 THR A OG1   1 
ATOM   1179  C  CG2   . THR A  1  155 ? -35.619 99.153  15.034  1.00 72.84  ? 181 THR A CG2   1 
ATOM   1180  N  N     . LEU A  1  156 ? -35.035 102.700 12.059  1.00 74.85  ? 182 LEU A N     1 
ATOM   1181  C  CA    . LEU A  1  156 ? -35.436 103.671 11.044  1.00 75.30  ? 182 LEU A CA    1 
ATOM   1182  C  C     . LEU A  1  156 ? -36.891 103.542 10.609  1.00 76.53  ? 182 LEU A C     1 
ATOM   1183  O  O     . LEU A  1  156 ? -37.492 104.517 10.168  1.00 76.94  ? 182 LEU A O     1 
ATOM   1184  C  CB    . LEU A  1  156 ? -34.547 103.560 9.805   1.00 75.88  ? 182 LEU A CB    1 
ATOM   1185  C  CG    . LEU A  1  156 ? -33.203 104.293 9.771   1.00 77.97  ? 182 LEU A CG    1 
ATOM   1186  C  CD1   . LEU A  1  156 ? -32.547 104.082 8.406   1.00 77.92  ? 182 LEU A CD1   1 
ATOM   1187  C  CD2   . LEU A  1  156 ? -33.403 105.783 10.034  1.00 78.53  ? 182 LEU A CD2   1 
ATOM   1188  N  N     . GLU A  1  157 ? -37.448 102.340 10.719  1.00 77.36  ? 183 GLU A N     1 
ATOM   1189  C  CA    . GLU A  1  157 ? -38.832 102.105 10.324  1.00 78.75  ? 183 GLU A CA    1 
ATOM   1190  C  C     . GLU A  1  157 ? -39.866 102.515 11.362  1.00 78.82  ? 183 GLU A C     1 
ATOM   1191  O  O     . GLU A  1  157 ? -40.951 102.978 11.008  1.00 79.54  ? 183 GLU A O     1 
ATOM   1192  C  CB    . GLU A  1  157 ? -39.041 100.648 9.915   1.00 80.04  ? 183 GLU A CB    1 
ATOM   1193  C  CG    . GLU A  1  157 ? -38.403 100.311 8.582   1.00 81.75  ? 183 GLU A CG    1 
ATOM   1194  C  CD    . GLU A  1  157 ? -37.288 99.303  8.712   1.00 81.53  ? 183 GLU A CD    1 
ATOM   1195  O  OE1   . GLU A  1  157 ? -36.099 99.701  8.716   1.00 78.82  ? 183 GLU A OE1   1 
ATOM   1196  O  OE2   . GLU A  1  157 ? -37.619 98.105  8.806   1.00 83.64  ? 183 GLU A OE2   1 
ATOM   1197  N  N     . SER A  1  158 ? -39.555 102.306 12.635  1.00 78.48  ? 184 SER A N     1 
ATOM   1198  C  CA    . SER A  1  158 ? -40.478 102.693 13.691  1.00 79.68  ? 184 SER A CA    1 
ATOM   1199  C  C     . SER A  1  158 ? -40.338 104.194 13.936  1.00 80.54  ? 184 SER A C     1 
ATOM   1200  O  O     . SER A  1  158 ? -41.237 104.830 14.482  1.00 80.84  ? 184 SER A O     1 
ATOM   1201  C  CB    . SER A  1  158 ? -40.202 101.907 14.975  1.00 79.34  ? 184 SER A CB    1 
ATOM   1202  O  OG    . SER A  1  158 ? -38.877 102.110 15.427  1.00 81.35  ? 184 SER A OG    1 
ATOM   1203  N  N     . LEU A  1  159 ? -39.219 104.755 13.485  1.00 81.28  ? 185 LEU A N     1 
ATOM   1204  C  CA    . LEU A  1  159 ? -38.942 106.175 13.643  1.00 82.84  ? 185 LEU A CA    1 
ATOM   1205  C  C     . LEU A  1  159 ? -39.686 107.057 12.647  1.00 84.93  ? 185 LEU A C     1 
ATOM   1206  O  O     . LEU A  1  159 ? -40.386 107.986 13.052  1.00 85.88  ? 185 LEU A O     1 
ATOM   1207  C  CB    . LEU A  1  159 ? -37.436 106.446 13.553  1.00 81.72  ? 185 LEU A CB    1 
ATOM   1208  C  CG    . LEU A  1  159 ? -36.678 106.758 14.848  1.00 80.39  ? 185 LEU A CG    1 
ATOM   1209  C  CD1   . LEU A  1  159 ? -36.907 105.668 15.875  1.00 79.63  ? 185 LEU A CD1   1 
ATOM   1210  C  CD2   . LEU A  1  159 ? -35.197 106.902 14.549  1.00 79.64  ? 185 LEU A CD2   1 
ATOM   1211  N  N     . GLU A  1  160 ? -39.554 106.762 11.354  1.00 86.44  ? 186 GLU A N     1 
ATOM   1212  C  CA    . GLU A  1  160 ? -40.212 107.564 10.322  1.00 88.47  ? 186 GLU A CA    1 
ATOM   1213  C  C     . GLU A  1  160 ? -41.739 107.501 10.346  1.00 88.98  ? 186 GLU A C     1 
ATOM   1214  O  O     . GLU A  1  160 ? -42.404 108.292 9.680   1.00 89.12  ? 186 GLU A O     1 
ATOM   1215  C  CB    . GLU A  1  160 ? -39.674 107.224 8.924   1.00 89.76  ? 186 GLU A CB    1 
ATOM   1216  C  CG    . GLU A  1  160 ? -39.969 105.813 8.425   1.00 93.16  ? 186 GLU A CG    1 
ATOM   1217  C  CD    . GLU A  1  160 ? -39.244 105.493 7.120   1.00 94.48  ? 186 GLU A CD    1 
ATOM   1218  O  OE1   . GLU A  1  160 ? -37.998 105.375 7.143   1.00 95.59  ? 186 GLU A OE1   1 
ATOM   1219  O  OE2   . GLU A  1  160 ? -39.915 105.358 6.072   1.00 93.94  ? 186 GLU A OE2   1 
ATOM   1220  N  N     . ASN A  1  161 ? -42.286 106.592 11.147  1.00 89.80  ? 187 ASN A N     1 
ATOM   1221  C  CA    . ASN A  1  161 ? -43.734 106.435 11.268  1.00 90.63  ? 187 ASN A CA    1 
ATOM   1222  C  C     . ASN A  1  161 ? -44.226 106.905 12.643  1.00 90.44  ? 187 ASN A C     1 
ATOM   1223  O  O     . ASN A  1  161 ? -45.381 106.679 13.013  1.00 90.90  ? 187 ASN A O     1 
ATOM   1224  C  CB    . ASN A  1  161 ? -44.120 104.967 11.042  1.00 92.50  ? 187 ASN A CB    1 
ATOM   1225  C  CG    . ASN A  1  161 ? -45.628 104.749 11.021  1.00 94.87  ? 187 ASN A CG    1 
ATOM   1226  O  OD1   . ASN A  1  161 ? -46.199 104.135 11.932  1.00 95.66  ? 187 ASN A OD1   1 
ATOM   1227  N  ND2   . ASN A  1  161 ? -46.282 105.261 9.984   1.00 95.98  ? 187 ASN A ND2   1 
ATOM   1228  N  N     . LEU A  1  162 ? -43.356 107.581 13.389  1.00 90.08  ? 188 LEU A N     1 
ATOM   1229  C  CA    . LEU A  1  162 ? -43.701 108.069 14.726  1.00 89.43  ? 188 LEU A CA    1 
ATOM   1230  C  C     . LEU A  1  162 ? -44.291 109.479 14.684  1.00 88.33  ? 188 LEU A C     1 
ATOM   1231  O  O     . LEU A  1  162 ? -43.759 110.361 14.005  1.00 87.96  ? 188 LEU A O     1 
ATOM   1232  C  CB    . LEU A  1  162 ? -42.459 108.035 15.628  1.00 89.27  ? 188 LEU A CB    1 
ATOM   1233  C  CG    . LEU A  1  162 ? -42.611 107.544 17.072  1.00 88.97  ? 188 LEU A CG    1 
ATOM   1234  C  CD1   . LEU A  1  162 ? -43.220 106.147 17.111  1.00 87.77  ? 188 LEU A CD1   1 
ATOM   1235  C  CD2   . LEU A  1  162 ? -41.247 107.542 17.743  1.00 89.48  ? 188 LEU A CD2   1 
ATOM   1236  N  N     . VAL A  1  163 ? -45.395 109.679 15.404  1.00 87.68  ? 189 VAL A N     1 
ATOM   1237  C  CA    . VAL A  1  163 ? -46.067 110.981 15.457  1.00 87.15  ? 189 VAL A CA    1 
ATOM   1238  C  C     . VAL A  1  163 ? -46.080 111.572 16.865  1.00 87.79  ? 189 VAL A C     1 
ATOM   1239  O  O     . VAL A  1  163 ? -45.883 110.855 17.849  1.00 87.58  ? 189 VAL A O     1 
ATOM   1240  C  CB    . VAL A  1  163 ? -47.532 110.905 14.948  1.00 85.90  ? 189 VAL A CB    1 
ATOM   1241  C  CG1   . VAL A  1  163 ? -47.570 110.438 13.497  1.00 84.82  ? 189 VAL A CG1   1 
ATOM   1242  C  CG2   . VAL A  1  163 ? -48.366 109.994 15.846  1.00 84.72  ? 189 VAL A CG2   1 
ATOM   1243  N  N     . VAL A  1  164 ? -46.352 112.876 16.943  1.00 88.20  ? 190 VAL A N     1 
ATOM   1244  C  CA    . VAL A  1  164 ? -46.410 113.622 18.206  1.00 86.91  ? 190 VAL A CA    1 
ATOM   1245  C  C     . VAL A  1  164 ? -47.287 112.959 19.269  1.00 85.58  ? 190 VAL A C     1 
ATOM   1246  O  O     . VAL A  1  164 ? -46.974 113.007 20.456  1.00 84.93  ? 190 VAL A O     1 
ATOM   1247  C  CB    . VAL A  1  164 ? -46.928 115.059 17.974  1.00 87.61  ? 190 VAL A CB    1 
ATOM   1248  C  CG1   . VAL A  1  164 ? -46.944 115.836 19.279  1.00 88.28  ? 190 VAL A CG1   1 
ATOM   1249  C  CG2   . VAL A  1  164 ? -46.068 115.770 16.944  1.00 88.74  ? 190 VAL A CG2   1 
ATOM   1250  N  N     . ALA A  1  165 ? -48.386 112.349 18.841  1.00 84.73  ? 191 ALA A N     1 
ATOM   1251  C  CA    . ALA A  1  165 ? -49.294 111.675 19.763  1.00 85.21  ? 191 ALA A CA    1 
ATOM   1252  C  C     . ALA A  1  165 ? -48.598 110.525 20.496  1.00 85.18  ? 191 ALA A C     1 
ATOM   1253  O  O     . ALA A  1  165 ? -48.917 110.235 21.650  1.00 84.39  ? 191 ALA A O     1 
ATOM   1254  C  CB    . ALA A  1  165 ? -50.523 111.165 19.015  1.00 85.25  ? 191 ALA A CB    1 
ATOM   1255  N  N     . ASP A  1  166 ? -47.649 109.878 19.817  1.00 85.41  ? 192 ASP A N     1 
ATOM   1256  C  CA    . ASP A  1  166 ? -46.892 108.767 20.397  1.00 85.13  ? 192 ASP A CA    1 
ATOM   1257  C  C     . ASP A  1  166 ? -45.978 109.271 21.515  1.00 85.40  ? 192 ASP A C     1 
ATOM   1258  O  O     . ASP A  1  166 ? -45.851 108.620 22.557  1.00 85.18  ? 192 ASP A O     1 
ATOM   1259  C  CB    . ASP A  1  166 ? -46.071 108.039 19.320  1.00 84.02  ? 192 ASP A CB    1 
ATOM   1260  C  CG    . ASP A  1  166 ? -46.938 107.230 18.358  1.00 82.44  ? 192 ASP A CG    1 
ATOM   1261  O  OD1   . ASP A  1  166 ? -46.856 107.476 17.132  1.00 80.61  ? 192 ASP A OD1   1 
ATOM   1262  O  OD2   . ASP A  1  166 ? -47.688 106.343 18.831  1.00 79.87  ? 192 ASP A OD2   1 
ATOM   1263  N  N     . LEU A  1  167 ? -45.348 110.425 21.290  1.00 85.43  ? 193 LEU A N     1 
ATOM   1264  C  CA    . LEU A  1  167 ? -44.473 111.047 22.282  1.00 86.25  ? 193 LEU A CA    1 
ATOM   1265  C  C     . LEU A  1  167 ? -45.293 111.253 23.551  1.00 88.59  ? 193 LEU A C     1 
ATOM   1266  O  O     . LEU A  1  167 ? -44.906 110.813 24.635  1.00 88.98  ? 193 LEU A O     1 
ATOM   1267  C  CB    . LEU A  1  167 ? -43.988 112.410 21.788  1.00 84.56  ? 193 LEU A CB    1 
ATOM   1268  C  CG    . LEU A  1  167 ? -42.841 112.563 20.789  1.00 83.78  ? 193 LEU A CG    1 
ATOM   1269  C  CD1   . LEU A  1  167 ? -41.518 112.502 21.506  1.00 84.71  ? 193 LEU A CD1   1 
ATOM   1270  C  CD2   . LEU A  1  167 ? -42.927 111.527 19.696  1.00 84.12  ? 193 LEU A CD2   1 
ATOM   1271  N  N     . GLU A  1  168 ? -46.447 111.898 23.382  1.00 90.96  ? 194 GLU A N     1 
ATOM   1272  C  CA    . GLU A  1  168 ? -47.375 112.183 24.472  1.00 92.94  ? 194 GLU A CA    1 
ATOM   1273  C  C     . GLU A  1  168 ? -47.827 110.905 25.159  1.00 93.17  ? 194 GLU A C     1 
ATOM   1274  O  O     . GLU A  1  168 ? -47.818 110.822 26.385  1.00 93.46  ? 194 GLU A O     1 
ATOM   1275  C  CB    . GLU A  1  168 ? -48.604 112.924 23.944  1.00 94.79  ? 194 GLU A CB    1 
ATOM   1276  C  CG    . GLU A  1  168 ? -48.314 114.304 23.366  1.00 98.19  ? 194 GLU A CG    1 
ATOM   1277  C  CD    . GLU A  1  168 ? -49.555 114.986 22.786  1.00 100.52 ? 194 GLU A CD    1 
ATOM   1278  O  OE1   . GLU A  1  168 ? -50.651 114.373 22.795  1.00 100.41 ? 194 GLU A OE1   1 
ATOM   1279  O  OE2   . GLU A  1  168 ? -49.428 116.140 22.314  1.00 101.06 ? 194 GLU A OE2   1 
ATOM   1280  N  N     . SER A  1  169 ? -48.216 109.914 24.360  1.00 93.52  ? 195 SER A N     1 
ATOM   1281  C  CA    . SER A  1  169 ? -48.681 108.629 24.874  1.00 94.36  ? 195 SER A CA    1 
ATOM   1282  C  C     . SER A  1  169 ? -47.642 107.994 25.791  1.00 94.42  ? 195 SER A C     1 
ATOM   1283  O  O     . SER A  1  169 ? -47.969 107.531 26.888  1.00 94.64  ? 195 SER A O     1 
ATOM   1284  C  CB    . SER A  1  169 ? -49.000 107.679 23.718  1.00 95.52  ? 195 SER A CB    1 
ATOM   1285  O  OG    . SER A  1  169 ? -49.977 108.236 22.855  1.00 96.43  ? 195 SER A OG    1 
ATOM   1286  N  N     . PHE A  1  170 ? -46.389 107.994 25.342  1.00 93.76  ? 196 PHE A N     1 
ATOM   1287  C  CA    . PHE A  1  170 ? -45.282 107.431 26.115  1.00 92.93  ? 196 PHE A CA    1 
ATOM   1288  C  C     . PHE A  1  170 ? -45.034 108.277 27.369  1.00 91.43  ? 196 PHE A C     1 
ATOM   1289  O  O     . PHE A  1  170 ? -44.977 107.752 28.487  1.00 89.75  ? 196 PHE A O     1 
ATOM   1290  C  CB    . PHE A  1  170 ? -44.015 107.379 25.246  1.00 93.99  ? 196 PHE A CB    1 
ATOM   1291  C  CG    . PHE A  1  170 ? -42.848 106.677 25.894  1.00 94.05  ? 196 PHE A CG    1 
ATOM   1292  C  CD1   . PHE A  1  170 ? -41.775 107.403 26.402  1.00 93.99  ? 196 PHE A CD1   1 
ATOM   1293  C  CD2   . PHE A  1  170 ? -42.815 105.289 25.978  1.00 94.36  ? 196 PHE A CD2   1 
ATOM   1294  C  CE1   . PHE A  1  170 ? -40.689 106.760 26.982  1.00 93.80  ? 196 PHE A CE1   1 
ATOM   1295  C  CE2   . PHE A  1  170 ? -41.731 104.637 26.557  1.00 93.89  ? 196 PHE A CE2   1 
ATOM   1296  C  CZ    . PHE A  1  170 ? -40.667 105.375 27.059  1.00 94.08  ? 196 PHE A CZ    1 
ATOM   1297  N  N     . ALA A  1  171 ? -44.919 109.591 27.169  1.00 90.28  ? 197 ALA A N     1 
ATOM   1298  C  CA    . ALA A  1  171 ? -44.677 110.539 28.253  1.00 89.45  ? 197 ALA A CA    1 
ATOM   1299  C  C     . ALA A  1  171 ? -45.715 110.442 29.368  1.00 89.06  ? 197 ALA A C     1 
ATOM   1300  O  O     . ALA A  1  171 ? -45.367 110.458 30.543  1.00 89.15  ? 197 ALA A O     1 
ATOM   1301  C  CB    . ALA A  1  171 ? -44.625 111.953 27.705  1.00 88.23  ? 197 ALA A CB    1 
ATOM   1302  N  N     . ASN A  1  172 ? -46.985 110.316 28.994  1.00 88.72  ? 198 ASN A N     1 
ATOM   1303  C  CA    . ASN A  1  172 ? -48.068 110.215 29.967  1.00 88.97  ? 198 ASN A CA    1 
ATOM   1304  C  C     . ASN A  1  172 ? -48.112 108.873 30.693  1.00 88.63  ? 198 ASN A C     1 
ATOM   1305  O  O     . ASN A  1  172 ? -48.881 108.704 31.644  1.00 88.71  ? 198 ASN A O     1 
ATOM   1306  C  CB    . ASN A  1  172 ? -49.422 110.477 29.293  1.00 90.56  ? 198 ASN A CB    1 
ATOM   1307  C  CG    . ASN A  1  172 ? -49.617 111.936 28.915  1.00 91.97  ? 198 ASN A CG    1 
ATOM   1308  O  OD1   . ASN A  1  172 ? -49.172 112.839 29.625  1.00 94.14  ? 198 ASN A OD1   1 
ATOM   1309  N  ND2   . ASN A  1  172 ? -50.288 112.174 27.792  1.00 92.13  ? 198 ASN A ND2   1 
ATOM   1310  N  N     . ASN A  1  173 ? -47.288 107.925 30.252  1.00 88.25  ? 199 ASN A N     1 
ATOM   1311  C  CA    . ASN A  1  173 ? -47.254 106.598 30.864  1.00 87.31  ? 199 ASN A CA    1 
ATOM   1312  C  C     . ASN A  1  173 ? -45.975 106.269 31.620  1.00 87.24  ? 199 ASN A C     1 
ATOM   1313  O  O     . ASN A  1  173 ? -45.981 105.398 32.490  1.00 86.62  ? 199 ASN A O     1 
ATOM   1314  C  CB    . ASN A  1  173 ? -47.498 105.516 29.811  1.00 85.77  ? 199 ASN A CB    1 
ATOM   1315  C  CG    . ASN A  1  173 ? -48.961 105.384 29.435  1.00 84.63  ? 199 ASN A CG    1 
ATOM   1316  O  OD1   . ASN A  1  173 ? -49.447 106.074 28.540  1.00 83.45  ? 199 ASN A OD1   1 
ATOM   1317  N  ND2   . ASN A  1  173 ? -49.670 104.482 30.112  1.00 83.33  ? 199 ASN A ND2   1 
ATOM   1318  N  N     . HIS A  1  174 ? -44.888 106.969 31.305  1.00 87.93  ? 200 HIS A N     1 
ATOM   1319  C  CA    . HIS A  1  174 ? -43.609 106.697 31.953  1.00 88.70  ? 200 HIS A CA    1 
ATOM   1320  C  C     . HIS A  1  174 ? -42.982 107.886 32.668  1.00 90.01  ? 200 HIS A C     1 
ATOM   1321  O  O     . HIS A  1  174 ? -42.244 107.706 33.640  1.00 90.37  ? 200 HIS A O     1 
ATOM   1322  C  CB    . HIS A  1  174 ? -42.630 106.094 30.939  1.00 88.23  ? 200 HIS A CB    1 
ATOM   1323  C  CG    . HIS A  1  174 ? -43.158 104.868 30.261  1.00 87.22  ? 200 HIS A CG    1 
ATOM   1324  N  ND1   . HIS A  1  174 ? -43.263 103.651 30.900  1.00 86.69  ? 200 HIS A ND1   1 
ATOM   1325  C  CD2   . HIS A  1  174 ? -43.681 104.692 29.026  1.00 86.40  ? 200 HIS A CD2   1 
ATOM   1326  C  CE1   . HIS A  1  174 ? -43.835 102.779 30.087  1.00 87.22  ? 200 HIS A CE1   1 
ATOM   1327  N  NE2   . HIS A  1  174 ? -44.098 103.386 28.944  1.00 87.42  ? 200 HIS A NE2   1 
ATOM   1328  N  N     . PHE A  1  175 ? -43.258 109.094 32.186  1.00 91.10  ? 201 PHE A N     1 
ATOM   1329  C  CA    . PHE A  1  175 ? -42.725 110.299 32.818  1.00 91.84  ? 201 PHE A CA    1 
ATOM   1330  C  C     . PHE A  1  175 ? -43.551 110.650 34.057  1.00 92.49  ? 201 PHE A C     1 
ATOM   1331  O  O     . PHE A  1  175 ? -43.847 111.814 34.317  1.00 91.54  ? 201 PHE A O     1 
ATOM   1332  C  CB    . PHE A  1  175 ? -42.707 111.468 31.832  1.00 91.05  ? 201 PHE A CB    1 
ATOM   1333  C  CG    . PHE A  1  175 ? -41.678 111.333 30.747  1.00 91.11  ? 201 PHE A CG    1 
ATOM   1334  C  CD1   . PHE A  1  175 ? -41.456 112.377 29.856  1.00 91.67  ? 201 PHE A CD1   1 
ATOM   1335  C  CD2   . PHE A  1  175 ? -40.925 110.174 30.616  1.00 90.78  ? 201 PHE A CD2   1 
ATOM   1336  C  CE1   . PHE A  1  175 ? -40.497 112.270 28.850  1.00 91.61  ? 201 PHE A CE1   1 
ATOM   1337  C  CE2   . PHE A  1  175 ? -39.966 110.059 29.616  1.00 91.21  ? 201 PHE A CE2   1 
ATOM   1338  C  CZ    . PHE A  1  175 ? -39.752 111.109 28.731  1.00 90.80  ? 201 PHE A CZ    1 
ATOM   1339  N  N     . LEU A  1  176 ? -43.923 109.615 34.805  1.00 93.86  ? 202 LEU A N     1 
ATOM   1340  C  CA    . LEU A  1  176 ? -44.707 109.753 36.025  1.00 95.29  ? 202 LEU A CA    1 
ATOM   1341  C  C     . LEU A  1  176 ? -43.793 110.025 37.216  1.00 96.19  ? 202 LEU A C     1 
ATOM   1342  O  O     . LEU A  1  176 ? -42.570 110.087 37.074  1.00 96.04  ? 202 LEU A O     1 
ATOM   1343  C  CB    . LEU A  1  176 ? -45.516 108.478 36.279  1.00 95.60  ? 202 LEU A CB    1 
ATOM   1344  C  CG    . LEU A  1  176 ? -46.351 107.957 35.107  1.00 96.50  ? 202 LEU A CG    1 
ATOM   1345  C  CD1   . LEU A  1  176 ? -47.028 106.660 35.504  1.00 96.66  ? 202 LEU A CD1   1 
ATOM   1346  C  CD2   . LEU A  1  176 ? -47.376 108.992 34.673  1.00 97.07  ? 202 LEU A CD2   1 
ATOM   1347  N  N     . ASN A  1  177 ? -44.395 110.170 38.392  1.00 97.19  ? 203 ASN A N     1 
ATOM   1348  C  CA    . ASN A  1  177 ? -43.646 110.451 39.606  1.00 97.97  ? 203 ASN A CA    1 
ATOM   1349  C  C     . ASN A  1  177 ? -43.122 109.185 40.270  1.00 97.96  ? 203 ASN A C     1 
ATOM   1350  O  O     . ASN A  1  177 ? -41.949 109.115 40.634  1.00 98.09  ? 203 ASN A O     1 
ATOM   1351  C  CB    . ASN A  1  177 ? -44.513 111.246 40.587  1.00 99.68  ? 203 ASN A CB    1 
ATOM   1352  C  CG    . ASN A  1  177 ? -43.742 111.702 41.816  1.00 100.77 ? 203 ASN A CG    1 
ATOM   1353  O  OD1   . ASN A  1  177 ? -42.797 112.488 41.717  1.00 100.35 ? 203 ASN A OD1   1 
ATOM   1354  N  ND2   . ASN A  1  177 ? -44.138 111.200 42.981  1.00 101.27 ? 203 ASN A ND2   1 
ATOM   1355  N  N     . SER A  1  178 ? -43.991 108.190 40.428  1.00 98.19  ? 204 SER A N     1 
ATOM   1356  C  CA    . SER A  1  178 ? -43.607 106.925 41.059  1.00 98.21  ? 204 SER A CA    1 
ATOM   1357  C  C     . SER A  1  178 ? -42.533 106.164 40.273  1.00 97.93  ? 204 SER A C     1 
ATOM   1358  O  O     . SER A  1  178 ? -41.998 105.158 40.748  1.00 97.70  ? 204 SER A O     1 
ATOM   1359  C  CB    . SER A  1  178 ? -44.841 106.042 41.286  1.00 97.88  ? 204 SER A CB    1 
ATOM   1360  O  OG    . SER A  1  178 ? -45.632 105.943 40.113  1.00 98.47  ? 204 SER A OG    1 
ATOM   1361  N  N     . ASN A  1  179 ? -42.216 106.664 39.080  1.00 96.98  ? 205 ASN A N     1 
ATOM   1362  C  CA    . ASN A  1  179 ? -41.203 106.062 38.220  1.00 96.71  ? 205 ASN A CA    1 
ATOM   1363  C  C     . ASN A  1  179 ? -40.138 107.119 37.910  1.00 96.27  ? 205 ASN A C     1 
ATOM   1364  O  O     . ASN A  1  179 ? -39.589 107.173 36.805  1.00 96.94  ? 205 ASN A O     1 
ATOM   1365  C  CB    . ASN A  1  179 ? -41.851 105.543 36.923  1.00 96.85  ? 205 ASN A CB    1 
ATOM   1366  C  CG    . ASN A  1  179 ? -40.867 104.801 36.023  1.00 96.14  ? 205 ASN A CG    1 
ATOM   1367  O  OD1   . ASN A  1  179 ? -40.323 103.760 36.399  1.00 95.89  ? 205 ASN A OD1   1 
ATOM   1368  N  ND2   . ASN A  1  179 ? -40.629 105.346 34.834  1.00 94.03  ? 205 ASN A ND2   1 
ATOM   1369  N  N     . ALA A  1  180 ? -39.840 107.953 38.899  1.00 95.29  ? 206 ALA A N     1 
ATOM   1370  C  CA    . ALA A  1  180 ? -38.852 109.008 38.719  1.00 94.61  ? 206 ALA A CA    1 
ATOM   1371  C  C     . ALA A  1  180 ? -37.971 109.207 39.941  1.00 94.34  ? 206 ALA A C     1 
ATOM   1372  O  O     . ALA A  1  180 ? -38.283 108.736 41.038  1.00 94.15  ? 206 ALA A O     1 
ATOM   1373  C  CB    . ALA A  1  180 ? -39.542 110.318 38.360  1.00 94.15  ? 206 ALA A CB    1 
ATOM   1374  N  N     . VAL A  1  181 ? -36.857 109.898 39.724  1.00 94.02  ? 207 VAL A N     1 
ATOM   1375  C  CA    . VAL A  1  181 ? -35.895 110.216 40.769  1.00 94.29  ? 207 VAL A CA    1 
ATOM   1376  C  C     . VAL A  1  181 ? -35.186 111.494 40.351  1.00 95.05  ? 207 VAL A C     1 
ATOM   1377  O  O     . VAL A  1  181 ? -34.630 111.574 39.253  1.00 95.02  ? 207 VAL A O     1 
ATOM   1378  C  CB    . VAL A  1  181 ? -34.829 109.099 40.957  1.00 94.18  ? 207 VAL A CB    1 
ATOM   1379  C  CG1   . VAL A  1  181 ? -33.634 109.631 41.737  1.00 94.08  ? 207 VAL A CG1   1 
ATOM   1380  C  CG2   . VAL A  1  181 ? -35.422 107.915 41.703  1.00 94.52  ? 207 VAL A CG2   1 
ATOM   1381  N  N     . VAL A  1  182 ? -35.270 112.517 41.195  1.00 95.83  ? 208 VAL A N     1 
ATOM   1382  C  CA    . VAL A  1  182 ? -34.602 113.781 40.914  1.00 95.83  ? 208 VAL A CA    1 
ATOM   1383  C  C     . VAL A  1  182 ? -33.197 113.677 41.501  1.00 95.63  ? 208 VAL A C     1 
ATOM   1384  O  O     . VAL A  1  182 ? -33.015 113.415 42.693  1.00 94.77  ? 208 VAL A O     1 
ATOM   1385  C  CB    . VAL A  1  182 ? -35.385 114.990 41.478  1.00 95.94  ? 208 VAL A CB    1 
ATOM   1386  C  CG1   . VAL A  1  182 ? -35.847 114.710 42.895  1.00 96.19  ? 208 VAL A CG1   1 
ATOM   1387  C  CG2   . VAL A  1  182 ? -34.531 116.247 41.411  1.00 94.66  ? 208 VAL A CG2   1 
ATOM   1388  N  N     . VAL A  1  183 ? -32.210 113.832 40.628  1.00 95.96  ? 209 VAL A N     1 
ATOM   1389  C  CA    . VAL A  1  183 ? -30.809 113.705 41.000  1.00 95.74  ? 209 VAL A CA    1 
ATOM   1390  C  C     . VAL A  1  183 ? -30.060 115.030 41.061  1.00 96.48  ? 209 VAL A C     1 
ATOM   1391  O  O     . VAL A  1  183 ? -30.318 115.947 40.277  1.00 96.46  ? 209 VAL A O     1 
ATOM   1392  C  CB    . VAL A  1  183 ? -30.085 112.764 40.006  1.00 94.75  ? 209 VAL A CB    1 
ATOM   1393  C  CG1   . VAL A  1  183 ? -28.697 112.421 40.500  1.00 95.30  ? 209 VAL A CG1   1 
ATOM   1394  C  CG2   . VAL A  1  183 ? -30.895 111.501 39.798  1.00 94.01  ? 209 VAL A CG2   1 
ATOM   1395  N  N     . GLY A  1  184 ? -29.110 115.101 41.987  1.00 97.56  ? 210 GLY A N     1 
ATOM   1396  C  CA    . GLY A  1  184 ? -28.302 116.293 42.149  1.00 99.36  ? 210 GLY A CA    1 
ATOM   1397  C  C     . GLY A  1  184 ? -26.879 115.949 42.543  1.00 100.72 ? 210 GLY A C     1 
ATOM   1398  O  O     . GLY A  1  184 ? -26.631 115.434 43.634  1.00 99.69  ? 210 GLY A O     1 
ATOM   1399  N  N     . THR A  1  185 ? -25.948 116.192 41.628  1.00 103.03 ? 211 THR A N     1 
ATOM   1400  C  CA    . THR A  1  185 ? -24.536 115.924 41.876  1.00 106.26 ? 211 THR A CA    1 
ATOM   1401  C  C     . THR A  1  185 ? -23.743 117.177 41.547  1.00 108.52 ? 211 THR A C     1 
ATOM   1402  O  O     . THR A  1  185 ? -24.237 118.069 40.855  1.00 108.28 ? 211 THR A O     1 
ATOM   1403  C  CB    . THR A  1  185 ? -23.995 114.751 41.012  1.00 106.44 ? 211 THR A CB    1 
ATOM   1404  O  OG1   . THR A  1  185 ? -24.107 115.077 39.620  1.00 106.73 ? 211 THR A OG1   1 
ATOM   1405  C  CG2   . THR A  1  185 ? -24.765 113.466 41.296  1.00 106.09 ? 211 THR A CG2   1 
ATOM   1406  N  N     . GLY A  1  186 ? -22.512 117.234 42.036  1.00 111.60 ? 212 GLY A N     1 
ATOM   1407  C  CA    . GLY A  1  186 ? -21.669 118.388 41.790  1.00 116.01 ? 212 GLY A CA    1 
ATOM   1408  C  C     . GLY A  1  186 ? -21.015 118.812 43.085  1.00 118.94 ? 212 GLY A C     1 
ATOM   1409  O  O     . GLY A  1  186 ? -19.958 118.299 43.444  1.00 119.76 ? 212 GLY A O     1 
ATOM   1410  N  N     . ASN A  1  187 ? -21.659 119.727 43.804  1.00 122.07 ? 213 ASN A N     1 
ATOM   1411  C  CA    . ASN A  1  187 ? -21.137 120.209 45.081  1.00 124.81 ? 213 ASN A CA    1 
ATOM   1412  C  C     . ASN A  1  187 ? -22.260 120.547 46.063  1.00 125.97 ? 213 ASN A C     1 
ATOM   1413  O  O     . ASN A  1  187 ? -22.063 120.511 47.281  1.00 126.54 ? 213 ASN A O     1 
ATOM   1414  C  CB    . ASN A  1  187 ? -20.237 121.436 44.870  1.00 125.23 ? 213 ASN A CB    1 
ATOM   1415  C  CG    . ASN A  1  187 ? -21.022 122.692 44.533  1.00 126.30 ? 213 ASN A CG    1 
ATOM   1416  O  OD1   . ASN A  1  187 ? -22.019 122.652 43.801  1.00 126.13 ? 213 ASN A OD1   1 
ATOM   1417  N  ND2   . ASN A  1  187 ? -20.579 123.817 45.078  1.00 126.23 ? 213 ASN A ND2   1 
ATOM   1418  N  N     . ILE A  1  188 ? -23.436 120.856 45.519  1.00 126.85 ? 214 ILE A N     1 
ATOM   1419  C  CA    . ILE A  1  188 ? -24.602 121.215 46.317  1.00 128.11 ? 214 ILE A CA    1 
ATOM   1420  C  C     . ILE A  1  188 ? -25.005 120.158 47.341  1.00 129.04 ? 214 ILE A C     1 
ATOM   1421  O  O     . ILE A  1  188 ? -24.891 118.958 47.089  1.00 129.17 ? 214 ILE A O     1 
ATOM   1422  C  CB    . ILE A  1  188 ? -25.802 121.600 45.415  1.00 128.34 ? 214 ILE A CB    1 
ATOM   1423  C  CG1   . ILE A  1  188 ? -26.048 120.540 44.335  1.00 127.81 ? 214 ILE A CG1   1 
ATOM   1424  C  CG2   . ILE A  1  188 ? -25.543 122.948 44.767  1.00 128.75 ? 214 ILE A CG2   1 
ATOM   1425  C  CD1   . ILE A  1  188 ? -26.956 119.406 44.761  1.00 127.66 ? 214 ILE A CD1   1 
ATOM   1426  N  N     . LYS A  1  189 ? -25.457 120.621 48.504  1.00 130.26 ? 215 LYS A N     1 
ATOM   1427  C  CA    . LYS A  1  189 ? -25.864 119.745 49.600  1.00 131.31 ? 215 LYS A CA    1 
ATOM   1428  C  C     . LYS A  1  189 ? -27.239 119.124 49.396  1.00 131.52 ? 215 LYS A C     1 
ATOM   1429  O  O     . LYS A  1  189 ? -28.085 119.679 48.696  1.00 130.74 ? 215 LYS A O     1 
ATOM   1430  C  CB    . LYS A  1  189 ? -25.851 120.517 50.922  1.00 132.30 ? 215 LYS A CB    1 
ATOM   1431  C  CG    . LYS A  1  189 ? -24.519 121.179 51.250  1.00 133.35 ? 215 LYS A CG    1 
ATOM   1432  C  CD    . LYS A  1  189 ? -24.603 121.978 52.545  1.00 133.82 ? 215 LYS A CD    1 
ATOM   1433  C  CE    . LYS A  1  189 ? -23.279 122.660 52.872  1.00 133.81 ? 215 LYS A CE    1 
ATOM   1434  N  NZ    . LYS A  1  189 ? -22.880 123.645 51.828  1.00 133.51 ? 215 LYS A NZ    1 
ATOM   1435  N  N     . HIS A  1  190 ? -27.451 117.974 50.030  1.00 132.66 ? 216 HIS A N     1 
ATOM   1436  C  CA    . HIS A  1  190 ? -28.719 117.253 49.952  1.00 134.30 ? 216 HIS A CA    1 
ATOM   1437  C  C     . HIS A  1  190 ? -29.846 118.133 50.472  1.00 135.76 ? 216 HIS A C     1 
ATOM   1438  O  O     . HIS A  1  190 ? -30.927 118.189 49.887  1.00 135.39 ? 216 HIS A O     1 
ATOM   1439  C  CB    . HIS A  1  190 ? -28.642 115.971 50.790  1.00 133.96 ? 216 HIS A CB    1 
ATOM   1440  C  CG    . HIS A  1  190 ? -29.924 115.199 50.845  1.00 133.38 ? 216 HIS A CG    1 
ATOM   1441  N  ND1   . HIS A  1  190 ? -30.705 114.971 49.732  1.00 133.29 ? 216 HIS A ND1   1 
ATOM   1442  C  CD2   . HIS A  1  190 ? -30.561 114.601 51.879  1.00 133.19 ? 216 HIS A CD2   1 
ATOM   1443  C  CE1   . HIS A  1  190 ? -31.766 114.266 50.078  1.00 133.49 ? 216 HIS A CE1   1 
ATOM   1444  N  NE2   . HIS A  1  190 ? -31.704 114.028 51.376  1.00 133.31 ? 216 HIS A NE2   1 
ATOM   1445  N  N     . GLU A  1  191 ? -29.561 118.832 51.567  1.00 138.11 ? 217 GLU A N     1 
ATOM   1446  C  CA    . GLU A  1  191 ? -30.518 119.720 52.216  1.00 140.12 ? 217 GLU A CA    1 
ATOM   1447  C  C     . GLU A  1  191 ? -30.707 121.037 51.469  1.00 140.75 ? 217 GLU A C     1 
ATOM   1448  O  O     . GLU A  1  191 ? -31.674 121.757 51.705  1.00 140.66 ? 217 GLU A O     1 
ATOM   1449  C  CB    . GLU A  1  191 ? -30.081 119.977 53.659  1.00 141.32 ? 217 GLU A CB    1 
ATOM   1450  C  CG    . GLU A  1  191 ? -29.886 118.689 54.463  1.00 143.20 ? 217 GLU A CG    1 
ATOM   1451  C  CD    . GLU A  1  191 ? -29.395 118.917 55.885  1.00 144.39 ? 217 GLU A CD    1 
ATOM   1452  O  OE1   . GLU A  1  191 ? -29.056 120.070 56.240  1.00 144.99 ? 217 GLU A OE1   1 
ATOM   1453  O  OE2   . GLU A  1  191 ? -29.345 117.930 56.652  1.00 144.67 ? 217 GLU A OE2   1 
ATOM   1454  N  N     . ASP A  1  192 ? -29.779 121.345 50.570  1.00 141.97 ? 218 ASP A N     1 
ATOM   1455  C  CA    . ASP A  1  192 ? -29.848 122.566 49.773  1.00 142.97 ? 218 ASP A CA    1 
ATOM   1456  C  C     . ASP A  1  192 ? -30.861 122.380 48.639  1.00 143.19 ? 218 ASP A C     1 
ATOM   1457  O  O     . ASP A  1  192 ? -31.706 123.246 48.397  1.00 142.97 ? 218 ASP A O     1 
ATOM   1458  C  CB    . ASP A  1  192 ? -28.463 122.893 49.199  1.00 144.08 ? 218 ASP A CB    1 
ATOM   1459  C  CG    . ASP A  1  192 ? -28.438 124.200 48.422  1.00 144.82 ? 218 ASP A CG    1 
ATOM   1460  O  OD1   . ASP A  1  192 ? -28.679 124.175 47.194  1.00 145.35 ? 218 ASP A OD1   1 
ATOM   1461  O  OD2   . ASP A  1  192 ? -28.165 125.251 49.040  1.00 144.92 ? 218 ASP A OD2   1 
ATOM   1462  N  N     . LEU A  1  193 ? -30.773 121.238 47.961  1.00 143.34 ? 219 LEU A N     1 
ATOM   1463  C  CA    . LEU A  1  193 ? -31.663 120.918 46.847  1.00 143.16 ? 219 LEU A CA    1 
ATOM   1464  C  C     . LEU A  1  193 ? -33.064 120.531 47.308  1.00 143.10 ? 219 LEU A C     1 
ATOM   1465  O  O     . LEU A  1  193 ? -34.051 121.060 46.797  1.00 143.36 ? 219 LEU A O     1 
ATOM   1466  C  CB    . LEU A  1  193 ? -31.073 119.784 45.998  1.00 143.00 ? 219 LEU A CB    1 
ATOM   1467  C  CG    . LEU A  1  193 ? -31.856 119.376 44.746  1.00 142.37 ? 219 LEU A CG    1 
ATOM   1468  C  CD1   . LEU A  1  193 ? -31.801 120.492 43.718  1.00 142.03 ? 219 LEU A CD1   1 
ATOM   1469  C  CD2   . LEU A  1  193 ? -31.288 118.094 44.167  1.00 142.08 ? 219 LEU A CD2   1 
ATOM   1470  N  N     . VAL A  1  194 ? -33.142 119.625 48.282  1.00 142.82 ? 220 VAL A N     1 
ATOM   1471  C  CA    . VAL A  1  194 ? -34.423 119.143 48.803  1.00 142.96 ? 220 VAL A CA    1 
ATOM   1472  C  C     . VAL A  1  194 ? -35.384 120.263 49.211  1.00 143.22 ? 220 VAL A C     1 
ATOM   1473  O  O     . VAL A  1  194 ? -36.605 120.098 49.138  1.00 143.47 ? 220 VAL A O     1 
ATOM   1474  C  CB    . VAL A  1  194 ? -34.224 118.154 49.989  1.00 142.81 ? 220 VAL A CB    1 
ATOM   1475  C  CG1   . VAL A  1  194 ? -33.741 118.886 51.227  1.00 142.89 ? 220 VAL A CG1   1 
ATOM   1476  C  CG2   . VAL A  1  194 ? -35.513 117.393 50.276  1.00 142.29 ? 220 VAL A CG2   1 
ATOM   1477  N  N     . ASN A  1  195 ? -34.832 121.405 49.618  1.00 143.21 ? 221 ASN A N     1 
ATOM   1478  C  CA    . ASN A  1  195 ? -35.643 122.551 50.027  1.00 142.97 ? 221 ASN A CA    1 
ATOM   1479  C  C     . ASN A  1  195 ? -36.268 123.256 48.831  1.00 142.77 ? 221 ASN A C     1 
ATOM   1480  O  O     . ASN A  1  195 ? -37.465 123.542 48.828  1.00 142.83 ? 221 ASN A O     1 
ATOM   1481  C  CB    . ASN A  1  195 ? -34.810 123.544 50.843  1.00 142.80 ? 221 ASN A CB    1 
ATOM   1482  C  CG    . ASN A  1  195 ? -34.483 123.031 52.236  1.00 142.65 ? 221 ASN A CG    1 
ATOM   1483  O  OD1   . ASN A  1  195 ? -35.081 122.065 52.715  1.00 142.65 ? 221 ASN A OD1   1 
ATOM   1484  N  ND2   . ASN A  1  195 ? -33.533 123.682 52.896  1.00 142.34 ? 221 ASN A ND2   1 
ATOM   1485  N  N     . SER A  1  196 ? -35.454 123.521 47.812  1.00 142.60 ? 222 SER A N     1 
ATOM   1486  C  CA    . SER A  1  196 ? -35.921 124.189 46.602  1.00 142.63 ? 222 SER A CA    1 
ATOM   1487  C  C     . SER A  1  196 ? -36.969 123.349 45.868  1.00 143.48 ? 222 SER A C     1 
ATOM   1488  O  O     . SER A  1  196 ? -37.724 123.867 45.045  1.00 143.09 ? 222 SER A O     1 
ATOM   1489  C  CB    . SER A  1  196 ? -34.741 124.480 45.676  1.00 141.76 ? 222 SER A CB    1 
ATOM   1490  O  OG    . SER A  1  196 ? -33.742 125.228 46.345  1.00 140.11 ? 222 SER A OG    1 
ATOM   1491  N  N     . ILE A  1  197 ? -37.010 122.055 46.182  1.00 144.92 ? 223 ILE A N     1 
ATOM   1492  C  CA    . ILE A  1  197 ? -37.960 121.128 45.569  1.00 146.56 ? 223 ILE A CA    1 
ATOM   1493  C  C     . ILE A  1  197 ? -39.251 121.013 46.383  1.00 147.30 ? 223 ILE A C     1 
ATOM   1494  O  O     . ILE A  1  197 ? -40.347 121.081 45.821  1.00 147.42 ? 223 ILE A O     1 
ATOM   1495  C  CB    . ILE A  1  197 ? -37.339 119.714 45.378  1.00 146.94 ? 223 ILE A CB    1 
ATOM   1496  C  CG1   . ILE A  1  197 ? -36.169 119.785 44.392  1.00 147.00 ? 223 ILE A CG1   1 
ATOM   1497  C  CG2   . ILE A  1  197 ? -38.391 118.723 44.872  1.00 146.79 ? 223 ILE A CG2   1 
ATOM   1498  C  CD1   . ILE A  1  197 ? -35.446 118.471 44.208  1.00 147.43 ? 223 ILE A CD1   1 
ATOM   1499  N  N     . GLU A  1  198 ? -39.123 120.846 47.699  1.00 148.02 ? 224 GLU A N     1 
ATOM   1500  C  CA    . GLU A  1  198 ? -40.295 120.724 48.568  1.00 148.67 ? 224 GLU A CA    1 
ATOM   1501  C  C     . GLU A  1  198 ? -41.017 122.068 48.717  1.00 149.38 ? 224 GLU A C     1 
ATOM   1502  O  O     . GLU A  1  198 ? -42.042 122.170 49.394  1.00 149.32 ? 224 GLU A O     1 
ATOM   1503  C  CB    . GLU A  1  198 ? -39.907 120.139 49.934  1.00 148.10 ? 224 GLU A CB    1 
ATOM   1504  C  CG    . GLU A  1  198 ? -41.097 119.606 50.745  1.00 146.98 ? 224 GLU A CG    1 
ATOM   1505  C  CD    . GLU A  1  198 ? -40.704 118.590 51.813  1.00 146.45 ? 224 GLU A CD    1 
ATOM   1506  O  OE1   . GLU A  1  198 ? -39.555 118.628 52.303  1.00 146.16 ? 224 GLU A OE1   1 
ATOM   1507  O  OE2   . GLU A  1  198 ? -41.555 117.745 52.164  1.00 145.49 ? 224 GLU A OE2   1 
ATOM   1508  N  N     . SER A  1  199 ? -40.470 123.091 48.064  1.00 150.38 ? 225 SER A N     1 
ATOM   1509  C  CA    . SER A  1  199 ? -41.042 124.433 48.063  1.00 151.30 ? 225 SER A CA    1 
ATOM   1510  C  C     . SER A  1  199 ? -42.232 124.431 47.104  1.00 152.38 ? 225 SER A C     1 
ATOM   1511  O  O     . SER A  1  199 ? -43.379 124.612 47.512  1.00 152.26 ? 225 SER A O     1 
ATOM   1512  C  CB    . SER A  1  199 ? -39.989 125.444 47.588  1.00 150.74 ? 225 SER A CB    1 
ATOM   1513  O  OG    . SER A  1  199 ? -40.563 126.707 47.304  1.00 149.59 ? 225 SER A OG    1 
ATOM   1514  N  N     . LYS A  1  200 ? -41.936 124.198 45.828  1.00 153.85 ? 226 LYS A N     1 
ATOM   1515  C  CA    . LYS A  1  200 ? -42.941 124.150 44.772  1.00 155.10 ? 226 LYS A CA    1 
ATOM   1516  C  C     . LYS A  1  200 ? -43.699 122.825 44.867  1.00 156.40 ? 226 LYS A C     1 
ATOM   1517  O  O     . LYS A  1  200 ? -43.118 121.752 44.684  1.00 156.72 ? 226 LYS A O     1 
ATOM   1518  C  CB    . LYS A  1  200 ? -42.253 124.264 43.408  1.00 154.59 ? 226 LYS A CB    1 
ATOM   1519  C  CG    . LYS A  1  200 ? -41.224 125.383 43.333  1.00 154.00 ? 226 LYS A CG    1 
ATOM   1520  C  CD    . LYS A  1  200 ? -40.403 125.306 42.059  1.00 153.36 ? 226 LYS A CD    1 
ATOM   1521  C  CE    . LYS A  1  200 ? -39.303 126.353 42.057  1.00 152.76 ? 226 LYS A CE    1 
ATOM   1522  N  NZ    . LYS A  1  200 ? -38.499 126.306 40.809  1.00 152.05 ? 226 LYS A NZ    1 
ATOM   1523  N  N     . ASN A  1  201 ? -44.994 122.907 45.157  1.00 157.48 ? 227 ASN A N     1 
ATOM   1524  C  CA    . ASN A  1  201 ? -45.835 121.719 45.291  1.00 158.63 ? 227 ASN A CA    1 
ATOM   1525  C  C     . ASN A  1  201 ? -46.257 121.128 43.937  1.00 159.27 ? 227 ASN A C     1 
ATOM   1526  O  O     . ASN A  1  201 ? -45.438 121.026 43.020  1.00 159.09 ? 227 ASN A O     1 
ATOM   1527  C  CB    . ASN A  1  201 ? -47.060 122.050 46.151  1.00 158.85 ? 227 ASN A CB    1 
ATOM   1528  C  CG    . ASN A  1  201 ? -47.278 121.045 47.269  1.00 159.17 ? 227 ASN A CG    1 
ATOM   1529  O  OD1   . ASN A  1  201 ? -48.411 120.658 47.559  1.00 159.21 ? 227 ASN A OD1   1 
ATOM   1530  N  ND2   . ASN A  1  201 ? -46.192 120.621 47.907  1.00 159.10 ? 227 ASN A ND2   1 
ATOM   1531  N  N     . LEU A  1  202 ? -47.525 120.722 43.833  1.00 160.15 ? 228 LEU A N     1 
ATOM   1532  C  CA    . LEU A  1  202 ? -48.096 120.136 42.615  1.00 161.06 ? 228 LEU A CA    1 
ATOM   1533  C  C     . LEU A  1  202 ? -47.524 118.750 42.299  1.00 161.57 ? 228 LEU A C     1 
ATOM   1534  O  O     . LEU A  1  202 ? -46.315 118.594 42.111  1.00 161.97 ? 228 LEU A O     1 
ATOM   1535  C  CB    . LEU A  1  202 ? -47.910 121.081 41.418  1.00 161.30 ? 228 LEU A CB    1 
ATOM   1536  C  CG    . LEU A  1  202 ? -48.541 120.704 40.071  1.00 161.46 ? 228 LEU A CG    1 
ATOM   1537  C  CD1   . LEU A  1  202 ? -50.057 120.612 40.204  1.00 161.38 ? 228 LEU A CD1   1 
ATOM   1538  C  CD2   . LEU A  1  202 ? -48.158 121.739 39.021  1.00 161.20 ? 228 LEU A CD2   1 
ATOM   1539  N  N     . SER A  1  203 ? -48.404 117.752 42.233  1.00 161.78 ? 229 SER A N     1 
ATOM   1540  C  CA    . SER A  1  203 ? -48.007 116.371 41.950  1.00 161.71 ? 229 SER A CA    1 
ATOM   1541  C  C     . SER A  1  203 ? -47.903 116.044 40.461  1.00 161.80 ? 229 SER A C     1 
ATOM   1542  O  O     . SER A  1  203 ? -46.933 115.418 40.030  1.00 161.91 ? 229 SER A O     1 
ATOM   1543  C  CB    . SER A  1  203 ? -48.970 115.393 42.625  1.00 161.55 ? 229 SER A CB    1 
ATOM   1544  O  OG    . SER A  1  203 ? -48.932 115.527 44.035  1.00 161.58 ? 229 SER A OG    1 
ATOM   1545  N  N     . LEU A  1  204 ? -48.913 116.455 39.692  1.00 161.77 ? 230 LEU A N     1 
ATOM   1546  C  CA    . LEU A  1  204 ? -48.980 116.224 38.242  1.00 161.53 ? 230 LEU A CA    1 
ATOM   1547  C  C     . LEU A  1  204 ? -48.974 114.729 37.906  1.00 161.33 ? 230 LEU A C     1 
ATOM   1548  O  O     . LEU A  1  204 ? -47.913 114.118 37.748  1.00 161.57 ? 230 LEU A O     1 
ATOM   1549  C  CB    . LEU A  1  204 ? -47.835 116.960 37.518  1.00 161.44 ? 230 LEU A CB    1 
ATOM   1550  C  CG    . LEU A  1  204 ? -47.920 117.291 36.017  1.00 161.06 ? 230 LEU A CG    1 
ATOM   1551  C  CD1   . LEU A  1  204 ? -47.734 116.053 35.153  1.00 160.62 ? 230 LEU A CD1   1 
ATOM   1552  C  CD2   . LEU A  1  204 ? -49.236 117.990 35.706  1.00 160.72 ? 230 LEU A CD2   1 
ATOM   1553  N  N     . GLN A  1  205 ? -50.175 114.159 37.797  1.00 160.79 ? 231 GLN A N     1 
ATOM   1554  C  CA    . GLN A  1  205 ? -50.370 112.741 37.487  1.00 160.05 ? 231 GLN A CA    1 
ATOM   1555  C  C     . GLN A  1  205 ? -49.775 111.824 38.555  1.00 159.16 ? 231 GLN A C     1 
ATOM   1556  O  O     . GLN A  1  205 ? -48.861 111.040 38.285  1.00 159.17 ? 231 GLN A O     1 
ATOM   1557  C  CB    . GLN A  1  205 ? -49.797 112.397 36.105  1.00 160.54 ? 231 GLN A CB    1 
ATOM   1558  C  CG    . GLN A  1  205 ? -50.502 113.080 34.942  1.00 161.01 ? 231 GLN A CG    1 
ATOM   1559  C  CD    . GLN A  1  205 ? -49.922 112.686 33.595  1.00 161.27 ? 231 GLN A CD    1 
ATOM   1560  O  OE1   . GLN A  1  205 ? -49.166 113.445 32.985  1.00 161.40 ? 231 GLN A OE1   1 
ATOM   1561  N  NE2   . GLN A  1  205 ? -50.272 111.492 33.125  1.00 160.92 ? 231 GLN A NE2   1 
ATOM   1562  N  N     . THR A  1  206 ? -50.298 111.934 39.772  1.00 157.92 ? 232 THR A N     1 
ATOM   1563  C  CA    . THR A  1  206 ? -49.827 111.119 40.883  1.00 157.20 ? 232 THR A CA    1 
ATOM   1564  C  C     . THR A  1  206 ? -50.700 109.877 41.066  1.00 156.42 ? 232 THR A C     1 
ATOM   1565  O  O     . THR A  1  206 ? -51.889 109.888 40.739  1.00 156.12 ? 232 THR A O     1 
ATOM   1566  C  CB    . THR A  1  206 ? -49.784 111.930 42.198  1.00 157.53 ? 232 THR A CB    1 
ATOM   1567  O  OG1   . THR A  1  206 ? -49.141 111.157 43.218  1.00 157.94 ? 232 THR A OG1   1 
ATOM   1568  C  CG2   . THR A  1  206 ? -51.192 112.299 42.656  1.00 157.69 ? 232 THR A CG2   1 
ATOM   1569  N  N     . GLY A  1  207 ? -50.099 108.813 41.592  1.00 155.72 ? 233 GLY A N     1 
ATOM   1570  C  CA    . GLY A  1  207 ? -50.819 107.568 41.807  1.00 154.22 ? 233 GLY A CA    1 
ATOM   1571  C  C     . GLY A  1  207 ? -50.794 106.663 40.587  1.00 153.04 ? 233 GLY A C     1 
ATOM   1572  O  O     . GLY A  1  207 ? -51.082 105.468 40.681  1.00 153.02 ? 233 GLY A O     1 
ATOM   1573  N  N     . THR A  1  208 ? -50.439 107.238 39.440  1.00 151.63 ? 234 THR A N     1 
ATOM   1574  C  CA    . THR A  1  208 ? -50.372 106.501 38.182  1.00 149.78 ? 234 THR A CA    1 
ATOM   1575  C  C     . THR A  1  208 ? -49.085 105.674 38.094  1.00 147.84 ? 234 THR A C     1 
ATOM   1576  O  O     . THR A  1  208 ? -48.009 106.130 38.488  1.00 147.84 ? 234 THR A O     1 
ATOM   1577  C  CB    . THR A  1  208 ? -50.442 107.466 36.966  1.00 150.36 ? 234 THR A CB    1 
ATOM   1578  O  OG1   . THR A  1  208 ? -51.479 108.434 37.176  1.00 150.24 ? 234 THR A OG1   1 
ATOM   1579  C  CG2   . THR A  1  208 ? -50.747 106.695 35.685  1.00 150.48 ? 234 THR A CG2   1 
ATOM   1580  N  N     . LYS A  1  209 ? -49.213 104.453 37.586  1.00 145.26 ? 235 LYS A N     1 
ATOM   1581  C  CA    . LYS A  1  209 ? -48.080 103.550 37.428  1.00 142.66 ? 235 LYS A CA    1 
ATOM   1582  C  C     . LYS A  1  209 ? -47.964 103.169 35.954  1.00 141.20 ? 235 LYS A C     1 
ATOM   1583  O  O     . LYS A  1  209 ? -48.966 103.158 35.235  1.00 141.29 ? 235 LYS A O     1 
ATOM   1584  C  CB    . LYS A  1  209 ? -48.298 102.276 38.249  1.00 142.42 ? 235 LYS A CB    1 
ATOM   1585  C  CG    . LYS A  1  209 ? -48.549 102.495 39.730  1.00 142.28 ? 235 LYS A CG    1 
ATOM   1586  C  CD    . LYS A  1  209 ? -48.871 101.188 40.454  1.00 142.38 ? 235 LYS A CD    1 
ATOM   1587  C  CE    . LYS A  1  209 ? -50.212 100.587 40.022  1.00 142.73 ? 235 LYS A CE    1 
ATOM   1588  N  NZ    . LYS A  1  209 ? -50.205 100.006 38.646  1.00 142.52 ? 235 LYS A NZ    1 
ATOM   1589  N  N     . PRO A  1  210 ? -46.737 102.888 35.475  1.00 139.50 ? 236 PRO A N     1 
ATOM   1590  C  CA    . PRO A  1  210 ? -46.529 102.503 34.073  1.00 137.43 ? 236 PRO A CA    1 
ATOM   1591  C  C     . PRO A  1  210 ? -47.033 101.079 33.821  1.00 135.56 ? 236 PRO A C     1 
ATOM   1592  O  O     . PRO A  1  210 ? -47.201 100.295 34.759  1.00 135.63 ? 236 PRO A O     1 
ATOM   1593  C  CB    . PRO A  1  210 ? -45.012 102.601 33.916  1.00 137.71 ? 236 PRO A CB    1 
ATOM   1594  C  CG    . PRO A  1  210 ? -44.510 102.237 35.276  1.00 138.48 ? 236 PRO A CG    1 
ATOM   1595  C  CD    . PRO A  1  210 ? -45.446 103.013 36.178  1.00 139.30 ? 236 PRO A CD    1 
ATOM   1596  N  N     . VAL A  1  211 ? -47.271 100.750 32.557  1.00 133.21 ? 237 VAL A N     1 
ATOM   1597  C  CA    . VAL A  1  211 ? -47.767 99.423  32.195  1.00 131.49 ? 237 VAL A CA    1 
ATOM   1598  C  C     . VAL A  1  211 ? -46.738 98.325  32.505  1.00 130.00 ? 237 VAL A C     1 
ATOM   1599  O  O     . VAL A  1  211 ? -45.553 98.605  32.693  1.00 129.73 ? 237 VAL A O     1 
ATOM   1600  C  CB    . VAL A  1  211 ? -48.148 99.364  30.689  1.00 131.87 ? 237 VAL A CB    1 
ATOM   1601  C  CG1   . VAL A  1  211 ? -49.022 98.145  30.399  1.00 131.68 ? 237 VAL A CG1   1 
ATOM   1602  C  CG2   . VAL A  1  211 ? -48.863 100.642 30.272  1.00 131.87 ? 237 VAL A CG2   1 
ATOM   1603  N  N     . LEU A  1  212 ? -47.211 97.087  32.609  1.00 128.07 ? 238 LEU A N     1 
ATOM   1604  C  CA    . LEU A  1  212 ? -46.344 95.941  32.874  1.00 125.99 ? 238 LEU A CA    1 
ATOM   1605  C  C     . LEU A  1  212 ? -46.101 95.161  31.577  1.00 124.40 ? 238 LEU A C     1 
ATOM   1606  O  O     . LEU A  1  212 ? -46.587 95.554  30.512  1.00 124.79 ? 238 LEU A O     1 
ATOM   1607  C  CB    . LEU A  1  212 ? -46.965 95.031  33.940  1.00 126.43 ? 238 LEU A CB    1 
ATOM   1608  C  CG    . LEU A  1  212 ? -46.921 95.495  35.401  1.00 126.58 ? 238 LEU A CG    1 
ATOM   1609  C  CD1   . LEU A  1  212 ? -45.477 95.742  35.813  1.00 126.94 ? 238 LEU A CD1   1 
ATOM   1610  C  CD2   . LEU A  1  212 ? -47.754 96.751  35.604  1.00 126.71 ? 238 LEU A CD2   1 
ATOM   1611  N  N     . LYS A  1  213 ? -45.355 94.060  31.663  1.00 121.55 ? 239 LYS A N     1 
ATOM   1612  C  CA    . LYS A  1  213 ? -45.052 93.248  30.482  1.00 118.48 ? 239 LYS A CA    1 
ATOM   1613  C  C     . LYS A  1  213 ? -44.669 91.794  30.793  1.00 116.45 ? 239 LYS A C     1 
ATOM   1614  O  O     . LYS A  1  213 ? -45.189 91.196  31.737  1.00 116.12 ? 239 LYS A O     1 
ATOM   1615  C  CB    . LYS A  1  213 ? -43.963 93.934  29.640  1.00 118.95 ? 239 LYS A CB    1 
ATOM   1616  C  CG    . LYS A  1  213 ? -42.939 94.751  30.435  1.00 119.58 ? 239 LYS A CG    1 
ATOM   1617  C  CD    . LYS A  1  213 ? -42.146 93.897  31.410  1.00 120.83 ? 239 LYS A CD    1 
ATOM   1618  C  CE    . LYS A  1  213 ? -41.162 94.734  32.210  1.00 122.01 ? 239 LYS A CE    1 
ATOM   1619  N  NZ    . LYS A  1  213 ? -40.345 93.896  33.137  1.00 122.11 ? 239 LYS A NZ    1 
ATOM   1620  N  N     . LYS A  1  214 ? -43.788 91.226  29.967  1.00 113.70 ? 240 LYS A N     1 
ATOM   1621  C  CA    . LYS A  1  214 ? -43.309 89.850  30.127  1.00 109.46 ? 240 LYS A CA    1 
ATOM   1622  C  C     . LYS A  1  214 ? -41.789 89.868  30.336  1.00 105.32 ? 240 LYS A C     1 
ATOM   1623  O  O     . LYS A  1  214 ? -41.062 90.538  29.596  1.00 104.47 ? 240 LYS A O     1 
ATOM   1624  C  CB    . LYS A  1  214 ? -43.650 89.026  28.883  1.00 111.61 ? 240 LYS A CB    1 
ATOM   1625  C  CG    . LYS A  1  214 ? -43.424 87.530  29.040  1.00 114.20 ? 240 LYS A CG    1 
ATOM   1626  C  CD    . LYS A  1  214 ? -43.079 86.860  27.709  1.00 115.99 ? 240 LYS A CD    1 
ATOM   1627  C  CE    . LYS A  1  214 ? -44.192 86.999  26.676  1.00 117.40 ? 240 LYS A CE    1 
ATOM   1628  N  NZ    . LYS A  1  214 ? -43.813 86.357  25.382  1.00 117.41 ? 240 LYS A NZ    1 
ATOM   1629  N  N     . LYS A  1  215 ? -41.320 89.106  31.325  1.00 100.56 ? 241 LYS A N     1 
ATOM   1630  C  CA    . LYS A  1  215 ? -39.894 89.033  31.674  1.00 95.99  ? 241 LYS A CA    1 
ATOM   1631  C  C     . LYS A  1  215 ? -38.920 88.653  30.559  1.00 91.48  ? 241 LYS A C     1 
ATOM   1632  O  O     . LYS A  1  215 ? -39.176 87.746  29.765  1.00 91.26  ? 241 LYS A O     1 
ATOM   1633  C  CB    . LYS A  1  215 ? -39.667 88.131  32.898  1.00 97.10  ? 241 LYS A CB    1 
ATOM   1634  C  CG    . LYS A  1  215 ? -40.801 87.155  33.215  1.00 99.60  ? 241 LYS A CG    1 
ATOM   1635  C  CD    . LYS A  1  215 ? -41.046 86.147  32.097  1.00 100.74 ? 241 LYS A CD    1 
ATOM   1636  C  CE    . LYS A  1  215 ? -42.242 85.261  32.419  1.00 101.28 ? 241 LYS A CE    1 
ATOM   1637  N  NZ    . LYS A  1  215 ? -42.575 84.354  31.285  1.00 101.12 ? 241 LYS A NZ    1 
ATOM   1638  N  N     . ALA A  1  216 ? -37.788 89.355  30.535  1.00 85.77  ? 242 ALA A N     1 
ATOM   1639  C  CA    . ALA A  1  216 ? -36.736 89.149  29.547  1.00 79.91  ? 242 ALA A CA    1 
ATOM   1640  C  C     . ALA A  1  216 ? -36.054 87.789  29.666  1.00 76.83  ? 242 ALA A C     1 
ATOM   1641  O  O     . ALA A  1  216 ? -35.718 87.350  30.764  1.00 76.28  ? 242 ALA A O     1 
ATOM   1642  C  CB    . ALA A  1  216 ? -35.715 90.248  29.659  1.00 78.79  ? 242 ALA A CB    1 
ATOM   1643  N  N     . ALA A  1  217 ? -35.828 87.139  28.524  1.00 72.84  ? 243 ALA A N     1 
ATOM   1644  C  CA    . ALA A  1  217 ? -35.191 85.822  28.493  1.00 68.47  ? 243 ALA A CA    1 
ATOM   1645  C  C     . ALA A  1  217 ? -34.123 85.686  27.413  1.00 65.65  ? 243 ALA A C     1 
ATOM   1646  O  O     . ALA A  1  217 ? -34.247 86.240  26.319  1.00 65.06  ? 243 ALA A O     1 
ATOM   1647  C  CB    . ALA A  1  217 ? -36.239 84.732  28.330  1.00 67.49  ? 243 ALA A CB    1 
ATOM   1648  N  N     . PHE A  1  218 ? -33.068 84.943  27.743  1.00 62.92  ? 244 PHE A N     1 
ATOM   1649  C  CA    . PHE A  1  218 ? -31.949 84.701  26.829  1.00 59.31  ? 244 PHE A CA    1 
ATOM   1650  C  C     . PHE A  1  218 ? -32.234 83.504  25.920  1.00 57.38  ? 244 PHE A C     1 
ATOM   1651  O  O     . PHE A  1  218 ? -32.852 82.515  26.330  1.00 56.11  ? 244 PHE A O     1 
ATOM   1652  C  CB    . PHE A  1  218 ? -30.658 84.456  27.629  1.00 56.39  ? 244 PHE A CB    1 
ATOM   1653  C  CG    . PHE A  1  218 ? -29.431 84.299  26.781  1.00 52.00  ? 244 PHE A CG    1 
ATOM   1654  C  CD1   . PHE A  1  218 ? -28.681 85.410  26.413  1.00 50.79  ? 244 PHE A CD1   1 
ATOM   1655  C  CD2   . PHE A  1  218 ? -29.020 83.037  26.352  1.00 50.10  ? 244 PHE A CD2   1 
ATOM   1656  C  CE1   . PHE A  1  218 ? -27.534 85.269  25.624  1.00 49.68  ? 244 PHE A CE1   1 
ATOM   1657  C  CE2   . PHE A  1  218 ? -27.879 82.882  25.565  1.00 47.78  ? 244 PHE A CE2   1 
ATOM   1658  C  CZ    . PHE A  1  218 ? -27.135 83.996  25.200  1.00 48.69  ? 244 PHE A CZ    1 
ATOM   1659  N  N     . LEU A  1  219 ? -31.775 83.604  24.681  1.00 55.79  ? 245 LEU A N     1 
ATOM   1660  C  CA    . LEU A  1  219 ? -31.970 82.532  23.717  1.00 55.42  ? 245 LEU A CA    1 
ATOM   1661  C  C     . LEU A  1  219 ? -30.722 82.336  22.856  1.00 53.94  ? 245 LEU A C     1 
ATOM   1662  O  O     . LEU A  1  219 ? -30.298 83.255  22.142  1.00 52.83  ? 245 LEU A O     1 
ATOM   1663  C  CB    . LEU A  1  219 ? -33.166 82.846  22.812  1.00 54.56  ? 245 LEU A CB    1 
ATOM   1664  C  CG    . LEU A  1  219 ? -33.590 81.746  21.843  1.00 53.80  ? 245 LEU A CG    1 
ATOM   1665  C  CD1   . LEU A  1  219 ? -34.346 80.678  22.609  1.00 53.25  ? 245 LEU A CD1   1 
ATOM   1666  C  CD2   . LEU A  1  219 ? -34.452 82.329  20.740  1.00 51.70  ? 245 LEU A CD2   1 
ATOM   1667  N  N     . GLY A  1  220 ? -30.141 81.138  22.929  1.00 51.60  ? 246 GLY A N     1 
ATOM   1668  C  CA    . GLY A  1  220 ? -28.965 80.838  22.128  1.00 49.56  ? 246 GLY A CA    1 
ATOM   1669  C  C     . GLY A  1  220 ? -29.317 80.986  20.661  1.00 47.63  ? 246 GLY A C     1 
ATOM   1670  O  O     . GLY A  1  220 ? -30.164 80.256  20.144  1.00 48.07  ? 246 GLY A O     1 
ATOM   1671  N  N     . SER A  1  221 ? -28.677 81.944  19.999  1.00 45.74  ? 247 SER A N     1 
ATOM   1672  C  CA    . SER A  1  221 ? -28.945 82.223  18.600  1.00 44.14  ? 247 SER A CA    1 
ATOM   1673  C  C     . SER A  1  221 ? -27.871 83.103  17.983  1.00 43.96  ? 247 SER A C     1 
ATOM   1674  O  O     . SER A  1  221 ? -26.905 83.476  18.642  1.00 44.89  ? 247 SER A O     1 
ATOM   1675  C  CB    . SER A  1  221 ? -30.283 82.934  18.485  1.00 45.75  ? 247 SER A CB    1 
ATOM   1676  O  OG    . SER A  1  221 ? -30.244 84.170  19.172  1.00 47.54  ? 247 SER A OG    1 
ATOM   1677  N  N     . GLU A  1  222 ? -28.081 83.492  16.729  1.00 43.96  ? 248 GLU A N     1 
ATOM   1678  C  CA    . GLU A  1  222 ? -27.119 84.327  16.023  1.00 43.14  ? 248 GLU A CA    1 
ATOM   1679  C  C     . GLU A  1  222 ? -27.749 85.128  14.892  1.00 43.59  ? 248 GLU A C     1 
ATOM   1680  O  O     . GLU A  1  222 ? -28.813 84.784  14.386  1.00 44.80  ? 248 GLU A O     1 
ATOM   1681  C  CB    . GLU A  1  222 ? -26.025 83.451  15.424  1.00 45.25  ? 248 GLU A CB    1 
ATOM   1682  C  CG    . GLU A  1  222 ? -26.525 82.516  14.317  1.00 47.67  ? 248 GLU A CG    1 
ATOM   1683  C  CD    . GLU A  1  222 ? -25.454 81.562  13.802  1.00 49.52  ? 248 GLU A CD    1 
ATOM   1684  O  OE1   . GLU A  1  222 ? -25.432 81.291  12.589  1.00 47.88  ? 248 GLU A OE1   1 
ATOM   1685  O  OE2   . GLU A  1  222 ? -24.645 81.065  14.613  1.00 53.07  ? 248 GLU A OE2   1 
ATOM   1686  N  N     . VAL A  1  223 ? -27.062 86.193  14.499  1.00 42.18  ? 249 VAL A N     1 
ATOM   1687  C  CA    . VAL A  1  223 ? -27.482 87.044  13.402  1.00 41.98  ? 249 VAL A CA    1 
ATOM   1688  C  C     . VAL A  1  223 ? -26.189 87.421  12.681  1.00 42.43  ? 249 VAL A C     1 
ATOM   1689  O  O     . VAL A  1  223 ? -25.268 87.994  13.264  1.00 44.78  ? 249 VAL A O     1 
ATOM   1690  C  CB    . VAL A  1  223 ? -28.287 88.296  13.879  1.00 42.25  ? 249 VAL A CB    1 
ATOM   1691  C  CG1   . VAL A  1  223 ? -27.508 89.103  14.915  1.00 39.40  ? 249 VAL A CG1   1 
ATOM   1692  C  CG2   . VAL A  1  223 ? -28.652 89.169  12.687  1.00 40.30  ? 249 VAL A CG2   1 
ATOM   1693  N  N     . ARG A  1  224 ? -26.102 87.028  11.419  1.00 42.97  ? 250 ARG A N     1 
ATOM   1694  C  CA    . ARG A  1  224 ? -24.912 87.283  10.626  1.00 43.56  ? 250 ARG A CA    1 
ATOM   1695  C  C     . ARG A  1  224 ? -25.198 88.307  9.536   1.00 43.04  ? 250 ARG A C     1 
ATOM   1696  O  O     . ARG A  1  224 ? -26.020 88.075  8.649   1.00 45.17  ? 250 ARG A O     1 
ATOM   1697  C  CB    . ARG A  1  224 ? -24.391 85.951  10.058  1.00 44.28  ? 250 ARG A CB    1 
ATOM   1698  C  CG    . ARG A  1  224 ? -24.226 84.873  11.150  1.00 45.85  ? 250 ARG A CG    1 
ATOM   1699  C  CD    . ARG A  1  224 ? -24.031 83.462  10.598  1.00 45.74  ? 250 ARG A CD    1 
ATOM   1700  N  NE    . ARG A  1  224 ? -22.627 83.070  10.576  1.00 47.14  ? 250 ARG A NE    1 
ATOM   1701  C  CZ    . ARG A  1  224 ? -22.040 82.273  11.471  1.00 46.89  ? 250 ARG A CZ    1 
ATOM   1702  N  NH1   . ARG A  1  224 ? -20.755 82.001  11.342  1.00 44.77  ? 250 ARG A NH1   1 
ATOM   1703  N  NH2   . ARG A  1  224 ? -22.720 81.743  12.486  1.00 44.71  ? 250 ARG A NH2   1 
ATOM   1704  N  N     . LEU A  1  225 ? -24.547 89.460  9.652   1.00 41.89  ? 251 LEU A N     1 
ATOM   1705  C  CA    . LEU A  1  225 ? -24.711 90.571  8.715   1.00 41.10  ? 251 LEU A CA    1 
ATOM   1706  C  C     . LEU A  1  225 ? -23.523 90.665  7.776   1.00 40.81  ? 251 LEU A C     1 
ATOM   1707  O  O     . LEU A  1  225 ? -22.839 91.688  7.729   1.00 41.21  ? 251 LEU A O     1 
ATOM   1708  C  CB    . LEU A  1  225 ? -24.855 91.874  9.507   1.00 42.32  ? 251 LEU A CB    1 
ATOM   1709  C  CG    . LEU A  1  225 ? -26.127 92.006  10.363  1.00 45.72  ? 251 LEU A CG    1 
ATOM   1710  C  CD1   . LEU A  1  225 ? -25.815 92.484  11.763  1.00 43.68  ? 251 LEU A CD1   1 
ATOM   1711  C  CD2   . LEU A  1  225 ? -27.083 92.958  9.685   1.00 47.19  ? 251 LEU A CD2   1 
ATOM   1712  N  N     . ARG A  1  226 ? -23.296 89.611  6.999   1.00 40.49  ? 252 ARG A N     1 
ATOM   1713  C  CA    . ARG A  1  226 ? -22.156 89.585  6.087   1.00 40.49  ? 252 ARG A CA    1 
ATOM   1714  C  C     . ARG A  1  226 ? -22.138 90.780  5.151   1.00 41.26  ? 252 ARG A C     1 
ATOM   1715  O  O     . ARG A  1  226 ? -23.174 91.212  4.665   1.00 44.10  ? 252 ARG A O     1 
ATOM   1716  C  CB    . ARG A  1  226 ? -22.129 88.283  5.271   1.00 38.72  ? 252 ARG A CB    1 
ATOM   1717  C  CG    . ARG A  1  226 ? -20.712 87.780  4.975   1.00 40.83  ? 252 ARG A CG    1 
ATOM   1718  C  CD    . ARG A  1  226 ? -20.514 87.330  3.532   1.00 39.39  ? 252 ARG A CD    1 
ATOM   1719  N  NE    . ARG A  1  226 ? -20.326 85.886  3.390   1.00 36.79  ? 252 ARG A NE    1 
ATOM   1720  C  CZ    . ARG A  1  226 ? -19.495 85.311  2.521   1.00 36.20  ? 252 ARG A CZ    1 
ATOM   1721  N  NH1   . ARG A  1  226 ? -19.417 83.991  2.470   1.00 40.48  ? 252 ARG A NH1   1 
ATOM   1722  N  NH2   . ARG A  1  226 ? -18.734 86.037  1.712   1.00 31.18  ? 252 ARG A NH2   1 
ATOM   1723  N  N     . ASP A  1  227 ? -20.956 91.340  4.953   1.00 42.44  ? 253 ASP A N     1 
ATOM   1724  C  CA    . ASP A  1  227 ? -20.754 92.462  4.052   1.00 43.81  ? 253 ASP A CA    1 
ATOM   1725  C  C     . ASP A  1  227 ? -19.287 92.395  3.627   1.00 45.09  ? 253 ASP A C     1 
ATOM   1726  O  O     . ASP A  1  227 ? -18.403 92.883  4.329   1.00 47.48  ? 253 ASP A O     1 
ATOM   1727  C  CB    . ASP A  1  227 ? -21.056 93.794  4.751   1.00 44.14  ? 253 ASP A CB    1 
ATOM   1728  C  CG    . ASP A  1  227 ? -21.001 94.998  3.792   1.00 46.63  ? 253 ASP A CG    1 
ATOM   1729  O  OD1   . ASP A  1  227 ? -20.265 94.963  2.780   1.00 43.41  ? 253 ASP A OD1   1 
ATOM   1730  O  OD2   . ASP A  1  227 ? -21.699 95.998  4.062   1.00 48.73  ? 253 ASP A OD2   1 
ATOM   1731  N  N     . ASP A  1  228 ? -19.043 91.798  2.466   1.00 44.46  ? 254 ASP A N     1 
ATOM   1732  C  CA    . ASP A  1  228 ? -17.694 91.639  1.942   1.00 44.93  ? 254 ASP A CA    1 
ATOM   1733  C  C     . ASP A  1  228 ? -17.040 92.938  1.477   1.00 46.40  ? 254 ASP A C     1 
ATOM   1734  O  O     . ASP A  1  228 ? -15.864 92.936  1.097   1.00 47.89  ? 254 ASP A O     1 
ATOM   1735  C  CB    . ASP A  1  228 ? -17.677 90.608  0.801   1.00 44.01  ? 254 ASP A CB    1 
ATOM   1736  C  CG    . ASP A  1  228 ? -18.060 89.197  1.258   1.00 44.68  ? 254 ASP A CG    1 
ATOM   1737  O  OD1   . ASP A  1  228 ? -18.207 88.946  2.474   1.00 43.42  ? 254 ASP A OD1   1 
ATOM   1738  O  OD2   . ASP A  1  228 ? -18.201 88.320  0.384   1.00 44.44  ? 254 ASP A OD2   1 
ATOM   1739  N  N     . THR A  1  229 ? -17.785 94.042  1.480   1.00 47.34  ? 255 THR A N     1 
ATOM   1740  C  CA    . THR A  1  229 ? -17.195 95.309  1.050   1.00 49.38  ? 255 THR A CA    1 
ATOM   1741  C  C     . THR A  1  229 ? -16.519 96.049  2.203   1.00 50.61  ? 255 THR A C     1 
ATOM   1742  O  O     . THR A  1  229 ? -15.828 97.039  1.977   1.00 51.79  ? 255 THR A O     1 
ATOM   1743  C  CB    . THR A  1  229 ? -18.213 96.249  0.355   1.00 49.05  ? 255 THR A CB    1 
ATOM   1744  O  OG1   . THR A  1  229 ? -19.188 96.699  1.304   1.00 50.95  ? 255 THR A OG1   1 
ATOM   1745  C  CG2   . THR A  1  229 ? -18.907 95.531  -0.793  1.00 47.13  ? 255 THR A CG2   1 
ATOM   1746  N  N     . LEU A  1  230 ? -16.747 95.597  3.434   1.00 50.60  ? 256 LEU A N     1 
ATOM   1747  C  CA    . LEU A  1  230 ? -16.115 96.219  4.595   1.00 52.01  ? 256 LEU A CA    1 
ATOM   1748  C  C     . LEU A  1  230 ? -14.682 95.689  4.668   1.00 53.33  ? 256 LEU A C     1 
ATOM   1749  O  O     . LEU A  1  230 ? -14.412 94.571  4.231   1.00 54.81  ? 256 LEU A O     1 
ATOM   1750  C  CB    . LEU A  1  230 ? -16.901 95.904  5.870   1.00 51.28  ? 256 LEU A CB    1 
ATOM   1751  C  CG    . LEU A  1  230 ? -18.288 96.567  5.917   1.00 52.16  ? 256 LEU A CG    1 
ATOM   1752  C  CD1   . LEU A  1  230 ? -19.057 96.165  7.173   1.00 50.45  ? 256 LEU A CD1   1 
ATOM   1753  C  CD2   . LEU A  1  230 ? -18.135 98.085  5.846   1.00 48.05  ? 256 LEU A CD2   1 
ATOM   1754  N  N     . PRO A  1  231 ? -13.735 96.494  5.182   1.00 53.10  ? 257 PRO A N     1 
ATOM   1755  C  CA    . PRO A  1  231 ? -12.350 96.022  5.257   1.00 51.02  ? 257 PRO A CA    1 
ATOM   1756  C  C     . PRO A  1  231 ? -11.976 95.128  6.450   1.00 49.44  ? 257 PRO A C     1 
ATOM   1757  O  O     . PRO A  1  231 ? -10.858 94.607  6.504   1.00 49.19  ? 257 PRO A O     1 
ATOM   1758  C  CB    . PRO A  1  231 ? -11.562 97.329  5.244   1.00 51.32  ? 257 PRO A CB    1 
ATOM   1759  C  CG    . PRO A  1  231 ? -12.419 98.222  6.063   1.00 51.43  ? 257 PRO A CG    1 
ATOM   1760  C  CD    . PRO A  1  231 ? -13.822 97.922  5.547   1.00 52.68  ? 257 PRO A CD    1 
ATOM   1761  N  N     . LYS A  1  232 ? -12.900 94.940  7.386   1.00 46.99  ? 258 LYS A N     1 
ATOM   1762  C  CA    . LYS A  1  232 ? -12.632 94.107  8.557   1.00 47.74  ? 258 LYS A CA    1 
ATOM   1763  C  C     . LYS A  1  232 ? -13.805 93.196  8.897   1.00 47.13  ? 258 LYS A C     1 
ATOM   1764  O  O     . LYS A  1  232 ? -14.804 93.154  8.185   1.00 48.44  ? 258 LYS A O     1 
ATOM   1765  C  CB    . LYS A  1  232 ? -12.371 94.971  9.796   1.00 49.69  ? 258 LYS A CB    1 
ATOM   1766  C  CG    . LYS A  1  232 ? -11.197 95.920  9.733   1.00 52.25  ? 258 LYS A CG    1 
ATOM   1767  C  CD    . LYS A  1  232 ? -11.051 96.610  11.085  1.00 53.95  ? 258 LYS A CD    1 
ATOM   1768  C  CE    . LYS A  1  232 ? -9.909  97.615  11.101  1.00 54.73  ? 258 LYS A CE    1 
ATOM   1769  N  NZ    . LYS A  1  232 ? -9.679  98.120  12.488  1.00 54.11  ? 258 LYS A NZ    1 
ATOM   1770  N  N     . ALA A  1  233 ? -13.673 92.490  10.017  1.00 45.09  ? 259 ALA A N     1 
ATOM   1771  C  CA    . ALA A  1  233 ? -14.717 91.615  10.524  1.00 43.79  ? 259 ALA A CA    1 
ATOM   1772  C  C     . ALA A  1  233 ? -14.891 91.992  11.993  1.00 44.09  ? 259 ALA A C     1 
ATOM   1773  O  O     . ALA A  1  233 ? -13.914 92.064  12.746  1.00 44.82  ? 259 ALA A O     1 
ATOM   1774  C  CB    . ALA A  1  233 ? -14.325 90.163  10.386  1.00 42.04  ? 259 ALA A CB    1 
ATOM   1775  N  N     . TRP A  1  234 ? -16.122 92.338  12.354  1.00 43.73  ? 260 TRP A N     1 
ATOM   1776  C  CA    . TRP A  1  234 ? -16.472 92.734  13.709  1.00 43.29  ? 260 TRP A CA    1 
ATOM   1777  C  C     . TRP A  1  234 ? -17.424 91.705  14.261  1.00 43.90  ? 260 TRP A C     1 
ATOM   1778  O  O     . TRP A  1  234 ? -18.499 91.506  13.706  1.00 47.54  ? 260 TRP A O     1 
ATOM   1779  C  CB    . TRP A  1  234 ? -17.192 94.088  13.697  1.00 42.89  ? 260 TRP A CB    1 
ATOM   1780  C  CG    . TRP A  1  234 ? -16.332 95.257  13.338  1.00 42.05  ? 260 TRP A CG    1 
ATOM   1781  C  CD1   . TRP A  1  234 ? -15.670 96.081  14.202  1.00 41.01  ? 260 TRP A CD1   1 
ATOM   1782  C  CD2   . TRP A  1  234 ? -16.064 95.754  12.021  1.00 40.85  ? 260 TRP A CD2   1 
ATOM   1783  N  NE1   . TRP A  1  234 ? -15.006 97.064  13.506  1.00 40.57  ? 260 TRP A NE1   1 
ATOM   1784  C  CE2   . TRP A  1  234 ? -15.230 96.891  12.165  1.00 41.34  ? 260 TRP A CE2   1 
ATOM   1785  C  CE3   . TRP A  1  234 ? -16.450 95.356  10.735  1.00 39.33  ? 260 TRP A CE3   1 
ATOM   1786  C  CZ2   . TRP A  1  234 ? -14.773 97.640  11.065  1.00 40.45  ? 260 TRP A CZ2   1 
ATOM   1787  C  CZ3   . TRP A  1  234 ? -15.998 96.101  9.640   1.00 40.05  ? 260 TRP A CZ3   1 
ATOM   1788  C  CH2   . TRP A  1  234 ? -15.168 97.232  9.815   1.00 41.12  ? 260 TRP A CH2   1 
ATOM   1789  N  N     . ILE A  1  235 ? -17.048 91.046  15.348  1.00 42.76  ? 261 ILE A N     1 
ATOM   1790  C  CA    . ILE A  1  235 ? -17.927 90.045  15.928  1.00 43.20  ? 261 ILE A CA    1 
ATOM   1791  C  C     . ILE A  1  235 ? -18.029 90.230  17.438  1.00 43.38  ? 261 ILE A C     1 
ATOM   1792  O  O     . ILE A  1  235 ? -17.111 90.749  18.072  1.00 44.24  ? 261 ILE A O     1 
ATOM   1793  C  CB    . ILE A  1  235 ? -17.504 88.554  15.530  1.00 43.23  ? 261 ILE A CB    1 
ATOM   1794  C  CG1   . ILE A  1  235 ? -17.094 87.740  16.749  1.00 44.74  ? 261 ILE A CG1   1 
ATOM   1795  C  CG2   . ILE A  1  235 ? -16.364 88.526  14.505  1.00 41.68  ? 261 ILE A CG2   1 
ATOM   1796  C  CD1   . ILE A  1  235 ? -18.068 86.624  17.097  1.00 48.70  ? 261 ILE A CD1   1 
ATOM   1797  N  N     . SER A  1  236 ? -19.190 89.893  17.986  1.00 42.69  ? 262 SER A N     1 
ATOM   1798  C  CA    . SER A  1  236 ? -19.434 89.981  19.420  1.00 45.57  ? 262 SER A CA    1 
ATOM   1799  C  C     . SER A  1  236 ? -20.051 88.644  19.789  1.00 47.41  ? 262 SER A C     1 
ATOM   1800  O  O     . SER A  1  236 ? -20.881 88.110  19.050  1.00 50.35  ? 262 SER A O     1 
ATOM   1801  C  CB    . SER A  1  236 ? -20.390 91.136  19.766  1.00 46.75  ? 262 SER A CB    1 
ATOM   1802  O  OG    . SER A  1  236 ? -19.769 92.413  19.610  1.00 47.16  ? 262 SER A OG    1 
ATOM   1803  N  N     . LEU A  1  237 ? -19.644 88.099  20.926  1.00 48.11  ? 263 LEU A N     1 
ATOM   1804  C  CA    . LEU A  1  237 ? -20.125 86.792  21.358  1.00 48.71  ? 263 LEU A CA    1 
ATOM   1805  C  C     . LEU A  1  237 ? -20.350 86.840  22.857  1.00 48.79  ? 263 LEU A C     1 
ATOM   1806  O  O     . LEU A  1  237 ? -19.535 87.419  23.583  1.00 49.54  ? 263 LEU A O     1 
ATOM   1807  C  CB    . LEU A  1  237 ? -19.057 85.741  21.008  1.00 49.84  ? 263 LEU A CB    1 
ATOM   1808  C  CG    . LEU A  1  237 ? -19.367 84.245  21.024  1.00 51.82  ? 263 LEU A CG    1 
ATOM   1809  C  CD1   . LEU A  1  237 ? -18.349 83.530  20.151  1.00 52.68  ? 263 LEU A CD1   1 
ATOM   1810  C  CD2   . LEU A  1  237 ? -19.368 83.685  22.438  1.00 51.67  ? 263 LEU A CD2   1 
ATOM   1811  N  N     . ALA A  1  238 ? -21.433 86.221  23.323  1.00 47.63  ? 264 ALA A N     1 
ATOM   1812  C  CA    . ALA A  1  238 ? -21.736 86.234  24.747  1.00 48.17  ? 264 ALA A CA    1 
ATOM   1813  C  C     . ALA A  1  238 ? -22.683 85.144  25.223  1.00 49.49  ? 264 ALA A C     1 
ATOM   1814  O  O     . ALA A  1  238 ? -23.364 84.497  24.424  1.00 51.07  ? 264 ALA A O     1 
ATOM   1815  C  CB    . ALA A  1  238 ? -22.309 87.584  25.119  1.00 47.71  ? 264 ALA A CB    1 
ATOM   1816  N  N     . VAL A  1  239 ? -22.670 84.912  26.533  1.00 49.75  ? 265 VAL A N     1 
ATOM   1817  C  CA    . VAL A  1  239 ? -23.565 83.952  27.175  1.00 51.03  ? 265 VAL A CA    1 
ATOM   1818  C  C     . VAL A  1  239 ? -24.476 84.805  28.063  1.00 53.02  ? 265 VAL A C     1 
ATOM   1819  O  O     . VAL A  1  239 ? -24.267 86.021  28.181  1.00 53.48  ? 265 VAL A O     1 
ATOM   1820  C  CB    . VAL A  1  239 ? -22.807 82.938  28.071  1.00 50.05  ? 265 VAL A CB    1 
ATOM   1821  C  CG1   . VAL A  1  239 ? -21.893 82.066  27.228  1.00 50.09  ? 265 VAL A CG1   1 
ATOM   1822  C  CG2   . VAL A  1  239 ? -22.012 83.662  29.145  1.00 50.44  ? 265 VAL A CG2   1 
ATOM   1823  N  N     . GLU A  1  240 ? -25.498 84.199  28.658  1.00 54.37  ? 266 GLU A N     1 
ATOM   1824  C  CA    . GLU A  1  240 ? -26.372 84.959  29.541  1.00 56.55  ? 266 GLU A CA    1 
ATOM   1825  C  C     . GLU A  1  240 ? -25.562 85.357  30.778  1.00 58.54  ? 266 GLU A C     1 
ATOM   1826  O  O     . GLU A  1  240 ? -25.006 84.502  31.481  1.00 56.86  ? 266 GLU A O     1 
ATOM   1827  C  CB    . GLU A  1  240 ? -27.594 84.140  29.953  1.00 57.88  ? 266 GLU A CB    1 
ATOM   1828  C  CG    . GLU A  1  240 ? -28.574 84.923  30.823  1.00 59.58  ? 266 GLU A CG    1 
ATOM   1829  C  CD    . GLU A  1  240 ? -29.810 84.131  31.215  1.00 60.54  ? 266 GLU A CD    1 
ATOM   1830  O  OE1   . GLU A  1  240 ? -30.821 84.767  31.579  1.00 62.66  ? 266 GLU A OE1   1 
ATOM   1831  O  OE2   . GLU A  1  240 ? -29.777 82.883  31.165  1.00 61.93  ? 266 GLU A OE2   1 
ATOM   1832  N  N     . GLY A  1  241 ? -25.470 86.663  31.014  1.00 60.88  ? 267 GLY A N     1 
ATOM   1833  C  CA    . GLY A  1  241 ? -24.715 87.169  32.149  1.00 62.41  ? 267 GLY A CA    1 
ATOM   1834  C  C     . GLY A  1  241 ? -25.474 87.318  33.455  1.00 63.30  ? 267 GLY A C     1 
ATOM   1835  O  O     . GLY A  1  241 ? -26.309 86.480  33.815  1.00 63.62  ? 267 GLY A O     1 
ATOM   1836  N  N     . GLU A  1  242 ? -25.174 88.401  34.169  1.00 64.14  ? 268 GLU A N     1 
ATOM   1837  C  CA    . GLU A  1  242 ? -25.800 88.683  35.462  1.00 63.66  ? 268 GLU A CA    1 
ATOM   1838  C  C     . GLU A  1  242 ? -26.563 90.002  35.492  1.00 63.62  ? 268 GLU A C     1 
ATOM   1839  O  O     . GLU A  1  242 ? -26.126 91.006  34.922  1.00 63.08  ? 268 GLU A O     1 
ATOM   1840  C  CB    . GLU A  1  242 ? -24.741 88.696  36.573  1.00 61.39  ? 268 GLU A CB    1 
ATOM   1841  C  CG    . GLU A  1  242 ? -24.005 87.383  36.776  1.00 62.38  ? 268 GLU A CG    1 
ATOM   1842  C  CD    . GLU A  1  242 ? -24.888 86.260  37.324  1.00 65.85  ? 268 GLU A CD    1 
ATOM   1843  O  OE1   . GLU A  1  242 ? -26.114 86.451  37.481  1.00 68.04  ? 268 GLU A OE1   1 
ATOM   1844  O  OE2   . GLU A  1  242 ? -24.349 85.168  37.611  1.00 67.38  ? 268 GLU A OE2   1 
ATOM   1845  N  N     . PRO A  1  243 ? -27.744 90.003  36.125  1.00 64.06  ? 269 PRO A N     1 
ATOM   1846  C  CA    . PRO A  1  243 ? -28.547 91.227  36.218  1.00 64.82  ? 269 PRO A CA    1 
ATOM   1847  C  C     . PRO A  1  243 ? -28.018 92.062  37.386  1.00 65.79  ? 269 PRO A C     1 
ATOM   1848  O  O     . PRO A  1  243 ? -27.297 91.536  38.240  1.00 64.72  ? 269 PRO A O     1 
ATOM   1849  C  CB    . PRO A  1  243 ? -29.941 90.683  36.519  1.00 63.53  ? 269 PRO A CB    1 
ATOM   1850  C  CG    . PRO A  1  243 ? -29.645 89.483  37.380  1.00 62.83  ? 269 PRO A CG    1 
ATOM   1851  C  CD    . PRO A  1  243 ? -28.476 88.840  36.665  1.00 62.89  ? 269 PRO A CD    1 
ATOM   1852  N  N     . VAL A  1  244 ? -28.325 93.360  37.413  1.00 68.28  ? 270 VAL A N     1 
ATOM   1853  C  CA    . VAL A  1  244 ? -27.882 94.198  38.535  1.00 69.68  ? 270 VAL A CA    1 
ATOM   1854  C  C     . VAL A  1  244 ? -28.635 93.675  39.751  1.00 71.48  ? 270 VAL A C     1 
ATOM   1855  O  O     . VAL A  1  244 ? -29.784 93.230  39.639  1.00 72.67  ? 270 VAL A O     1 
ATOM   1856  C  CB    . VAL A  1  244 ? -28.198 95.705  38.348  1.00 68.25  ? 270 VAL A CB    1 
ATOM   1857  C  CG1   . VAL A  1  244 ? -27.451 96.269  37.153  1.00 67.52  ? 270 VAL A CG1   1 
ATOM   1858  C  CG2   . VAL A  1  244 ? -29.685 95.922  38.201  1.00 68.30  ? 270 VAL A CG2   1 
ATOM   1859  N  N     . ASN A  1  245 ? -27.966 93.671  40.893  1.00 73.36  ? 271 ASN A N     1 
ATOM   1860  C  CA    . ASN A  1  245 ? -28.560 93.173  42.128  1.00 77.07  ? 271 ASN A CA    1 
ATOM   1861  C  C     . ASN A  1  245 ? -28.614 91.648  42.066  1.00 76.18  ? 271 ASN A C     1 
ATOM   1862  O  O     . ASN A  1  245 ? -29.668 91.026  42.226  1.00 76.92  ? 271 ASN A O     1 
ATOM   1863  C  CB    . ASN A  1  245 ? -29.963 93.767  42.356  1.00 81.34  ? 271 ASN A CB    1 
ATOM   1864  C  CG    . ASN A  1  245 ? -30.274 93.978  43.831  1.00 85.25  ? 271 ASN A CG    1 
ATOM   1865  O  OD1   . ASN A  1  245 ? -29.687 94.852  44.479  1.00 87.21  ? 271 ASN A OD1   1 
ATOM   1866  N  ND2   . ASN A  1  245 ? -31.193 93.177  44.371  1.00 86.01  ? 271 ASN A ND2   1 
ATOM   1867  N  N     . SER A  1  246 ? -27.455 91.071  41.770  1.00 75.17  ? 272 SER A N     1 
ATOM   1868  C  CA    . SER A  1  246 ? -27.265 89.633  41.681  1.00 72.47  ? 272 SER A CA    1 
ATOM   1869  C  C     . SER A  1  246 ? -26.071 89.306  42.563  1.00 70.84  ? 272 SER A C     1 
ATOM   1870  O  O     . SER A  1  246 ? -25.103 90.075  42.628  1.00 69.36  ? 272 SER A O     1 
ATOM   1871  C  CB    . SER A  1  246 ? -26.960 89.217  40.236  1.00 73.22  ? 272 SER A CB    1 
ATOM   1872  O  OG    . SER A  1  246 ? -26.447 87.889  40.169  1.00 73.13  ? 272 SER A OG    1 
ATOM   1873  N  N     . PRO A  1  247 ? -26.134 88.167  43.270  1.00 69.53  ? 273 PRO A N     1 
ATOM   1874  C  CA    . PRO A  1  247 ? -25.063 87.711  44.163  1.00 69.13  ? 273 PRO A CA    1 
ATOM   1875  C  C     . PRO A  1  247 ? -23.707 87.583  43.459  1.00 69.50  ? 273 PRO A C     1 
ATOM   1876  O  O     . PRO A  1  247 ? -22.660 87.610  44.113  1.00 70.17  ? 273 PRO A O     1 
ATOM   1877  C  CB    . PRO A  1  247 ? -25.572 86.349  44.626  1.00 68.72  ? 273 PRO A CB    1 
ATOM   1878  C  CG    . PRO A  1  247 ? -27.055 86.540  44.642  1.00 69.08  ? 273 PRO A CG    1 
ATOM   1879  C  CD    . PRO A  1  247 ? -27.298 87.267  43.344  1.00 68.26  ? 273 PRO A CD    1 
ATOM   1880  N  N     . ASN A  1  248 ? -23.729 87.469  42.129  1.00 68.77  ? 274 ASN A N     1 
ATOM   1881  C  CA    . ASN A  1  248 ? -22.504 87.323  41.344  1.00 66.57  ? 274 ASN A CA    1 
ATOM   1882  C  C     . ASN A  1  248 ? -22.154 88.503  40.444  1.00 64.87  ? 274 ASN A C     1 
ATOM   1883  O  O     . ASN A  1  248 ? -21.261 88.401  39.604  1.00 63.55  ? 274 ASN A O     1 
ATOM   1884  C  CB    . ASN A  1  248 ? -22.566 86.045  40.518  1.00 66.89  ? 274 ASN A CB    1 
ATOM   1885  C  CG    . ASN A  1  248 ? -22.560 84.805  41.376  1.00 68.74  ? 274 ASN A CG    1 
ATOM   1886  O  OD1   . ASN A  1  248 ? -23.546 84.065  41.435  1.00 69.22  ? 274 ASN A OD1   1 
ATOM   1887  N  ND2   . ASN A  1  248 ? -21.444 84.569  42.055  1.00 70.47  ? 274 ASN A ND2   1 
ATOM   1888  N  N     . TYR A  1  249 ? -22.823 89.634  40.650  1.00 63.23  ? 275 TYR A N     1 
ATOM   1889  C  CA    . TYR A  1  249 ? -22.572 90.831  39.854  1.00 61.97  ? 275 TYR A CA    1 
ATOM   1890  C  C     . TYR A  1  249 ? -21.078 91.133  39.745  1.00 62.78  ? 275 TYR A C     1 
ATOM   1891  O  O     . TYR A  1  249 ? -20.589 91.520  38.682  1.00 62.57  ? 275 TYR A O     1 
ATOM   1892  C  CB    . TYR A  1  249 ? -23.308 92.025  40.473  1.00 59.88  ? 275 TYR A CB    1 
ATOM   1893  C  CG    . TYR A  1  249 ? -23.032 93.358  39.804  1.00 57.45  ? 275 TYR A CG    1 
ATOM   1894  C  CD1   . TYR A  1  249 ? -23.790 93.788  38.719  1.00 55.59  ? 275 TYR A CD1   1 
ATOM   1895  C  CD2   . TYR A  1  249 ? -22.009 94.190  40.264  1.00 56.45  ? 275 TYR A CD2   1 
ATOM   1896  C  CE1   . TYR A  1  249 ? -23.536 95.015  38.102  1.00 56.94  ? 275 TYR A CE1   1 
ATOM   1897  C  CE2   . TYR A  1  249 ? -21.746 95.414  39.660  1.00 56.51  ? 275 TYR A CE2   1 
ATOM   1898  C  CZ    . TYR A  1  249 ? -22.510 95.823  38.579  1.00 57.64  ? 275 TYR A CZ    1 
ATOM   1899  O  OH    . TYR A  1  249 ? -22.238 97.034  37.973  1.00 57.74  ? 275 TYR A OH    1 
ATOM   1900  N  N     . PHE A  1  250 ? -20.358 90.930  40.846  1.00 63.86  ? 276 PHE A N     1 
ATOM   1901  C  CA    . PHE A  1  250 ? -18.919 91.190  40.894  1.00 64.35  ? 276 PHE A CA    1 
ATOM   1902  C  C     . PHE A  1  250 ? -18.010 90.072  40.388  1.00 64.29  ? 276 PHE A C     1 
ATOM   1903  O  O     . PHE A  1  250 ? -16.999 90.355  39.733  1.00 63.86  ? 276 PHE A O     1 
ATOM   1904  C  CB    . PHE A  1  250 ? -18.495 91.631  42.299  1.00 64.10  ? 276 PHE A CB    1 
ATOM   1905  C  CG    . PHE A  1  250 ? -18.935 93.018  42.643  1.00 63.03  ? 276 PHE A CG    1 
ATOM   1906  C  CD1   . PHE A  1  250 ? -20.029 93.227  43.476  1.00 63.37  ? 276 PHE A CD1   1 
ATOM   1907  C  CD2   . PHE A  1  250 ? -18.293 94.118  42.082  1.00 61.55  ? 276 PHE A CD2   1 
ATOM   1908  C  CE1   . PHE A  1  250 ? -20.484 94.512  43.739  1.00 63.04  ? 276 PHE A CE1   1 
ATOM   1909  C  CE2   . PHE A  1  250 ? -18.735 95.406  42.336  1.00 61.82  ? 276 PHE A CE2   1 
ATOM   1910  C  CZ    . PHE A  1  250 ? -19.835 95.607  43.166  1.00 62.48  ? 276 PHE A CZ    1 
ATOM   1911  N  N     . VAL A  1  251 ? -18.340 88.820  40.710  1.00 63.37  ? 277 VAL A N     1 
ATOM   1912  C  CA    . VAL A  1  251 ? -17.537 87.686  40.249  1.00 63.34  ? 277 VAL A CA    1 
ATOM   1913  C  C     . VAL A  1  251 ? -17.451 87.760  38.723  1.00 63.40  ? 277 VAL A C     1 
ATOM   1914  O  O     . VAL A  1  251 ? -16.370 87.650  38.141  1.00 63.21  ? 277 VAL A O     1 
ATOM   1915  C  CB    . VAL A  1  251 ? -18.175 86.340  40.625  1.00 63.17  ? 277 VAL A CB    1 
ATOM   1916  C  CG1   . VAL A  1  251 ? -17.242 85.205  40.248  1.00 63.22  ? 277 VAL A CG1   1 
ATOM   1917  C  CG2   . VAL A  1  251 ? -18.496 86.299  42.106  1.00 64.83  ? 277 VAL A CG2   1 
ATOM   1918  N  N     . ALA A  1  252 ? -18.603 88.011  38.101  1.00 62.69  ? 278 ALA A N     1 
ATOM   1919  C  CA    . ALA A  1  252 ? -18.714 88.125  36.658  1.00 61.47  ? 278 ALA A CA    1 
ATOM   1920  C  C     . ALA A  1  252 ? -17.863 89.271  36.154  1.00 61.47  ? 278 ALA A C     1 
ATOM   1921  O  O     . ALA A  1  252 ? -17.033 89.086  35.266  1.00 62.81  ? 278 ALA A O     1 
ATOM   1922  C  CB    . ALA A  1  252 ? -20.159 88.332  36.258  1.00 61.74  ? 278 ALA A CB    1 
ATOM   1923  N  N     . LYS A  1  253 ? -18.041 90.449  36.741  1.00 61.06  ? 279 LYS A N     1 
ATOM   1924  C  CA    . LYS A  1  253 ? -17.265 91.608  36.321  1.00 60.76  ? 279 LYS A CA    1 
ATOM   1925  C  C     . LYS A  1  253 ? -15.762 91.397  36.482  1.00 59.17  ? 279 LYS A C     1 
ATOM   1926  O  O     . LYS A  1  253 ? -14.967 91.955  35.716  1.00 58.38  ? 279 LYS A O     1 
ATOM   1927  C  CB    . LYS A  1  253 ? -17.742 92.874  37.037  1.00 62.92  ? 279 LYS A CB    1 
ATOM   1928  C  CG    . LYS A  1  253 ? -18.457 93.810  36.082  1.00 66.87  ? 279 LYS A CG    1 
ATOM   1929  C  CD    . LYS A  1  253 ? -19.202 94.932  36.762  1.00 68.80  ? 279 LYS A CD    1 
ATOM   1930  C  CE    . LYS A  1  253 ? -20.015 95.711  35.732  1.00 70.40  ? 279 LYS A CE    1 
ATOM   1931  N  NZ    . LYS A  1  253 ? -19.148 96.339  34.683  1.00 70.95  ? 279 LYS A NZ    1 
ATOM   1932  N  N     . LEU A  1  254 ? -15.388 90.553  37.445  1.00 57.20  ? 280 LEU A N     1 
ATOM   1933  C  CA    . LEU A  1  254 ? -13.986 90.236  37.696  1.00 56.75  ? 280 LEU A CA    1 
ATOM   1934  C  C     . LEU A  1  254 ? -13.501 89.270  36.612  1.00 56.27  ? 280 LEU A C     1 
ATOM   1935  O  O     . LEU A  1  254 ? -12.414 89.444  36.048  1.00 55.30  ? 280 LEU A O     1 
ATOM   1936  C  CB    . LEU A  1  254 ? -13.812 89.610  39.086  1.00 56.13  ? 280 LEU A CB    1 
ATOM   1937  C  CG    . LEU A  1  254 ? -12.388 89.212  39.492  1.00 56.44  ? 280 LEU A CG    1 
ATOM   1938  C  CD1   . LEU A  1  254 ? -12.086 89.724  40.875  1.00 57.03  ? 280 LEU A CD1   1 
ATOM   1939  C  CD2   . LEU A  1  254 ? -12.210 87.700  39.439  1.00 58.55  ? 280 LEU A CD2   1 
ATOM   1940  N  N     . ALA A  1  255 ? -14.339 88.278  36.310  1.00 55.01  ? 281 ALA A N     1 
ATOM   1941  C  CA    . ALA A  1  255 ? -14.043 87.269  35.292  1.00 53.39  ? 281 ALA A CA    1 
ATOM   1942  C  C     . ALA A  1  255 ? -13.757 87.890  33.925  1.00 52.91  ? 281 ALA A C     1 
ATOM   1943  O  O     . ALA A  1  255 ? -12.928 87.385  33.166  1.00 53.71  ? 281 ALA A O     1 
ATOM   1944  C  CB    . ALA A  1  255 ? -15.185 86.281  35.189  1.00 50.85  ? 281 ALA A CB    1 
ATOM   1945  N  N     . ALA A  1  256 ? -14.429 88.995  33.623  1.00 51.29  ? 282 ALA A N     1 
ATOM   1946  C  CA    . ALA A  1  256 ? -14.222 89.668  32.355  1.00 50.94  ? 282 ALA A CA    1 
ATOM   1947  C  C     . ALA A  1  256 ? -12.896 90.414  32.358  1.00 51.09  ? 282 ALA A C     1 
ATOM   1948  O  O     . ALA A  1  256 ? -12.252 90.555  31.323  1.00 51.27  ? 282 ALA A O     1 
ATOM   1949  C  CB    . ALA A  1  256 ? -15.368 90.624  32.078  1.00 52.30  ? 282 ALA A CB    1 
ATOM   1950  N  N     . GLN A  1  257 ? -12.487 90.883  33.535  1.00 52.46  ? 283 GLN A N     1 
ATOM   1951  C  CA    . GLN A  1  257 ? -11.236 91.633  33.689  1.00 51.74  ? 283 GLN A CA    1 
ATOM   1952  C  C     . GLN A  1  257 ? -10.005 90.748  33.445  1.00 50.13  ? 283 GLN A C     1 
ATOM   1953  O  O     . GLN A  1  257 ? -8.956  91.233  32.973  1.00 48.01  ? 283 GLN A O     1 
ATOM   1954  C  CB    . GLN A  1  257 ? -11.169 92.272  35.086  1.00 52.60  ? 283 GLN A CB    1 
ATOM   1955  C  CG    . GLN A  1  257 ? -10.090 93.344  35.242  1.00 51.95  ? 283 GLN A CG    1 
ATOM   1956  C  CD    . GLN A  1  257 ? -10.358 94.594  34.417  1.00 52.04  ? 283 GLN A CD    1 
ATOM   1957  O  OE1   . GLN A  1  257 ? -9.458  95.129  33.759  1.00 52.20  ? 283 GLN A OE1   1 
ATOM   1958  N  NE2   . GLN A  1  257 ? -11.592 95.078  34.468  1.00 53.06  ? 283 GLN A NE2   1 
ATOM   1959  N  N     . ILE A  1  258 ? -10.146 89.456  33.760  1.00 48.20  ? 284 ILE A N     1 
ATOM   1960  C  CA    . ILE A  1  258 ? -9.075  88.479  33.563  1.00 46.21  ? 284 ILE A CA    1 
ATOM   1961  C  C     . ILE A  1  258 ? -8.606  88.479  32.102  1.00 46.77  ? 284 ILE A C     1 
ATOM   1962  O  O     . ILE A  1  258 ? -7.404  88.449  31.831  1.00 47.76  ? 284 ILE A O     1 
ATOM   1963  C  CB    . ILE A  1  258 ? -9.522  87.056  33.956  1.00 44.74  ? 284 ILE A CB    1 
ATOM   1964  C  CG1   . ILE A  1  258 ? -9.762  86.983  35.461  1.00 44.09  ? 284 ILE A CG1   1 
ATOM   1965  C  CG2   . ILE A  1  258 ? -8.477  86.042  33.534  1.00 46.27  ? 284 ILE A CG2   1 
ATOM   1966  C  CD1   . ILE A  1  258 ? -10.101 85.605  35.980  1.00 43.36  ? 284 ILE A CD1   1 
ATOM   1967  N  N     . PHE A  1  259 ? -9.557  88.514  31.167  1.00 45.74  ? 285 PHE A N     1 
ATOM   1968  C  CA    . PHE A  1  259 ? -9.231  88.540  29.743  1.00 44.79  ? 285 PHE A CA    1 
ATOM   1969  C  C     . PHE A  1  259 ? -9.129  89.986  29.270  1.00 46.42  ? 285 PHE A C     1 
ATOM   1970  O  O     . PHE A  1  259 ? -8.421  90.287  28.310  1.00 47.39  ? 285 PHE A O     1 
ATOM   1971  C  CB    . PHE A  1  259 ? -10.257 87.736  28.958  1.00 40.84  ? 285 PHE A CB    1 
ATOM   1972  C  CG    . PHE A  1  259 ? -10.446 86.342  29.490  1.00 38.75  ? 285 PHE A CG    1 
ATOM   1973  C  CD1   . PHE A  1  259 ? -9.395  85.433  29.474  1.00 36.50  ? 285 PHE A CD1   1 
ATOM   1974  C  CD2   . PHE A  1  259 ? -11.640 85.968  30.093  1.00 37.00  ? 285 PHE A CD2   1 
ATOM   1975  C  CE1   . PHE A  1  259 ? -9.529  84.177  30.059  1.00 36.94  ? 285 PHE A CE1   1 
ATOM   1976  C  CE2   . PHE A  1  259 ? -11.784 84.705  30.683  1.00 36.16  ? 285 PHE A CE2   1 
ATOM   1977  C  CZ    . PHE A  1  259 ? -10.727 83.814  30.667  1.00 36.35  ? 285 PHE A CZ    1 
ATOM   1978  N  N     . GLY A  1  260 ? -9.824  90.873  29.986  1.00 47.84  ? 286 GLY A N     1 
ATOM   1979  C  CA    . GLY A  1  260 ? -9.801  92.303  29.718  1.00 47.44  ? 286 GLY A CA    1 
ATOM   1980  C  C     . GLY A  1  260 ? -9.940  92.796  28.296  1.00 47.76  ? 286 GLY A C     1 
ATOM   1981  O  O     . GLY A  1  260 ? -10.786 92.309  27.551  1.00 50.18  ? 286 GLY A O     1 
ATOM   1982  N  N     . SER A  1  261 ? -9.178  93.832  27.955  1.00 46.32  ? 287 SER A N     1 
ATOM   1983  C  CA    . SER A  1  261 ? -9.224  94.396  26.613  1.00 47.53  ? 287 SER A CA    1 
ATOM   1984  C  C     . SER A  1  261 ? -7.823  94.529  26.035  1.00 46.94  ? 287 SER A C     1 
ATOM   1985  O  O     . SER A  1  261 ? -6.838  94.612  26.774  1.00 47.11  ? 287 SER A O     1 
ATOM   1986  C  CB    . SER A  1  261 ? -9.974  95.737  26.584  1.00 50.56  ? 287 SER A CB    1 
ATOM   1987  O  OG    . SER A  1  261 ? -9.260  96.788  27.210  1.00 55.38  ? 287 SER A OG    1 
ATOM   1988  N  N     . TYR A  1  262 ? -7.741  94.568  24.709  1.00 46.31  ? 288 TYR A N     1 
ATOM   1989  C  CA    . TYR A  1  262 ? -6.455  94.625  24.033  1.00 46.58  ? 288 TYR A CA    1 
ATOM   1990  C  C     . TYR A  1  262 ? -6.501  95.439  22.752  1.00 45.93  ? 288 TYR A C     1 
ATOM   1991  O  O     . TYR A  1  262 ? -7.520  95.501  22.090  1.00 47.60  ? 288 TYR A O     1 
ATOM   1992  C  CB    . TYR A  1  262 ? -5.993  93.177  23.765  1.00 46.06  ? 288 TYR A CB    1 
ATOM   1993  C  CG    . TYR A  1  262 ? -4.935  92.976  22.702  1.00 47.12  ? 288 TYR A CG    1 
ATOM   1994  C  CD1   . TYR A  1  262 ? -5.289  92.603  21.406  1.00 48.35  ? 288 TYR A CD1   1 
ATOM   1995  C  CD2   . TYR A  1  262 ? -3.582  93.113  22.996  1.00 47.91  ? 288 TYR A CD2   1 
ATOM   1996  C  CE1   . TYR A  1  262 ? -4.327  92.371  20.430  1.00 46.52  ? 288 TYR A CE1   1 
ATOM   1997  C  CE2   . TYR A  1  262 ? -2.610  92.880  22.029  1.00 47.82  ? 288 TYR A CE2   1 
ATOM   1998  C  CZ    . TYR A  1  262 ? -2.993  92.509  20.749  1.00 48.54  ? 288 TYR A CZ    1 
ATOM   1999  O  OH    . TYR A  1  262 ? -2.037  92.274  19.790  1.00 50.21  ? 288 TYR A OH    1 
ATOM   2000  N  N     . ASN A  1  263 ? -5.376  96.060  22.423  1.00 47.25  ? 289 ASN A N     1 
ATOM   2001  C  CA    . ASN A  1  263 ? -5.224  96.875  21.225  1.00 49.01  ? 289 ASN A CA    1 
ATOM   2002  C  C     . ASN A  1  263 ? -3.819  96.564  20.685  1.00 50.87  ? 289 ASN A C     1 
ATOM   2003  O  O     . ASN A  1  263 ? -2.819  97.084  21.177  1.00 51.77  ? 289 ASN A O     1 
ATOM   2004  C  CB    . ASN A  1  263 ? -5.365  98.356  21.589  1.00 47.96  ? 289 ASN A CB    1 
ATOM   2005  C  CG    . ASN A  1  263 ? -5.130  99.300  20.411  1.00 49.73  ? 289 ASN A CG    1 
ATOM   2006  O  OD1   . ASN A  1  263 ? -5.553  100.447 20.465  1.00 53.61  ? 289 ASN A OD1   1 
ATOM   2007  N  ND2   . ASN A  1  263 ? -4.434  98.843  19.373  1.00 47.95  ? 289 ASN A ND2   1 
ATOM   2008  N  N     . ALA A  1  264 ? -3.772  95.740  19.644  1.00 51.81  ? 290 ALA A N     1 
ATOM   2009  C  CA    . ALA A  1  264 ? -2.531  95.305  19.015  1.00 52.26  ? 290 ALA A CA    1 
ATOM   2010  C  C     . ALA A  1  264 ? -1.554  96.387  18.589  1.00 53.53  ? 290 ALA A C     1 
ATOM   2011  O  O     . ALA A  1  264 ? -0.402  96.086  18.291  1.00 55.32  ? 290 ALA A O     1 
ATOM   2012  C  CB    . ALA A  1  264 ? -2.850  94.418  17.829  1.00 51.14  ? 290 ALA A CB    1 
ATOM   2013  N  N     . PHE A  1  265 ? -1.999  97.635  18.527  1.00 54.93  ? 291 PHE A N     1 
ATOM   2014  C  CA    . PHE A  1  265 ? -1.105  98.717  18.104  1.00 56.82  ? 291 PHE A CA    1 
ATOM   2015  C  C     . PHE A  1  265 ? -0.412  99.464  19.250  1.00 57.36  ? 291 PHE A C     1 
ATOM   2016  O  O     . PHE A  1  265 ? 0.639   100.084 19.051  1.00 56.82  ? 291 PHE A O     1 
ATOM   2017  C  CB    . PHE A  1  265 ? -1.845  99.678  17.175  1.00 56.24  ? 291 PHE A CB    1 
ATOM   2018  C  CG    . PHE A  1  265 ? -2.351  99.023  15.924  1.00 57.03  ? 291 PHE A CG    1 
ATOM   2019  C  CD1   . PHE A  1  265 ? -3.657  98.552  15.848  1.00 57.58  ? 291 PHE A CD1   1 
ATOM   2020  C  CD2   . PHE A  1  265 ? -1.511  98.844  14.830  1.00 57.26  ? 291 PHE A CD2   1 
ATOM   2021  C  CE1   . PHE A  1  265 ? -4.121  97.908  14.698  1.00 57.51  ? 291 PHE A CE1   1 
ATOM   2022  C  CE2   . PHE A  1  265 ? -1.965  98.202  13.677  1.00 56.82  ? 291 PHE A CE2   1 
ATOM   2023  C  CZ    . PHE A  1  265 ? -3.274  97.734  13.613  1.00 56.95  ? 291 PHE A CZ    1 
ATOM   2024  N  N     . GLU A  1  266 ? -1.004  99.397  20.441  1.00 56.92  ? 292 GLU A N     1 
ATOM   2025  C  CA    . GLU A  1  266 ? -0.441  100.038 21.622  1.00 57.31  ? 292 GLU A CA    1 
ATOM   2026  C  C     . GLU A  1  266 ? 0.551   99.094  22.312  1.00 55.49  ? 292 GLU A C     1 
ATOM   2027  O  O     . GLU A  1  266 ? 0.150   98.131  22.967  1.00 55.17  ? 292 GLU A O     1 
ATOM   2028  C  CB    . GLU A  1  266 ? -1.560  100.439 22.591  1.00 58.83  ? 292 GLU A CB    1 
ATOM   2029  C  CG    . GLU A  1  266 ? -2.380  101.651 22.147  1.00 61.82  ? 292 GLU A CG    1 
ATOM   2030  C  CD    . GLU A  1  266 ? -1.576  102.951 22.129  1.00 63.98  ? 292 GLU A CD    1 
ATOM   2031  O  OE1   . GLU A  1  266 ? -1.907  103.852 21.332  1.00 63.59  ? 292 GLU A OE1   1 
ATOM   2032  O  OE2   . GLU A  1  266 ? -0.615  103.080 22.919  1.00 67.26  ? 292 GLU A OE2   1 
ATOM   2033  N  N     . PRO A  1  267 ? 1.860   99.393  22.213  1.00 54.35  ? 293 PRO A N     1 
ATOM   2034  C  CA    . PRO A  1  267 ? 2.948   98.600  22.806  1.00 54.05  ? 293 PRO A CA    1 
ATOM   2035  C  C     . PRO A  1  267 ? 2.701   98.016  24.203  1.00 53.93  ? 293 PRO A C     1 
ATOM   2036  O  O     . PRO A  1  267 ? 2.980   96.837  24.456  1.00 53.56  ? 293 PRO A O     1 
ATOM   2037  C  CB    . PRO A  1  267 ? 4.109   99.584  22.804  1.00 52.11  ? 293 PRO A CB    1 
ATOM   2038  C  CG    . PRO A  1  267 ? 3.892   100.312 21.511  1.00 52.90  ? 293 PRO A CG    1 
ATOM   2039  C  CD    . PRO A  1  267 ? 2.400   100.597 21.552  1.00 53.67  ? 293 PRO A CD    1 
ATOM   2040  N  N     . ALA A  1  268 ? 2.153   98.828  25.097  1.00 53.24  ? 294 ALA A N     1 
ATOM   2041  C  CA    . ALA A  1  268 ? 1.895   98.382  26.461  1.00 52.28  ? 294 ALA A CA    1 
ATOM   2042  C  C     . ALA A  1  268 ? 0.821   97.321  26.531  1.00 51.17  ? 294 ALA A C     1 
ATOM   2043  O  O     . ALA A  1  268 ? 0.859   96.461  27.405  1.00 51.94  ? 294 ALA A O     1 
ATOM   2044  C  CB    . ALA A  1  268 ? 1.512   99.570  27.349  1.00 52.58  ? 294 ALA A CB    1 
ATOM   2045  N  N     . SER A  1  269 ? -0.147  97.398  25.620  1.00 50.56  ? 295 SER A N     1 
ATOM   2046  C  CA    . SER A  1  269 ? -1.265  96.455  25.583  1.00 49.26  ? 295 SER A CA    1 
ATOM   2047  C  C     . SER A  1  269 ? -0.756  95.048  25.295  1.00 48.37  ? 295 SER A C     1 
ATOM   2048  O  O     . SER A  1  269 ? -1.239  94.071  25.867  1.00 46.48  ? 295 SER A O     1 
ATOM   2049  C  CB    . SER A  1  269 ? -2.275  96.879  24.511  1.00 49.89  ? 295 SER A CB    1 
ATOM   2050  O  OG    . SER A  1  269 ? -3.550  96.300  24.737  1.00 51.48  ? 295 SER A OG    1 
ATOM   2051  N  N     . ARG A  1  270 ? 0.259   94.966  24.441  1.00 48.51  ? 296 ARG A N     1 
ATOM   2052  C  CA    . ARG A  1  270 ? 0.850   93.690  24.064  1.00 49.67  ? 296 ARG A CA    1 
ATOM   2053  C  C     . ARG A  1  270 ? 1.581   93.009  25.224  1.00 49.74  ? 296 ARG A C     1 
ATOM   2054  O  O     . ARG A  1  270 ? 1.773   91.788  25.213  1.00 49.62  ? 296 ARG A O     1 
ATOM   2055  C  CB    . ARG A  1  270 ? 1.818   93.875  22.885  1.00 51.09  ? 296 ARG A CB    1 
ATOM   2056  C  CG    . ARG A  1  270 ? 1.194   94.537  21.656  1.00 56.16  ? 296 ARG A CG    1 
ATOM   2057  C  CD    . ARG A  1  270 ? 1.949   94.202  20.368  1.00 62.29  ? 296 ARG A CD    1 
ATOM   2058  N  NE    . ARG A  1  270 ? 3.282   94.793  20.337  1.00 70.31  ? 296 ARG A NE    1 
ATOM   2059  C  CZ    . ARG A  1  270 ? 3.630   95.836  19.580  1.00 75.23  ? 296 ARG A CZ    1 
ATOM   2060  N  NH1   . ARG A  1  270 ? 4.876   96.312  19.619  1.00 76.70  ? 296 ARG A NH1   1 
ATOM   2061  N  NH2   . ARG A  1  270 ? 2.735   96.410  18.783  1.00 77.90  ? 296 ARG A NH2   1 
ATOM   2062  N  N     . LEU A  1  271 ? 1.947   93.790  26.242  1.00 48.70  ? 297 LEU A N     1 
ATOM   2063  C  CA    . LEU A  1  271 ? 2.692   93.269  27.389  1.00 45.70  ? 297 LEU A CA    1 
ATOM   2064  C  C     . LEU A  1  271 ? 1.869   92.797  28.580  1.00 44.80  ? 297 LEU A C     1 
ATOM   2065  O  O     . LEU A  1  271 ? 2.408   92.199  29.508  1.00 45.61  ? 297 LEU A O     1 
ATOM   2066  C  CB    . LEU A  1  271 ? 3.715   94.305  27.840  1.00 44.60  ? 297 LEU A CB    1 
ATOM   2067  C  CG    . LEU A  1  271 ? 4.687   94.700  26.728  1.00 46.01  ? 297 LEU A CG    1 
ATOM   2068  C  CD1   . LEU A  1  271 ? 5.521   95.926  27.119  1.00 44.91  ? 297 LEU A CD1   1 
ATOM   2069  C  CD2   . LEU A  1  271 ? 5.568   93.515  26.399  1.00 44.94  ? 297 LEU A CD2   1 
ATOM   2070  N  N     . GLN A  1  272 ? 0.564   93.025  28.536  1.00 43.19  ? 298 GLN A N     1 
ATOM   2071  C  CA    . GLN A  1  272 ? -0.322  92.639  29.630  1.00 43.90  ? 298 GLN A CA    1 
ATOM   2072  C  C     . GLN A  1  272 ? -0.241  91.187  30.063  1.00 45.37  ? 298 GLN A C     1 
ATOM   2073  O  O     . GLN A  1  272 ? 0.060   90.306  29.260  1.00 49.02  ? 298 GLN A O     1 
ATOM   2074  C  CB    . GLN A  1  272 ? -1.766  92.949  29.275  1.00 45.00  ? 298 GLN A CB    1 
ATOM   2075  C  CG    . GLN A  1  272 ? -2.051  94.388  28.954  1.00 43.07  ? 298 GLN A CG    1 
ATOM   2076  C  CD    . GLN A  1  272 ? -3.484  94.559  28.553  1.00 45.04  ? 298 GLN A CD    1 
ATOM   2077  O  OE1   . GLN A  1  272 ? -4.392  94.403  29.377  1.00 44.94  ? 298 GLN A OE1   1 
ATOM   2078  N  NE2   . GLN A  1  272 ? -3.711  94.822  27.268  1.00 44.98  ? 298 GLN A NE2   1 
ATOM   2079  N  N     . GLY A  1  273 ? -0.623  90.940  31.314  1.00 46.01  ? 299 GLY A N     1 
ATOM   2080  C  CA    . GLY A  1  273 ? -0.586  89.602  31.876  1.00 45.32  ? 299 GLY A CA    1 
ATOM   2081  C  C     . GLY A  1  273 ? -1.816  88.773  31.591  1.00 45.68  ? 299 GLY A C     1 
ATOM   2082  O  O     . GLY A  1  273 ? -2.495  88.315  32.514  1.00 46.38  ? 299 GLY A O     1 
ATOM   2083  N  N     . ILE A  1  274 ? -2.105  88.590  30.307  1.00 45.85  ? 300 ILE A N     1 
ATOM   2084  C  CA    . ILE A  1  274 ? -3.256  87.800  29.857  1.00 45.46  ? 300 ILE A CA    1 
ATOM   2085  C  C     . ILE A  1  274 ? -2.683  86.654  29.037  1.00 44.51  ? 300 ILE A C     1 
ATOM   2086  O  O     . ILE A  1  274 ? -1.988  86.884  28.044  1.00 45.64  ? 300 ILE A O     1 
ATOM   2087  C  CB    . ILE A  1  274 ? -4.199  88.643  28.951  1.00 46.34  ? 300 ILE A CB    1 
ATOM   2088  C  CG1   . ILE A  1  274 ? -4.571  89.957  29.657  1.00 46.65  ? 300 ILE A CG1   1 
ATOM   2089  C  CG2   . ILE A  1  274 ? -5.475  87.851  28.631  1.00 46.34  ? 300 ILE A CG2   1 
ATOM   2090  C  CD1   . ILE A  1  274 ? -5.135  91.016  28.736  1.00 43.62  ? 300 ILE A CD1   1 
ATOM   2091  N  N     . LYS A  1  275 ? -2.959  85.424  29.451  1.00 43.74  ? 301 LYS A N     1 
ATOM   2092  C  CA    . LYS A  1  275 ? -2.434  84.255  28.742  1.00 44.90  ? 301 LYS A CA    1 
ATOM   2093  C  C     . LYS A  1  275 ? -2.844  84.204  27.264  1.00 46.30  ? 301 LYS A C     1 
ATOM   2094  O  O     . LYS A  1  275 ? -2.036  83.850  26.394  1.00 46.42  ? 301 LYS A O     1 
ATOM   2095  C  CB    . LYS A  1  275 ? -2.833  82.967  29.466  1.00 42.88  ? 301 LYS A CB    1 
ATOM   2096  C  CG    . LYS A  1  275 ? -2.184  82.840  30.821  1.00 44.60  ? 301 LYS A CG    1 
ATOM   2097  C  CD    . LYS A  1  275 ? -2.484  81.513  31.493  1.00 49.25  ? 301 LYS A CD    1 
ATOM   2098  C  CE    . LYS A  1  275 ? -1.787  81.424  32.860  1.00 51.87  ? 301 LYS A CE    1 
ATOM   2099  N  NZ    . LYS A  1  275 ? -0.307  81.710  32.779  1.00 53.53  ? 301 LYS A NZ    1 
ATOM   2100  N  N     . LEU A  1  276 ? -4.079  84.618  26.984  1.00 44.56  ? 302 LEU A N     1 
ATOM   2101  C  CA    . LEU A  1  276 ? -4.603  84.636  25.629  1.00 43.07  ? 302 LEU A CA    1 
ATOM   2102  C  C     . LEU A  1  276 ? -3.680  85.350  24.633  1.00 44.05  ? 302 LEU A C     1 
ATOM   2103  O  O     . LEU A  1  276 ? -3.607  84.959  23.457  1.00 45.73  ? 302 LEU A O     1 
ATOM   2104  C  CB    . LEU A  1  276 ? -5.988  85.289  25.620  1.00 41.07  ? 302 LEU A CB    1 
ATOM   2105  C  CG    . LEU A  1  276 ? -6.741  85.461  24.296  1.00 39.33  ? 302 LEU A CG    1 
ATOM   2106  C  CD1   . LEU A  1  276 ? -6.961  84.123  23.628  1.00 38.64  ? 302 LEU A CD1   1 
ATOM   2107  C  CD2   . LEU A  1  276 ? -8.066  86.151  24.551  1.00 37.55  ? 302 LEU A CD2   1 
ATOM   2108  N  N     . LEU A  1  277 ? -2.937  86.348  25.105  1.00 41.99  ? 303 LEU A N     1 
ATOM   2109  C  CA    . LEU A  1  277 ? -2.060  87.102  24.215  1.00 42.71  ? 303 LEU A CA    1 
ATOM   2110  C  C     . LEU A  1  277 ? -0.917  86.296  23.627  1.00 43.14  ? 303 LEU A C     1 
ATOM   2111  O  O     . LEU A  1  277 ? -0.360  86.669  22.596  1.00 41.14  ? 303 LEU A O     1 
ATOM   2112  C  CB    . LEU A  1  277 ? -1.533  88.368  24.891  1.00 42.85  ? 303 LEU A CB    1 
ATOM   2113  C  CG    . LEU A  1  277 ? -2.558  89.438  25.274  1.00 45.73  ? 303 LEU A CG    1 
ATOM   2114  C  CD1   . LEU A  1  277 ? -1.826  90.726  25.638  1.00 47.42  ? 303 LEU A CD1   1 
ATOM   2115  C  CD2   . LEU A  1  277 ? -3.509  89.703  24.127  1.00 45.17  ? 303 LEU A CD2   1 
ATOM   2116  N  N     . ASP A  1  278 ? -0.553  85.204  24.289  1.00 45.44  ? 304 ASP A N     1 
ATOM   2117  C  CA    . ASP A  1  278 ? 0.525   84.351  23.792  1.00 47.96  ? 304 ASP A CA    1 
ATOM   2118  C  C     . ASP A  1  278 ? 0.053   83.663  22.503  1.00 49.25  ? 304 ASP A C     1 
ATOM   2119  O  O     . ASP A  1  278 ? 0.813   83.550  21.538  1.00 49.67  ? 304 ASP A O     1 
ATOM   2120  C  CB    . ASP A  1  278 ? 0.925   83.299  24.844  1.00 49.84  ? 304 ASP A CB    1 
ATOM   2121  C  CG    . ASP A  1  278 ? 1.671   83.901  26.042  1.00 51.66  ? 304 ASP A CG    1 
ATOM   2122  O  OD1   . ASP A  1  278 ? 1.474   83.414  27.184  1.00 52.83  ? 304 ASP A OD1   1 
ATOM   2123  O  OD2   . ASP A  1  278 ? 2.463   84.846  25.842  1.00 50.93  ? 304 ASP A OD2   1 
ATOM   2124  N  N     . ASN A  1  279 ? -1.230  83.294  22.478  1.00 48.47  ? 305 ASN A N     1 
ATOM   2125  C  CA    . ASN A  1  279 ? -1.846  82.618  21.345  1.00 48.46  ? 305 ASN A CA    1 
ATOM   2126  C  C     . ASN A  1  279 ? -2.220  83.508  20.161  1.00 49.28  ? 305 ASN A C     1 
ATOM   2127  O  O     . ASN A  1  279 ? -2.054  83.107  18.999  1.00 49.50  ? 305 ASN A O     1 
ATOM   2128  C  CB    . ASN A  1  279 ? -3.125  81.895  21.782  1.00 47.95  ? 305 ASN A CB    1 
ATOM   2129  C  CG    . ASN A  1  279 ? -2.881  80.829  22.824  1.00 49.23  ? 305 ASN A CG    1 
ATOM   2130  O  OD1   . ASN A  1  279 ? -3.669  80.684  23.764  1.00 47.15  ? 305 ASN A OD1   1 
ATOM   2131  N  ND2   . ASN A  1  279 ? -1.818  80.046  22.646  1.00 49.17  ? 305 ASN A ND2   1 
ATOM   2132  N  N     . ILE A  1  280 ? -2.780  84.684  20.440  1.00 48.36  ? 306 ILE A N     1 
ATOM   2133  C  CA    . ILE A  1  280 ? -3.228  85.552  19.361  1.00 47.63  ? 306 ILE A CA    1 
ATOM   2134  C  C     . ILE A  1  280 ? -2.162  86.396  18.684  1.00 48.04  ? 306 ILE A C     1 
ATOM   2135  O  O     . ILE A  1  280 ? -2.312  86.758  17.526  1.00 49.10  ? 306 ILE A O     1 
ATOM   2136  C  CB    . ILE A  1  280 ? -4.475  86.428  19.776  1.00 48.69  ? 306 ILE A CB    1 
ATOM   2137  C  CG1   . ILE A  1  280 ? -4.065  87.704  20.500  1.00 50.02  ? 306 ILE A CG1   1 
ATOM   2138  C  CG2   . ILE A  1  280 ? -5.432  85.642  20.642  1.00 48.32  ? 306 ILE A CG2   1 
ATOM   2139  C  CD1   . ILE A  1  280 ? -3.853  88.882  19.552  1.00 52.50  ? 306 ILE A CD1   1 
ATOM   2140  N  N     . GLN A  1  281 ? -1.053  86.649  19.367  1.00 51.10  ? 307 GLN A N     1 
ATOM   2141  C  CA    . GLN A  1  281 ? 0.000   87.492  18.798  1.00 52.67  ? 307 GLN A CA    1 
ATOM   2142  C  C     . GLN A  1  281 ? 0.954   86.874  17.788  1.00 53.32  ? 307 GLN A C     1 
ATOM   2143  O  O     . GLN A  1  281 ? 1.581   87.595  17.008  1.00 53.55  ? 307 GLN A O     1 
ATOM   2144  C  CB    . GLN A  1  281 ? 0.779   88.185  19.907  1.00 52.80  ? 307 GLN A CB    1 
ATOM   2145  C  CG    . GLN A  1  281 ? -0.102  89.113  20.719  1.00 56.91  ? 307 GLN A CG    1 
ATOM   2146  C  CD    . GLN A  1  281 ? 0.687   90.098  21.544  1.00 57.51  ? 307 GLN A CD    1 
ATOM   2147  O  OE1   . GLN A  1  281 ? 0.915   91.229  21.117  1.00 59.89  ? 307 GLN A OE1   1 
ATOM   2148  N  NE2   . GLN A  1  281 ? 1.104   89.679  22.731  1.00 56.26  ? 307 GLN A NE2   1 
ATOM   2149  N  N     . GLU A  1  282 ? 1.046   85.548  17.779  1.00 54.09  ? 308 GLU A N     1 
ATOM   2150  C  CA    . GLU A  1  282 ? 1.928   84.844  16.847  1.00 54.19  ? 308 GLU A CA    1 
ATOM   2151  C  C     . GLU A  1  282 ? 1.604   85.187  15.393  1.00 53.01  ? 308 GLU A C     1 
ATOM   2152  O  O     . GLU A  1  282 ? 2.470   85.641  14.657  1.00 52.20  ? 308 GLU A O     1 
ATOM   2153  C  CB    . GLU A  1  282 ? 1.815   83.336  17.074  1.00 56.87  ? 308 GLU A CB    1 
ATOM   2154  C  CG    . GLU A  1  282 ? 2.914   82.499  16.425  1.00 61.72  ? 308 GLU A CG    1 
ATOM   2155  C  CD    . GLU A  1  282 ? 2.901   81.039  16.888  1.00 65.67  ? 308 GLU A CD    1 
ATOM   2156  O  OE1   . GLU A  1  282 ? 1.945   80.624  17.601  1.00 63.45  ? 308 GLU A OE1   1 
ATOM   2157  O  OE2   . GLU A  1  282 ? 3.859   80.309  16.534  1.00 66.26  ? 308 GLU A OE2   1 
ATOM   2158  N  N     . TYR A  1  283 ? 0.343   85.016  15.007  1.00 52.67  ? 309 TYR A N     1 
ATOM   2159  C  CA    . TYR A  1  283 ? -0.105  85.296  13.641  1.00 52.94  ? 309 TYR A CA    1 
ATOM   2160  C  C     . TYR A  1  283 ? -0.956  86.560  13.552  1.00 53.10  ? 309 TYR A C     1 
ATOM   2161  O  O     . TYR A  1  283 ? -1.556  86.839  12.516  1.00 53.33  ? 309 TYR A O     1 
ATOM   2162  C  CB    . TYR A  1  283 ? -0.890  84.099  13.080  1.00 52.71  ? 309 TYR A CB    1 
ATOM   2163  C  CG    . TYR A  1  283 ? -0.030  82.888  12.801  1.00 52.95  ? 309 TYR A CG    1 
ATOM   2164  C  CD1   . TYR A  1  283 ? 0.214   81.936  13.793  1.00 54.17  ? 309 TYR A CD1   1 
ATOM   2165  C  CD2   . TYR A  1  283 ? 0.581   82.720  11.562  1.00 53.02  ? 309 TYR A CD2   1 
ATOM   2166  C  CE1   . TYR A  1  283 ? 1.053   80.853  13.560  1.00 53.90  ? 309 TYR A CE1   1 
ATOM   2167  C  CE2   . TYR A  1  283 ? 1.419   81.640  11.315  1.00 54.48  ? 309 TYR A CE2   1 
ATOM   2168  C  CZ    . TYR A  1  283 ? 1.655   80.709  12.318  1.00 55.14  ? 309 TYR A CZ    1 
ATOM   2169  O  OH    . TYR A  1  283 ? 2.499   79.643  12.078  1.00 54.50  ? 309 TYR A OH    1 
ATOM   2170  N  N     . GLN A  1  284 ? -0.979  87.328  14.637  1.00 52.65  ? 310 GLN A N     1 
ATOM   2171  C  CA    . GLN A  1  284 ? -1.747  88.560  14.716  1.00 50.75  ? 310 GLN A CA    1 
ATOM   2172  C  C     . GLN A  1  284 ? -3.196  88.304  14.304  1.00 49.47  ? 310 GLN A C     1 
ATOM   2173  O  O     . GLN A  1  284 ? -3.650  88.717  13.240  1.00 49.04  ? 310 GLN A O     1 
ATOM   2174  C  CB    . GLN A  1  284 ? -1.098  89.673  13.884  1.00 51.75  ? 310 GLN A CB    1 
ATOM   2175  C  CG    . GLN A  1  284 ? -1.580  91.090  14.291  1.00 57.83  ? 310 GLN A CG    1 
ATOM   2176  C  CD    . GLN A  1  284 ? -1.386  91.401  15.796  1.00 58.18  ? 310 GLN A CD    1 
ATOM   2177  O  OE1   . GLN A  1  284 ? -0.352  91.945  16.203  1.00 58.02  ? 310 GLN A OE1   1 
ATOM   2178  N  NE2   . GLN A  1  284 ? -2.384  91.050  16.615  1.00 55.79  ? 310 GLN A NE2   1 
ATOM   2179  N  N     . LEU A  1  285 ? -3.910  87.622  15.192  1.00 48.12  ? 311 LEU A N     1 
ATOM   2180  C  CA    . LEU A  1  285 ? -5.298  87.232  14.991  1.00 46.47  ? 311 LEU A CA    1 
ATOM   2181  C  C     . LEU A  1  285 ? -6.362  88.322  15.037  1.00 47.00  ? 311 LEU A C     1 
ATOM   2182  O  O     . LEU A  1  285 ? -7.498  88.087  14.625  1.00 48.47  ? 311 LEU A O     1 
ATOM   2183  C  CB    . LEU A  1  285 ? -5.654  86.108  15.975  1.00 43.69  ? 311 LEU A CB    1 
ATOM   2184  C  CG    . LEU A  1  285 ? -5.327  84.665  15.558  1.00 39.51  ? 311 LEU A CG    1 
ATOM   2185  C  CD1   . LEU A  1  285 ? -4.058  84.585  14.746  1.00 39.93  ? 311 LEU A CD1   1 
ATOM   2186  C  CD2   . LEU A  1  285 ? -5.239  83.777  16.766  1.00 36.82  ? 311 LEU A CD2   1 
ATOM   2187  N  N     . CYS A  1  286 ? -6.016  89.505  15.533  1.00 48.21  ? 312 CYS A N     1 
ATOM   2188  C  CA    . CYS A  1  286 ? -6.993  90.598  15.615  1.00 48.39  ? 312 CYS A CA    1 
ATOM   2189  C  C     . CYS A  1  286 ? -6.374  91.943  15.966  1.00 47.55  ? 312 CYS A C     1 
ATOM   2190  O  O     . CYS A  1  286 ? -5.324  92.008  16.590  1.00 48.81  ? 312 CYS A O     1 
ATOM   2191  C  CB    . CYS A  1  286 ? -8.059  90.278  16.655  1.00 48.39  ? 312 CYS A CB    1 
ATOM   2192  S  SG    . CYS A  1  286 ? -7.458  90.432  18.339  1.00 56.09  ? 312 CYS A SG    1 
ATOM   2193  N  N     . ASP A  1  287 ? -7.034  93.017  15.551  1.00 47.54  ? 313 ASP A N     1 
ATOM   2194  C  CA    . ASP A  1  287 ? -6.567  94.360  15.839  1.00 47.21  ? 313 ASP A CA    1 
ATOM   2195  C  C     . ASP A  1  287 ? -6.905  94.752  17.270  1.00 47.48  ? 313 ASP A C     1 
ATOM   2196  O  O     . ASP A  1  287 ? -6.184  95.538  17.888  1.00 47.25  ? 313 ASP A O     1 
ATOM   2197  C  CB    . ASP A  1  287 ? -7.178  95.356  14.862  1.00 47.91  ? 313 ASP A CB    1 
ATOM   2198  C  CG    . ASP A  1  287 ? -6.541  95.284  13.501  1.00 50.03  ? 313 ASP A CG    1 
ATOM   2199  O  OD1   . ASP A  1  287 ? -7.049  95.935  12.561  1.00 49.66  ? 313 ASP A OD1   1 
ATOM   2200  O  OD2   . ASP A  1  287 ? -5.518  94.579  13.372  1.00 52.56  ? 313 ASP A OD2   1 
ATOM   2201  N  N     . ASN A  1  288 ? -7.996  94.197  17.795  1.00 46.20  ? 314 ASN A N     1 
ATOM   2202  C  CA    . ASN A  1  288 ? -8.411  94.483  19.156  1.00 47.48  ? 314 ASN A CA    1 
ATOM   2203  C  C     . ASN A  1  288 ? -9.557  93.608  19.627  1.00 49.20  ? 314 ASN A C     1 
ATOM   2204  O  O     . ASN A  1  288 ? -10.211 92.933  18.835  1.00 51.36  ? 314 ASN A O     1 
ATOM   2205  C  CB    . ASN A  1  288 ? -8.808  95.957  19.301  1.00 47.28  ? 314 ASN A CB    1 
ATOM   2206  C  CG    . ASN A  1  288 ? -9.951  96.353  18.386  1.00 47.89  ? 314 ASN A CG    1 
ATOM   2207  O  OD1   . ASN A  1  288 ? -9.736  96.998  17.359  1.00 50.06  ? 314 ASN A OD1   1 
ATOM   2208  N  ND2   . ASN A  1  288 ? -11.176 95.991  18.767  1.00 45.70  ? 314 ASN A ND2   1 
ATOM   2209  N  N     . PHE A  1  289 ? -9.769  93.614  20.937  1.00 49.87  ? 315 PHE A N     1 
ATOM   2210  C  CA    . PHE A  1  289 ? -10.855 92.882  21.567  1.00 49.38  ? 315 PHE A CA    1 
ATOM   2211  C  C     . PHE A  1  289 ? -11.118 93.501  22.941  1.00 49.46  ? 315 PHE A C     1 
ATOM   2212  O  O     . PHE A  1  289 ? -10.308 94.289  23.441  1.00 48.27  ? 315 PHE A O     1 
ATOM   2213  C  CB    . PHE A  1  289 ? -10.562 91.367  21.658  1.00 49.99  ? 315 PHE A CB    1 
ATOM   2214  C  CG    . PHE A  1  289 ? -9.489  90.976  22.657  1.00 51.85  ? 315 PHE A CG    1 
ATOM   2215  C  CD1   . PHE A  1  289 ? -9.777  90.880  24.022  1.00 51.70  ? 315 PHE A CD1   1 
ATOM   2216  C  CD2   . PHE A  1  289 ? -8.208  90.649  22.227  1.00 52.47  ? 315 PHE A CD2   1 
ATOM   2217  C  CE1   . PHE A  1  289 ? -8.810  90.460  24.942  1.00 51.19  ? 315 PHE A CE1   1 
ATOM   2218  C  CE2   . PHE A  1  289 ? -7.231  90.225  23.138  1.00 53.64  ? 315 PHE A CE2   1 
ATOM   2219  C  CZ    . PHE A  1  289 ? -7.534  90.133  24.498  1.00 52.91  ? 315 PHE A CZ    1 
ATOM   2220  N  N     . ASN A  1  290 ? -12.274 93.190  23.518  1.00 49.55  ? 316 ASN A N     1 
ATOM   2221  C  CA    . ASN A  1  290 ? -12.632 93.693  24.837  1.00 50.76  ? 316 ASN A CA    1 
ATOM   2222  C  C     . ASN A  1  290 ? -13.766 92.892  25.439  1.00 49.27  ? 316 ASN A C     1 
ATOM   2223  O  O     . ASN A  1  290 ? -14.802 92.714  24.819  1.00 49.84  ? 316 ASN A O     1 
ATOM   2224  C  CB    . ASN A  1  290 ? -13.005 95.179  24.790  1.00 53.46  ? 316 ASN A CB    1 
ATOM   2225  C  CG    . ASN A  1  290 ? -14.081 95.474  23.779  1.00 57.73  ? 316 ASN A CG    1 
ATOM   2226  O  OD1   . ASN A  1  290 ? -13.815 95.507  22.576  1.00 62.55  ? 316 ASN A OD1   1 
ATOM   2227  N  ND2   . ASN A  1  290 ? -15.310 95.672  24.251  1.00 58.18  ? 316 ASN A ND2   1 
ATOM   2228  N  N     . HIS A  1  291 ? -13.543 92.376  26.638  1.00 49.39  ? 317 HIS A N     1 
ATOM   2229  C  CA    . HIS A  1  291 ? -14.563 91.609  27.338  1.00 50.72  ? 317 HIS A CA    1 
ATOM   2230  C  C     . HIS A  1  291 ? -15.497 92.542  28.125  1.00 52.31  ? 317 HIS A C     1 
ATOM   2231  O  O     . HIS A  1  291 ? -15.194 93.721  28.342  1.00 53.39  ? 317 HIS A O     1 
ATOM   2232  C  CB    . HIS A  1  291 ? -13.901 90.576  28.254  1.00 48.93  ? 317 HIS A CB    1 
ATOM   2233  C  CG    . HIS A  1  291 ? -13.111 89.543  27.513  1.00 48.76  ? 317 HIS A CG    1 
ATOM   2234  N  ND1   . HIS A  1  291 ? -13.408 88.197  27.566  1.00 49.88  ? 317 HIS A ND1   1 
ATOM   2235  C  CD2   . HIS A  1  291 ? -12.074 89.667  26.652  1.00 46.21  ? 317 HIS A CD2   1 
ATOM   2236  C  CE1   . HIS A  1  291 ? -12.593 87.538  26.762  1.00 49.12  ? 317 HIS A CE1   1 
ATOM   2237  N  NE2   . HIS A  1  291 ? -11.774 88.407  26.197  1.00 48.58  ? 317 HIS A NE2   1 
ATOM   2238  N  N     . PHE A  1  292 ? -16.631 92.011  28.559  1.00 52.23  ? 318 PHE A N     1 
ATOM   2239  C  CA    . PHE A  1  292 ? -17.587 92.819  29.287  1.00 51.97  ? 318 PHE A CA    1 
ATOM   2240  C  C     . PHE A  1  292 ? -18.623 91.988  30.016  1.00 52.30  ? 318 PHE A C     1 
ATOM   2241  O  O     . PHE A  1  292 ? -18.937 90.864  29.615  1.00 52.14  ? 318 PHE A O     1 
ATOM   2242  C  CB    . PHE A  1  292 ? -18.301 93.772  28.318  1.00 51.93  ? 318 PHE A CB    1 
ATOM   2243  C  CG    . PHE A  1  292 ? -18.934 93.076  27.137  1.00 52.36  ? 318 PHE A CG    1 
ATOM   2244  C  CD1   . PHE A  1  292 ? -20.046 92.251  27.306  1.00 52.23  ? 318 PHE A CD1   1 
ATOM   2245  C  CD2   . PHE A  1  292 ? -18.390 93.211  25.862  1.00 51.43  ? 318 PHE A CD2   1 
ATOM   2246  C  CE1   . PHE A  1  292 ? -20.600 91.564  26.225  1.00 52.77  ? 318 PHE A CE1   1 
ATOM   2247  C  CE2   . PHE A  1  292 ? -18.935 92.531  24.772  1.00 50.71  ? 318 PHE A CE2   1 
ATOM   2248  C  CZ    . PHE A  1  292 ? -20.041 91.704  24.950  1.00 51.20  ? 318 PHE A CZ    1 
ATOM   2249  N  N     . SER A  1  293 ? -19.143 92.554  31.100  1.00 52.74  ? 319 SER A N     1 
ATOM   2250  C  CA    . SER A  1  293 ? -20.187 91.908  31.870  1.00 53.02  ? 319 SER A CA    1 
ATOM   2251  C  C     . SER A  1  293 ? -21.272 92.956  31.993  1.00 55.30  ? 319 SER A C     1 
ATOM   2252  O  O     . SER A  1  293 ? -21.288 93.744  32.940  1.00 57.96  ? 319 SER A O     1 
ATOM   2253  C  CB    . SER A  1  293 ? -19.694 91.473  33.246  1.00 51.08  ? 319 SER A CB    1 
ATOM   2254  O  OG    . SER A  1  293 ? -20.675 90.684  33.905  1.00 47.53  ? 319 SER A OG    1 
ATOM   2255  N  N     . LEU A  1  294 ? -22.098 93.037  30.952  1.00 56.74  ? 320 LEU A N     1 
ATOM   2256  C  CA    . LEU A  1  294 ? -23.206 93.979  30.897  1.00 56.84  ? 320 LEU A CA    1 
ATOM   2257  C  C     . LEU A  1  294 ? -24.326 93.498  31.801  1.00 58.54  ? 320 LEU A C     1 
ATOM   2258  O  O     . LEU A  1  294 ? -24.692 92.319  31.779  1.00 57.43  ? 320 LEU A O     1 
ATOM   2259  C  CB    . LEU A  1  294 ? -23.717 94.107  29.466  1.00 56.83  ? 320 LEU A CB    1 
ATOM   2260  C  CG    . LEU A  1  294 ? -23.121 95.192  28.568  1.00 57.78  ? 320 LEU A CG    1 
ATOM   2261  C  CD1   . LEU A  1  294 ? -21.659 95.434  28.865  1.00 57.05  ? 320 LEU A CD1   1 
ATOM   2262  C  CD2   . LEU A  1  294 ? -23.325 94.786  27.124  1.00 57.94  ? 320 LEU A CD2   1 
ATOM   2263  N  N     . SER A  1  295 ? -24.835 94.406  32.627  1.00 59.88  ? 321 SER A N     1 
ATOM   2264  C  CA    . SER A  1  295 ? -25.915 94.072  33.542  1.00 61.24  ? 321 SER A CA    1 
ATOM   2265  C  C     . SER A  1  295 ? -27.105 95.011  33.404  1.00 62.83  ? 321 SER A C     1 
ATOM   2266  O  O     . SER A  1  295 ? -26.950 96.213  33.159  1.00 64.34  ? 321 SER A O     1 
ATOM   2267  C  CB    . SER A  1  295 ? -25.407 94.060  34.974  1.00 60.32  ? 321 SER A CB    1 
ATOM   2268  O  OG    . SER A  1  295 ? -24.422 93.060  35.129  1.00 62.74  ? 321 SER A OG    1 
ATOM   2269  N  N     . TYR A  1  296 ? -28.296 94.433  33.514  1.00 63.30  ? 322 TYR A N     1 
ATOM   2270  C  CA    . TYR A  1  296 ? -29.544 95.175  33.408  1.00 63.23  ? 322 TYR A CA    1 
ATOM   2271  C  C     . TYR A  1  296 ? -30.470 94.680  34.514  1.00 65.33  ? 322 TYR A C     1 
ATOM   2272  O  O     . TYR A  1  296 ? -30.096 93.817  35.313  1.00 64.77  ? 322 TYR A O     1 
ATOM   2273  C  CB    . TYR A  1  296 ? -30.187 94.945  32.032  1.00 60.32  ? 322 TYR A CB    1 
ATOM   2274  C  CG    . TYR A  1  296 ? -29.285 95.290  30.863  1.00 57.77  ? 322 TYR A CG    1 
ATOM   2275  C  CD1   . TYR A  1  296 ? -28.690 94.292  30.094  1.00 55.66  ? 322 TYR A CD1   1 
ATOM   2276  C  CD2   . TYR A  1  296 ? -29.016 96.613  30.536  1.00 57.21  ? 322 TYR A CD2   1 
ATOM   2277  C  CE1   . TYR A  1  296 ? -27.854 94.606  29.037  1.00 54.22  ? 322 TYR A CE1   1 
ATOM   2278  C  CE2   . TYR A  1  296 ? -28.179 96.936  29.477  1.00 56.52  ? 322 TYR A CE2   1 
ATOM   2279  C  CZ    . TYR A  1  296 ? -27.601 95.926  28.733  1.00 56.38  ? 322 TYR A CZ    1 
ATOM   2280  O  OH    . TYR A  1  296 ? -26.762 96.248  27.688  1.00 58.17  ? 322 TYR A OH    1 
ATOM   2281  N  N     . LYS A  1  297 ? -31.682 95.218  34.551  1.00 67.45  ? 323 LYS A N     1 
ATOM   2282  C  CA    . LYS A  1  297 ? -32.654 94.841  35.562  1.00 70.76  ? 323 LYS A CA    1 
ATOM   2283  C  C     . LYS A  1  297 ? -33.020 93.350  35.555  1.00 70.71  ? 323 LYS A C     1 
ATOM   2284  O  O     . LYS A  1  297 ? -32.888 92.673  36.576  1.00 69.83  ? 323 LYS A O     1 
ATOM   2285  C  CB    . LYS A  1  297 ? -33.903 95.715  35.406  1.00 75.37  ? 323 LYS A CB    1 
ATOM   2286  C  CG    . LYS A  1  297 ? -35.033 95.435  36.388  1.00 80.33  ? 323 LYS A CG    1 
ATOM   2287  C  CD    . LYS A  1  297 ? -36.112 96.515  36.276  1.00 84.88  ? 323 LYS A CD    1 
ATOM   2288  C  CE    . LYS A  1  297 ? -37.465 96.017  36.772  1.00 87.92  ? 323 LYS A CE    1 
ATOM   2289  N  NZ    . LYS A  1  297 ? -37.408 95.511  38.177  1.00 90.81  ? 323 LYS A NZ    1 
ATOM   2290  N  N     . ASP A  1  298 ? -33.430 92.834  34.396  1.00 71.11  ? 324 ASP A N     1 
ATOM   2291  C  CA    . ASP A  1  298 ? -33.834 91.431  34.279  1.00 71.49  ? 324 ASP A CA    1 
ATOM   2292  C  C     . ASP A  1  298 ? -32.772 90.410  33.873  1.00 70.38  ? 324 ASP A C     1 
ATOM   2293  O  O     . ASP A  1  298 ? -32.909 89.228  34.195  1.00 70.02  ? 324 ASP A O     1 
ATOM   2294  C  CB    . ASP A  1  298 ? -35.033 91.294  33.338  1.00 73.43  ? 324 ASP A CB    1 
ATOM   2295  C  CG    . ASP A  1  298 ? -36.311 91.863  33.925  1.00 74.76  ? 324 ASP A CG    1 
ATOM   2296  O  OD1   . ASP A  1  298 ? -36.414 91.951  35.172  1.00 75.04  ? 324 ASP A OD1   1 
ATOM   2297  O  OD2   . ASP A  1  298 ? -37.217 92.206  33.129  1.00 74.33  ? 324 ASP A OD2   1 
ATOM   2298  N  N     . SER A  1  299 ? -31.733 90.848  33.164  1.00 68.09  ? 325 SER A N     1 
ATOM   2299  C  CA    . SER A  1  299 ? -30.680 89.934  32.725  1.00 65.90  ? 325 SER A CA    1 
ATOM   2300  C  C     . SER A  1  299 ? -29.402 90.675  32.352  1.00 64.78  ? 325 SER A C     1 
ATOM   2301  O  O     . SER A  1  299 ? -29.267 91.870  32.612  1.00 63.58  ? 325 SER A O     1 
ATOM   2302  C  CB    . SER A  1  299 ? -31.173 89.115  31.524  1.00 66.51  ? 325 SER A CB    1 
ATOM   2303  O  OG    . SER A  1  299 ? -30.243 88.115  31.152  1.00 65.88  ? 325 SER A OG    1 
ATOM   2304  N  N     . GLY A  1  300 ? -28.469 89.950  31.739  1.00 64.05  ? 326 GLY A N     1 
ATOM   2305  C  CA    . GLY A  1  300 ? -27.205 90.538  31.325  1.00 61.40  ? 326 GLY A CA    1 
ATOM   2306  C  C     . GLY A  1  300 ? -26.486 89.728  30.257  1.00 59.69  ? 326 GLY A C     1 
ATOM   2307  O  O     . GLY A  1  300 ? -26.964 88.677  29.820  1.00 58.97  ? 326 GLY A O     1 
ATOM   2308  N  N     . LEU A  1  301 ? -25.320 90.219  29.853  1.00 57.86  ? 327 LEU A N     1 
ATOM   2309  C  CA    . LEU A  1  301 ? -24.512 89.567  28.835  1.00 56.29  ? 327 LEU A CA    1 
ATOM   2310  C  C     . LEU A  1  301 ? -23.038 89.531  29.209  1.00 56.20  ? 327 LEU A C     1 
ATOM   2311  O  O     . LEU A  1  301 ? -22.428 90.572  29.449  1.00 56.45  ? 327 LEU A O     1 
ATOM   2312  C  CB    . LEU A  1  301 ? -24.645 90.299  27.497  1.00 54.78  ? 327 LEU A CB    1 
ATOM   2313  C  CG    . LEU A  1  301 ? -25.968 90.332  26.740  1.00 52.80  ? 327 LEU A CG    1 
ATOM   2314  C  CD1   . LEU A  1  301 ? -25.748 91.068  25.431  1.00 53.59  ? 327 LEU A CD1   1 
ATOM   2315  C  CD2   . LEU A  1  301 ? -26.458 88.926  26.469  1.00 51.64  ? 327 LEU A CD2   1 
ATOM   2316  N  N     . TRP A  1  302 ? -22.462 88.332  29.234  1.00 56.39  ? 328 TRP A N     1 
ATOM   2317  C  CA    . TRP A  1  302 ? -21.040 88.172  29.538  1.00 56.00  ? 328 TRP A CA    1 
ATOM   2318  C  C     . TRP A  1  302 ? -20.358 87.603  28.300  1.00 54.37  ? 328 TRP A C     1 
ATOM   2319  O  O     . TRP A  1  302 ? -20.709 86.520  27.828  1.00 55.60  ? 328 TRP A O     1 
ATOM   2320  C  CB    . TRP A  1  302 ? -20.823 87.233  30.729  1.00 56.91  ? 328 TRP A CB    1 
ATOM   2321  C  CG    . TRP A  1  302 ? -19.405 87.232  31.229  1.00 59.08  ? 328 TRP A CG    1 
ATOM   2322  C  CD1   . TRP A  1  302 ? -18.921 87.908  32.309  1.00 58.48  ? 328 TRP A CD1   1 
ATOM   2323  C  CD2   . TRP A  1  302 ? -18.281 86.552  30.647  1.00 60.50  ? 328 TRP A CD2   1 
ATOM   2324  N  NE1   . TRP A  1  302 ? -17.567 87.700  32.435  1.00 59.16  ? 328 TRP A NE1   1 
ATOM   2325  C  CE2   . TRP A  1  302 ? -17.148 86.874  31.427  1.00 59.94  ? 328 TRP A CE2   1 
ATOM   2326  C  CE3   . TRP A  1  302 ? -18.121 85.704  29.539  1.00 60.68  ? 328 TRP A CE3   1 
ATOM   2327  C  CZ2   . TRP A  1  302 ? -15.875 86.379  31.137  1.00 60.64  ? 328 TRP A CZ2   1 
ATOM   2328  C  CZ3   . TRP A  1  302 ? -16.854 85.211  29.250  1.00 60.69  ? 328 TRP A CZ3   1 
ATOM   2329  C  CH2   . TRP A  1  302 ? -15.748 85.552  30.046  1.00 62.11  ? 328 TRP A CH2   1 
ATOM   2330  N  N     . GLY A  1  303 ? -19.391 88.339  27.771  1.00 51.22  ? 329 GLY A N     1 
ATOM   2331  C  CA    . GLY A  1  303 ? -18.692 87.881  26.590  1.00 47.88  ? 329 GLY A CA    1 
ATOM   2332  C  C     . GLY A  1  303 ? -17.640 88.871  26.153  1.00 46.26  ? 329 GLY A C     1 
ATOM   2333  O  O     . GLY A  1  303 ? -17.115 89.614  26.969  1.00 47.64  ? 329 GLY A O     1 
ATOM   2334  N  N     . PHE A  1  304 ? -17.347 88.909  24.861  1.00 44.96  ? 330 PHE A N     1 
ATOM   2335  C  CA    . PHE A  1  304 ? -16.347 89.829  24.359  1.00 43.62  ? 330 PHE A CA    1 
ATOM   2336  C  C     . PHE A  1  304 ? -16.716 90.283  22.962  1.00 44.46  ? 330 PHE A C     1 
ATOM   2337  O  O     . PHE A  1  304 ? -17.660 89.768  22.360  1.00 45.14  ? 330 PHE A O     1 
ATOM   2338  C  CB    . PHE A  1  304 ? -14.947 89.178  24.377  1.00 43.93  ? 330 PHE A CB    1 
ATOM   2339  C  CG    . PHE A  1  304 ? -14.618 88.353  23.154  1.00 44.60  ? 330 PHE A CG    1 
ATOM   2340  C  CD1   . PHE A  1  304 ? -13.468 88.631  22.409  1.00 43.15  ? 330 PHE A CD1   1 
ATOM   2341  C  CD2   . PHE A  1  304 ? -15.446 87.300  22.744  1.00 44.79  ? 330 PHE A CD2   1 
ATOM   2342  C  CE1   . PHE A  1  304 ? -13.147 87.882  21.276  1.00 43.77  ? 330 PHE A CE1   1 
ATOM   2343  C  CE2   . PHE A  1  304 ? -15.134 86.543  21.610  1.00 44.23  ? 330 PHE A CE2   1 
ATOM   2344  C  CZ    . PHE A  1  304 ? -13.981 86.834  20.875  1.00 43.18  ? 330 PHE A CZ    1 
ATOM   2345  N  N     . SER A  1  305 ? -15.977 91.270  22.472  1.00 44.24  ? 331 SER A N     1 
ATOM   2346  C  CA    . SER A  1  305 ? -16.170 91.821  21.142  1.00 45.23  ? 331 SER A CA    1 
ATOM   2347  C  C     . SER A  1  305 ? -14.781 91.906  20.541  1.00 45.08  ? 331 SER A C     1 
ATOM   2348  O  O     . SER A  1  305 ? -13.801 92.046  21.265  1.00 47.43  ? 331 SER A O     1 
ATOM   2349  C  CB    . SER A  1  305 ? -16.788 93.219  21.225  1.00 46.02  ? 331 SER A CB    1 
ATOM   2350  O  OG    . SER A  1  305 ? -18.061 93.167  21.844  1.00 49.12  ? 331 SER A OG    1 
ATOM   2351  N  N     . THR A  1  306 ? -14.684 91.824  19.223  1.00 43.95  ? 332 THR A N     1 
ATOM   2352  C  CA    . THR A  1  306 ? -13.380 91.877  18.583  1.00 43.28  ? 332 THR A CA    1 
ATOM   2353  C  C     . THR A  1  306 ? -13.493 92.355  17.151  1.00 42.31  ? 332 THR A C     1 
ATOM   2354  O  O     . THR A  1  306 ? -14.552 92.267  16.543  1.00 42.23  ? 332 THR A O     1 
ATOM   2355  C  CB    . THR A  1  306 ? -12.666 90.467  18.616  1.00 43.54  ? 332 THR A CB    1 
ATOM   2356  O  OG1   . THR A  1  306 ? -11.393 90.546  17.965  1.00 42.31  ? 332 THR A OG1   1 
ATOM   2357  C  CG2   . THR A  1  306 ? -13.500 89.408  17.924  1.00 41.60  ? 332 THR A CG2   1 
ATOM   2358  N  N     . ALA A  1  307 ? -12.398 92.901  16.644  1.00 41.42  ? 333 ALA A N     1 
ATOM   2359  C  CA    . ALA A  1  307 ? -12.331 93.380  15.273  1.00 43.76  ? 333 ALA A CA    1 
ATOM   2360  C  C     . ALA A  1  307 ? -11.039 92.806  14.678  1.00 45.21  ? 333 ALA A C     1 
ATOM   2361  O  O     . ALA A  1  307 ? -10.002 92.766  15.356  1.00 44.49  ? 333 ALA A O     1 
ATOM   2362  C  CB    . ALA A  1  307 ? -12.314 94.898  15.238  1.00 41.55  ? 333 ALA A CB    1 
ATOM   2363  N  N     . THR A  1  308 ? -11.095 92.364  13.419  1.00 44.92  ? 334 THR A N     1 
ATOM   2364  C  CA    . THR A  1  308 ? -9.923  91.767  12.782  1.00 43.33  ? 334 THR A CA    1 
ATOM   2365  C  C     . THR A  1  308 ? -9.843  91.949  11.271  1.00 43.00  ? 334 THR A C     1 
ATOM   2366  O  O     . THR A  1  308 ? -10.847 92.111  10.599  1.00 45.11  ? 334 THR A O     1 
ATOM   2367  C  CB    . THR A  1  308 ? -9.862  90.258  13.098  1.00 42.25  ? 334 THR A CB    1 
ATOM   2368  O  OG1   . THR A  1  308 ? -8.778  89.664  12.384  1.00 42.45  ? 334 THR A OG1   1 
ATOM   2369  C  CG2   . THR A  1  308 ? -11.173 89.571  12.710  1.00 41.58  ? 334 THR A CG2   1 
ATOM   2370  N  N     . ARG A  1  309 ? -8.624  91.926  10.760  1.00 43.44  ? 335 ARG A N     1 
ATOM   2371  C  CA    . ARG A  1  309 ? -8.342  92.055  9.335   1.00 45.06  ? 335 ARG A CA    1 
ATOM   2372  C  C     . ARG A  1  309 ? -7.759  90.728  8.821   1.00 44.85  ? 335 ARG A C     1 
ATOM   2373  O  O     . ARG A  1  309 ? -7.471  90.579  7.630   1.00 43.77  ? 335 ARG A O     1 
ATOM   2374  C  CB    . ARG A  1  309 ? -7.327  93.178  9.098   1.00 46.55  ? 335 ARG A CB    1 
ATOM   2375  C  CG    . ARG A  1  309 ? -7.920  94.569  9.074   1.00 52.04  ? 335 ARG A CG    1 
ATOM   2376  C  CD    . ARG A  1  309 ? -6.930  95.611  9.579   1.00 58.04  ? 335 ARG A CD    1 
ATOM   2377  N  NE    . ARG A  1  309 ? -5.578  95.419  9.059   1.00 62.76  ? 335 ARG A NE    1 
ATOM   2378  C  CZ    . ARG A  1  309 ? -4.493  95.290  9.821   1.00 65.93  ? 335 ARG A CZ    1 
ATOM   2379  N  NH1   . ARG A  1  309 ? -3.299  95.114  9.264   1.00 67.54  ? 335 ARG A NH1   1 
ATOM   2380  N  NH2   . ARG A  1  309 ? -4.594  95.339  11.142  1.00 65.36  ? 335 ARG A NH2   1 
ATOM   2381  N  N     . ASN A  1  310 ? -7.522  89.797  9.743   1.00 43.70  ? 336 ASN A N     1 
ATOM   2382  C  CA    . ASN A  1  310 ? -6.985  88.497  9.401   1.00 45.55  ? 336 ASN A CA    1 
ATOM   2383  C  C     . ASN A  1  310 ? -8.217  87.652  9.134   1.00 46.90  ? 336 ASN A C     1 
ATOM   2384  O  O     . ASN A  1  310 ? -8.613  86.822  9.958   1.00 48.34  ? 336 ASN A O     1 
ATOM   2385  C  CB    . ASN A  1  310 ? -6.191  87.924  10.572  1.00 47.16  ? 336 ASN A CB    1 
ATOM   2386  C  CG    . ASN A  1  310 ? -5.339  86.731  10.175  1.00 49.64  ? 336 ASN A CG    1 
ATOM   2387  O  OD1   . ASN A  1  310 ? -4.313  86.458  10.795  1.00 52.07  ? 336 ASN A OD1   1 
ATOM   2388  N  ND2   . ASN A  1  310 ? -5.761  86.014  9.142   1.00 50.85  ? 336 ASN A ND2   1 
ATOM   2389  N  N     . VAL A  1  311 ? -8.810  87.856  7.963   1.00 46.19  ? 337 VAL A N     1 
ATOM   2390  C  CA    . VAL A  1  311 ? -10.033 87.157  7.601   1.00 46.33  ? 337 VAL A CA    1 
ATOM   2391  C  C     . VAL A  1  311 ? -9.918  85.677  7.266   1.00 45.73  ? 337 VAL A C     1 
ATOM   2392  O  O     . VAL A  1  311 ? -10.931 85.025  7.047   1.00 46.85  ? 337 VAL A O     1 
ATOM   2393  C  CB    . VAL A  1  311 ? -10.790 87.904  6.480   1.00 46.54  ? 337 VAL A CB    1 
ATOM   2394  C  CG1   . VAL A  1  311 ? -11.166 89.300  6.961   1.00 45.67  ? 337 VAL A CG1   1 
ATOM   2395  C  CG2   . VAL A  1  311 ? -9.941  87.981  5.215   1.00 45.29  ? 337 VAL A CG2   1 
ATOM   2396  N  N     . THR A  1  312 ? -8.704  85.133  7.247   1.00 44.09  ? 338 THR A N     1 
ATOM   2397  C  CA    . THR A  1  312 ? -8.543  83.713  6.950   1.00 41.42  ? 338 THR A CA    1 
ATOM   2398  C  C     . THR A  1  312 ? -8.258  82.871  8.186   1.00 41.36  ? 338 THR A C     1 
ATOM   2399  O  O     . THR A  1  312 ? -8.191  81.648  8.096   1.00 39.49  ? 338 THR A O     1 
ATOM   2400  C  CB    . THR A  1  312 ? -7.454  83.454  5.888   1.00 41.69  ? 338 THR A CB    1 
ATOM   2401  O  OG1   . THR A  1  312 ? -6.199  83.982  6.321   1.00 42.38  ? 338 THR A OG1   1 
ATOM   2402  C  CG2   . THR A  1  312 ? -7.830  84.099  4.575   1.00 41.45  ? 338 THR A CG2   1 
ATOM   2403  N  N     . MET A  1  313 ? -8.134  83.523  9.344   1.00 41.68  ? 339 MET A N     1 
ATOM   2404  C  CA    . MET A  1  313 ? -7.847  82.813  10.595  1.00 41.30  ? 339 MET A CA    1 
ATOM   2405  C  C     . MET A  1  313 ? -8.831  83.110  11.736  1.00 40.79  ? 339 MET A C     1 
ATOM   2406  O  O     . MET A  1  313 ? -8.527  82.891  12.912  1.00 42.61  ? 339 MET A O     1 
ATOM   2407  C  CB    . MET A  1  313 ? -6.408  83.094  11.037  1.00 40.34  ? 339 MET A CB    1 
ATOM   2408  C  CG    . MET A  1  313 ? -5.391  82.812  9.943   1.00 42.63  ? 339 MET A CG    1 
ATOM   2409  S  SD    . MET A  1  313 ? -3.695  82.926  10.458  1.00 46.10  ? 339 MET A SD    1 
ATOM   2410  C  CE    . MET A  1  313 ? -3.605  81.461  11.496  1.00 43.33  ? 339 MET A CE    1 
ATOM   2411  N  N     . ILE A  1  314 ? -10.029 83.556  11.381  1.00 37.46  ? 340 ILE A N     1 
ATOM   2412  C  CA    . ILE A  1  314 ? -11.048 83.876  12.369  1.00 35.51  ? 340 ILE A CA    1 
ATOM   2413  C  C     . ILE A  1  314 ? -11.383 82.672  13.245  1.00 37.34  ? 340 ILE A C     1 
ATOM   2414  O  O     . ILE A  1  314 ? -11.679 82.842  14.424  1.00 41.71  ? 340 ILE A O     1 
ATOM   2415  C  CB    . ILE A  1  314 ? -12.340 84.429  11.683  1.00 32.55  ? 340 ILE A CB    1 
ATOM   2416  C  CG1   . ILE A  1  314 ? -12.033 85.730  10.956  1.00 30.76  ? 340 ILE A CG1   1 
ATOM   2417  C  CG2   . ILE A  1  314 ? -13.436 84.682  12.675  1.00 30.25  ? 340 ILE A CG2   1 
ATOM   2418  C  CD1   . ILE A  1  314 ? -13.199 86.247  10.165  1.00 34.69  ? 340 ILE A CD1   1 
ATOM   2419  N  N     . ASP A  1  315 ? -11.322 81.457  12.705  1.00 37.73  ? 341 ASP A N     1 
ATOM   2420  C  CA    . ASP A  1  315 ? -11.656 80.298  13.528  1.00 39.31  ? 341 ASP A CA    1 
ATOM   2421  C  C     . ASP A  1  315 ? -10.661 80.096  14.669  1.00 40.61  ? 341 ASP A C     1 
ATOM   2422  O  O     . ASP A  1  315 ? -11.034 79.647  15.753  1.00 40.15  ? 341 ASP A O     1 
ATOM   2423  C  CB    . ASP A  1  315 ? -11.870 79.013  12.700  1.00 41.08  ? 341 ASP A CB    1 
ATOM   2424  C  CG    . ASP A  1  315 ? -10.637 78.572  11.924  1.00 43.91  ? 341 ASP A CG    1 
ATOM   2425  O  OD1   . ASP A  1  315 ? -10.262 79.256  10.950  1.00 48.35  ? 341 ASP A OD1   1 
ATOM   2426  O  OD2   . ASP A  1  315 ? -10.070 77.508  12.255  1.00 45.50  ? 341 ASP A OD2   1 
ATOM   2427  N  N     . ASP A  1  316 ? -9.406  80.472  14.442  1.00 41.37  ? 342 ASP A N     1 
ATOM   2428  C  CA    . ASP A  1  316 ? -8.396  80.349  15.482  1.00 42.78  ? 342 ASP A CA    1 
ATOM   2429  C  C     . ASP A  1  316 ? -8.625  81.411  16.563  1.00 43.50  ? 342 ASP A C     1 
ATOM   2430  O  O     . ASP A  1  316 ? -8.484  81.129  17.754  1.00 44.27  ? 342 ASP A O     1 
ATOM   2431  C  CB    . ASP A  1  316 ? -6.994  80.463  14.895  1.00 43.17  ? 342 ASP A CB    1 
ATOM   2432  C  CG    . ASP A  1  316 ? -6.609  79.247  14.062  1.00 46.17  ? 342 ASP A CG    1 
ATOM   2433  O  OD1   . ASP A  1  316 ? -6.267  79.423  12.873  1.00 46.92  ? 342 ASP A OD1   1 
ATOM   2434  O  OD2   . ASP A  1  316 ? -6.657  78.116  14.593  1.00 45.29  ? 342 ASP A OD2   1 
ATOM   2435  N  N     . LEU A  1  317 ? -9.023  82.612  16.142  1.00 43.00  ? 343 LEU A N     1 
ATOM   2436  C  CA    . LEU A  1  317 ? -9.300  83.709  17.061  1.00 41.29  ? 343 LEU A CA    1 
ATOM   2437  C  C     . LEU A  1  317 ? -10.377 83.237  18.029  1.00 40.57  ? 343 LEU A C     1 
ATOM   2438  O  O     . LEU A  1  317 ? -10.170 83.219  19.245  1.00 41.71  ? 343 LEU A O     1 
ATOM   2439  C  CB    . LEU A  1  317 ? -9.818  84.929  16.295  1.00 41.85  ? 343 LEU A CB    1 
ATOM   2440  C  CG    . LEU A  1  317 ? -9.568  86.332  16.870  1.00 44.18  ? 343 LEU A CG    1 
ATOM   2441  C  CD1   . LEU A  1  317 ? -10.534 87.321  16.233  1.00 42.23  ? 343 LEU A CD1   1 
ATOM   2442  C  CD2   . LEU A  1  317 ? -9.729  86.366  18.379  1.00 45.44  ? 343 LEU A CD2   1 
ATOM   2443  N  N     . ILE A  1  318 ? -11.502 82.802  17.475  1.00 38.15  ? 344 ILE A N     1 
ATOM   2444  C  CA    . ILE A  1  318 ? -12.625 82.330  18.272  1.00 37.02  ? 344 ILE A CA    1 
ATOM   2445  C  C     . ILE A  1  318 ? -12.284 81.088  19.113  1.00 38.43  ? 344 ILE A C     1 
ATOM   2446  O  O     . ILE A  1  318 ? -12.700 80.981  20.280  1.00 39.34  ? 344 ILE A O     1 
ATOM   2447  C  CB    . ILE A  1  318 ? -13.858 82.054  17.364  1.00 36.29  ? 344 ILE A CB    1 
ATOM   2448  C  CG1   . ILE A  1  318 ? -14.191 83.302  16.539  1.00 37.01  ? 344 ILE A CG1   1 
ATOM   2449  C  CG2   . ILE A  1  318 ? -15.080 81.639  18.187  1.00 33.20  ? 344 ILE A CG2   1 
ATOM   2450  C  CD1   . ILE A  1  318 ? -14.430 84.564  17.353  1.00 36.77  ? 344 ILE A CD1   1 
ATOM   2451  N  N     . HIS A  1  319 ? -11.491 80.182  18.537  1.00 38.11  ? 345 HIS A N     1 
ATOM   2452  C  CA    . HIS A  1  319 ? -11.099 78.943  19.210  1.00 37.83  ? 345 HIS A CA    1 
ATOM   2453  C  C     . HIS A  1  319 ? -10.203 79.184  20.432  1.00 38.45  ? 345 HIS A C     1 
ATOM   2454  O  O     . HIS A  1  319 ? -10.411 78.597  21.497  1.00 37.36  ? 345 HIS A O     1 
ATOM   2455  C  CB    . HIS A  1  319 ? -10.413 78.000  18.208  1.00 38.48  ? 345 HIS A CB    1 
ATOM   2456  C  CG    . HIS A  1  319 ? -9.842  76.754  18.822  1.00 37.07  ? 345 HIS A CG    1 
ATOM   2457  N  ND1   . HIS A  1  319 ? -10.616 75.819  19.482  1.00 36.12  ? 345 HIS A ND1   1 
ATOM   2458  C  CD2   . HIS A  1  319 ? -8.566  76.305  18.899  1.00 34.60  ? 345 HIS A CD2   1 
ATOM   2459  C  CE1   . HIS A  1  319 ? -9.841  74.853  19.943  1.00 34.76  ? 345 HIS A CE1   1 
ATOM   2460  N  NE2   . HIS A  1  319 ? -8.592  75.123  19.602  1.00 35.60  ? 345 HIS A NE2   1 
ATOM   2461  N  N     . PHE A  1  320 ? -9.186  80.020  20.267  1.00 38.61  ? 346 PHE A N     1 
ATOM   2462  C  CA    . PHE A  1  320 ? -8.286  80.326  21.372  1.00 39.63  ? 346 PHE A CA    1 
ATOM   2463  C  C     . PHE A  1  320 ? -9.014  81.059  22.493  1.00 40.40  ? 346 PHE A C     1 
ATOM   2464  O  O     . PHE A  1  320 ? -8.926  80.666  23.653  1.00 42.08  ? 346 PHE A O     1 
ATOM   2465  C  CB    . PHE A  1  320 ? -7.095  81.140  20.883  1.00 37.88  ? 346 PHE A CB    1 
ATOM   2466  C  CG    . PHE A  1  320 ? -6.057  80.318  20.164  1.00 37.37  ? 346 PHE A CG    1 
ATOM   2467  C  CD1   . PHE A  1  320 ? -5.674  79.071  20.663  1.00 35.86  ? 346 PHE A CD1   1 
ATOM   2468  C  CD2   . PHE A  1  320 ? -5.433  80.803  19.015  1.00 34.78  ? 346 PHE A CD2   1 
ATOM   2469  C  CE1   . PHE A  1  320 ? -4.674  78.319  20.029  1.00 37.00  ? 346 PHE A CE1   1 
ATOM   2470  C  CE2   . PHE A  1  320 ? -4.437  80.065  18.374  1.00 37.08  ? 346 PHE A CE2   1 
ATOM   2471  C  CZ    . PHE A  1  320 ? -4.053  78.820  18.880  1.00 36.77  ? 346 PHE A CZ    1 
ATOM   2472  N  N     . THR A  1  321 ? -9.771  82.089  22.137  1.00 41.05  ? 347 THR A N     1 
ATOM   2473  C  CA    . THR A  1  321 ? -10.526 82.854  23.123  1.00 40.33  ? 347 THR A CA    1 
ATOM   2474  C  C     . THR A  1  321 ? -11.445 81.937  23.934  1.00 41.50  ? 347 THR A C     1 
ATOM   2475  O  O     . THR A  1  321 ? -11.444 81.986  25.160  1.00 40.99  ? 347 THR A O     1 
ATOM   2476  C  CB    . THR A  1  321 ? -11.371 83.960  22.450  1.00 38.89  ? 347 THR A CB    1 
ATOM   2477  O  OG1   . THR A  1  321 ? -10.511 84.900  21.792  1.00 36.39  ? 347 THR A OG1   1 
ATOM   2478  C  CG2   . THR A  1  321 ? -12.221 84.681  23.477  1.00 38.15  ? 347 THR A CG2   1 
ATOM   2479  N  N     . LEU A  1  322 ? -12.201 81.076  23.255  1.00 43.11  ? 348 LEU A N     1 
ATOM   2480  C  CA    . LEU A  1  322 ? -13.117 80.170  23.956  1.00 44.34  ? 348 LEU A CA    1 
ATOM   2481  C  C     . LEU A  1  322 ? -12.409 79.076  24.756  1.00 44.56  ? 348 LEU A C     1 
ATOM   2482  O  O     . LEU A  1  322 ? -13.002 78.481  25.661  1.00 43.15  ? 348 LEU A O     1 
ATOM   2483  C  CB    . LEU A  1  322 ? -14.161 79.577  23.002  1.00 44.47  ? 348 LEU A CB    1 
ATOM   2484  C  CG    . LEU A  1  322 ? -15.482 80.368  22.945  1.00 49.38  ? 348 LEU A CG    1 
ATOM   2485  C  CD1   . LEU A  1  322 ? -15.235 81.814  22.505  1.00 47.15  ? 348 LEU A CD1   1 
ATOM   2486  C  CD2   . LEU A  1  322 ? -16.495 79.687  22.013  1.00 47.54  ? 348 LEU A CD2   1 
ATOM   2487  N  N     . LYS A  1  323 ? -11.154 78.789  24.407  1.00 44.00  ? 349 LYS A N     1 
ATOM   2488  C  CA    . LYS A  1  323 ? -10.392 77.799  25.161  1.00 45.04  ? 349 LYS A CA    1 
ATOM   2489  C  C     . LYS A  1  323 ? -9.953  78.448  26.468  1.00 44.92  ? 349 LYS A C     1 
ATOM   2490  O  O     . LYS A  1  323 ? -9.960  77.818  27.519  1.00 44.08  ? 349 LYS A O     1 
ATOM   2491  C  CB    . LYS A  1  323 ? -9.183  77.288  24.380  1.00 45.95  ? 349 LYS A CB    1 
ATOM   2492  C  CG    . LYS A  1  323 ? -9.535  76.189  23.404  1.00 47.66  ? 349 LYS A CG    1 
ATOM   2493  C  CD    . LYS A  1  323 ? -10.329 75.098  24.093  1.00 47.31  ? 349 LYS A CD    1 
ATOM   2494  C  CE    . LYS A  1  323 ? -11.182 74.331  23.109  1.00 50.07  ? 349 LYS A CE    1 
ATOM   2495  N  NZ    . LYS A  1  323 ? -12.278 73.587  23.800  1.00 50.01  ? 349 LYS A NZ    1 
ATOM   2496  N  N     . GLN A  1  324 ? -9.586  79.721  26.398  1.00 44.46  ? 350 GLN A N     1 
ATOM   2497  C  CA    . GLN A  1  324 ? -9.204  80.450  27.591  1.00 45.68  ? 350 GLN A CA    1 
ATOM   2498  C  C     . GLN A  1  324 ? -10.386 80.509  28.567  1.00 45.91  ? 350 GLN A C     1 
ATOM   2499  O  O     . GLN A  1  324 ? -10.220 80.215  29.754  1.00 47.06  ? 350 GLN A O     1 
ATOM   2500  C  CB    . GLN A  1  324 ? -8.713  81.857  27.235  1.00 45.37  ? 350 GLN A CB    1 
ATOM   2501  C  CG    . GLN A  1  324 ? -7.279  81.879  26.704  1.00 47.07  ? 350 GLN A CG    1 
ATOM   2502  C  CD    . GLN A  1  324 ? -6.269  81.244  27.670  1.00 48.86  ? 350 GLN A CD    1 
ATOM   2503  O  OE1   . GLN A  1  324 ? -5.250  80.700  27.248  1.00 49.05  ? 350 GLN A OE1   1 
ATOM   2504  N  NE2   . GLN A  1  324 ? -6.558  81.308  28.967  1.00 50.09  ? 350 GLN A NE2   1 
ATOM   2505  N  N     . TRP A  1  325 ? -11.582 80.830  28.063  1.00 45.03  ? 351 TRP A N     1 
ATOM   2506  C  CA    . TRP A  1  325 ? -12.767 80.896  28.916  1.00 43.79  ? 351 TRP A CA    1 
ATOM   2507  C  C     . TRP A  1  325 ? -13.064 79.559  29.588  1.00 45.90  ? 351 TRP A C     1 
ATOM   2508  O  O     . TRP A  1  325 ? -13.669 79.545  30.659  1.00 47.14  ? 351 TRP A O     1 
ATOM   2509  C  CB    . TRP A  1  325 ? -14.012 81.325  28.142  1.00 41.70  ? 351 TRP A CB    1 
ATOM   2510  C  CG    . TRP A  1  325 ? -13.989 82.697  27.533  1.00 37.74  ? 351 TRP A CG    1 
ATOM   2511  C  CD1   . TRP A  1  325 ? -12.948 83.581  27.510  1.00 37.10  ? 351 TRP A CD1   1 
ATOM   2512  C  CD2   . TRP A  1  325 ? -15.047 83.302  26.784  1.00 34.92  ? 351 TRP A CD2   1 
ATOM   2513  N  NE1   . TRP A  1  325 ? -13.290 84.700  26.778  1.00 34.97  ? 351 TRP A NE1   1 
ATOM   2514  C  CE2   . TRP A  1  325 ? -14.574 84.552  26.323  1.00 35.78  ? 351 TRP A CE2   1 
ATOM   2515  C  CE3   . TRP A  1  325 ? -16.350 82.905  26.454  1.00 35.72  ? 351 TRP A CE3   1 
ATOM   2516  C  CZ2   . TRP A  1  325 ? -15.364 85.416  25.544  1.00 37.25  ? 351 TRP A CZ2   1 
ATOM   2517  C  CZ3   . TRP A  1  325 ? -17.139 83.764  25.679  1.00 36.09  ? 351 TRP A CZ3   1 
ATOM   2518  C  CH2   . TRP A  1  325 ? -16.639 85.005  25.235  1.00 36.22  ? 351 TRP A CH2   1 
ATOM   2519  N  N     . ASN A  1  326 ? -12.671 78.446  28.956  1.00 46.20  ? 352 ASN A N     1 
ATOM   2520  C  CA    . ASN A  1  326 ? -12.897 77.112  29.524  1.00 46.17  ? 352 ASN A CA    1 
ATOM   2521  C  C     . ASN A  1  326 ? -12.155 77.012  30.844  1.00 46.88  ? 352 ASN A C     1 
ATOM   2522  O  O     . ASN A  1  326 ? -12.615 76.371  31.790  1.00 46.64  ? 352 ASN A O     1 
ATOM   2523  C  CB    . ASN A  1  326 ? -12.337 76.001  28.628  1.00 48.24  ? 352 ASN A CB    1 
ATOM   2524  C  CG    . ASN A  1  326 ? -13.080 75.845  27.328  1.00 48.98  ? 352 ASN A CG    1 
ATOM   2525  O  OD1   . ASN A  1  326 ? -12.482 75.491  26.324  1.00 50.44  ? 352 ASN A OD1   1 
ATOM   2526  N  ND2   . ASN A  1  326 ? -14.386 76.086  27.337  1.00 50.84  ? 352 ASN A ND2   1 
ATOM   2527  N  N     . ARG A  1  327 ? -10.972 77.612  30.873  1.00 46.60  ? 353 ARG A N     1 
ATOM   2528  C  CA    . ARG A  1  327 ? -10.129 77.599  32.054  1.00 48.16  ? 353 ARG A CA    1 
ATOM   2529  C  C     . ARG A  1  327 ? -10.810 78.117  33.331  1.00 48.53  ? 353 ARG A C     1 
ATOM   2530  O  O     . ARG A  1  327 ? -10.595 77.562  34.409  1.00 48.93  ? 353 ARG A O     1 
ATOM   2531  C  CB    . ARG A  1  327 ? -8.845  78.376  31.778  1.00 48.58  ? 353 ARG A CB    1 
ATOM   2532  C  CG    . ARG A  1  327 ? -7.983  77.742  30.695  1.00 48.99  ? 353 ARG A CG    1 
ATOM   2533  C  CD    . ARG A  1  327 ? -6.669  78.486  30.524  1.00 49.54  ? 353 ARG A CD    1 
ATOM   2534  N  NE    . ARG A  1  327 ? -5.954  78.571  31.790  1.00 52.28  ? 353 ARG A NE    1 
ATOM   2535  C  CZ    . ARG A  1  327 ? -5.653  79.713  32.399  1.00 52.55  ? 353 ARG A CZ    1 
ATOM   2536  N  NH1   . ARG A  1  327 ? -5.010  79.692  33.558  1.00 54.18  ? 353 ARG A NH1   1 
ATOM   2537  N  NH2   . ARG A  1  327 ? -5.968  80.871  31.837  1.00 49.70  ? 353 ARG A NH2   1 
ATOM   2538  N  N     . LEU A  1  328 ? -11.665 79.133  33.200  1.00 47.38  ? 354 LEU A N     1 
ATOM   2539  C  CA    . LEU A  1  328 ? -12.360 79.695  34.349  1.00 46.21  ? 354 LEU A CA    1 
ATOM   2540  C  C     . LEU A  1  328 ? -13.117 78.652  35.153  1.00 47.36  ? 354 LEU A C     1 
ATOM   2541  O  O     . LEU A  1  328 ? -13.398 78.869  36.329  1.00 50.46  ? 354 LEU A O     1 
ATOM   2542  C  CB    . LEU A  1  328 ? -13.310 80.817  33.939  1.00 45.01  ? 354 LEU A CB    1 
ATOM   2543  C  CG    . LEU A  1  328 ? -12.669 82.081  33.379  1.00 45.24  ? 354 LEU A CG    1 
ATOM   2544  C  CD1   . LEU A  1  328 ? -13.701 83.187  33.320  1.00 45.15  ? 354 LEU A CD1   1 
ATOM   2545  C  CD2   . LEU A  1  328 ? -11.511 82.503  34.257  1.00 47.87  ? 354 LEU A CD2   1 
ATOM   2546  N  N     . THR A  1  329 ? -13.425 77.514  34.539  1.00 44.90  ? 355 THR A N     1 
ATOM   2547  C  CA    . THR A  1  329 ? -14.142 76.458  35.240  1.00 43.62  ? 355 THR A CA    1 
ATOM   2548  C  C     . THR A  1  329 ? -13.200 75.432  35.857  1.00 45.58  ? 355 THR A C     1 
ATOM   2549  O  O     . THR A  1  329 ? -13.499 74.861  36.908  1.00 46.25  ? 355 THR A O     1 
ATOM   2550  C  CB    . THR A  1  329 ? -15.113 75.693  34.291  1.00 41.37  ? 355 THR A CB    1 
ATOM   2551  O  OG1   . THR A  1  329 ? -16.113 76.588  33.799  1.00 40.28  ? 355 THR A OG1   1 
ATOM   2552  C  CG2   . THR A  1  329 ? -15.814 74.539  35.009  1.00 37.68  ? 355 THR A CG2   1 
ATOM   2553  N  N     . ILE A  1  330 ? -12.045 75.226  35.233  1.00 47.19  ? 356 ILE A N     1 
ATOM   2554  C  CA    . ILE A  1  330 ? -11.127 74.191  35.705  1.00 48.34  ? 356 ILE A CA    1 
ATOM   2555  C  C     . ILE A  1  330 ? -9.697  74.537  36.127  1.00 49.01  ? 356 ILE A C     1 
ATOM   2556  O  O     . ILE A  1  330 ? -9.151  73.849  36.988  1.00 50.01  ? 356 ILE A O     1 
ATOM   2557  C  CB    . ILE A  1  330 ? -10.997 73.062  34.646  1.00 49.08  ? 356 ILE A CB    1 
ATOM   2558  C  CG1   . ILE A  1  330 ? -10.323 73.616  33.388  1.00 50.52  ? 356 ILE A CG1   1 
ATOM   2559  C  CG2   . ILE A  1  330 ? -12.361 72.493  34.288  1.00 46.62  ? 356 ILE A CG2   1 
ATOM   2560  C  CD1   . ILE A  1  330 ? -9.869  72.562  32.400  1.00 54.08  ? 356 ILE A CD1   1 
ATOM   2561  N  N     . SER A  1  331 ? -9.078  75.561  35.538  1.00 47.69  ? 357 SER A N     1 
ATOM   2562  C  CA    . SER A  1  331 ? -7.689  75.856  35.888  1.00 48.24  ? 357 SER A CA    1 
ATOM   2563  C  C     . SER A  1  331 ? -7.245  77.315  36.104  1.00 48.73  ? 357 SER A C     1 
ATOM   2564  O  O     . SER A  1  331 ? -6.054  77.629  35.966  1.00 47.43  ? 357 SER A O     1 
ATOM   2565  C  CB    . SER A  1  331 ? -6.772  75.205  34.849  1.00 47.42  ? 357 SER A CB    1 
ATOM   2566  O  OG    . SER A  1  331 ? -6.913  75.850  33.593  1.00 49.94  ? 357 SER A OG    1 
ATOM   2567  N  N     . VAL A  1  332 ? -8.171  78.209  36.439  1.00 48.82  ? 358 VAL A N     1 
ATOM   2568  C  CA    . VAL A  1  332 ? -7.789  79.604  36.663  1.00 48.34  ? 358 VAL A CA    1 
ATOM   2569  C  C     . VAL A  1  332 ? -6.876  79.676  37.894  1.00 48.19  ? 358 VAL A C     1 
ATOM   2570  O  O     . VAL A  1  332 ? -7.103  78.980  38.886  1.00 47.73  ? 358 VAL A O     1 
ATOM   2571  C  CB    . VAL A  1  332 ? -9.035  80.525  36.809  1.00 47.17  ? 358 VAL A CB    1 
ATOM   2572  C  CG1   . VAL A  1  332 ? -9.862  80.139  38.018  1.00 45.59  ? 358 VAL A CG1   1 
ATOM   2573  C  CG2   . VAL A  1  332 ? -8.610  81.976  36.859  1.00 46.64  ? 358 VAL A CG2   1 
ATOM   2574  N  N     . THR A  1  333 ? -5.807  80.461  37.793  1.00 48.45  ? 359 THR A N     1 
ATOM   2575  C  CA    . THR A  1  333 ? -4.842  80.591  38.878  1.00 50.54  ? 359 THR A CA    1 
ATOM   2576  C  C     . THR A  1  333 ? -5.124  81.745  39.840  1.00 53.81  ? 359 THR A C     1 
ATOM   2577  O  O     . THR A  1  333 ? -5.803  82.716  39.484  1.00 54.09  ? 359 THR A O     1 
ATOM   2578  C  CB    . THR A  1  333 ? -3.418  80.801  38.335  1.00 50.60  ? 359 THR A CB    1 
ATOM   2579  O  OG1   . THR A  1  333 ? -3.320  82.096  37.734  1.00 50.15  ? 359 THR A OG1   1 
ATOM   2580  C  CG2   . THR A  1  333 ? -3.074  79.753  37.305  1.00 50.43  ? 359 THR A CG2   1 
ATOM   2581  N  N     . ASP A  1  334 ? -4.532  81.655  41.035  1.00 55.79  ? 360 ASP A N     1 
ATOM   2582  C  CA    . ASP A  1  334 ? -4.669  82.677  42.069  1.00 55.72  ? 360 ASP A CA    1 
ATOM   2583  C  C     . ASP A  1  334 ? -4.167  84.027  41.585  1.00 55.57  ? 360 ASP A C     1 
ATOM   2584  O  O     . ASP A  1  334 ? -4.830  85.051  41.771  1.00 55.82  ? 360 ASP A O     1 
ATOM   2585  C  CB    . ASP A  1  334 ? -3.884  82.282  43.318  1.00 60.67  ? 360 ASP A CB    1 
ATOM   2586  C  CG    . ASP A  1  334 ? -4.661  81.359  44.224  1.00 65.78  ? 360 ASP A CG    1 
ATOM   2587  O  OD1   . ASP A  1  334 ? -4.302  80.167  44.313  1.00 68.58  ? 360 ASP A OD1   1 
ATOM   2588  O  OD2   . ASP A  1  334 ? -5.636  81.827  44.852  1.00 70.08  ? 360 ASP A OD2   1 
ATOM   2589  N  N     . THR A  1  335 ? -3.005  84.030  40.942  1.00 54.45  ? 361 THR A N     1 
ATOM   2590  C  CA    . THR A  1  335 ? -2.436  85.275  40.454  1.00 54.64  ? 361 THR A CA    1 
ATOM   2591  C  C     . THR A  1  335 ? -3.266  85.936  39.352  1.00 55.71  ? 361 THR A C     1 
ATOM   2592  O  O     . THR A  1  335 ? -3.237  87.162  39.198  1.00 54.31  ? 361 THR A O     1 
ATOM   2593  C  CB    . THR A  1  335 ? -0.923  85.122  40.101  1.00 54.81  ? 361 THR A CB    1 
ATOM   2594  O  OG1   . THR A  1  335 ? -0.599  85.881  38.926  1.00 52.94  ? 361 THR A OG1   1 
ATOM   2595  C  CG2   . THR A  1  335 ? -0.544  83.652  39.954  1.00 56.63  ? 361 THR A CG2   1 
ATOM   2596  N  N     . GLU A  1  336 ? -4.043  85.139  38.614  1.00 56.78  ? 362 GLU A N     1 
ATOM   2597  C  CA    . GLU A  1  336 ? -4.905  85.699  37.566  1.00 56.29  ? 362 GLU A CA    1 
ATOM   2598  C  C     . GLU A  1  336 ? -6.063  86.418  38.241  1.00 55.39  ? 362 GLU A C     1 
ATOM   2599  O  O     . GLU A  1  336 ? -6.445  87.513  37.824  1.00 53.65  ? 362 GLU A O     1 
ATOM   2600  C  CB    . GLU A  1  336 ? -5.442  84.615  36.632  1.00 56.43  ? 362 GLU A CB    1 
ATOM   2601  C  CG    . GLU A  1  336 ? -4.495  84.234  35.497  1.00 55.42  ? 362 GLU A CG    1 
ATOM   2602  C  CD    . GLU A  1  336 ? -4.974  83.008  34.744  1.00 54.49  ? 362 GLU A CD    1 
ATOM   2603  O  OE1   . GLU A  1  336 ? -5.291  81.992  35.406  1.00 53.18  ? 362 GLU A OE1   1 
ATOM   2604  O  OE2   . GLU A  1  336 ? -5.041  83.063  33.497  1.00 53.09  ? 362 GLU A OE2   1 
ATOM   2605  N  N     . VAL A  1  337 ? -6.623  85.781  39.272  1.00 54.32  ? 363 VAL A N     1 
ATOM   2606  C  CA    . VAL A  1  337 ? -7.715  86.368  40.048  1.00 55.32  ? 363 VAL A CA    1 
ATOM   2607  C  C     . VAL A  1  337 ? -7.234  87.671  40.710  1.00 57.54  ? 363 VAL A C     1 
ATOM   2608  O  O     . VAL A  1  337 ? -7.917  88.701  40.646  1.00 56.12  ? 363 VAL A O     1 
ATOM   2609  C  CB    . VAL A  1  337 ? -8.213  85.410  41.142  1.00 53.28  ? 363 VAL A CB    1 
ATOM   2610  C  CG1   . VAL A  1  337 ? -9.192  86.118  42.055  1.00 50.96  ? 363 VAL A CG1   1 
ATOM   2611  C  CG2   . VAL A  1  337 ? -8.875  84.203  40.506  1.00 51.96  ? 363 VAL A CG2   1 
ATOM   2612  N  N     . GLU A  1  338 ? -6.040  87.625  41.307  1.00 58.07  ? 364 GLU A N     1 
ATOM   2613  C  CA    . GLU A  1  338 ? -5.461  88.795  41.954  1.00 58.64  ? 364 GLU A CA    1 
ATOM   2614  C  C     . GLU A  1  338 ? -5.208  89.929  40.970  1.00 58.08  ? 364 GLU A C     1 
ATOM   2615  O  O     . GLU A  1  338 ? -5.546  91.073  41.259  1.00 59.22  ? 364 GLU A O     1 
ATOM   2616  C  CB    . GLU A  1  338 ? -4.163  88.443  42.689  1.00 60.95  ? 364 GLU A CB    1 
ATOM   2617  C  CG    . GLU A  1  338 ? -4.349  87.540  43.915  1.00 64.10  ? 364 GLU A CG    1 
ATOM   2618  C  CD    . GLU A  1  338 ? -5.341  88.098  44.928  1.00 66.50  ? 364 GLU A CD    1 
ATOM   2619  O  OE1   . GLU A  1  338 ? -6.278  87.358  45.309  1.00 67.41  ? 364 GLU A OE1   1 
ATOM   2620  O  OE2   . GLU A  1  338 ? -5.184  89.274  45.336  1.00 66.84  ? 364 GLU A OE2   1 
ATOM   2621  N  N     . ARG A  1  339 ? -4.635  89.622  39.807  1.00 57.73  ? 365 ARG A N     1 
ATOM   2622  C  CA    . ARG A  1  339 ? -4.368  90.661  38.809  1.00 56.94  ? 365 ARG A CA    1 
ATOM   2623  C  C     . ARG A  1  339 ? -5.686  91.341  38.447  1.00 57.52  ? 365 ARG A C     1 
ATOM   2624  O  O     . ARG A  1  339 ? -5.729  92.551  38.219  1.00 58.62  ? 365 ARG A O     1 
ATOM   2625  C  CB    . ARG A  1  339 ? -3.740  90.077  37.535  1.00 54.35  ? 365 ARG A CB    1 
ATOM   2626  C  CG    . ARG A  1  339 ? -3.153  91.149  36.605  1.00 54.59  ? 365 ARG A CG    1 
ATOM   2627  C  CD    . ARG A  1  339 ? -3.049  90.717  35.134  1.00 53.53  ? 365 ARG A CD    1 
ATOM   2628  N  NE    . ARG A  1  339 ? -4.326  90.858  34.432  1.00 54.65  ? 365 ARG A NE    1 
ATOM   2629  C  CZ    . ARG A  1  339 ? -4.538  91.671  33.398  1.00 54.26  ? 365 ARG A CZ    1 
ATOM   2630  N  NH1   . ARG A  1  339 ? -5.739  91.727  32.847  1.00 56.16  ? 365 ARG A NH1   1 
ATOM   2631  N  NH2   . ARG A  1  339 ? -3.558  92.425  32.905  1.00 53.14  ? 365 ARG A NH2   1 
ATOM   2632  N  N     . ALA A  1  340 ? -6.760  90.551  38.430  1.00 57.24  ? 366 ALA A N     1 
ATOM   2633  C  CA    . ALA A  1  340 ? -8.085  91.049  38.091  1.00 58.02  ? 366 ALA A CA    1 
ATOM   2634  C  C     . ALA A  1  340 ? -8.609  92.001  39.163  1.00 58.68  ? 366 ALA A C     1 
ATOM   2635  O  O     . ALA A  1  340 ? -9.065  93.106  38.843  1.00 60.02  ? 366 ALA A O     1 
ATOM   2636  C  CB    . ALA A  1  340 ? -9.047  89.896  37.889  1.00 58.28  ? 366 ALA A CB    1 
ATOM   2637  N  N     . LYS A  1  341 ? -8.538  91.578  40.426  1.00 57.01  ? 367 LYS A N     1 
ATOM   2638  C  CA    . LYS A  1  341 ? -8.988  92.409  41.545  1.00 54.58  ? 367 LYS A CA    1 
ATOM   2639  C  C     . LYS A  1  341 ? -8.437  93.838  41.452  1.00 54.22  ? 367 LYS A C     1 
ATOM   2640  O  O     . LYS A  1  341 ? -9.201  94.808  41.437  1.00 53.14  ? 367 LYS A O     1 
ATOM   2641  C  CB    . LYS A  1  341 ? -8.576  91.782  42.875  1.00 50.80  ? 367 LYS A CB    1 
ATOM   2642  C  CG    . LYS A  1  341 ? -9.441  90.610  43.292  1.00 49.61  ? 367 LYS A CG    1 
ATOM   2643  C  CD    . LYS A  1  341 ? -8.852  89.902  44.498  1.00 47.84  ? 367 LYS A CD    1 
ATOM   2644  C  CE    . LYS A  1  341 ? -9.702  88.721  44.913  1.00 45.48  ? 367 LYS A CE    1 
ATOM   2645  N  NZ    . LYS A  1  341 ? -9.039  87.960  46.007  1.00 45.94  ? 367 LYS A NZ    1 
ATOM   2646  N  N     . SER A  1  342 ? -7.121  93.955  41.329  1.00 52.92  ? 368 SER A N     1 
ATOM   2647  C  CA    . SER A  1  342 ? -6.482  95.257  41.235  1.00 55.07  ? 368 SER A CA    1 
ATOM   2648  C  C     . SER A  1  342 ? -7.047  96.066  40.077  1.00 57.05  ? 368 SER A C     1 
ATOM   2649  O  O     . SER A  1  342 ? -7.517  97.191  40.260  1.00 59.01  ? 368 SER A O     1 
ATOM   2650  C  CB    . SER A  1  342 ? -4.967  95.106  41.059  1.00 53.71  ? 368 SER A CB    1 
ATOM   2651  O  OG    . SER A  1  342 ? -4.403  94.329  42.098  1.00 55.63  ? 368 SER A OG    1 
ATOM   2652  N  N     . LEU A  1  343 ? -7.038  95.469  38.889  1.00 59.59  ? 369 LEU A N     1 
ATOM   2653  C  CA    . LEU A  1  343 ? -7.519  96.144  37.690  1.00 59.22  ? 369 LEU A CA    1 
ATOM   2654  C  C     . LEU A  1  343 ? -9.002  96.492  37.700  1.00 59.05  ? 369 LEU A C     1 
ATOM   2655  O  O     . LEU A  1  343 ? -9.400  97.485  37.083  1.00 58.30  ? 369 LEU A O     1 
ATOM   2656  C  CB    . LEU A  1  343 ? -7.145  95.344  36.442  1.00 59.51  ? 369 LEU A CB    1 
ATOM   2657  C  CG    . LEU A  1  343 ? -5.644  95.335  36.150  1.00 60.04  ? 369 LEU A CG    1 
ATOM   2658  C  CD1   . LEU A  1  343 ? -5.360  94.538  34.891  1.00 59.72  ? 369 LEU A CD1   1 
ATOM   2659  C  CD2   . LEU A  1  343 ? -5.140  96.768  36.000  1.00 59.12  ? 369 LEU A CD2   1 
ATOM   2660  N  N     . LEU A  1  344 ? -9.814  95.689  38.392  1.00 58.25  ? 370 LEU A N     1 
ATOM   2661  C  CA    . LEU A  1  344 ? -11.249 95.963  38.479  1.00 60.07  ? 370 LEU A CA    1 
ATOM   2662  C  C     . LEU A  1  344 ? -11.448 97.231  39.322  1.00 62.99  ? 370 LEU A C     1 
ATOM   2663  O  O     . LEU A  1  344 ? -12.228 98.116  38.957  1.00 64.15  ? 370 LEU A O     1 
ATOM   2664  C  CB    . LEU A  1  344 ? -12.002 94.799  39.127  1.00 56.75  ? 370 LEU A CB    1 
ATOM   2665  C  CG    . LEU A  1  344 ? -13.411 94.488  38.604  1.00 55.16  ? 370 LEU A CG    1 
ATOM   2666  C  CD1   . LEU A  1  344 ? -14.190 93.770  39.676  1.00 53.55  ? 370 LEU A CD1   1 
ATOM   2667  C  CD2   . LEU A  1  344 ? -14.157 95.731  38.183  1.00 54.89  ? 370 LEU A CD2   1 
ATOM   2668  N  N     . LYS A  1  345 ? -10.716 97.316  40.434  1.00 64.48  ? 371 LYS A N     1 
ATOM   2669  C  CA    . LYS A  1  345 ? -10.783 98.461  41.329  1.00 64.30  ? 371 LYS A CA    1 
ATOM   2670  C  C     . LYS A  1  345 ? -10.406 99.728  40.585  1.00 65.75  ? 371 LYS A C     1 
ATOM   2671  O  O     . LYS A  1  345 ? -11.073 100.755 40.709  1.00 66.65  ? 371 LYS A O     1 
ATOM   2672  C  CB    . LYS A  1  345 ? -9.820  98.282  42.497  1.00 63.94  ? 371 LYS A CB    1 
ATOM   2673  C  CG    . LYS A  1  345 ? -10.195 97.206  43.494  1.00 63.89  ? 371 LYS A CG    1 
ATOM   2674  C  CD    . LYS A  1  345 ? -9.091  97.094  44.524  1.00 64.55  ? 371 LYS A CD    1 
ATOM   2675  C  CE    . LYS A  1  345 ? -9.340  95.962  45.492  1.00 66.14  ? 371 LYS A CE    1 
ATOM   2676  N  NZ    . LYS A  1  345 ? -8.134  95.733  46.347  1.00 66.22  ? 371 LYS A NZ    1 
ATOM   2677  N  N     . LEU A  1  346 ? -9.332  99.650  39.808  1.00 66.64  ? 372 LEU A N     1 
ATOM   2678  C  CA    . LEU A  1  346 ? -8.854  100.800 39.052  1.00 68.55  ? 372 LEU A CA    1 
ATOM   2679  C  C     . LEU A  1  346 ? -9.883  101.328 38.057  1.00 71.27  ? 372 LEU A C     1 
ATOM   2680  O  O     . LEU A  1  346 ? -10.056 102.542 37.927  1.00 72.07  ? 372 LEU A O     1 
ATOM   2681  C  CB    . LEU A  1  346 ? -7.552  100.455 38.324  1.00 66.87  ? 372 LEU A CB    1 
ATOM   2682  C  CG    . LEU A  1  346 ? -6.929  101.562 37.470  1.00 66.23  ? 372 LEU A CG    1 
ATOM   2683  C  CD1   . LEU A  1  346 ? -6.398  102.673 38.357  1.00 66.83  ? 372 LEU A CD1   1 
ATOM   2684  C  CD2   . LEU A  1  346 ? -5.814  100.995 36.617  1.00 64.98  ? 372 LEU A CD2   1 
ATOM   2685  N  N     . GLN A  1  347 ? -10.572 100.425 37.361  1.00 74.22  ? 373 GLN A N     1 
ATOM   2686  C  CA    . GLN A  1  347 ? -11.559 100.848 36.374  1.00 76.85  ? 373 GLN A CA    1 
ATOM   2687  C  C     . GLN A  1  347 ? -12.860 101.279 37.028  1.00 76.43  ? 373 GLN A C     1 
ATOM   2688  O  O     . GLN A  1  347 ? -13.471 102.254 36.600  1.00 77.28  ? 373 GLN A O     1 
ATOM   2689  C  CB    . GLN A  1  347 ? -11.816 99.760  35.311  1.00 80.08  ? 373 GLN A CB    1 
ATOM   2690  C  CG    . GLN A  1  347 ? -12.768 98.629  35.729  1.00 83.54  ? 373 GLN A CG    1 
ATOM   2691  C  CD    . GLN A  1  347 ? -13.750 98.250  34.622  1.00 85.37  ? 373 GLN A CD    1 
ATOM   2692  O  OE1   . GLN A  1  347 ? -14.271 99.121  33.914  1.00 86.82  ? 373 GLN A OE1   1 
ATOM   2693  N  NE2   . GLN A  1  347 ? -14.015 96.951  34.476  1.00 84.06  ? 373 GLN A NE2   1 
ATOM   2694  N  N     . LEU A  1  348 ? -13.276 100.555 38.065  1.00 75.79  ? 374 LEU A N     1 
ATOM   2695  C  CA    . LEU A  1  348 ? -14.502 100.882 38.779  1.00 76.23  ? 374 LEU A CA    1 
ATOM   2696  C  C     . LEU A  1  348 ? -14.327 102.238 39.470  1.00 78.52  ? 374 LEU A C     1 
ATOM   2697  O  O     . LEU A  1  348 ? -15.296 102.970 39.691  1.00 79.13  ? 374 LEU A O     1 
ATOM   2698  C  CB    . LEU A  1  348 ? -14.823 99.795  39.800  1.00 74.92  ? 374 LEU A CB    1 
ATOM   2699  C  CG    . LEU A  1  348 ? -16.312 99.527  40.013  1.00 75.27  ? 374 LEU A CG    1 
ATOM   2700  C  CD1   . LEU A  1  348 ? -16.979 99.258  38.667  1.00 73.38  ? 374 LEU A CD1   1 
ATOM   2701  C  CD2   . LEU A  1  348 ? -16.501 98.344  40.956  1.00 74.51  ? 374 LEU A CD2   1 
ATOM   2702  N  N     . GLY A  1  349 ? -13.076 102.564 39.796  1.00 79.91  ? 375 GLY A N     1 
ATOM   2703  C  CA    . GLY A  1  349 ? -12.769 103.835 40.419  1.00 80.27  ? 375 GLY A CA    1 
ATOM   2704  C  C     . GLY A  1  349 ? -12.969 104.931 39.393  1.00 81.58  ? 375 GLY A C     1 
ATOM   2705  O  O     . GLY A  1  349 ? -13.873 105.747 39.533  1.00 82.77  ? 375 GLY A O     1 
ATOM   2706  N  N     . GLN A  1  350 ? -12.182 104.892 38.322  1.00 82.74  ? 376 GLN A N     1 
ATOM   2707  C  CA    . GLN A  1  350 ? -12.255 105.881 37.243  1.00 84.96  ? 376 GLN A CA    1 
ATOM   2708  C  C     . GLN A  1  350 ? -13.657 106.142 36.680  1.00 86.85  ? 376 GLN A C     1 
ATOM   2709  O  O     . GLN A  1  350 ? -13.863 107.116 35.952  1.00 85.91  ? 376 GLN A O     1 
ATOM   2710  C  CB    . GLN A  1  350 ? -11.346 105.465 36.091  1.00 84.31  ? 376 GLN A CB    1 
ATOM   2711  C  CG    . GLN A  1  350 ? -9.879  105.444 36.414  1.00 83.81  ? 376 GLN A CG    1 
ATOM   2712  C  CD    . GLN A  1  350 ? -9.072  104.875 35.273  1.00 84.94  ? 376 GLN A CD    1 
ATOM   2713  O  OE1   . GLN A  1  350 ? -8.889  103.660 35.180  1.00 86.02  ? 376 GLN A OE1   1 
ATOM   2714  N  NE2   . GLN A  1  350 ? -8.602  105.744 34.382  1.00 84.08  ? 376 GLN A NE2   1 
ATOM   2715  N  N     . LEU A  1  351 ? -14.596 105.240 36.956  1.00 89.44  ? 377 LEU A N     1 
ATOM   2716  C  CA    . LEU A  1  351 ? -15.967 105.402 36.483  1.00 92.60  ? 377 LEU A CA    1 
ATOM   2717  C  C     . LEU A  1  351 ? -16.786 106.151 37.519  1.00 93.58  ? 377 LEU A C     1 
ATOM   2718  O  O     . LEU A  1  351 ? -17.369 107.194 37.221  1.00 94.23  ? 377 LEU A O     1 
ATOM   2719  C  CB    . LEU A  1  351 ? -16.625 104.048 36.191  1.00 94.12  ? 377 LEU A CB    1 
ATOM   2720  C  CG    . LEU A  1  351 ? -16.750 103.629 34.720  1.00 96.15  ? 377 LEU A CG    1 
ATOM   2721  C  CD1   . LEU A  1  351 ? -17.486 102.297 34.639  1.00 97.20  ? 377 LEU A CD1   1 
ATOM   2722  C  CD2   . LEU A  1  351 ? -17.491 104.697 33.917  1.00 95.77  ? 377 LEU A CD2   1 
ATOM   2723  N  N     . TYR A  1  352 ? -16.811 105.620 38.739  1.00 94.22  ? 378 TYR A N     1 
ATOM   2724  C  CA    . TYR A  1  352 ? -17.560 106.233 39.827  1.00 94.60  ? 378 TYR A CA    1 
ATOM   2725  C  C     . TYR A  1  352 ? -16.999 107.576 40.290  1.00 94.47  ? 378 TYR A C     1 
ATOM   2726  O  O     . TYR A  1  352 ? -17.702 108.345 40.952  1.00 95.88  ? 378 TYR A O     1 
ATOM   2727  C  CB    . TYR A  1  352 ? -17.685 105.268 41.009  1.00 95.40  ? 378 TYR A CB    1 
ATOM   2728  C  CG    . TYR A  1  352 ? -18.775 104.230 40.844  1.00 97.60  ? 378 TYR A CG    1 
ATOM   2729  C  CD1   . TYR A  1  352 ? -19.381 103.646 41.957  1.00 98.61  ? 378 TYR A CD1   1 
ATOM   2730  C  CD2   . TYR A  1  352 ? -19.206 103.831 39.577  1.00 98.94  ? 378 TYR A CD2   1 
ATOM   2731  C  CE1   . TYR A  1  352 ? -20.390 102.689 41.814  1.00 99.64  ? 378 TYR A CE1   1 
ATOM   2732  C  CE2   . TYR A  1  352 ? -20.214 102.875 39.422  1.00 99.52  ? 378 TYR A CE2   1 
ATOM   2733  C  CZ    . TYR A  1  352 ? -20.801 102.309 40.542  1.00 99.67  ? 378 TYR A CZ    1 
ATOM   2734  O  OH    . TYR A  1  352 ? -21.798 101.369 40.391  1.00 99.07  ? 378 TYR A OH    1 
ATOM   2735  N  N     . GLU A  1  353 ? -15.753 107.877 39.927  1.00 92.85  ? 379 GLU A N     1 
ATOM   2736  C  CA    . GLU A  1  353 ? -15.158 109.144 40.331  1.00 92.46  ? 379 GLU A CA    1 
ATOM   2737  C  C     . GLU A  1  353 ? -14.287 109.864 39.310  1.00 92.50  ? 379 GLU A C     1 
ATOM   2738  O  O     . GLU A  1  353 ? -13.059 109.858 39.394  1.00 91.78  ? 379 GLU A O     1 
ATOM   2739  C  CB    . GLU A  1  353 ? -14.434 109.027 41.685  1.00 91.61  ? 379 GLU A CB    1 
ATOM   2740  C  CG    . GLU A  1  353 ? -13.427 107.906 41.806  1.00 89.65  ? 379 GLU A CG    1 
ATOM   2741  C  CD    . GLU A  1  353 ? -12.653 107.956 43.110  1.00 88.37  ? 379 GLU A CD    1 
ATOM   2742  O  OE1   . GLU A  1  353 ? -11.458 108.307 43.066  1.00 87.54  ? 379 GLU A OE1   1 
ATOM   2743  O  OE2   . GLU A  1  353 ? -13.232 107.645 44.173  1.00 87.25  ? 379 GLU A OE2   1 
ATOM   2744  N  N     . SER A  1  354 ? -14.949 110.497 38.348  1.00 93.28  ? 380 SER A N     1 
ATOM   2745  C  CA    . SER A  1  354 ? -14.270 111.276 37.324  1.00 94.68  ? 380 SER A CA    1 
ATOM   2746  C  C     . SER A  1  354 ? -14.579 112.748 37.606  1.00 96.65  ? 380 SER A C     1 
ATOM   2747  O  O     . SER A  1  354 ? -15.346 113.067 38.525  1.00 96.38  ? 380 SER A O     1 
ATOM   2748  C  CB    . SER A  1  354 ? -14.783 110.903 35.933  1.00 94.32  ? 380 SER A CB    1 
ATOM   2749  O  OG    . SER A  1  354 ? -14.121 111.658 34.931  1.00 94.09  ? 380 SER A OG    1 
ATOM   2750  N  N     . GLY A  1  355 ? -13.984 113.643 36.819  1.00 98.08  ? 381 GLY A N     1 
ATOM   2751  C  CA    . GLY A  1  355 ? -14.227 115.066 37.005  1.00 99.18  ? 381 GLY A CA    1 
ATOM   2752  C  C     . GLY A  1  355 ? -15.418 115.580 36.210  1.00 99.46  ? 381 GLY A C     1 
ATOM   2753  O  O     . GLY A  1  355 ? -15.379 116.692 35.672  1.00 99.94  ? 381 GLY A O     1 
ATOM   2754  N  N     . ASN A  1  356 ? -16.477 114.775 36.133  1.00 98.78  ? 382 ASN A N     1 
ATOM   2755  C  CA    . ASN A  1  356 ? -17.673 115.156 35.391  1.00 98.25  ? 382 ASN A CA    1 
ATOM   2756  C  C     . ASN A  1  356 ? -18.940 114.715 36.112  1.00 97.81  ? 382 ASN A C     1 
ATOM   2757  O  O     . ASN A  1  356 ? -19.269 113.528 36.155  1.00 97.56  ? 382 ASN A O     1 
ATOM   2758  C  CB    . ASN A  1  356 ? -17.641 114.572 33.977  1.00 98.68  ? 382 ASN A CB    1 
ATOM   2759  C  CG    . ASN A  1  356 ? -18.674 115.204 33.060  1.00 99.53  ? 382 ASN A CG    1 
ATOM   2760  O  OD1   . ASN A  1  356 ? -19.586 115.899 33.512  1.00 100.03 ? 382 ASN A OD1   1 
ATOM   2761  N  ND2   . ASN A  1  356 ? -18.527 114.975 31.759  1.00 100.28 ? 382 ASN A ND2   1 
ATOM   2762  N  N     . PRO A  1  357 ? -19.676 115.684 36.679  1.00 97.61  ? 383 PRO A N     1 
ATOM   2763  C  CA    . PRO A  1  357 ? -20.926 115.479 37.420  1.00 96.89  ? 383 PRO A CA    1 
ATOM   2764  C  C     . PRO A  1  357 ? -22.055 114.806 36.637  1.00 95.90  ? 383 PRO A C     1 
ATOM   2765  O  O     . PRO A  1  357 ? -22.878 114.104 37.229  1.00 96.07  ? 383 PRO A O     1 
ATOM   2766  C  CB    . PRO A  1  357 ? -21.307 116.901 37.834  1.00 97.21  ? 383 PRO A CB    1 
ATOM   2767  C  CG    . PRO A  1  357 ? -19.979 117.565 37.996  1.00 97.47  ? 383 PRO A CG    1 
ATOM   2768  C  CD    . PRO A  1  357 ? -19.254 117.093 36.763  1.00 97.52  ? 383 PRO A CD    1 
ATOM   2769  N  N     . VAL A  1  358 ? -22.094 115.005 35.318  1.00 94.13  ? 384 VAL A N     1 
ATOM   2770  C  CA    . VAL A  1  358 ? -23.152 114.405 34.501  1.00 92.78  ? 384 VAL A CA    1 
ATOM   2771  C  C     . VAL A  1  358 ? -23.110 112.875 34.532  1.00 91.26  ? 384 VAL A C     1 
ATOM   2772  O  O     . VAL A  1  358 ? -24.155 112.222 34.517  1.00 91.09  ? 384 VAL A O     1 
ATOM   2773  C  CB    . VAL A  1  358 ? -23.137 114.913 33.028  1.00 93.17  ? 384 VAL A CB    1 
ATOM   2774  C  CG1   . VAL A  1  358 ? -23.080 116.430 32.988  1.00 92.82  ? 384 VAL A CG1   1 
ATOM   2775  C  CG2   . VAL A  1  358 ? -21.986 114.307 32.251  1.00 95.44  ? 384 VAL A CG2   1 
ATOM   2776  N  N     . ASN A  1  359 ? -21.905 112.312 34.596  1.00 89.29  ? 385 ASN A N     1 
ATOM   2777  C  CA    . ASN A  1  359 ? -21.747 110.863 34.653  1.00 87.73  ? 385 ASN A CA    1 
ATOM   2778  C  C     . ASN A  1  359 ? -22.236 110.393 36.012  1.00 86.55  ? 385 ASN A C     1 
ATOM   2779  O  O     . ASN A  1  359 ? -22.926 109.380 36.114  1.00 85.95  ? 385 ASN A O     1 
ATOM   2780  C  CB    . ASN A  1  359 ? -20.281 110.458 34.462  1.00 87.99  ? 385 ASN A CB    1 
ATOM   2781  C  CG    . ASN A  1  359 ? -19.753 110.779 33.070  1.00 88.47  ? 385 ASN A CG    1 
ATOM   2782  O  OD1   . ASN A  1  359 ? -18.540 110.778 32.843  1.00 87.80  ? 385 ASN A OD1   1 
ATOM   2783  N  ND2   . ASN A  1  359 ? -20.660 111.047 32.130  1.00 87.95  ? 385 ASN A ND2   1 
ATOM   2784  N  N     . ASP A  1  360 ? -21.886 111.155 37.048  1.00 85.48  ? 386 ASP A N     1 
ATOM   2785  C  CA    . ASP A  1  360 ? -22.286 110.849 38.419  1.00 84.97  ? 386 ASP A CA    1 
ATOM   2786  C  C     . ASP A  1  360 ? -23.804 110.854 38.571  1.00 84.12  ? 386 ASP A C     1 
ATOM   2787  O  O     . ASP A  1  360 ? -24.374 110.007 39.272  1.00 82.89  ? 386 ASP A O     1 
ATOM   2788  C  CB    . ASP A  1  360 ? -21.670 111.857 39.391  1.00 85.73  ? 386 ASP A CB    1 
ATOM   2789  C  CG    . ASP A  1  360 ? -20.201 111.604 39.641  1.00 86.46  ? 386 ASP A CG    1 
ATOM   2790  O  OD1   . ASP A  1  360 ? -19.369 112.350 39.083  1.00 86.10  ? 386 ASP A OD1   1 
ATOM   2791  O  OD2   . ASP A  1  360 ? -19.882 110.662 40.403  1.00 87.99  ? 386 ASP A OD2   1 
ATOM   2792  N  N     . ALA A  1  361 ? -24.447 111.815 37.909  1.00 82.85  ? 387 ALA A N     1 
ATOM   2793  C  CA    . ALA A  1  361 ? -25.899 111.947 37.943  1.00 83.03  ? 387 ALA A CA    1 
ATOM   2794  C  C     . ALA A  1  361 ? -26.565 110.681 37.405  1.00 83.39  ? 387 ALA A C     1 
ATOM   2795  O  O     . ALA A  1  361 ? -27.388 110.058 38.089  1.00 82.88  ? 387 ALA A O     1 
ATOM   2796  C  CB    . ALA A  1  361 ? -26.330 113.152 37.130  1.00 82.57  ? 387 ALA A CB    1 
ATOM   2797  N  N     . ASN A  1  362 ? -26.178 110.296 36.188  1.00 83.17  ? 388 ASN A N     1 
ATOM   2798  C  CA    . ASN A  1  362 ? -26.710 109.104 35.536  1.00 82.22  ? 388 ASN A CA    1 
ATOM   2799  C  C     . ASN A  1  362 ? -26.534 107.863 36.401  1.00 83.25  ? 388 ASN A C     1 
ATOM   2800  O  O     . ASN A  1  362 ? -27.494 107.133 36.654  1.00 83.40  ? 388 ASN A O     1 
ATOM   2801  C  CB    . ASN A  1  362 ? -26.024 108.888 34.189  1.00 79.96  ? 388 ASN A CB    1 
ATOM   2802  C  CG    . ASN A  1  362 ? -26.579 109.778 33.105  1.00 78.49  ? 388 ASN A CG    1 
ATOM   2803  O  OD1   . ASN A  1  362 ? -26.028 110.835 32.799  1.00 77.41  ? 388 ASN A OD1   1 
ATOM   2804  N  ND2   . ASN A  1  362 ? -27.668 109.341 32.497  1.00 78.39  ? 388 ASN A ND2   1 
ATOM   2805  N  N     . LEU A  1  363 ? -25.310 107.653 36.881  1.00 83.99  ? 389 LEU A N     1 
ATOM   2806  C  CA    . LEU A  1  363 ? -24.996 106.499 37.715  1.00 85.06  ? 389 LEU A CA    1 
ATOM   2807  C  C     . LEU A  1  363 ? -25.822 106.487 38.999  1.00 85.23  ? 389 LEU A C     1 
ATOM   2808  O  O     . LEU A  1  363 ? -26.361 105.445 39.381  1.00 85.29  ? 389 LEU A O     1 
ATOM   2809  C  CB    . LEU A  1  363 ? -23.499 106.473 38.049  1.00 86.45  ? 389 LEU A CB    1 
ATOM   2810  C  CG    . LEU A  1  363 ? -22.511 106.405 36.872  1.00 87.77  ? 389 LEU A CG    1 
ATOM   2811  C  CD1   . LEU A  1  363 ? -21.080 106.559 37.375  1.00 87.94  ? 389 LEU A CD1   1 
ATOM   2812  C  CD2   . LEU A  1  363 ? -22.671 105.099 36.103  1.00 87.49  ? 389 LEU A CD2   1 
ATOM   2813  N  N     . LEU A  1  364 ? -25.950 107.655 39.631  1.00 84.72  ? 390 LEU A N     1 
ATOM   2814  C  CA    . LEU A  1  364 ? -26.705 107.791 40.879  1.00 84.02  ? 390 LEU A CA    1 
ATOM   2815  C  C     . LEU A  1  364 ? -28.187 107.493 40.672  1.00 83.79  ? 390 LEU A C     1 
ATOM   2816  O  O     . LEU A  1  364 ? -28.775 106.682 41.397  1.00 82.23  ? 390 LEU A O     1 
ATOM   2817  C  CB    . LEU A  1  364 ? -26.552 109.204 41.446  1.00 84.06  ? 390 LEU A CB    1 
ATOM   2818  C  CG    . LEU A  1  364 ? -26.594 109.422 42.969  1.00 83.31  ? 390 LEU A CG    1 
ATOM   2819  C  CD1   . LEU A  1  364 ? -26.725 110.906 43.246  1.00 82.25  ? 390 LEU A CD1   1 
ATOM   2820  C  CD2   . LEU A  1  364 ? -27.739 108.681 43.623  1.00 82.01  ? 390 LEU A CD2   1 
ATOM   2821  N  N     . GLY A  1  365 ? -28.786 108.173 39.697  1.00 83.81  ? 391 GLY A N     1 
ATOM   2822  C  CA    . GLY A  1  365 ? -30.194 107.974 39.405  1.00 85.07  ? 391 GLY A CA    1 
ATOM   2823  C  C     . GLY A  1  365 ? -30.517 106.540 39.032  1.00 86.05  ? 391 GLY A C     1 
ATOM   2824  O  O     . GLY A  1  365 ? -31.432 105.928 39.594  1.00 85.15  ? 391 GLY A O     1 
ATOM   2825  N  N     . ALA A  1  366 ? -29.727 105.994 38.110  1.00 87.00  ? 392 ALA A N     1 
ATOM   2826  C  CA    . ALA A  1  366 ? -29.902 104.626 37.635  1.00 87.51  ? 392 ALA A CA    1 
ATOM   2827  C  C     . ALA A  1  366 ? -29.876 103.597 38.762  1.00 87.98  ? 392 ALA A C     1 
ATOM   2828  O  O     . ALA A  1  366 ? -30.724 102.703 38.812  1.00 87.09  ? 392 ALA A O     1 
ATOM   2829  C  CB    . ALA A  1  366 ? -28.838 104.298 36.599  1.00 87.51  ? 392 ALA A CB    1 
ATOM   2830  N  N     . GLU A  1  367 ? -28.909 103.733 39.668  1.00 89.20  ? 393 GLU A N     1 
ATOM   2831  C  CA    . GLU A  1  367 ? -28.773 102.808 40.789  1.00 91.12  ? 393 GLU A CA    1 
ATOM   2832  C  C     . GLU A  1  367 ? -29.877 102.909 41.834  1.00 92.43  ? 393 GLU A C     1 
ATOM   2833  O  O     . GLU A  1  367 ? -30.398 101.884 42.289  1.00 92.39  ? 393 GLU A O     1 
ATOM   2834  C  CB    . GLU A  1  367 ? -27.414 102.967 41.469  1.00 92.12  ? 393 GLU A CB    1 
ATOM   2835  C  CG    . GLU A  1  367 ? -26.382 101.939 41.042  1.00 94.18  ? 393 GLU A CG    1 
ATOM   2836  C  CD    . GLU A  1  367 ? -25.544 101.444 42.208  1.00 95.26  ? 393 GLU A CD    1 
ATOM   2837  O  OE1   . GLU A  1  367 ? -24.409 101.940 42.383  1.00 95.46  ? 393 GLU A OE1   1 
ATOM   2838  O  OE2   . GLU A  1  367 ? -26.024 100.559 42.953  1.00 95.25  ? 393 GLU A OE2   1 
ATOM   2839  N  N     . VAL A  1  368 ? -30.228 104.136 42.221  1.00 93.52  ? 394 VAL A N     1 
ATOM   2840  C  CA    . VAL A  1  368 ? -31.267 104.347 43.227  1.00 94.10  ? 394 VAL A CA    1 
ATOM   2841  C  C     . VAL A  1  368 ? -32.636 103.895 42.733  1.00 94.48  ? 394 VAL A C     1 
ATOM   2842  O  O     . VAL A  1  368 ? -33.509 103.562 43.534  1.00 94.59  ? 394 VAL A O     1 
ATOM   2843  C  CB    . VAL A  1  368 ? -31.335 105.819 43.687  1.00 93.98  ? 394 VAL A CB    1 
ATOM   2844  C  CG1   . VAL A  1  368 ? -30.008 106.241 44.277  1.00 94.05  ? 394 VAL A CG1   1 
ATOM   2845  C  CG2   . VAL A  1  368 ? -31.703 106.717 42.534  1.00 95.22  ? 394 VAL A CG2   1 
ATOM   2846  N  N     . LEU A  1  369 ? -32.801 103.868 41.412  1.00 94.81  ? 395 LEU A N     1 
ATOM   2847  C  CA    . LEU A  1  369 ? -34.049 103.447 40.780  1.00 95.91  ? 395 LEU A CA    1 
ATOM   2848  C  C     . LEU A  1  369 ? -34.256 101.932 40.797  1.00 97.45  ? 395 LEU A C     1 
ATOM   2849  O  O     . LEU A  1  369 ? -35.394 101.458 40.774  1.00 97.66  ? 395 LEU A O     1 
ATOM   2850  C  CB    . LEU A  1  369 ? -34.096 103.932 39.329  1.00 95.09  ? 395 LEU A CB    1 
ATOM   2851  C  CG    . LEU A  1  369 ? -34.670 105.314 39.014  1.00 94.67  ? 395 LEU A CG    1 
ATOM   2852  C  CD1   . LEU A  1  369 ? -34.230 105.755 37.631  1.00 93.39  ? 395 LEU A CD1   1 
ATOM   2853  C  CD2   . LEU A  1  369 ? -36.188 105.284 39.113  1.00 94.23  ? 395 LEU A CD2   1 
ATOM   2854  N  N     . ILE A  1  370 ? -33.160 101.176 40.843  1.00 99.16  ? 396 ILE A N     1 
ATOM   2855  C  CA    . ILE A  1  370 ? -33.234 99.716  40.823  1.00 100.50 ? 396 ILE A CA    1 
ATOM   2856  C  C     . ILE A  1  370 ? -33.091 99.027  42.181  1.00 101.58 ? 396 ILE A C     1 
ATOM   2857  O  O     . ILE A  1  370 ? -33.719 97.991  42.420  1.00 101.25 ? 396 ILE A O     1 
ATOM   2858  C  CB    . ILE A  1  370 ? -32.201 99.126  39.833  1.00 100.24 ? 396 ILE A CB    1 
ATOM   2859  C  CG1   . ILE A  1  370 ? -32.307 99.845  38.482  1.00 100.43 ? 396 ILE A CG1   1 
ATOM   2860  C  CG2   . ILE A  1  370 ? -32.454 97.637  39.637  1.00 99.17  ? 396 ILE A CG2   1 
ATOM   2861  C  CD1   . ILE A  1  370 ? -31.240 99.459  37.480  1.00 100.81 ? 396 ILE A CD1   1 
ATOM   2862  N  N     . LYS A  1  371 ? -32.274 99.593  43.067  1.00 103.15 ? 397 LYS A N     1 
ATOM   2863  C  CA    . LYS A  1  371 ? -32.068 98.999  44.388  1.00 105.28 ? 397 LYS A CA    1 
ATOM   2864  C  C     . LYS A  1  371 ? -32.331 99.931  45.576  1.00 105.72 ? 397 LYS A C     1 
ATOM   2865  O  O     . LYS A  1  371 ? -31.892 99.664  46.699  1.00 105.91 ? 397 LYS A O     1 
ATOM   2866  C  CB    . LYS A  1  371 ? -30.677 98.354  44.477  1.00 106.37 ? 397 LYS A CB    1 
ATOM   2867  C  CG    . LYS A  1  371 ? -29.569 99.110  43.751  1.00 108.18 ? 397 LYS A CG    1 
ATOM   2868  C  CD    . LYS A  1  371 ? -28.314 98.255  43.591  1.00 109.61 ? 397 LYS A CD    1 
ATOM   2869  C  CE    . LYS A  1  371 ? -27.695 97.896  44.937  1.00 110.92 ? 397 LYS A CE    1 
ATOM   2870  N  NZ    . LYS A  1  371 ? -26.442 97.102  44.780  1.00 110.92 ? 397 LYS A NZ    1 
ATOM   2871  N  N     . GLY A  1  372 ? -33.067 101.012 45.317  1.00 105.98 ? 398 GLY A N     1 
ATOM   2872  C  CA    . GLY A  1  372 ? -33.418 101.974 46.352  1.00 105.59 ? 398 GLY A CA    1 
ATOM   2873  C  C     . GLY A  1  372 ? -32.276 102.628 47.108  1.00 105.41 ? 398 GLY A C     1 
ATOM   2874  O  O     . GLY A  1  372 ? -32.502 103.271 48.133  1.00 105.29 ? 398 GLY A O     1 
ATOM   2875  N  N     . SER A  1  373 ? -31.056 102.480 46.597  1.00 105.16 ? 399 SER A N     1 
ATOM   2876  C  CA    . SER A  1  373 ? -29.862 103.050 47.225  1.00 104.21 ? 399 SER A CA    1 
ATOM   2877  C  C     . SER A  1  373 ? -28.628 102.760 46.378  1.00 103.73 ? 399 SER A C     1 
ATOM   2878  O  O     . SER A  1  373 ? -28.659 101.907 45.490  1.00 104.48 ? 399 SER A O     1 
ATOM   2879  C  CB    . SER A  1  373 ? -29.661 102.452 48.620  1.00 103.62 ? 399 SER A CB    1 
ATOM   2880  O  OG    . SER A  1  373 ? -29.573 101.040 48.552  1.00 102.53 ? 399 SER A OG    1 
ATOM   2881  N  N     . LYS A  1  374 ? -27.543 103.476 46.655  1.00 102.77 ? 400 LYS A N     1 
ATOM   2882  C  CA    . LYS A  1  374 ? -26.295 103.278 45.926  1.00 101.92 ? 400 LYS A CA    1 
ATOM   2883  C  C     . LYS A  1  374 ? -25.246 102.602 46.806  1.00 101.86 ? 400 LYS A C     1 
ATOM   2884  O  O     . LYS A  1  374 ? -25.149 102.885 48.001  1.00 102.39 ? 400 LYS A O     1 
ATOM   2885  C  CB    . LYS A  1  374 ? -25.750 104.610 45.398  1.00 100.50 ? 400 LYS A CB    1 
ATOM   2886  C  CG    . LYS A  1  374 ? -24.377 104.496 44.759  1.00 99.45  ? 400 LYS A CG    1 
ATOM   2887  C  CD    . LYS A  1  374 ? -23.906 105.802 44.153  1.00 99.20  ? 400 LYS A CD    1 
ATOM   2888  C  CE    . LYS A  1  374 ? -22.499 105.651 43.595  1.00 98.58  ? 400 LYS A CE    1 
ATOM   2889  N  NZ    . LYS A  1  374 ? -22.015 106.884 42.921  1.00 98.85  ? 400 LYS A NZ    1 
ATOM   2890  N  N     . LEU A  1  375 ? -24.489 101.685 46.212  1.00 101.35 ? 401 LEU A N     1 
ATOM   2891  C  CA    . LEU A  1  375 ? -23.431 100.983 46.928  1.00 100.06 ? 401 LEU A CA    1 
ATOM   2892  C  C     . LEU A  1  375 ? -22.187 101.870 46.867  1.00 98.87  ? 401 LEU A C     1 
ATOM   2893  O  O     . LEU A  1  375 ? -21.751 102.273 45.781  1.00 98.61  ? 401 LEU A O     1 
ATOM   2894  C  CB    . LEU A  1  375 ? -23.150 99.627  46.271  1.00 100.81 ? 401 LEU A CB    1 
ATOM   2895  C  CG    . LEU A  1  375 ? -22.302 98.628  47.064  1.00 100.98 ? 401 LEU A CG    1 
ATOM   2896  C  CD1   . LEU A  1  375 ? -23.078 98.146  48.283  1.00 101.19 ? 401 LEU A CD1   1 
ATOM   2897  C  CD2   . LEU A  1  375 ? -21.930 97.449  46.180  1.00 100.93 ? 401 LEU A CD2   1 
ATOM   2898  N  N     . SER A  1  376 ? -21.645 102.204 48.036  1.00 97.00  ? 402 SER A N     1 
ATOM   2899  C  CA    . SER A  1  376 ? -20.459 103.055 48.124  1.00 94.62  ? 402 SER A CA    1 
ATOM   2900  C  C     . SER A  1  376 ? -19.233 102.370 47.536  1.00 93.01  ? 402 SER A C     1 
ATOM   2901  O  O     . SER A  1  376 ? -19.053 101.159 47.695  1.00 92.44  ? 402 SER A O     1 
ATOM   2902  C  CB    . SER A  1  376 ? -20.196 103.456 49.580  1.00 94.50  ? 402 SER A CB    1 
ATOM   2903  O  OG    . SER A  1  376 ? -20.090 102.318 50.420  1.00 93.69  ? 402 SER A OG    1 
ATOM   2904  N  N     . LEU A  1  377 ? -18.392 103.155 46.863  1.00 90.76  ? 403 LEU A N     1 
ATOM   2905  C  CA    . LEU A  1  377 ? -17.177 102.643 46.234  1.00 88.26  ? 403 LEU A CA    1 
ATOM   2906  C  C     . LEU A  1  377 ? -16.357 101.777 47.184  1.00 87.92  ? 403 LEU A C     1 
ATOM   2907  O  O     . LEU A  1  377 ? -15.849 100.730 46.788  1.00 89.31  ? 403 LEU A O     1 
ATOM   2908  C  CB    . LEU A  1  377 ? -16.319 103.791 45.709  1.00 85.93  ? 403 LEU A CB    1 
ATOM   2909  C  CG    . LEU A  1  377 ? -15.220 103.374 44.741  1.00 84.33  ? 403 LEU A CG    1 
ATOM   2910  C  CD1   . LEU A  1  377 ? -15.845 102.691 43.542  1.00 84.61  ? 403 LEU A CD1   1 
ATOM   2911  C  CD2   . LEU A  1  377 ? -14.426 104.581 44.299  1.00 85.21  ? 403 LEU A CD2   1 
ATOM   2912  N  N     . GLY A  1  378 ? -16.261 102.205 48.441  1.00 87.23  ? 404 GLY A N     1 
ATOM   2913  C  CA    . GLY A  1  378 ? -15.515 101.461 49.443  1.00 85.35  ? 404 GLY A CA    1 
ATOM   2914  C  C     . GLY A  1  378 ? -16.172 100.140 49.792  1.00 84.55  ? 404 GLY A C     1 
ATOM   2915  O  O     . GLY A  1  378 ? -15.492 99.178  50.144  1.00 84.35  ? 404 GLY A O     1 
ATOM   2916  N  N     . GLU A  1  379 ? -17.499 100.099 49.711  1.00 84.48  ? 405 GLU A N     1 
ATOM   2917  C  CA    . GLU A  1  379 ? -18.254 98.885  49.999  1.00 85.17  ? 405 GLU A CA    1 
ATOM   2918  C  C     . GLU A  1  379 ? -18.055 97.850  48.892  1.00 84.14  ? 405 GLU A C     1 
ATOM   2919  O  O     . GLU A  1  379 ? -18.134 96.641  49.134  1.00 84.39  ? 405 GLU A O     1 
ATOM   2920  C  CB    . GLU A  1  379 ? -19.742 99.209  50.145  1.00 87.78  ? 405 GLU A CB    1 
ATOM   2921  C  CG    . GLU A  1  379 ? -20.231 99.281  51.584  1.00 91.21  ? 405 GLU A CG    1 
ATOM   2922  C  CD    . GLU A  1  379 ? -20.210 97.925  52.271  1.00 93.30  ? 405 GLU A CD    1 
ATOM   2923  O  OE1   . GLU A  1  379 ? -19.389 97.742  53.201  1.00 94.23  ? 405 GLU A OE1   1 
ATOM   2924  O  OE2   . GLU A  1  379 ? -21.014 97.045  51.878  1.00 93.67  ? 405 GLU A OE2   1 
ATOM   2925  N  N     . ALA A  1  380 ? -17.813 98.340  47.677  1.00 81.41  ? 406 ALA A N     1 
ATOM   2926  C  CA    . ALA A  1  380 ? -17.588 97.484  46.517  1.00 78.59  ? 406 ALA A CA    1 
ATOM   2927  C  C     . ALA A  1  380 ? -16.250 96.764  46.658  1.00 76.70  ? 406 ALA A C     1 
ATOM   2928  O  O     . ALA A  1  380 ? -16.190 95.538  46.577  1.00 76.23  ? 406 ALA A O     1 
ATOM   2929  C  CB    . ALA A  1  380 ? -17.608 98.313  45.243  1.00 77.85  ? 406 ALA A CB    1 
ATOM   2930  N  N     . PHE A  1  381 ? -15.191 97.536  46.895  1.00 73.62  ? 407 PHE A N     1 
ATOM   2931  C  CA    . PHE A  1  381 ? -13.846 96.999  47.060  1.00 71.79  ? 407 PHE A CA    1 
ATOM   2932  C  C     . PHE A  1  381 ? -13.807 95.842  48.051  1.00 74.27  ? 407 PHE A C     1 
ATOM   2933  O  O     . PHE A  1  381 ? -13.105 94.855  47.833  1.00 76.13  ? 407 PHE A O     1 
ATOM   2934  C  CB    . PHE A  1  381 ? -12.883 98.092  47.532  1.00 66.75  ? 407 PHE A CB    1 
ATOM   2935  C  CG    . PHE A  1  381 ? -12.479 99.069  46.460  1.00 60.65  ? 407 PHE A CG    1 
ATOM   2936  C  CD1   . PHE A  1  381 ? -13.314 99.344  45.386  1.00 58.30  ? 407 PHE A CD1   1 
ATOM   2937  C  CD2   . PHE A  1  381 ? -11.250 99.720  46.533  1.00 58.66  ? 407 PHE A CD2   1 
ATOM   2938  C  CE1   . PHE A  1  381 ? -12.933 100.254 44.403  1.00 57.39  ? 407 PHE A CE1   1 
ATOM   2939  C  CE2   . PHE A  1  381 ? -10.860 100.632 45.555  1.00 56.80  ? 407 PHE A CE2   1 
ATOM   2940  C  CZ    . PHE A  1  381 ? -11.704 100.899 44.488  1.00 56.64  ? 407 PHE A CZ    1 
ATOM   2941  N  N     . LYS A  1  382 ? -14.554 95.963  49.142  1.00 76.17  ? 408 LYS A N     1 
ATOM   2942  C  CA    . LYS A  1  382 ? -14.586 94.907  50.149  1.00 79.05  ? 408 LYS A CA    1 
ATOM   2943  C  C     . LYS A  1  382 ? -15.120 93.609  49.556  1.00 77.91  ? 408 LYS A C     1 
ATOM   2944  O  O     . LYS A  1  382 ? -14.633 92.528  49.886  1.00 77.33  ? 408 LYS A O     1 
ATOM   2945  C  CB    . LYS A  1  382 ? -15.428 95.328  51.363  1.00 83.52  ? 408 LYS A CB    1 
ATOM   2946  C  CG    . LYS A  1  382 ? -14.721 96.279  52.334  1.00 88.09  ? 408 LYS A CG    1 
ATOM   2947  C  CD    . LYS A  1  382 ? -15.560 96.517  53.592  1.00 91.63  ? 408 LYS A CD    1 
ATOM   2948  C  CE    . LYS A  1  382 ? -14.853 97.453  54.570  1.00 93.19  ? 408 LYS A CE    1 
ATOM   2949  N  NZ    . LYS A  1  382 ? -15.694 97.739  55.770  1.00 94.42  ? 408 LYS A NZ    1 
ATOM   2950  N  N     . LYS A  1  383 ? -16.119 93.726  48.681  1.00 77.57  ? 409 LYS A N     1 
ATOM   2951  C  CA    . LYS A  1  383 ? -16.718 92.562  48.019  1.00 77.23  ? 409 LYS A CA    1 
ATOM   2952  C  C     . LYS A  1  383 ? -15.765 91.982  46.971  1.00 75.52  ? 409 LYS A C     1 
ATOM   2953  O  O     . LYS A  1  383 ? -15.601 90.760  46.871  1.00 74.55  ? 409 LYS A O     1 
ATOM   2954  C  CB    . LYS A  1  383 ? -18.049 92.932  47.354  1.00 78.58  ? 409 LYS A CB    1 
ATOM   2955  C  CG    . LYS A  1  383 ? -19.196 93.124  48.323  1.00 79.78  ? 409 LYS A CG    1 
ATOM   2956  C  CD    . LYS A  1  383 ? -20.520 93.230  47.590  1.00 81.48  ? 409 LYS A CD    1 
ATOM   2957  C  CE    . LYS A  1  383 ? -21.686 93.327  48.565  1.00 82.90  ? 409 LYS A CE    1 
ATOM   2958  N  NZ    . LYS A  1  383 ? -21.786 92.117  49.441  1.00 83.42  ? 409 LYS A NZ    1 
ATOM   2959  N  N     . ILE A  1  384 ? -15.143 92.873  46.201  1.00 72.83  ? 410 ILE A N     1 
ATOM   2960  C  CA    . ILE A  1  384 ? -14.196 92.488  45.172  1.00 70.92  ? 410 ILE A CA    1 
ATOM   2961  C  C     . ILE A  1  384 ? -13.040 91.690  45.773  1.00 72.08  ? 410 ILE A C     1 
ATOM   2962  O  O     . ILE A  1  384 ? -12.724 90.598  45.303  1.00 73.99  ? 410 ILE A O     1 
ATOM   2963  C  CB    . ILE A  1  384 ? -13.661 93.726  44.425  1.00 68.13  ? 410 ILE A CB    1 
ATOM   2964  C  CG1   . ILE A  1  384 ? -14.778 94.337  43.580  1.00 65.84  ? 410 ILE A CG1   1 
ATOM   2965  C  CG2   . ILE A  1  384 ? -12.455 93.362  43.570  1.00 67.24  ? 410 ILE A CG2   1 
ATOM   2966  C  CD1   . ILE A  1  384 ? -14.376 95.586  42.817  1.00 65.75  ? 410 ILE A CD1   1 
ATOM   2967  N  N     . ASP A  1  385 ? -12.446 92.206  46.843  1.00 72.22  ? 411 ASP A N     1 
ATOM   2968  C  CA    . ASP A  1  385 ? -11.325 91.529  47.490  1.00 72.28  ? 411 ASP A CA    1 
ATOM   2969  C  C     . ASP A  1  385 ? -11.690 90.181  48.099  1.00 71.55  ? 411 ASP A C     1 
ATOM   2970  O  O     . ASP A  1  385 ? -10.828 89.316  48.252  1.00 72.06  ? 411 ASP A O     1 
ATOM   2971  C  CB    . ASP A  1  385 ? -10.703 92.425  48.569  1.00 73.69  ? 411 ASP A CB    1 
ATOM   2972  C  CG    . ASP A  1  385 ? -9.814  93.519  47.989  1.00 75.87  ? 411 ASP A CG    1 
ATOM   2973  O  OD1   . ASP A  1  385 ? -9.928  94.685  48.435  1.00 76.86  ? 411 ASP A OD1   1 
ATOM   2974  O  OD2   . ASP A  1  385 ? -8.981  93.208  47.105  1.00 76.16  ? 411 ASP A OD2   1 
ATOM   2975  N  N     . ALA A  1  386 ? -12.968 89.991  48.410  1.00 71.07  ? 412 ALA A N     1 
ATOM   2976  C  CA    . ALA A  1  386 ? -13.432 88.753  49.032  1.00 71.79  ? 412 ALA A CA    1 
ATOM   2977  C  C     . ALA A  1  386 ? -13.570 87.566  48.086  1.00 72.52  ? 412 ALA A C     1 
ATOM   2978  O  O     . ALA A  1  386 ? -13.763 86.432  48.536  1.00 73.17  ? 412 ALA A O     1 
ATOM   2979  C  CB    . ALA A  1  386 ? -14.752 88.996  49.757  1.00 71.50  ? 412 ALA A CB    1 
ATOM   2980  N  N     . ILE A  1  387 ? -13.472 87.826  46.784  1.00 71.91  ? 413 ILE A N     1 
ATOM   2981  C  CA    . ILE A  1  387 ? -13.612 86.779  45.774  1.00 70.60  ? 413 ILE A CA    1 
ATOM   2982  C  C     . ILE A  1  387 ? -12.434 85.807  45.721  1.00 69.60  ? 413 ILE A C     1 
ATOM   2983  O  O     . ILE A  1  387 ? -11.280 86.211  45.588  1.00 67.71  ? 413 ILE A O     1 
ATOM   2984  C  CB    . ILE A  1  387 ? -13.833 87.389  44.375  1.00 70.87  ? 413 ILE A CB    1 
ATOM   2985  C  CG1   . ILE A  1  387 ? -15.009 88.371  44.417  1.00 69.81  ? 413 ILE A CG1   1 
ATOM   2986  C  CG2   . ILE A  1  387 ? -14.130 86.285  43.363  1.00 72.26  ? 413 ILE A CG2   1 
ATOM   2987  C  CD1   . ILE A  1  387 ? -15.129 89.241  43.193  1.00 67.37  ? 413 ILE A CD1   1 
ATOM   2988  N  N     . THR A  1  388 ? -12.751 84.521  45.836  1.00 69.46  ? 414 THR A N     1 
ATOM   2989  C  CA    . THR A  1  388 ? -11.757 83.451  45.790  1.00 70.55  ? 414 THR A CA    1 
ATOM   2990  C  C     . THR A  1  388 ? -11.778 82.741  44.430  1.00 70.66  ? 414 THR A C     1 
ATOM   2991  O  O     . THR A  1  388 ? -12.686 82.950  43.622  1.00 70.75  ? 414 THR A O     1 
ATOM   2992  C  CB    . THR A  1  388 ? -12.030 82.390  46.885  1.00 71.12  ? 414 THR A CB    1 
ATOM   2993  O  OG1   . THR A  1  388 ? -13.399 81.966  46.818  1.00 70.27  ? 414 THR A OG1   1 
ATOM   2994  C  CG2   . THR A  1  388 ? -11.740 82.952  48.271  1.00 72.19  ? 414 THR A CG2   1 
ATOM   2995  N  N     . VAL A  1  389 ? -10.773 81.905  44.182  1.00 70.46  ? 415 VAL A N     1 
ATOM   2996  C  CA    . VAL A  1  389 ? -10.701 81.148  42.937  1.00 68.91  ? 415 VAL A CA    1 
ATOM   2997  C  C     . VAL A  1  389 ? -11.928 80.244  42.865  1.00 69.03  ? 415 VAL A C     1 
ATOM   2998  O  O     . VAL A  1  389 ? -12.520 80.084  41.800  1.00 69.62  ? 415 VAL A O     1 
ATOM   2999  C  CB    . VAL A  1  389 ? -9.397  80.307  42.852  1.00 67.67  ? 415 VAL A CB    1 
ATOM   3000  C  CG1   . VAL A  1  389 ? -9.526  79.204  41.824  1.00 67.23  ? 415 VAL A CG1   1 
ATOM   3001  C  CG2   . VAL A  1  389 ? -8.230  81.198  42.476  1.00 67.15  ? 415 VAL A CG2   1 
ATOM   3002  N  N     . LYS A  1  390 ? -12.341 79.710  44.012  1.00 69.26  ? 416 LYS A N     1 
ATOM   3003  C  CA    . LYS A  1  390 ? -13.507 78.835  44.072  1.00 70.71  ? 416 LYS A CA    1 
ATOM   3004  C  C     . LYS A  1  390 ? -14.779 79.517  43.583  1.00 70.23  ? 416 LYS A C     1 
ATOM   3005  O  O     . LYS A  1  390 ? -15.641 78.873  42.988  1.00 70.00  ? 416 LYS A O     1 
ATOM   3006  C  CB    . LYS A  1  390 ? -13.728 78.308  45.490  1.00 73.66  ? 416 LYS A CB    1 
ATOM   3007  C  CG    . LYS A  1  390 ? -13.266 76.879  45.694  1.00 77.88  ? 416 LYS A CG    1 
ATOM   3008  C  CD    . LYS A  1  390 ? -13.897 76.263  46.936  1.00 81.82  ? 416 LYS A CD    1 
ATOM   3009  C  CE    . LYS A  1  390 ? -13.529 74.785  47.071  1.00 83.60  ? 416 LYS A CE    1 
ATOM   3010  N  NZ    . LYS A  1  390 ? -14.092 74.188  48.318  1.00 85.32  ? 416 LYS A NZ    1 
ATOM   3011  N  N     . ASP A  1  391 ? -14.891 80.817  43.838  1.00 69.74  ? 417 ASP A N     1 
ATOM   3012  C  CA    . ASP A  1  391 ? -16.062 81.582  43.414  1.00 69.61  ? 417 ASP A CA    1 
ATOM   3013  C  C     . ASP A  1  391 ? -16.119 81.639  41.893  1.00 68.17  ? 417 ASP A C     1 
ATOM   3014  O  O     . ASP A  1  391 ? -17.150 81.325  41.292  1.00 68.96  ? 417 ASP A O     1 
ATOM   3015  C  CB    . ASP A  1  391 ? -16.026 83.014  43.977  1.00 71.38  ? 417 ASP A CB    1 
ATOM   3016  C  CG    . ASP A  1  391 ? -16.082 83.060  45.504  1.00 72.09  ? 417 ASP A CG    1 
ATOM   3017  O  OD1   . ASP A  1  391 ? -16.603 82.103  46.130  1.00 70.18  ? 417 ASP A OD1   1 
ATOM   3018  O  OD2   . ASP A  1  391 ? -15.598 84.071  46.069  1.00 72.40  ? 417 ASP A OD2   1 
ATOM   3019  N  N     . VAL A  1  392 ? -15.008 82.051  41.283  1.00 66.14  ? 418 VAL A N     1 
ATOM   3020  C  CA    . VAL A  1  392 ? -14.905 82.149  39.830  1.00 64.08  ? 418 VAL A CA    1 
ATOM   3021  C  C     . VAL A  1  392 ? -15.245 80.797  39.196  1.00 64.37  ? 418 VAL A C     1 
ATOM   3022  O  O     . VAL A  1  392 ? -16.072 80.726  38.286  1.00 64.61  ? 418 VAL A O     1 
ATOM   3023  C  CB    . VAL A  1  392 ? -13.486 82.579  39.391  1.00 63.27  ? 418 VAL A CB    1 
ATOM   3024  C  CG1   . VAL A  1  392 ? -13.392 82.629  37.869  1.00 62.74  ? 418 VAL A CG1   1 
ATOM   3025  C  CG2   . VAL A  1  392 ? -13.138 83.936  39.986  1.00 61.64  ? 418 VAL A CG2   1 
ATOM   3026  N  N     . LYS A  1  393 ? -14.659 79.727  39.734  1.00 62.58  ? 419 LYS A N     1 
ATOM   3027  C  CA    . LYS A  1  393 ? -14.895 78.379  39.232  1.00 61.44  ? 419 LYS A CA    1 
ATOM   3028  C  C     . LYS A  1  393 ? -16.341 77.918  39.321  1.00 61.50  ? 419 LYS A C     1 
ATOM   3029  O  O     . LYS A  1  393 ? -16.811 77.173  38.457  1.00 64.22  ? 419 LYS A O     1 
ATOM   3030  C  CB    . LYS A  1  393 ? -14.009 77.366  39.948  1.00 59.94  ? 419 LYS A CB    1 
ATOM   3031  C  CG    . LYS A  1  393 ? -12.551 77.441  39.578  1.00 60.30  ? 419 LYS A CG    1 
ATOM   3032  C  CD    . LYS A  1  393 ? -11.800 76.242  40.125  1.00 59.42  ? 419 LYS A CD    1 
ATOM   3033  C  CE    . LYS A  1  393 ? -10.324 76.358  39.815  1.00 61.39  ? 419 LYS A CE    1 
ATOM   3034  N  NZ    . LYS A  1  393 ? -9.583  75.156  40.271  1.00 62.88  ? 419 LYS A NZ    1 
ATOM   3035  N  N     . ALA A  1  394 ? -17.037 78.321  40.378  1.00 60.01  ? 420 ALA A N     1 
ATOM   3036  C  CA    . ALA A  1  394 ? -18.432 77.931  40.559  1.00 57.27  ? 420 ALA A CA    1 
ATOM   3037  C  C     . ALA A  1  394 ? -19.308 78.724  39.599  1.00 55.99  ? 420 ALA A C     1 
ATOM   3038  O  O     . ALA A  1  394 ? -20.250 78.185  39.019  1.00 54.63  ? 420 ALA A O     1 
ATOM   3039  C  CB    . ALA A  1  394 ? -18.865 78.164  41.987  1.00 54.99  ? 420 ALA A CB    1 
ATOM   3040  N  N     . TRP A  1  395 ? -18.965 79.995  39.410  1.00 54.73  ? 421 TRP A N     1 
ATOM   3041  C  CA    . TRP A  1  395 ? -19.717 80.878  38.521  1.00 55.47  ? 421 TRP A CA    1 
ATOM   3042  C  C     . TRP A  1  395 ? -19.600 80.435  37.067  1.00 55.25  ? 421 TRP A C     1 
ATOM   3043  O  O     . TRP A  1  395 ? -20.608 80.296  36.372  1.00 54.45  ? 421 TRP A O     1 
ATOM   3044  C  CB    . TRP A  1  395 ? -19.233 82.327  38.676  1.00 53.83  ? 421 TRP A CB    1 
ATOM   3045  C  CG    . TRP A  1  395 ? -19.848 83.287  37.701  1.00 52.81  ? 421 TRP A CG    1 
ATOM   3046  C  CD1   . TRP A  1  395 ? -21.063 83.911  37.804  1.00 52.00  ? 421 TRP A CD1   1 
ATOM   3047  C  CD2   . TRP A  1  395 ? -19.272 83.734  36.471  1.00 52.30  ? 421 TRP A CD2   1 
ATOM   3048  N  NE1   . TRP A  1  395 ? -21.274 84.722  36.713  1.00 50.64  ? 421 TRP A NE1   1 
ATOM   3049  C  CE2   . TRP A  1  395 ? -20.191 84.629  35.878  1.00 52.66  ? 421 TRP A CE2   1 
ATOM   3050  C  CE3   . TRP A  1  395 ? -18.070 83.462  35.809  1.00 52.64  ? 421 TRP A CE3   1 
ATOM   3051  C  CZ2   . TRP A  1  395 ? -19.940 85.256  34.649  1.00 54.77  ? 421 TRP A CZ2   1 
ATOM   3052  C  CZ3   . TRP A  1  395 ? -17.820 84.084  34.589  1.00 53.41  ? 421 TRP A CZ3   1 
ATOM   3053  C  CH2   . TRP A  1  395 ? -18.750 84.969  34.023  1.00 53.98  ? 421 TRP A CH2   1 
ATOM   3054  N  N     . ALA A  1  396 ? -18.365 80.223  36.619  1.00 55.65  ? 422 ALA A N     1 
ATOM   3055  C  CA    . ALA A  1  396 ? -18.094 79.789  35.250  1.00 55.78  ? 422 ALA A CA    1 
ATOM   3056  C  C     . ALA A  1  396 ? -18.736 78.433  34.962  1.00 55.53  ? 422 ALA A C     1 
ATOM   3057  O  O     . ALA A  1  396 ? -19.275 78.213  33.876  1.00 55.53  ? 422 ALA A O     1 
ATOM   3058  C  CB    . ALA A  1  396 ? -16.602 79.726  35.000  1.00 56.55  ? 422 ALA A CB    1 
ATOM   3059  N  N     . GLY A  1  397 ? -18.703 77.539  35.945  1.00 54.76  ? 423 GLY A N     1 
ATOM   3060  C  CA    . GLY A  1  397 ? -19.302 76.230  35.766  1.00 56.28  ? 423 GLY A CA    1 
ATOM   3061  C  C     . GLY A  1  397 ? -20.808 76.300  35.571  1.00 58.14  ? 423 GLY A C     1 
ATOM   3062  O  O     . GLY A  1  397 ? -21.437 75.331  35.132  1.00 58.89  ? 423 GLY A O     1 
ATOM   3063  N  N     . LYS A  1  398 ? -21.381 77.464  35.866  1.00 59.65  ? 424 LYS A N     1 
ATOM   3064  C  CA    . LYS A  1  398 ? -22.818 77.677  35.751  1.00 60.73  ? 424 LYS A CA    1 
ATOM   3065  C  C     . LYS A  1  398 ? -23.189 78.518  34.538  1.00 58.48  ? 424 LYS A C     1 
ATOM   3066  O  O     . LYS A  1  398 ? -24.178 78.239  33.865  1.00 59.18  ? 424 LYS A O     1 
ATOM   3067  C  CB    . LYS A  1  398 ? -23.342 78.371  37.013  1.00 65.02  ? 424 LYS A CB    1 
ATOM   3068  C  CG    . LYS A  1  398 ? -24.622 77.782  37.587  1.00 70.41  ? 424 LYS A CG    1 
ATOM   3069  C  CD    . LYS A  1  398 ? -24.362 76.408  38.209  1.00 75.28  ? 424 LYS A CD    1 
ATOM   3070  C  CE    . LYS A  1  398 ? -25.597 75.877  38.936  1.00 77.99  ? 424 LYS A CE    1 
ATOM   3071  N  NZ    . LYS A  1  398 ? -26.755 75.670  38.005  1.00 79.97  ? 424 LYS A NZ    1 
ATOM   3072  N  N     . ARG A  1  399 ? -22.388 79.541  34.264  1.00 56.14  ? 425 ARG A N     1 
ATOM   3073  C  CA    . ARG A  1  399 ? -22.635 80.462  33.158  1.00 56.42  ? 425 ARG A CA    1 
ATOM   3074  C  C     . ARG A  1  399 ? -21.883 80.217  31.849  1.00 56.24  ? 425 ARG A C     1 
ATOM   3075  O  O     . ARG A  1  399 ? -22.358 80.613  30.785  1.00 57.57  ? 425 ARG A O     1 
ATOM   3076  C  CB    . ARG A  1  399 ? -22.327 81.891  33.612  1.00 56.51  ? 425 ARG A CB    1 
ATOM   3077  C  CG    . ARG A  1  399 ? -23.536 82.749  33.900  1.00 59.84  ? 425 ARG A CG    1 
ATOM   3078  C  CD    . ARG A  1  399 ? -24.392 82.194  35.016  1.00 61.65  ? 425 ARG A CD    1 
ATOM   3079  N  NE    . ARG A  1  399 ? -25.329 83.202  35.507  1.00 65.58  ? 425 ARG A NE    1 
ATOM   3080  C  CZ    . ARG A  1  399 ? -26.612 83.267  35.173  1.00 67.22  ? 425 ARG A CZ    1 
ATOM   3081  N  NH1   . ARG A  1  399 ? -27.375 84.226  35.674  1.00 68.66  ? 425 ARG A NH1   1 
ATOM   3082  N  NH2   . ARG A  1  399 ? -27.137 82.372  34.348  1.00 70.23  ? 425 ARG A NH2   1 
ATOM   3083  N  N     . LEU A  1  400 ? -20.697 79.617  31.930  1.00 55.09  ? 426 LEU A N     1 
ATOM   3084  C  CA    . LEU A  1  400 ? -19.871 79.385  30.751  1.00 51.89  ? 426 LEU A CA    1 
ATOM   3085  C  C     . LEU A  1  400 ? -19.738 77.954  30.243  1.00 51.34  ? 426 LEU A C     1 
ATOM   3086  O  O     . LEU A  1  400 ? -19.809 77.730  29.037  1.00 52.84  ? 426 LEU A O     1 
ATOM   3087  C  CB    . LEU A  1  400 ? -18.484 79.978  30.976  1.00 52.47  ? 426 LEU A CB    1 
ATOM   3088  C  CG    . LEU A  1  400 ? -18.229 81.427  30.554  1.00 54.61  ? 426 LEU A CG    1 
ATOM   3089  C  CD1   . LEU A  1  400 ? -19.332 82.334  31.024  1.00 57.08  ? 426 LEU A CD1   1 
ATOM   3090  C  CD2   . LEU A  1  400 ? -16.900 81.895  31.113  1.00 56.04  ? 426 LEU A CD2   1 
ATOM   3091  N  N     . TRP A  1  401 ? -19.592 76.986  31.146  1.00 48.82  ? 427 TRP A N     1 
ATOM   3092  C  CA    . TRP A  1  401 ? -19.415 75.588  30.748  1.00 47.55  ? 427 TRP A CA    1 
ATOM   3093  C  C     . TRP A  1  401 ? -20.610 74.900  30.086  1.00 47.40  ? 427 TRP A C     1 
ATOM   3094  O  O     . TRP A  1  401 ? -21.629 74.637  30.732  1.00 48.46  ? 427 TRP A O     1 
ATOM   3095  C  CB    . TRP A  1  401 ? -18.924 74.750  31.931  1.00 45.30  ? 427 TRP A CB    1 
ATOM   3096  C  CG    . TRP A  1  401 ? -18.362 73.395  31.544  1.00 44.26  ? 427 TRP A CG    1 
ATOM   3097  C  CD1   . TRP A  1  401 ? -19.028 72.196  31.531  1.00 43.78  ? 427 TRP A CD1   1 
ATOM   3098  C  CD2   . TRP A  1  401 ? -17.004 73.101  31.178  1.00 41.85  ? 427 TRP A CD2   1 
ATOM   3099  N  NE1   . TRP A  1  401 ? -18.164 71.176  31.190  1.00 43.11  ? 427 TRP A NE1   1 
ATOM   3100  C  CE2   . TRP A  1  401 ? -16.918 71.705  30.969  1.00 41.73  ? 427 TRP A CE2   1 
ATOM   3101  C  CE3   . TRP A  1  401 ? -15.852 73.881  31.011  1.00 41.42  ? 427 TRP A CE3   1 
ATOM   3102  C  CZ2   . TRP A  1  401 ? -15.725 71.075  30.606  1.00 39.97  ? 427 TRP A CZ2   1 
ATOM   3103  C  CZ3   . TRP A  1  401 ? -14.666 73.254  30.649  1.00 41.43  ? 427 TRP A CZ3   1 
ATOM   3104  C  CH2   . TRP A  1  401 ? -14.614 71.860  30.451  1.00 40.18  ? 427 TRP A CH2   1 
ATOM   3105  N  N     . ASP A  1  402 ? -20.449 74.579  28.800  1.00 46.00  ? 428 ASP A N     1 
ATOM   3106  C  CA    . ASP A  1  402 ? -21.475 73.902  28.010  1.00 44.36  ? 428 ASP A CA    1 
ATOM   3107  C  C     . ASP A  1  402 ? -22.814 74.639  28.056  1.00 44.15  ? 428 ASP A C     1 
ATOM   3108  O  O     . ASP A  1  402 ? -23.862 74.045  28.318  1.00 43.88  ? 428 ASP A O     1 
ATOM   3109  C  CB    . ASP A  1  402 ? -21.620 72.453  28.499  1.00 44.35  ? 428 ASP A CB    1 
ATOM   3110  C  CG    . ASP A  1  402 ? -22.368 71.562  27.525  1.00 45.12  ? 428 ASP A CG    1 
ATOM   3111  O  OD1   . ASP A  1  402 ? -22.567 71.928  26.354  1.00 45.42  ? 428 ASP A OD1   1 
ATOM   3112  O  OD2   . ASP A  1  402 ? -22.761 70.459  27.937  1.00 49.16  ? 428 ASP A OD2   1 
ATOM   3113  N  N     . GLN A  1  403 ? -22.765 75.938  27.780  1.00 44.70  ? 429 GLN A N     1 
ATOM   3114  C  CA    . GLN A  1  403 ? -23.951 76.788  27.775  1.00 46.05  ? 429 GLN A CA    1 
ATOM   3115  C  C     . GLN A  1  403 ? -24.140 77.451  26.409  1.00 45.91  ? 429 GLN A C     1 
ATOM   3116  O  O     . GLN A  1  403 ? -23.157 77.766  25.723  1.00 45.74  ? 429 GLN A O     1 
ATOM   3117  C  CB    . GLN A  1  403 ? -23.824 77.881  28.845  1.00 47.70  ? 429 GLN A CB    1 
ATOM   3118  C  CG    . GLN A  1  403 ? -23.902 77.390  30.274  1.00 52.01  ? 429 GLN A CG    1 
ATOM   3119  C  CD    . GLN A  1  403 ? -25.250 76.789  30.605  1.00 55.75  ? 429 GLN A CD    1 
ATOM   3120  O  OE1   . GLN A  1  403 ? -26.292 77.322  30.216  1.00 57.00  ? 429 GLN A OE1   1 
ATOM   3121  N  NE2   . GLN A  1  403 ? -25.241 75.671  31.326  1.00 58.27  ? 429 GLN A NE2   1 
ATOM   3122  N  N     . ASP A  1  404 ? -25.396 77.705  26.037  1.00 44.96  ? 430 ASP A N     1 
ATOM   3123  C  CA    . ASP A  1  404 ? -25.694 78.343  24.762  1.00 45.27  ? 430 ASP A CA    1 
ATOM   3124  C  C     . ASP A  1  404 ? -25.034 79.696  24.699  1.00 44.53  ? 430 ASP A C     1 
ATOM   3125  O  O     . ASP A  1  404 ? -24.727 80.277  25.722  1.00 46.39  ? 430 ASP A O     1 
ATOM   3126  C  CB    . ASP A  1  404 ? -27.198 78.517  24.576  1.00 47.55  ? 430 ASP A CB    1 
ATOM   3127  C  CG    . ASP A  1  404 ? -27.872 77.276  24.018  1.00 49.88  ? 430 ASP A CG    1 
ATOM   3128  O  OD1   . ASP A  1  404 ? -29.013 76.971  24.441  1.00 51.95  ? 430 ASP A OD1   1 
ATOM   3129  O  OD2   . ASP A  1  404 ? -27.278 76.622  23.137  1.00 49.06  ? 430 ASP A OD2   1 
ATOM   3130  N  N     . ILE A  1  405 ? -24.817 80.196  23.492  1.00 46.04  ? 431 ILE A N     1 
ATOM   3131  C  CA    . ILE A  1  405 ? -24.199 81.508  23.297  1.00 46.60  ? 431 ILE A CA    1 
ATOM   3132  C  C     . ILE A  1  405 ? -25.006 82.295  22.271  1.00 45.29  ? 431 ILE A C     1 
ATOM   3133  O  O     . ILE A  1  405 ? -25.921 81.761  21.638  1.00 45.37  ? 431 ILE A O     1 
ATOM   3134  C  CB    . ILE A  1  405 ? -22.741 81.391  22.769  1.00 47.79  ? 431 ILE A CB    1 
ATOM   3135  C  CG1   . ILE A  1  405 ? -22.742 80.764  21.368  1.00 50.78  ? 431 ILE A CG1   1 
ATOM   3136  C  CG2   . ILE A  1  405 ? -21.894 80.569  23.723  1.00 48.24  ? 431 ILE A CG2   1 
ATOM   3137  C  CD1   . ILE A  1  405 ? -21.374 80.356  20.869  1.00 53.06  ? 431 ILE A CD1   1 
ATOM   3138  N  N     . ALA A  1  406 ? -24.665 83.570  22.130  1.00 42.76  ? 432 ALA A N     1 
ATOM   3139  C  CA    . ALA A  1  406 ? -25.307 84.444  21.171  1.00 40.99  ? 432 ALA A CA    1 
ATOM   3140  C  C     . ALA A  1  406 ? -24.175 85.043  20.360  1.00 41.24  ? 432 ALA A C     1 
ATOM   3141  O  O     . ALA A  1  406 ? -23.119 85.371  20.908  1.00 42.62  ? 432 ALA A O     1 
ATOM   3142  C  CB    . ALA A  1  406 ? -26.080 85.519  21.881  1.00 41.38  ? 432 ALA A CB    1 
ATOM   3143  N  N     . ILE A  1  407 ? -24.381 85.167  19.055  1.00 40.51  ? 433 ILE A N     1 
ATOM   3144  C  CA    . ILE A  1  407 ? -23.352 85.711  18.171  1.00 40.41  ? 433 ILE A CA    1 
ATOM   3145  C  C     . ILE A  1  407 ? -23.945 86.765  17.242  1.00 39.47  ? 433 ILE A C     1 
ATOM   3146  O  O     . ILE A  1  407 ? -25.133 86.741  16.948  1.00 40.22  ? 433 ILE A O     1 
ATOM   3147  C  CB    . ILE A  1  407 ? -22.699 84.572  17.286  1.00 40.09  ? 433 ILE A CB    1 
ATOM   3148  C  CG1   . ILE A  1  407 ? -22.279 83.395  18.160  1.00 40.32  ? 433 ILE A CG1   1 
ATOM   3149  C  CG2   . ILE A  1  407 ? -21.465 85.092  16.549  1.00 37.99  ? 433 ILE A CG2   1 
ATOM   3150  C  CD1   . ILE A  1  407 ? -21.762 82.223  17.392  1.00 44.03  ? 433 ILE A CD1   1 
ATOM   3151  N  N     . ALA A  1  408 ? -23.094 87.667  16.765  1.00 38.53  ? 434 ALA A N     1 
ATOM   3152  C  CA    . ALA A  1  408 ? -23.498 88.711  15.841  1.00 37.72  ? 434 ALA A CA    1 
ATOM   3153  C  C     . ALA A  1  408 ? -22.241 89.270  15.214  1.00 38.65  ? 434 ALA A C     1 
ATOM   3154  O  O     . ALA A  1  408 ? -21.228 89.417  15.895  1.00 40.39  ? 434 ALA A O     1 
ATOM   3155  C  CB    . ALA A  1  408 ? -24.229 89.794  16.571  1.00 39.95  ? 434 ALA A CB    1 
ATOM   3156  N  N     . GLY A  1  409 ? -22.288 89.553  13.916  1.00 36.47  ? 435 GLY A N     1 
ATOM   3157  C  CA    . GLY A  1  409 ? -21.119 90.100  13.261  1.00 36.16  ? 435 GLY A CA    1 
ATOM   3158  C  C     . GLY A  1  409 ? -21.432 90.718  11.919  1.00 37.55  ? 435 GLY A C     1 
ATOM   3159  O  O     . GLY A  1  409 ? -22.490 90.472  11.350  1.00 40.15  ? 435 GLY A O     1 
ATOM   3160  N  N     . THR A  1  410 ? -20.509 91.520  11.409  1.00 36.69  ? 436 THR A N     1 
ATOM   3161  C  CA    . THR A  1  410 ? -20.683 92.162  10.115  1.00 38.98  ? 436 THR A CA    1 
ATOM   3162  C  C     . THR A  1  410 ? -19.308 92.275  9.476   1.00 39.58  ? 436 THR A C     1 
ATOM   3163  O  O     . THR A  1  410 ? -18.299 92.132  10.163  1.00 42.08  ? 436 THR A O     1 
ATOM   3164  C  CB    . THR A  1  410 ? -21.345 93.561  10.242  1.00 41.00  ? 436 THR A CB    1 
ATOM   3165  O  OG1   . THR A  1  410 ? -21.550 94.114  8.934   1.00 44.86  ? 436 THR A OG1   1 
ATOM   3166  C  CG2   . THR A  1  410 ? -20.477 94.521  11.067  1.00 40.91  ? 436 THR A CG2   1 
ATOM   3167  N  N     . GLY A  1  411 ? -19.265 92.547  8.176   1.00 38.59  ? 437 GLY A N     1 
ATOM   3168  C  CA    . GLY A  1  411 ? -17.995 92.630  7.483   1.00 39.33  ? 437 GLY A CA    1 
ATOM   3169  C  C     . GLY A  1  411 ? -17.628 91.287  6.860   1.00 40.64  ? 437 GLY A C     1 
ATOM   3170  O  O     . GLY A  1  411 ? -18.498 90.447  6.607   1.00 41.81  ? 437 GLY A O     1 
ATOM   3171  N  N     . GLN A  1  412 ? -16.337 91.077  6.622   1.00 39.92  ? 438 GLN A N     1 
ATOM   3172  C  CA    . GLN A  1  412 ? -15.851 89.838  6.016   1.00 39.90  ? 438 GLN A CA    1 
ATOM   3173  C  C     . GLN A  1  412 ? -15.896 88.642  6.970   1.00 38.78  ? 438 GLN A C     1 
ATOM   3174  O  O     . GLN A  1  412 ? -14.849 88.120  7.353   1.00 39.52  ? 438 GLN A O     1 
ATOM   3175  C  CB    . GLN A  1  412 ? -14.422 90.039  5.495   1.00 37.54  ? 438 GLN A CB    1 
ATOM   3176  C  CG    . GLN A  1  412 ? -14.263 91.227  4.562   1.00 37.59  ? 438 GLN A CG    1 
ATOM   3177  C  CD    . GLN A  1  412 ? -12.977 91.170  3.753   1.00 40.37  ? 438 GLN A CD    1 
ATOM   3178  O  OE1   . GLN A  1  412 ? -12.356 92.195  3.467   1.00 43.00  ? 438 GLN A OE1   1 
ATOM   3179  N  NE2   . GLN A  1  412 ? -12.582 89.967  3.363   1.00 41.35  ? 438 GLN A NE2   1 
ATOM   3180  N  N     . ILE A  1  413 ? -17.101 88.194  7.322   1.00 37.91  ? 439 ILE A N     1 
ATOM   3181  C  CA    . ILE A  1  413 ? -17.268 87.068  8.248   1.00 39.47  ? 439 ILE A CA    1 
ATOM   3182  C  C     . ILE A  1  413 ? -17.468 85.666  7.639   1.00 41.06  ? 439 ILE A C     1 
ATOM   3183  O  O     . ILE A  1  413 ? -18.086 84.790  8.263   1.00 40.11  ? 439 ILE A O     1 
ATOM   3184  C  CB    . ILE A  1  413 ? -18.408 87.324  9.265   1.00 38.51  ? 439 ILE A CB    1 
ATOM   3185  C  CG1   . ILE A  1  413 ? -19.718 87.635  8.543   1.00 40.24  ? 439 ILE A CG1   1 
ATOM   3186  C  CG2   . ILE A  1  413 ? -18.041 88.465  10.194  1.00 41.43  ? 439 ILE A CG2   1 
ATOM   3187  C  CD1   . ILE A  1  413 ? -20.931 87.679  9.462   1.00 38.15  ? 439 ILE A CD1   1 
ATOM   3188  N  N     . GLU A  1  414 ? -16.962 85.448  6.425   1.00 40.57  ? 440 GLU A N     1 
ATOM   3189  C  CA    . GLU A  1  414 ? -17.087 84.134  5.800   1.00 41.87  ? 440 GLU A CA    1 
ATOM   3190  C  C     . GLU A  1  414 ? -16.316 83.091  6.633   1.00 43.14  ? 440 GLU A C     1 
ATOM   3191  O  O     . GLU A  1  414 ? -16.754 81.951  6.779   1.00 44.36  ? 440 GLU A O     1 
ATOM   3192  C  CB    . GLU A  1  414 ? -16.552 84.161  4.365   1.00 40.64  ? 440 GLU A CB    1 
ATOM   3193  C  CG    . GLU A  1  414 ? -16.544 82.800  3.667   1.00 38.51  ? 440 GLU A CG    1 
ATOM   3194  C  CD    . GLU A  1  414 ? -16.010 82.880  2.247   1.00 42.50  ? 440 GLU A CD    1 
ATOM   3195  O  OE1   . GLU A  1  414 ? -14.799 82.673  2.039   1.00 43.54  ? 440 GLU A OE1   1 
ATOM   3196  O  OE2   . GLU A  1  414 ? -16.805 83.150  1.324   1.00 47.37  ? 440 GLU A OE2   1 
ATOM   3197  N  N     . GLY A  1  415 ? -15.194 83.515  7.208   1.00 41.75  ? 441 GLY A N     1 
ATOM   3198  C  CA    . GLY A  1  415 ? -14.373 82.635  8.014   1.00 41.50  ? 441 GLY A CA    1 
ATOM   3199  C  C     . GLY A  1  415 ? -14.903 82.261  9.391   1.00 41.40  ? 441 GLY A C     1 
ATOM   3200  O  O     . GLY A  1  415 ? -14.341 81.378  10.042  1.00 41.18  ? 441 GLY A O     1 
ATOM   3201  N  N     . LEU A  1  416 ? -15.942 82.947  9.860   1.00 40.38  ? 442 LEU A N     1 
ATOM   3202  C  CA    . LEU A  1  416 ? -16.528 82.643  11.163  1.00 40.39  ? 442 LEU A CA    1 
ATOM   3203  C  C     . LEU A  1  416 ? -17.347 81.374  10.964  1.00 40.80  ? 442 LEU A C     1 
ATOM   3204  O  O     . LEU A  1  416 ? -18.361 81.388  10.279  1.00 43.45  ? 442 LEU A O     1 
ATOM   3205  C  CB    . LEU A  1  416 ? -17.420 83.804  11.623  1.00 39.20  ? 442 LEU A CB    1 
ATOM   3206  C  CG    . LEU A  1  416 ? -18.164 83.673  12.956  1.00 39.79  ? 442 LEU A CG    1 
ATOM   3207  C  CD1   . LEU A  1  416 ? -17.212 83.827  14.131  1.00 40.01  ? 442 LEU A CD1   1 
ATOM   3208  C  CD2   . LEU A  1  416 ? -19.239 84.725  13.028  1.00 38.65  ? 442 LEU A CD2   1 
ATOM   3209  N  N     . LEU A  1  417 ? -16.879 80.261  11.511  1.00 41.21  ? 443 LEU A N     1 
ATOM   3210  C  CA    . LEU A  1  417 ? -17.571 78.979  11.345  1.00 41.63  ? 443 LEU A CA    1 
ATOM   3211  C  C     . LEU A  1  417 ? -19.018 78.939  11.833  1.00 40.38  ? 443 LEU A C     1 
ATOM   3212  O  O     . LEU A  1  417 ? -19.515 79.896  12.409  1.00 41.89  ? 443 LEU A O     1 
ATOM   3213  C  CB    . LEU A  1  417 ? -16.749 77.855  11.986  1.00 42.35  ? 443 LEU A CB    1 
ATOM   3214  C  CG    . LEU A  1  417 ? -15.721 77.124  11.115  1.00 43.81  ? 443 LEU A CG    1 
ATOM   3215  C  CD1   . LEU A  1  417 ? -15.125 78.040  10.072  1.00 44.71  ? 443 LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A  1  417 ? -14.639 76.498  11.976  1.00 40.15  ? 443 LEU A CD2   1 
ATOM   3217  N  N     . ASP A  1  418 ? -19.685 77.819  11.590  1.00 39.19  ? 444 ASP A N     1 
ATOM   3218  C  CA    . ASP A  1  418 ? -21.080 77.623  11.981  1.00 40.53  ? 444 ASP A CA    1 
ATOM   3219  C  C     . ASP A  1  418 ? -21.321 77.688  13.492  1.00 41.01  ? 444 ASP A C     1 
ATOM   3220  O  O     . ASP A  1  418 ? -20.395 77.562  14.280  1.00 40.68  ? 444 ASP A O     1 
ATOM   3221  C  CB    . ASP A  1  418 ? -21.555 76.272  11.470  1.00 40.87  ? 444 ASP A CB    1 
ATOM   3222  C  CG    . ASP A  1  418 ? -20.734 75.141  12.023  1.00 41.68  ? 444 ASP A CG    1 
ATOM   3223  O  OD1   . ASP A  1  418 ? -19.546 75.053  11.657  1.00 42.68  ? 444 ASP A OD1   1 
ATOM   3224  O  OD2   . ASP A  1  418 ? -21.258 74.375  12.856  1.00 41.09  ? 444 ASP A OD2   1 
ATOM   3225  N  N     . TYR A  1  419 ? -22.590 77.780  13.882  1.00 41.24  ? 445 TYR A N     1 
ATOM   3226  C  CA    . TYR A  1  419 ? -22.954 77.874  15.287  1.00 39.69  ? 445 TYR A CA    1 
ATOM   3227  C  C     . TYR A  1  419 ? -22.440 76.723  16.127  1.00 40.19  ? 445 TYR A C     1 
ATOM   3228  O  O     . TYR A  1  419 ? -21.755 76.953  17.122  1.00 40.82  ? 445 TYR A O     1 
ATOM   3229  C  CB    . TYR A  1  419 ? -24.469 77.997  15.452  1.00 38.58  ? 445 TYR A CB    1 
ATOM   3230  C  CG    . TYR A  1  419 ? -24.910 78.269  16.883  1.00 39.32  ? 445 TYR A CG    1 
ATOM   3231  C  CD1   . TYR A  1  419 ? -24.951 79.575  17.384  1.00 39.45  ? 445 TYR A CD1   1 
ATOM   3232  C  CD2   . TYR A  1  419 ? -25.282 77.217  17.742  1.00 38.33  ? 445 TYR A CD2   1 
ATOM   3233  C  CE1   . TYR A  1  419 ? -25.348 79.832  18.702  1.00 39.61  ? 445 TYR A CE1   1 
ATOM   3234  C  CE2   . TYR A  1  419 ? -25.680 77.459  19.055  1.00 37.55  ? 445 TYR A CE2   1 
ATOM   3235  C  CZ    . TYR A  1  419 ? -25.711 78.774  19.529  1.00 40.82  ? 445 TYR A CZ    1 
ATOM   3236  O  OH    . TYR A  1  419 ? -26.108 79.039  20.824  1.00 43.20  ? 445 TYR A OH    1 
ATOM   3237  N  N     . MET A  1  420 ? -22.789 75.496  15.740  1.00 41.28  ? 446 MET A N     1 
ATOM   3238  C  CA    . MET A  1  420 ? -22.379 74.303  16.475  1.00 42.63  ? 446 MET A CA    1 
ATOM   3239  C  C     . MET A  1  420 ? -20.875 74.132  16.697  1.00 45.91  ? 446 MET A C     1 
ATOM   3240  O  O     . MET A  1  420 ? -20.459 73.471  17.662  1.00 47.08  ? 446 MET A O     1 
ATOM   3241  C  CB    . MET A  1  420 ? -22.971 73.055  15.848  1.00 42.59  ? 446 MET A CB    1 
ATOM   3242  C  CG    . MET A  1  420 ? -24.428 72.902  16.179  1.00 45.49  ? 446 MET A CG    1 
ATOM   3243  S  SD    . MET A  1  420 ? -24.676 72.937  17.964  1.00 46.15  ? 446 MET A SD    1 
ATOM   3244  C  CE    . MET A  1  420 ? -25.114 71.208  18.260  1.00 44.97  ? 446 MET A CE    1 
ATOM   3245  N  N     . ARG A  1  421 ? -20.063 74.714  15.809  1.00 44.45  ? 447 ARG A N     1 
ATOM   3246  C  CA    . ARG A  1  421 ? -18.619 74.659  15.960  1.00 42.48  ? 447 ARG A CA    1 
ATOM   3247  C  C     . ARG A  1  421 ? -18.231 75.528  17.137  1.00 43.61  ? 447 ARG A C     1 
ATOM   3248  O  O     . ARG A  1  421 ? -17.494 75.088  18.024  1.00 45.84  ? 447 ARG A O     1 
ATOM   3249  C  CB    . ARG A  1  421 ? -17.925 75.200  14.725  1.00 44.41  ? 447 ARG A CB    1 
ATOM   3250  C  CG    . ARG A  1  421 ? -17.370 74.130  13.825  1.00 47.95  ? 447 ARG A CG    1 
ATOM   3251  C  CD    . ARG A  1  421 ? -16.387 73.218  14.550  1.00 45.76  ? 447 ARG A CD    1 
ATOM   3252  N  NE    . ARG A  1  421 ? -15.776 72.348  13.569  1.00 44.59  ? 447 ARG A NE    1 
ATOM   3253  C  CZ    . ARG A  1  421 ? -14.620 72.601  12.977  1.00 44.06  ? 447 ARG A CZ    1 
ATOM   3254  N  NH1   . ARG A  1  421 ? -14.161 71.768  12.059  1.00 46.05  ? 447 ARG A NH1   1 
ATOM   3255  N  NH2   . ARG A  1  421 ? -13.881 73.623  13.371  1.00 42.30  ? 447 ARG A NH2   1 
ATOM   3256  N  N     . ILE A  1  422 ? -18.704 76.775  17.116  1.00 42.53  ? 448 ILE A N     1 
ATOM   3257  C  CA    . ILE A  1  422 ? -18.435 77.733  18.182  1.00 40.96  ? 448 ILE A CA    1 
ATOM   3258  C  C     . ILE A  1  422 ? -19.013 77.168  19.475  1.00 40.37  ? 448 ILE A C     1 
ATOM   3259  O  O     . ILE A  1  422 ? -18.321 77.063  20.479  1.00 39.81  ? 448 ILE A O     1 
ATOM   3260  C  CB    . ILE A  1  422 ? -19.124 79.093  17.932  1.00 40.95  ? 448 ILE A CB    1 
ATOM   3261  C  CG1   . ILE A  1  422 ? -19.024 79.519  16.465  1.00 41.22  ? 448 ILE A CG1   1 
ATOM   3262  C  CG2   . ILE A  1  422 ? -18.498 80.152  18.808  1.00 40.69  ? 448 ILE A CG2   1 
ATOM   3263  C  CD1   . ILE A  1  422 ? -17.630 79.770  15.976  1.00 40.56  ? 448 ILE A CD1   1 
ATOM   3264  N  N     . ARG A  1  423 ? -20.269 76.743  19.412  1.00 40.56  ? 449 ARG A N     1 
ATOM   3265  C  CA    . ARG A  1  423 ? -20.973 76.200  20.571  1.00 44.06  ? 449 ARG A CA    1 
ATOM   3266  C  C     . ARG A  1  423 ? -20.242 75.032  21.241  1.00 46.07  ? 449 ARG A C     1 
ATOM   3267  O  O     . ARG A  1  423 ? -20.201 74.940  22.468  1.00 47.24  ? 449 ARG A O     1 
ATOM   3268  C  CB    . ARG A  1  423 ? -22.405 75.815  20.170  1.00 42.67  ? 449 ARG A CB    1 
ATOM   3269  C  CG    . ARG A  1  423 ? -23.239 75.136  21.246  1.00 42.86  ? 449 ARG A CG    1 
ATOM   3270  C  CD    . ARG A  1  423 ? -23.402 75.981  22.496  1.00 45.59  ? 449 ARG A CD    1 
ATOM   3271  N  NE    . ARG A  1  423 ? -23.294 75.111  23.668  1.00 51.25  ? 449 ARG A NE    1 
ATOM   3272  C  CZ    . ARG A  1  423 ? -24.330 74.668  24.367  1.00 52.36  ? 449 ARG A CZ    1 
ATOM   3273  N  NH1   . ARG A  1  423 ? -24.149 73.862  25.399  1.00 54.14  ? 449 ARG A NH1   1 
ATOM   3274  N  NH2   . ARG A  1  423 ? -25.550 75.073  24.068  1.00 54.87  ? 449 ARG A NH2   1 
ATOM   3275  N  N     . SER A  1  424 ? -19.646 74.158  20.436  1.00 47.41  ? 450 SER A N     1 
ATOM   3276  C  CA    . SER A  1  424 ? -18.903 73.019  20.965  1.00 46.74  ? 450 SER A CA    1 
ATOM   3277  C  C     . SER A  1  424 ? -17.689 73.418  21.807  1.00 45.72  ? 450 SER A C     1 
ATOM   3278  O  O     . SER A  1  424 ? -17.328 72.714  22.751  1.00 44.51  ? 450 SER A O     1 
ATOM   3279  C  CB    . SER A  1  424 ? -18.465 72.090  19.831  1.00 45.88  ? 450 SER A CB    1 
ATOM   3280  O  OG    . SER A  1  424 ? -19.565 71.310  19.382  1.00 52.62  ? 450 SER A OG    1 
ATOM   3281  N  N     . ASP A  1  425 ? -17.072 74.546  21.471  1.00 44.58  ? 451 ASP A N     1 
ATOM   3282  C  CA    . ASP A  1  425 ? -15.902 75.024  22.195  1.00 44.89  ? 451 ASP A CA    1 
ATOM   3283  C  C     . ASP A  1  425 ? -16.176 75.556  23.607  1.00 45.92  ? 451 ASP A C     1 
ATOM   3284  O  O     . ASP A  1  425 ? -15.257 75.971  24.302  1.00 46.08  ? 451 ASP A O     1 
ATOM   3285  C  CB    . ASP A  1  425 ? -15.163 76.077  21.369  1.00 44.61  ? 451 ASP A CB    1 
ATOM   3286  C  CG    . ASP A  1  425 ? -14.026 75.491  20.559  1.00 44.66  ? 451 ASP A CG    1 
ATOM   3287  O  OD1   . ASP A  1  425 ? -13.519 76.177  19.651  1.00 45.69  ? 451 ASP A OD1   1 
ATOM   3288  O  OD2   . ASP A  1  425 ? -13.614 74.354  20.841  1.00 46.64  ? 451 ASP A OD2   1 
ATOM   3289  N  N     . MET A  1  426 ? -17.433 75.538  24.037  1.00 47.42  ? 452 MET A N     1 
ATOM   3290  C  CA    . MET A  1  426 ? -17.772 76.004  25.372  1.00 48.93  ? 452 MET A CA    1 
ATOM   3291  C  C     . MET A  1  426 ? -17.457 74.928  26.397  1.00 50.27  ? 452 MET A C     1 
ATOM   3292  O  O     . MET A  1  426 ? -17.914 74.994  27.542  1.00 51.78  ? 452 MET A O     1 
ATOM   3293  C  CB    . MET A  1  426 ? -19.248 76.394  25.458  1.00 47.49  ? 452 MET A CB    1 
ATOM   3294  C  CG    . MET A  1  426 ? -19.628 77.556  24.574  1.00 46.50  ? 452 MET A CG    1 
ATOM   3295  S  SD    . MET A  1  426 ? -18.589 78.995  24.862  1.00 49.03  ? 452 MET A SD    1 
ATOM   3296  C  CE    . MET A  1  426 ? -19.383 79.681  26.281  1.00 50.03  ? 452 MET A CE    1 
ATOM   3297  N  N     . SER A  1  427 ? -16.694 73.924  25.973  1.00 50.23  ? 453 SER A N     1 
ATOM   3298  C  CA    . SER A  1  427 ? -16.302 72.825  26.851  1.00 50.38  ? 453 SER A CA    1 
ATOM   3299  C  C     . SER A  1  427 ? -15.071 72.084  26.350  1.00 50.22  ? 453 SER A C     1 
ATOM   3300  O  O     . SER A  1  427 ? -14.462 72.472  25.356  1.00 50.07  ? 453 SER A O     1 
ATOM   3301  C  CB    . SER A  1  427 ? -17.460 71.848  27.049  1.00 50.27  ? 453 SER A CB    1 
ATOM   3302  O  OG    . SER A  1  427 ? -17.974 71.411  25.810  1.00 52.90  ? 453 SER A OG    1 
ATOM   3303  N  N     . MET A  1  428 ? -14.679 71.047  27.084  1.00 51.34  ? 454 MET A N     1 
ATOM   3304  C  CA    . MET A  1  428 ? -13.522 70.235  26.738  1.00 51.71  ? 454 MET A CA    1 
ATOM   3305  C  C     . MET A  1  428 ? -13.814 68.770  26.995  1.00 53.17  ? 454 MET A C     1 
ATOM   3306  O  O     . MET A  1  428 ? -14.649 68.436  27.831  1.00 52.62  ? 454 MET A O     1 
ATOM   3307  C  CB    . MET A  1  428 ? -12.322 70.629  27.589  1.00 52.80  ? 454 MET A CB    1 
ATOM   3308  C  CG    . MET A  1  428 ? -11.797 72.021  27.355  1.00 56.13  ? 454 MET A CG    1 
ATOM   3309  S  SD    . MET A  1  428 ? -10.435 72.336  28.481  1.00 60.50  ? 454 MET A SD    1 
ATOM   3310  C  CE    . MET A  1  428 ? -9.047  71.857  27.445  1.00 60.67  ? 454 MET A CE    1 
ATOM   3311  N  N     . MET A  1  429 ? -13.126 67.899  26.260  1.00 56.37  ? 455 MET A N     1 
ATOM   3312  C  CA    . MET A  1  429 ? -13.272 66.453  26.419  1.00 58.48  ? 455 MET A CA    1 
ATOM   3313  C  C     . MET A  1  429 ? -12.512 66.046  27.686  1.00 60.95  ? 455 MET A C     1 
ATOM   3314  O  O     . MET A  1  429 ? -11.522 66.682  28.056  1.00 58.91  ? 455 MET A O     1 
ATOM   3315  C  CB    . MET A  1  429 ? -12.658 65.720  25.214  1.00 58.33  ? 455 MET A CB    1 
ATOM   3316  C  CG    . MET A  1  429 ? -13.290 66.018  23.856  1.00 56.87  ? 455 MET A CG    1 
ATOM   3317  S  SD    . MET A  1  429 ? -14.912 65.271  23.635  1.00 57.32  ? 455 MET A SD    1 
ATOM   3318  C  CE    . MET A  1  429 ? -14.492 63.509  23.596  1.00 56.78  ? 455 MET A CE    1 
ATOM   3319  N  N     . ARG A  1  430 ? -12.978 64.992  28.347  1.00 65.21  ? 456 ARG A N     1 
ATOM   3320  C  CA    . ARG A  1  430 ? -12.334 64.492  29.561  1.00 69.51  ? 456 ARG A CA    1 
ATOM   3321  C  C     . ARG A  1  430 ? -12.672 63.016  29.785  1.00 71.03  ? 456 ARG A C     1 
ATOM   3322  O  O     . ARG A  1  430 ? -13.602 62.490  29.166  1.00 71.39  ? 456 ARG A O     1 
ATOM   3323  C  CB    . ARG A  1  430 ? -12.742 65.344  30.774  1.00 72.14  ? 456 ARG A CB    1 
ATOM   3324  C  CG    . ARG A  1  430 ? -14.236 65.601  30.904  1.00 77.77  ? 456 ARG A CG    1 
ATOM   3325  C  CD    . ARG A  1  430 ? -14.566 66.537  32.071  1.00 82.56  ? 456 ARG A CD    1 
ATOM   3326  N  NE    . ARG A  1  430 ? -14.202 65.983  33.381  1.00 88.17  ? 456 ARG A NE    1 
ATOM   3327  C  CZ    . ARG A  1  430 ? -14.660 64.833  33.885  1.00 90.21  ? 456 ARG A CZ    1 
ATOM   3328  N  NH1   . ARG A  1  430 ? -14.260 64.428  35.087  1.00 89.84  ? 456 ARG A NH1   1 
ATOM   3329  N  NH2   . ARG A  1  430 ? -15.506 64.078  33.194  1.00 90.83  ? 456 ARG A NH2   1 
ATOM   3330  N  N     . TRP A  1  431 ? -11.884 62.337  30.619  1.00 73.32  ? 457 TRP A N     1 
ATOM   3331  C  CA    . TRP A  1  431 ? -12.120 60.919  30.916  1.00 74.96  ? 457 TRP A CA    1 
ATOM   3332  C  C     . TRP A  1  431 ? -13.223 60.740  31.974  1.00 75.09  ? 457 TRP A C     1 
ATOM   3333  O  O     . TRP A  1  431 ? -14.100 59.859  31.782  1.00 73.76  ? 457 TRP A O     1 
ATOM   3334  C  CB    . TRP A  1  431 ? -10.824 60.236  31.373  1.00 76.69  ? 457 TRP A CB    1 
ATOM   3335  C  CG    . TRP A  1  431 ? -10.920 58.722  31.446  1.00 81.29  ? 457 TRP A CG    1 
ATOM   3336  C  CD1   . TRP A  1  431 ? -11.357 57.968  32.509  1.00 82.20  ? 457 TRP A CD1   1 
ATOM   3337  C  CD2   . TRP A  1  431 ? -10.577 57.783  30.408  1.00 82.88  ? 457 TRP A CD2   1 
ATOM   3338  N  NE1   . TRP A  1  431 ? -11.309 56.626  32.193  1.00 82.64  ? 457 TRP A NE1   1 
ATOM   3339  C  CE2   . TRP A  1  431 ? -10.836 56.484  30.913  1.00 82.59  ? 457 TRP A CE2   1 
ATOM   3340  C  CE3   . TRP A  1  431 ? -10.079 57.915  29.100  1.00 83.59  ? 457 TRP A CE3   1 
ATOM   3341  C  CZ2   . TRP A  1  431 ? -10.615 55.326  30.155  1.00 83.43  ? 457 TRP A CZ2   1 
ATOM   3342  C  CZ3   . TRP A  1  431 ? -9.859  56.759  28.345  1.00 83.60  ? 457 TRP A CZ3   1 
ATOM   3343  C  CH2   . TRP A  1  431 ? -10.128 55.483  28.878  1.00 84.02  ? 457 TRP A CH2   1 
ATOM   3344  O  OXT   . TRP A  1  431 ? -13.205 61.497  32.975  1.00 74.99  ? 457 TRP A OXT   1 
ATOM   3345  N  N     . LEU B  2  1   ? 11.214  123.016 39.086  1.00 114.25 ? 17  LEU B N     1 
ATOM   3346  C  CA    . LEU B  2  1   ? 10.695  121.793 39.765  1.00 114.10 ? 17  LEU B CA    1 
ATOM   3347  C  C     . LEU B  2  1   ? 9.562   122.182 40.715  1.00 113.83 ? 17  LEU B C     1 
ATOM   3348  O  O     . LEU B  2  1   ? 9.708   122.132 41.940  1.00 114.05 ? 17  LEU B O     1 
ATOM   3349  C  CB    . LEU B  2  1   ? 11.823  121.092 40.538  1.00 114.45 ? 17  LEU B CB    1 
ATOM   3350  C  CG    . LEU B  2  1   ? 11.806  119.564 40.689  1.00 114.16 ? 17  LEU B CG    1 
ATOM   3351  C  CD1   . LEU B  2  1   ? 10.531  119.086 41.360  1.00 113.51 ? 17  LEU B CD1   1 
ATOM   3352  C  CD2   . LEU B  2  1   ? 11.962  118.917 39.328  1.00 114.54 ? 17  LEU B CD2   1 
ATOM   3353  N  N     . THR B  2  2   ? 8.439   122.591 40.132  1.00 112.86 ? 18  THR B N     1 
ATOM   3354  C  CA    . THR B  2  2   ? 7.263   122.987 40.898  1.00 112.56 ? 18  THR B CA    1 
ATOM   3355  C  C     . THR B  2  2   ? 6.441   121.740 41.227  1.00 111.57 ? 18  THR B C     1 
ATOM   3356  O  O     . THR B  2  2   ? 6.030   121.013 40.326  1.00 112.83 ? 18  THR B O     1 
ATOM   3357  C  CB    . THR B  2  2   ? 6.389   123.959 40.084  1.00 113.22 ? 18  THR B CB    1 
ATOM   3358  O  OG1   . THR B  2  2   ? 7.224   124.949 39.471  1.00 113.89 ? 18  THR B OG1   1 
ATOM   3359  C  CG2   . THR B  2  2   ? 5.367   124.651 40.988  1.00 113.95 ? 18  THR B CG2   1 
ATOM   3360  N  N     . VAL B  2  3   ? 6.211   121.489 42.512  1.00 109.66 ? 19  VAL B N     1 
ATOM   3361  C  CA    . VAL B  2  3   ? 5.443   120.320 42.926  1.00 108.04 ? 19  VAL B CA    1 
ATOM   3362  C  C     . VAL B  2  3   ? 4.078   120.702 43.496  1.00 107.61 ? 19  VAL B C     1 
ATOM   3363  O  O     . VAL B  2  3   ? 3.956   121.042 44.671  1.00 108.18 ? 19  VAL B O     1 
ATOM   3364  C  CB    . VAL B  2  3   ? 6.220   119.478 43.962  1.00 107.93 ? 19  VAL B CB    1 
ATOM   3365  C  CG1   . VAL B  2  3   ? 5.459   118.204 44.291  1.00 107.59 ? 19  VAL B CG1   1 
ATOM   3366  C  CG2   . VAL B  2  3   ? 7.603   119.145 43.435  1.00 107.48 ? 19  VAL B CG2   1 
ATOM   3367  N  N     . SER B  2  4   ? 3.055   120.638 42.649  1.00 107.22 ? 20  SER B N     1 
ATOM   3368  C  CA    . SER B  2  4   ? 1.685   120.967 43.042  1.00 106.75 ? 20  SER B CA    1 
ATOM   3369  C  C     . SER B  2  4   ? 0.920   119.704 43.455  1.00 106.32 ? 20  SER B C     1 
ATOM   3370  O  O     . SER B  2  4   ? 1.381   118.589 43.211  1.00 106.36 ? 20  SER B O     1 
ATOM   3371  C  CB    . SER B  2  4   ? 0.962   121.643 41.876  1.00 106.50 ? 20  SER B CB    1 
ATOM   3372  O  OG    . SER B  2  4   ? 1.789   122.616 41.265  1.00 106.68 ? 20  SER B OG    1 
ATOM   3373  N  N     . ALA B  2  5   ? -0.248  119.885 44.067  1.00 105.85 ? 21  ALA B N     1 
ATOM   3374  C  CA    . ALA B  2  5   ? -1.079  118.764 44.508  1.00 106.11 ? 21  ALA B CA    1 
ATOM   3375  C  C     . ALA B  2  5   ? -2.495  119.207 44.868  1.00 106.62 ? 21  ALA B C     1 
ATOM   3376  O  O     . ALA B  2  5   ? -2.913  120.302 44.494  1.00 106.91 ? 21  ALA B O     1 
ATOM   3377  C  CB    . ALA B  2  5   ? -0.435  118.061 45.691  1.00 106.04 ? 21  ALA B CB    1 
ATOM   3378  N  N     . ARG B  2  6   ? -3.233  118.330 45.552  1.00 107.27 ? 22  ARG B N     1 
ATOM   3379  C  CA    . ARG B  2  6   ? -4.611  118.581 45.992  1.00 108.52 ? 22  ARG B CA    1 
ATOM   3380  C  C     . ARG B  2  6   ? -5.266  117.287 46.472  1.00 107.54 ? 22  ARG B C     1 
ATOM   3381  O  O     . ARG B  2  6   ? -5.701  116.474 45.664  1.00 108.73 ? 22  ARG B O     1 
ATOM   3382  C  CB    . ARG B  2  6   ? -5.455  119.202 44.867  1.00 110.90 ? 22  ARG B CB    1 
ATOM   3383  C  CG    . ARG B  2  6   ? -6.904  119.494 45.256  1.00 114.80 ? 22  ARG B CG    1 
ATOM   3384  C  CD    . ARG B  2  6   ? -7.524  120.579 44.380  1.00 117.98 ? 22  ARG B CD    1 
ATOM   3385  N  NE    . ARG B  2  6   ? -7.574  120.215 42.965  1.00 121.09 ? 22  ARG B NE    1 
ATOM   3386  C  CZ    . ARG B  2  6   ? -7.107  120.974 41.974  1.00 122.75 ? 22  ARG B CZ    1 
ATOM   3387  N  NH1   . ARG B  2  6   ? -7.202  120.557 40.716  1.00 123.39 ? 22  ARG B NH1   1 
ATOM   3388  N  NH2   . ARG B  2  6   ? -6.534  122.143 42.236  1.00 122.98 ? 22  ARG B NH2   1 
ATOM   3389  N  N     . ASP B  2  7   ? -5.365  117.120 47.788  1.00 106.29 ? 23  ASP B N     1 
ATOM   3390  C  CA    . ASP B  2  7   ? -5.956  115.922 48.383  1.00 105.07 ? 23  ASP B CA    1 
ATOM   3391  C  C     . ASP B  2  7   ? -7.485  115.838 48.217  1.00 104.01 ? 23  ASP B C     1 
ATOM   3392  O  O     . ASP B  2  7   ? -8.118  116.760 47.695  1.00 103.90 ? 23  ASP B O     1 
ATOM   3393  C  CB    . ASP B  2  7   ? -5.574  115.846 49.870  1.00 106.18 ? 23  ASP B CB    1 
ATOM   3394  C  CG    . ASP B  2  7   ? -5.676  114.438 50.437  1.00 107.30 ? 23  ASP B CG    1 
ATOM   3395  O  OD1   . ASP B  2  7   ? -6.210  114.272 51.555  1.00 107.61 ? 23  ASP B OD1   1 
ATOM   3396  O  OD2   . ASP B  2  7   ? -5.207  113.492 49.770  1.00 108.89 ? 23  ASP B OD2   1 
ATOM   3397  N  N     . ALA B  2  8   ? -8.050  114.706 48.640  1.00 102.37 ? 24  ALA B N     1 
ATOM   3398  C  CA    . ALA B  2  8   ? -9.489  114.426 48.581  1.00 100.35 ? 24  ALA B CA    1 
ATOM   3399  C  C     . ALA B  2  8   ? -9.731  113.036 49.188  1.00 99.40  ? 24  ALA B C     1 
ATOM   3400  O  O     . ALA B  2  8   ? -8.798  112.237 49.308  1.00 99.59  ? 24  ALA B O     1 
ATOM   3401  C  CB    . ALA B  2  8   ? -9.987  114.477 47.139  1.00 98.98  ? 24  ALA B CB    1 
ATOM   3402  N  N     . PRO B  2  9   ? -10.978 112.736 49.600  1.00 98.49  ? 25  PRO B N     1 
ATOM   3403  C  CA    . PRO B  2  9   ? -11.305 111.432 50.196  1.00 98.16  ? 25  PRO B CA    1 
ATOM   3404  C  C     . PRO B  2  9   ? -11.591 110.312 49.184  1.00 97.58  ? 25  PRO B C     1 
ATOM   3405  O  O     . PRO B  2  9   ? -12.219 109.303 49.521  1.00 97.51  ? 25  PRO B O     1 
ATOM   3406  C  CB    . PRO B  2  9   ? -12.547 111.753 51.020  1.00 97.82  ? 25  PRO B CB    1 
ATOM   3407  C  CG    . PRO B  2  9   ? -13.258 112.719 50.129  1.00 98.22  ? 25  PRO B CG    1 
ATOM   3408  C  CD    . PRO B  2  9   ? -12.137 113.644 49.673  1.00 98.20  ? 25  PRO B CD    1 
ATOM   3409  N  N     . THR B  2  10  ? -11.128 110.490 47.951  1.00 96.50  ? 26  THR B N     1 
ATOM   3410  C  CA    . THR B  2  10  ? -11.341 109.500 46.901  1.00 95.53  ? 26  THR B CA    1 
ATOM   3411  C  C     . THR B  2  10  ? -10.237 108.440 46.900  1.00 94.00  ? 26  THR B C     1 
ATOM   3412  O  O     . THR B  2  10  ? -9.151  108.665 47.446  1.00 94.30  ? 26  THR B O     1 
ATOM   3413  C  CB    . THR B  2  10  ? -11.399 110.162 45.516  1.00 96.79  ? 26  THR B CB    1 
ATOM   3414  O  OG1   . THR B  2  10  ? -10.070 110.473 45.083  1.00 96.67  ? 26  THR B OG1   1 
ATOM   3415  C  CG2   . THR B  2  10  ? -12.233 111.439 45.557  1.00 96.54  ? 26  THR B CG2   1 
ATOM   3416  N  N     . LYS B  2  11  ? -10.502 107.313 46.238  1.00 91.49  ? 27  LYS B N     1 
ATOM   3417  C  CA    . LYS B  2  11  ? -9.548  106.204 46.177  1.00 88.32  ? 27  LYS B CA    1 
ATOM   3418  C  C     . LYS B  2  11  ? -8.627  106.145 44.958  1.00 85.50  ? 27  LYS B C     1 
ATOM   3419  O  O     . LYS B  2  11  ? -7.696  105.347 44.934  1.00 85.81  ? 27  LYS B O     1 
ATOM   3420  C  CB    . LYS B  2  11  ? -10.288 104.876 46.342  1.00 88.16  ? 27  LYS B CB    1 
ATOM   3421  C  CG    . LYS B  2  11  ? -10.903 104.699 47.723  1.00 89.40  ? 27  LYS B CG    1 
ATOM   3422  C  CD    . LYS B  2  11  ? -11.734 103.432 47.817  1.00 90.31  ? 27  LYS B CD    1 
ATOM   3423  C  CE    . LYS B  2  11  ? -12.224 103.183 49.235  1.00 91.78  ? 27  LYS B CE    1 
ATOM   3424  N  NZ    . LYS B  2  11  ? -11.102 102.896 50.178  1.00 92.43  ? 27  LYS B NZ    1 
ATOM   3425  N  N     . ILE B  2  12  ? -8.856  107.007 43.972  1.00 82.70  ? 28  ILE B N     1 
ATOM   3426  C  CA    . ILE B  2  12  ? -8.039  107.020 42.757  1.00 80.80  ? 28  ILE B CA    1 
ATOM   3427  C  C     . ILE B  2  12  ? -7.221  108.301 42.621  1.00 80.32  ? 28  ILE B C     1 
ATOM   3428  O  O     . ILE B  2  12  ? -7.762  109.364 42.312  1.00 81.76  ? 28  ILE B O     1 
ATOM   3429  C  CB    . ILE B  2  12  ? -8.920  106.859 41.477  1.00 80.54  ? 28  ILE B CB    1 
ATOM   3430  C  CG1   . ILE B  2  12  ? -9.658  105.519 41.493  1.00 78.90  ? 28  ILE B CG1   1 
ATOM   3431  C  CG2   . ILE B  2  12  ? -8.074  106.980 40.213  1.00 79.46  ? 28  ILE B CG2   1 
ATOM   3432  C  CD1   . ILE B  2  12  ? -8.753  104.316 41.426  1.00 77.77  ? 28  ILE B CD1   1 
ATOM   3433  N  N     . SER B  2  13  ? -5.914  108.192 42.828  1.00 79.26  ? 29  SER B N     1 
ATOM   3434  C  CA    . SER B  2  13  ? -5.015  109.341 42.713  1.00 78.22  ? 29  SER B CA    1 
ATOM   3435  C  C     . SER B  2  13  ? -4.442  109.374 41.296  1.00 77.45  ? 29  SER B C     1 
ATOM   3436  O  O     . SER B  2  13  ? -4.514  108.379 40.579  1.00 78.07  ? 29  SER B O     1 
ATOM   3437  C  CB    . SER B  2  13  ? -3.877  109.220 43.732  1.00 78.42  ? 29  SER B CB    1 
ATOM   3438  O  OG    . SER B  2  13  ? -4.369  108.886 45.022  1.00 77.96  ? 29  SER B OG    1 
ATOM   3439  N  N     . THR B  2  14  ? -3.869  110.504 40.891  1.00 76.56  ? 30  THR B N     1 
ATOM   3440  C  CA    . THR B  2  14  ? -3.293  110.606 39.550  1.00 77.05  ? 30  THR B CA    1 
ATOM   3441  C  C     . THR B  2  14  ? -2.098  111.548 39.388  1.00 77.31  ? 30  THR B C     1 
ATOM   3442  O  O     . THR B  2  14  ? -2.245  112.740 39.106  1.00 77.72  ? 30  THR B O     1 
ATOM   3443  C  CB    . THR B  2  14  ? -4.382  110.879 38.450  1.00 77.17  ? 30  THR B CB    1 
ATOM   3444  O  OG1   . THR B  2  14  ? -3.805  111.586 37.344  1.00 76.61  ? 30  THR B OG1   1 
ATOM   3445  C  CG2   . THR B  2  14  ? -5.552  111.665 38.999  1.00 78.58  ? 30  THR B CG2   1 
ATOM   3446  N  N     . LEU B  2  15  ? -0.908  110.971 39.530  1.00 77.10  ? 31  LEU B N     1 
ATOM   3447  C  CA    . LEU B  2  15  ? 0.356   111.688 39.389  1.00 77.47  ? 31  LEU B CA    1 
ATOM   3448  C  C     . LEU B  2  15  ? 0.502   112.109 37.926  1.00 76.95  ? 31  LEU B C     1 
ATOM   3449  O  O     . LEU B  2  15  ? -0.063  111.478 37.045  1.00 78.61  ? 31  LEU B O     1 
ATOM   3450  C  CB    . LEU B  2  15  ? 1.511   110.751 39.761  1.00 78.22  ? 31  LEU B CB    1 
ATOM   3451  C  CG    . LEU B  2  15  ? 2.684   111.243 40.612  1.00 79.55  ? 31  LEU B CG    1 
ATOM   3452  C  CD1   . LEU B  2  15  ? 3.218   112.558 40.067  1.00 80.29  ? 31  LEU B CD1   1 
ATOM   3453  C  CD2   . LEU B  2  15  ? 2.243   111.402 42.062  1.00 80.30  ? 31  LEU B CD2   1 
ATOM   3454  N  N     . ALA B  2  16  ? 1.277   113.155 37.667  1.00 76.91  ? 32  ALA B N     1 
ATOM   3455  C  CA    . ALA B  2  16  ? 1.483   113.638 36.302  1.00 76.26  ? 32  ALA B CA    1 
ATOM   3456  C  C     . ALA B  2  16  ? 2.677   114.581 36.213  1.00 76.55  ? 32  ALA B C     1 
ATOM   3457  O  O     . ALA B  2  16  ? 2.769   115.552 36.964  1.00 76.85  ? 32  ALA B O     1 
ATOM   3458  C  CB    . ALA B  2  16  ? 0.234   114.336 35.798  1.00 76.00  ? 32  ALA B CB    1 
ATOM   3459  N  N     . VAL B  2  17  ? 3.586   114.290 35.286  1.00 75.99  ? 33  VAL B N     1 
ATOM   3460  C  CA    . VAL B  2  17  ? 4.779   115.105 35.099  1.00 75.79  ? 33  VAL B CA    1 
ATOM   3461  C  C     . VAL B  2  17  ? 4.745   115.825 33.761  1.00 76.84  ? 33  VAL B C     1 
ATOM   3462  O  O     . VAL B  2  17  ? 5.117   115.259 32.735  1.00 77.59  ? 33  VAL B O     1 
ATOM   3463  C  CB    . VAL B  2  17  ? 6.081   114.252 35.198  1.00 75.49  ? 33  VAL B CB    1 
ATOM   3464  C  CG1   . VAL B  2  17  ? 7.304   115.091 34.830  1.00 73.78  ? 33  VAL B CG1   1 
ATOM   3465  C  CG2   . VAL B  2  17  ? 6.243   113.693 36.609  1.00 73.78  ? 33  VAL B CG2   1 
ATOM   3466  N  N     . LYS B  2  18  ? 4.271   117.069 33.775  1.00 77.77  ? 34  LYS B N     1 
ATOM   3467  C  CA    . LYS B  2  18  ? 4.209   117.878 32.562  1.00 78.65  ? 34  LYS B CA    1 
ATOM   3468  C  C     . LYS B  2  18  ? 5.626   118.309 32.226  1.00 78.23  ? 34  LYS B C     1 
ATOM   3469  O  O     . LYS B  2  18  ? 6.440   118.519 33.121  1.00 79.45  ? 34  LYS B O     1 
ATOM   3470  C  CB    . LYS B  2  18  ? 3.319   119.102 32.772  1.00 80.44  ? 34  LYS B CB    1 
ATOM   3471  C  CG    . LYS B  2  18  ? 1.878   118.759 33.103  1.00 84.38  ? 34  LYS B CG    1 
ATOM   3472  C  CD    . LYS B  2  18  ? 1.043   120.009 33.337  1.00 88.34  ? 34  LYS B CD    1 
ATOM   3473  C  CE    . LYS B  2  18  ? -0.343  119.654 33.876  1.00 90.21  ? 34  LYS B CE    1 
ATOM   3474  N  NZ    . LYS B  2  18  ? -1.159  120.863 34.204  1.00 90.34  ? 34  LYS B NZ    1 
ATOM   3475  N  N     . VAL B  2  19  ? 5.929   118.402 30.938  1.00 77.69  ? 35  VAL B N     1 
ATOM   3476  C  CA    . VAL B  2  19  ? 7.263   118.785 30.489  1.00 77.40  ? 35  VAL B CA    1 
ATOM   3477  C  C     . VAL B  2  19  ? 7.158   119.601 29.212  1.00 77.72  ? 35  VAL B C     1 
ATOM   3478  O  O     . VAL B  2  19  ? 6.360   119.291 28.333  1.00 78.10  ? 35  VAL B O     1 
ATOM   3479  C  CB    . VAL B  2  19  ? 8.142   117.536 30.203  1.00 77.20  ? 35  VAL B CB    1 
ATOM   3480  C  CG1   . VAL B  2  19  ? 9.477   117.949 29.634  1.00 78.17  ? 35  VAL B CG1   1 
ATOM   3481  C  CG2   . VAL B  2  19  ? 8.352   116.724 31.470  1.00 76.68  ? 35  VAL B CG2   1 
ATOM   3482  N  N     . HIS B  2  20  ? 7.978   120.637 29.105  1.00 78.64  ? 36  HIS B N     1 
ATOM   3483  C  CA    . HIS B  2  20  ? 7.961   121.490 27.928  1.00 79.95  ? 36  HIS B CA    1 
ATOM   3484  C  C     . HIS B  2  20  ? 8.807   120.897 26.807  1.00 80.42  ? 36  HIS B C     1 
ATOM   3485  O  O     . HIS B  2  20  ? 9.888   121.404 26.485  1.00 80.38  ? 36  HIS B O     1 
ATOM   3486  C  CB    . HIS B  2  20  ? 8.415   122.914 28.287  1.00 80.42  ? 36  HIS B CB    1 
ATOM   3487  C  CG    . HIS B  2  20  ? 7.465   123.634 29.193  1.00 80.17  ? 36  HIS B CG    1 
ATOM   3488  N  ND1   . HIS B  2  20  ? 6.364   124.317 28.723  1.00 80.77  ? 36  HIS B ND1   1 
ATOM   3489  C  CD2   . HIS B  2  20  ? 7.421   123.735 30.543  1.00 80.13  ? 36  HIS B CD2   1 
ATOM   3490  C  CE1   . HIS B  2  20  ? 5.680   124.801 29.744  1.00 81.55  ? 36  HIS B CE1   1 
ATOM   3491  N  NE2   . HIS B  2  20  ? 6.300   124.461 30.860  1.00 80.51  ? 36  HIS B NE2   1 
ATOM   3492  N  N     . GLY B  2  21  ? 8.286   119.832 26.199  1.00 80.83  ? 37  GLY B N     1 
ATOM   3493  C  CA    . GLY B  2  21  ? 8.996   119.172 25.119  1.00 80.93  ? 37  GLY B CA    1 
ATOM   3494  C  C     . GLY B  2  21  ? 8.213   118.902 23.847  1.00 80.49  ? 37  GLY B C     1 
ATOM   3495  O  O     . GLY B  2  21  ? 8.728   118.230 22.958  1.00 81.12  ? 37  GLY B O     1 
ATOM   3496  N  N     . GLY B  2  22  ? 6.996   119.436 23.749  1.00 80.07  ? 38  GLY B N     1 
ATOM   3497  C  CA    . GLY B  2  22  ? 6.163   119.240 22.571  1.00 79.77  ? 38  GLY B CA    1 
ATOM   3498  C  C     . GLY B  2  22  ? 6.783   119.640 21.244  1.00 80.50  ? 38  GLY B C     1 
ATOM   3499  O  O     . GLY B  2  22  ? 7.946   120.037 21.179  1.00 79.98  ? 38  GLY B O     1 
ATOM   3500  N  N     . SER B  2  23  ? 5.991   119.557 20.180  1.00 82.31  ? 39  SER B N     1 
ATOM   3501  C  CA    . SER B  2  23  ? 6.460   119.881 18.833  1.00 85.05  ? 39  SER B CA    1 
ATOM   3502  C  C     . SER B  2  23  ? 7.027   121.286 18.685  1.00 86.90  ? 39  SER B C     1 
ATOM   3503  O  O     . SER B  2  23  ? 7.923   121.518 17.869  1.00 87.24  ? 39  SER B O     1 
ATOM   3504  C  CB    . SER B  2  23  ? 5.335   119.675 17.815  1.00 85.24  ? 39  SER B CB    1 
ATOM   3505  O  OG    . SER B  2  23  ? 4.257   120.561 18.064  1.00 87.19  ? 39  SER B OG    1 
ATOM   3506  N  N     . ARG B  2  24  ? 6.499   122.215 19.480  1.00 89.37  ? 40  ARG B N     1 
ATOM   3507  C  CA    . ARG B  2  24  ? 6.927   123.613 19.454  1.00 91.38  ? 40  ARG B CA    1 
ATOM   3508  C  C     . ARG B  2  24  ? 8.427   123.772 19.709  1.00 91.89  ? 40  ARG B C     1 
ATOM   3509  O  O     . ARG B  2  24  ? 9.050   124.706 19.199  1.00 92.82  ? 40  ARG B O     1 
ATOM   3510  C  CB    . ARG B  2  24  ? 6.136   124.415 20.491  1.00 92.78  ? 40  ARG B CB    1 
ATOM   3511  C  CG    . ARG B  2  24  ? 5.751   125.815 20.038  1.00 95.55  ? 40  ARG B CG    1 
ATOM   3512  C  CD    . ARG B  2  24  ? 6.610   126.902 20.678  1.00 96.88  ? 40  ARG B CD    1 
ATOM   3513  N  NE    . ARG B  2  24  ? 6.356   127.041 22.112  1.00 97.33  ? 40  ARG B NE    1 
ATOM   3514  C  CZ    . ARG B  2  24  ? 5.368   127.759 22.638  1.00 96.94  ? 40  ARG B CZ    1 
ATOM   3515  N  NH1   . ARG B  2  24  ? 5.227   127.819 23.954  1.00 97.82  ? 40  ARG B NH1   1 
ATOM   3516  N  NH2   . ARG B  2  24  ? 4.527   128.422 21.856  1.00 95.97  ? 40  ARG B NH2   1 
ATOM   3517  N  N     . TYR B  2  25  ? 9.002   122.836 20.466  1.00 91.57  ? 41  TYR B N     1 
ATOM   3518  C  CA    . TYR B  2  25  ? 10.423  122.864 20.806  1.00 90.94  ? 41  TYR B CA    1 
ATOM   3519  C  C     . TYR B  2  25  ? 11.258  121.831 20.047  1.00 90.00  ? 41  TYR B C     1 
ATOM   3520  O  O     . TYR B  2  25  ? 12.471  121.757 20.240  1.00 90.49  ? 41  TYR B O     1 
ATOM   3521  C  CB    . TYR B  2  25  ? 10.607  122.630 22.309  1.00 91.84  ? 41  TYR B CB    1 
ATOM   3522  C  CG    . TYR B  2  25  ? 9.676   123.429 23.200  1.00 93.05  ? 41  TYR B CG    1 
ATOM   3523  C  CD1   . TYR B  2  25  ? 8.626   122.803 23.872  1.00 92.72  ? 41  TYR B CD1   1 
ATOM   3524  C  CD2   . TYR B  2  25  ? 9.853   124.802 23.388  1.00 93.08  ? 41  TYR B CD2   1 
ATOM   3525  C  CE1   . TYR B  2  25  ? 7.777   123.518 24.710  1.00 93.34  ? 41  TYR B CE1   1 
ATOM   3526  C  CE2   . TYR B  2  25  ? 9.006   125.530 24.228  1.00 93.24  ? 41  TYR B CE2   1 
ATOM   3527  C  CZ    . TYR B  2  25  ? 7.969   124.881 24.887  1.00 93.63  ? 41  TYR B CZ    1 
ATOM   3528  O  OH    . TYR B  2  25  ? 7.128   125.586 25.725  1.00 92.46  ? 41  TYR B OH    1 
ATOM   3529  N  N     . ALA B  2  26  ? 10.616  121.054 19.176  1.00 88.39  ? 42  ALA B N     1 
ATOM   3530  C  CA    . ALA B  2  26  ? 11.299  120.006 18.413  1.00 86.65  ? 42  ALA B CA    1 
ATOM   3531  C  C     . ALA B  2  26  ? 12.432  120.465 17.489  1.00 85.33  ? 42  ALA B C     1 
ATOM   3532  O  O     . ALA B  2  26  ? 12.219  121.242 16.556  1.00 84.82  ? 42  ALA B O     1 
ATOM   3533  C  CB    . ALA B  2  26  ? 10.280  119.181 17.631  1.00 87.52  ? 42  ALA B CB    1 
ATOM   3534  N  N     . THR B  2  27  ? 13.628  119.932 17.734  1.00 83.56  ? 43  THR B N     1 
ATOM   3535  C  CA    . THR B  2  27  ? 14.815  120.256 16.940  1.00 82.57  ? 43  THR B CA    1 
ATOM   3536  C  C     . THR B  2  27  ? 14.761  119.694 15.510  1.00 81.35  ? 43  THR B C     1 
ATOM   3537  O  O     . THR B  2  27  ? 15.281  120.302 14.573  1.00 80.90  ? 43  THR B O     1 
ATOM   3538  C  CB    . THR B  2  27  ? 16.114  119.803 17.670  1.00 83.12  ? 43  THR B CB    1 
ATOM   3539  O  OG1   . THR B  2  27  ? 17.190  119.694 16.729  1.00 83.59  ? 43  THR B OG1   1 
ATOM   3540  C  CG2   . THR B  2  27  ? 15.911  118.475 18.391  1.00 83.45  ? 43  THR B CG2   1 
ATOM   3541  N  N     . LYS B  2  28  ? 14.164  118.512 15.360  1.00 80.78  ? 44  LYS B N     1 
ATOM   3542  C  CA    . LYS B  2  28  ? 13.996  117.866 14.054  1.00 79.00  ? 44  LYS B CA    1 
ATOM   3543  C  C     . LYS B  2  28  ? 12.536  117.426 13.934  1.00 77.86  ? 44  LYS B C     1 
ATOM   3544  O  O     . LYS B  2  28  ? 11.875  117.189 14.951  1.00 76.85  ? 44  LYS B O     1 
ATOM   3545  C  CB    . LYS B  2  28  ? 14.945  116.673 13.889  1.00 79.02  ? 44  LYS B CB    1 
ATOM   3546  C  CG    . LYS B  2  28  ? 16.250  116.999 13.172  1.00 79.54  ? 44  LYS B CG    1 
ATOM   3547  C  CD    . LYS B  2  28  ? 17.131  115.767 13.035  1.00 80.09  ? 44  LYS B CD    1 
ATOM   3548  C  CE    . LYS B  2  28  ? 18.391  116.069 12.237  1.00 80.71  ? 44  LYS B CE    1 
ATOM   3549  N  NZ    . LYS B  2  28  ? 19.319  114.906 12.187  1.00 80.38  ? 44  LYS B NZ    1 
ATOM   3550  N  N     . ASP B  2  29  ? 12.031  117.345 12.703  1.00 76.71  ? 45  ASP B N     1 
ATOM   3551  C  CA    . ASP B  2  29  ? 10.639  116.968 12.461  1.00 76.25  ? 45  ASP B CA    1 
ATOM   3552  C  C     . ASP B  2  29  ? 10.156  115.668 13.103  1.00 75.61  ? 45  ASP B C     1 
ATOM   3553  O  O     . ASP B  2  29  ? 10.634  114.578 12.783  1.00 75.94  ? 45  ASP B O     1 
ATOM   3554  C  CB    . ASP B  2  29  ? 10.334  116.953 10.960  1.00 77.64  ? 45  ASP B CB    1 
ATOM   3555  C  CG    . ASP B  2  29  ? 10.161  118.352 10.378  1.00 80.04  ? 45  ASP B CG    1 
ATOM   3556  O  OD1   . ASP B  2  29  ? 9.838   119.290 11.147  1.00 81.37  ? 45  ASP B OD1   1 
ATOM   3557  O  OD2   . ASP B  2  29  ? 10.340  118.511 9.146   1.00 79.19  ? 45  ASP B OD2   1 
ATOM   3558  N  N     . GLY B  2  30  ? 9.211   115.810 14.032  1.00 74.42  ? 46  GLY B N     1 
ATOM   3559  C  CA    . GLY B  2  30  ? 8.631   114.666 14.715  1.00 71.99  ? 46  GLY B CA    1 
ATOM   3560  C  C     . GLY B  2  30  ? 9.420   114.029 15.845  1.00 71.02  ? 46  GLY B C     1 
ATOM   3561  O  O     . GLY B  2  30  ? 8.962   113.054 16.439  1.00 70.90  ? 46  GLY B O     1 
ATOM   3562  N  N     . VAL B  2  31  ? 10.579  114.584 16.180  1.00 69.68  ? 47  VAL B N     1 
ATOM   3563  C  CA    . VAL B  2  31  ? 11.397  114.013 17.245  1.00 68.91  ? 47  VAL B CA    1 
ATOM   3564  C  C     . VAL B  2  31  ? 10.674  113.960 18.584  1.00 67.35  ? 47  VAL B C     1 
ATOM   3565  O  O     . VAL B  2  31  ? 10.880  113.032 19.369  1.00 67.69  ? 47  VAL B O     1 
ATOM   3566  C  CB    . VAL B  2  31  ? 12.738  114.752 17.397  1.00 69.96  ? 47  VAL B CB    1 
ATOM   3567  C  CG1   . VAL B  2  31  ? 13.600  114.068 18.441  1.00 71.69  ? 47  VAL B CG1   1 
ATOM   3568  C  CG2   . VAL B  2  31  ? 13.471  114.753 16.079  1.00 71.25  ? 47  VAL B CG2   1 
ATOM   3569  N  N     . ALA B  2  32  ? 9.821   114.942 18.844  1.00 65.56  ? 48  ALA B N     1 
ATOM   3570  C  CA    . ALA B  2  32  ? 9.071   114.961 20.094  1.00 65.01  ? 48  ALA B CA    1 
ATOM   3571  C  C     . ALA B  2  32  ? 8.140   113.763 20.076  1.00 65.02  ? 48  ALA B C     1 
ATOM   3572  O  O     . ALA B  2  32  ? 7.975   113.078 21.089  1.00 65.56  ? 48  ALA B O     1 
ATOM   3573  C  CB    . ALA B  2  32  ? 8.268   116.248 20.220  1.00 65.14  ? 48  ALA B CB    1 
ATOM   3574  N  N     . HIS B  2  33  ? 7.580   113.495 18.893  1.00 64.39  ? 49  HIS B N     1 
ATOM   3575  C  CA    . HIS B  2  33  ? 6.660   112.381 18.680  1.00 62.64  ? 49  HIS B CA    1 
ATOM   3576  C  C     . HIS B  2  33  ? 7.347   111.084 19.081  1.00 61.78  ? 49  HIS B C     1 
ATOM   3577  O  O     . HIS B  2  33  ? 6.881   110.382 19.979  1.00 61.30  ? 49  HIS B O     1 
ATOM   3578  C  CB    . HIS B  2  33  ? 6.225   112.334 17.210  1.00 62.57  ? 49  HIS B CB    1 
ATOM   3579  C  CG    . HIS B  2  33  ? 5.261   111.230 16.883  1.00 64.37  ? 49  HIS B CG    1 
ATOM   3580  N  ND1   . HIS B  2  33  ? 4.486   110.602 17.837  1.00 63.41  ? 49  HIS B ND1   1 
ATOM   3581  C  CD2   . HIS B  2  33  ? 4.943   110.648 15.700  1.00 63.15  ? 49  HIS B CD2   1 
ATOM   3582  C  CE1   . HIS B  2  33  ? 3.733   109.685 17.256  1.00 62.13  ? 49  HIS B CE1   1 
ATOM   3583  N  NE2   . HIS B  2  33  ? 3.991   109.693 15.959  1.00 62.23  ? 49  HIS B NE2   1 
ATOM   3584  N  N     . LEU B  2  34  ? 8.496   110.817 18.465  1.00 60.85  ? 50  LEU B N     1 
ATOM   3585  C  CA    . LEU B  2  34  ? 9.255   109.605 18.748  1.00 62.16  ? 50  LEU B CA    1 
ATOM   3586  C  C     . LEU B  2  34  ? 9.538   109.407 20.233  1.00 63.40  ? 50  LEU B C     1 
ATOM   3587  O  O     . LEU B  2  34  ? 9.375   108.298 20.757  1.00 63.58  ? 50  LEU B O     1 
ATOM   3588  C  CB    . LEU B  2  34  ? 10.561  109.582 17.947  1.00 60.19  ? 50  LEU B CB    1 
ATOM   3589  C  CG    . LEU B  2  34  ? 10.347  109.521 16.435  1.00 60.36  ? 50  LEU B CG    1 
ATOM   3590  C  CD1   . LEU B  2  34  ? 11.655  109.291 15.713  1.00 59.53  ? 50  LEU B CD1   1 
ATOM   3591  C  CD2   . LEU B  2  34  ? 9.374   108.403 16.111  1.00 61.36  ? 50  LEU B CD2   1 
ATOM   3592  N  N     . LEU B  2  35  ? 9.903   110.491 20.916  1.00 63.67  ? 51  LEU B N     1 
ATOM   3593  C  CA    . LEU B  2  35  ? 10.212  110.428 22.337  1.00 63.50  ? 51  LEU B CA    1 
ATOM   3594  C  C     . LEU B  2  35  ? 8.984   110.114 23.181  1.00 63.16  ? 51  LEU B C     1 
ATOM   3595  O  O     . LEU B  2  35  ? 9.077   109.384 24.170  1.00 62.42  ? 51  LEU B O     1 
ATOM   3596  C  CB    . LEU B  2  35  ? 10.865  111.726 22.810  1.00 65.33  ? 51  LEU B CB    1 
ATOM   3597  C  CG    . LEU B  2  35  ? 11.278  111.756 24.288  1.00 66.00  ? 51  LEU B CG    1 
ATOM   3598  C  CD1   . LEU B  2  35  ? 12.328  110.694 24.562  1.00 65.93  ? 51  LEU B CD1   1 
ATOM   3599  C  CD2   . LEU B  2  35  ? 11.803  113.136 24.642  1.00 66.18  ? 51  LEU B CD2   1 
ATOM   3600  N  N     . ASN B  2  36  ? 7.838   110.678 22.809  1.00 63.09  ? 52  ASN B N     1 
ATOM   3601  C  CA    . ASN B  2  36  ? 6.605   110.415 23.554  1.00 63.81  ? 52  ASN B CA    1 
ATOM   3602  C  C     . ASN B  2  36  ? 6.283   108.926 23.414  1.00 64.42  ? 52  ASN B C     1 
ATOM   3603  O  O     . ASN B  2  36  ? 5.784   108.279 24.347  1.00 64.53  ? 52  ASN B O     1 
ATOM   3604  C  CB    . ASN B  2  36  ? 5.444   111.254 23.007  1.00 61.96  ? 52  ASN B CB    1 
ATOM   3605  C  CG    . ASN B  2  36  ? 4.141   111.005 23.757  1.00 61.87  ? 52  ASN B CG    1 
ATOM   3606  O  OD1   . ASN B  2  36  ? 3.116   110.686 23.161  1.00 63.11  ? 52  ASN B OD1   1 
ATOM   3607  N  ND2   . ASN B  2  36  ? 4.185   111.131 25.072  1.00 60.21  ? 52  ASN B ND2   1 
ATOM   3608  N  N     . ARG B  2  37  ? 6.605   108.396 22.236  1.00 63.68  ? 53  ARG B N     1 
ATOM   3609  C  CA    . ARG B  2  37  ? 6.385   106.998 21.904  1.00 62.31  ? 53  ARG B CA    1 
ATOM   3610  C  C     . ARG B  2  37  ? 7.470   106.110 22.546  1.00 61.71  ? 53  ARG B C     1 
ATOM   3611  O  O     . ARG B  2  37  ? 7.233   104.934 22.818  1.00 62.30  ? 53  ARG B O     1 
ATOM   3612  C  CB    . ARG B  2  37  ? 6.384   106.844 20.381  1.00 60.69  ? 53  ARG B CB    1 
ATOM   3613  C  CG    . ARG B  2  37  ? 5.320   105.905 19.827  1.00 59.89  ? 53  ARG B CG    1 
ATOM   3614  C  CD    . ARG B  2  37  ? 3.889   106.419 19.991  1.00 55.00  ? 53  ARG B CD    1 
ATOM   3615  N  NE    . ARG B  2  37  ? 3.106   105.543 20.862  1.00 52.34  ? 53  ARG B NE    1 
ATOM   3616  C  CZ    . ARG B  2  37  ? 1.803   105.301 20.731  1.00 53.02  ? 53  ARG B CZ    1 
ATOM   3617  N  NH1   . ARG B  2  37  ? 1.192   104.490 21.585  1.00 50.70  ? 53  ARG B NH1   1 
ATOM   3618  N  NH2   . ARG B  2  37  ? 1.105   105.864 19.754  1.00 51.29  ? 53  ARG B NH2   1 
ATOM   3619  N  N     . PHE B  2  38  ? 8.649   106.682 22.800  1.00 59.61  ? 54  PHE B N     1 
ATOM   3620  C  CA    . PHE B  2  38  ? 9.759   105.945 23.419  1.00 56.79  ? 54  PHE B CA    1 
ATOM   3621  C  C     . PHE B  2  38  ? 9.621   105.856 24.941  1.00 57.35  ? 54  PHE B C     1 
ATOM   3622  O  O     . PHE B  2  38  ? 10.366  105.129 25.589  1.00 57.67  ? 54  PHE B O     1 
ATOM   3623  C  CB    . PHE B  2  38  ? 11.103  106.598 23.071  1.00 52.06  ? 54  PHE B CB    1 
ATOM   3624  C  CG    . PHE B  2  38  ? 12.154  105.630 22.584  1.00 49.36  ? 54  PHE B CG    1 
ATOM   3625  C  CD1   . PHE B  2  38  ? 12.841  105.878 21.391  1.00 47.36  ? 54  PHE B CD1   1 
ATOM   3626  C  CD2   . PHE B  2  38  ? 12.469  104.479 23.316  1.00 47.03  ? 54  PHE B CD2   1 
ATOM   3627  C  CE1   . PHE B  2  38  ? 13.828  104.998 20.931  1.00 47.20  ? 54  PHE B CE1   1 
ATOM   3628  C  CE2   . PHE B  2  38  ? 13.456  103.588 22.869  1.00 45.83  ? 54  PHE B CE2   1 
ATOM   3629  C  CZ    . PHE B  2  38  ? 14.139  103.850 21.670  1.00 46.61  ? 54  PHE B CZ    1 
ATOM   3630  N  N     . ASN B  2  39  ? 8.680   106.604 25.511  1.00 59.09  ? 55  ASN B N     1 
ATOM   3631  C  CA    . ASN B  2  39  ? 8.465   106.585 26.956  1.00 60.77  ? 55  ASN B CA    1 
ATOM   3632  C  C     . ASN B  2  39  ? 7.868   105.270 27.406  1.00 60.73  ? 55  ASN B C     1 
ATOM   3633  O  O     . ASN B  2  39  ? 7.078   104.663 26.696  1.00 61.59  ? 55  ASN B O     1 
ATOM   3634  C  CB    . ASN B  2  39  ? 7.540   107.726 27.401  1.00 62.93  ? 55  ASN B CB    1 
ATOM   3635  C  CG    . ASN B  2  39  ? 8.250   109.064 27.497  1.00 64.91  ? 55  ASN B CG    1 
ATOM   3636  O  OD1   . ASN B  2  39  ? 7.605   110.105 27.563  1.00 67.66  ? 55  ASN B OD1   1 
ATOM   3637  N  ND2   . ASN B  2  39  ? 9.580   109.043 27.519  1.00 65.95  ? 55  ASN B ND2   1 
ATOM   3638  N  N     . PHE B  2  40  ? 8.218   104.867 28.617  1.00 61.97  ? 56  PHE B N     1 
ATOM   3639  C  CA    . PHE B  2  40  ? 7.736   103.626 29.206  1.00 62.88  ? 56  PHE B CA    1 
ATOM   3640  C  C     . PHE B  2  40  ? 8.260   102.353 28.543  1.00 62.01  ? 56  PHE B C     1 
ATOM   3641  O  O     . PHE B  2  40  ? 7.778   101.251 28.824  1.00 60.52  ? 56  PHE B O     1 
ATOM   3642  C  CB    . PHE B  2  40  ? 6.215   103.637 29.334  1.00 64.98  ? 56  PHE B CB    1 
ATOM   3643  C  CG    . PHE B  2  40  ? 5.711   104.707 30.250  1.00 68.85  ? 56  PHE B CG    1 
ATOM   3644  C  CD1   . PHE B  2  40  ? 5.071   105.837 29.744  1.00 69.31  ? 56  PHE B CD1   1 
ATOM   3645  C  CD2   . PHE B  2  40  ? 5.917   104.611 31.625  1.00 69.77  ? 56  PHE B CD2   1 
ATOM   3646  C  CE1   . PHE B  2  40  ? 4.645   106.855 30.597  1.00 69.85  ? 56  PHE B CE1   1 
ATOM   3647  C  CE2   . PHE B  2  40  ? 5.495   105.625 32.487  1.00 69.53  ? 56  PHE B CE2   1 
ATOM   3648  C  CZ    . PHE B  2  40  ? 4.859   106.748 31.973  1.00 69.18  ? 56  PHE B CZ    1 
ATOM   3649  N  N     . GLN B  2  41  ? 9.247   102.518 27.663  1.00 61.23  ? 57  GLN B N     1 
ATOM   3650  C  CA    . GLN B  2  41  ? 9.909   101.389 27.026  1.00 61.27  ? 57  GLN B CA    1 
ATOM   3651  C  C     . GLN B  2  41  ? 10.851  100.836 28.108  1.00 63.09  ? 57  GLN B C     1 
ATOM   3652  O  O     . GLN B  2  41  ? 10.477  100.757 29.287  1.00 63.50  ? 57  GLN B O     1 
ATOM   3653  C  CB    . GLN B  2  41  ? 10.712  101.838 25.802  1.00 59.36  ? 57  GLN B CB    1 
ATOM   3654  C  CG    . GLN B  2  41  ? 9.902   101.946 24.526  1.00 61.15  ? 57  GLN B CG    1 
ATOM   3655  C  CD    . GLN B  2  41  ? 9.331   100.606 24.072  1.00 61.99  ? 57  GLN B CD    1 
ATOM   3656  O  OE1   . GLN B  2  41  ? 8.144   100.498 23.770  1.00 62.27  ? 57  GLN B OE1   1 
ATOM   3657  N  NE2   . GLN B  2  41  ? 10.179  99.583  24.015  1.00 62.89  ? 57  GLN B NE2   1 
ATOM   3658  N  N     . ASN B  2  42  ? 12.081  100.498 27.738  1.00 64.14  ? 58  ASN B N     1 
ATOM   3659  C  CA    . ASN B  2  42  ? 13.020  99.963  28.721  1.00 65.71  ? 58  ASN B CA    1 
ATOM   3660  C  C     . ASN B  2  42  ? 13.880  100.995 29.432  1.00 66.01  ? 58  ASN B C     1 
ATOM   3661  O  O     . ASN B  2  42  ? 14.370  101.935 28.811  1.00 65.00  ? 58  ASN B O     1 
ATOM   3662  C  CB    . ASN B  2  42  ? 13.946  98.925  28.080  1.00 65.55  ? 58  ASN B CB    1 
ATOM   3663  C  CG    . ASN B  2  42  ? 13.372  97.530  28.111  1.00 65.69  ? 58  ASN B CG    1 
ATOM   3664  O  OD1   . ASN B  2  42  ? 12.371  97.269  28.776  1.00 66.19  ? 58  ASN B OD1   1 
ATOM   3665  N  ND2   . ASN B  2  42  ? 14.011  96.619  27.397  1.00 64.67  ? 58  ASN B ND2   1 
ATOM   3666  N  N     . THR B  2  43  ? 14.008  100.834 30.748  1.00 67.01  ? 59  THR B N     1 
ATOM   3667  C  CA    . THR B  2  43  ? 14.875  101.695 31.552  1.00 67.96  ? 59  THR B CA    1 
ATOM   3668  C  C     . THR B  2  43  ? 16.089  100.802 31.812  1.00 68.96  ? 59  THR B C     1 
ATOM   3669  O  O     . THR B  2  43  ? 16.087  99.633  31.429  1.00 69.86  ? 59  THR B O     1 
ATOM   3670  C  CB    . THR B  2  43  ? 14.259  102.111 32.924  1.00 66.18  ? 59  THR B CB    1 
ATOM   3671  O  OG1   . THR B  2  43  ? 14.153  100.968 33.781  1.00 66.04  ? 59  THR B OG1   1 
ATOM   3672  C  CG2   . THR B  2  43  ? 12.896  102.753 32.744  1.00 64.67  ? 59  THR B CG2   1 
ATOM   3673  N  N     . ASN B  2  44  ? 17.108  101.327 32.479  1.00 69.95  ? 60  ASN B N     1 
ATOM   3674  C  CA    . ASN B  2  44  ? 18.300  100.535 32.751  1.00 69.35  ? 60  ASN B CA    1 
ATOM   3675  C  C     . ASN B  2  44  ? 18.152  99.526  33.878  1.00 69.09  ? 60  ASN B C     1 
ATOM   3676  O  O     . ASN B  2  44  ? 18.999  98.655  34.032  1.00 70.46  ? 60  ASN B O     1 
ATOM   3677  C  CB    . ASN B  2  44  ? 19.496  101.448 33.002  1.00 70.77  ? 60  ASN B CB    1 
ATOM   3678  C  CG    . ASN B  2  44  ? 19.960  102.153 31.741  1.00 73.10  ? 60  ASN B CG    1 
ATOM   3679  O  OD1   . ASN B  2  44  ? 19.922  101.585 30.649  1.00 75.87  ? 60  ASN B OD1   1 
ATOM   3680  N  ND2   . ASN B  2  44  ? 20.408  103.394 31.886  1.00 73.37  ? 60  ASN B ND2   1 
ATOM   3681  N  N     . THR B  2  45  ? 17.058  99.601  34.629  1.00 68.78  ? 61  THR B N     1 
ATOM   3682  C  CA    . THR B  2  45  ? 16.840  98.674  35.739  1.00 70.10  ? 61  THR B CA    1 
ATOM   3683  C  C     . THR B  2  45  ? 15.519  97.898  35.659  1.00 70.14  ? 61  THR B C     1 
ATOM   3684  O  O     . THR B  2  45  ? 15.357  96.850  36.304  1.00 70.33  ? 61  THR B O     1 
ATOM   3685  C  CB    . THR B  2  45  ? 16.889  99.408  37.114  1.00 71.22  ? 61  THR B CB    1 
ATOM   3686  O  OG1   . THR B  2  45  ? 15.829  100.375 37.196  1.00 70.21  ? 61  THR B OG1   1 
ATOM   3687  C  CG2   . THR B  2  45  ? 18.236  100.104 37.300  1.00 71.75  ? 61  THR B CG2   1 
ATOM   3688  N  N     . ARG B  2  46  ? 14.585  98.412  34.863  1.00 68.39  ? 62  ARG B N     1 
ATOM   3689  C  CA    . ARG B  2  46  ? 13.270  97.799  34.721  1.00 65.60  ? 62  ARG B CA    1 
ATOM   3690  C  C     . ARG B  2  46  ? 12.909  97.694  33.245  1.00 63.18  ? 62  ARG B C     1 
ATOM   3691  O  O     . ARG B  2  46  ? 13.113  98.639  32.480  1.00 62.81  ? 62  ARG B O     1 
ATOM   3692  C  CB    . ARG B  2  46  ? 12.233  98.673  35.434  1.00 66.62  ? 62  ARG B CB    1 
ATOM   3693  C  CG    . ARG B  2  46  ? 10.974  97.960  35.889  1.00 68.76  ? 62  ARG B CG    1 
ATOM   3694  C  CD    . ARG B  2  46  ? 10.908  97.896  37.415  1.00 73.23  ? 62  ARG B CD    1 
ATOM   3695  N  NE    . ARG B  2  46  ? 9.964   98.840  38.036  1.00 76.31  ? 62  ARG B NE    1 
ATOM   3696  C  CZ    . ARG B  2  46  ? 10.063  100.172 38.020  1.00 76.94  ? 62  ARG B CZ    1 
ATOM   3697  N  NH1   . ARG B  2  46  ? 9.143   100.899 38.633  1.00 78.52  ? 62  ARG B NH1   1 
ATOM   3698  N  NH2   . ARG B  2  46  ? 11.049  100.788 37.376  1.00 77.76  ? 62  ARG B NH2   1 
ATOM   3699  N  N     . SER B  2  47  ? 12.393  96.537  32.842  1.00 60.50  ? 63  SER B N     1 
ATOM   3700  C  CA    . SER B  2  47  ? 11.976  96.333  31.451  1.00 57.02  ? 63  SER B CA    1 
ATOM   3701  C  C     . SER B  2  47  ? 10.522  96.777  31.313  1.00 55.71  ? 63  SER B C     1 
ATOM   3702  O  O     . SER B  2  47  ? 9.766   96.772  32.298  1.00 55.70  ? 63  SER B O     1 
ATOM   3703  C  CB    . SER B  2  47  ? 12.093  94.861  31.044  1.00 54.68  ? 63  SER B CB    1 
ATOM   3704  O  OG    . SER B  2  47  ? 11.109  94.070  31.694  1.00 52.26  ? 63  SER B OG    1 
ATOM   3705  N  N     . ALA B  2  48  ? 10.135  97.159  30.098  1.00 53.73  ? 64  ALA B N     1 
ATOM   3706  C  CA    . ALA B  2  48  ? 8.764   97.595  29.820  1.00 51.92  ? 64  ALA B CA    1 
ATOM   3707  C  C     . ALA B  2  48  ? 7.761   96.519  30.265  1.00 51.00  ? 64  ALA B C     1 
ATOM   3708  O  O     . ALA B  2  48  ? 6.664   96.823  30.738  1.00 51.62  ? 64  ALA B O     1 
ATOM   3709  C  CB    . ALA B  2  48  ? 8.605   97.894  28.340  1.00 46.65  ? 64  ALA B CB    1 
ATOM   3710  N  N     . LEU B  2  49  ? 8.178   95.263  30.153  1.00 50.31  ? 65  LEU B N     1 
ATOM   3711  C  CA    . LEU B  2  49  ? 7.359   94.129  30.545  1.00 50.97  ? 65  LEU B CA    1 
ATOM   3712  C  C     . LEU B  2  49  ? 7.158   94.063  32.064  1.00 51.53  ? 65  LEU B C     1 
ATOM   3713  O  O     . LEU B  2  49  ? 6.025   93.930  32.536  1.00 49.51  ? 65  LEU B O     1 
ATOM   3714  C  CB    . LEU B  2  49  ? 7.989   92.826  30.019  1.00 49.19  ? 65  LEU B CB    1 
ATOM   3715  C  CG    . LEU B  2  49  ? 7.441   91.461  30.452  1.00 46.22  ? 65  LEU B CG    1 
ATOM   3716  C  CD1   . LEU B  2  49  ? 6.006   91.276  30.015  1.00 45.76  ? 65  LEU B CD1   1 
ATOM   3717  C  CD2   . LEU B  2  49  ? 8.318   90.389  29.863  1.00 46.49  ? 65  LEU B CD2   1 
ATOM   3718  N  N     . LYS B  2  50  ? 8.252   94.152  32.824  1.00 53.76  ? 66  LYS B N     1 
ATOM   3719  C  CA    . LYS B  2  50  ? 8.169   94.098  34.287  1.00 56.03  ? 66  LYS B CA    1 
ATOM   3720  C  C     . LYS B  2  50  ? 7.353   95.270  34.836  1.00 55.27  ? 66  LYS B C     1 
ATOM   3721  O  O     . LYS B  2  50  ? 6.538   95.109  35.760  1.00 53.46  ? 66  LYS B O     1 
ATOM   3722  C  CB    . LYS B  2  50  ? 9.564   94.077  34.927  1.00 59.07  ? 66  LYS B CB    1 
ATOM   3723  C  CG    . LYS B  2  50  ? 9.522   93.746  36.420  1.00 63.60  ? 66  LYS B CG    1 
ATOM   3724  C  CD    . LYS B  2  50  ? 10.877  93.312  36.948  1.00 68.74  ? 66  LYS B CD    1 
ATOM   3725  C  CE    . LYS B  2  50  ? 10.753  92.752  38.369  1.00 72.82  ? 66  LYS B CE    1 
ATOM   3726  N  NZ    . LYS B  2  50  ? 12.037  92.166  38.882  1.00 74.23  ? 66  LYS B NZ    1 
ATOM   3727  N  N     . LEU B  2  51  ? 7.552   96.437  34.228  1.00 52.96  ? 67  LEU B N     1 
ATOM   3728  C  CA    . LEU B  2  51  ? 6.839   97.637  34.623  1.00 53.26  ? 67  LEU B CA    1 
ATOM   3729  C  C     . LEU B  2  51  ? 5.332   97.409  34.546  1.00 53.62  ? 67  LEU B C     1 
ATOM   3730  O  O     . LEU B  2  51  ? 4.604   97.689  35.502  1.00 54.19  ? 67  LEU B O     1 
ATOM   3731  C  CB    . LEU B  2  51  ? 7.243   98.806  33.720  1.00 53.79  ? 67  LEU B CB    1 
ATOM   3732  C  CG    . LEU B  2  51  ? 6.634   100.177 34.021  1.00 53.43  ? 67  LEU B CG    1 
ATOM   3733  C  CD1   . LEU B  2  51  ? 6.864   100.522 35.486  1.00 53.43  ? 67  LEU B CD1   1 
ATOM   3734  C  CD2   . LEU B  2  51  ? 7.272   101.222 33.110  1.00 53.52  ? 67  LEU B CD2   1 
ATOM   3735  N  N     . VAL B  2  52  ? 4.877   96.863  33.420  1.00 52.35  ? 68  VAL B N     1 
ATOM   3736  C  CA    . VAL B  2  52  ? 3.461   96.600  33.214  1.00 51.04  ? 68  VAL B CA    1 
ATOM   3737  C  C     . VAL B  2  52  ? 2.932   95.502  34.134  1.00 51.58  ? 68  VAL B C     1 
ATOM   3738  O  O     . VAL B  2  52  ? 1.885   95.652  34.765  1.00 51.27  ? 68  VAL B O     1 
ATOM   3739  C  CB    . VAL B  2  52  ? 3.159   96.221  31.736  1.00 51.28  ? 68  VAL B CB    1 
ATOM   3740  C  CG1   . VAL B  2  52  ? 1.676   95.948  31.552  1.00 48.78  ? 68  VAL B CG1   1 
ATOM   3741  C  CG2   . VAL B  2  52  ? 3.617   97.319  30.788  1.00 47.24  ? 68  VAL B CG2   1 
ATOM   3742  N  N     . ARG B  2  53  ? 3.663   94.402  34.232  1.00 53.34  ? 69  ARG B N     1 
ATOM   3743  C  CA    . ARG B  2  53  ? 3.212   93.296  35.065  1.00 56.68  ? 69  ARG B CA    1 
ATOM   3744  C  C     . ARG B  2  53  ? 3.088   93.733  36.509  1.00 57.14  ? 69  ARG B C     1 
ATOM   3745  O  O     . ARG B  2  53  ? 2.138   93.356  37.182  1.00 56.43  ? 69  ARG B O     1 
ATOM   3746  C  CB    . ARG B  2  53  ? 4.144   92.087  34.927  1.00 57.87  ? 69  ARG B CB    1 
ATOM   3747  C  CG    . ARG B  2  53  ? 4.392   91.679  33.482  1.00 60.28  ? 69  ARG B CG    1 
ATOM   3748  C  CD    . ARG B  2  53  ? 3.090   91.366  32.742  1.00 61.69  ? 69  ARG B CD    1 
ATOM   3749  N  NE    . ARG B  2  53  ? 2.720   89.960  32.854  1.00 63.40  ? 69  ARG B NE    1 
ATOM   3750  C  CZ    . ARG B  2  53  ? 2.912   89.060  31.896  1.00 62.39  ? 69  ARG B CZ    1 
ATOM   3751  N  NH1   . ARG B  2  53  ? 2.552   87.804  32.098  1.00 63.49  ? 69  ARG B NH1   1 
ATOM   3752  N  NH2   . ARG B  2  53  ? 3.433   89.421  30.730  1.00 60.71  ? 69  ARG B NH2   1 
ATOM   3753  N  N     . GLU B  2  54  ? 4.022   94.568  36.965  1.00 59.88  ? 70  GLU B N     1 
ATOM   3754  C  CA    . GLU B  2  54  ? 3.995   95.065  38.345  1.00 61.73  ? 70  GLU B CA    1 
ATOM   3755  C  C     . GLU B  2  54  ? 2.827   96.008  38.617  1.00 60.04  ? 70  GLU B C     1 
ATOM   3756  O  O     . GLU B  2  54  ? 2.015   95.758  39.513  1.00 59.06  ? 70  GLU B O     1 
ATOM   3757  C  CB    . GLU B  2  54  ? 5.308   95.755  38.717  1.00 64.77  ? 70  GLU B CB    1 
ATOM   3758  C  CG    . GLU B  2  54  ? 6.332   94.833  39.355  1.00 68.41  ? 70  GLU B CG    1 
ATOM   3759  C  CD    . GLU B  2  54  ? 7.547   95.578  39.872  1.00 70.76  ? 70  GLU B CD    1 
ATOM   3760  O  OE1   . GLU B  2  54  ? 7.905   95.361  41.049  1.00 74.26  ? 70  GLU B OE1   1 
ATOM   3761  O  OE2   . GLU B  2  54  ? 8.148   96.371  39.110  1.00 70.33  ? 70  GLU B OE2   1 
ATOM   3762  N  N     . SER B  2  55  ? 2.736   97.078  37.832  1.00 58.58  ? 71  SER B N     1 
ATOM   3763  C  CA    . SER B  2  55  ? 1.661   98.043  37.999  1.00 59.17  ? 71  SER B CA    1 
ATOM   3764  C  C     . SER B  2  55  ? 0.279   97.405  37.943  1.00 60.02  ? 71  SER B C     1 
ATOM   3765  O  O     . SER B  2  55  ? -0.627  97.840  38.651  1.00 62.63  ? 71  SER B O     1 
ATOM   3766  C  CB    . SER B  2  55  ? 1.780   99.180  36.986  1.00 57.72  ? 71  SER B CB    1 
ATOM   3767  O  OG    . SER B  2  55  ? 2.185   98.701  35.723  1.00 59.16  ? 71  SER B OG    1 
ATOM   3768  N  N     . GLU B  2  56  ? 0.130   96.348  37.146  1.00 59.22  ? 72  GLU B N     1 
ATOM   3769  C  CA    . GLU B  2  56  ? -1.149  95.657  37.037  1.00 59.00  ? 72  GLU B CA    1 
ATOM   3770  C  C     . GLU B  2  56  ? -1.495  94.993  38.360  1.00 59.11  ? 72  GLU B C     1 
ATOM   3771  O  O     . GLU B  2  56  ? -2.642  95.033  38.798  1.00 59.15  ? 72  GLU B O     1 
ATOM   3772  C  CB    . GLU B  2  56  ? -1.106  94.596  35.938  1.00 60.07  ? 72  GLU B CB    1 
ATOM   3773  C  CG    . GLU B  2  56  ? -1.110  95.144  34.517  1.00 60.41  ? 72  GLU B CG    1 
ATOM   3774  C  CD    . GLU B  2  56  ? -1.136  94.052  33.444  1.00 59.34  ? 72  GLU B CD    1 
ATOM   3775  O  OE1   . GLU B  2  56  ? -1.143  92.845  33.779  1.00 55.94  ? 72  GLU B OE1   1 
ATOM   3776  O  OE2   . GLU B  2  56  ? -1.165  94.416  32.256  1.00 58.78  ? 72  GLU B OE2   1 
ATOM   3777  N  N     . LEU B  2  57  ? -0.505  94.360  38.983  1.00 59.81  ? 73  LEU B N     1 
ATOM   3778  C  CA    . LEU B  2  57  ? -0.711  93.697  40.268  1.00 60.59  ? 73  LEU B CA    1 
ATOM   3779  C  C     . LEU B  2  57  ? -1.020  94.714  41.381  1.00 60.84  ? 73  LEU B C     1 
ATOM   3780  O  O     . LEU B  2  57  ? -1.706  94.389  42.355  1.00 57.89  ? 73  LEU B O     1 
ATOM   3781  C  CB    . LEU B  2  57  ? 0.512   92.852  40.646  1.00 61.41  ? 73  LEU B CB    1 
ATOM   3782  C  CG    . LEU B  2  57  ? 0.592   91.380  40.234  1.00 61.21  ? 73  LEU B CG    1 
ATOM   3783  C  CD1   . LEU B  2  57  ? -0.676  90.646  40.653  1.00 60.36  ? 73  LEU B CD1   1 
ATOM   3784  C  CD2   . LEU B  2  57  ? 0.799   91.271  38.752  1.00 62.97  ? 73  LEU B CD2   1 
ATOM   3785  N  N     . LEU B  2  58  ? -0.477  95.925  41.247  1.00 61.40  ? 74  LEU B N     1 
ATOM   3786  C  CA    . LEU B  2  58  ? -0.729  96.990  42.215  1.00 63.84  ? 74  LEU B CA    1 
ATOM   3787  C  C     . LEU B  2  58  ? -2.100  97.593  41.938  1.00 64.88  ? 74  LEU B C     1 
ATOM   3788  O  O     . LEU B  2  58  ? -2.923  97.753  42.849  1.00 66.00  ? 74  LEU B O     1 
ATOM   3789  C  CB    . LEU B  2  58  ? 0.331   98.089  42.122  1.00 64.31  ? 74  LEU B CB    1 
ATOM   3790  C  CG    . LEU B  2  58  ? 1.712   97.810  42.719  1.00 64.40  ? 74  LEU B CG    1 
ATOM   3791  C  CD1   . LEU B  2  58  ? 2.604   99.022  42.522  1.00 63.40  ? 74  LEU B CD1   1 
ATOM   3792  C  CD2   . LEU B  2  58  ? 1.583   97.475  44.197  1.00 63.74  ? 74  LEU B CD2   1 
ATOM   3793  N  N     . GLY B  2  59  ? -2.335  97.913  40.668  1.00 64.10  ? 75  GLY B N     1 
ATOM   3794  C  CA    . GLY B  2  59  ? -3.601  98.482  40.260  1.00 63.60  ? 75  GLY B CA    1 
ATOM   3795  C  C     . GLY B  2  59  ? -3.426  99.882  39.723  1.00 64.45  ? 75  GLY B C     1 
ATOM   3796  O  O     . GLY B  2  59  ? -3.969  100.831 40.283  1.00 67.64  ? 75  GLY B O     1 
ATOM   3797  N  N     . GLY B  2  60  ? -2.671  100.018 38.638  1.00 63.41  ? 76  GLY B N     1 
ATOM   3798  C  CA    . GLY B  2  60  ? -2.455  101.327 38.053  1.00 63.27  ? 76  GLY B CA    1 
ATOM   3799  C  C     . GLY B  2  60  ? -1.885  101.238 36.656  1.00 64.52  ? 76  GLY B C     1 
ATOM   3800  O  O     . GLY B  2  60  ? -1.286  100.224 36.289  1.00 65.87  ? 76  GLY B O     1 
ATOM   3801  N  N     . THR B  2  61  ? -2.081  102.291 35.868  1.00 64.64  ? 77  THR B N     1 
ATOM   3802  C  CA    . THR B  2  61  ? -1.572  102.326 34.504  1.00 66.89  ? 77  THR B CA    1 
ATOM   3803  C  C     . THR B  2  61  ? -0.776  103.593 34.218  1.00 67.67  ? 77  THR B C     1 
ATOM   3804  O  O     . THR B  2  61  ? -0.809  104.552 34.985  1.00 68.43  ? 77  THR B O     1 
ATOM   3805  C  CB    . THR B  2  61  ? -2.708  102.212 33.454  1.00 67.97  ? 77  THR B CB    1 
ATOM   3806  O  OG1   . THR B  2  61  ? -3.694  103.227 33.689  1.00 69.46  ? 77  THR B OG1   1 
ATOM   3807  C  CG2   . THR B  2  61  ? -3.360  100.838 33.510  1.00 66.77  ? 77  THR B CG2   1 
ATOM   3808  N  N     . PHE B  2  62  ? -0.052  103.573 33.107  1.00 68.65  ? 78  PHE B N     1 
ATOM   3809  C  CA    . PHE B  2  62  ? 0.751   104.702 32.676  1.00 69.60  ? 78  PHE B CA    1 
ATOM   3810  C  C     . PHE B  2  62  ? 0.263   105.112 31.298  1.00 70.68  ? 78  PHE B C     1 
ATOM   3811  O  O     . PHE B  2  62  ? -0.487  104.372 30.654  1.00 71.37  ? 78  PHE B O     1 
ATOM   3812  C  CB    . PHE B  2  62  ? 2.230   104.317 32.608  1.00 71.01  ? 78  PHE B CB    1 
ATOM   3813  C  CG    . PHE B  2  62  ? 2.824   103.942 33.938  1.00 72.49  ? 78  PHE B CG    1 
ATOM   3814  C  CD1   . PHE B  2  62  ? 2.827   102.619 34.365  1.00 72.09  ? 78  PHE B CD1   1 
ATOM   3815  C  CD2   . PHE B  2  62  ? 3.395   104.913 34.761  1.00 73.44  ? 78  PHE B CD2   1 
ATOM   3816  C  CE1   . PHE B  2  62  ? 3.389   102.265 35.589  1.00 73.36  ? 78  PHE B CE1   1 
ATOM   3817  C  CE2   . PHE B  2  62  ? 3.961   104.570 35.990  1.00 74.02  ? 78  PHE B CE2   1 
ATOM   3818  C  CZ    . PHE B  2  62  ? 3.958   103.241 36.405  1.00 74.04  ? 78  PHE B CZ    1 
ATOM   3819  N  N     . LYS B  2  63  ? 0.700   106.287 30.851  1.00 71.61  ? 79  LYS B N     1 
ATOM   3820  C  CA    . LYS B  2  63  ? 0.316   106.837 29.555  1.00 71.93  ? 79  LYS B CA    1 
ATOM   3821  C  C     . LYS B  2  63  ? 1.170   108.072 29.305  1.00 71.19  ? 79  LYS B C     1 
ATOM   3822  O  O     . LYS B  2  63  ? 1.492   108.805 30.237  1.00 70.66  ? 79  LYS B O     1 
ATOM   3823  C  CB    . LYS B  2  63  ? -1.176  107.212 29.572  1.00 75.28  ? 79  LYS B CB    1 
ATOM   3824  C  CG    . LYS B  2  63  ? -1.685  107.945 28.337  1.00 80.31  ? 79  LYS B CG    1 
ATOM   3825  C  CD    . LYS B  2  63  ? -1.627  107.078 27.090  1.00 85.06  ? 79  LYS B CD    1 
ATOM   3826  C  CE    . LYS B  2  63  ? -1.997  107.880 25.844  1.00 87.39  ? 79  LYS B CE    1 
ATOM   3827  N  NZ    . LYS B  2  63  ? -1.899  107.048 24.601  1.00 90.52  ? 79  LYS B NZ    1 
ATOM   3828  N  N     . SER B  2  64  ? 1.538   108.295 28.049  1.00 71.31  ? 80  SER B N     1 
ATOM   3829  C  CA    . SER B  2  64  ? 2.356   109.444 27.683  1.00 72.04  ? 80  SER B CA    1 
ATOM   3830  C  C     . SER B  2  64  ? 1.730   110.185 26.499  1.00 73.12  ? 80  SER B C     1 
ATOM   3831  O  O     . SER B  2  64  ? 1.709   109.677 25.379  1.00 73.22  ? 80  SER B O     1 
ATOM   3832  C  CB    . SER B  2  64  ? 3.772   108.983 27.343  1.00 72.32  ? 80  SER B CB    1 
ATOM   3833  O  OG    . SER B  2  64  ? 4.661   110.077 27.255  1.00 72.19  ? 80  SER B OG    1 
ATOM   3834  N  N     . THR B  2  65  ? 1.248   111.401 26.764  1.00 74.27  ? 81  THR B N     1 
ATOM   3835  C  CA    . THR B  2  65  ? 0.580   112.250 25.771  1.00 73.37  ? 81  THR B CA    1 
ATOM   3836  C  C     . THR B  2  65  ? 1.483   113.309 25.134  1.00 72.14  ? 81  THR B C     1 
ATOM   3837  O  O     . THR B  2  65  ? 2.449   113.752 25.739  1.00 71.81  ? 81  THR B O     1 
ATOM   3838  C  CB    . THR B  2  65  ? -0.635  112.944 26.417  1.00 74.93  ? 81  THR B CB    1 
ATOM   3839  O  OG1   . THR B  2  65  ? -1.415  111.970 27.127  1.00 76.41  ? 81  THR B OG1   1 
ATOM   3840  C  CG2   . THR B  2  65  ? -1.507  113.604 25.360  1.00 75.50  ? 81  THR B CG2   1 
ATOM   3841  N  N     . LEU B  2  66  ? 1.147   113.718 23.913  1.00 72.92  ? 82  LEU B N     1 
ATOM   3842  C  CA    . LEU B  2  66  ? 1.917   114.722 23.175  1.00 74.02  ? 82  LEU B CA    1 
ATOM   3843  C  C     . LEU B  2  66  ? 1.075   115.915 22.717  1.00 76.82  ? 82  LEU B C     1 
ATOM   3844  O  O     . LEU B  2  66  ? 0.165   115.766 21.896  1.00 76.94  ? 82  LEU B O     1 
ATOM   3845  C  CB    . LEU B  2  66  ? 2.568   114.093 21.942  1.00 71.67  ? 82  LEU B CB    1 
ATOM   3846  C  CG    . LEU B  2  66  ? 3.325   115.052 21.022  1.00 70.58  ? 82  LEU B CG    1 
ATOM   3847  C  CD1   . LEU B  2  66  ? 4.703   115.329 21.586  1.00 70.26  ? 82  LEU B CD1   1 
ATOM   3848  C  CD2   . LEU B  2  66  ? 3.444   114.471 19.631  1.00 70.75  ? 82  LEU B CD2   1 
ATOM   3849  N  N     . ASP B  2  67  ? 1.397   117.097 23.243  1.00 80.07  ? 83  ASP B N     1 
ATOM   3850  C  CA    . ASP B  2  67  ? 0.710   118.341 22.882  1.00 82.20  ? 83  ASP B CA    1 
ATOM   3851  C  C     . ASP B  2  67  ? 1.564   119.066 21.851  1.00 82.73  ? 83  ASP B C     1 
ATOM   3852  O  O     . ASP B  2  67  ? 2.546   118.523 21.336  1.00 82.10  ? 83  ASP B O     1 
ATOM   3853  C  CB    . ASP B  2  67  ? 0.557   119.265 24.100  1.00 84.73  ? 83  ASP B CB    1 
ATOM   3854  C  CG    . ASP B  2  67  ? -0.442  118.748 25.113  1.00 88.74  ? 83  ASP B CG    1 
ATOM   3855  O  OD1   . ASP B  2  67  ? -0.163  117.717 25.768  1.00 92.67  ? 83  ASP B OD1   1 
ATOM   3856  O  OD2   . ASP B  2  67  ? -1.506  119.385 25.266  1.00 90.24  ? 83  ASP B OD2   1 
ATOM   3857  N  N     . ARG B  2  68  ? 1.179   120.299 21.546  1.00 83.46  ? 84  ARG B N     1 
ATOM   3858  C  CA    . ARG B  2  68  ? 1.940   121.114 20.612  1.00 83.56  ? 84  ARG B CA    1 
ATOM   3859  C  C     . ARG B  2  68  ? 3.079   121.741 21.438  1.00 83.88  ? 84  ARG B C     1 
ATOM   3860  O  O     . ARG B  2  68  ? 4.128   122.107 20.901  1.00 82.90  ? 84  ARG B O     1 
ATOM   3861  C  CB    . ARG B  2  68  ? 1.036   122.193 19.992  1.00 82.78  ? 84  ARG B CB    1 
ATOM   3862  C  CG    . ARG B  2  68  ? 1.653   122.982 18.825  1.00 81.71  ? 84  ARG B CG    1 
ATOM   3863  C  CD    . ARG B  2  68  ? 1.702   122.196 17.516  1.00 80.29  ? 84  ARG B CD    1 
ATOM   3864  N  NE    . ARG B  2  68  ? 0.376   121.851 17.000  1.00 78.18  ? 84  ARG B NE    1 
ATOM   3865  C  CZ    . ARG B  2  68  ? 0.122   121.532 15.732  1.00 77.45  ? 84  ARG B CZ    1 
ATOM   3866  N  NH1   . ARG B  2  68  ? -1.114  121.222 15.365  1.00 77.79  ? 84  ARG B NH1   1 
ATOM   3867  N  NH2   . ARG B  2  68  ? 1.093   121.546 14.823  1.00 76.01  ? 84  ARG B NH2   1 
ATOM   3868  N  N     . GLU B  2  69  ? 2.882   121.799 22.756  1.00 84.49  ? 85  GLU B N     1 
ATOM   3869  C  CA    . GLU B  2  69  ? 3.877   122.368 23.657  1.00 86.21  ? 85  GLU B CA    1 
ATOM   3870  C  C     . GLU B  2  69  ? 4.397   121.405 24.730  1.00 86.44  ? 85  GLU B C     1 
ATOM   3871  O  O     . GLU B  2  69  ? 5.568   121.466 25.101  1.00 85.61  ? 85  GLU B O     1 
ATOM   3872  C  CB    . GLU B  2  69  ? 3.322   123.619 24.340  1.00 88.89  ? 85  GLU B CB    1 
ATOM   3873  C  CG    . GLU B  2  69  ? 4.396   124.442 25.052  1.00 91.47  ? 85  GLU B CG    1 
ATOM   3874  C  CD    . GLU B  2  69  ? 3.835   125.496 25.978  1.00 93.27  ? 85  GLU B CD    1 
ATOM   3875  O  OE1   . GLU B  2  69  ? 3.306   126.517 25.484  1.00 94.82  ? 85  GLU B OE1   1 
ATOM   3876  O  OE2   . GLU B  2  69  ? 3.935   125.303 27.207  1.00 94.30  ? 85  GLU B OE2   1 
ATOM   3877  N  N     . TYR B  2  70  ? 3.528   120.530 25.231  1.00 87.23  ? 86  TYR B N     1 
ATOM   3878  C  CA    . TYR B  2  70  ? 3.906   119.575 26.278  1.00 87.75  ? 86  TYR B CA    1 
ATOM   3879  C  C     . TYR B  2  70  ? 4.136   118.125 25.839  1.00 86.11  ? 86  TYR B C     1 
ATOM   3880  O  O     . TYR B  2  70  ? 3.901   117.751 24.691  1.00 86.05  ? 86  TYR B O     1 
ATOM   3881  C  CB    . TYR B  2  70  ? 2.833   119.539 27.374  1.00 90.87  ? 86  TYR B CB    1 
ATOM   3882  C  CG    . TYR B  2  70  ? 2.712   120.780 28.224  1.00 94.55  ? 86  TYR B CG    1 
ATOM   3883  C  CD1   . TYR B  2  70  ? 3.106   120.768 29.562  1.00 96.40  ? 86  TYR B CD1   1 
ATOM   3884  C  CD2   . TYR B  2  70  ? 2.151   121.950 27.712  1.00 96.33  ? 86  TYR B CD2   1 
ATOM   3885  C  CE1   . TYR B  2  70  ? 2.943   121.887 30.372  1.00 98.06  ? 86  TYR B CE1   1 
ATOM   3886  C  CE2   . TYR B  2  70  ? 1.983   123.076 28.513  1.00 98.04  ? 86  TYR B CE2   1 
ATOM   3887  C  CZ    . TYR B  2  70  ? 2.381   123.037 29.842  1.00 98.78  ? 86  TYR B CZ    1 
ATOM   3888  O  OH    . TYR B  2  70  ? 2.216   124.147 30.642  1.00 100.18 ? 86  TYR B OH    1 
ATOM   3889  N  N     . ILE B  2  71  ? 4.612   117.337 26.804  1.00 83.42  ? 87  ILE B N     1 
ATOM   3890  C  CA    . ILE B  2  71  ? 4.855   115.899 26.704  1.00 80.38  ? 87  ILE B CA    1 
ATOM   3891  C  C     . ILE B  2  71  ? 4.549   115.483 28.138  1.00 79.71  ? 87  ILE B C     1 
ATOM   3892  O  O     . ILE B  2  71  ? 5.370   115.649 29.035  1.00 79.78  ? 87  ILE B O     1 
ATOM   3893  C  CB    . ILE B  2  71  ? 6.318   115.526 26.346  1.00 78.80  ? 87  ILE B CB    1 
ATOM   3894  C  CG1   . ILE B  2  71  ? 6.583   115.765 24.862  1.00 78.05  ? 87  ILE B CG1   1 
ATOM   3895  C  CG2   . ILE B  2  71  ? 6.575   114.052 26.649  1.00 77.71  ? 87  ILE B CG2   1 
ATOM   3896  C  CD1   . ILE B  2  71  ? 7.881   115.155 24.364  1.00 77.65  ? 87  ILE B CD1   1 
ATOM   3897  N  N     . THR B  2  72  ? 3.331   115.011 28.359  1.00 79.21  ? 88  THR B N     1 
ATOM   3898  C  CA    . THR B  2  72  ? 2.888   114.633 29.692  1.00 78.95  ? 88  THR B CA    1 
ATOM   3899  C  C     . THR B  2  72  ? 2.984   113.149 30.015  1.00 78.33  ? 88  THR B C     1 
ATOM   3900  O  O     . THR B  2  72  ? 2.478   112.309 29.272  1.00 79.33  ? 88  THR B O     1 
ATOM   3901  C  CB    . THR B  2  72  ? 1.427   115.063 29.910  1.00 79.54  ? 88  THR B CB    1 
ATOM   3902  O  OG1   . THR B  2  72  ? 1.195   116.314 29.251  1.00 81.32  ? 88  THR B OG1   1 
ATOM   3903  C  CG2   . THR B  2  72  ? 1.133   115.210 31.393  1.00 78.82  ? 88  THR B CG2   1 
ATOM   3904  N  N     . LEU B  2  73  ? 3.610   112.838 31.146  1.00 76.84  ? 89  LEU B N     1 
ATOM   3905  C  CA    . LEU B  2  73  ? 3.743   111.463 31.607  1.00 75.58  ? 89  LEU B CA    1 
ATOM   3906  C  C     . LEU B  2  73  ? 2.785   111.290 32.782  1.00 75.53  ? 89  LEU B C     1 
ATOM   3907  O  O     . LEU B  2  73  ? 3.131   111.597 33.918  1.00 77.23  ? 89  LEU B O     1 
ATOM   3908  C  CB    . LEU B  2  73  ? 5.182   111.167 32.042  1.00 74.27  ? 89  LEU B CB    1 
ATOM   3909  C  CG    . LEU B  2  73  ? 6.280   111.030 30.980  1.00 74.35  ? 89  LEU B CG    1 
ATOM   3910  C  CD1   . LEU B  2  73  ? 6.633   112.380 30.371  1.00 73.17  ? 89  LEU B CD1   1 
ATOM   3911  C  CD2   . LEU B  2  73  ? 7.510   110.421 31.621  1.00 75.10  ? 89  LEU B CD2   1 
ATOM   3912  N  N     . LYS B  2  74  ? 1.570   110.829 32.497  1.00 75.69  ? 90  LYS B N     1 
ATOM   3913  C  CA    . LYS B  2  74  ? 0.550   110.641 33.527  1.00 76.13  ? 90  LYS B CA    1 
ATOM   3914  C  C     . LYS B  2  74  ? 0.564   109.227 34.094  1.00 75.22  ? 90  LYS B C     1 
ATOM   3915  O  O     . LYS B  2  74  ? 1.110   108.316 33.476  1.00 75.89  ? 90  LYS B O     1 
ATOM   3916  C  CB    . LYS B  2  74  ? -0.833  110.970 32.951  1.00 78.49  ? 90  LYS B CB    1 
ATOM   3917  C  CG    . LYS B  2  74  ? -1.956  111.082 33.982  1.00 81.76  ? 90  LYS B CG    1 
ATOM   3918  C  CD    . LYS B  2  74  ? -3.293  111.409 33.317  1.00 84.81  ? 90  LYS B CD    1 
ATOM   3919  C  CE    . LYS B  2  74  ? -4.446  111.369 34.320  1.00 86.55  ? 90  LYS B CE    1 
ATOM   3920  N  NZ    . LYS B  2  74  ? -5.786  111.510 33.669  1.00 86.90  ? 90  LYS B NZ    1 
ATOM   3921  N  N     . ALA B  2  75  ? -0.043  109.055 35.266  1.00 73.88  ? 91  ALA B N     1 
ATOM   3922  C  CA    . ALA B  2  75  ? -0.116  107.755 35.936  1.00 73.78  ? 91  ALA B CA    1 
ATOM   3923  C  C     . ALA B  2  75  ? -1.327  107.685 36.863  1.00 73.98  ? 91  ALA B C     1 
ATOM   3924  O  O     . ALA B  2  75  ? -1.388  108.385 37.872  1.00 75.31  ? 91  ALA B O     1 
ATOM   3925  C  CB    . ALA B  2  75  ? 1.160   107.493 36.726  1.00 72.91  ? 91  ALA B CB    1 
ATOM   3926  N  N     . THR B  2  76  ? -2.293  106.844 36.507  1.00 73.19  ? 92  THR B N     1 
ATOM   3927  C  CA    . THR B  2  76  ? -3.508  106.672 37.297  1.00 71.90  ? 92  THR B CA    1 
ATOM   3928  C  C     . THR B  2  76  ? -3.359  105.427 38.158  1.00 73.06  ? 92  THR B C     1 
ATOM   3929  O  O     . THR B  2  76  ? -2.998  104.363 37.656  1.00 73.65  ? 92  THR B O     1 
ATOM   3930  C  CB    . THR B  2  76  ? -4.724  106.534 36.386  1.00 70.14  ? 92  THR B CB    1 
ATOM   3931  O  OG1   . THR B  2  76  ? -4.701  107.589 35.415  1.00 69.28  ? 92  THR B OG1   1 
ATOM   3932  C  CG2   . THR B  2  76  ? -6.004  106.623 37.197  1.00 69.27  ? 92  THR B CG2   1 
ATOM   3933  N  N     . PHE B  2  77  ? -3.673  105.546 39.445  1.00 74.15  ? 93  PHE B N     1 
ATOM   3934  C  CA    . PHE B  2  77  ? -3.509  104.421 40.366  1.00 75.19  ? 93  PHE B CA    1 
ATOM   3935  C  C     . PHE B  2  77  ? -4.314  104.538 41.644  1.00 75.67  ? 93  PHE B C     1 
ATOM   3936  O  O     . PHE B  2  77  ? -5.049  105.500 41.845  1.00 76.45  ? 93  PHE B O     1 
ATOM   3937  C  CB    . PHE B  2  77  ? -2.040  104.334 40.762  1.00 75.77  ? 93  PHE B CB    1 
ATOM   3938  C  CG    . PHE B  2  77  ? -1.484  105.633 41.283  1.00 76.36  ? 93  PHE B CG    1 
ATOM   3939  C  CD1   . PHE B  2  77  ? -1.493  105.913 42.646  1.00 76.07  ? 93  PHE B CD1   1 
ATOM   3940  C  CD2   . PHE B  2  77  ? -0.977  106.592 40.407  1.00 76.10  ? 93  PHE B CD2   1 
ATOM   3941  C  CE1   . PHE B  2  77  ? -1.012  107.129 43.132  1.00 75.58  ? 93  PHE B CE1   1 
ATOM   3942  C  CE2   . PHE B  2  77  ? -0.493  107.815 40.883  1.00 76.36  ? 93  PHE B CE2   1 
ATOM   3943  C  CZ    . PHE B  2  77  ? -0.509  108.082 42.248  1.00 75.11  ? 93  PHE B CZ    1 
ATOM   3944  N  N     . LEU B  2  78  ? -4.152  103.542 42.511  1.00 76.73  ? 94  LEU B N     1 
ATOM   3945  C  CA    . LEU B  2  78  ? -4.812  103.527 43.808  1.00 78.30  ? 94  LEU B CA    1 
ATOM   3946  C  C     . LEU B  2  78  ? -3.993  104.431 44.739  1.00 79.51  ? 94  LEU B C     1 
ATOM   3947  O  O     . LEU B  2  78  ? -2.762  104.444 44.679  1.00 78.44  ? 94  LEU B O     1 
ATOM   3948  C  CB    . LEU B  2  78  ? -4.878  102.106 44.364  1.00 78.55  ? 94  LEU B CB    1 
ATOM   3949  C  CG    . LEU B  2  78  ? -5.632  101.084 43.513  1.00 78.38  ? 94  LEU B CG    1 
ATOM   3950  C  CD1   . LEU B  2  78  ? -5.827  99.803  44.311  1.00 78.85  ? 94  LEU B CD1   1 
ATOM   3951  C  CD2   . LEU B  2  78  ? -6.972  101.649 43.106  1.00 78.26  ? 94  LEU B CD2   1 
ATOM   3952  N  N     . LYS B  2  79  ? -4.692  105.169 45.595  1.00 81.23  ? 95  LYS B N     1 
ATOM   3953  C  CA    . LYS B  2  79  ? -4.105  106.133 46.531  1.00 81.98  ? 95  LYS B CA    1 
ATOM   3954  C  C     . LYS B  2  79  ? -2.826  105.793 47.312  1.00 80.98  ? 95  LYS B C     1 
ATOM   3955  O  O     . LYS B  2  79  ? -1.806  106.465 47.145  1.00 80.14  ? 95  LYS B O     1 
ATOM   3956  C  CB    . LYS B  2  79  ? -5.188  106.611 47.501  1.00 84.88  ? 95  LYS B CB    1 
ATOM   3957  C  CG    . LYS B  2  79  ? -4.819  107.851 48.288  1.00 87.85  ? 95  LYS B CG    1 
ATOM   3958  C  CD    . LYS B  2  79  ? -5.987  108.325 49.137  1.00 89.60  ? 95  LYS B CD    1 
ATOM   3959  C  CE    . LYS B  2  79  ? -5.690  109.684 49.750  1.00 90.42  ? 95  LYS B CE    1 
ATOM   3960  N  NZ    . LYS B  2  79  ? -5.404  110.699 48.688  1.00 90.95  ? 95  LYS B NZ    1 
ATOM   3961  N  N     . ASP B  2  80  ? -2.881  104.761 48.153  1.00 80.25  ? 96  ASP B N     1 
ATOM   3962  C  CA    . ASP B  2  80  ? -1.743  104.363 48.991  1.00 80.23  ? 96  ASP B CA    1 
ATOM   3963  C  C     . ASP B  2  80  ? -0.478  103.810 48.321  1.00 80.65  ? 96  ASP B C     1 
ATOM   3964  O  O     . ASP B  2  80  ? 0.448   103.404 49.018  1.00 81.33  ? 96  ASP B O     1 
ATOM   3965  C  CB    . ASP B  2  80  ? -2.200  103.360 50.062  1.00 79.71  ? 96  ASP B CB    1 
ATOM   3966  C  CG    . ASP B  2  80  ? -3.294  103.908 50.963  1.00 80.11  ? 96  ASP B CG    1 
ATOM   3967  O  OD1   . ASP B  2  80  ? -4.124  103.098 51.432  1.00 79.39  ? 96  ASP B OD1   1 
ATOM   3968  O  OD2   . ASP B  2  80  ? -3.326  105.137 51.207  1.00 79.90  ? 96  ASP B OD2   1 
ATOM   3969  N  N     . ASP B  2  81  ? -0.424  103.781 46.993  1.00 80.94  ? 97  ASP B N     1 
ATOM   3970  C  CA    . ASP B  2  81  ? 0.751   103.242 46.302  1.00 80.47  ? 97  ASP B CA    1 
ATOM   3971  C  C     . ASP B  2  81  ? 1.578   104.346 45.662  1.00 79.51  ? 97  ASP B C     1 
ATOM   3972  O  O     . ASP B  2  81  ? 2.473   104.082 44.857  1.00 79.44  ? 97  ASP B O     1 
ATOM   3973  C  CB    . ASP B  2  81  ? 0.319   102.221 45.242  1.00 81.72  ? 97  ASP B CB    1 
ATOM   3974  C  CG    . ASP B  2  81  ? -0.509  101.081 45.825  1.00 84.43  ? 97  ASP B CG    1 
ATOM   3975  O  OD1   . ASP B  2  81  ? -0.295  100.721 47.004  1.00 84.60  ? 97  ASP B OD1   1 
ATOM   3976  O  OD2   . ASP B  2  81  ? -1.384  100.547 45.106  1.00 87.17  ? 97  ASP B OD2   1 
ATOM   3977  N  N     . LEU B  2  82  ? 1.328   105.572 46.110  1.00 78.37  ? 98  LEU B N     1 
ATOM   3978  C  CA    . LEU B  2  82  ? 1.978   106.778 45.602  1.00 77.69  ? 98  LEU B CA    1 
ATOM   3979  C  C     . LEU B  2  82  ? 3.481   106.770 45.281  1.00 76.06  ? 98  LEU B C     1 
ATOM   3980  O  O     . LEU B  2  82  ? 3.876   107.144 44.175  1.00 75.42  ? 98  LEU B O     1 
ATOM   3981  C  CB    . LEU B  2  82  ? 1.671   107.957 46.524  1.00 79.56  ? 98  LEU B CB    1 
ATOM   3982  C  CG    . LEU B  2  82  ? 1.777   109.321 45.846  1.00 80.98  ? 98  LEU B CG    1 
ATOM   3983  C  CD1   . LEU B  2  82  ? 0.406   109.684 45.293  1.00 81.58  ? 98  LEU B CD1   1 
ATOM   3984  C  CD2   . LEU B  2  82  ? 2.242   110.368 46.846  1.00 82.44  ? 98  LEU B CD2   1 
ATOM   3985  N  N     . PRO B  2  83  ? 4.339   106.370 46.240  1.00 74.24  ? 99  PRO B N     1 
ATOM   3986  C  CA    . PRO B  2  83  ? 5.782   106.355 45.973  1.00 74.35  ? 99  PRO B CA    1 
ATOM   3987  C  C     . PRO B  2  83  ? 6.216   105.554 44.738  1.00 74.99  ? 99  PRO B C     1 
ATOM   3988  O  O     . PRO B  2  83  ? 7.089   105.996 43.975  1.00 74.37  ? 99  PRO B O     1 
ATOM   3989  C  CB    . PRO B  2  83  ? 6.362   105.773 47.264  1.00 74.39  ? 99  PRO B CB    1 
ATOM   3990  C  CG    . PRO B  2  83  ? 5.245   104.925 47.798  1.00 73.38  ? 99  PRO B CG    1 
ATOM   3991  C  CD    . PRO B  2  83  ? 4.056   105.811 47.574  1.00 72.88  ? 99  PRO B CD    1 
ATOM   3992  N  N     . TYR B  2  84  ? 5.579   104.401 44.526  1.00 74.71  ? 100 TYR B N     1 
ATOM   3993  C  CA    . TYR B  2  84  ? 5.898   103.533 43.394  1.00 73.18  ? 100 TYR B CA    1 
ATOM   3994  C  C     . TYR B  2  84  ? 5.810   104.251 42.052  1.00 70.97  ? 100 TYR B C     1 
ATOM   3995  O  O     . TYR B  2  84  ? 6.743   104.200 41.249  1.00 70.01  ? 100 TYR B O     1 
ATOM   3996  C  CB    . TYR B  2  84  ? 4.989   102.302 43.385  1.00 74.87  ? 100 TYR B CB    1 
ATOM   3997  C  CG    . TYR B  2  84  ? 5.307   101.330 42.270  1.00 77.54  ? 100 TYR B CG    1 
ATOM   3998  C  CD1   . TYR B  2  84  ? 6.347   100.411 42.397  1.00 78.40  ? 100 TYR B CD1   1 
ATOM   3999  C  CD2   . TYR B  2  84  ? 4.587   101.348 41.074  1.00 78.45  ? 100 TYR B CD2   1 
ATOM   4000  C  CE1   . TYR B  2  84  ? 6.665   99.536  41.360  1.00 79.74  ? 100 TYR B CE1   1 
ATOM   4001  C  CE2   . TYR B  2  84  ? 4.897   100.479 40.034  1.00 79.29  ? 100 TYR B CE2   1 
ATOM   4002  C  CZ    . TYR B  2  84  ? 5.937   99.578  40.181  1.00 79.61  ? 100 TYR B CZ    1 
ATOM   4003  O  OH    . TYR B  2  84  ? 6.261   98.733  39.146  1.00 79.43  ? 100 TYR B OH    1 
ATOM   4004  N  N     . TYR B  2  85  ? 4.693   104.924 41.816  1.00 69.39  ? 101 TYR B N     1 
ATOM   4005  C  CA    . TYR B  2  85  ? 4.506   105.635 40.560  1.00 69.85  ? 101 TYR B CA    1 
ATOM   4006  C  C     . TYR B  2  85  ? 5.353   106.903 40.476  1.00 69.96  ? 101 TYR B C     1 
ATOM   4007  O  O     . TYR B  2  85  ? 5.548   107.458 39.388  1.00 70.39  ? 101 TYR B O     1 
ATOM   4008  C  CB    . TYR B  2  85  ? 3.022   105.920 40.321  1.00 69.40  ? 101 TYR B CB    1 
ATOM   4009  C  CG    . TYR B  2  85  ? 2.176   104.665 40.390  1.00 69.62  ? 101 TYR B CG    1 
ATOM   4010  C  CD1   . TYR B  2  85  ? 1.634   104.241 41.603  1.00 68.87  ? 101 TYR B CD1   1 
ATOM   4011  C  CD2   . TYR B  2  85  ? 1.974   103.863 39.259  1.00 68.29  ? 101 TYR B CD2   1 
ATOM   4012  C  CE1   . TYR B  2  85  ? 0.919   103.051 41.697  1.00 69.70  ? 101 TYR B CE1   1 
ATOM   4013  C  CE2   . TYR B  2  85  ? 1.256   102.668 39.341  1.00 66.60  ? 101 TYR B CE2   1 
ATOM   4014  C  CZ    . TYR B  2  85  ? 0.734   102.269 40.565  1.00 68.99  ? 101 TYR B CZ    1 
ATOM   4015  O  OH    . TYR B  2  85  ? 0.028   101.093 40.680  1.00 70.23  ? 101 TYR B OH    1 
ATOM   4016  N  N     . VAL B  2  86  ? 5.874   107.351 41.619  1.00 68.64  ? 102 VAL B N     1 
ATOM   4017  C  CA    . VAL B  2  86  ? 6.728   108.530 41.634  1.00 67.52  ? 102 VAL B CA    1 
ATOM   4018  C  C     . VAL B  2  86  ? 8.100   108.093 41.124  1.00 67.16  ? 102 VAL B C     1 
ATOM   4019  O  O     . VAL B  2  86  ? 8.682   108.734 40.235  1.00 65.14  ? 102 VAL B O     1 
ATOM   4020  C  CB    . VAL B  2  86  ? 6.853   109.148 43.053  1.00 68.27  ? 102 VAL B CB    1 
ATOM   4021  C  CG1   . VAL B  2  86  ? 7.806   110.343 43.027  1.00 64.87  ? 102 VAL B CG1   1 
ATOM   4022  C  CG2   . VAL B  2  86  ? 5.484   109.602 43.550  1.00 68.91  ? 102 VAL B CG2   1 
ATOM   4023  N  N     . ASN B  2  87  ? 8.590   106.976 41.662  1.00 66.96  ? 103 ASN B N     1 
ATOM   4024  C  CA    . ASN B  2  87  ? 9.886   106.429 41.255  1.00 68.15  ? 103 ASN B CA    1 
ATOM   4025  C  C     . ASN B  2  87  ? 9.834   105.870 39.831  1.00 68.58  ? 103 ASN B C     1 
ATOM   4026  O  O     . ASN B  2  87  ? 10.840  105.880 39.106  1.00 68.12  ? 103 ASN B O     1 
ATOM   4027  C  CB    . ASN B  2  87  ? 10.342  105.338 42.224  1.00 69.16  ? 103 ASN B CB    1 
ATOM   4028  C  CG    . ASN B  2  87  ? 10.689  105.882 43.593  1.00 70.31  ? 103 ASN B CG    1 
ATOM   4029  O  OD1   . ASN B  2  87  ? 9.984   105.624 44.567  1.00 71.99  ? 103 ASN B OD1   1 
ATOM   4030  N  ND2   . ASN B  2  87  ? 11.785  106.633 43.676  1.00 69.03  ? 103 ASN B ND2   1 
ATOM   4031  N  N     . ALA B  2  88  ? 8.662   105.374 39.442  1.00 67.98  ? 104 ALA B N     1 
ATOM   4032  C  CA    . ALA B  2  88  ? 8.476   104.834 38.108  1.00 68.45  ? 104 ALA B CA    1 
ATOM   4033  C  C     . ALA B  2  88  ? 8.668   105.965 37.101  1.00 68.64  ? 104 ALA B C     1 
ATOM   4034  O  O     . ALA B  2  88  ? 9.476   105.851 36.178  1.00 68.88  ? 104 ALA B O     1 
ATOM   4035  C  CB    . ALA B  2  88  ? 7.095   104.230 37.977  1.00 70.47  ? 104 ALA B CB    1 
ATOM   4036  N  N     . LEU B  2  89  ? 7.952   107.070 37.312  1.00 68.09  ? 105 LEU B N     1 
ATOM   4037  C  CA    . LEU B  2  89  ? 8.059   108.232 36.439  1.00 67.78  ? 105 LEU B CA    1 
ATOM   4038  C  C     . LEU B  2  89  ? 9.453   108.830 36.517  1.00 68.60  ? 105 LEU B C     1 
ATOM   4039  O  O     . LEU B  2  89  ? 9.959   109.367 35.533  1.00 68.32  ? 105 LEU B O     1 
ATOM   4040  C  CB    . LEU B  2  89  ? 7.014   109.275 36.814  1.00 67.98  ? 105 LEU B CB    1 
ATOM   4041  C  CG    . LEU B  2  89  ? 5.606   108.961 36.310  1.00 69.38  ? 105 LEU B CG    1 
ATOM   4042  C  CD1   . LEU B  2  89  ? 4.587   109.896 36.932  1.00 70.89  ? 105 LEU B CD1   1 
ATOM   4043  C  CD2   . LEU B  2  89  ? 5.584   109.078 34.802  1.00 69.50  ? 105 LEU B CD2   1 
ATOM   4044  N  N     . ALA B  2  90  ? 10.073  108.725 37.692  1.00 69.99  ? 106 ALA B N     1 
ATOM   4045  C  CA    . ALA B  2  90  ? 11.426  109.233 37.906  1.00 71.34  ? 106 ALA B CA    1 
ATOM   4046  C  C     . ALA B  2  90  ? 12.414  108.454 37.029  1.00 72.92  ? 106 ALA B C     1 
ATOM   4047  O  O     . ALA B  2  90  ? 13.221  109.042 36.295  1.00 72.11  ? 106 ALA B O     1 
ATOM   4048  C  CB    . ALA B  2  90  ? 11.800  109.093 39.365  1.00 69.81  ? 106 ALA B CB    1 
ATOM   4049  N  N     . ASP B  2  91  ? 12.302  107.125 37.082  1.00 74.34  ? 107 ASP B N     1 
ATOM   4050  C  CA    . ASP B  2  91  ? 13.154  106.219 36.315  1.00 74.91  ? 107 ASP B CA    1 
ATOM   4051  C  C     . ASP B  2  91  ? 13.137  106.470 34.813  1.00 73.41  ? 107 ASP B C     1 
ATOM   4052  O  O     . ASP B  2  91  ? 14.181  106.416 34.162  1.00 72.07  ? 107 ASP B O     1 
ATOM   4053  C  CB    . ASP B  2  91  ? 12.750  104.770 36.579  1.00 78.32  ? 107 ASP B CB    1 
ATOM   4054  C  CG    . ASP B  2  91  ? 13.782  104.018 37.384  1.00 82.10  ? 107 ASP B CG    1 
ATOM   4055  O  OD1   . ASP B  2  91  ? 14.782  103.560 36.782  1.00 84.50  ? 107 ASP B OD1   1 
ATOM   4056  O  OD2   . ASP B  2  91  ? 13.595  103.887 38.616  1.00 83.43  ? 107 ASP B OD2   1 
ATOM   4057  N  N     . VAL B  2  92  ? 11.953  106.741 34.274  1.00 71.93  ? 108 VAL B N     1 
ATOM   4058  C  CA    . VAL B  2  92  ? 11.786  106.984 32.845  1.00 72.79  ? 108 VAL B CA    1 
ATOM   4059  C  C     . VAL B  2  92  ? 12.565  108.203 32.370  1.00 73.66  ? 108 VAL B C     1 
ATOM   4060  O  O     . VAL B  2  92  ? 13.317  108.136 31.395  1.00 72.82  ? 108 VAL B O     1 
ATOM   4061  C  CB    . VAL B  2  92  ? 10.291  107.170 32.483  1.00 73.17  ? 108 VAL B CB    1 
ATOM   4062  C  CG1   . VAL B  2  92  ? 10.119  107.363 30.984  1.00 71.73  ? 108 VAL B CG1   1 
ATOM   4063  C  CG2   . VAL B  2  92  ? 9.480   105.976 32.966  1.00 73.06  ? 108 VAL B CG2   1 
ATOM   4064  N  N     . LEU B  2  93  ? 12.397  109.308 33.090  1.00 75.76  ? 109 LEU B N     1 
ATOM   4065  C  CA    . LEU B  2  93  ? 13.054  110.574 32.765  1.00 76.25  ? 109 LEU B CA    1 
ATOM   4066  C  C     . LEU B  2  93  ? 14.575  110.537 32.869  1.00 75.95  ? 109 LEU B C     1 
ATOM   4067  O  O     . LEU B  2  93  ? 15.281  111.105 32.030  1.00 73.76  ? 109 LEU B O     1 
ATOM   4068  C  CB    . LEU B  2  93  ? 12.509  111.681 33.674  1.00 76.15  ? 109 LEU B CB    1 
ATOM   4069  C  CG    . LEU B  2  93  ? 11.055  112.109 33.454  1.00 76.29  ? 109 LEU B CG    1 
ATOM   4070  C  CD1   . LEU B  2  93  ? 10.536  112.841 34.674  1.00 75.50  ? 109 LEU B CD1   1 
ATOM   4071  C  CD2   . LEU B  2  93  ? 10.952  112.985 32.216  1.00 75.18  ? 109 LEU B CD2   1 
ATOM   4072  N  N     . TYR B  2  94  ? 15.067  109.838 33.883  1.00 77.20  ? 110 TYR B N     1 
ATOM   4073  C  CA    . TYR B  2  94  ? 16.498  109.755 34.126  1.00 80.94  ? 110 TYR B CA    1 
ATOM   4074  C  C     . TYR B  2  94  ? 17.281  108.654 33.410  1.00 81.43  ? 110 TYR B C     1 
ATOM   4075  O  O     . TYR B  2  94  ? 18.436  108.872 33.027  1.00 81.17  ? 110 TYR B O     1 
ATOM   4076  C  CB    . TYR B  2  94  ? 16.761  109.668 35.636  1.00 84.42  ? 110 TYR B CB    1 
ATOM   4077  C  CG    . TYR B  2  94  ? 18.220  109.800 36.026  1.00 88.44  ? 110 TYR B CG    1 
ATOM   4078  C  CD1   . TYR B  2  94  ? 19.018  110.822 35.496  1.00 89.75  ? 110 TYR B CD1   1 
ATOM   4079  C  CD2   . TYR B  2  94  ? 18.806  108.901 36.917  1.00 89.88  ? 110 TYR B CD2   1 
ATOM   4080  C  CE1   . TYR B  2  94  ? 20.362  110.941 35.843  1.00 90.89  ? 110 TYR B CE1   1 
ATOM   4081  C  CE2   . TYR B  2  94  ? 20.152  109.013 37.272  1.00 91.26  ? 110 TYR B CE2   1 
ATOM   4082  C  CZ    . TYR B  2  94  ? 20.922  110.034 36.732  1.00 91.74  ? 110 TYR B CZ    1 
ATOM   4083  O  OH    . TYR B  2  94  ? 22.248  110.147 37.078  1.00 92.80  ? 110 TYR B OH    1 
ATOM   4084  N  N     . LYS B  2  95  ? 16.669  107.489 33.205  1.00 81.77  ? 111 LYS B N     1 
ATOM   4085  C  CA    . LYS B  2  95  ? 17.406  106.398 32.574  1.00 81.68  ? 111 LYS B CA    1 
ATOM   4086  C  C     . LYS B  2  95  ? 16.701  105.397 31.635  1.00 80.47  ? 111 LYS B C     1 
ATOM   4087  O  O     . LYS B  2  95  ? 16.748  104.186 31.869  1.00 80.05  ? 111 LYS B O     1 
ATOM   4088  C  CB    . LYS B  2  95  ? 18.191  105.644 33.662  1.00 83.43  ? 111 LYS B CB    1 
ATOM   4089  C  CG    . LYS B  2  95  ? 17.322  105.035 34.770  1.00 85.45  ? 111 LYS B CG    1 
ATOM   4090  C  CD    . LYS B  2  95  ? 17.969  105.179 36.145  1.00 89.20  ? 111 LYS B CD    1 
ATOM   4091  C  CE    . LYS B  2  95  ? 19.325  104.477 36.242  1.00 92.30  ? 111 LYS B CE    1 
ATOM   4092  N  NZ    . LYS B  2  95  ? 19.211  102.989 36.208  1.00 94.73  ? 111 LYS B NZ    1 
ATOM   4093  N  N     . THR B  2  96  ? 16.058  105.880 30.572  1.00 78.42  ? 112 THR B N     1 
ATOM   4094  C  CA    . THR B  2  96  ? 15.437  104.953 29.621  1.00 75.45  ? 112 THR B CA    1 
ATOM   4095  C  C     . THR B  2  96  ? 16.563  104.444 28.718  1.00 73.54  ? 112 THR B C     1 
ATOM   4096  O  O     . THR B  2  96  ? 17.345  105.231 28.186  1.00 73.21  ? 112 THR B O     1 
ATOM   4097  C  CB    . THR B  2  96  ? 14.313  105.599 28.762  1.00 75.12  ? 112 THR B CB    1 
ATOM   4098  O  OG1   . THR B  2  96  ? 14.704  106.910 28.342  1.00 74.57  ? 112 THR B OG1   1 
ATOM   4099  C  CG2   . THR B  2  96  ? 13.007  105.657 29.538  1.00 74.09  ? 112 THR B CG2   1 
ATOM   4100  N  N     . ALA B  2  97  ? 16.640  103.126 28.562  1.00 71.28  ? 113 ALA B N     1 
ATOM   4101  C  CA    . ALA B  2  97  ? 17.684  102.468 27.773  1.00 68.75  ? 113 ALA B CA    1 
ATOM   4102  C  C     . ALA B  2  97  ? 17.939  102.903 26.331  1.00 66.94  ? 113 ALA B C     1 
ATOM   4103  O  O     . ALA B  2  97  ? 19.090  102.966 25.907  1.00 65.39  ? 113 ALA B O     1 
ATOM   4104  C  CB    . ALA B  2  97  ? 17.497  100.963 27.833  1.00 69.05  ? 113 ALA B CB    1 
ATOM   4105  N  N     . PHE B  2  98  ? 16.881  103.179 25.574  1.00 66.50  ? 114 PHE B N     1 
ATOM   4106  C  CA    . PHE B  2  98  ? 17.017  103.577 24.171  1.00 66.63  ? 114 PHE B CA    1 
ATOM   4107  C  C     . PHE B  2  98  ? 17.805  102.554 23.352  1.00 65.39  ? 114 PHE B C     1 
ATOM   4108  O  O     . PHE B  2  98  ? 18.781  102.913 22.688  1.00 65.37  ? 114 PHE B O     1 
ATOM   4109  C  CB    . PHE B  2  98  ? 17.694  104.947 24.033  1.00 68.89  ? 114 PHE B CB    1 
ATOM   4110  C  CG    . PHE B  2  98  ? 16.891  106.086 24.587  1.00 72.28  ? 114 PHE B CG    1 
ATOM   4111  C  CD1   . PHE B  2  98  ? 15.740  106.528 23.939  1.00 72.50  ? 114 PHE B CD1   1 
ATOM   4112  C  CD2   . PHE B  2  98  ? 17.286  106.721 25.761  1.00 72.82  ? 114 PHE B CD2   1 
ATOM   4113  C  CE1   . PHE B  2  98  ? 14.995  107.585 24.456  1.00 73.68  ? 114 PHE B CE1   1 
ATOM   4114  C  CE2   . PHE B  2  98  ? 16.549  107.777 26.285  1.00 72.92  ? 114 PHE B CE2   1 
ATOM   4115  C  CZ    . PHE B  2  98  ? 15.400  108.209 25.633  1.00 73.80  ? 114 PHE B CZ    1 
ATOM   4116  N  N     . LYS B  2  99  ? 17.394  101.285 23.413  1.00 63.55  ? 115 LYS B N     1 
ATOM   4117  C  CA    . LYS B  2  99  ? 18.062  100.221 22.660  1.00 62.61  ? 115 LYS B CA    1 
ATOM   4118  C  C     . LYS B  2  99  ? 17.673  100.291 21.182  1.00 60.34  ? 115 LYS B C     1 
ATOM   4119  O  O     . LYS B  2  99  ? 16.503  100.439 20.851  1.00 60.71  ? 115 LYS B O     1 
ATOM   4120  C  CB    . LYS B  2  99  ? 17.698  98.855  23.242  1.00 64.76  ? 115 LYS B CB    1 
ATOM   4121  C  CG    . LYS B  2  99  ? 18.042  98.694  24.723  1.00 67.28  ? 115 LYS B CG    1 
ATOM   4122  C  CD    . LYS B  2  99  ? 19.549  98.731  24.973  1.00 69.93  ? 115 LYS B CD    1 
ATOM   4123  C  CE    . LYS B  2  99  ? 20.182  97.344  24.901  1.00 71.37  ? 115 LYS B CE    1 
ATOM   4124  N  NZ    . LYS B  2  99  ? 19.847  96.514  26.097  1.00 71.87  ? 115 LYS B NZ    1 
ATOM   4125  N  N     . PRO B  2  100 ? 18.652  100.178 20.272  1.00 59.14  ? 116 PRO B N     1 
ATOM   4126  C  CA    . PRO B  2  100 ? 18.418  100.232 18.822  1.00 59.78  ? 116 PRO B CA    1 
ATOM   4127  C  C     . PRO B  2  100 ? 17.276  99.328  18.335  1.00 60.21  ? 116 PRO B C     1 
ATOM   4128  O  O     . PRO B  2  100 ? 16.587  99.657  17.367  1.00 60.84  ? 116 PRO B O     1 
ATOM   4129  C  CB    . PRO B  2  100 ? 19.758  99.770  18.245  1.00 58.96  ? 116 PRO B CB    1 
ATOM   4130  C  CG    . PRO B  2  100 ? 20.728  100.237 19.248  1.00 58.93  ? 116 PRO B CG    1 
ATOM   4131  C  CD    . PRO B  2  100 ? 20.063  99.877  20.555  1.00 58.59  ? 116 PRO B CD    1 
ATOM   4132  N  N     . HIS B  2  101 ? 17.076  98.197  19.010  1.00 59.79  ? 117 HIS B N     1 
ATOM   4133  C  CA    . HIS B  2  101 ? 16.022  97.277  18.620  1.00 58.61  ? 117 HIS B CA    1 
ATOM   4134  C  C     . HIS B  2  101 ? 14.629  97.712  19.063  1.00 59.42  ? 117 HIS B C     1 
ATOM   4135  O  O     . HIS B  2  101 ? 13.634  97.309  18.460  1.00 60.06  ? 117 HIS B O     1 
ATOM   4136  C  CB    . HIS B  2  101 ? 16.328  95.848  19.081  1.00 56.62  ? 117 HIS B CB    1 
ATOM   4137  C  CG    . HIS B  2  101 ? 16.153  95.611  20.551  1.00 55.10  ? 117 HIS B CG    1 
ATOM   4138  N  ND1   . HIS B  2  101 ? 17.220  95.479  21.414  1.00 53.79  ? 117 HIS B ND1   1 
ATOM   4139  C  CD2   . HIS B  2  101 ? 15.040  95.404  21.296  1.00 53.50  ? 117 HIS B CD2   1 
ATOM   4140  C  CE1   . HIS B  2  101 ? 16.771  95.196  22.624  1.00 51.87  ? 117 HIS B CE1   1 
ATOM   4141  N  NE2   . HIS B  2  101 ? 15.452  95.145  22.580  1.00 51.58  ? 117 HIS B NE2   1 
ATOM   4142  N  N     . GLU B  2  102 ? 14.551  98.516  20.120  1.00 59.05  ? 118 GLU B N     1 
ATOM   4143  C  CA    . GLU B  2  102 ? 13.260  98.998  20.605  1.00 58.51  ? 118 GLU B CA    1 
ATOM   4144  C  C     . GLU B  2  102 ? 12.704  100.031 19.640  1.00 57.94  ? 118 GLU B C     1 
ATOM   4145  O  O     . GLU B  2  102 ? 11.490  100.183 19.511  1.00 58.29  ? 118 GLU B O     1 
ATOM   4146  C  CB    . GLU B  2  102 ? 13.397  99.605  21.994  1.00 58.09  ? 118 GLU B CB    1 
ATOM   4147  C  CG    . GLU B  2  102 ? 13.942  98.637  23.001  1.00 60.43  ? 118 GLU B CG    1 
ATOM   4148  C  CD    . GLU B  2  102 ? 13.845  99.163  24.400  1.00 61.95  ? 118 GLU B CD    1 
ATOM   4149  O  OE1   . GLU B  2  102 ? 14.773  99.893  24.821  1.00 64.72  ? 118 GLU B OE1   1 
ATOM   4150  O  OE2   . GLU B  2  102 ? 12.836  98.850  25.069  1.00 60.19  ? 118 GLU B OE2   1 
ATOM   4151  N  N     . LEU B  2  103 ? 13.604  100.724 18.947  1.00 57.51  ? 119 LEU B N     1 
ATOM   4152  C  CA    . LEU B  2  103 ? 13.202  101.732 17.982  1.00 57.92  ? 119 LEU B CA    1 
ATOM   4153  C  C     . LEU B  2  103 ? 12.515  101.059 16.800  1.00 58.14  ? 119 LEU B C     1 
ATOM   4154  O  O     . LEU B  2  103 ? 11.374  101.393 16.468  1.00 58.44  ? 119 LEU B O     1 
ATOM   4155  C  CB    . LEU B  2  103 ? 14.413  102.533 17.493  1.00 56.53  ? 119 LEU B CB    1 
ATOM   4156  C  CG    . LEU B  2  103 ? 14.062  103.654 16.509  1.00 56.89  ? 119 LEU B CG    1 
ATOM   4157  C  CD1   . LEU B  2  103 ? 13.111  104.638 17.184  1.00 55.47  ? 119 LEU B CD1   1 
ATOM   4158  C  CD2   . LEU B  2  103 ? 15.315  104.354 16.007  1.00 54.94  ? 119 LEU B CD2   1 
ATOM   4159  N  N     . THR B  2  104 ? 13.201  100.087 16.198  1.00 58.09  ? 120 THR B N     1 
ATOM   4160  C  CA    . THR B  2  104 ? 12.675  99.358  15.041  1.00 57.51  ? 120 THR B CA    1 
ATOM   4161  C  C     . THR B  2  104 ? 11.483  98.439  15.326  1.00 55.43  ? 120 THR B C     1 
ATOM   4162  O  O     . THR B  2  104 ? 10.590  98.302  14.494  1.00 57.21  ? 120 THR B O     1 
ATOM   4163  C  CB    . THR B  2  104 ? 13.774  98.522  14.356  1.00 57.88  ? 120 THR B CB    1 
ATOM   4164  O  OG1   . THR B  2  104 ? 14.411  97.699  15.332  1.00 61.23  ? 120 THR B OG1   1 
ATOM   4165  C  CG2   . THR B  2  104 ? 14.821  99.412  13.712  1.00 58.32  ? 120 THR B CG2   1 
ATOM   4166  N  N     . GLU B  2  105 ? 11.434  97.869  16.521  1.00 53.66  ? 121 GLU B N     1 
ATOM   4167  C  CA    . GLU B  2  105 ? 10.368  96.941  16.875  1.00 53.13  ? 121 GLU B CA    1 
ATOM   4168  C  C     . GLU B  2  105 ? 9.137   97.490  17.573  1.00 53.68  ? 121 GLU B C     1 
ATOM   4169  O  O     . GLU B  2  105 ? 8.062   96.912  17.441  1.00 55.08  ? 121 GLU B O     1 
ATOM   4170  C  CB    . GLU B  2  105 ? 10.937  95.784  17.701  1.00 51.69  ? 121 GLU B CB    1 
ATOM   4171  C  CG    . GLU B  2  105 ? 12.018  94.986  16.977  1.00 49.95  ? 121 GLU B CG    1 
ATOM   4172  C  CD    . GLU B  2  105 ? 12.627  93.889  17.829  1.00 51.19  ? 121 GLU B CD    1 
ATOM   4173  O  OE1   . GLU B  2  105 ? 12.054  93.569  18.900  1.00 50.47  ? 121 GLU B OE1   1 
ATOM   4174  O  OE2   . GLU B  2  105 ? 13.682  93.348  17.420  1.00 49.44  ? 121 GLU B OE2   1 
ATOM   4175  N  N     . SER B  2  106 ? 9.276   98.580  18.323  1.00 54.88  ? 122 SER B N     1 
ATOM   4176  C  CA    . SER B  2  106 ? 8.129   99.134  19.044  1.00 56.01  ? 122 SER B CA    1 
ATOM   4177  C  C     . SER B  2  106 ? 7.809   100.594 18.762  1.00 57.34  ? 122 SER B C     1 
ATOM   4178  O  O     . SER B  2  106 ? 6.656   100.935 18.502  1.00 59.52  ? 122 SER B O     1 
ATOM   4179  C  CB    . SER B  2  106 ? 8.304   98.948  20.550  1.00 54.33  ? 122 SER B CB    1 
ATOM   4180  O  OG    . SER B  2  106 ? 8.548   97.593  20.880  1.00 56.54  ? 122 SER B OG    1 
ATOM   4181  N  N     . VAL B  2  107 ? 8.827   101.447 18.798  1.00 57.37  ? 123 VAL B N     1 
ATOM   4182  C  CA    . VAL B  2  107 ? 8.638   102.876 18.584  1.00 57.67  ? 123 VAL B CA    1 
ATOM   4183  C  C     . VAL B  2  107 ? 8.184   103.265 17.182  1.00 57.66  ? 123 VAL B C     1 
ATOM   4184  O  O     . VAL B  2  107 ? 7.086   103.804 17.017  1.00 58.28  ? 123 VAL B O     1 
ATOM   4185  C  CB    . VAL B  2  107 ? 9.905   103.675 19.001  1.00 59.20  ? 123 VAL B CB    1 
ATOM   4186  C  CG1   . VAL B  2  107 ? 9.721   105.163 18.722  1.00 59.01  ? 123 VAL B CG1   1 
ATOM   4187  C  CG2   . VAL B  2  107 ? 10.181  103.458 20.486  1.00 57.22  ? 123 VAL B CG2   1 
ATOM   4188  N  N     . LEU B  2  108 ? 9.017   103.010 16.179  1.00 57.36  ? 124 LEU B N     1 
ATOM   4189  C  CA    . LEU B  2  108 ? 8.659   103.347 14.807  1.00 59.04  ? 124 LEU B CA    1 
ATOM   4190  C  C     . LEU B  2  108 ? 7.260   102.834 14.419  1.00 60.16  ? 124 LEU B C     1 
ATOM   4191  O  O     . LEU B  2  108 ? 6.471   103.575 13.854  1.00 59.68  ? 124 LEU B O     1 
ATOM   4192  C  CB    . LEU B  2  108 ? 9.731   102.847 13.844  1.00 61.08  ? 124 LEU B CB    1 
ATOM   4193  C  CG    . LEU B  2  108 ? 11.038  103.633 13.906  1.00 63.42  ? 124 LEU B CG    1 
ATOM   4194  C  CD1   . LEU B  2  108 ? 12.148  102.899 13.164  1.00 65.15  ? 124 LEU B CD1   1 
ATOM   4195  C  CD2   . LEU B  2  108 ? 10.826  105.023 13.321  1.00 64.89  ? 124 LEU B CD2   1 
ATOM   4196  N  N     . PRO B  2  109 ? 6.946   101.552 14.697  1.00 61.88  ? 125 PRO B N     1 
ATOM   4197  C  CA    . PRO B  2  109 ? 5.617   101.035 14.352  1.00 61.88  ? 125 PRO B CA    1 
ATOM   4198  C  C     . PRO B  2  109 ? 4.504   101.848 15.012  1.00 61.18  ? 125 PRO B C     1 
ATOM   4199  O  O     . PRO B  2  109 ? 3.582   102.303 14.341  1.00 61.61  ? 125 PRO B O     1 
ATOM   4200  C  CB    . PRO B  2  109 ? 5.659   99.609  14.905  1.00 61.22  ? 125 PRO B CB    1 
ATOM   4201  C  CG    . PRO B  2  109 ? 7.068   99.221  14.639  1.00 62.43  ? 125 PRO B CG    1 
ATOM   4202  C  CD    . PRO B  2  109 ? 7.835   100.443 15.101  1.00 62.70  ? 125 PRO B CD    1 
ATOM   4203  N  N     . ALA B  2  110 ? 4.602   102.036 16.326  1.00 60.58  ? 126 ALA B N     1 
ATOM   4204  C  CA    . ALA B  2  110 ? 3.600   102.795 17.072  1.00 60.50  ? 126 ALA B CA    1 
ATOM   4205  C  C     . ALA B  2  110 ? 3.445   104.189 16.476  1.00 60.84  ? 126 ALA B C     1 
ATOM   4206  O  O     . ALA B  2  110 ? 2.334   104.696 16.344  1.00 61.42  ? 126 ALA B O     1 
ATOM   4207  C  CB    . ALA B  2  110 ? 3.990   102.886 18.541  1.00 58.73  ? 126 ALA B CB    1 
ATOM   4208  N  N     . ALA B  2  111 ? 4.566   104.777 16.072  1.00 60.27  ? 127 ALA B N     1 
ATOM   4209  C  CA    . ALA B  2  111 ? 4.566   106.102 15.483  1.00 60.35  ? 127 ALA B CA    1 
ATOM   4210  C  C     . ALA B  2  111 ? 3.927   106.098 14.103  1.00 61.24  ? 127 ALA B C     1 
ATOM   4211  O  O     . ALA B  2  111 ? 3.178   107.016 13.766  1.00 62.03  ? 127 ALA B O     1 
ATOM   4212  C  CB    . ALA B  2  111 ? 5.988   106.641 15.401  1.00 59.50  ? 127 ALA B CB    1 
ATOM   4213  N  N     . ARG B  2  112 ? 4.232   105.072 13.307  1.00 62.23  ? 128 ARG B N     1 
ATOM   4214  C  CA    . ARG B  2  112 ? 3.694   104.949 11.949  1.00 64.03  ? 128 ARG B CA    1 
ATOM   4215  C  C     . ARG B  2  112 ? 2.162   104.842 11.972  1.00 63.57  ? 128 ARG B C     1 
ATOM   4216  O  O     . ARG B  2  112 ? 1.485   105.362 11.084  1.00 63.70  ? 128 ARG B O     1 
ATOM   4217  C  CB    . ARG B  2  112 ? 4.304   103.736 11.229  1.00 66.50  ? 128 ARG B CB    1 
ATOM   4218  C  CG    . ARG B  2  112 ? 5.064   104.061 9.941   1.00 70.90  ? 128 ARG B CG    1 
ATOM   4219  C  CD    . ARG B  2  112 ? 6.492   104.545 10.215  1.00 78.08  ? 128 ARG B CD    1 
ATOM   4220  N  NE    . ARG B  2  112 ? 7.014   105.349 9.102   1.00 84.36  ? 128 ARG B NE    1 
ATOM   4221  C  CZ    . ARG B  2  112 ? 8.298   105.656 8.912   1.00 85.37  ? 128 ARG B CZ    1 
ATOM   4222  N  NH1   . ARG B  2  112 ? 8.652   106.401 7.870   1.00 84.40  ? 128 ARG B NH1   1 
ATOM   4223  N  NH2   . ARG B  2  112 ? 9.232   105.205 9.745   1.00 85.89  ? 128 ARG B NH2   1 
ATOM   4224  N  N     . TYR B  2  113 ? 1.634   104.181 13.002  1.00 62.82  ? 129 TYR B N     1 
ATOM   4225  C  CA    . TYR B  2  113 ? 0.197   104.003 13.187  1.00 63.14  ? 129 TYR B CA    1 
ATOM   4226  C  C     . TYR B  2  113 ? -0.452  105.326 13.577  1.00 64.16  ? 129 TYR B C     1 
ATOM   4227  O  O     . TYR B  2  113 ? -1.569  105.621 13.159  1.00 64.84  ? 129 TYR B O     1 
ATOM   4228  C  CB    . TYR B  2  113 ? -0.054  102.914 14.242  1.00 62.95  ? 129 TYR B CB    1 
ATOM   4229  C  CG    . TYR B  2  113 ? -1.375  102.981 14.993  1.00 64.25  ? 129 TYR B CG    1 
ATOM   4230  C  CD1   . TYR B  2  113 ? -2.577  102.576 14.402  1.00 64.36  ? 129 TYR B CD1   1 
ATOM   4231  C  CD2   . TYR B  2  113 ? -1.406  103.401 16.325  1.00 66.61  ? 129 TYR B CD2   1 
ATOM   4232  C  CE1   . TYR B  2  113 ? -3.775  102.584 15.125  1.00 65.08  ? 129 TYR B CE1   1 
ATOM   4233  C  CE2   . TYR B  2  113 ? -2.591  103.411 17.057  1.00 67.10  ? 129 TYR B CE2   1 
ATOM   4234  C  CZ    . TYR B  2  113 ? -3.770  103.001 16.458  1.00 68.07  ? 129 TYR B CZ    1 
ATOM   4235  O  OH    . TYR B  2  113 ? -4.929  102.994 17.217  1.00 69.85  ? 129 TYR B OH    1 
ATOM   4236  N  N     . ASP B  2  114 ? 0.254   106.121 14.376  1.00 65.60  ? 130 ASP B N     1 
ATOM   4237  C  CA    . ASP B  2  114 ? -0.247  107.426 14.802  1.00 65.67  ? 130 ASP B CA    1 
ATOM   4238  C  C     . ASP B  2  114 ? -0.428  108.338 13.590  1.00 66.21  ? 130 ASP B C     1 
ATOM   4239  O  O     . ASP B  2  114 ? -1.490  108.924 13.403  1.00 66.02  ? 130 ASP B O     1 
ATOM   4240  C  CB    . ASP B  2  114 ? 0.725   108.089 15.782  1.00 64.92  ? 130 ASP B CB    1 
ATOM   4241  C  CG    . ASP B  2  114 ? 0.698   107.464 17.160  1.00 65.15  ? 130 ASP B CG    1 
ATOM   4242  O  OD1   . ASP B  2  114 ? 1.722   107.580 17.864  1.00 65.04  ? 130 ASP B OD1   1 
ATOM   4243  O  OD2   . ASP B  2  114 ? -0.336  106.876 17.551  1.00 64.45  ? 130 ASP B OD2   1 
ATOM   4244  N  N     . TYR B  2  115 ? 0.613   108.440 12.770  1.00 67.24  ? 131 TYR B N     1 
ATOM   4245  C  CA    . TYR B  2  115 ? 0.578   109.278 11.585  1.00 70.39  ? 131 TYR B CA    1 
ATOM   4246  C  C     . TYR B  2  115 ? -0.509  108.823 10.621  1.00 72.58  ? 131 TYR B C     1 
ATOM   4247  O  O     . TYR B  2  115 ? -1.173  109.652 10.000  1.00 74.30  ? 131 TYR B O     1 
ATOM   4248  C  CB    . TYR B  2  115 ? 1.941   109.272 10.885  1.00 71.22  ? 131 TYR B CB    1 
ATOM   4249  C  CG    . TYR B  2  115 ? 1.969   110.020 9.566   1.00 72.96  ? 131 TYR B CG    1 
ATOM   4250  C  CD1   . TYR B  2  115 ? 1.610   111.365 9.494   1.00 74.82  ? 131 TYR B CD1   1 
ATOM   4251  C  CD2   . TYR B  2  115 ? 2.344   109.377 8.387   1.00 74.04  ? 131 TYR B CD2   1 
ATOM   4252  C  CE1   . TYR B  2  115 ? 1.621   112.052 8.281   1.00 75.66  ? 131 TYR B CE1   1 
ATOM   4253  C  CE2   . TYR B  2  115 ? 2.361   110.052 7.170   1.00 75.13  ? 131 TYR B CE2   1 
ATOM   4254  C  CZ    . TYR B  2  115 ? 1.998   111.388 7.124   1.00 76.51  ? 131 TYR B CZ    1 
ATOM   4255  O  OH    . TYR B  2  115 ? 2.009   112.059 5.922   1.00 78.77  ? 131 TYR B OH    1 
ATOM   4256  N  N     . ALA B  2  116 ? -0.697  107.509 10.514  1.00 73.97  ? 132 ALA B N     1 
ATOM   4257  C  CA    . ALA B  2  116 ? -1.702  106.933 9.620   1.00 74.13  ? 132 ALA B CA    1 
ATOM   4258  C  C     . ALA B  2  116 ? -3.115  107.332 10.018  1.00 74.65  ? 132 ALA B C     1 
ATOM   4259  O  O     . ALA B  2  116 ? -3.896  107.752 9.166   1.00 75.62  ? 132 ALA B O     1 
ATOM   4260  C  CB    . ALA B  2  116 ? -1.573  105.414 9.578   1.00 73.56  ? 132 ALA B CB    1 
ATOM   4261  N  N     . VAL B  2  117 ? -3.434  107.211 11.307  1.00 74.18  ? 133 VAL B N     1 
ATOM   4262  C  CA    . VAL B  2  117 ? -4.757  107.569 11.815  1.00 75.29  ? 133 VAL B CA    1 
ATOM   4263  C  C     . VAL B  2  117 ? -5.096  109.037 11.537  1.00 77.31  ? 133 VAL B C     1 
ATOM   4264  O  O     . VAL B  2  117 ? -6.206  109.363 11.111  1.00 77.31  ? 133 VAL B O     1 
ATOM   4265  C  CB    . VAL B  2  117 ? -4.871  107.299 13.334  1.00 74.34  ? 133 VAL B CB    1 
ATOM   4266  C  CG1   . VAL B  2  117 ? -6.190  107.830 13.872  1.00 73.78  ? 133 VAL B CG1   1 
ATOM   4267  C  CG2   . VAL B  2  117 ? -4.769  105.811 13.609  1.00 74.33  ? 133 VAL B CG2   1 
ATOM   4268  N  N     . ALA B  2  118 ? -4.120  109.911 11.753  1.00 79.31  ? 134 ALA B N     1 
ATOM   4269  C  CA    . ALA B  2  118 ? -4.300  111.339 11.540  1.00 81.12  ? 134 ALA B CA    1 
ATOM   4270  C  C     . ALA B  2  118 ? -4.350  111.713 10.059  1.00 82.89  ? 134 ALA B C     1 
ATOM   4271  O  O     . ALA B  2  118 ? -4.978  112.703 9.685   1.00 84.06  ? 134 ALA B O     1 
ATOM   4272  C  CB    . ALA B  2  118 ? -3.192  112.110 12.243  1.00 80.50  ? 134 ALA B CB    1 
ATOM   4273  N  N     . GLU B  2  119 ? -3.687  110.921 9.223   1.00 84.28  ? 135 GLU B N     1 
ATOM   4274  C  CA    . GLU B  2  119 ? -3.649  111.172 7.784   1.00 85.91  ? 135 GLU B CA    1 
ATOM   4275  C  C     . GLU B  2  119 ? -4.999  110.888 7.121   1.00 86.46  ? 135 GLU B C     1 
ATOM   4276  O  O     . GLU B  2  119 ? -5.191  111.165 5.938   1.00 86.31  ? 135 GLU B O     1 
ATOM   4277  C  CB    . GLU B  2  119 ? -2.554  110.314 7.144   1.00 87.22  ? 135 GLU B CB    1 
ATOM   4278  C  CG    . GLU B  2  119 ? -2.330  110.550 5.657   1.00 89.86  ? 135 GLU B CG    1 
ATOM   4279  C  CD    . GLU B  2  119 ? -1.236  109.666 5.075   1.00 91.77  ? 135 GLU B CD    1 
ATOM   4280  O  OE1   . GLU B  2  119 ? -0.504  110.149 4.182   1.00 92.31  ? 135 GLU B OE1   1 
ATOM   4281  O  OE2   . GLU B  2  119 ? -1.112  108.491 5.501   1.00 92.37  ? 135 GLU B OE2   1 
ATOM   4282  N  N     . GLN B  2  120 ? -5.940  110.358 7.897   1.00 87.26  ? 136 GLN B N     1 
ATOM   4283  C  CA    . GLN B  2  120 ? -7.263  110.034 7.379   1.00 88.26  ? 136 GLN B CA    1 
ATOM   4284  C  C     . GLN B  2  120 ? -8.385  110.957 7.854   1.00 87.61  ? 136 GLN B C     1 
ATOM   4285  O  O     . GLN B  2  120 ? -9.502  110.895 7.333   1.00 87.44  ? 136 GLN B O     1 
ATOM   4286  C  CB    . GLN B  2  120 ? -7.589  108.567 7.668   1.00 90.59  ? 136 GLN B CB    1 
ATOM   4287  C  CG    . GLN B  2  120 ? -6.854  107.605 6.732   1.00 93.81  ? 136 GLN B CG    1 
ATOM   4288  C  CD    . GLN B  2  120 ? -6.579  106.241 7.358   1.00 96.22  ? 136 GLN B CD    1 
ATOM   4289  O  OE1   . GLN B  2  120 ? -5.532  105.634 7.107   1.00 96.75  ? 136 GLN B OE1   1 
ATOM   4290  N  NE2   . GLN B  2  120 ? -7.511  105.756 8.178   1.00 96.25  ? 136 GLN B NE2   1 
ATOM   4291  N  N     . CYS B  2  121 ? -8.088  111.804 8.840   1.00 87.28  ? 137 CYS B N     1 
ATOM   4292  C  CA    . CYS B  2  121 ? -9.059  112.770 9.374   1.00 86.00  ? 137 CYS B CA    1 
ATOM   4293  C  C     . CYS B  2  121 ? -8.692  114.153 8.809   1.00 85.48  ? 137 CYS B C     1 
ATOM   4294  O  O     . CYS B  2  121 ? -7.719  114.770 9.235   1.00 84.33  ? 137 CYS B O     1 
ATOM   4295  C  CB    . CYS B  2  121 ? -9.014  112.779 10.901  1.00 84.54  ? 137 CYS B CB    1 
ATOM   4296  S  SG    . CYS B  2  121 ? -10.369 113.663 11.673  1.00 82.94  ? 137 CYS B SG    1 
ATOM   4297  N  N     . PRO B  2  122 ? -9.483  114.658 7.844   1.00 86.14  ? 138 PRO B N     1 
ATOM   4298  C  CA    . PRO B  2  122 ? -9.263  115.956 7.191   1.00 86.13  ? 138 PRO B CA    1 
ATOM   4299  C  C     . PRO B  2  122 ? -9.227  117.199 8.078   1.00 85.35  ? 138 PRO B C     1 
ATOM   4300  O  O     . PRO B  2  122 ? -8.514  118.147 7.762   1.00 84.01  ? 138 PRO B O     1 
ATOM   4301  C  CB    . PRO B  2  122 ? -10.389 116.013 6.158   1.00 86.69  ? 138 PRO B CB    1 
ATOM   4302  C  CG    . PRO B  2  122 ? -11.491 115.258 6.828   1.00 86.65  ? 138 PRO B CG    1 
ATOM   4303  C  CD    . PRO B  2  122 ? -10.759 114.066 7.399   1.00 86.85  ? 138 PRO B CD    1 
ATOM   4304  N  N     . VAL B  2  123 ? -9.996  117.210 9.167   1.00 85.30  ? 139 VAL B N     1 
ATOM   4305  C  CA    . VAL B  2  123 ? -9.989  118.361 10.066  1.00 86.38  ? 139 VAL B CA    1 
ATOM   4306  C  C     . VAL B  2  123 ? -8.591  118.557 10.658  1.00 87.98  ? 139 VAL B C     1 
ATOM   4307  O  O     . VAL B  2  123 ? -8.116  119.687 10.773  1.00 88.91  ? 139 VAL B O     1 
ATOM   4308  C  CB    . VAL B  2  123 ? -11.038 118.245 11.208  1.00 85.68  ? 139 VAL B CB    1 
ATOM   4309  C  CG1   . VAL B  2  123 ? -12.434 118.155 10.632  1.00 85.04  ? 139 VAL B CG1   1 
ATOM   4310  C  CG2   . VAL B  2  123 ? -10.745 117.051 12.101  1.00 86.37  ? 139 VAL B CG2   1 
ATOM   4311  N  N     . LYS B  2  124 ? -7.927  117.451 11.000  1.00 88.95  ? 140 LYS B N     1 
ATOM   4312  C  CA    . LYS B  2  124 ? -6.576  117.504 11.560  1.00 89.33  ? 140 LYS B CA    1 
ATOM   4313  C  C     . LYS B  2  124 ? -5.555  117.871 10.491  1.00 88.13  ? 140 LYS B C     1 
ATOM   4314  O  O     . LYS B  2  124 ? -4.538  118.486 10.792  1.00 88.23  ? 140 LYS B O     1 
ATOM   4315  C  CB    . LYS B  2  124 ? -6.189  116.174 12.216  1.00 91.30  ? 140 LYS B CB    1 
ATOM   4316  C  CG    . LYS B  2  124 ? -6.881  115.889 13.544  1.00 94.04  ? 140 LYS B CG    1 
ATOM   4317  C  CD    . LYS B  2  124 ? -6.379  114.571 14.122  1.00 96.38  ? 140 LYS B CD    1 
ATOM   4318  C  CE    . LYS B  2  124 ? -7.184  114.125 15.336  1.00 97.41  ? 140 LYS B CE    1 
ATOM   4319  N  NZ    . LYS B  2  124 ? -6.799  112.741 15.758  1.00 97.37  ? 140 LYS B NZ    1 
ATOM   4320  N  N     . SER B  2  125 ? -5.818  117.475 9.249   1.00 87.35  ? 141 SER B N     1 
ATOM   4321  C  CA    . SER B  2  125 ? -4.919  117.801 8.145   1.00 87.50  ? 141 SER B CA    1 
ATOM   4322  C  C     . SER B  2  125 ? -4.983  119.313 7.995   1.00 87.15  ? 141 SER B C     1 
ATOM   4323  O  O     . SER B  2  125 ? -4.012  119.954 7.598   1.00 86.69  ? 141 SER B O     1 
ATOM   4324  C  CB    . SER B  2  125 ? -5.394  117.143 6.846   1.00 88.19  ? 141 SER B CB    1 
ATOM   4325  O  OG    . SER B  2  125 ? -5.644  115.758 7.026   1.00 91.17  ? 141 SER B OG    1 
ATOM   4326  N  N     . ALA B  2  126 ? -6.145  119.865 8.341   1.00 87.00  ? 142 ALA B N     1 
ATOM   4327  C  CA    . ALA B  2  126 ? -6.405  121.297 8.275   1.00 86.12  ? 142 ALA B CA    1 
ATOM   4328  C  C     . ALA B  2  126 ? -5.759  122.025 9.450   1.00 85.71  ? 142 ALA B C     1 
ATOM   4329  O  O     . ALA B  2  126 ? -4.979  122.953 9.246   1.00 85.76  ? 142 ALA B O     1 
ATOM   4330  C  CB    . ALA B  2  126 ? -7.906  121.553 8.256   1.00 85.68  ? 142 ALA B CB    1 
ATOM   4331  N  N     . GLU B  2  127 ? -6.077  121.597 10.672  1.00 85.20  ? 143 GLU B N     1 
ATOM   4332  C  CA    . GLU B  2  127 ? -5.518  122.210 11.879  1.00 84.95  ? 143 GLU B CA    1 
ATOM   4333  C  C     . GLU B  2  127 ? -3.998  122.286 11.807  1.00 84.59  ? 143 GLU B C     1 
ATOM   4334  O  O     . GLU B  2  127 ? -3.399  123.258 12.254  1.00 85.11  ? 143 GLU B O     1 
ATOM   4335  C  CB    . GLU B  2  127 ? -5.943  121.440 13.132  1.00 84.77  ? 143 GLU B CB    1 
ATOM   4336  C  CG    . GLU B  2  127 ? -5.344  121.984 14.425  1.00 85.26  ? 143 GLU B CG    1 
ATOM   4337  C  CD    . GLU B  2  127 ? -5.995  121.415 15.676  1.00 86.73  ? 143 GLU B CD    1 
ATOM   4338  O  OE1   . GLU B  2  127 ? -7.215  121.138 15.649  1.00 87.01  ? 143 GLU B OE1   1 
ATOM   4339  O  OE2   . GLU B  2  127 ? -5.290  121.266 16.700  1.00 87.48  ? 143 GLU B OE2   1 
ATOM   4340  N  N     . ASP B  2  128 ? -3.383  121.260 11.233  1.00 84.72  ? 144 ASP B N     1 
ATOM   4341  C  CA    . ASP B  2  128 ? -1.936  121.229 11.078  1.00 85.13  ? 144 ASP B CA    1 
ATOM   4342  C  C     . ASP B  2  128 ? -1.493  122.275 10.056  1.00 84.63  ? 144 ASP B C     1 
ATOM   4343  O  O     . ASP B  2  128 ? -0.428  122.873 10.194  1.00 85.11  ? 144 ASP B O     1 
ATOM   4344  C  CB    . ASP B  2  128 ? -1.464  119.833 10.655  1.00 85.69  ? 144 ASP B CB    1 
ATOM   4345  C  CG    . ASP B  2  128 ? -1.056  118.972 11.838  1.00 87.08  ? 144 ASP B CG    1 
ATOM   4346  O  OD1   . ASP B  2  128 ? 0.112   118.523 11.861  1.00 87.91  ? 144 ASP B OD1   1 
ATOM   4347  O  OD2   . ASP B  2  128 ? -1.891  118.759 12.751  1.00 86.66  ? 144 ASP B OD2   1 
ATOM   4348  N  N     . GLN B  2  129 ? -2.328  122.504 9.046   1.00 83.66  ? 145 GLN B N     1 
ATOM   4349  C  CA    . GLN B  2  129 ? -2.035  123.486 8.007   1.00 82.90  ? 145 GLN B CA    1 
ATOM   4350  C  C     . GLN B  2  129 ? -2.174  124.917 8.507   1.00 82.11  ? 145 GLN B C     1 
ATOM   4351  O  O     . GLN B  2  129 ? -1.442  125.807 8.072   1.00 81.64  ? 145 GLN B O     1 
ATOM   4352  C  CB    . GLN B  2  129 ? -2.933  123.260 6.793   1.00 83.14  ? 145 GLN B CB    1 
ATOM   4353  C  CG    . GLN B  2  129 ? -2.530  122.065 5.972   1.00 83.37  ? 145 GLN B CG    1 
ATOM   4354  C  CD    . GLN B  2  129 ? -1.083  122.137 5.552   1.00 83.91  ? 145 GLN B CD    1 
ATOM   4355  O  OE1   . GLN B  2  129 ? -0.767  122.630 4.472   1.00 84.46  ? 145 GLN B OE1   1 
ATOM   4356  N  NE2   . GLN B  2  129 ? -0.190  121.654 6.411   1.00 83.18  ? 145 GLN B NE2   1 
ATOM   4357  N  N     . LEU B  2  130 ? -3.125  125.130 9.412   1.00 81.11  ? 146 LEU B N     1 
ATOM   4358  C  CA    . LEU B  2  130 ? -3.358  126.444 10.002  1.00 80.24  ? 146 LEU B CA    1 
ATOM   4359  C  C     . LEU B  2  130 ? -2.106  126.886 10.762  1.00 79.70  ? 146 LEU B C     1 
ATOM   4360  O  O     . LEU B  2  130 ? -1.521  127.923 10.454  1.00 79.97  ? 146 LEU B O     1 
ATOM   4361  C  CB    . LEU B  2  130 ? -4.568  126.389 10.945  1.00 79.66  ? 146 LEU B CB    1 
ATOM   4362  C  CG    . LEU B  2  130 ? -5.907  126.977 10.475  1.00 78.70  ? 146 LEU B CG    1 
ATOM   4363  C  CD1   . LEU B  2  130 ? -6.101  126.797 8.993   1.00 76.49  ? 146 LEU B CD1   1 
ATOM   4364  C  CD2   . LEU B  2  130 ? -7.048  126.350 11.247  1.00 77.99  ? 146 LEU B CD2   1 
ATOM   4365  N  N     . TYR B  2  131 ? -1.671  126.060 11.713  1.00 79.44  ? 147 TYR B N     1 
ATOM   4366  C  CA    . TYR B  2  131 ? -0.483  126.339 12.519  1.00 78.08  ? 147 TYR B CA    1 
ATOM   4367  C  C     . TYR B  2  131 ? 0.757   126.570 11.665  1.00 79.34  ? 147 TYR B C     1 
ATOM   4368  O  O     . TYR B  2  131 ? 1.532   127.486 11.925  1.00 80.97  ? 147 TYR B O     1 
ATOM   4369  C  CB    . TYR B  2  131 ? -0.199  125.185 13.480  1.00 74.42  ? 147 TYR B CB    1 
ATOM   4370  C  CG    . TYR B  2  131 ? -1.016  125.184 14.749  1.00 71.94  ? 147 TYR B CG    1 
ATOM   4371  C  CD1   . TYR B  2  131 ? -2.329  124.727 14.759  1.00 71.25  ? 147 TYR B CD1   1 
ATOM   4372  C  CD2   . TYR B  2  131 ? -0.459  125.607 15.952  1.00 72.18  ? 147 TYR B CD2   1 
ATOM   4373  C  CE1   . TYR B  2  131 ? -3.071  124.686 15.939  1.00 71.30  ? 147 TYR B CE1   1 
ATOM   4374  C  CE2   . TYR B  2  131 ? -1.189  125.574 17.137  1.00 72.17  ? 147 TYR B CE2   1 
ATOM   4375  C  CZ    . TYR B  2  131 ? -2.495  125.112 17.125  1.00 72.39  ? 147 TYR B CZ    1 
ATOM   4376  O  OH    . TYR B  2  131 ? -3.214  125.074 18.300  1.00 72.42  ? 147 TYR B OH    1 
ATOM   4377  N  N     . ALA B  2  132 ? 0.940   125.738 10.647  1.00 80.44  ? 148 ALA B N     1 
ATOM   4378  C  CA    . ALA B  2  132 ? 2.103   125.839 9.769   1.00 82.25  ? 148 ALA B CA    1 
ATOM   4379  C  C     . ALA B  2  132 ? 2.188   127.160 9.012   1.00 83.48  ? 148 ALA B C     1 
ATOM   4380  O  O     . ALA B  2  132 ? 3.288   127.648 8.730   1.00 83.26  ? 148 ALA B O     1 
ATOM   4381  C  CB    . ALA B  2  132 ? 2.133   124.667 8.791   1.00 81.87  ? 148 ALA B CB    1 
ATOM   4382  N  N     . ILE B  2  133 ? 1.036   127.726 8.659   1.00 84.70  ? 149 ILE B N     1 
ATOM   4383  C  CA    . ILE B  2  133 ? 1.036   128.988 7.933   1.00 86.29  ? 149 ILE B CA    1 
ATOM   4384  C  C     . ILE B  2  133 ? 0.977   130.223 8.831   1.00 87.50  ? 149 ILE B C     1 
ATOM   4385  O  O     . ILE B  2  133 ? 1.546   131.258 8.475   1.00 88.33  ? 149 ILE B O     1 
ATOM   4386  C  CB    . ILE B  2  133 ? -0.038  129.044 6.816   1.00 86.25  ? 149 ILE B CB    1 
ATOM   4387  C  CG1   . ILE B  2  133 ? -1.445  128.871 7.391   1.00 86.39  ? 149 ILE B CG1   1 
ATOM   4388  C  CG2   . ILE B  2  133 ? 0.266   127.992 5.752   1.00 85.93  ? 149 ILE B CG2   1 
ATOM   4389  C  CD1   . ILE B  2  133 ? -2.540  128.880 6.333   1.00 86.73  ? 149 ILE B CD1   1 
ATOM   4390  N  N     . THR B  2  134 ? 0.321   130.129 9.989   1.00 87.94  ? 150 THR B N     1 
ATOM   4391  C  CA    . THR B  2  134 ? 0.276   131.278 10.893  1.00 89.16  ? 150 THR B CA    1 
ATOM   4392  C  C     . THR B  2  134 ? 1.666   131.453 11.518  1.00 90.67  ? 150 THR B C     1 
ATOM   4393  O  O     . THR B  2  134 ? 2.346   132.437 11.231  1.00 90.99  ? 150 THR B O     1 
ATOM   4394  C  CB    . THR B  2  134 ? -0.815  131.163 12.000  1.00 88.55  ? 150 THR B CB    1 
ATOM   4395  O  OG1   . THR B  2  134 ? -0.479  130.127 12.925  1.00 89.24  ? 150 THR B OG1   1 
ATOM   4396  C  CG2   . THR B  2  134 ? -2.169  130.871 11.392  1.00 87.59  ? 150 THR B CG2   1 
ATOM   4397  N  N     . PHE B  2  135 ? 2.106   130.473 12.311  1.00 92.36  ? 151 PHE B N     1 
ATOM   4398  C  CA    . PHE B  2  135 ? 3.429   130.507 12.956  1.00 93.65  ? 151 PHE B CA    1 
ATOM   4399  C  C     . PHE B  2  135 ? 4.402   129.665 12.124  1.00 94.74  ? 151 PHE B C     1 
ATOM   4400  O  O     . PHE B  2  135 ? 4.695   128.521 12.468  1.00 97.07  ? 151 PHE B O     1 
ATOM   4401  C  CB    . PHE B  2  135 ? 3.354   129.934 14.374  1.00 92.86  ? 151 PHE B CB    1 
ATOM   4402  C  CG    . PHE B  2  135 ? 2.096   130.288 15.113  1.00 93.05  ? 151 PHE B CG    1 
ATOM   4403  C  CD1   . PHE B  2  135 ? 1.885   131.576 15.588  1.00 93.03  ? 151 PHE B CD1   1 
ATOM   4404  C  CD2   . PHE B  2  135 ? 1.129   129.321 15.355  1.00 93.29  ? 151 PHE B CD2   1 
ATOM   4405  C  CE1   . PHE B  2  135 ? 0.724   131.891 16.298  1.00 93.38  ? 151 PHE B CE1   1 
ATOM   4406  C  CE2   . PHE B  2  135 ? -0.033  129.626 16.062  1.00 93.39  ? 151 PHE B CE2   1 
ATOM   4407  C  CZ    . PHE B  2  135 ? -0.236  130.912 16.535  1.00 93.15  ? 151 PHE B CZ    1 
ATOM   4408  N  N     . ARG B  2  136 ? 4.939   130.264 11.066  1.00 94.86  ? 152 ARG B N     1 
ATOM   4409  C  CA    . ARG B  2  136 ? 5.844   129.602 10.125  1.00 95.52  ? 152 ARG B CA    1 
ATOM   4410  C  C     . ARG B  2  136 ? 6.982   128.671 10.559  1.00 95.49  ? 152 ARG B C     1 
ATOM   4411  O  O     . ARG B  2  136 ? 7.668   128.121 9.693   1.00 96.18  ? 152 ARG B O     1 
ATOM   4412  C  CB    . ARG B  2  136 ? 6.363   130.622 9.109   1.00 96.41  ? 152 ARG B CB    1 
ATOM   4413  C  CG    . ARG B  2  136 ? 5.361   130.895 7.995   1.00 99.01  ? 152 ARG B CG    1 
ATOM   4414  C  CD    . ARG B  2  136 ? 5.540   132.258 7.354   1.00 98.62  ? 152 ARG B CD    1 
ATOM   4415  N  NE    . ARG B  2  136 ? 6.868   132.454 6.784   1.00 98.99  ? 152 ARG B NE    1 
ATOM   4416  C  CZ    . ARG B  2  136 ? 7.109   133.205 5.716   1.00 99.98  ? 152 ARG B CZ    1 
ATOM   4417  N  NH1   . ARG B  2  136 ? 8.345   133.337 5.263   1.00 100.68 ? 152 ARG B NH1   1 
ATOM   4418  N  NH2   . ARG B  2  136 ? 6.111   133.808 5.085   1.00 100.53 ? 152 ARG B NH2   1 
ATOM   4419  N  N     . LYS B  2  137 ? 7.190   128.476 11.861  1.00 94.78  ? 153 LYS B N     1 
ATOM   4420  C  CA    . LYS B  2  137 ? 8.252   127.577 12.324  1.00 94.07  ? 153 LYS B CA    1 
ATOM   4421  C  C     . LYS B  2  137 ? 8.315   127.365 13.832  1.00 92.96  ? 153 LYS B C     1 
ATOM   4422  O  O     . LYS B  2  137 ? 9.201   126.673 14.325  1.00 91.38  ? 153 LYS B O     1 
ATOM   4423  C  CB    . LYS B  2  137 ? 9.625   128.029 11.814  1.00 95.35  ? 153 LYS B CB    1 
ATOM   4424  C  CG    . LYS B  2  137 ? 10.604  126.881 11.667  1.00 97.61  ? 153 LYS B CG    1 
ATOM   4425  C  CD    . LYS B  2  137 ? 11.961  127.334 11.171  1.00 98.83  ? 153 LYS B CD    1 
ATOM   4426  C  CE    . LYS B  2  137 ? 12.876  126.131 10.989  1.00 100.55 ? 153 LYS B CE    1 
ATOM   4427  N  NZ    . LYS B  2  137 ? 12.909  125.266 12.213  1.00 100.12 ? 153 LYS B NZ    1 
ATOM   4428  N  N     . GLY B  2  138 ? 7.387   127.970 14.561  1.00 93.49  ? 154 GLY B N     1 
ATOM   4429  C  CA    . GLY B  2  138 ? 7.363   127.811 16.006  1.00 93.40  ? 154 GLY B CA    1 
ATOM   4430  C  C     . GLY B  2  138 ? 6.386   126.710 16.364  1.00 92.72  ? 154 GLY B C     1 
ATOM   4431  O  O     . GLY B  2  138 ? 6.772   125.548 16.519  1.00 92.82  ? 154 GLY B O     1 
ATOM   4432  N  N     . LEU B  2  139 ? 5.118   127.087 16.510  1.00 91.35  ? 155 LEU B N     1 
ATOM   4433  C  CA    . LEU B  2  139 ? 4.055   126.137 16.817  1.00 89.86  ? 155 LEU B CA    1 
ATOM   4434  C  C     . LEU B  2  139 ? 3.585   125.557 15.483  1.00 88.82  ? 155 LEU B C     1 
ATOM   4435  O  O     . LEU B  2  139 ? 2.669   124.733 15.431  1.00 88.89  ? 155 LEU B O     1 
ATOM   4436  C  CB    . LEU B  2  139 ? 2.884   126.830 17.525  1.00 89.91  ? 155 LEU B CB    1 
ATOM   4437  C  CG    . LEU B  2  139 ? 3.144   127.631 18.803  1.00 89.90  ? 155 LEU B CG    1 
ATOM   4438  C  CD1   . LEU B  2  139 ? 3.806   128.957 18.458  1.00 90.71  ? 155 LEU B CD1   1 
ATOM   4439  C  CD2   . LEU B  2  139 ? 1.837   127.879 19.532  1.00 88.84  ? 155 LEU B CD2   1 
ATOM   4440  N  N     . GLY B  2  140 ? 4.215   126.020 14.405  1.00 87.17  ? 156 GLY B N     1 
ATOM   4441  C  CA    . GLY B  2  140 ? 3.884   125.552 13.073  1.00 85.73  ? 156 GLY B CA    1 
ATOM   4442  C  C     . GLY B  2  140 ? 4.708   124.348 12.668  1.00 84.65  ? 156 GLY B C     1 
ATOM   4443  O  O     . GLY B  2  140 ? 4.707   123.944 11.501  1.00 84.63  ? 156 GLY B O     1 
ATOM   4444  N  N     . ASN B  2  141 ? 5.456   123.808 13.627  1.00 82.92  ? 157 ASN B N     1 
ATOM   4445  C  CA    . ASN B  2  141 ? 6.282   122.631 13.396  1.00 80.31  ? 157 ASN B CA    1 
ATOM   4446  C  C     . ASN B  2  141 ? 5.386   121.399 13.359  1.00 78.14  ? 157 ASN B C     1 
ATOM   4447  O  O     . ASN B  2  141 ? 4.366   121.343 14.057  1.00 78.17  ? 157 ASN B O     1 
ATOM   4448  C  CB    . ASN B  2  141 ? 7.315   122.470 14.520  1.00 81.12  ? 157 ASN B CB    1 
ATOM   4449  C  CG    . ASN B  2  141 ? 8.621   123.192 14.232  1.00 81.54  ? 157 ASN B CG    1 
ATOM   4450  O  OD1   . ASN B  2  141 ? 8.917   123.554 13.085  1.00 81.63  ? 157 ASN B OD1   1 
ATOM   4451  N  ND2   . ASN B  2  141 ? 9.423   123.382 15.275  1.00 79.66  ? 157 ASN B ND2   1 
ATOM   4452  N  N     . PRO B  2  142 ? 5.751   120.401 12.536  1.00 75.94  ? 158 PRO B N     1 
ATOM   4453  C  CA    . PRO B  2  142 ? 5.001   119.150 12.389  1.00 73.45  ? 158 PRO B CA    1 
ATOM   4454  C  C     . PRO B  2  142 ? 4.833   118.470 13.740  1.00 71.92  ? 158 PRO B C     1 
ATOM   4455  O  O     . PRO B  2  142 ? 5.808   118.255 14.461  1.00 72.39  ? 158 PRO B O     1 
ATOM   4456  C  CB    . PRO B  2  142 ? 5.900   118.332 11.475  1.00 73.58  ? 158 PRO B CB    1 
ATOM   4457  C  CG    . PRO B  2  142 ? 6.542   119.373 10.629  1.00 74.69  ? 158 PRO B CG    1 
ATOM   4458  C  CD    . PRO B  2  142 ? 6.920   120.410 11.641  1.00 75.41  ? 158 PRO B CD    1 
ATOM   4459  N  N     . LEU B  2  143 ? 3.589   118.174 14.091  1.00 70.52  ? 159 LEU B N     1 
ATOM   4460  C  CA    . LEU B  2  143 ? 3.272   117.531 15.359  1.00 69.19  ? 159 LEU B CA    1 
ATOM   4461  C  C     . LEU B  2  143 ? 3.727   116.071 15.423  1.00 69.43  ? 159 LEU B C     1 
ATOM   4462  O  O     . LEU B  2  143 ? 4.271   115.637 16.438  1.00 70.30  ? 159 LEU B O     1 
ATOM   4463  C  CB    . LEU B  2  143 ? 1.771   117.619 15.617  1.00 68.61  ? 159 LEU B CB    1 
ATOM   4464  C  CG    . LEU B  2  143 ? 1.254   117.066 16.942  1.00 69.42  ? 159 LEU B CG    1 
ATOM   4465  C  CD1   . LEU B  2  143 ? 1.819   117.867 18.096  1.00 70.53  ? 159 LEU B CD1   1 
ATOM   4466  C  CD2   . LEU B  2  143 ? -0.263  117.123 16.960  1.00 70.57  ? 159 LEU B CD2   1 
ATOM   4467  N  N     . LEU B  2  144 ? 3.505   115.320 14.343  1.00 68.83  ? 160 LEU B N     1 
ATOM   4468  C  CA    . LEU B  2  144 ? 3.880   113.907 14.292  1.00 67.13  ? 160 LEU B CA    1 
ATOM   4469  C  C     . LEU B  2  144 ? 5.018   113.609 13.316  1.00 67.50  ? 160 LEU B C     1 
ATOM   4470  O  O     . LEU B  2  144 ? 5.333   114.419 12.436  1.00 66.88  ? 160 LEU B O     1 
ATOM   4471  C  CB    . LEU B  2  144 ? 2.660   113.053 13.948  1.00 65.94  ? 160 LEU B CB    1 
ATOM   4472  C  CG    . LEU B  2  144 ? 1.448   113.185 14.876  1.00 66.40  ? 160 LEU B CG    1 
ATOM   4473  C  CD1   . LEU B  2  144 ? 0.328   112.287 14.390  1.00 67.49  ? 160 LEU B CD1   1 
ATOM   4474  C  CD2   . LEU B  2  144 ? 1.812   112.825 16.305  1.00 66.05  ? 160 LEU B CD2   1 
ATOM   4475  N  N     . TYR B  2  145 ? 5.629   112.436 13.484  1.00 66.80  ? 161 TYR B N     1 
ATOM   4476  C  CA    . TYR B  2  145 ? 6.743   111.988 12.644  1.00 66.34  ? 161 TYR B CA    1 
ATOM   4477  C  C     . TYR B  2  145 ? 6.287   111.406 11.304  1.00 65.85  ? 161 TYR B C     1 
ATOM   4478  O  O     . TYR B  2  145 ? 5.320   110.655 11.253  1.00 65.85  ? 161 TYR B O     1 
ATOM   4479  C  CB    . TYR B  2  145 ? 7.573   110.945 13.406  1.00 65.75  ? 161 TYR B CB    1 
ATOM   4480  C  CG    . TYR B  2  145 ? 8.686   110.312 12.596  1.00 66.37  ? 161 TYR B CG    1 
ATOM   4481  C  CD1   . TYR B  2  145 ? 8.594   108.988 12.164  1.00 67.12  ? 161 TYR B CD1   1 
ATOM   4482  C  CD2   . TYR B  2  145 ? 9.830   111.032 12.261  1.00 66.74  ? 161 TYR B CD2   1 
ATOM   4483  C  CE1   . TYR B  2  145 ? 9.613   108.397 11.416  1.00 66.52  ? 161 TYR B CE1   1 
ATOM   4484  C  CE2   . TYR B  2  145 ? 10.856  110.448 11.516  1.00 66.94  ? 161 TYR B CE2   1 
ATOM   4485  C  CZ    . TYR B  2  145 ? 10.738  109.133 11.098  1.00 66.50  ? 161 TYR B CZ    1 
ATOM   4486  O  OH    . TYR B  2  145 ? 11.740  108.557 10.357  1.00 67.15  ? 161 TYR B OH    1 
ATOM   4487  N  N     . ASP B  2  146 ? 6.987   111.751 10.225  1.00 66.63  ? 162 ASP B N     1 
ATOM   4488  C  CA    . ASP B  2  146 ? 6.646   111.230 8.901   1.00 67.96  ? 162 ASP B CA    1 
ATOM   4489  C  C     . ASP B  2  146 ? 7.845   110.918 7.995   1.00 68.96  ? 162 ASP B C     1 
ATOM   4490  O  O     . ASP B  2  146 ? 7.682   110.641 6.805   1.00 70.06  ? 162 ASP B O     1 
ATOM   4491  C  CB    . ASP B  2  146 ? 5.609   112.116 8.183   1.00 68.09  ? 162 ASP B CB    1 
ATOM   4492  C  CG    . ASP B  2  146 ? 6.140   113.503 7.814   1.00 68.44  ? 162 ASP B CG    1 
ATOM   4493  O  OD1   . ASP B  2  146 ? 7.311   113.631 7.393   1.00 66.72  ? 162 ASP B OD1   1 
ATOM   4494  O  OD2   . ASP B  2  146 ? 5.355   114.471 7.915   1.00 68.53  ? 162 ASP B OD2   1 
ATOM   4495  N  N     . GLY B  2  147 ? 9.046   111.003 8.556   1.00 69.94  ? 163 GLY B N     1 
ATOM   4496  C  CA    . GLY B  2  147 ? 10.253  110.679 7.815   1.00 72.11  ? 163 GLY B CA    1 
ATOM   4497  C  C     . GLY B  2  147 ? 10.789  111.588 6.724   1.00 74.44  ? 163 GLY B C     1 
ATOM   4498  O  O     . GLY B  2  147 ? 11.683  111.164 5.988   1.00 75.13  ? 163 GLY B O     1 
ATOM   4499  N  N     . VAL B  2  148 ? 10.293  112.820 6.613   1.00 76.34  ? 164 VAL B N     1 
ATOM   4500  C  CA    . VAL B  2  148 ? 10.788  113.741 5.579   1.00 78.12  ? 164 VAL B CA    1 
ATOM   4501  C  C     . VAL B  2  148 ? 12.259  114.073 5.769   1.00 78.39  ? 164 VAL B C     1 
ATOM   4502  O  O     . VAL B  2  148 ? 12.989  114.280 4.796   1.00 77.87  ? 164 VAL B O     1 
ATOM   4503  C  CB    . VAL B  2  148 ? 9.982   115.038 5.516   1.00 79.07  ? 164 VAL B CB    1 
ATOM   4504  C  CG1   . VAL B  2  148 ? 8.679   114.798 4.768   1.00 79.68  ? 164 VAL B CG1   1 
ATOM   4505  C  CG2   . VAL B  2  148 ? 9.730   115.566 6.922   1.00 80.92  ? 164 VAL B CG2   1 
ATOM   4506  N  N     . GLU B  2  149 ? 12.674  114.180 7.026   1.00 79.47  ? 165 GLU B N     1 
ATOM   4507  C  CA    . GLU B  2  149 ? 14.071  114.432 7.341   1.00 81.77  ? 165 GLU B CA    1 
ATOM   4508  C  C     . GLU B  2  149 ? 14.515  113.348 8.322   1.00 82.33  ? 165 GLU B C     1 
ATOM   4509  O  O     . GLU B  2  149 ? 13.729  112.890 9.159   1.00 81.06  ? 165 GLU B O     1 
ATOM   4510  C  CB    . GLU B  2  149 ? 14.306  115.852 7.893   1.00 82.74  ? 165 GLU B CB    1 
ATOM   4511  C  CG    . GLU B  2  149 ? 13.765  116.157 9.290   1.00 84.46  ? 165 GLU B CG    1 
ATOM   4512  C  CD    . GLU B  2  149 ? 14.253  117.505 9.825   1.00 85.00  ? 165 GLU B CD    1 
ATOM   4513  O  OE1   . GLU B  2  149 ? 13.424  118.269 10.361  1.00 84.80  ? 165 GLU B OE1   1 
ATOM   4514  O  OE2   . GLU B  2  149 ? 15.465  117.802 9.715   1.00 85.39  ? 165 GLU B OE2   1 
ATOM   4515  N  N     . ARG B  2  150 ? 15.759  112.901 8.168   1.00 83.63  ? 166 ARG B N     1 
ATOM   4516  C  CA    . ARG B  2  150 ? 16.327  111.850 9.008   1.00 85.27  ? 166 ARG B CA    1 
ATOM   4517  C  C     . ARG B  2  150 ? 16.176  112.128 10.500  1.00 84.11  ? 166 ARG B C     1 
ATOM   4518  O  O     . ARG B  2  150 ? 16.188  113.279 10.935  1.00 85.79  ? 166 ARG B O     1 
ATOM   4519  C  CB    . ARG B  2  150 ? 17.821  111.674 8.712   1.00 88.53  ? 166 ARG B CB    1 
ATOM   4520  C  CG    . ARG B  2  150 ? 18.230  111.898 7.269   1.00 94.02  ? 166 ARG B CG    1 
ATOM   4521  C  CD    . ARG B  2  150 ? 17.714  110.817 6.341   1.00 98.86  ? 166 ARG B CD    1 
ATOM   4522  N  NE    . ARG B  2  150 ? 18.104  111.087 4.959   1.00 103.85 ? 166 ARG B NE    1 
ATOM   4523  C  CZ    . ARG B  2  150 ? 18.165  110.171 3.994   1.00 106.52 ? 166 ARG B CZ    1 
ATOM   4524  N  NH1   . ARG B  2  150 ? 18.532  110.525 2.767   1.00 107.53 ? 166 ARG B NH1   1 
ATOM   4525  N  NH2   . ARG B  2  150 ? 17.869  108.901 4.254   1.00 107.69 ? 166 ARG B NH2   1 
ATOM   4526  N  N     . VAL B  2  151 ? 16.010  111.060 11.270  1.00 81.42  ? 167 VAL B N     1 
ATOM   4527  C  CA    . VAL B  2  151 ? 15.904  111.134 12.722  1.00 78.58  ? 167 VAL B CA    1 
ATOM   4528  C  C     . VAL B  2  151 ? 16.486  109.824 13.239  1.00 78.43  ? 167 VAL B C     1 
ATOM   4529  O  O     . VAL B  2  151 ? 15.857  108.768 13.128  1.00 78.38  ? 167 VAL B O     1 
ATOM   4530  C  CB    . VAL B  2  151 ? 14.452  111.267 13.219  1.00 77.60  ? 167 VAL B CB    1 
ATOM   4531  C  CG1   . VAL B  2  151 ? 14.437  111.326 14.743  1.00 76.26  ? 167 VAL B CG1   1 
ATOM   4532  C  CG2   . VAL B  2  151 ? 13.795  112.510 12.643  1.00 77.05  ? 167 VAL B CG2   1 
ATOM   4533  N  N     . SER B  2  152 ? 17.717  109.890 13.742  1.00 77.33  ? 168 SER B N     1 
ATOM   4534  C  CA    . SER B  2  152 ? 18.407  108.714 14.265  1.00 75.24  ? 168 SER B CA    1 
ATOM   4535  C  C     . SER B  2  152 ? 18.067  108.475 15.724  1.00 73.52  ? 168 SER B C     1 
ATOM   4536  O  O     . SER B  2  152 ? 17.351  109.262 16.344  1.00 72.99  ? 168 SER B O     1 
ATOM   4537  C  CB    . SER B  2  152 ? 19.920  108.879 14.132  1.00 76.27  ? 168 SER B CB    1 
ATOM   4538  O  OG    . SER B  2  152 ? 20.396  109.860 15.040  1.00 78.98  ? 168 SER B OG    1 
ATOM   4539  N  N     . LEU B  2  153 ? 18.600  107.381 16.261  1.00 72.38  ? 169 LEU B N     1 
ATOM   4540  C  CA    . LEU B  2  153 ? 18.392  107.009 17.655  1.00 71.19  ? 169 LEU B CA    1 
ATOM   4541  C  C     . LEU B  2  153 ? 19.060  108.081 18.517  1.00 72.55  ? 169 LEU B C     1 
ATOM   4542  O  O     . LEU B  2  153 ? 18.559  108.434 19.590  1.00 72.24  ? 169 LEU B O     1 
ATOM   4543  C  CB    . LEU B  2  153 ? 19.050  105.653 17.932  1.00 67.68  ? 169 LEU B CB    1 
ATOM   4544  C  CG    . LEU B  2  153 ? 18.434  104.669 18.928  1.00 64.52  ? 169 LEU B CG    1 
ATOM   4545  C  CD1   . LEU B  2  153 ? 19.553  103.924 19.611  1.00 62.69  ? 169 LEU B CD1   1 
ATOM   4546  C  CD2   . LEU B  2  153 ? 17.564  105.359 19.954  1.00 64.08  ? 169 LEU B CD2   1 
ATOM   4547  N  N     . GLN B  2  154 ? 20.184  108.604 18.021  1.00 73.53  ? 170 GLN B N     1 
ATOM   4548  C  CA    . GLN B  2  154 ? 20.948  109.635 18.716  1.00 74.83  ? 170 GLN B CA    1 
ATOM   4549  C  C     . GLN B  2  154 ? 20.179  110.956 18.813  1.00 74.39  ? 170 GLN B C     1 
ATOM   4550  O  O     . GLN B  2  154 ? 20.152  111.585 19.874  1.00 73.50  ? 170 GLN B O     1 
ATOM   4551  C  CB    . GLN B  2  154 ? 22.300  109.854 18.029  1.00 76.61  ? 170 GLN B CB    1 
ATOM   4552  C  CG    . GLN B  2  154 ? 23.306  110.650 18.863  1.00 78.27  ? 170 GLN B CG    1 
ATOM   4553  C  CD    . GLN B  2  154 ? 23.609  109.996 20.210  1.00 79.50  ? 170 GLN B CD    1 
ATOM   4554  O  OE1   . GLN B  2  154 ? 23.163  110.468 21.260  1.00 79.35  ? 170 GLN B OE1   1 
ATOM   4555  N  NE2   . GLN B  2  154 ? 24.365  108.902 20.181  1.00 79.89  ? 170 GLN B NE2   1 
ATOM   4556  N  N     . ASP B  2  155 ? 19.539  111.356 17.715  1.00 73.55  ? 171 ASP B N     1 
ATOM   4557  C  CA    . ASP B  2  155 ? 18.760  112.590 17.692  1.00 73.22  ? 171 ASP B CA    1 
ATOM   4558  C  C     . ASP B  2  155 ? 17.645  112.539 18.737  1.00 73.20  ? 171 ASP B C     1 
ATOM   4559  O  O     . ASP B  2  155 ? 17.264  113.565 19.297  1.00 74.12  ? 171 ASP B O     1 
ATOM   4560  C  CB    . ASP B  2  155 ? 18.170  112.831 16.298  1.00 72.82  ? 171 ASP B CB    1 
ATOM   4561  C  CG    . ASP B  2  155 ? 19.237  112.985 15.222  1.00 74.33  ? 171 ASP B CG    1 
ATOM   4562  O  OD1   . ASP B  2  155 ? 20.376  113.398 15.533  1.00 75.63  ? 171 ASP B OD1   1 
ATOM   4563  O  OD2   . ASP B  2  155 ? 18.937  112.697 14.048  1.00 75.07  ? 171 ASP B OD2   1 
ATOM   4564  N  N     . ILE B  2  156 ? 17.137  111.336 19.001  1.00 72.89  ? 172 ILE B N     1 
ATOM   4565  C  CA    . ILE B  2  156 ? 16.078  111.133 19.988  1.00 72.66  ? 172 ILE B CA    1 
ATOM   4566  C  C     . ILE B  2  156 ? 16.683  111.215 21.382  1.00 73.56  ? 172 ILE B C     1 
ATOM   4567  O  O     . ILE B  2  156 ? 16.002  111.568 22.344  1.00 73.58  ? 172 ILE B O     1 
ATOM   4568  C  CB    . ILE B  2  156 ? 15.398  109.745 19.832  1.00 72.25  ? 172 ILE B CB    1 
ATOM   4569  C  CG1   . ILE B  2  156 ? 14.831  109.577 18.422  1.00 71.26  ? 172 ILE B CG1   1 
ATOM   4570  C  CG2   . ILE B  2  156 ? 14.275  109.576 20.864  1.00 69.51  ? 172 ILE B CG2   1 
ATOM   4571  C  CD1   . ILE B  2  156 ? 14.210  108.213 18.182  1.00 71.13  ? 172 ILE B CD1   1 
ATOM   4572  N  N     . LYS B  2  157 ? 17.956  110.844 21.490  1.00 75.15  ? 173 LYS B N     1 
ATOM   4573  C  CA    . LYS B  2  157 ? 18.662  110.890 22.765  1.00 77.40  ? 173 LYS B CA    1 
ATOM   4574  C  C     . LYS B  2  157 ? 19.044  112.330 23.126  1.00 77.76  ? 173 LYS B C     1 
ATOM   4575  O  O     . LYS B  2  157 ? 18.880  112.750 24.276  1.00 77.16  ? 173 LYS B O     1 
ATOM   4576  C  CB    . LYS B  2  157 ? 19.900  109.989 22.734  1.00 78.82  ? 173 LYS B CB    1 
ATOM   4577  C  CG    . LYS B  2  157 ? 19.753  108.717 23.564  1.00 80.49  ? 173 LYS B CG    1 
ATOM   4578  C  CD    . LYS B  2  157 ? 20.981  107.812 23.459  1.00 83.12  ? 173 LYS B CD    1 
ATOM   4579  C  CE    . LYS B  2  157 ? 21.119  107.192 22.060  1.00 85.32  ? 173 LYS B CE    1 
ATOM   4580  N  NZ    . LYS B  2  157 ? 22.291  106.264 21.943  1.00 84.80  ? 173 LYS B NZ    1 
ATOM   4581  N  N     . ASP B  2  158 ? 19.525  113.086 22.138  1.00 77.60  ? 174 ASP B N     1 
ATOM   4582  C  CA    . ASP B  2  158 ? 19.905  114.481 22.348  1.00 78.24  ? 174 ASP B CA    1 
ATOM   4583  C  C     . ASP B  2  158 ? 18.706  115.286 22.836  1.00 79.28  ? 174 ASP B C     1 
ATOM   4584  O  O     . ASP B  2  158 ? 18.791  115.984 23.847  1.00 81.23  ? 174 ASP B O     1 
ATOM   4585  C  CB    . ASP B  2  158 ? 20.439  115.110 21.057  1.00 77.44  ? 174 ASP B CB    1 
ATOM   4586  C  CG    . ASP B  2  158 ? 21.762  114.509 20.607  1.00 78.22  ? 174 ASP B CG    1 
ATOM   4587  O  OD1   . ASP B  2  158 ? 22.471  113.898 21.441  1.00 77.62  ? 174 ASP B OD1   1 
ATOM   4588  O  OD2   . ASP B  2  158 ? 22.097  114.654 19.409  1.00 77.52  ? 174 ASP B OD2   1 
ATOM   4589  N  N     . PHE B  2  159 ? 17.583  115.161 22.131  1.00 79.20  ? 175 PHE B N     1 
ATOM   4590  C  CA    . PHE B  2  159 ? 16.362  115.880 22.484  1.00 78.29  ? 175 PHE B CA    1 
ATOM   4591  C  C     . PHE B  2  159 ? 15.853  115.494 23.869  1.00 77.93  ? 175 PHE B C     1 
ATOM   4592  O  O     . PHE B  2  159 ? 15.163  116.270 24.522  1.00 77.72  ? 175 PHE B O     1 
ATOM   4593  C  CB    . PHE B  2  159 ? 15.271  115.637 21.431  1.00 78.04  ? 175 PHE B CB    1 
ATOM   4594  C  CG    . PHE B  2  159 ? 14.035  116.477 21.632  1.00 77.05  ? 175 PHE B CG    1 
ATOM   4595  C  CD1   . PHE B  2  159 ? 14.002  117.799 21.199  1.00 76.12  ? 175 PHE B CD1   1 
ATOM   4596  C  CD2   . PHE B  2  159 ? 12.916  115.955 22.281  1.00 76.44  ? 175 PHE B CD2   1 
ATOM   4597  C  CE1   . PHE B  2  159 ? 12.879  118.589 21.411  1.00 75.59  ? 175 PHE B CE1   1 
ATOM   4598  C  CE2   . PHE B  2  159 ? 11.785  116.739 22.498  1.00 75.60  ? 175 PHE B CE2   1 
ATOM   4599  C  CZ    . PHE B  2  159 ? 11.768  118.059 22.063  1.00 75.46  ? 175 PHE B CZ    1 
ATOM   4600  N  N     . ALA B  2  160 ? 16.167  114.280 24.301  1.00 79.14  ? 176 ALA B N     1 
ATOM   4601  C  CA    . ALA B  2  160 ? 15.747  113.822 25.617  1.00 81.26  ? 176 ALA B CA    1 
ATOM   4602  C  C     . ALA B  2  160 ? 16.582  114.562 26.652  1.00 82.27  ? 176 ALA B C     1 
ATOM   4603  O  O     . ALA B  2  160 ? 16.061  115.006 27.678  1.00 82.93  ? 176 ALA B O     1 
ATOM   4604  C  CB    . ALA B  2  160 ? 15.949  112.316 25.748  1.00 81.27  ? 176 ALA B CB    1 
ATOM   4605  N  N     . ASP B  2  161 ? 17.873  114.714 26.353  1.00 82.81  ? 177 ASP B N     1 
ATOM   4606  C  CA    . ASP B  2  161 ? 18.812  115.404 27.235  1.00 84.01  ? 177 ASP B CA    1 
ATOM   4607  C  C     . ASP B  2  161 ? 18.381  116.841 27.498  1.00 84.91  ? 177 ASP B C     1 
ATOM   4608  O  O     . ASP B  2  161 ? 18.423  117.310 28.637  1.00 85.96  ? 177 ASP B O     1 
ATOM   4609  C  CB    . ASP B  2  161 ? 20.231  115.387 26.648  1.00 83.14  ? 177 ASP B CB    1 
ATOM   4610  C  CG    . ASP B  2  161 ? 20.885  114.013 26.728  1.00 83.47  ? 177 ASP B CG    1 
ATOM   4611  O  OD1   . ASP B  2  161 ? 21.724  113.708 25.851  1.00 82.52  ? 177 ASP B OD1   1 
ATOM   4612  O  OD2   . ASP B  2  161 ? 20.565  113.245 27.667  1.00 81.82  ? 177 ASP B OD2   1 
ATOM   4613  N  N     . LYS B  2  162 ? 17.957  117.532 26.444  1.00 85.33  ? 178 LYS B N     1 
ATOM   4614  C  CA    . LYS B  2  162 ? 17.509  118.913 26.561  1.00 85.30  ? 178 LYS B CA    1 
ATOM   4615  C  C     . LYS B  2  162 ? 16.232  119.019 27.381  1.00 85.09  ? 178 LYS B C     1 
ATOM   4616  O  O     . LYS B  2  162 ? 16.225  119.586 28.469  1.00 86.69  ? 178 LYS B O     1 
ATOM   4617  C  CB    . LYS B  2  162 ? 17.257  119.515 25.179  1.00 85.08  ? 178 LYS B CB    1 
ATOM   4618  C  CG    . LYS B  2  162 ? 18.503  119.694 24.324  1.00 87.56  ? 178 LYS B CG    1 
ATOM   4619  C  CD    . LYS B  2  162 ? 18.180  120.472 23.051  1.00 89.18  ? 178 LYS B CD    1 
ATOM   4620  C  CE    . LYS B  2  162 ? 17.502  121.805 23.374  1.00 89.19  ? 178 LYS B CE    1 
ATOM   4621  N  NZ    . LYS B  2  162 ? 17.242  122.621 22.160  1.00 89.98  ? 178 LYS B NZ    1 
ATOM   4622  N  N     . VAL B  2  163 ? 15.173  118.415 26.864  1.00 84.83  ? 179 VAL B N     1 
ATOM   4623  C  CA    . VAL B  2  163 ? 13.849  118.440 27.473  1.00 85.17  ? 179 VAL B CA    1 
ATOM   4624  C  C     . VAL B  2  163 ? 13.668  117.875 28.891  1.00 85.24  ? 179 VAL B C     1 
ATOM   4625  O  O     . VAL B  2  163 ? 12.929  118.447 29.693  1.00 84.05  ? 179 VAL B O     1 
ATOM   4626  C  CB    . VAL B  2  163 ? 12.827  117.793 26.504  1.00 85.56  ? 179 VAL B CB    1 
ATOM   4627  C  CG1   . VAL B  2  163 ? 11.441  117.791 27.100  1.00 85.63  ? 179 VAL B CG1   1 
ATOM   4628  C  CG2   . VAL B  2  163 ? 12.822  118.551 25.189  1.00 83.64  ? 179 VAL B CG2   1 
ATOM   4629  N  N     . TYR B  2  164 ? 14.322  116.762 29.203  1.00 86.35  ? 180 TYR B N     1 
ATOM   4630  C  CA    . TYR B  2  164 ? 14.175  116.165 30.529  1.00 88.12  ? 180 TYR B CA    1 
ATOM   4631  C  C     . TYR B  2  164 ? 15.157  116.723 31.560  1.00 88.71  ? 180 TYR B C     1 
ATOM   4632  O  O     . TYR B  2  164 ? 16.197  116.123 31.836  1.00 89.29  ? 180 TYR B O     1 
ATOM   4633  C  CB    . TYR B  2  164 ? 14.290  114.639 30.444  1.00 89.25  ? 180 TYR B CB    1 
ATOM   4634  C  CG    . TYR B  2  164 ? 13.194  113.966 29.637  1.00 90.34  ? 180 TYR B CG    1 
ATOM   4635  C  CD1   . TYR B  2  164 ? 13.387  112.697 29.092  1.00 91.04  ? 180 TYR B CD1   1 
ATOM   4636  C  CD2   . TYR B  2  164 ? 11.961  114.589 29.431  1.00 90.08  ? 180 TYR B CD2   1 
ATOM   4637  C  CE1   . TYR B  2  164 ? 12.381  112.062 28.364  1.00 91.16  ? 180 TYR B CE1   1 
ATOM   4638  C  CE2   . TYR B  2  164 ? 10.948  113.961 28.704  1.00 90.82  ? 180 TYR B CE2   1 
ATOM   4639  C  CZ    . TYR B  2  164 ? 11.166  112.698 28.174  1.00 90.81  ? 180 TYR B CZ    1 
ATOM   4640  O  OH    . TYR B  2  164 ? 10.178  112.067 27.455  1.00 90.50  ? 180 TYR B OH    1 
ATOM   4641  N  N     . THR B  2  165 ? 14.806  117.874 32.132  1.00 89.26  ? 181 THR B N     1 
ATOM   4642  C  CA    . THR B  2  165 ? 15.628  118.555 33.138  1.00 89.32  ? 181 THR B CA    1 
ATOM   4643  C  C     . THR B  2  165 ? 14.721  119.168 34.209  1.00 90.95  ? 181 THR B C     1 
ATOM   4644  O  O     . THR B  2  165 ? 13.545  119.428 33.947  1.00 90.88  ? 181 THR B O     1 
ATOM   4645  C  CB    . THR B  2  165 ? 16.468  119.693 32.509  1.00 88.00  ? 181 THR B CB    1 
ATOM   4646  O  OG1   . THR B  2  165 ? 15.598  120.651 31.897  1.00 86.50  ? 181 THR B OG1   1 
ATOM   4647  C  CG2   . THR B  2  165 ? 17.426  119.151 31.461  1.00 86.51  ? 181 THR B CG2   1 
ATOM   4648  N  N     . LYS B  2  166 ? 15.269  119.421 35.399  1.00 92.75  ? 182 LYS B N     1 
ATOM   4649  C  CA    . LYS B  2  166 ? 14.487  119.994 36.503  1.00 94.18  ? 182 LYS B CA    1 
ATOM   4650  C  C     . LYS B  2  166 ? 13.947  121.395 36.230  1.00 94.74  ? 182 LYS B C     1 
ATOM   4651  O  O     . LYS B  2  166 ? 12.936  121.801 36.810  1.00 94.41  ? 182 LYS B O     1 
ATOM   4652  C  CB    . LYS B  2  166 ? 15.290  120.017 37.808  1.00 94.38  ? 182 LYS B CB    1 
ATOM   4653  C  CG    . LYS B  2  166 ? 15.633  118.656 38.374  1.00 95.72  ? 182 LYS B CG    1 
ATOM   4654  C  CD    . LYS B  2  166 ? 16.067  118.750 39.834  1.00 96.48  ? 182 LYS B CD    1 
ATOM   4655  C  CE    . LYS B  2  166 ? 17.342  119.563 40.014  1.00 97.03  ? 182 LYS B CE    1 
ATOM   4656  N  NZ    . LYS B  2  166 ? 17.737  119.647 41.450  1.00 97.04  ? 182 LYS B NZ    1 
ATOM   4657  N  N     . GLU B  2  167 ? 14.628  122.137 35.362  1.00 95.59  ? 183 GLU B N     1 
ATOM   4658  C  CA    . GLU B  2  167 ? 14.199  123.491 35.028  1.00 97.06  ? 183 GLU B CA    1 
ATOM   4659  C  C     . GLU B  2  167 ? 13.255  123.575 33.835  1.00 96.66  ? 183 GLU B C     1 
ATOM   4660  O  O     . GLU B  2  167 ? 12.924  124.675 33.382  1.00 96.98  ? 183 GLU B O     1 
ATOM   4661  C  CB    . GLU B  2  167 ? 15.412  124.395 34.793  1.00 99.14  ? 183 GLU B CB    1 
ATOM   4662  C  CG    . GLU B  2  167 ? 16.087  124.873 36.078  1.00 103.02 ? 183 GLU B CG    1 
ATOM   4663  C  CD    . GLU B  2  167 ? 15.156  125.698 36.963  1.00 104.88 ? 183 GLU B CD    1 
ATOM   4664  O  OE1   . GLU B  2  167 ? 14.770  126.812 36.541  1.00 105.37 ? 183 GLU B OE1   1 
ATOM   4665  O  OE2   . GLU B  2  167 ? 14.806  125.227 38.071  1.00 105.43 ? 183 GLU B OE2   1 
ATOM   4666  N  N     . ASN B  2  168 ? 12.804  122.423 33.342  1.00 95.30  ? 184 ASN B N     1 
ATOM   4667  C  CA    . ASN B  2  168 ? 11.908  122.401 32.193  1.00 93.02  ? 184 ASN B CA    1 
ATOM   4668  C  C     . ASN B  2  168 ? 10.666  121.550 32.417  1.00 91.99  ? 184 ASN B C     1 
ATOM   4669  O  O     . ASN B  2  168 ? 9.852   121.398 31.512  1.00 92.04  ? 184 ASN B O     1 
ATOM   4670  C  CB    . ASN B  2  168 ? 12.659  121.927 30.942  1.00 92.38  ? 184 ASN B CB    1 
ATOM   4671  C  CG    . ASN B  2  168 ? 12.046  122.455 29.655  1.00 91.49  ? 184 ASN B CG    1 
ATOM   4672  O  OD1   . ASN B  2  168 ? 11.093  123.229 29.681  1.00 90.84  ? 184 ASN B OD1   1 
ATOM   4673  N  ND2   . ASN B  2  168 ? 12.607  122.051 28.521  1.00 91.35  ? 184 ASN B ND2   1 
ATOM   4674  N  N     . LEU B  2  169 ? 10.501  121.026 33.626  1.00 91.26  ? 185 LEU B N     1 
ATOM   4675  C  CA    . LEU B  2  169 ? 9.339   120.197 33.930  1.00 91.90  ? 185 LEU B CA    1 
ATOM   4676  C  C     . LEU B  2  169 ? 8.607   120.649 35.181  1.00 92.08  ? 185 LEU B C     1 
ATOM   4677  O  O     . LEU B  2  169 ? 9.083   121.520 35.896  1.00 92.95  ? 185 LEU B O     1 
ATOM   4678  C  CB    . LEU B  2  169 ? 9.743   118.723 34.036  1.00 91.93  ? 185 LEU B CB    1 
ATOM   4679  C  CG    . LEU B  2  169 ? 10.732  118.257 35.103  1.00 91.15  ? 185 LEU B CG    1 
ATOM   4680  C  CD1   . LEU B  2  169 ? 9.998   117.962 36.406  1.00 90.23  ? 185 LEU B CD1   1 
ATOM   4681  C  CD2   . LEU B  2  169 ? 11.436  117.004 34.605  1.00 91.18  ? 185 LEU B CD2   1 
ATOM   4682  N  N     . GLU B  2  170 ? 7.450   120.046 35.441  1.00 92.91  ? 186 GLU B N     1 
ATOM   4683  C  CA    . GLU B  2  170 ? 6.629   120.397 36.599  1.00 94.11  ? 186 GLU B CA    1 
ATOM   4684  C  C     . GLU B  2  170 ? 5.802   119.203 37.077  1.00 94.01  ? 186 GLU B C     1 
ATOM   4685  O  O     . GLU B  2  170 ? 4.924   118.727 36.358  1.00 94.72  ? 186 GLU B O     1 
ATOM   4686  C  CB    . GLU B  2  170 ? 5.652   121.523 36.233  1.00 95.76  ? 186 GLU B CB    1 
ATOM   4687  C  CG    . GLU B  2  170 ? 6.271   122.764 35.594  1.00 99.32  ? 186 GLU B CG    1 
ATOM   4688  C  CD    . GLU B  2  170 ? 5.270   123.563 34.770  1.00 101.21 ? 186 GLU B CD    1 
ATOM   4689  O  OE1   . GLU B  2  170 ? 4.084   123.633 35.167  1.00 102.33 ? 186 GLU B OE1   1 
ATOM   4690  O  OE2   . GLU B  2  170 ? 5.668   124.112 33.718  1.00 101.34 ? 186 GLU B OE2   1 
ATOM   4691  N  N     . VAL B  2  171 ? 6.065   118.735 38.293  1.00 93.60  ? 187 VAL B N     1 
ATOM   4692  C  CA    . VAL B  2  171 ? 5.309   117.620 38.860  1.00 93.21  ? 187 VAL B CA    1 
ATOM   4693  C  C     . VAL B  2  171 ? 3.938   118.149 39.289  1.00 93.62  ? 187 VAL B C     1 
ATOM   4694  O  O     . VAL B  2  171 ? 3.824   119.277 39.763  1.00 93.78  ? 187 VAL B O     1 
ATOM   4695  C  CB    . VAL B  2  171 ? 6.036   117.005 40.086  1.00 93.06  ? 187 VAL B CB    1 
ATOM   4696  C  CG1   . VAL B  2  171 ? 5.204   115.889 40.707  1.00 92.41  ? 187 VAL B CG1   1 
ATOM   4697  C  CG2   . VAL B  2  171 ? 7.404   116.478 39.680  1.00 92.66  ? 187 VAL B CG2   1 
ATOM   4698  N  N     . SER B  2  172 ? 2.902   117.339 39.099  1.00 94.47  ? 188 SER B N     1 
ATOM   4699  C  CA    . SER B  2  172 ? 1.536   117.719 39.459  1.00 94.90  ? 188 SER B CA    1 
ATOM   4700  C  C     . SER B  2  172 ? 0.736   116.486 39.857  1.00 95.40  ? 188 SER B C     1 
ATOM   4701  O  O     . SER B  2  172 ? 0.512   115.595 39.037  1.00 96.45  ? 188 SER B O     1 
ATOM   4702  C  CB    . SER B  2  172 ? 0.856   118.413 38.279  1.00 94.58  ? 188 SER B CB    1 
ATOM   4703  O  OG    . SER B  2  172 ? -0.531  118.567 38.513  1.00 94.37  ? 188 SER B OG    1 
ATOM   4704  N  N     . GLY B  2  173 ? 0.282   116.449 41.105  1.00 95.46  ? 189 GLY B N     1 
ATOM   4705  C  CA    . GLY B  2  173 ? -0.475  115.306 41.577  1.00 96.27  ? 189 GLY B CA    1 
ATOM   4706  C  C     . GLY B  2  173 ? -1.905  115.600 41.975  1.00 97.08  ? 189 GLY B C     1 
ATOM   4707  O  O     . GLY B  2  173 ? -2.156  116.381 42.884  1.00 98.39  ? 189 GLY B O     1 
ATOM   4708  N  N     . GLU B  2  174 ? -2.847  114.960 41.293  1.00 97.80  ? 190 GLU B N     1 
ATOM   4709  C  CA    . GLU B  2  174 ? -4.262  115.133 41.583  1.00 98.56  ? 190 GLU B CA    1 
ATOM   4710  C  C     . GLU B  2  174 ? -4.680  114.077 42.601  1.00 98.79  ? 190 GLU B C     1 
ATOM   4711  O  O     . GLU B  2  174 ? -4.347  112.903 42.454  1.00 100.23 ? 190 GLU B O     1 
ATOM   4712  C  CB    . GLU B  2  174 ? -5.079  114.982 40.299  1.00 100.08 ? 190 GLU B CB    1 
ATOM   4713  C  CG    . GLU B  2  174 ? -6.509  115.477 40.409  1.00 102.99 ? 190 GLU B CG    1 
ATOM   4714  C  CD    . GLU B  2  174 ? -6.585  116.945 40.793  1.00 104.92 ? 190 GLU B CD    1 
ATOM   4715  O  OE1   . GLU B  2  174 ? -6.042  117.796 40.049  1.00 104.75 ? 190 GLU B OE1   1 
ATOM   4716  O  OE2   . GLU B  2  174 ? -7.186  117.244 41.848  1.00 106.06 ? 190 GLU B OE2   1 
ATOM   4717  N  N     . ASN B  2  175 ? -5.386  114.504 43.642  1.00 98.68  ? 191 ASN B N     1 
ATOM   4718  C  CA    . ASN B  2  175 ? -5.846  113.614 44.705  1.00 98.85  ? 191 ASN B CA    1 
ATOM   4719  C  C     . ASN B  2  175 ? -4.676  113.023 45.492  1.00 99.59  ? 191 ASN B C     1 
ATOM   4720  O  O     . ASN B  2  175 ? -4.703  111.864 45.910  1.00 98.91  ? 191 ASN B O     1 
ATOM   4721  C  CB    . ASN B  2  175 ? -6.707  112.502 44.127  1.00 99.27  ? 191 ASN B CB    1 
ATOM   4722  C  CG    . ASN B  2  175 ? -7.826  112.108 45.050  1.00 100.57 ? 191 ASN B CG    1 
ATOM   4723  O  OD1   . ASN B  2  175 ? -7.647  111.299 45.965  1.00 100.71 ? 191 ASN B OD1   1 
ATOM   4724  N  ND2   . ASN B  2  175 ? -9.002  112.680 44.817  1.00 101.21 ? 191 ASN B ND2   1 
ATOM   4725  N  N     . VAL B  2  176 ? -3.670  113.861 45.725  1.00 101.13 ? 192 VAL B N     1 
ATOM   4726  C  CA    . VAL B  2  176 ? -2.462  113.471 46.442  1.00 102.50 ? 192 VAL B CA    1 
ATOM   4727  C  C     . VAL B  2  176 ? -2.138  114.459 47.566  1.00 103.42 ? 192 VAL B C     1 
ATOM   4728  O  O     . VAL B  2  176 ? -2.391  115.658 47.438  1.00 103.81 ? 192 VAL B O     1 
ATOM   4729  C  CB    . VAL B  2  176 ? -1.256  113.441 45.467  1.00 102.55 ? 192 VAL B CB    1 
ATOM   4730  C  CG1   . VAL B  2  176 ? 0.020   113.049 46.195  1.00 102.44 ? 192 VAL B CG1   1 
ATOM   4731  C  CG2   . VAL B  2  176 ? -1.534  112.493 44.311  1.00 102.55 ? 192 VAL B CG2   1 
ATOM   4732  N  N     . VAL B  2  177 ? -1.596  113.946 48.669  1.00 104.51 ? 193 VAL B N     1 
ATOM   4733  C  CA    . VAL B  2  177 ? -1.197  114.781 49.805  1.00 105.14 ? 193 VAL B CA    1 
ATOM   4734  C  C     . VAL B  2  177 ? 0.147   115.440 49.479  1.00 105.40 ? 193 VAL B C     1 
ATOM   4735  O  O     . VAL B  2  177 ? 1.186   114.775 49.448  1.00 105.90 ? 193 VAL B O     1 
ATOM   4736  C  CB    . VAL B  2  177 ? -1.067  113.957 51.112  1.00 105.20 ? 193 VAL B CB    1 
ATOM   4737  C  CG1   . VAL B  2  177 ? -2.416  113.842 51.797  1.00 105.25 ? 193 VAL B CG1   1 
ATOM   4738  C  CG2   . VAL B  2  177 ? -0.525  112.567 50.809  1.00 105.99 ? 193 VAL B CG2   1 
ATOM   4739  N  N     . GLU B  2  178 ? 0.110   116.750 49.236  1.00 105.53 ? 194 GLU B N     1 
ATOM   4740  C  CA    . GLU B  2  178 ? 1.293   117.538 48.880  1.00 105.49 ? 194 GLU B CA    1 
ATOM   4741  C  C     . GLU B  2  178 ? 2.518   117.316 49.766  1.00 105.07 ? 194 GLU B C     1 
ATOM   4742  O  O     . GLU B  2  178 ? 3.656   117.355 49.288  1.00 104.19 ? 194 GLU B O     1 
ATOM   4743  C  CB    . GLU B  2  178 ? 0.931   119.023 48.844  1.00 106.58 ? 194 GLU B CB    1 
ATOM   4744  C  CG    . GLU B  2  178 ? 1.984   119.911 48.192  1.00 108.52 ? 194 GLU B CG    1 
ATOM   4745  C  CD    . GLU B  2  178 ? 1.440   121.269 47.767  1.00 109.64 ? 194 GLU B CD    1 
ATOM   4746  O  OE1   . GLU B  2  178 ? 2.246   122.120 47.330  1.00 109.74 ? 194 GLU B OE1   1 
ATOM   4747  O  OE2   . GLU B  2  178 ? 0.209   121.487 47.854  1.00 109.99 ? 194 GLU B OE2   1 
ATOM   4748  N  N     . ALA B  2  179 ? 2.279   117.086 51.055  1.00 104.97 ? 195 ALA B N     1 
ATOM   4749  C  CA    . ALA B  2  179 ? 3.358   116.847 52.009  1.00 104.65 ? 195 ALA B CA    1 
ATOM   4750  C  C     . ALA B  2  179 ? 4.183   115.644 51.564  1.00 103.67 ? 195 ALA B C     1 
ATOM   4751  O  O     . ALA B  2  179 ? 5.402   115.737 51.403  1.00 103.48 ? 195 ALA B O     1 
ATOM   4752  C  CB    . ALA B  2  179 ? 2.782   116.607 53.404  1.00 105.41 ? 195 ALA B CB    1 
ATOM   4753  N  N     . ASP B  2  180 ? 3.497   114.528 51.336  1.00 102.49 ? 196 ASP B N     1 
ATOM   4754  C  CA    . ASP B  2  180 ? 4.137   113.297 50.900  1.00 101.11 ? 196 ASP B CA    1 
ATOM   4755  C  C     . ASP B  2  180 ? 4.686   113.390 49.480  1.00 99.83  ? 196 ASP B C     1 
ATOM   4756  O  O     . ASP B  2  180 ? 5.761   112.864 49.194  1.00 99.43  ? 196 ASP B O     1 
ATOM   4757  C  CB    . ASP B  2  180 ? 3.163   112.124 51.012  1.00 101.39 ? 196 ASP B CB    1 
ATOM   4758  C  CG    . ASP B  2  180 ? 2.880   111.737 52.451  1.00 102.07 ? 196 ASP B CG    1 
ATOM   4759  O  OD1   . ASP B  2  180 ? 1.692   111.597 52.808  1.00 101.43 ? 196 ASP B OD1   1 
ATOM   4760  O  OD2   . ASP B  2  180 ? 3.849   111.563 53.225  1.00 103.27 ? 196 ASP B OD2   1 
ATOM   4761  N  N     . LEU B  2  181 ? 3.960   114.071 48.598  1.00 98.58  ? 197 LEU B N     1 
ATOM   4762  C  CA    . LEU B  2  181 ? 4.402   114.214 47.217  1.00 98.37  ? 197 LEU B CA    1 
ATOM   4763  C  C     . LEU B  2  181 ? 5.754   114.920 47.138  1.00 98.65  ? 197 LEU B C     1 
ATOM   4764  O  O     . LEU B  2  181 ? 6.682   114.409 46.510  1.00 98.97  ? 197 LEU B O     1 
ATOM   4765  C  CB    . LEU B  2  181 ? 3.357   114.955 46.379  1.00 97.65  ? 197 LEU B CB    1 
ATOM   4766  C  CG    . LEU B  2  181 ? 3.666   115.107 44.886  1.00 97.05  ? 197 LEU B CG    1 
ATOM   4767  C  CD1   . LEU B  2  181 ? 3.930   113.753 44.256  1.00 97.55  ? 197 LEU B CD1   1 
ATOM   4768  C  CD2   . LEU B  2  181 ? 2.515   115.795 44.192  1.00 96.93  ? 197 LEU B CD2   1 
ATOM   4769  N  N     . LYS B  2  182 ? 5.877   116.068 47.804  1.00 99.04  ? 198 LYS B N     1 
ATOM   4770  C  CA    . LYS B  2  182 ? 7.133   116.821 47.803  1.00 98.70  ? 198 LYS B CA    1 
ATOM   4771  C  C     . LYS B  2  182 ? 8.261   116.004 48.416  1.00 97.00  ? 198 LYS B C     1 
ATOM   4772  O  O     . LYS B  2  182 ? 9.391   116.014 47.926  1.00 95.29  ? 198 LYS B O     1 
ATOM   4773  C  CB    . LYS B  2  182 ? 6.974   118.152 48.546  1.00 100.80 ? 198 LYS B CB    1 
ATOM   4774  C  CG    . LYS B  2  182 ? 6.301   119.230 47.713  1.00 102.90 ? 198 LYS B CG    1 
ATOM   4775  C  CD    . LYS B  2  182 ? 6.233   120.568 48.423  1.00 104.28 ? 198 LYS B CD    1 
ATOM   4776  C  CE    . LYS B  2  182 ? 5.652   121.624 47.489  1.00 106.01 ? 198 LYS B CE    1 
ATOM   4777  N  NZ    . LYS B  2  182 ? 5.371   122.921 48.167  1.00 107.38 ? 198 LYS B NZ    1 
ATOM   4778  N  N     . ARG B  2  183 ? 7.925   115.273 49.471  1.00 95.93  ? 199 ARG B N     1 
ATOM   4779  C  CA    . ARG B  2  183 ? 8.870   114.417 50.177  1.00 96.06  ? 199 ARG B CA    1 
ATOM   4780  C  C     . ARG B  2  183 ? 9.440   113.334 49.251  1.00 95.50  ? 199 ARG B C     1 
ATOM   4781  O  O     . ARG B  2  183 ? 10.655  113.115 49.211  1.00 95.65  ? 199 ARG B O     1 
ATOM   4782  C  CB    . ARG B  2  183 ? 8.159   113.782 51.378  1.00 96.98  ? 199 ARG B CB    1 
ATOM   4783  C  CG    . ARG B  2  183 ? 8.887   112.636 52.050  1.00 98.24  ? 199 ARG B CG    1 
ATOM   4784  C  CD    . ARG B  2  183 ? 7.982   111.995 53.088  1.00 99.63  ? 199 ARG B CD    1 
ATOM   4785  N  NE    . ARG B  2  183 ? 8.415   110.643 53.427  1.00 101.87 ? 199 ARG B NE    1 
ATOM   4786  C  CZ    . ARG B  2  183 ? 7.604   109.682 53.864  1.00 102.48 ? 199 ARG B CZ    1 
ATOM   4787  N  NH1   . ARG B  2  183 ? 8.094   108.481 54.142  1.00 102.43 ? 199 ARG B NH1   1 
ATOM   4788  N  NH2   . ARG B  2  183 ? 6.306   109.917 54.022  1.00 102.19 ? 199 ARG B NH2   1 
ATOM   4789  N  N     . PHE B  2  184 ? 8.557   112.691 48.484  1.00 93.88  ? 200 PHE B N     1 
ATOM   4790  C  CA    . PHE B  2  184 ? 8.945   111.623 47.565  1.00 91.19  ? 200 PHE B CA    1 
ATOM   4791  C  C     . PHE B  2  184 ? 9.659   112.079 46.296  1.00 91.12  ? 200 PHE B C     1 
ATOM   4792  O  O     . PHE B  2  184 ? 10.554  111.386 45.811  1.00 90.23  ? 200 PHE B O     1 
ATOM   4793  C  CB    . PHE B  2  184 ? 7.738   110.750 47.226  1.00 88.13  ? 200 PHE B CB    1 
ATOM   4794  C  CG    . PHE B  2  184 ? 7.265   109.903 48.377  1.00 85.38  ? 200 PHE B CG    1 
ATOM   4795  C  CD1   . PHE B  2  184 ? 5.912   109.820 48.691  1.00 84.38  ? 200 PHE B CD1   1 
ATOM   4796  C  CD2   . PHE B  2  184 ? 8.173   109.189 49.151  1.00 84.57  ? 200 PHE B CD2   1 
ATOM   4797  C  CE1   . PHE B  2  184 ? 5.468   109.040 49.763  1.00 82.98  ? 200 PHE B CE1   1 
ATOM   4798  C  CE2   . PHE B  2  184 ? 7.739   108.408 50.223  1.00 84.14  ? 200 PHE B CE2   1 
ATOM   4799  C  CZ    . PHE B  2  184 ? 6.380   108.334 50.528  1.00 82.58  ? 200 PHE B CZ    1 
ATOM   4800  N  N     . VAL B  2  185 ? 9.266   113.231 45.759  1.00 91.60  ? 201 VAL B N     1 
ATOM   4801  C  CA    . VAL B  2  185 ? 9.902   113.770 44.557  1.00 93.36  ? 201 VAL B CA    1 
ATOM   4802  C  C     . VAL B  2  185 ? 11.374  114.062 44.847  1.00 96.18  ? 201 VAL B C     1 
ATOM   4803  O  O     . VAL B  2  185 ? 12.247  113.817 44.013  1.00 97.45  ? 201 VAL B O     1 
ATOM   4804  C  CB    . VAL B  2  185 ? 9.228   115.081 44.083  1.00 92.16  ? 201 VAL B CB    1 
ATOM   4805  C  CG1   . VAL B  2  185 ? 9.979   115.666 42.897  1.00 91.46  ? 201 VAL B CG1   1 
ATOM   4806  C  CG2   . VAL B  2  185 ? 7.784   114.830 43.706  1.00 91.85  ? 201 VAL B CG2   1 
ATOM   4807  N  N     . ASP B  2  186 ? 11.639  114.586 46.042  1.00 98.93  ? 202 ASP B N     1 
ATOM   4808  C  CA    . ASP B  2  186 ? 12.996  114.916 46.460  1.00 100.49 ? 202 ASP B CA    1 
ATOM   4809  C  C     . ASP B  2  186 ? 13.764  113.677 46.893  1.00 100.91 ? 202 ASP B C     1 
ATOM   4810  O  O     . ASP B  2  186 ? 14.985  113.621 46.762  1.00 101.29 ? 202 ASP B O     1 
ATOM   4811  C  CB    . ASP B  2  186 ? 12.966  115.963 47.580  1.00 101.37 ? 202 ASP B CB    1 
ATOM   4812  C  CG    . ASP B  2  186 ? 12.540  117.335 47.075  1.00 102.22 ? 202 ASP B CG    1 
ATOM   4813  O  OD1   . ASP B  2  186 ? 13.376  118.023 46.449  1.00 101.66 ? 202 ASP B OD1   1 
ATOM   4814  O  OD2   . ASP B  2  186 ? 11.366  117.717 47.280  1.00 102.33 ? 202 ASP B OD2   1 
ATOM   4815  N  N     . GLU B  2  187 ? 13.034  112.679 47.379  1.00 101.94 ? 203 GLU B N     1 
ATOM   4816  C  CA    . GLU B  2  187 ? 13.619  111.416 47.824  1.00 103.21 ? 203 GLU B CA    1 
ATOM   4817  C  C     . GLU B  2  187 ? 13.887  110.494 46.623  1.00 103.43 ? 203 GLU B C     1 
ATOM   4818  O  O     . GLU B  2  187 ? 14.559  109.468 46.753  1.00 103.33 ? 203 GLU B O     1 
ATOM   4819  C  CB    . GLU B  2  187 ? 12.661  110.737 48.806  1.00 104.28 ? 203 GLU B CB    1 
ATOM   4820  C  CG    . GLU B  2  187 ? 13.229  109.549 49.561  1.00 107.30 ? 203 GLU B CG    1 
ATOM   4821  C  CD    . GLU B  2  187 ? 12.185  108.872 50.433  1.00 109.53 ? 203 GLU B CD    1 
ATOM   4822  O  OE1   . GLU B  2  187 ? 11.564  109.562 51.277  1.00 110.07 ? 203 GLU B OE1   1 
ATOM   4823  O  OE2   . GLU B  2  187 ? 11.977  107.650 50.267  1.00 110.88 ? 203 GLU B OE2   1 
ATOM   4824  N  N     . SER B  2  188 ? 13.373  110.883 45.456  1.00 103.63 ? 204 SER B N     1 
ATOM   4825  C  CA    . SER B  2  188 ? 13.528  110.113 44.222  1.00 103.14 ? 204 SER B CA    1 
ATOM   4826  C  C     . SER B  2  188 ? 14.710  110.572 43.369  1.00 102.95 ? 204 SER B C     1 
ATOM   4827  O  O     . SER B  2  188 ? 15.637  111.214 43.861  1.00 103.01 ? 204 SER B O     1 
ATOM   4828  C  CB    . SER B  2  188 ? 12.246  110.197 43.387  1.00 102.92 ? 204 SER B CB    1 
ATOM   4829  O  OG    . SER B  2  188 ? 12.119  111.469 42.771  1.00 101.27 ? 204 SER B OG    1 
ATOM   4830  N  N     . LEU B  2  189 ? 14.662  110.220 42.086  1.00 103.11 ? 205 LEU B N     1 
ATOM   4831  C  CA    . LEU B  2  189 ? 15.701  110.580 41.124  1.00 103.20 ? 205 LEU B CA    1 
ATOM   4832  C  C     . LEU B  2  189 ? 15.352  111.862 40.386  1.00 103.11 ? 205 LEU B C     1 
ATOM   4833  O  O     . LEU B  2  189 ? 16.107  112.300 39.516  1.00 102.14 ? 205 LEU B O     1 
ATOM   4834  C  CB    . LEU B  2  189 ? 15.916  109.460 40.096  1.00 103.68 ? 205 LEU B CB    1 
ATOM   4835  C  CG    . LEU B  2  189 ? 16.603  108.147 40.483  1.00 104.10 ? 205 LEU B CG    1 
ATOM   4836  C  CD1   . LEU B  2  189 ? 15.749  107.343 41.459  1.00 104.95 ? 205 LEU B CD1   1 
ATOM   4837  C  CD2   . LEU B  2  189 ? 16.846  107.338 39.223  1.00 104.71 ? 205 LEU B CD2   1 
ATOM   4838  N  N     . LEU B  2  190 ? 14.197  112.444 40.702  1.00 103.98 ? 206 LEU B N     1 
ATOM   4839  C  CA    . LEU B  2  190 ? 13.776  113.683 40.053  1.00 105.67 ? 206 LEU B CA    1 
ATOM   4840  C  C     . LEU B  2  190 ? 14.805  114.777 40.311  1.00 106.73 ? 206 LEU B C     1 
ATOM   4841  O  O     . LEU B  2  190 ? 15.238  115.463 39.384  1.00 106.61 ? 206 LEU B O     1 
ATOM   4842  C  CB    . LEU B  2  190 ? 12.408  114.142 40.569  1.00 105.94 ? 206 LEU B CB    1 
ATOM   4843  C  CG    . LEU B  2  190 ? 11.145  113.885 39.734  1.00 106.51 ? 206 LEU B CG    1 
ATOM   4844  C  CD1   . LEU B  2  190 ? 11.341  114.391 38.311  1.00 105.54 ? 206 LEU B CD1   1 
ATOM   4845  C  CD2   . LEU B  2  190 ? 10.798  112.416 39.736  1.00 106.48 ? 206 LEU B CD2   1 
ATOM   4846  N  N     . SER B  2  191 ? 15.218  114.892 41.572  1.00 107.87 ? 207 SER B N     1 
ATOM   4847  C  CA    . SER B  2  191 ? 16.196  115.889 42.010  1.00 108.14 ? 207 SER B CA    1 
ATOM   4848  C  C     . SER B  2  191 ? 17.615  115.683 41.467  1.00 108.26 ? 207 SER B C     1 
ATOM   4849  O  O     . SER B  2  191 ? 18.431  116.605 41.498  1.00 108.27 ? 207 SER B O     1 
ATOM   4850  C  CB    . SER B  2  191 ? 16.225  115.952 43.539  1.00 108.33 ? 207 SER B CB    1 
ATOM   4851  O  OG    . SER B  2  191 ? 16.451  114.670 44.101  1.00 107.90 ? 207 SER B OG    1 
ATOM   4852  N  N     . THR B  2  192 ? 17.905  114.480 40.979  1.00 108.41 ? 208 THR B N     1 
ATOM   4853  C  CA    . THR B  2  192 ? 19.222  114.168 40.427  1.00 108.30 ? 208 THR B CA    1 
ATOM   4854  C  C     . THR B  2  192 ? 19.322  114.628 38.968  1.00 108.50 ? 208 THR B C     1 
ATOM   4855  O  O     . THR B  2  192 ? 20.419  114.771 38.426  1.00 108.43 ? 208 THR B O     1 
ATOM   4856  C  CB    . THR B  2  192 ? 19.525  112.649 40.527  1.00 108.41 ? 208 THR B CB    1 
ATOM   4857  O  OG1   . THR B  2  192 ? 19.367  112.220 41.887  1.00 107.82 ? 208 THR B OG1   1 
ATOM   4858  C  CG2   . THR B  2  192 ? 20.952  112.343 40.074  1.00 107.78 ? 208 THR B CG2   1 
ATOM   4859  N  N     . LEU B  2  193 ? 18.170  114.875 38.347  1.00 109.09 ? 209 LEU B N     1 
ATOM   4860  C  CA    . LEU B  2  193 ? 18.108  115.327 36.957  1.00 109.78 ? 209 LEU B CA    1 
ATOM   4861  C  C     . LEU B  2  193 ? 18.872  116.629 36.749  1.00 109.89 ? 209 LEU B C     1 
ATOM   4862  O  O     . LEU B  2  193 ? 18.581  117.638 37.389  1.00 109.85 ? 209 LEU B O     1 
ATOM   4863  C  CB    . LEU B  2  193 ? 16.653  115.525 36.525  1.00 110.02 ? 209 LEU B CB    1 
ATOM   4864  C  CG    . LEU B  2  193 ? 15.811  114.289 36.213  1.00 109.71 ? 209 LEU B CG    1 
ATOM   4865  C  CD1   . LEU B  2  193 ? 14.355  114.683 36.061  1.00 109.85 ? 209 LEU B CD1   1 
ATOM   4866  C  CD2   . LEU B  2  193 ? 16.321  113.633 34.944  1.00 109.52 ? 209 LEU B CD2   1 
ATOM   4867  N  N     . PRO B  2  194 ? 19.851  116.624 35.835  1.00 110.37 ? 210 PRO B N     1 
ATOM   4868  C  CA    . PRO B  2  194 ? 20.665  117.805 35.534  1.00 111.50 ? 210 PRO B CA    1 
ATOM   4869  C  C     . PRO B  2  194 ? 19.818  118.976 35.043  1.00 112.19 ? 210 PRO B C     1 
ATOM   4870  O  O     . PRO B  2  194 ? 19.618  119.146 33.843  1.00 112.64 ? 210 PRO B O     1 
ATOM   4871  C  CB    . PRO B  2  194 ? 21.619  117.291 34.451  1.00 111.60 ? 210 PRO B CB    1 
ATOM   4872  C  CG    . PRO B  2  194 ? 20.830  116.200 33.786  1.00 111.15 ? 210 PRO B CG    1 
ATOM   4873  C  CD    . PRO B  2  194 ? 20.221  115.496 34.965  1.00 110.53 ? 210 PRO B CD    1 
ATOM   4874  N  N     . ALA B  2  195 ? 19.335  119.781 35.990  1.00 113.10 ? 211 ALA B N     1 
ATOM   4875  C  CA    . ALA B  2  195 ? 18.488  120.942 35.704  1.00 113.98 ? 211 ALA B CA    1 
ATOM   4876  C  C     . ALA B  2  195 ? 19.112  121.953 34.748  1.00 114.30 ? 211 ALA B C     1 
ATOM   4877  O  O     . ALA B  2  195 ? 19.953  122.759 35.144  1.00 114.56 ? 211 ALA B O     1 
ATOM   4878  C  CB    . ALA B  2  195 ? 18.097  121.627 37.000  1.00 113.87 ? 211 ALA B CB    1 
ATOM   4879  N  N     . GLY B  2  196 ? 18.676  121.912 33.493  1.00 114.73 ? 212 GLY B N     1 
ATOM   4880  C  CA    . GLY B  2  196 ? 19.193  122.823 32.489  1.00 115.54 ? 212 GLY B CA    1 
ATOM   4881  C  C     . GLY B  2  196 ? 18.391  124.106 32.429  1.00 116.42 ? 212 GLY B C     1 
ATOM   4882  O  O     . GLY B  2  196 ? 18.143  124.735 33.455  1.00 116.75 ? 212 GLY B O     1 
ATOM   4883  N  N     . LYS B  2  197 ? 17.978  124.487 31.224  1.00 117.32 ? 213 LYS B N     1 
ATOM   4884  C  CA    . LYS B  2  197 ? 17.198  125.704 31.022  1.00 118.22 ? 213 LYS B CA    1 
ATOM   4885  C  C     . LYS B  2  197 ? 15.733  125.426 30.710  1.00 118.55 ? 213 LYS B C     1 
ATOM   4886  O  O     . LYS B  2  197 ? 15.355  124.305 30.368  1.00 118.88 ? 213 LYS B O     1 
ATOM   4887  C  CB    . LYS B  2  197 ? 17.787  126.531 29.878  1.00 118.51 ? 213 LYS B CB    1 
ATOM   4888  C  CG    . LYS B  2  197 ? 19.188  127.052 30.115  1.00 119.55 ? 213 LYS B CG    1 
ATOM   4889  C  CD    . LYS B  2  197 ? 19.627  127.919 28.951  1.00 120.74 ? 213 LYS B CD    1 
ATOM   4890  C  CE    . LYS B  2  197 ? 20.974  128.567 29.220  1.00 121.78 ? 213 LYS B CE    1 
ATOM   4891  N  NZ    . LYS B  2  197 ? 21.353  129.507 28.127  1.00 122.58 ? 213 LYS B NZ    1 
ATOM   4892  N  N     . SER B  2  198 ? 14.917  126.468 30.835  1.00 118.99 ? 214 SER B N     1 
ATOM   4893  C  CA    . SER B  2  198 ? 13.494  126.395 30.540  1.00 119.43 ? 214 SER B CA    1 
ATOM   4894  C  C     . SER B  2  198 ? 13.334  127.045 29.172  1.00 120.45 ? 214 SER B C     1 
ATOM   4895  O  O     . SER B  2  198 ? 13.734  128.195 28.985  1.00 120.28 ? 214 SER B O     1 
ATOM   4896  C  CB    . SER B  2  198 ? 12.698  127.176 31.587  1.00 118.48 ? 214 SER B CB    1 
ATOM   4897  O  OG    . SER B  2  198 ? 11.310  127.119 31.321  1.00 117.89 ? 214 SER B OG    1 
ATOM   4898  N  N     . LEU B  2  199 ? 12.781  126.309 28.212  1.00 121.84 ? 215 LEU B N     1 
ATOM   4899  C  CA    . LEU B  2  199 ? 12.606  126.842 26.862  1.00 123.60 ? 215 LEU B CA    1 
ATOM   4900  C  C     . LEU B  2  199 ? 11.329  127.662 26.685  1.00 124.41 ? 215 LEU B C     1 
ATOM   4901  O  O     . LEU B  2  199 ? 11.015  128.106 25.579  1.00 124.29 ? 215 LEU B O     1 
ATOM   4902  C  CB    . LEU B  2  199 ? 12.675  125.713 25.828  1.00 124.07 ? 215 LEU B CB    1 
ATOM   4903  C  CG    . LEU B  2  199 ? 13.685  125.919 24.690  1.00 124.63 ? 215 LEU B CG    1 
ATOM   4904  C  CD1   . LEU B  2  199 ? 13.865  124.628 23.911  1.00 124.75 ? 215 LEU B CD1   1 
ATOM   4905  C  CD2   . LEU B  2  199 ? 13.246  127.057 23.769  1.00 124.53 ? 215 LEU B CD2   1 
ATOM   4906  N  N     . VAL B  2  200 ? 10.620  127.895 27.787  1.00 126.03 ? 216 VAL B N     1 
ATOM   4907  C  CA    . VAL B  2  200 ? 9.377   128.666 27.769  1.00 128.01 ? 216 VAL B CA    1 
ATOM   4908  C  C     . VAL B  2  200 ? 9.655   130.150 27.520  1.00 129.24 ? 216 VAL B C     1 
ATOM   4909  O  O     . VAL B  2  200 ? 9.859   130.915 28.463  1.00 129.56 ? 216 VAL B O     1 
ATOM   4910  C  CB    . VAL B  2  200 ? 8.611   128.533 29.112  1.00 127.79 ? 216 VAL B CB    1 
ATOM   4911  C  CG1   . VAL B  2  200 ? 7.184   129.039 28.962  1.00 127.82 ? 216 VAL B CG1   1 
ATOM   4912  C  CG2   . VAL B  2  200 ? 8.627   127.097 29.595  1.00 128.33 ? 216 VAL B CG2   1 
ATOM   4913  N  N     . SER B  2  201 ? 9.679   130.551 26.251  1.00 130.81 ? 217 SER B N     1 
ATOM   4914  C  CA    . SER B  2  201 ? 9.926   131.947 25.896  1.00 132.40 ? 217 SER B CA    1 
ATOM   4915  C  C     . SER B  2  201 ? 8.634   132.753 26.043  1.00 133.97 ? 217 SER B C     1 
ATOM   4916  O  O     . SER B  2  201 ? 7.559   132.287 25.658  1.00 134.57 ? 217 SER B O     1 
ATOM   4917  C  CB    . SER B  2  201 ? 10.458  132.050 24.463  1.00 131.50 ? 217 SER B CB    1 
ATOM   4918  O  OG    . SER B  2  201 ? 10.870  133.372 24.164  1.00 130.87 ? 217 SER B OG    1 
ATOM   4919  N  N     . LYS B  2  202 ? 8.741   133.951 26.615  1.00 135.58 ? 218 LYS B N     1 
ATOM   4920  C  CA    . LYS B  2  202 ? 7.577   134.812 26.824  1.00 136.79 ? 218 LYS B CA    1 
ATOM   4921  C  C     . LYS B  2  202 ? 7.247   135.721 25.634  1.00 136.84 ? 218 LYS B C     1 
ATOM   4922  O  O     . LYS B  2  202 ? 6.098   136.141 25.468  1.00 136.63 ? 218 LYS B O     1 
ATOM   4923  C  CB    . LYS B  2  202 ? 7.748   135.640 28.104  1.00 137.58 ? 218 LYS B CB    1 
ATOM   4924  C  CG    . LYS B  2  202 ? 6.548   136.526 28.431  1.00 138.97 ? 218 LYS B CG    1 
ATOM   4925  C  CD    . LYS B  2  202 ? 6.660   137.164 29.807  1.00 139.79 ? 218 LYS B CD    1 
ATOM   4926  C  CE    . LYS B  2  202 ? 6.515   136.131 30.915  1.00 140.26 ? 218 LYS B CE    1 
ATOM   4927  N  NZ    . LYS B  2  202 ? 6.561   136.761 32.265  1.00 140.01 ? 218 LYS B NZ    1 
ATOM   4928  N  N     . SER B  2  203 ? 8.249   136.020 24.810  1.00 136.96 ? 219 SER B N     1 
ATOM   4929  C  CA    . SER B  2  203 ? 8.045   136.869 23.638  1.00 137.09 ? 219 SER B CA    1 
ATOM   4930  C  C     . SER B  2  203 ? 7.047   136.221 22.682  1.00 137.35 ? 219 SER B C     1 
ATOM   4931  O  O     . SER B  2  203 ? 7.212   135.066 22.285  1.00 137.75 ? 219 SER B O     1 
ATOM   4932  C  CB    . SER B  2  203 ? 9.373   137.131 22.919  1.00 136.60 ? 219 SER B CB    1 
ATOM   4933  O  OG    . SER B  2  203 ? 9.974   135.927 22.478  1.00 136.28 ? 219 SER B OG    1 
ATOM   4934  N  N     . GLU B  2  204 ? 6.005   136.971 22.334  1.00 137.25 ? 220 GLU B N     1 
ATOM   4935  C  CA    . GLU B  2  204 ? 4.957   136.490 21.438  1.00 137.19 ? 220 GLU B CA    1 
ATOM   4936  C  C     . GLU B  2  204 ? 5.500   135.970 20.109  1.00 136.12 ? 220 GLU B C     1 
ATOM   4937  O  O     . GLU B  2  204 ? 6.389   136.577 19.509  1.00 135.94 ? 220 GLU B O     1 
ATOM   4938  C  CB    . GLU B  2  204 ? 3.941   137.603 21.186  1.00 138.44 ? 220 GLU B CB    1 
ATOM   4939  C  CG    . GLU B  2  204 ? 3.235   138.078 22.444  1.00 140.26 ? 220 GLU B CG    1 
ATOM   4940  C  CD    . GLU B  2  204 ? 2.330   139.269 22.198  1.00 141.56 ? 220 GLU B CD    1 
ATOM   4941  O  OE1   . GLU B  2  204 ? 1.331   139.122 21.460  1.00 142.35 ? 220 GLU B OE1   1 
ATOM   4942  O  OE2   . GLU B  2  204 ? 2.617   140.353 22.750  1.00 141.86 ? 220 GLU B OE2   1 
ATOM   4943  N  N     . PRO B  2  205 ? 4.979   134.821 19.645  1.00 135.12 ? 221 PRO B N     1 
ATOM   4944  C  CA    . PRO B  2  205 ? 5.404   134.207 18.384  1.00 134.26 ? 221 PRO B CA    1 
ATOM   4945  C  C     . PRO B  2  205 ? 5.100   135.155 17.232  1.00 133.20 ? 221 PRO B C     1 
ATOM   4946  O  O     . PRO B  2  205 ? 4.028   135.763 17.196  1.00 133.57 ? 221 PRO B O     1 
ATOM   4947  C  CB    . PRO B  2  205 ? 4.526   132.956 18.303  1.00 134.92 ? 221 PRO B CB    1 
ATOM   4948  C  CG    . PRO B  2  205 ? 4.229   132.642 19.740  1.00 134.99 ? 221 PRO B CG    1 
ATOM   4949  C  CD    . PRO B  2  205 ? 3.943   134.003 20.298  1.00 134.96 ? 221 PRO B CD    1 
ATOM   4950  N  N     . LYS B  2  206 ? 6.046   135.301 16.309  1.00 131.43 ? 222 LYS B N     1 
ATOM   4951  C  CA    . LYS B  2  206 ? 5.845   136.188 15.171  1.00 130.07 ? 222 LYS B CA    1 
ATOM   4952  C  C     . LYS B  2  206 ? 4.886   135.553 14.164  1.00 128.42 ? 222 LYS B C     1 
ATOM   4953  O  O     . LYS B  2  206 ? 5.310   134.815 13.275  1.00 128.83 ? 222 LYS B O     1 
ATOM   4954  C  CB    . LYS B  2  206 ? 7.180   136.510 14.493  1.00 130.98 ? 222 LYS B CB    1 
ATOM   4955  C  CG    . LYS B  2  206 ? 7.107   137.716 13.564  1.00 132.76 ? 222 LYS B CG    1 
ATOM   4956  C  CD    . LYS B  2  206 ? 8.346   137.863 12.694  1.00 133.65 ? 222 LYS B CD    1 
ATOM   4957  C  CE    . LYS B  2  206 ? 8.413   136.766 11.646  1.00 133.96 ? 222 LYS B CE    1 
ATOM   4958  N  NZ    . LYS B  2  206 ? 9.494   137.019 10.658  1.00 134.64 ? 222 LYS B NZ    1 
ATOM   4959  N  N     . PHE B  2  207 ? 3.595   135.841 14.310  1.00 126.15 ? 223 PHE B N     1 
ATOM   4960  C  CA    . PHE B  2  207 ? 2.587   135.285 13.414  1.00 124.19 ? 223 PHE B CA    1 
ATOM   4961  C  C     . PHE B  2  207 ? 2.348   136.072 12.134  1.00 121.93 ? 223 PHE B C     1 
ATOM   4962  O  O     . PHE B  2  207 ? 2.703   137.245 12.035  1.00 121.77 ? 223 PHE B O     1 
ATOM   4963  C  CB    . PHE B  2  207 ? 1.262   135.037 14.150  1.00 126.00 ? 223 PHE B CB    1 
ATOM   4964  C  CG    . PHE B  2  207 ? 0.792   136.191 14.998  1.00 127.64 ? 223 PHE B CG    1 
ATOM   4965  C  CD1   . PHE B  2  207 ? 0.298   137.358 14.414  1.00 128.50 ? 223 PHE B CD1   1 
ATOM   4966  C  CD2   . PHE B  2  207 ? 0.805   136.092 16.390  1.00 128.48 ? 223 PHE B CD2   1 
ATOM   4967  C  CE1   . PHE B  2  207 ? -0.176  138.408 15.203  1.00 128.56 ? 223 PHE B CE1   1 
ATOM   4968  C  CE2   . PHE B  2  207 ? 0.334   137.134 17.188  1.00 129.13 ? 223 PHE B CE2   1 
ATOM   4969  C  CZ    . PHE B  2  207 ? -0.159  138.294 16.593  1.00 129.15 ? 223 PHE B CZ    1 
ATOM   4970  N  N     . PHE B  2  208 ? 1.758   135.396 11.152  1.00 119.37 ? 224 PHE B N     1 
ATOM   4971  C  CA    . PHE B  2  208 ? 1.452   135.988 9.854   1.00 116.81 ? 224 PHE B CA    1 
ATOM   4972  C  C     . PHE B  2  208 ? -0.055  136.039 9.635   1.00 115.72 ? 224 PHE B C     1 
ATOM   4973  O  O     . PHE B  2  208 ? -0.819  135.466 10.415  1.00 115.04 ? 224 PHE B O     1 
ATOM   4974  C  CB    . PHE B  2  208 ? 2.132   135.196 8.737   1.00 115.36 ? 224 PHE B CB    1 
ATOM   4975  C  CG    . PHE B  2  208 ? 3.633   135.233 8.800   1.00 114.72 ? 224 PHE B CG    1 
ATOM   4976  C  CD1   . PHE B  2  208 ? 4.314   134.659 9.871   1.00 113.86 ? 224 PHE B CD1   1 
ATOM   4977  C  CD2   . PHE B  2  208 ? 4.368   135.861 7.801   1.00 114.61 ? 224 PHE B CD2   1 
ATOM   4978  C  CE1   . PHE B  2  208 ? 5.704   134.708 9.947   1.00 113.65 ? 224 PHE B CE1   1 
ATOM   4979  C  CE2   . PHE B  2  208 ? 5.763   135.915 7.866   1.00 114.44 ? 224 PHE B CE2   1 
ATOM   4980  C  CZ    . PHE B  2  208 ? 6.430   135.338 8.943   1.00 114.02 ? 224 PHE B CZ    1 
ATOM   4981  N  N     . LEU B  2  209 ? -0.478  136.740 8.585   1.00 114.78 ? 225 LEU B N     1 
ATOM   4982  C  CA    . LEU B  2  209 ? -1.900  136.885 8.269   1.00 113.84 ? 225 LEU B CA    1 
ATOM   4983  C  C     . LEU B  2  209 ? -2.169  136.950 6.767   1.00 112.93 ? 225 LEU B C     1 
ATOM   4984  O  O     . LEU B  2  209 ? -1.273  137.268 5.980   1.00 112.77 ? 225 LEU B O     1 
ATOM   4985  C  CB    . LEU B  2  209 ? -2.465  138.136 8.948   1.00 114.11 ? 225 LEU B CB    1 
ATOM   4986  C  CG    . LEU B  2  209 ? -2.589  138.103 10.473  1.00 114.49 ? 225 LEU B CG    1 
ATOM   4987  C  CD1   . LEU B  2  209 ? -2.838  139.498 11.015  1.00 114.91 ? 225 LEU B CD1   1 
ATOM   4988  C  CD2   . LEU B  2  209 ? -3.703  137.154 10.876  1.00 114.37 ? 225 LEU B CD2   1 
ATOM   4989  N  N     . GLY B  2  210 ? -3.410  136.651 6.385   1.00 111.59 ? 226 GLY B N     1 
ATOM   4990  C  CA    . GLY B  2  210 ? -3.792  136.669 4.983   1.00 110.38 ? 226 GLY B CA    1 
ATOM   4991  C  C     . GLY B  2  210 ? -3.121  135.573 4.173   1.00 110.10 ? 226 GLY B C     1 
ATOM   4992  O  O     . GLY B  2  210 ? -2.906  135.729 2.969   1.00 109.62 ? 226 GLY B O     1 
ATOM   4993  N  N     . GLU B  2  211 ? -2.783  134.469 4.842   1.00 109.88 ? 227 GLU B N     1 
ATOM   4994  C  CA    . GLU B  2  211 ? -2.128  133.320 4.208   1.00 108.83 ? 227 GLU B CA    1 
ATOM   4995  C  C     . GLU B  2  211 ? -3.128  132.187 3.983   1.00 107.87 ? 227 GLU B C     1 
ATOM   4996  O  O     . GLU B  2  211 ? -4.048  131.995 4.784   1.00 106.85 ? 227 GLU B O     1 
ATOM   4997  C  CB    . GLU B  2  211 ? -0.978  132.813 5.087   1.00 108.83 ? 227 GLU B CB    1 
ATOM   4998  C  CG    . GLU B  2  211 ? 0.195   133.774 5.233   1.00 108.63 ? 227 GLU B CG    1 
ATOM   4999  C  CD    . GLU B  2  211 ? 1.181   133.680 4.083   1.00 108.59 ? 227 GLU B CD    1 
ATOM   5000  O  OE1   . GLU B  2  211 ? 2.270   133.103 4.284   1.00 108.64 ? 227 GLU B OE1   1 
ATOM   5001  O  OE2   . GLU B  2  211 ? 0.872   134.184 2.982   1.00 108.76 ? 227 GLU B OE2   1 
ATOM   5002  N  N     . GLU B  2  212 ? -2.938  131.435 2.899   1.00 107.07 ? 228 GLU B N     1 
ATOM   5003  C  CA    . GLU B  2  212 ? -3.830  130.321 2.582   1.00 106.10 ? 228 GLU B CA    1 
ATOM   5004  C  C     . GLU B  2  212 ? -3.134  129.124 1.931   1.00 105.09 ? 228 GLU B C     1 
ATOM   5005  O  O     . GLU B  2  212 ? -2.155  129.283 1.191   1.00 105.00 ? 228 GLU B O     1 
ATOM   5006  C  CB    . GLU B  2  212 ? -4.990  130.786 1.694   1.00 105.98 ? 228 GLU B CB    1 
ATOM   5007  C  CG    . GLU B  2  212 ? -4.598  131.162 0.271   1.00 105.54 ? 228 GLU B CG    1 
ATOM   5008  C  CD    . GLU B  2  212 ? -5.745  131.005 -0.718  1.00 105.93 ? 228 GLU B CD    1 
ATOM   5009  O  OE1   . GLU B  2  212 ? -5.582  131.425 -1.884  1.00 106.60 ? 228 GLU B OE1   1 
ATOM   5010  O  OE2   . GLU B  2  212 ? -6.805  130.452 -0.342  1.00 104.73 ? 228 GLU B OE2   1 
ATOM   5011  N  N     . ASN B  2  213 ? -3.667  127.930 2.194   1.00 103.56 ? 229 ASN B N     1 
ATOM   5012  C  CA    . ASN B  2  213 ? -3.119  126.693 1.641   1.00 101.19 ? 229 ASN B CA    1 
ATOM   5013  C  C     . ASN B  2  213 ? -4.233  125.734 1.219   1.00 99.29  ? 229 ASN B C     1 
ATOM   5014  O  O     . ASN B  2  213 ? -5.246  125.606 1.910   1.00 98.41  ? 229 ASN B O     1 
ATOM   5015  C  CB    . ASN B  2  213 ? -2.207  126.013 2.664   1.00 101.57 ? 229 ASN B CB    1 
ATOM   5016  C  CG    . ASN B  2  213 ? -1.132  125.172 2.011   1.00 101.57 ? 229 ASN B CG    1 
ATOM   5017  O  OD1   . ASN B  2  213 ? -1.068  125.069 0.786   1.00 101.41 ? 229 ASN B OD1   1 
ATOM   5018  N  ND2   . ASN B  2  213 ? -0.266  124.585 2.824   1.00 102.29 ? 229 ASN B ND2   1 
ATOM   5019  N  N     . ARG B  2  214 ? -4.029  125.052 0.093   1.00 97.10  ? 230 ARG B N     1 
ATOM   5020  C  CA    . ARG B  2  214 ? -5.019  124.113 -0.446  1.00 94.63  ? 230 ARG B CA    1 
ATOM   5021  C  C     . ARG B  2  214 ? -4.448  122.701 -0.618  1.00 93.03  ? 230 ARG B C     1 
ATOM   5022  O  O     . ARG B  2  214 ? -3.423  122.519 -1.280  1.00 92.65  ? 230 ARG B O     1 
ATOM   5023  C  CB    . ARG B  2  214 ? -5.522  124.623 -1.804  1.00 94.11  ? 230 ARG B CB    1 
ATOM   5024  C  CG    . ARG B  2  214 ? -5.856  126.112 -1.823  1.00 92.08  ? 230 ARG B CG    1 
ATOM   5025  C  CD    . ARG B  2  214 ? -6.138  126.632 -3.227  1.00 89.68  ? 230 ARG B CD    1 
ATOM   5026  N  NE    . ARG B  2  214 ? -7.438  126.217 -3.750  1.00 87.30  ? 230 ARG B NE    1 
ATOM   5027  C  CZ    . ARG B  2  214 ? -8.610  126.520 -3.196  1.00 85.83  ? 230 ARG B CZ    1 
ATOM   5028  N  NH1   . ARG B  2  214 ? -9.732  126.099 -3.758  1.00 84.73  ? 230 ARG B NH1   1 
ATOM   5029  N  NH2   . ARG B  2  214 ? -8.668  127.228 -2.076  1.00 85.53  ? 230 ARG B NH2   1 
ATOM   5030  N  N     . VAL B  2  215 ? -5.115  121.704 -0.037  1.00 91.07  ? 231 VAL B N     1 
ATOM   5031  C  CA    . VAL B  2  215 ? -4.660  120.315 -0.145  1.00 89.08  ? 231 VAL B CA    1 
ATOM   5032  C  C     . VAL B  2  215 ? -5.738  119.372 -0.688  1.00 87.45  ? 231 VAL B C     1 
ATOM   5033  O  O     . VAL B  2  215 ? -6.838  119.271 -0.132  1.00 86.33  ? 231 VAL B O     1 
ATOM   5034  C  CB    . VAL B  2  215 ? -4.178  119.759 1.212   1.00 89.35  ? 231 VAL B CB    1 
ATOM   5035  C  CG1   . VAL B  2  215 ? -3.527  118.398 1.018   1.00 88.97  ? 231 VAL B CG1   1 
ATOM   5036  C  CG2   . VAL B  2  215 ? -3.208  120.722 1.869   1.00 90.50  ? 231 VAL B CG2   1 
ATOM   5037  N  N     . ARG B  2  216 ? -5.404  118.678 -1.773  1.00 85.60  ? 232 ARG B N     1 
ATOM   5038  C  CA    . ARG B  2  216 ? -6.310  117.722 -2.405  1.00 83.55  ? 232 ARG B CA    1 
ATOM   5039  C  C     . ARG B  2  216 ? -6.434  116.501 -1.483  1.00 82.75  ? 232 ARG B C     1 
ATOM   5040  O  O     . ARG B  2  216 ? -5.439  116.033 -0.918  1.00 81.88  ? 232 ARG B O     1 
ATOM   5041  C  CB    . ARG B  2  216 ? -5.760  117.315 -3.771  1.00 82.97  ? 232 ARG B CB    1 
ATOM   5042  C  CG    . ARG B  2  216 ? -5.146  118.472 -4.544  1.00 83.62  ? 232 ARG B CG    1 
ATOM   5043  C  CD    . ARG B  2  216 ? -4.648  118.063 -5.924  1.00 85.51  ? 232 ARG B CD    1 
ATOM   5044  N  NE    . ARG B  2  216 ? -5.631  118.340 -6.973  1.00 87.52  ? 232 ARG B NE    1 
ATOM   5045  C  CZ    . ARG B  2  216 ? -6.667  117.559 -7.262  1.00 88.22  ? 232 ARG B CZ    1 
ATOM   5046  N  NH1   . ARG B  2  216 ? -7.512  117.893 -8.227  1.00 88.20  ? 232 ARG B NH1   1 
ATOM   5047  N  NH2   . ARG B  2  216 ? -6.853  116.431 -6.597  1.00 89.56  ? 232 ARG B NH2   1 
ATOM   5048  N  N     . PHE B  2  217 ? -7.653  115.990 -1.338  1.00 81.49  ? 233 PHE B N     1 
ATOM   5049  C  CA    . PHE B  2  217 ? -7.909  114.856 -0.455  1.00 80.28  ? 233 PHE B CA    1 
ATOM   5050  C  C     . PHE B  2  217 ? -9.118  114.044 -0.928  1.00 79.90  ? 233 PHE B C     1 
ATOM   5051  O  O     . PHE B  2  217 ? -10.062 114.593 -1.502  1.00 79.89  ? 233 PHE B O     1 
ATOM   5052  C  CB    . PHE B  2  217 ? -8.139  115.394 0.967   1.00 79.68  ? 233 PHE B CB    1 
ATOM   5053  C  CG    . PHE B  2  217 ? -8.378  114.333 2.014   1.00 79.91  ? 233 PHE B CG    1 
ATOM   5054  C  CD1   . PHE B  2  217 ? -7.308  113.726 2.669   1.00 79.72  ? 233 PHE B CD1   1 
ATOM   5055  C  CD2   . PHE B  2  217 ? -9.677  113.994 2.399   1.00 79.30  ? 233 PHE B CD2   1 
ATOM   5056  C  CE1   . PHE B  2  217 ? -7.530  112.802 3.696   1.00 78.81  ? 233 PHE B CE1   1 
ATOM   5057  C  CE2   . PHE B  2  217 ? -9.907  113.073 3.424   1.00 78.07  ? 233 PHE B CE2   1 
ATOM   5058  C  CZ    . PHE B  2  217 ? -8.833  112.478 4.072   1.00 77.99  ? 233 PHE B CZ    1 
ATOM   5059  N  N     . ILE B  2  218 ? -9.062  112.731 -0.711  1.00 78.76  ? 234 ILE B N     1 
ATOM   5060  C  CA    . ILE B  2  218 ? -10.146 111.828 -1.084  1.00 76.91  ? 234 ILE B CA    1 
ATOM   5061  C  C     . ILE B  2  218 ? -10.937 111.468 0.180   1.00 77.43  ? 234 ILE B C     1 
ATOM   5062  O  O     . ILE B  2  218 ? -10.499 110.646 0.990   1.00 78.27  ? 234 ILE B O     1 
ATOM   5063  C  CB    . ILE B  2  218 ? -9.602  110.546 -1.760  1.00 74.98  ? 234 ILE B CB    1 
ATOM   5064  C  CG1   . ILE B  2  218 ? -8.766  110.920 -2.984  1.00 74.53  ? 234 ILE B CG1   1 
ATOM   5065  C  CG2   . ILE B  2  218 ? -10.744 109.646 -2.179  1.00 74.12  ? 234 ILE B CG2   1 
ATOM   5066  C  CD1   . ILE B  2  218 ? -8.151  109.747 -3.703  1.00 73.36  ? 234 ILE B CD1   1 
ATOM   5067  N  N     . GLY B  2  219 ? -12.075 112.133 0.361   1.00 77.04  ? 235 GLY B N     1 
ATOM   5068  C  CA    . GLY B  2  219 ? -12.925 111.900 1.518   1.00 77.33  ? 235 GLY B CA    1 
ATOM   5069  C  C     . GLY B  2  219 ? -13.854 113.085 1.704   1.00 77.87  ? 235 GLY B C     1 
ATOM   5070  O  O     . GLY B  2  219 ? -14.390 113.608 0.725   1.00 78.29  ? 235 GLY B O     1 
ATOM   5071  N  N     . ASP B  2  220 ? -14.067 113.500 2.951   1.00 77.79  ? 236 ASP B N     1 
ATOM   5072  C  CA    . ASP B  2  220 ? -14.919 114.656 3.232   1.00 77.08  ? 236 ASP B CA    1 
ATOM   5073  C  C     . ASP B  2  220 ? -14.147 115.951 2.974   1.00 76.78  ? 236 ASP B C     1 
ATOM   5074  O  O     . ASP B  2  220 ? -12.933 116.015 3.195   1.00 75.93  ? 236 ASP B O     1 
ATOM   5075  C  CB    . ASP B  2  220 ? -15.396 114.648 4.688   1.00 77.49  ? 236 ASP B CB    1 
ATOM   5076  C  CG    . ASP B  2  220 ? -16.495 113.632 4.948   1.00 79.69  ? 236 ASP B CG    1 
ATOM   5077  O  OD1   . ASP B  2  220 ? -17.018 113.614 6.086   1.00 79.21  ? 236 ASP B OD1   1 
ATOM   5078  O  OD2   . ASP B  2  220 ? -16.841 112.855 4.028   1.00 81.33  ? 236 ASP B OD2   1 
ATOM   5079  N  N     . SER B  2  221 ? -14.851 116.972 2.487   1.00 76.32  ? 237 SER B N     1 
ATOM   5080  C  CA    . SER B  2  221 ? -14.238 118.269 2.217   1.00 74.70  ? 237 SER B CA    1 
ATOM   5081  C  C     . SER B  2  221 ? -14.311 119.155 3.452   1.00 74.32  ? 237 SER B C     1 
ATOM   5082  O  O     . SER B  2  221 ? -15.279 119.103 4.216   1.00 73.02  ? 237 SER B O     1 
ATOM   5083  C  CB    . SER B  2  221 ? -14.915 118.953 1.030   1.00 73.36  ? 237 SER B CB    1 
ATOM   5084  O  OG    . SER B  2  221 ? -14.601 118.286 -0.179  1.00 72.74  ? 237 SER B OG    1 
ATOM   5085  N  N     . VAL B  2  222 ? -13.268 119.950 3.659   1.00 75.10  ? 238 VAL B N     1 
ATOM   5086  C  CA    . VAL B  2  222 ? -13.222 120.837 4.812   1.00 76.78  ? 238 VAL B CA    1 
ATOM   5087  C  C     . VAL B  2  222 ? -12.565 122.182 4.521   1.00 77.98  ? 238 VAL B C     1 
ATOM   5088  O  O     . VAL B  2  222 ? -11.515 122.258 3.870   1.00 78.46  ? 238 VAL B O     1 
ATOM   5089  C  CB    . VAL B  2  222 ? -12.508 120.169 6.017   1.00 75.90  ? 238 VAL B CB    1 
ATOM   5090  C  CG1   . VAL B  2  222 ? -11.075 119.838 5.664   1.00 75.68  ? 238 VAL B CG1   1 
ATOM   5091  C  CG2   . VAL B  2  222 ? -12.554 121.078 7.236   1.00 74.94  ? 238 VAL B CG2   1 
ATOM   5092  N  N     . ALA B  2  223 ? -13.227 123.240 4.983   1.00 78.58  ? 239 ALA B N     1 
ATOM   5093  C  CA    . ALA B  2  223 ? -12.743 124.606 4.837   1.00 79.04  ? 239 ALA B CA    1 
ATOM   5094  C  C     . ALA B  2  223 ? -12.593 125.134 6.255   1.00 79.41  ? 239 ALA B C     1 
ATOM   5095  O  O     . ALA B  2  223 ? -13.508 125.006 7.073   1.00 78.52  ? 239 ALA B O     1 
ATOM   5096  C  CB    . ALA B  2  223 ? -13.743 125.438 4.062   1.00 79.38  ? 239 ALA B CB    1 
ATOM   5097  N  N     . ALA B  2  224 ? -11.428 125.691 6.559   1.00 80.85  ? 240 ALA B N     1 
ATOM   5098  C  CA    . ALA B  2  224 ? -11.180 126.204 7.900   1.00 82.94  ? 240 ALA B CA    1 
ATOM   5099  C  C     . ALA B  2  224 ? -10.423 127.528 7.921   1.00 83.88  ? 240 ALA B C     1 
ATOM   5100  O  O     . ALA B  2  224 ? -9.631  127.822 7.020   1.00 83.95  ? 240 ALA B O     1 
ATOM   5101  C  CB    . ALA B  2  224 ? -10.430 125.158 8.718   1.00 82.81  ? 240 ALA B CB    1 
ATOM   5102  N  N     . ILE B  2  225 ? -10.678 128.321 8.960   1.00 85.07  ? 241 ILE B N     1 
ATOM   5103  C  CA    . ILE B  2  225 ? -10.017 129.614 9.132   1.00 86.83  ? 241 ILE B CA    1 
ATOM   5104  C  C     . ILE B  2  225 ? -9.225  129.653 10.439  1.00 87.77  ? 241 ILE B C     1 
ATOM   5105  O  O     . ILE B  2  225 ? -9.681  129.146 11.468  1.00 87.42  ? 241 ILE B O     1 
ATOM   5106  C  CB    . ILE B  2  225 ? -11.026 130.799 9.107   1.00 86.69  ? 241 ILE B CB    1 
ATOM   5107  C  CG1   . ILE B  2  225 ? -12.069 130.645 10.216  1.00 86.08  ? 241 ILE B CG1   1 
ATOM   5108  C  CG2   . ILE B  2  225 ? -11.696 130.897 7.741   1.00 87.14  ? 241 ILE B CG2   1 
ATOM   5109  C  CD1   . ILE B  2  225 ? -12.937 131.859 10.407  1.00 85.09  ? 241 ILE B CD1   1 
ATOM   5110  N  N     . GLY B  2  226 ? -8.035  130.248 10.389  1.00 89.45  ? 242 GLY B N     1 
ATOM   5111  C  CA    . GLY B  2  226 ? -7.193  130.344 11.573  1.00 92.22  ? 242 GLY B CA    1 
ATOM   5112  C  C     . GLY B  2  226 ? -6.855  131.777 11.945  1.00 93.53  ? 242 GLY B C     1 
ATOM   5113  O  O     . GLY B  2  226 ? -6.357  132.535 11.108  1.00 93.64  ? 242 GLY B O     1 
ATOM   5114  N  N     . ILE B  2  227 ? -7.084  132.137 13.209  1.00 94.96  ? 243 ILE B N     1 
ATOM   5115  C  CA    . ILE B  2  227 ? -6.830  133.499 13.686  1.00 96.43  ? 243 ILE B CA    1 
ATOM   5116  C  C     . ILE B  2  227 ? -5.905  133.592 14.906  1.00 96.87  ? 243 ILE B C     1 
ATOM   5117  O  O     . ILE B  2  227 ? -6.220  133.074 15.981  1.00 95.57  ? 243 ILE B O     1 
ATOM   5118  C  CB    . ILE B  2  227 ? -8.161  134.216 14.040  1.00 96.75  ? 243 ILE B CB    1 
ATOM   5119  C  CG1   . ILE B  2  227 ? -9.109  134.201 12.840  1.00 97.20  ? 243 ILE B CG1   1 
ATOM   5120  C  CG2   . ILE B  2  227 ? -7.892  135.652 14.469  1.00 96.72  ? 243 ILE B CG2   1 
ATOM   5121  C  CD1   . ILE B  2  227 ? -10.476 134.768 13.136  1.00 97.85  ? 243 ILE B CD1   1 
ATOM   5122  N  N     . PRO B  2  228 ? -4.755  134.275 14.754  1.00 97.96  ? 244 PRO B N     1 
ATOM   5123  C  CA    . PRO B  2  228 ? -3.769  134.461 15.827  1.00 99.69  ? 244 PRO B CA    1 
ATOM   5124  C  C     . PRO B  2  228 ? -4.312  135.433 16.877  1.00 102.33 ? 244 PRO B C     1 
ATOM   5125  O  O     . PRO B  2  228 ? -4.738  136.538 16.534  1.00 103.14 ? 244 PRO B O     1 
ATOM   5126  C  CB    . PRO B  2  228 ? -2.582  135.088 15.094  1.00 97.83  ? 244 PRO B CB    1 
ATOM   5127  C  CG    . PRO B  2  228 ? -2.758  134.646 13.678  1.00 97.65  ? 244 PRO B CG    1 
ATOM   5128  C  CD    . PRO B  2  228 ? -4.232  134.795 13.481  1.00 97.37  ? 244 PRO B CD    1 
ATOM   5129  N  N     . VAL B  2  229 ? -4.309  135.030 18.146  1.00 104.67 ? 245 VAL B N     1 
ATOM   5130  C  CA    . VAL B  2  229 ? -4.805  135.906 19.209  1.00 107.54 ? 245 VAL B CA    1 
ATOM   5131  C  C     . VAL B  2  229 ? -3.692  136.476 20.101  1.00 110.02 ? 245 VAL B C     1 
ATOM   5132  O  O     . VAL B  2  229 ? -2.546  136.011 20.062  1.00 110.39 ? 245 VAL B O     1 
ATOM   5133  C  CB    . VAL B  2  229 ? -5.887  135.213 20.076  1.00 106.73 ? 245 VAL B CB    1 
ATOM   5134  C  CG1   . VAL B  2  229 ? -6.964  134.623 19.188  1.00 107.29 ? 245 VAL B CG1   1 
ATOM   5135  C  CG2   . VAL B  2  229 ? -5.274  134.150 20.961  1.00 107.34 ? 245 VAL B CG2   1 
ATOM   5136  N  N     . ASN B  2  230 ? -4.036  137.503 20.879  1.00 112.23 ? 246 ASN B N     1 
ATOM   5137  C  CA    . ASN B  2  230 ? -3.090  138.166 21.780  1.00 114.08 ? 246 ASN B CA    1 
ATOM   5138  C  C     . ASN B  2  230 ? -3.067  137.523 23.162  1.00 114.80 ? 246 ASN B C     1 
ATOM   5139  O  O     . ASN B  2  230 ? -3.951  136.737 23.506  1.00 114.83 ? 246 ASN B O     1 
ATOM   5140  C  CB    . ASN B  2  230 ? -3.440  139.653 21.922  1.00 115.02 ? 246 ASN B CB    1 
ATOM   5141  C  CG    . ASN B  2  230 ? -3.402  140.395 20.597  1.00 116.19 ? 246 ASN B CG    1 
ATOM   5142  O  OD1   . ASN B  2  230 ? -2.503  141.201 20.350  1.00 116.22 ? 246 ASN B OD1   1 
ATOM   5143  N  ND2   . ASN B  2  230 ? -4.386  140.133 19.739  1.00 116.03 ? 246 ASN B ND2   1 
ATOM   5144  N  N     . LYS B  2  231 ? -2.067  137.887 23.958  1.00 115.89 ? 247 LYS B N     1 
ATOM   5145  C  CA    . LYS B  2  231 ? -1.919  137.353 25.308  1.00 117.32 ? 247 LYS B CA    1 
ATOM   5146  C  C     . LYS B  2  231 ? -3.097  137.719 26.210  1.00 118.22 ? 247 LYS B C     1 
ATOM   5147  O  O     . LYS B  2  231 ? -3.430  136.977 27.135  1.00 118.56 ? 247 LYS B O     1 
ATOM   5148  C  CB    . LYS B  2  231 ? -0.614  137.847 25.942  1.00 117.60 ? 247 LYS B CB    1 
ATOM   5149  C  CG    . LYS B  2  231 ? 0.637   137.505 25.147  1.00 118.64 ? 247 LYS B CG    1 
ATOM   5150  C  CD    . LYS B  2  231 ? 1.912   137.756 25.949  1.00 119.09 ? 247 LYS B CD    1 
ATOM   5151  C  CE    . LYS B  2  231 ? 2.038   136.786 27.121  1.00 119.32 ? 247 LYS B CE    1 
ATOM   5152  N  NZ    . LYS B  2  231 ? 3.345   136.915 27.824  1.00 119.34 ? 247 LYS B NZ    1 
ATOM   5153  N  N     . ALA B  2  232 ? -3.728  138.859 25.935  1.00 118.97 ? 248 ALA B N     1 
ATOM   5154  C  CA    . ALA B  2  232 ? -4.864  139.326 26.729  1.00 119.31 ? 248 ALA B CA    1 
ATOM   5155  C  C     . ALA B  2  232 ? -6.179  139.289 25.957  1.00 119.25 ? 248 ALA B C     1 
ATOM   5156  O  O     . ALA B  2  232 ? -7.252  139.172 26.552  1.00 119.17 ? 248 ALA B O     1 
ATOM   5157  C  CB    . ALA B  2  232 ? -4.598  140.739 27.248  1.00 119.14 ? 248 ALA B CB    1 
ATOM   5158  N  N     . SER B  2  233 ? -6.087  139.371 24.631  1.00 119.17 ? 249 SER B N     1 
ATOM   5159  C  CA    . SER B  2  233 ? -7.262  139.363 23.759  1.00 118.92 ? 249 SER B CA    1 
ATOM   5160  C  C     . SER B  2  233 ? -7.835  137.957 23.492  1.00 118.30 ? 249 SER B C     1 
ATOM   5161  O  O     . SER B  2  233 ? -8.666  137.774 22.597  1.00 117.87 ? 249 SER B O     1 
ATOM   5162  C  CB    . SER B  2  233 ? -6.914  140.053 22.435  1.00 118.73 ? 249 SER B CB    1 
ATOM   5163  O  OG    . SER B  2  233 ? -8.080  140.413 21.717  1.00 119.83 ? 249 SER B OG    1 
ATOM   5164  N  N     . LEU B  2  234 ? -7.417  136.977 24.291  1.00 117.55 ? 250 LEU B N     1 
ATOM   5165  C  CA    . LEU B  2  234 ? -7.881  135.601 24.122  1.00 116.43 ? 250 LEU B CA    1 
ATOM   5166  C  C     . LEU B  2  234 ? -9.190  135.277 24.849  1.00 115.22 ? 250 LEU B C     1 
ATOM   5167  O  O     . LEU B  2  234 ? -9.930  134.384 24.430  1.00 115.99 ? 250 LEU B O     1 
ATOM   5168  C  CB    . LEU B  2  234 ? -6.784  134.606 24.536  1.00 116.73 ? 250 LEU B CB    1 
ATOM   5169  C  CG    . LEU B  2  234 ? -6.510  134.314 26.017  1.00 117.17 ? 250 LEU B CG    1 
ATOM   5170  C  CD1   . LEU B  2  234 ? -5.396  133.284 26.129  1.00 116.66 ? 250 LEU B CD1   1 
ATOM   5171  C  CD2   . LEU B  2  234 ? -6.140  135.584 26.769  1.00 118.13 ? 250 LEU B CD2   1 
ATOM   5172  N  N     . ALA B  2  235 ? -9.481  136.004 25.925  1.00 112.97 ? 251 ALA B N     1 
ATOM   5173  C  CA    . ALA B  2  235 ? -10.698 135.768 26.696  1.00 110.56 ? 251 ALA B CA    1 
ATOM   5174  C  C     . ALA B  2  235 ? -11.979 136.073 25.926  1.00 109.03 ? 251 ALA B C     1 
ATOM   5175  O  O     . ALA B  2  235 ? -13.035 135.522 26.240  1.00 108.26 ? 251 ALA B O     1 
ATOM   5176  C  CB    . ALA B  2  235 ? -10.662 136.549 27.990  1.00 110.61 ? 251 ALA B CB    1 
ATOM   5177  N  N     . GLN B  2  236 ? -11.894 136.961 24.935  1.00 107.49 ? 252 GLN B N     1 
ATOM   5178  C  CA    . GLN B  2  236 ? -13.066 137.298 24.128  1.00 106.08 ? 252 GLN B CA    1 
ATOM   5179  C  C     . GLN B  2  236 ? -13.293 136.186 23.108  1.00 105.04 ? 252 GLN B C     1 
ATOM   5180  O  O     . GLN B  2  236 ? -14.420 135.724 22.921  1.00 104.78 ? 252 GLN B O     1 
ATOM   5181  C  CB    . GLN B  2  236 ? -12.903 138.652 23.413  1.00 105.82 ? 252 GLN B CB    1 
ATOM   5182  C  CG    . GLN B  2  236 ? -11.884 138.683 22.271  1.00 105.99 ? 252 GLN B CG    1 
ATOM   5183  C  CD    . GLN B  2  236 ? -12.121 139.824 21.286  1.00 105.46 ? 252 GLN B CD    1 
ATOM   5184  O  OE1   . GLN B  2  236 ? -11.175 140.420 20.764  1.00 105.26 ? 252 GLN B OE1   1 
ATOM   5185  N  NE2   . GLN B  2  236 ? -13.386 140.119 21.015  1.00 104.26 ? 252 GLN B NE2   1 
ATOM   5186  N  N     . TYR B  2  237 ? -12.205 135.742 22.479  1.00 103.38 ? 253 TYR B N     1 
ATOM   5187  C  CA    . TYR B  2  237 ? -12.255 134.677 21.485  1.00 101.28 ? 253 TYR B CA    1 
ATOM   5188  C  C     . TYR B  2  237 ? -12.814 133.385 22.073  1.00 100.54 ? 253 TYR B C     1 
ATOM   5189  O  O     . TYR B  2  237 ? -13.452 132.609 21.369  1.00 101.01 ? 253 TYR B O     1 
ATOM   5190  C  CB    . TYR B  2  237 ? -10.866 134.435 20.891  1.00 99.88  ? 253 TYR B CB    1 
ATOM   5191  C  CG    . TYR B  2  237 ? -10.502 135.384 19.769  1.00 99.09  ? 253 TYR B CG    1 
ATOM   5192  C  CD1   . TYR B  2  237 ? -10.020 136.667 20.035  1.00 98.37  ? 253 TYR B CD1   1 
ATOM   5193  C  CD2   . TYR B  2  237 ? -10.633 134.994 18.434  1.00 98.24  ? 253 TYR B CD2   1 
ATOM   5194  C  CE1   . TYR B  2  237 ? -9.676  137.539 18.995  1.00 97.70  ? 253 TYR B CE1   1 
ATOM   5195  C  CE2   . TYR B  2  237 ? -10.292 135.856 17.390  1.00 98.06  ? 253 TYR B CE2   1 
ATOM   5196  C  CZ    . TYR B  2  237 ? -9.815  137.127 17.676  1.00 97.56  ? 253 TYR B CZ    1 
ATOM   5197  O  OH    . TYR B  2  237 ? -9.481  137.978 16.644  1.00 96.02  ? 253 TYR B OH    1 
ATOM   5198  N  N     . GLU B  2  238 ? -12.587 133.172 23.366  1.00 99.64  ? 254 GLU B N     1 
ATOM   5199  C  CA    . GLU B  2  238 ? -13.085 131.983 24.049  1.00 99.62  ? 254 GLU B CA    1 
ATOM   5200  C  C     . GLU B  2  238 ? -14.613 131.951 24.055  1.00 99.16  ? 254 GLU B C     1 
ATOM   5201  O  O     . GLU B  2  238 ? -15.213 130.906 23.807  1.00 99.09  ? 254 GLU B O     1 
ATOM   5202  C  CB    . GLU B  2  238 ? -12.561 131.935 25.485  1.00 100.70 ? 254 GLU B CB    1 
ATOM   5203  C  CG    . GLU B  2  238 ? -11.663 130.742 25.797  1.00 103.11 ? 254 GLU B CG    1 
ATOM   5204  C  CD    . GLU B  2  238 ? -12.399 129.409 25.791  1.00 104.09 ? 254 GLU B CD    1 
ATOM   5205  O  OE1   . GLU B  2  238 ? -13.285 129.209 26.654  1.00 104.07 ? 254 GLU B OE1   1 
ATOM   5206  O  OE2   . GLU B  2  238 ? -12.079 128.555 24.933  1.00 104.78 ? 254 GLU B OE2   1 
ATOM   5207  N  N     . VAL B  2  239 ? -15.237 133.097 24.330  1.00 98.86  ? 255 VAL B N     1 
ATOM   5208  C  CA    . VAL B  2  239 ? -16.699 133.189 24.355  1.00 97.73  ? 255 VAL B CA    1 
ATOM   5209  C  C     . VAL B  2  239 ? -17.236 133.054 22.934  1.00 96.38  ? 255 VAL B C     1 
ATOM   5210  O  O     . VAL B  2  239 ? -18.324 132.523 22.727  1.00 95.91  ? 255 VAL B O     1 
ATOM   5211  C  CB    . VAL B  2  239 ? -17.205 134.522 24.995  1.00 98.77  ? 255 VAL B CB    1 
ATOM   5212  C  CG1   . VAL B  2  239 ? -16.284 134.950 26.132  1.00 98.58  ? 255 VAL B CG1   1 
ATOM   5213  C  CG2   . VAL B  2  239 ? -17.350 135.631 23.951  1.00 98.64  ? 255 VAL B CG2   1 
ATOM   5214  N  N     . LEU B  2  240 ? -16.458 133.544 21.970  1.00 94.81  ? 256 LEU B N     1 
ATOM   5215  C  CA    . LEU B  2  240 ? -16.805 133.473 20.556  1.00 94.07  ? 256 LEU B CA    1 
ATOM   5216  C  C     . LEU B  2  240 ? -16.891 132.004 20.154  1.00 95.29  ? 256 LEU B C     1 
ATOM   5217  O  O     . LEU B  2  240 ? -17.833 131.586 19.478  1.00 95.91  ? 256 LEU B O     1 
ATOM   5218  C  CB    . LEU B  2  240 ? -15.727 134.170 19.724  1.00 91.89  ? 256 LEU B CB    1 
ATOM   5219  C  CG    . LEU B  2  240 ? -15.707 133.906 18.218  1.00 90.79  ? 256 LEU B CG    1 
ATOM   5220  C  CD1   . LEU B  2  240 ? -16.948 134.476 17.561  1.00 91.33  ? 256 LEU B CD1   1 
ATOM   5221  C  CD2   . LEU B  2  240 ? -14.458 134.513 17.614  1.00 90.35  ? 256 LEU B CD2   1 
ATOM   5222  N  N     . ALA B  2  241 ? -15.898 131.231 20.584  1.00 95.83  ? 257 ALA B N     1 
ATOM   5223  C  CA    . ALA B  2  241 ? -15.834 129.805 20.300  1.00 96.10  ? 257 ALA B CA    1 
ATOM   5224  C  C     . ALA B  2  241 ? -17.066 129.104 20.864  1.00 96.54  ? 257 ALA B C     1 
ATOM   5225  O  O     . ALA B  2  241 ? -17.693 128.298 20.178  1.00 97.00  ? 257 ALA B O     1 
ATOM   5226  C  CB    . ALA B  2  241 ? -14.564 129.210 20.893  1.00 96.12  ? 257 ALA B CB    1 
ATOM   5227  N  N     . ASN B  2  242 ? -17.418 129.424 22.107  1.00 96.55  ? 258 ASN B N     1 
ATOM   5228  C  CA    . ASN B  2  242 ? -18.585 128.827 22.745  1.00 97.96  ? 258 ASN B CA    1 
ATOM   5229  C  C     . ASN B  2  242 ? -19.891 129.394 22.191  1.00 99.54  ? 258 ASN B C     1 
ATOM   5230  O  O     . ASN B  2  242 ? -20.945 128.763 22.300  1.00 100.22 ? 258 ASN B O     1 
ATOM   5231  C  CB    . ASN B  2  242 ? -18.526 129.006 24.261  1.00 97.05  ? 258 ASN B CB    1 
ATOM   5232  C  CG    . ASN B  2  242 ? -17.477 128.129 24.908  1.00 96.30  ? 258 ASN B CG    1 
ATOM   5233  O  OD1   . ASN B  2  242 ? -16.319 128.518 25.037  1.00 96.94  ? 258 ASN B OD1   1 
ATOM   5234  N  ND2   . ASN B  2  242 ? -17.878 126.932 25.316  1.00 96.49  ? 258 ASN B ND2   1 
ATOM   5235  N  N     . TYR B  2  243 ? -19.814 130.583 21.595  1.00 100.45 ? 259 TYR B N     1 
ATOM   5236  C  CA    . TYR B  2  243 ? -20.979 131.238 21.001  1.00 100.84 ? 259 TYR B CA    1 
ATOM   5237  C  C     . TYR B  2  243 ? -21.333 130.524 19.702  1.00 100.79 ? 259 TYR B C     1 
ATOM   5238  O  O     . TYR B  2  243 ? -22.469 130.093 19.513  1.00 100.52 ? 259 TYR B O     1 
ATOM   5239  C  CB    . TYR B  2  243 ? -20.679 132.726 20.744  1.00 101.72 ? 259 TYR B CB    1 
ATOM   5240  C  CG    . TYR B  2  243 ? -21.681 133.458 19.868  1.00 101.99 ? 259 TYR B CG    1 
ATOM   5241  C  CD1   . TYR B  2  243 ? -22.998 133.671 20.293  1.00 101.62 ? 259 TYR B CD1   1 
ATOM   5242  C  CD2   . TYR B  2  243 ? -21.310 133.933 18.607  1.00 101.88 ? 259 TYR B CD2   1 
ATOM   5243  C  CE1   . TYR B  2  243 ? -23.921 134.339 19.477  1.00 101.21 ? 259 TYR B CE1   1 
ATOM   5244  C  CE2   . TYR B  2  243 ? -22.221 134.601 17.787  1.00 101.86 ? 259 TYR B CE2   1 
ATOM   5245  C  CZ    . TYR B  2  243 ? -23.523 134.799 18.225  1.00 101.57 ? 259 TYR B CZ    1 
ATOM   5246  O  OH    . TYR B  2  243 ? -24.420 135.449 17.405  1.00 101.47 ? 259 TYR B OH    1 
ATOM   5247  N  N     . LEU B  2  244 ? -20.343 130.375 18.827  1.00 101.22 ? 260 LEU B N     1 
ATOM   5248  C  CA    . LEU B  2  244 ? -20.538 129.707 17.546  1.00 102.57 ? 260 LEU B CA    1 
ATOM   5249  C  C     . LEU B  2  244 ? -20.892 128.225 17.728  1.00 104.11 ? 260 LEU B C     1 
ATOM   5250  O  O     . LEU B  2  244 ? -21.545 127.627 16.871  1.00 104.21 ? 260 LEU B O     1 
ATOM   5251  C  CB    . LEU B  2  244 ? -19.285 129.855 16.679  1.00 101.56 ? 260 LEU B CB    1 
ATOM   5252  C  CG    . LEU B  2  244 ? -18.852 131.285 16.352  1.00 100.79 ? 260 LEU B CG    1 
ATOM   5253  C  CD1   . LEU B  2  244 ? -17.606 131.267 15.488  1.00 100.98 ? 260 LEU B CD1   1 
ATOM   5254  C  CD2   . LEU B  2  244 ? -19.973 132.024 15.645  1.00 100.61 ? 260 LEU B CD2   1 
ATOM   5255  N  N     . THR B  2  245 ? -20.465 127.650 18.852  1.00 105.35 ? 261 THR B N     1 
ATOM   5256  C  CA    . THR B  2  245 ? -20.731 126.248 19.174  1.00 105.86 ? 261 THR B CA    1 
ATOM   5257  C  C     . THR B  2  245 ? -21.840 126.193 20.223  1.00 105.76 ? 261 THR B C     1 
ATOM   5258  O  O     . THR B  2  245 ? -21.675 125.590 21.287  1.00 105.61 ? 261 THR B O     1 
ATOM   5259  C  CB    . THR B  2  245 ? -19.462 125.555 19.740  1.00 106.96 ? 261 THR B CB    1 
ATOM   5260  O  OG1   . THR B  2  245 ? -18.362 125.765 18.844  1.00 107.97 ? 261 THR B OG1   1 
ATOM   5261  C  CG2   . THR B  2  245 ? -19.687 124.051 19.906  1.00 108.10 ? 261 THR B CG2   1 
ATOM   5262  N  N     . SER B  2  246 ? -22.962 126.847 19.934  1.00 105.98 ? 262 SER B N     1 
ATOM   5263  C  CA    . SER B  2  246 ? -24.084 126.864 20.869  1.00 106.49 ? 262 SER B CA    1 
ATOM   5264  C  C     . SER B  2  246 ? -25.429 127.178 20.227  1.00 106.77 ? 262 SER B C     1 
ATOM   5265  O  O     . SER B  2  246 ? -25.508 127.570 19.059  1.00 106.39 ? 262 SER B O     1 
ATOM   5266  C  CB    . SER B  2  246 ? -23.823 127.851 22.012  1.00 106.30 ? 262 SER B CB    1 
ATOM   5267  O  OG    . SER B  2  246 ? -23.684 129.174 21.529  1.00 104.88 ? 262 SER B OG    1 
ATOM   5268  N  N     . ALA B  2  247 ? -26.482 127.022 21.025  1.00 106.62 ? 263 ALA B N     1 
ATOM   5269  C  CA    . ALA B  2  247 ? -27.846 127.266 20.582  1.00 107.13 ? 263 ALA B CA    1 
ATOM   5270  C  C     . ALA B  2  247 ? -28.150 128.745 20.333  1.00 107.74 ? 263 ALA B C     1 
ATOM   5271  O  O     . ALA B  2  247 ? -29.072 129.079 19.584  1.00 108.14 ? 263 ALA B O     1 
ATOM   5272  C  CB    . ALA B  2  247 ? -28.815 126.694 21.593  1.00 106.53 ? 263 ALA B CB    1 
ATOM   5273  N  N     . LEU B  2  248 ? -27.368 129.625 20.954  1.00 107.89 ? 264 LEU B N     1 
ATOM   5274  C  CA    . LEU B  2  248 ? -27.555 131.065 20.808  1.00 107.28 ? 264 LEU B CA    1 
ATOM   5275  C  C     . LEU B  2  248 ? -27.240 131.562 19.403  1.00 107.68 ? 264 LEU B C     1 
ATOM   5276  O  O     . LEU B  2  248 ? -27.988 132.363 18.847  1.00 108.33 ? 264 LEU B O     1 
ATOM   5277  C  CB    . LEU B  2  248 ? -26.730 131.815 21.851  1.00 106.36 ? 264 LEU B CB    1 
ATOM   5278  C  CG    . LEU B  2  248 ? -27.073 131.415 23.288  1.00 106.13 ? 264 LEU B CG    1 
ATOM   5279  C  CD1   . LEU B  2  248 ? -26.303 132.265 24.275  1.00 106.07 ? 264 LEU B CD1   1 
ATOM   5280  C  CD2   . LEU B  2  248 ? -28.565 131.561 23.523  1.00 106.04 ? 264 LEU B CD2   1 
ATOM   5281  N  N     . SER B  2  249 ? -26.136 131.095 18.830  1.00 108.09 ? 265 SER B N     1 
ATOM   5282  C  CA    . SER B  2  249 ? -25.779 131.492 17.476  1.00 109.06 ? 265 SER B CA    1 
ATOM   5283  C  C     . SER B  2  249 ? -26.660 130.729 16.503  1.00 110.32 ? 265 SER B C     1 
ATOM   5284  O  O     . SER B  2  249 ? -26.990 129.562 16.731  1.00 110.53 ? 265 SER B O     1 
ATOM   5285  C  CB    . SER B  2  249 ? -24.314 131.190 17.176  1.00 108.79 ? 265 SER B CB    1 
ATOM   5286  O  OG    . SER B  2  249 ? -24.009 131.517 15.830  1.00 107.83 ? 265 SER B OG    1 
ATOM   5287  N  N     . GLU B  2  250 ? -27.054 131.400 15.428  1.00 111.72 ? 266 GLU B N     1 
ATOM   5288  C  CA    . GLU B  2  250 ? -27.901 130.785 14.417  1.00 112.98 ? 266 GLU B CA    1 
ATOM   5289  C  C     . GLU B  2  250 ? -27.086 129.873 13.513  1.00 112.39 ? 266 GLU B C     1 
ATOM   5290  O  O     . GLU B  2  250 ? -27.584 128.849 13.036  1.00 112.74 ? 266 GLU B O     1 
ATOM   5291  C  CB    . GLU B  2  250 ? -28.587 131.855 13.568  1.00 115.07 ? 266 GLU B CB    1 
ATOM   5292  C  CG    . GLU B  2  250 ? -29.499 132.790 14.342  1.00 118.58 ? 266 GLU B CG    1 
ATOM   5293  C  CD    . GLU B  2  250 ? -30.250 133.747 13.430  1.00 121.05 ? 266 GLU B CD    1 
ATOM   5294  O  OE1   . GLU B  2  250 ? -29.590 134.540 12.716  1.00 122.14 ? 266 GLU B OE1   1 
ATOM   5295  O  OE2   . GLU B  2  250 ? -31.500 133.697 13.419  1.00 121.80 ? 266 GLU B OE2   1 
ATOM   5296  N  N     . LEU B  2  251 ? -25.826 130.243 13.295  1.00 110.97 ? 267 LEU B N     1 
ATOM   5297  C  CA    . LEU B  2  251 ? -24.945 129.466 12.434  1.00 109.83 ? 267 LEU B CA    1 
ATOM   5298  C  C     . LEU B  2  251 ? -24.143 128.335 13.101  1.00 108.47 ? 267 LEU B C     1 
ATOM   5299  O  O     . LEU B  2  251 ? -23.118 127.897 12.574  1.00 108.15 ? 267 LEU B O     1 
ATOM   5300  C  CB    . LEU B  2  251 ? -24.044 130.403 11.615  1.00 109.79 ? 267 LEU B CB    1 
ATOM   5301  C  CG    . LEU B  2  251 ? -23.597 131.753 12.186  1.00 109.16 ? 267 LEU B CG    1 
ATOM   5302  C  CD1   . LEU B  2  251 ? -22.545 131.567 13.256  1.00 109.06 ? 267 LEU B CD1   1 
ATOM   5303  C  CD2   . LEU B  2  251 ? -23.035 132.603 11.059  1.00 109.49 ? 267 LEU B CD2   1 
ATOM   5304  N  N     . SER B  2  252 ? -24.640 127.833 14.231  1.00 106.84 ? 268 SER B N     1 
ATOM   5305  C  CA    . SER B  2  252 ? -23.974 126.739 14.936  1.00 105.57 ? 268 SER B CA    1 
ATOM   5306  C  C     . SER B  2  252 ? -24.175 125.431 14.171  1.00 104.93 ? 268 SER B C     1 
ATOM   5307  O  O     . SER B  2  252 ? -23.373 124.503 14.282  1.00 104.86 ? 268 SER B O     1 
ATOM   5308  C  CB    . SER B  2  252 ? -24.509 126.600 16.365  1.00 104.87 ? 268 SER B CB    1 
ATOM   5309  O  OG    . SER B  2  252 ? -25.874 126.223 16.381  1.00 104.42 ? 268 SER B OG    1 
ATOM   5310  N  N     . GLY B  2  253 ? -25.259 125.372 13.403  1.00 104.17 ? 269 GLY B N     1 
ATOM   5311  C  CA    . GLY B  2  253 ? -25.561 124.193 12.614  1.00 103.09 ? 269 GLY B CA    1 
ATOM   5312  C  C     . GLY B  2  253 ? -24.845 124.212 11.275  1.00 102.41 ? 269 GLY B C     1 
ATOM   5313  O  O     . GLY B  2  253 ? -24.994 123.287 10.473  1.00 102.67 ? 269 GLY B O     1 
ATOM   5314  N  N     . LEU B  2  254 ? -24.075 125.270 11.032  1.00 101.34 ? 270 LEU B N     1 
ATOM   5315  C  CA    . LEU B  2  254 ? -23.324 125.423 9.788   1.00 100.47 ? 270 LEU B CA    1 
ATOM   5316  C  C     . LEU B  2  254 ? -21.837 125.144 9.958   1.00 99.93  ? 270 LEU B C     1 
ATOM   5317  O  O     . LEU B  2  254 ? -21.084 125.126 8.984   1.00 99.97  ? 270 LEU B O     1 
ATOM   5318  C  CB    . LEU B  2  254 ? -23.522 126.824 9.207   1.00 100.21 ? 270 LEU B CB    1 
ATOM   5319  C  CG    . LEU B  2  254 ? -24.744 127.029 8.311   1.00 100.26 ? 270 LEU B CG    1 
ATOM   5320  C  CD1   . LEU B  2  254 ? -26.026 126.689 9.053   1.00 100.15 ? 270 LEU B CD1   1 
ATOM   5321  C  CD2   . LEU B  2  254 ? -24.767 128.464 7.821   1.00 101.14 ? 270 LEU B CD2   1 
ATOM   5322  N  N     . ILE B  2  255 ? -21.413 124.950 11.202  1.00 99.84  ? 271 ILE B N     1 
ATOM   5323  C  CA    . ILE B  2  255 ? -20.013 124.662 11.491  1.00 100.14 ? 271 ILE B CA    1 
ATOM   5324  C  C     . ILE B  2  255 ? -19.871 123.351 12.248  1.00 99.59  ? 271 ILE B C     1 
ATOM   5325  O  O     . ILE B  2  255 ? -20.707 123.007 13.089  1.00 98.95  ? 271 ILE B O     1 
ATOM   5326  C  CB    . ILE B  2  255 ? -19.349 125.789 12.310  1.00 100.81 ? 271 ILE B CB    1 
ATOM   5327  C  CG1   . ILE B  2  255 ? -20.149 126.057 13.588  1.00 100.91 ? 271 ILE B CG1   1 
ATOM   5328  C  CG2   . ILE B  2  255 ? -19.214 127.048 11.460  1.00 101.12 ? 271 ILE B CG2   1 
ATOM   5329  C  CD1   . ILE B  2  255 ? -19.566 127.141 14.449  1.00 101.02 ? 271 ILE B CD1   1 
ATOM   5330  N  N     . SER B  2  256 ? -18.810 122.618 11.932  1.00 99.07  ? 272 SER B N     1 
ATOM   5331  C  CA    . SER B  2  256 ? -18.550 121.340 12.574  1.00 98.73  ? 272 SER B CA    1 
ATOM   5332  C  C     . SER B  2  256 ? -17.906 121.530 13.944  1.00 97.67  ? 272 SER B C     1 
ATOM   5333  O  O     . SER B  2  256 ? -18.422 121.046 14.953  1.00 96.48  ? 272 SER B O     1 
ATOM   5334  C  CB    . SER B  2  256 ? -17.665 120.472 11.678  1.00 99.65  ? 272 SER B CB    1 
ATOM   5335  O  OG    . SER B  2  256 ? -18.292 120.236 10.427  1.00 101.04 ? 272 SER B OG    1 
ATOM   5336  N  N     . SER B  2  257 ? -16.808 122.279 13.981  1.00 96.99  ? 273 SER B N     1 
ATOM   5337  C  CA    . SER B  2  257 ? -16.101 122.519 15.231  1.00 96.76  ? 273 SER B CA    1 
ATOM   5338  C  C     . SER B  2  257 ? -15.429 123.887 15.269  1.00 96.01  ? 273 SER B C     1 
ATOM   5339  O  O     . SER B  2  257 ? -14.987 124.405 14.246  1.00 95.32  ? 273 SER B O     1 
ATOM   5340  C  CB    . SER B  2  257 ? -15.054 121.421 15.454  1.00 97.97  ? 273 SER B CB    1 
ATOM   5341  O  OG    . SER B  2  257 ? -14.441 121.532 16.727  1.00 99.05  ? 273 SER B OG    1 
ATOM   5342  N  N     . ALA B  2  258 ? -15.352 124.460 16.466  1.00 95.67  ? 274 ALA B N     1 
ATOM   5343  C  CA    . ALA B  2  258 ? -14.727 125.764 16.675  1.00 95.29  ? 274 ALA B CA    1 
ATOM   5344  C  C     . ALA B  2  258 ? -14.109 125.794 18.064  1.00 94.43  ? 274 ALA B C     1 
ATOM   5345  O  O     . ALA B  2  258 ? -14.761 125.435 19.044  1.00 94.14  ? 274 ALA B O     1 
ATOM   5346  C  CB    . ALA B  2  258 ? -15.760 126.871 16.540  1.00 95.78  ? 274 ALA B CB    1 
ATOM   5347  N  N     . LYS B  2  259 ? -12.858 126.233 18.155  1.00 94.24  ? 275 LYS B N     1 
ATOM   5348  C  CA    . LYS B  2  259 ? -12.182 126.281 19.448  1.00 95.16  ? 275 LYS B CA    1 
ATOM   5349  C  C     . LYS B  2  259 ? -11.036 127.283 19.531  1.00 95.22  ? 275 LYS B C     1 
ATOM   5350  O  O     . LYS B  2  259 ? -10.569 127.819 18.520  1.00 93.85  ? 275 LYS B O     1 
ATOM   5351  C  CB    . LYS B  2  259 ? -11.656 124.890 19.821  1.00 95.92  ? 275 LYS B CB    1 
ATOM   5352  C  CG    . LYS B  2  259 ? -10.686 124.303 18.802  1.00 96.95  ? 275 LYS B CG    1 
ATOM   5353  C  CD    . LYS B  2  259 ? -10.091 122.991 19.281  1.00 97.53  ? 275 LYS B CD    1 
ATOM   5354  C  CE    . LYS B  2  259 ? -9.240  122.350 18.197  1.00 98.12  ? 275 LYS B CE    1 
ATOM   5355  N  NZ    . LYS B  2  259 ? -8.172  123.268 17.714  1.00 98.89  ? 275 LYS B NZ    1 
ATOM   5356  N  N     . LEU B  2  260 ? -10.593 127.523 20.762  1.00 95.64  ? 276 LEU B N     1 
ATOM   5357  C  CA    . LEU B  2  260 ? -9.487  128.426 21.026  1.00 96.68  ? 276 LEU B CA    1 
ATOM   5358  C  C     . LEU B  2  260 ? -8.390  127.682 21.775  1.00 96.77  ? 276 LEU B C     1 
ATOM   5359  O  O     . LEU B  2  260 ? -8.576  127.273 22.927  1.00 95.74  ? 276 LEU B O     1 
ATOM   5360  C  CB    . LEU B  2  260 ? -9.941  129.623 21.862  1.00 97.78  ? 276 LEU B CB    1 
ATOM   5361  C  CG    . LEU B  2  260 ? -8.778  130.517 22.312  1.00 98.29  ? 276 LEU B CG    1 
ATOM   5362  C  CD1   . LEU B  2  260 ? -8.139  131.188 21.104  1.00 98.47  ? 276 LEU B CD1   1 
ATOM   5363  C  CD2   . LEU B  2  260 ? -9.258  131.547 23.308  1.00 98.93  ? 276 LEU B CD2   1 
ATOM   5364  N  N     . ASP B  2  261 ? -7.251  127.508 21.114  1.00 97.28  ? 277 ASP B N     1 
ATOM   5365  C  CA    . ASP B  2  261 ? -6.117  126.827 21.719  1.00 98.38  ? 277 ASP B CA    1 
ATOM   5366  C  C     . ASP B  2  261 ? -5.320  127.821 22.551  1.00 99.50  ? 277 ASP B C     1 
ATOM   5367  O  O     . ASP B  2  261 ? -4.754  128.779 22.021  1.00 99.43  ? 277 ASP B O     1 
ATOM   5368  C  CB    . ASP B  2  261 ? -5.235  126.176 20.644  1.00 97.72  ? 277 ASP B CB    1 
ATOM   5369  C  CG    . ASP B  2  261 ? -5.898  124.969 19.995  1.00 96.25  ? 277 ASP B CG    1 
ATOM   5370  O  OD1   . ASP B  2  261 ? -6.510  124.158 20.726  1.00 95.27  ? 277 ASP B OD1   1 
ATOM   5371  O  OD2   . ASP B  2  261 ? -5.815  124.834 18.756  1.00 95.23  ? 277 ASP B OD2   1 
ATOM   5372  N  N     . LYS B  2  262 ? -5.309  127.591 23.862  1.00 101.14 ? 278 LYS B N     1 
ATOM   5373  C  CA    . LYS B  2  262 ? -4.611  128.455 24.812  1.00 102.82 ? 278 LYS B CA    1 
ATOM   5374  C  C     . LYS B  2  262 ? -3.204  127.970 25.147  1.00 103.93 ? 278 LYS B C     1 
ATOM   5375  O  O     . LYS B  2  262 ? -3.009  126.830 25.570  1.00 103.87 ? 278 LYS B O     1 
ATOM   5376  C  CB    . LYS B  2  262 ? -5.420  128.559 26.105  1.00 102.33 ? 278 LYS B CB    1 
ATOM   5377  C  CG    . LYS B  2  262 ? -6.887  128.859 25.886  1.00 103.19 ? 278 LYS B CG    1 
ATOM   5378  C  CD    . LYS B  2  262 ? -7.684  128.595 27.149  1.00 104.00 ? 278 LYS B CD    1 
ATOM   5379  C  CE    . LYS B  2  262 ? -9.172  128.599 26.860  1.00 105.05 ? 278 LYS B CE    1 
ATOM   5380  N  NZ    . LYS B  2  262 ? -9.533  127.625 25.784  1.00 104.98 ? 278 LYS B NZ    1 
ATOM   5381  N  N     . PHE B  2  263 ? -2.227  128.854 24.969  1.00 105.94 ? 279 PHE B N     1 
ATOM   5382  C  CA    . PHE B  2  263 ? -0.833  128.543 25.270  1.00 107.57 ? 279 PHE B CA    1 
ATOM   5383  C  C     . PHE B  2  263 ? -0.335  129.448 26.402  1.00 108.01 ? 279 PHE B C     1 
ATOM   5384  O  O     . PHE B  2  263 ? -1.138  130.026 27.141  1.00 107.69 ? 279 PHE B O     1 
ATOM   5385  C  CB    . PHE B  2  263 ? 0.030   128.714 24.015  1.00 108.12 ? 279 PHE B CB    1 
ATOM   5386  C  CG    . PHE B  2  263 ? -0.320  127.761 22.911  1.00 109.51 ? 279 PHE B CG    1 
ATOM   5387  C  CD1   . PHE B  2  263 ? -1.033  128.196 21.800  1.00 110.19 ? 279 PHE B CD1   1 
ATOM   5388  C  CD2   . PHE B  2  263 ? 0.044   126.420 22.993  1.00 110.10 ? 279 PHE B CD2   1 
ATOM   5389  C  CE1   . PHE B  2  263 ? -1.380  127.308 20.783  1.00 111.29 ? 279 PHE B CE1   1 
ATOM   5390  C  CE2   . PHE B  2  263 ? -0.297  125.523 21.985  1.00 110.44 ? 279 PHE B CE2   1 
ATOM   5391  C  CZ    . PHE B  2  263 ? -1.012  125.967 20.877  1.00 110.87 ? 279 PHE B CZ    1 
ATOM   5392  N  N     . THR B  2  264 ? 0.983   129.545 26.555  1.00 108.48 ? 280 THR B N     1 
ATOM   5393  C  CA    . THR B  2  264 ? 1.570   130.386 27.598  1.00 108.59 ? 280 THR B CA    1 
ATOM   5394  C  C     . THR B  2  264 ? 2.038   131.735 27.049  1.00 107.81 ? 280 THR B C     1 
ATOM   5395  O  O     . THR B  2  264 ? 2.379   132.635 27.816  1.00 107.87 ? 280 THR B O     1 
ATOM   5396  C  CB    . THR B  2  264 ? 2.765   129.688 28.293  1.00 109.35 ? 280 THR B CB    1 
ATOM   5397  O  OG1   . THR B  2  264 ? 3.801   129.431 27.335  1.00 109.91 ? 280 THR B OG1   1 
ATOM   5398  C  CG2   . THR B  2  264 ? 2.323   128.374 28.930  1.00 109.82 ? 280 THR B CG2   1 
ATOM   5399  N  N     . ASP B  2  265 ? 2.034   131.873 25.725  1.00 106.84 ? 281 ASP B N     1 
ATOM   5400  C  CA    . ASP B  2  265 ? 2.468   133.108 25.079  1.00 105.72 ? 281 ASP B CA    1 
ATOM   5401  C  C     . ASP B  2  265 ? 1.574   133.527 23.907  1.00 104.97 ? 281 ASP B C     1 
ATOM   5402  O  O     . ASP B  2  265 ? 2.062   134.000 22.875  1.00 104.57 ? 281 ASP B O     1 
ATOM   5403  C  CB    . ASP B  2  265 ? 3.932   132.977 24.622  1.00 105.78 ? 281 ASP B CB    1 
ATOM   5404  C  CG    . ASP B  2  265 ? 4.138   131.886 23.570  1.00 105.64 ? 281 ASP B CG    1 
ATOM   5405  O  OD1   . ASP B  2  265 ? 3.301   130.964 23.461  1.00 105.39 ? 281 ASP B OD1   1 
ATOM   5406  O  OD2   . ASP B  2  265 ? 5.156   131.953 22.850  1.00 105.51 ? 281 ASP B OD2   1 
ATOM   5407  N  N     . GLY B  2  266 ? 0.263   133.370 24.082  1.00 103.86 ? 282 GLY B N     1 
ATOM   5408  C  CA    . GLY B  2  266 ? -0.677  133.730 23.034  1.00 102.89 ? 282 GLY B CA    1 
ATOM   5409  C  C     . GLY B  2  266 ? -1.694  132.633 22.785  1.00 102.06 ? 282 GLY B C     1 
ATOM   5410  O  O     . GLY B  2  266 ? -2.126  131.962 23.725  1.00 102.68 ? 282 GLY B O     1 
ATOM   5411  N  N     . GLY B  2  267 ? -2.080  132.446 21.525  1.00 100.60 ? 283 GLY B N     1 
ATOM   5412  C  CA    . GLY B  2  267 ? -3.050  131.412 21.200  1.00 99.18  ? 283 GLY B CA    1 
ATOM   5413  C  C     . GLY B  2  267 ? -3.490  131.383 19.745  1.00 98.12  ? 283 GLY B C     1 
ATOM   5414  O  O     . GLY B  2  267 ? -3.032  132.192 18.931  1.00 97.93  ? 283 GLY B O     1 
ATOM   5415  N  N     . LEU B  2  268 ? -4.368  130.434 19.417  1.00 96.33  ? 284 LEU B N     1 
ATOM   5416  C  CA    . LEU B  2  268 ? -4.885  130.295 18.058  1.00 93.93  ? 284 LEU B CA    1 
ATOM   5417  C  C     . LEU B  2  268 ? -6.352  129.884 18.060  1.00 92.39  ? 284 LEU B C     1 
ATOM   5418  O  O     . LEU B  2  268 ? -6.758  128.958 18.768  1.00 92.13  ? 284 LEU B O     1 
ATOM   5419  C  CB    . LEU B  2  268 ? -4.074  129.272 17.255  1.00 93.66  ? 284 LEU B CB    1 
ATOM   5420  C  CG    . LEU B  2  268 ? -4.431  129.199 15.765  1.00 93.67  ? 284 LEU B CG    1 
ATOM   5421  C  CD1   . LEU B  2  268 ? -3.860  130.405 15.035  1.00 93.72  ? 284 LEU B CD1   1 
ATOM   5422  C  CD2   . LEU B  2  268 ? -3.890  127.925 15.147  1.00 94.35  ? 284 LEU B CD2   1 
ATOM   5423  N  N     . PHE B  2  269 ? -7.143  130.603 17.270  1.00 89.88  ? 285 PHE B N     1 
ATOM   5424  C  CA    . PHE B  2  269 ? -8.568  130.338 17.143  1.00 86.99  ? 285 PHE B CA    1 
ATOM   5425  C  C     . PHE B  2  269 ? -8.802  129.555 15.856  1.00 86.61  ? 285 PHE B C     1 
ATOM   5426  O  O     . PHE B  2  269 ? -8.310  129.941 14.787  1.00 86.59  ? 285 PHE B O     1 
ATOM   5427  C  CB    . PHE B  2  269 ? -9.356  131.655 17.105  1.00 83.54  ? 285 PHE B CB    1 
ATOM   5428  C  CG    . PHE B  2  269 ? -10.831 131.470 16.890  1.00 80.60  ? 285 PHE B CG    1 
ATOM   5429  C  CD1   . PHE B  2  269 ? -11.669 131.156 17.959  1.00 79.07  ? 285 PHE B CD1   1 
ATOM   5430  C  CD2   . PHE B  2  269 ? -11.380 131.581 15.613  1.00 78.42  ? 285 PHE B CD2   1 
ATOM   5431  C  CE1   . PHE B  2  269 ? -13.032 130.949 17.762  1.00 77.45  ? 285 PHE B CE1   1 
ATOM   5432  C  CE2   . PHE B  2  269 ? -12.738 131.377 15.403  1.00 77.05  ? 285 PHE B CE2   1 
ATOM   5433  C  CZ    . PHE B  2  269 ? -13.568 131.060 16.482  1.00 77.33  ? 285 PHE B CZ    1 
ATOM   5434  N  N     . THR B  2  270 ? -9.562  128.467 15.959  1.00 85.29  ? 286 THR B N     1 
ATOM   5435  C  CA    . THR B  2  270 ? -9.856  127.635 14.798  1.00 84.01  ? 286 THR B CA    1 
ATOM   5436  C  C     . THR B  2  270 ? -11.351 127.416 14.588  1.00 84.06  ? 286 THR B C     1 
ATOM   5437  O  O     . THR B  2  270 ? -12.114 127.270 15.546  1.00 83.63  ? 286 THR B O     1 
ATOM   5438  C  CB    . THR B  2  270 ? -9.133  126.265 14.884  1.00 83.16  ? 286 THR B CB    1 
ATOM   5439  O  OG1   . THR B  2  270 ? -9.343  125.683 16.179  1.00 82.21  ? 286 THR B OG1   1 
ATOM   5440  C  CG2   . THR B  2  270 ? -7.638  126.429 14.633  1.00 81.33  ? 286 THR B CG2   1 
ATOM   5441  N  N     . LEU B  2  271 ? -11.757 127.414 13.322  1.00 84.60  ? 287 LEU B N     1 
ATOM   5442  C  CA    . LEU B  2  271 ? -13.152 127.207 12.937  1.00 85.79  ? 287 LEU B CA    1 
ATOM   5443  C  C     . LEU B  2  271 ? -13.180 126.164 11.818  1.00 85.38  ? 287 LEU B C     1 
ATOM   5444  O  O     . LEU B  2  271 ? -12.493 126.317 10.801  1.00 84.92  ? 287 LEU B O     1 
ATOM   5445  C  CB    . LEU B  2  271 ? -13.762 128.517 12.440  1.00 87.41  ? 287 LEU B CB    1 
ATOM   5446  C  CG    . LEU B  2  271 ? -15.247 128.477 12.086  1.00 88.58  ? 287 LEU B CG    1 
ATOM   5447  C  CD1   . LEU B  2  271 ? -16.068 128.382 13.363  1.00 88.50  ? 287 LEU B CD1   1 
ATOM   5448  C  CD2   . LEU B  2  271 ? -15.623 129.719 11.302  1.00 89.29  ? 287 LEU B CD2   1 
ATOM   5449  N  N     . PHE B  2  272 ? -14.009 125.135 11.985  1.00 85.02  ? 288 PHE B N     1 
ATOM   5450  C  CA    . PHE B  2  272 ? -14.091 124.046 11.005  1.00 84.26  ? 288 PHE B CA    1 
ATOM   5451  C  C     . PHE B  2  272 ? -15.454 123.785 10.359  1.00 84.48  ? 288 PHE B C     1 
ATOM   5452  O  O     . PHE B  2  272 ? -16.470 123.622 11.045  1.00 83.19  ? 288 PHE B O     1 
ATOM   5453  C  CB    . PHE B  2  272 ? -13.593 122.737 11.642  1.00 81.73  ? 288 PHE B CB    1 
ATOM   5454  C  CG    . PHE B  2  272 ? -12.199 122.817 12.191  1.00 78.53  ? 288 PHE B CG    1 
ATOM   5455  C  CD1   . PHE B  2  272 ? -11.979 122.796 13.565  1.00 77.67  ? 288 PHE B CD1   1 
ATOM   5456  C  CD2   . PHE B  2  272 ? -11.107 122.933 11.335  1.00 77.36  ? 288 PHE B CD2   1 
ATOM   5457  C  CE1   . PHE B  2  272 ? -10.687 122.894 14.084  1.00 76.89  ? 288 PHE B CE1   1 
ATOM   5458  C  CE2   . PHE B  2  272 ? -9.812  123.032 11.836  1.00 77.05  ? 288 PHE B CE2   1 
ATOM   5459  C  CZ    . PHE B  2  272 ? -9.601  123.012 13.215  1.00 77.15  ? 288 PHE B CZ    1 
ATOM   5460  N  N     . VAL B  2  273 ? -15.446 123.700 9.030   1.00 85.56  ? 289 VAL B N     1 
ATOM   5461  C  CA    . VAL B  2  273 ? -16.648 123.414 8.245   1.00 86.98  ? 289 VAL B CA    1 
ATOM   5462  C  C     . VAL B  2  273 ? -16.358 122.107 7.497   1.00 87.40  ? 289 VAL B C     1 
ATOM   5463  O  O     . VAL B  2  273 ? -15.503 122.074 6.606   1.00 86.56  ? 289 VAL B O     1 
ATOM   5464  C  CB    . VAL B  2  273 ? -16.941 124.530 7.205   1.00 87.20  ? 289 VAL B CB    1 
ATOM   5465  C  CG1   . VAL B  2  273 ? -18.280 124.281 6.529   1.00 87.74  ? 289 VAL B CG1   1 
ATOM   5466  C  CG2   . VAL B  2  273 ? -16.925 125.896 7.862   1.00 87.12  ? 289 VAL B CG2   1 
ATOM   5467  N  N     . ARG B  2  274 ? -17.055 121.035 7.870   1.00 88.41  ? 290 ARG B N     1 
ATOM   5468  C  CA    . ARG B  2  274 ? -16.845 119.727 7.244   1.00 89.30  ? 290 ARG B CA    1 
ATOM   5469  C  C     . ARG B  2  274 ? -18.131 119.080 6.720   1.00 89.31  ? 290 ARG B C     1 
ATOM   5470  O  O     . ARG B  2  274 ? -19.146 119.036 7.422   1.00 88.68  ? 290 ARG B O     1 
ATOM   5471  C  CB    . ARG B  2  274 ? -16.168 118.776 8.239   1.00 89.90  ? 290 ARG B CB    1 
ATOM   5472  C  CG    . ARG B  2  274 ? -15.862 117.397 7.673   1.00 91.36  ? 290 ARG B CG    1 
ATOM   5473  C  CD    . ARG B  2  274 ? -15.528 116.392 8.767   1.00 92.42  ? 290 ARG B CD    1 
ATOM   5474  N  NE    . ARG B  2  274 ? -15.201 115.086 8.199   1.00 93.76  ? 290 ARG B NE    1 
ATOM   5475  C  CZ    . ARG B  2  274 ? -14.385 114.199 8.761   1.00 94.11  ? 290 ARG B CZ    1 
ATOM   5476  N  NH1   . ARG B  2  274 ? -14.151 113.042 8.156   1.00 93.96  ? 290 ARG B NH1   1 
ATOM   5477  N  NH2   . ARG B  2  274 ? -13.805 114.461 9.926   1.00 94.34  ? 290 ARG B NH2   1 
ATOM   5478  N  N     . ASP B  2  275 ? -18.062 118.547 5.499   1.00 89.88  ? 291 ASP B N     1 
ATOM   5479  C  CA    . ASP B  2  275 ? -19.202 117.878 4.866   1.00 90.85  ? 291 ASP B CA    1 
ATOM   5480  C  C     . ASP B  2  275 ? -18.769 117.017 3.671   1.00 91.05  ? 291 ASP B C     1 
ATOM   5481  O  O     . ASP B  2  275 ? -17.695 117.220 3.103   1.00 89.89  ? 291 ASP B O     1 
ATOM   5482  C  CB    . ASP B  2  275 ? -20.246 118.910 4.418   1.00 90.63  ? 291 ASP B CB    1 
ATOM   5483  C  CG    . ASP B  2  275 ? -21.572 118.276 4.044   1.00 90.07  ? 291 ASP B CG    1 
ATOM   5484  O  OD1   . ASP B  2  275 ? -22.385 118.023 4.960   1.00 89.62  ? 291 ASP B OD1   1 
ATOM   5485  O  OD2   . ASP B  2  275 ? -21.796 118.034 2.837   1.00 89.02  ? 291 ASP B OD2   1 
ATOM   5486  N  N     . GLN B  2  276 ? -19.626 116.073 3.284   1.00 92.32  ? 292 GLN B N     1 
ATOM   5487  C  CA    . GLN B  2  276 ? -19.356 115.171 2.164   1.00 94.05  ? 292 GLN B CA    1 
ATOM   5488  C  C     . GLN B  2  276 ? -19.137 115.871 0.823   1.00 93.86  ? 292 GLN B C     1 
ATOM   5489  O  O     . GLN B  2  276 ? -18.060 115.758 0.239   1.00 93.41  ? 292 GLN B O     1 
ATOM   5490  C  CB    . GLN B  2  276 ? -20.477 114.142 2.029   1.00 96.49  ? 292 GLN B CB    1 
ATOM   5491  C  CG    . GLN B  2  276 ? -20.674 113.268 3.263   1.00 100.53 ? 292 GLN B CG    1 
ATOM   5492  C  CD    . GLN B  2  276 ? -21.783 112.236 3.091   1.00 102.44 ? 292 GLN B CD    1 
ATOM   5493  O  OE1   . GLN B  2  276 ? -22.375 112.108 2.014   1.00 103.20 ? 292 GLN B OE1   1 
ATOM   5494  N  NE2   . GLN B  2  276 ? -22.069 111.492 4.157   1.00 102.92 ? 292 GLN B NE2   1 
ATOM   5495  N  N     . ASP B  2  277 ? -20.156 116.570 0.322   1.00 94.09  ? 293 ASP B N     1 
ATOM   5496  C  CA    . ASP B  2  277 ? -20.023 117.274 -0.956  1.00 93.59  ? 293 ASP B CA    1 
ATOM   5497  C  C     . ASP B  2  277 ? -19.519 118.706 -0.782  1.00 93.05  ? 293 ASP B C     1 
ATOM   5498  O  O     . ASP B  2  277 ? -19.877 119.400 0.175   1.00 92.32  ? 293 ASP B O     1 
ATOM   5499  C  CB    . ASP B  2  277 ? -21.328 117.224 -1.778  1.00 93.95  ? 293 ASP B CB    1 
ATOM   5500  C  CG    . ASP B  2  277 ? -22.381 118.219 -1.306  1.00 93.31  ? 293 ASP B CG    1 
ATOM   5501  O  OD1   . ASP B  2  277 ? -22.856 118.113 -0.153  1.00 93.08  ? 293 ASP B OD1   1 
ATOM   5502  O  OD2   . ASP B  2  277 ? -22.749 119.094 -2.116  1.00 91.97  ? 293 ASP B OD2   1 
ATOM   5503  N  N     . SER B  2  278 ? -18.668 119.123 -1.714  1.00 92.67  ? 294 SER B N     1 
ATOM   5504  C  CA    . SER B  2  278 ? -18.054 120.446 -1.703  1.00 92.85  ? 294 SER B CA    1 
ATOM   5505  C  C     . SER B  2  278 ? -18.999 121.653 -1.722  1.00 93.80  ? 294 SER B C     1 
ATOM   5506  O  O     . SER B  2  278 ? -18.696 122.684 -1.121  1.00 93.93  ? 294 SER B O     1 
ATOM   5507  C  CB    . SER B  2  278 ? -17.038 120.548 -2.843  1.00 91.57  ? 294 SER B CB    1 
ATOM   5508  O  OG    . SER B  2  278 ? -17.573 120.041 -4.052  1.00 90.78  ? 294 SER B OG    1 
ATOM   5509  N  N     . ALA B  2  279 ? -20.138 121.522 -2.398  1.00 94.16  ? 295 ALA B N     1 
ATOM   5510  C  CA    . ALA B  2  279 ? -21.111 122.610 -2.491  1.00 93.97  ? 295 ALA B CA    1 
ATOM   5511  C  C     . ALA B  2  279 ? -21.584 123.134 -1.129  1.00 94.02  ? 295 ALA B C     1 
ATOM   5512  O  O     . ALA B  2  279 ? -21.587 124.344 -0.897  1.00 94.26  ? 295 ALA B O     1 
ATOM   5513  C  CB    . ALA B  2  279 ? -22.303 122.177 -3.339  1.00 94.13  ? 295 ALA B CB    1 
ATOM   5514  N  N     . VAL B  2  280 ? -21.973 122.231 -0.232  1.00 93.53  ? 296 VAL B N     1 
ATOM   5515  C  CA    . VAL B  2  280 ? -22.445 122.621 1.096   1.00 93.91  ? 296 VAL B CA    1 
ATOM   5516  C  C     . VAL B  2  280 ? -21.337 123.251 1.937   1.00 95.16  ? 296 VAL B C     1 
ATOM   5517  O  O     . VAL B  2  280 ? -21.607 124.077 2.808   1.00 95.23  ? 296 VAL B O     1 
ATOM   5518  C  CB    . VAL B  2  280 ? -23.043 121.419 1.861   1.00 93.37  ? 296 VAL B CB    1 
ATOM   5519  C  CG1   . VAL B  2  280 ? -23.498 121.840 3.255   1.00 92.22  ? 296 VAL B CG1   1 
ATOM   5520  C  CG2   . VAL B  2  280 ? -24.213 120.840 1.084   1.00 93.65  ? 296 VAL B CG2   1 
ATOM   5521  N  N     . VAL B  2  281 ? -20.092 122.862 1.674   1.00 96.76  ? 297 VAL B N     1 
ATOM   5522  C  CA    . VAL B  2  281 ? -18.953 123.407 2.411   1.00 97.81  ? 297 VAL B CA    1 
ATOM   5523  C  C     . VAL B  2  281 ? -18.689 124.838 1.965   1.00 98.01  ? 297 VAL B C     1 
ATOM   5524  O  O     . VAL B  2  281 ? -18.520 125.725 2.799   1.00 98.27  ? 297 VAL B O     1 
ATOM   5525  C  CB    . VAL B  2  281 ? -17.670 122.553 2.213   1.00 97.97  ? 297 VAL B CB    1 
ATOM   5526  C  CG1   . VAL B  2  281 ? -16.481 123.202 2.912   1.00 97.47  ? 297 VAL B CG1   1 
ATOM   5527  C  CG2   . VAL B  2  281 ? -17.884 121.154 2.763   1.00 97.91  ? 297 VAL B CG2   1 
ATOM   5528  N  N     . SER B  2  282 ? -18.680 125.055 0.651   1.00 98.30  ? 298 SER B N     1 
ATOM   5529  C  CA    . SER B  2  282 ? -18.446 126.380 0.081   1.00 99.24  ? 298 SER B CA    1 
ATOM   5530  C  C     . SER B  2  282 ? -19.474 127.398 0.568   1.00 100.01 ? 298 SER B C     1 
ATOM   5531  O  O     . SER B  2  282 ? -19.129 128.537 0.878   1.00 99.87  ? 298 SER B O     1 
ATOM   5532  C  CB    . SER B  2  282 ? -18.468 126.321 -1.451  1.00 99.20  ? 298 SER B CB    1 
ATOM   5533  O  OG    . SER B  2  282 ? -17.385 125.558 -1.957  1.00 99.13  ? 298 SER B OG    1 
ATOM   5534  N  N     . SER B  2  283 ? -20.733 126.972 0.645   1.00 100.94 ? 299 SER B N     1 
ATOM   5535  C  CA    . SER B  2  283 ? -21.818 127.837 1.093   1.00 102.14 ? 299 SER B CA    1 
ATOM   5536  C  C     . SER B  2  283 ? -21.710 128.182 2.573   1.00 102.49 ? 299 SER B C     1 
ATOM   5537  O  O     . SER B  2  283 ? -21.576 129.350 2.934   1.00 103.59 ? 299 SER B O     1 
ATOM   5538  C  CB    . SER B  2  283 ? -23.171 127.178 0.819   1.00 102.67 ? 299 SER B CB    1 
ATOM   5539  O  OG    . SER B  2  283 ? -23.386 127.031 -0.573  1.00 103.88 ? 299 SER B OG    1 
ATOM   5540  N  N     . ASN B  2  284 ? -21.747 127.157 3.420   1.00 102.21 ? 300 ASN B N     1 
ATOM   5541  C  CA    . ASN B  2  284 ? -21.668 127.336 4.866   1.00 101.65 ? 300 ASN B CA    1 
ATOM   5542  C  C     . ASN B  2  284 ? -20.518 128.212 5.348   1.00 101.16 ? 300 ASN B C     1 
ATOM   5543  O  O     . ASN B  2  284 ? -20.665 128.908 6.343   1.00 100.69 ? 300 ASN B O     1 
ATOM   5544  C  CB    . ASN B  2  284 ? -21.629 125.979 5.575   1.00 101.75 ? 300 ASN B CB    1 
ATOM   5545  C  CG    . ASN B  2  284 ? -22.970 125.273 5.556   1.00 102.14 ? 300 ASN B CG    1 
ATOM   5546  O  OD1   . ASN B  2  284 ? -23.759 125.436 4.626   1.00 103.31 ? 300 ASN B OD1   1 
ATOM   5547  N  ND2   . ASN B  2  284 ? -23.238 124.487 6.591   1.00 102.05 ? 300 ASN B ND2   1 
ATOM   5548  N  N     . ILE B  2  285 ? -19.384 128.185 4.652   1.00 101.10 ? 301 ILE B N     1 
ATOM   5549  C  CA    . ILE B  2  285 ? -18.243 129.000 5.059   1.00 101.52 ? 301 ILE B CA    1 
ATOM   5550  C  C     . ILE B  2  285 ? -18.333 130.415 4.504   1.00 102.39 ? 301 ILE B C     1 
ATOM   5551  O  O     . ILE B  2  285 ? -17.975 131.374 5.187   1.00 102.85 ? 301 ILE B O     1 
ATOM   5552  C  CB    . ILE B  2  285 ? -16.886 128.383 4.649   1.00 100.98 ? 301 ILE B CB    1 
ATOM   5553  C  CG1   . ILE B  2  285 ? -15.754 129.172 5.313   1.00 100.72 ? 301 ILE B CG1   1 
ATOM   5554  C  CG2   . ILE B  2  285 ? -16.729 128.375 3.131   1.00 100.24 ? 301 ILE B CG2   1 
ATOM   5555  C  CD1   . ILE B  2  285 ? -14.376 128.849 4.803   1.00 101.55 ? 301 ILE B CD1   1 
ATOM   5556  N  N     . LYS B  2  286 ? -18.807 130.537 3.266   1.00 103.28 ? 302 LYS B N     1 
ATOM   5557  C  CA    . LYS B  2  286 ? -18.958 131.836 2.608   1.00 103.95 ? 302 LYS B CA    1 
ATOM   5558  C  C     . LYS B  2  286 ? -19.974 132.683 3.381   1.00 104.71 ? 302 LYS B C     1 
ATOM   5559  O  O     . LYS B  2  286 ? -19.949 133.913 3.326   1.00 105.40 ? 302 LYS B O     1 
ATOM   5560  C  CB    . LYS B  2  286 ? -19.412 131.634 1.162   1.00 103.15 ? 302 LYS B CB    1 
ATOM   5561  C  CG    . LYS B  2  286 ? -19.237 132.842 0.270   1.00 104.02 ? 302 LYS B CG    1 
ATOM   5562  C  CD    . LYS B  2  286 ? -19.462 132.475 -1.190  1.00 104.58 ? 302 LYS B CD    1 
ATOM   5563  C  CE    . LYS B  2  286 ? -18.425 131.472 -1.685  1.00 103.87 ? 302 LYS B CE    1 
ATOM   5564  N  NZ    . LYS B  2  286 ? -18.635 131.106 -3.117  1.00 104.13 ? 302 LYS B NZ    1 
ATOM   5565  N  N     . LYS B  2  287 ? -20.844 131.999 4.121   1.00 104.96 ? 303 LYS B N     1 
ATOM   5566  C  CA    . LYS B  2  287 ? -21.872 132.620 4.945   1.00 105.25 ? 303 LYS B CA    1 
ATOM   5567  C  C     . LYS B  2  287 ? -21.276 133.035 6.292   1.00 105.82 ? 303 LYS B C     1 
ATOM   5568  O  O     . LYS B  2  287 ? -21.570 134.116 6.795   1.00 106.21 ? 303 LYS B O     1 
ATOM   5569  C  CB    . LYS B  2  287 ? -23.016 131.622 5.166   1.00 105.80 ? 303 LYS B CB    1 
ATOM   5570  C  CG    . LYS B  2  287 ? -24.072 132.033 6.190   1.00 106.54 ? 303 LYS B CG    1 
ATOM   5571  C  CD    . LYS B  2  287 ? -25.101 132.984 5.609   1.00 106.84 ? 303 LYS B CD    1 
ATOM   5572  C  CE    . LYS B  2  287 ? -26.229 133.226 6.604   1.00 106.63 ? 303 LYS B CE    1 
ATOM   5573  N  NZ    . LYS B  2  287 ? -27.341 134.026 6.019   1.00 106.66 ? 303 LYS B NZ    1 
ATOM   5574  N  N     . ILE B  2  288 ? -20.441 132.170 6.869   1.00 106.63 ? 304 ILE B N     1 
ATOM   5575  C  CA    . ILE B  2  288 ? -19.806 132.443 8.161   1.00 106.89 ? 304 ILE B CA    1 
ATOM   5576  C  C     . ILE B  2  288 ? -18.889 133.656 8.061   1.00 107.35 ? 304 ILE B C     1 
ATOM   5577  O  O     . ILE B  2  288 ? -18.943 134.555 8.903   1.00 107.09 ? 304 ILE B O     1 
ATOM   5578  C  CB    . ILE B  2  288 ? -18.963 131.239 8.665   1.00 106.46 ? 304 ILE B CB    1 
ATOM   5579  C  CG1   . ILE B  2  288 ? -19.815 129.975 8.768   1.00 105.82 ? 304 ILE B CG1   1 
ATOM   5580  C  CG2   . ILE B  2  288 ? -18.373 131.548 10.032  1.00 106.31 ? 304 ILE B CG2   1 
ATOM   5581  C  CD1   . ILE B  2  288 ? -20.945 130.062 9.752   1.00 105.67 ? 304 ILE B CD1   1 
ATOM   5582  N  N     . VAL B  2  289 ? -18.051 133.675 7.028   1.00 107.99 ? 305 VAL B N     1 
ATOM   5583  C  CA    . VAL B  2  289 ? -17.118 134.775 6.813   1.00 108.99 ? 305 VAL B CA    1 
ATOM   5584  C  C     . VAL B  2  289 ? -17.864 136.099 6.639   1.00 109.91 ? 305 VAL B C     1 
ATOM   5585  O  O     . VAL B  2  289 ? -17.462 137.120 7.198   1.00 109.60 ? 305 VAL B O     1 
ATOM   5586  C  CB    . VAL B  2  289 ? -16.202 134.506 5.591   1.00 108.70 ? 305 VAL B CB    1 
ATOM   5587  C  CG1   . VAL B  2  289 ? -15.244 135.664 5.374   1.00 108.39 ? 305 VAL B CG1   1 
ATOM   5588  C  CG2   . VAL B  2  289 ? -15.416 133.223 5.804   1.00 108.52 ? 305 VAL B CG2   1 
ATOM   5589  N  N     . ALA B  2  290 ? -18.976 136.061 5.905   1.00 110.90 ? 306 ALA B N     1 
ATOM   5590  C  CA    . ALA B  2  290 ? -19.791 137.250 5.665   1.00 111.68 ? 306 ALA B CA    1 
ATOM   5591  C  C     . ALA B  2  290 ? -20.487 137.759 6.930   1.00 112.31 ? 306 ALA B C     1 
ATOM   5592  O  O     . ALA B  2  290 ? -20.498 138.959 7.193   1.00 112.49 ? 306 ALA B O     1 
ATOM   5593  C  CB    . ALA B  2  290 ? -20.816 136.974 4.579   1.00 111.77 ? 306 ALA B CB    1 
ATOM   5594  N  N     . ASP B  2  291 ? -21.069 136.847 7.704   1.00 113.26 ? 307 ASP B N     1 
ATOM   5595  C  CA    . ASP B  2  291 ? -21.757 137.214 8.937   1.00 115.02 ? 307 ASP B CA    1 
ATOM   5596  C  C     . ASP B  2  291 ? -20.798 137.652 10.037  1.00 116.75 ? 307 ASP B C     1 
ATOM   5597  O  O     . ASP B  2  291 ? -21.179 138.415 10.927  1.00 117.09 ? 307 ASP B O     1 
ATOM   5598  C  CB    . ASP B  2  291 ? -22.629 136.060 9.440   1.00 114.81 ? 307 ASP B CB    1 
ATOM   5599  C  CG    . ASP B  2  291 ? -24.031 136.085 8.858   1.00 114.77 ? 307 ASP B CG    1 
ATOM   5600  O  OD1   . ASP B  2  291 ? -24.983 135.784 9.608   1.00 114.03 ? 307 ASP B OD1   1 
ATOM   5601  O  OD2   . ASP B  2  291 ? -24.185 136.403 7.658   1.00 115.21 ? 307 ASP B OD2   1 
ATOM   5602  N  N     . LEU B  2  292 ? -19.566 137.151 9.991   1.00 118.53 ? 308 LEU B N     1 
ATOM   5603  C  CA    . LEU B  2  292 ? -18.565 137.516 10.990  1.00 120.39 ? 308 LEU B CA    1 
ATOM   5604  C  C     . LEU B  2  292 ? -17.890 138.843 10.652  1.00 121.47 ? 308 LEU B C     1 
ATOM   5605  O  O     . LEU B  2  292 ? -17.373 139.523 11.539  1.00 121.43 ? 308 LEU B O     1 
ATOM   5606  C  CB    . LEU B  2  292 ? -17.521 136.407 11.164  1.00 120.33 ? 308 LEU B CB    1 
ATOM   5607  C  CG    . LEU B  2  292 ? -17.938 135.184 11.986  1.00 120.25 ? 308 LEU B CG    1 
ATOM   5608  C  CD1   . LEU B  2  292 ? -16.744 134.254 12.144  1.00 120.14 ? 308 LEU B CD1   1 
ATOM   5609  C  CD2   . LEU B  2  292 ? -18.457 135.617 13.355  1.00 119.99 ? 308 LEU B CD2   1 
ATOM   5610  N  N     . LYS B  2  293 ? -17.885 139.196 9.367   1.00 122.81 ? 309 LYS B N     1 
ATOM   5611  C  CA    . LYS B  2  293 ? -17.302 140.459 8.913   1.00 124.49 ? 309 LYS B CA    1 
ATOM   5612  C  C     . LYS B  2  293 ? -18.207 141.604 9.367   1.00 125.97 ? 309 LYS B C     1 
ATOM   5613  O  O     . LYS B  2  293 ? -17.785 142.758 9.453   1.00 126.13 ? 309 LYS B O     1 
ATOM   5614  C  CB    . LYS B  2  293 ? -17.157 140.467 7.391   1.00 124.19 ? 309 LYS B CB    1 
ATOM   5615  C  CG    . LYS B  2  293 ? -15.727 140.294 6.905   1.00 124.11 ? 309 LYS B CG    1 
ATOM   5616  C  CD    . LYS B  2  293 ? -15.676 140.094 5.398   1.00 124.40 ? 309 LYS B CD    1 
ATOM   5617  C  CE    . LYS B  2  293 ? -14.258 140.226 4.855   1.00 124.74 ? 309 LYS B CE    1 
ATOM   5618  N  NZ    . LYS B  2  293 ? -13.300 139.268 5.471   1.00 125.78 ? 309 LYS B NZ    1 
ATOM   5619  N  N     . LYS B  2  294 ? -19.462 141.260 9.641   1.00 127.43 ? 310 LYS B N     1 
ATOM   5620  C  CA    . LYS B  2  294 ? -20.472 142.194 10.126  1.00 128.55 ? 310 LYS B CA    1 
ATOM   5621  C  C     . LYS B  2  294 ? -20.729 141.733 11.564  1.00 129.15 ? 310 LYS B C     1 
ATOM   5622  O  O     . LYS B  2  294 ? -21.868 141.491 11.972  1.00 129.03 ? 310 LYS B O     1 
ATOM   5623  C  CB    . LYS B  2  294 ? -21.738 142.065 9.272   1.00 128.87 ? 310 LYS B CB    1 
ATOM   5624  C  CG    . LYS B  2  294 ? -22.830 143.069 9.590   1.00 129.98 ? 310 LYS B CG    1 
ATOM   5625  C  CD    . LYS B  2  294 ? -24.025 142.896 8.659   1.00 130.24 ? 310 LYS B CD    1 
ATOM   5626  C  CE    . LYS B  2  294 ? -25.146 143.868 9.008   1.00 130.04 ? 310 LYS B CE    1 
ATOM   5627  N  NZ    . LYS B  2  294 ? -24.691 145.289 8.973   1.00 129.08 ? 310 LYS B NZ    1 
ATOM   5628  N  N     . GLY B  2  295 ? -19.634 141.607 12.310  1.00 130.18 ? 311 GLY B N     1 
ATOM   5629  C  CA    . GLY B  2  295 ? -19.658 141.138 13.687  1.00 131.95 ? 311 GLY B CA    1 
ATOM   5630  C  C     . GLY B  2  295 ? -20.703 141.642 14.663  1.00 132.73 ? 311 GLY B C     1 
ATOM   5631  O  O     . GLY B  2  295 ? -21.241 142.739 14.521  1.00 133.58 ? 311 GLY B O     1 
ATOM   5632  N  N     . LYS B  2  296 ? -20.966 140.816 15.673  1.00 133.14 ? 312 LYS B N     1 
ATOM   5633  C  CA    . LYS B  2  296 ? -21.929 141.107 16.728  1.00 134.06 ? 312 LYS B CA    1 
ATOM   5634  C  C     . LYS B  2  296 ? -21.713 140.102 17.850  1.00 134.68 ? 312 LYS B C     1 
ATOM   5635  O  O     . LYS B  2  296 ? -21.211 139.007 17.608  1.00 135.43 ? 312 LYS B O     1 
ATOM   5636  C  CB    . LYS B  2  296 ? -23.369 140.995 16.204  1.00 134.54 ? 312 LYS B CB    1 
ATOM   5637  C  CG    . LYS B  2  296 ? -23.876 139.572 15.928  1.00 135.39 ? 312 LYS B CG    1 
ATOM   5638  C  CD    . LYS B  2  296 ? -23.394 139.009 14.593  1.00 135.42 ? 312 LYS B CD    1 
ATOM   5639  C  CE    . LYS B  2  296 ? -24.020 137.643 14.321  1.00 134.88 ? 312 LYS B CE    1 
ATOM   5640  N  NZ    . LYS B  2  296 ? -23.707 137.130 12.957  1.00 134.34 ? 312 LYS B NZ    1 
ATOM   5641  N  N     . ASP B  2  297 ? -22.092 140.466 19.071  1.00 135.38 ? 313 ASP B N     1 
ATOM   5642  C  CA    . ASP B  2  297 ? -21.929 139.561 20.204  1.00 136.39 ? 313 ASP B CA    1 
ATOM   5643  C  C     . ASP B  2  297 ? -22.893 139.892 21.336  1.00 137.37 ? 313 ASP B C     1 
ATOM   5644  O  O     . ASP B  2  297 ? -23.823 139.130 21.598  1.00 136.76 ? 313 ASP B O     1 
ATOM   5645  C  CB    . ASP B  2  297 ? -20.481 139.594 20.715  1.00 135.94 ? 313 ASP B CB    1 
ATOM   5646  C  CG    . ASP B  2  297 ? -20.117 138.366 21.543  1.00 135.37 ? 313 ASP B CG    1 
ATOM   5647  O  OD1   . ASP B  2  297 ? -20.699 138.174 22.631  1.00 134.53 ? 313 ASP B OD1   1 
ATOM   5648  O  OD2   . ASP B  2  297 ? -19.240 137.592 21.103  1.00 134.48 ? 313 ASP B OD2   1 
ATOM   5649  N  N     . LEU B  2  298 ? -22.664 141.030 21.991  1.00 139.09 ? 314 LEU B N     1 
ATOM   5650  C  CA    . LEU B  2  298 ? -23.481 141.502 23.117  1.00 140.17 ? 314 LEU B CA    1 
ATOM   5651  C  C     . LEU B  2  298 ? -23.323 140.627 24.364  1.00 140.84 ? 314 LEU B C     1 
ATOM   5652  O  O     . LEU B  2  298 ? -23.963 140.869 25.388  1.00 140.81 ? 314 LEU B O     1 
ATOM   5653  C  CB    . LEU B  2  298 ? -24.960 141.611 22.718  1.00 140.38 ? 314 LEU B CB    1 
ATOM   5654  C  CG    . LEU B  2  298 ? -25.302 142.582 21.583  1.00 140.29 ? 314 LEU B CG    1 
ATOM   5655  C  CD1   . LEU B  2  298 ? -26.783 142.491 21.253  1.00 139.98 ? 314 LEU B CD1   1 
ATOM   5656  C  CD2   . LEU B  2  298 ? -24.923 144.001 21.977  1.00 140.57 ? 314 LEU B CD2   1 
ATOM   5657  N  N     . SER B  2  299 ? -22.463 139.614 24.255  1.00 141.55 ? 315 SER B N     1 
ATOM   5658  C  CA    . SER B  2  299 ? -22.154 138.669 25.329  1.00 142.37 ? 315 SER B CA    1 
ATOM   5659  C  C     . SER B  2  299 ? -23.332 138.030 26.069  1.00 142.61 ? 315 SER B C     1 
ATOM   5660  O  O     . SER B  2  299 ? -23.373 138.034 27.300  1.00 142.28 ? 315 SER B O     1 
ATOM   5661  C  CB    . SER B  2  299 ? -21.182 139.299 26.334  1.00 143.08 ? 315 SER B CB    1 
ATOM   5662  O  OG    . SER B  2  299 ? -21.765 140.409 26.998  1.00 144.29 ? 315 SER B OG    1 
ATOM   5663  N  N     . PRO B  2  300 ? -24.304 137.469 25.331  1.00 143.15 ? 316 PRO B N     1 
ATOM   5664  C  CA    . PRO B  2  300 ? -25.455 136.834 25.984  1.00 143.68 ? 316 PRO B CA    1 
ATOM   5665  C  C     . PRO B  2  300 ? -25.001 135.496 26.563  1.00 144.32 ? 316 PRO B C     1 
ATOM   5666  O  O     . PRO B  2  300 ? -25.548 135.007 27.555  1.00 144.49 ? 316 PRO B O     1 
ATOM   5667  C  CB    . PRO B  2  300 ? -26.430 136.615 24.821  1.00 143.80 ? 316 PRO B CB    1 
ATOM   5668  C  CG    . PRO B  2  300 ? -25.960 137.581 23.754  1.00 143.41 ? 316 PRO B CG    1 
ATOM   5669  C  CD    . PRO B  2  300 ? -24.477 137.460 23.872  1.00 143.15 ? 316 PRO B CD    1 
ATOM   5670  N  N     . ALA B  2  301 ? -23.986 134.922 25.920  1.00 144.67 ? 317 ALA B N     1 
ATOM   5671  C  CA    . ALA B  2  301 ? -23.405 133.646 26.316  1.00 144.83 ? 317 ALA B CA    1 
ATOM   5672  C  C     . ALA B  2  301 ? -22.253 133.848 27.295  1.00 144.78 ? 317 ALA B C     1 
ATOM   5673  O  O     . ALA B  2  301 ? -21.381 132.990 27.419  1.00 145.29 ? 317 ALA B O     1 
ATOM   5674  C  CB    . ALA B  2  301 ? -22.916 132.898 25.080  1.00 145.24 ? 317 ALA B CB    1 
ATOM   5675  N  N     . ILE B  2  302 ? -22.259 134.981 27.990  1.00 144.49 ? 318 ILE B N     1 
ATOM   5676  C  CA    . ILE B  2  302 ? -21.219 135.306 28.961  1.00 143.96 ? 318 ILE B CA    1 
ATOM   5677  C  C     . ILE B  2  302 ? -21.210 134.315 30.129  1.00 143.26 ? 318 ILE B C     1 
ATOM   5678  O  O     . ILE B  2  302 ? -20.162 134.043 30.720  1.00 143.29 ? 318 ILE B O     1 
ATOM   5679  C  CB    . ILE B  2  302 ? -21.392 136.754 29.497  1.00 144.44 ? 318 ILE B CB    1 
ATOM   5680  C  CG1   . ILE B  2  302 ? -20.172 137.172 30.324  1.00 144.47 ? 318 ILE B CG1   1 
ATOM   5681  C  CG2   . ILE B  2  302 ? -22.676 136.880 30.315  1.00 144.28 ? 318 ILE B CG2   1 
ATOM   5682  C  CD1   . ILE B  2  302 ? -18.893 137.248 29.523  1.00 144.38 ? 318 ILE B CD1   1 
ATOM   5683  N  N     . ASN B  2  303 ? -22.379 133.768 30.442  1.00 142.47 ? 319 ASN B N     1 
ATOM   5684  C  CA    . ASN B  2  303 ? -22.511 132.811 31.532  1.00 141.81 ? 319 ASN B CA    1 
ATOM   5685  C  C     . ASN B  2  303 ? -22.375 131.371 31.036  1.00 141.35 ? 319 ASN B C     1 
ATOM   5686  O  O     . ASN B  2  303 ? -22.178 130.451 31.831  1.00 141.28 ? 319 ASN B O     1 
ATOM   5687  C  CB    . ASN B  2  303 ? -23.845 133.015 32.256  1.00 141.79 ? 319 ASN B CB    1 
ATOM   5688  C  CG    . ASN B  2  303 ? -23.983 134.413 32.838  1.00 141.44 ? 319 ASN B CG    1 
ATOM   5689  O  OD1   . ASN B  2  303 ? -23.137 134.864 33.610  1.00 140.75 ? 319 ASN B OD1   1 
ATOM   5690  N  ND2   . ASN B  2  303 ? -25.049 135.110 32.457  1.00 141.35 ? 319 ASN B ND2   1 
ATOM   5691  N  N     . TYR B  2  304 ? -22.492 131.185 29.722  1.00 140.56 ? 320 TYR B N     1 
ATOM   5692  C  CA    . TYR B  2  304 ? -22.359 129.864 29.109  1.00 139.69 ? 320 TYR B CA    1 
ATOM   5693  C  C     . TYR B  2  304 ? -20.874 129.602 28.848  1.00 139.14 ? 320 TYR B C     1 
ATOM   5694  O  O     . TYR B  2  304 ? -20.376 128.509 29.114  1.00 139.63 ? 320 TYR B O     1 
ATOM   5695  C  CB    . TYR B  2  304 ? -23.159 129.793 27.798  1.00 139.43 ? 320 TYR B CB    1 
ATOM   5696  C  CG    . TYR B  2  304 ? -23.204 128.422 27.135  1.00 138.45 ? 320 TYR B CG    1 
ATOM   5697  C  CD1   . TYR B  2  304 ? -22.550 128.190 25.922  1.00 138.00 ? 320 TYR B CD1   1 
ATOM   5698  C  CD2   . TYR B  2  304 ? -23.919 127.368 27.708  1.00 137.81 ? 320 TYR B CD2   1 
ATOM   5699  C  CE1   . TYR B  2  304 ? -22.608 126.945 25.297  1.00 137.63 ? 320 TYR B CE1   1 
ATOM   5700  C  CE2   . TYR B  2  304 ? -23.983 126.119 27.088  1.00 137.58 ? 320 TYR B CE2   1 
ATOM   5701  C  CZ    . TYR B  2  304 ? -23.326 125.916 25.884  1.00 137.72 ? 320 TYR B CZ    1 
ATOM   5702  O  OH    . TYR B  2  304 ? -23.386 124.686 25.267  1.00 137.46 ? 320 TYR B OH    1 
ATOM   5703  N  N     . THR B  2  305 ? -20.172 130.621 28.354  1.00 138.07 ? 321 THR B N     1 
ATOM   5704  C  CA    . THR B  2  305 ? -18.744 130.516 28.065  1.00 137.42 ? 321 THR B CA    1 
ATOM   5705  C  C     . THR B  2  305 ? -17.926 130.387 29.347  1.00 137.89 ? 321 THR B C     1 
ATOM   5706  O  O     . THR B  2  305 ? -16.782 129.934 29.320  1.00 138.22 ? 321 THR B O     1 
ATOM   5707  C  CB    . THR B  2  305 ? -18.234 131.733 27.268  1.00 136.54 ? 321 THR B CB    1 
ATOM   5708  O  OG1   . THR B  2  305 ? -16.843 131.563 26.975  1.00 135.88 ? 321 THR B OG1   1 
ATOM   5709  C  CG2   . THR B  2  305 ? -18.412 133.009 28.066  1.00 136.99 ? 321 THR B CG2   1 
ATOM   5710  N  N     . LYS B  2  306 ? -18.514 130.808 30.462  1.00 138.31 ? 322 LYS B N     1 
ATOM   5711  C  CA    . LYS B  2  306 ? -17.854 130.735 31.757  1.00 138.88 ? 322 LYS B CA    1 
ATOM   5712  C  C     . LYS B  2  306 ? -18.128 129.368 32.381  1.00 138.91 ? 322 LYS B C     1 
ATOM   5713  O  O     . LYS B  2  306 ? -17.266 128.800 33.050  1.00 139.22 ? 322 LYS B O     1 
ATOM   5714  C  CB    . LYS B  2  306 ? -18.364 131.855 32.667  1.00 139.66 ? 322 LYS B CB    1 
ATOM   5715  C  CG    . LYS B  2  306 ? -17.523 132.088 33.912  1.00 140.87 ? 322 LYS B CG    1 
ATOM   5716  C  CD    . LYS B  2  306 ? -18.047 133.270 34.715  1.00 141.41 ? 322 LYS B CD    1 
ATOM   5717  C  CE    . LYS B  2  306 ? -17.221 133.496 35.970  1.00 141.93 ? 322 LYS B CE    1 
ATOM   5718  N  NZ    . LYS B  2  306 ? -17.759 134.618 36.786  1.00 142.17 ? 322 LYS B NZ    1 
ATOM   5719  N  N     . LEU B  2  307 ? -19.327 128.843 32.136  1.00 138.96 ? 323 LEU B N     1 
ATOM   5720  C  CA    . LEU B  2  307 ? -19.740 127.537 32.651  1.00 139.18 ? 323 LEU B CA    1 
ATOM   5721  C  C     . LEU B  2  307 ? -19.021 126.408 31.919  1.00 139.74 ? 323 LEU B C     1 
ATOM   5722  O  O     . LEU B  2  307 ? -18.593 125.431 32.536  1.00 139.77 ? 323 LEU B O     1 
ATOM   5723  C  CB    . LEU B  2  307 ? -21.264 127.377 32.520  1.00 138.29 ? 323 LEU B CB    1 
ATOM   5724  C  CG    . LEU B  2  307 ? -21.995 126.077 32.892  1.00 137.44 ? 323 LEU B CG    1 
ATOM   5725  C  CD1   . LEU B  2  307 ? -21.979 125.092 31.736  1.00 137.11 ? 323 LEU B CD1   1 
ATOM   5726  C  CD2   . LEU B  2  307 ? -21.416 125.465 34.156  1.00 136.55 ? 323 LEU B CD2   1 
ATOM   5727  N  N     . LYS B  2  308 ? -18.892 126.549 30.603  1.00 140.48 ? 324 LYS B N     1 
ATOM   5728  C  CA    . LYS B  2  308 ? -18.228 125.544 29.781  1.00 141.58 ? 324 LYS B CA    1 
ATOM   5729  C  C     . LYS B  2  308 ? -16.719 125.554 30.031  1.00 142.03 ? 324 LYS B C     1 
ATOM   5730  O  O     . LYS B  2  308 ? -16.047 124.536 29.857  1.00 142.57 ? 324 LYS B O     1 
ATOM   5731  C  CB    . LYS B  2  308 ? -18.519 125.798 28.296  1.00 141.89 ? 324 LYS B CB    1 
ATOM   5732  C  CG    . LYS B  2  308 ? -18.577 124.538 27.430  1.00 142.88 ? 324 LYS B CG    1 
ATOM   5733  C  CD    . LYS B  2  308 ? -19.838 123.720 27.709  1.00 143.41 ? 324 LYS B CD    1 
ATOM   5734  C  CE    . LYS B  2  308 ? -19.906 122.465 26.845  1.00 143.75 ? 324 LYS B CE    1 
ATOM   5735  N  NZ    . LYS B  2  308 ? -18.808 121.500 27.154  1.00 144.12 ? 324 LYS B NZ    1 
ATOM   5736  N  N     . ASN B  2  309 ? -16.194 126.701 30.454  1.00 142.28 ? 325 ASN B N     1 
ATOM   5737  C  CA    . ASN B  2  309 ? -14.767 126.832 30.728  1.00 142.61 ? 325 ASN B CA    1 
ATOM   5738  C  C     . ASN B  2  309 ? -14.435 126.472 32.178  1.00 142.83 ? 325 ASN B C     1 
ATOM   5739  O  O     . ASN B  2  309 ? -13.347 126.769 32.671  1.00 142.28 ? 325 ASN B O     1 
ATOM   5740  C  CB    . ASN B  2  309 ? -14.296 128.252 30.408  1.00 142.70 ? 325 ASN B CB    1 
ATOM   5741  C  CG    . ASN B  2  309 ? -12.899 128.283 29.821  1.00 142.86 ? 325 ASN B CG    1 
ATOM   5742  O  OD1   . ASN B  2  309 ? -12.056 129.075 30.237  1.00 142.73 ? 325 ASN B OD1   1 
ATOM   5743  N  ND2   . ASN B  2  309 ? -12.650 127.421 28.842  1.00 142.99 ? 325 ASN B ND2   1 
ATOM   5744  N  N     . ALA B  2  310 ? -15.385 125.825 32.847  1.00 143.71 ? 326 ALA B N     1 
ATOM   5745  C  CA    . ALA B  2  310 ? -15.220 125.405 34.233  1.00 145.04 ? 326 ALA B CA    1 
ATOM   5746  C  C     . ALA B  2  310 ? -15.327 123.889 34.348  1.00 146.14 ? 326 ALA B C     1 
ATOM   5747  O  O     . ALA B  2  310 ? -14.776 123.291 35.273  1.00 146.27 ? 326 ALA B O     1 
ATOM   5748  C  CB    . ALA B  2  310 ? -16.262 126.073 35.118  1.00 145.24 ? 326 ALA B CB    1 
ATOM   5749  N  N     . VAL B  2  311 ? -16.034 123.273 33.399  1.00 147.58 ? 327 VAL B N     1 
ATOM   5750  C  CA    . VAL B  2  311 ? -16.214 121.821 33.375  1.00 148.83 ? 327 VAL B CA    1 
ATOM   5751  C  C     . VAL B  2  311 ? -14.870 121.119 33.200  1.00 150.10 ? 327 VAL B C     1 
ATOM   5752  O  O     . VAL B  2  311 ? -14.768 119.903 33.365  1.00 150.26 ? 327 VAL B O     1 
ATOM   5753  C  CB    . VAL B  2  311 ? -17.173 121.376 32.243  1.00 148.35 ? 327 VAL B CB    1 
ATOM   5754  C  CG1   . VAL B  2  311 ? -18.541 122.006 32.434  1.00 148.11 ? 327 VAL B CG1   1 
ATOM   5755  C  CG2   . VAL B  2  311 ? -16.601 121.738 30.880  1.00 148.19 ? 327 VAL B CG2   1 
ATOM   5756  N  N     . GLN B  2  312 ? -13.851 121.903 32.857  1.00 151.68 ? 328 GLN B N     1 
ATOM   5757  C  CA    . GLN B  2  312 ? -12.498 121.400 32.669  1.00 153.85 ? 328 GLN B CA    1 
ATOM   5758  C  C     . GLN B  2  312 ? -11.797 121.362 34.027  1.00 156.32 ? 328 GLN B C     1 
ATOM   5759  O  O     . GLN B  2  312 ? -11.088 122.298 34.404  1.00 156.19 ? 328 GLN B O     1 
ATOM   5760  C  CB    . GLN B  2  312 ? -11.746 122.302 31.688  1.00 152.47 ? 328 GLN B CB    1 
ATOM   5761  C  CG    . GLN B  2  312 ? -12.431 122.412 30.333  1.00 150.78 ? 328 GLN B CG    1 
ATOM   5762  C  CD    . GLN B  2  312 ? -11.772 123.418 29.416  1.00 149.99 ? 328 GLN B CD    1 
ATOM   5763  O  OE1   . GLN B  2  312 ? -10.552 123.433 29.262  1.00 149.72 ? 328 GLN B OE1   1 
ATOM   5764  N  NE2   . GLN B  2  312 ? -12.582 124.265 28.794  1.00 149.51 ? 328 GLN B NE2   1 
ATOM   5765  N  N     . ASN B  2  313 ? -12.036 120.278 34.765  1.00 159.53 ? 329 ASN B N     1 
ATOM   5766  C  CA    . ASN B  2  313 ? -11.461 120.077 36.097  1.00 162.45 ? 329 ASN B CA    1 
ATOM   5767  C  C     . ASN B  2  313 ? -9.999  119.636 36.106  1.00 164.13 ? 329 ASN B C     1 
ATOM   5768  O  O     . ASN B  2  313 ? -9.366  119.600 37.164  1.00 164.33 ? 329 ASN B O     1 
ATOM   5769  C  CB    . ASN B  2  313 ? -12.310 119.087 36.903  1.00 162.72 ? 329 ASN B CB    1 
ATOM   5770  C  CG    . ASN B  2  313 ? -13.633 119.681 37.346  1.00 163.09 ? 329 ASN B CG    1 
ATOM   5771  O  OD1   . ASN B  2  313 ? -13.686 120.472 38.288  1.00 162.82 ? 329 ASN B OD1   1 
ATOM   5772  N  ND2   . ASN B  2  313 ? -14.710 119.310 36.660  1.00 163.32 ? 329 ASN B ND2   1 
ATOM   5773  N  N     . GLU B  2  314 ? -9.473  119.265 34.942  1.00 165.87 ? 330 GLU B N     1 
ATOM   5774  C  CA    . GLU B  2  314 ? -8.076  118.856 34.845  1.00 167.56 ? 330 GLU B CA    1 
ATOM   5775  C  C     . GLU B  2  314 ? -7.227  120.108 34.615  1.00 168.66 ? 330 GLU B C     1 
ATOM   5776  O  O     . GLU B  2  314 ? -6.008  120.094 34.799  1.00 168.72 ? 330 GLU B O     1 
ATOM   5777  C  CB    . GLU B  2  314 ? -7.885  117.839 33.708  1.00 167.83 ? 330 GLU B CB    1 
ATOM   5778  C  CG    . GLU B  2  314 ? -8.041  118.386 32.283  1.00 168.30 ? 330 GLU B CG    1 
ATOM   5779  C  CD    . GLU B  2  314 ? -6.716  118.819 31.661  1.00 168.53 ? 330 GLU B CD    1 
ATOM   5780  O  OE1   . GLU B  2  314 ? -6.562  120.017 31.343  1.00 168.68 ? 330 GLU B OE1   1 
ATOM   5781  O  OE2   . GLU B  2  314 ? -5.827  117.958 31.483  1.00 168.53 ? 330 GLU B OE2   1 
ATOM   5782  N  N     . SER B  2  315 ? -7.899  121.194 34.240  1.00 170.06 ? 331 SER B N     1 
ATOM   5783  C  CA    . SER B  2  315 ? -7.252  122.472 33.969  1.00 171.37 ? 331 SER B CA    1 
ATOM   5784  C  C     . SER B  2  315 ? -7.457  123.476 35.106  1.00 172.11 ? 331 SER B C     1 
ATOM   5785  O  O     . SER B  2  315 ? -7.814  124.633 34.865  1.00 172.50 ? 331 SER B O     1 
ATOM   5786  C  CB    . SER B  2  315 ? -7.779  123.051 32.649  1.00 171.54 ? 331 SER B CB    1 
ATOM   5787  O  OG    . SER B  2  315 ? -7.128  124.266 32.310  1.00 171.74 ? 331 SER B OG    1 
ATOM   5788  N  N     . VAL B  2  316 ? -7.251  123.031 36.345  1.00 172.62 ? 332 VAL B N     1 
ATOM   5789  C  CA    . VAL B  2  316 ? -7.397  123.921 37.497  1.00 172.96 ? 332 VAL B CA    1 
ATOM   5790  C  C     . VAL B  2  316 ? -6.064  124.645 37.711  1.00 173.07 ? 332 VAL B C     1 
ATOM   5791  O  O     . VAL B  2  316 ? -5.442  124.567 38.775  1.00 173.40 ? 332 VAL B O     1 
ATOM   5792  C  CB    . VAL B  2  316 ? -7.830  123.157 38.776  1.00 173.01 ? 332 VAL B CB    1 
ATOM   5793  C  CG1   . VAL B  2  316 ? -8.123  124.141 39.907  1.00 173.00 ? 332 VAL B CG1   1 
ATOM   5794  C  CG2   . VAL B  2  316 ? -9.068  122.321 38.493  1.00 172.85 ? 332 VAL B CG2   1 
ATOM   5795  N  N     . SER B  2  317 ? -5.627  125.317 36.650  1.00 172.90 ? 333 SER B N     1 
ATOM   5796  C  CA    . SER B  2  317 ? -4.385  126.084 36.614  1.00 172.53 ? 333 SER B CA    1 
ATOM   5797  C  C     . SER B  2  317 ? -4.421  126.963 35.360  1.00 172.46 ? 333 SER B C     1 
ATOM   5798  O  O     . SER B  2  317 ? -3.385  127.419 34.872  1.00 172.42 ? 333 SER B O     1 
ATOM   5799  C  CB    . SER B  2  317 ? -3.170  125.143 36.581  1.00 172.24 ? 333 SER B CB    1 
ATOM   5800  O  OG    . SER B  2  317 ? -3.255  124.208 35.517  1.00 171.51 ? 333 SER B OG    1 
ATOM   5801  N  N     . SER B  2  318 ? -5.634  127.196 34.862  1.00 172.38 ? 334 SER B N     1 
ATOM   5802  C  CA    . SER B  2  318 ? -5.879  128.004 33.668  1.00 172.27 ? 334 SER B CA    1 
ATOM   5803  C  C     . SER B  2  318 ? -5.530  129.479 33.880  1.00 172.14 ? 334 SER B C     1 
ATOM   5804  O  O     . SER B  2  318 ? -5.594  129.983 35.003  1.00 172.18 ? 334 SER B O     1 
ATOM   5805  C  CB    . SER B  2  318 ? -7.349  127.880 33.245  1.00 172.23 ? 334 SER B CB    1 
ATOM   5806  O  OG    . SER B  2  318 ? -8.217  128.412 34.234  1.00 171.85 ? 334 SER B OG    1 
ATOM   5807  N  N     . PRO B  2  319 ? -5.156  130.185 32.795  1.00 171.94 ? 335 PRO B N     1 
ATOM   5808  C  CA    . PRO B  2  319 ? -4.787  131.606 32.804  1.00 171.69 ? 335 PRO B CA    1 
ATOM   5809  C  C     . PRO B  2  319 ? -5.862  132.554 33.360  1.00 171.55 ? 335 PRO B C     1 
ATOM   5810  O  O     . PRO B  2  319 ? -6.320  132.389 34.492  1.00 171.55 ? 335 PRO B O     1 
ATOM   5811  C  CB    . PRO B  2  319 ? -4.484  131.881 31.329  1.00 171.53 ? 335 PRO B CB    1 
ATOM   5812  C  CG    . PRO B  2  319 ? -3.931  130.581 30.861  1.00 171.51 ? 335 PRO B CG    1 
ATOM   5813  C  CD    . PRO B  2  319 ? -4.911  129.603 31.462  1.00 171.72 ? 335 PRO B CD    1 
ATOM   5814  N  N     . ILE B  2  320 ? -6.256  133.546 32.564  1.00 171.42 ? 336 ILE B N     1 
ATOM   5815  C  CA    . ILE B  2  320 ? -7.255  134.523 32.996  1.00 171.12 ? 336 ILE B CA    1 
ATOM   5816  C  C     . ILE B  2  320 ? -8.655  133.924 33.137  1.00 170.81 ? 336 ILE B C     1 
ATOM   5817  O  O     . ILE B  2  320 ? -9.114  133.173 32.274  1.00 170.65 ? 336 ILE B O     1 
ATOM   5818  C  CB    . ILE B  2  320 ? -7.316  135.759 32.062  1.00 171.14 ? 336 ILE B CB    1 
ATOM   5819  C  CG1   . ILE B  2  320 ? -5.908  136.216 31.654  1.00 170.88 ? 336 ILE B CG1   1 
ATOM   5820  C  CG2   . ILE B  2  320 ? -7.968  136.911 32.799  1.00 171.12 ? 336 ILE B CG2   1 
ATOM   5821  C  CD1   . ILE B  2  320 ? -5.324  135.474 30.469  1.00 170.85 ? 336 ILE B CD1   1 
ATOM   5822  N  N     . GLU B  2  321 ? -9.334  134.291 34.221  1.00 170.49 ? 337 GLU B N     1 
ATOM   5823  C  CA    . GLU B  2  321 ? -10.672 133.785 34.511  1.00 170.27 ? 337 GLU B CA    1 
ATOM   5824  C  C     . GLU B  2  321 ? -11.769 134.855 34.406  1.00 170.03 ? 337 GLU B C     1 
ATOM   5825  O  O     . GLU B  2  321 ? -12.814 134.616 33.797  1.00 170.05 ? 337 GLU B O     1 
ATOM   5826  C  CB    . GLU B  2  321 ? -10.675 133.147 35.910  1.00 170.32 ? 337 GLU B CB    1 
ATOM   5827  C  CG    . GLU B  2  321 ? -11.678 132.012 36.114  1.00 170.30 ? 337 GLU B CG    1 
ATOM   5828  C  CD    . GLU B  2  321 ? -13.092 132.498 36.380  1.00 170.54 ? 337 GLU B CD    1 
ATOM   5829  O  OE1   . GLU B  2  321 ? -13.406 132.799 37.551  1.00 170.69 ? 337 GLU B OE1   1 
ATOM   5830  O  OE2   . GLU B  2  321 ? -13.893 132.568 35.424  1.00 170.57 ? 337 GLU B OE2   1 
ATOM   5831  N  N     . LEU B  2  322 ? -11.527 136.027 34.991  1.00 169.74 ? 338 LEU B N     1 
ATOM   5832  C  CA    . LEU B  2  322 ? -12.507 137.119 34.980  1.00 169.16 ? 338 LEU B CA    1 
ATOM   5833  C  C     . LEU B  2  322 ? -12.380 138.127 33.829  1.00 168.49 ? 338 LEU B C     1 
ATOM   5834  O  O     . LEU B  2  322 ? -13.040 139.172 33.843  1.00 168.65 ? 338 LEU B O     1 
ATOM   5835  C  CB    . LEU B  2  322 ? -12.486 137.862 36.325  1.00 169.22 ? 338 LEU B CB    1 
ATOM   5836  C  CG    . LEU B  2  322 ? -13.745 137.865 37.205  1.00 169.25 ? 338 LEU B CG    1 
ATOM   5837  C  CD1   . LEU B  2  322 ? -14.856 138.675 36.554  1.00 168.85 ? 338 LEU B CD1   1 
ATOM   5838  C  CD2   . LEU B  2  322 ? -14.204 136.439 37.489  1.00 169.42 ? 338 LEU B CD2   1 
ATOM   5839  N  N     . ASN B  2  323 ? -11.547 137.819 32.836  1.00 167.28 ? 339 ASN B N     1 
ATOM   5840  C  CA    . ASN B  2  323 ? -11.363 138.708 31.686  1.00 165.81 ? 339 ASN B CA    1 
ATOM   5841  C  C     . ASN B  2  323 ? -12.599 138.634 30.791  1.00 164.68 ? 339 ASN B C     1 
ATOM   5842  O  O     . ASN B  2  323 ? -12.805 139.482 29.920  1.00 164.65 ? 339 ASN B O     1 
ATOM   5843  C  CB    . ASN B  2  323 ? -10.121 138.301 30.890  1.00 166.03 ? 339 ASN B CB    1 
ATOM   5844  C  CG    . ASN B  2  323 ? -9.538  139.446 30.079  1.00 166.37 ? 339 ASN B CG    1 
ATOM   5845  O  OD1   . ASN B  2  323 ? -9.658  139.482 28.855  1.00 166.68 ? 339 ASN B OD1   1 
ATOM   5846  N  ND2   . ASN B  2  323 ? -8.886  140.380 30.761  1.00 166.28 ? 339 ASN B ND2   1 
ATOM   5847  N  N     . PHE B  2  324 ? -13.412 137.605 31.024  1.00 163.28 ? 340 PHE B N     1 
ATOM   5848  C  CA    . PHE B  2  324 ? -14.642 137.367 30.275  1.00 161.75 ? 340 PHE B CA    1 
ATOM   5849  C  C     . PHE B  2  324 ? -15.663 138.473 30.526  1.00 160.41 ? 340 PHE B C     1 
ATOM   5850  O  O     . PHE B  2  324 ? -16.245 139.016 29.581  1.00 160.59 ? 340 PHE B O     1 
ATOM   5851  C  CB    . PHE B  2  324 ? -15.246 136.011 30.667  1.00 161.95 ? 340 PHE B CB    1 
ATOM   5852  C  CG    . PHE B  2  324 ? -14.403 134.826 30.275  1.00 162.09 ? 340 PHE B CG    1 
ATOM   5853  C  CD1   . PHE B  2  324 ? -13.059 134.754 30.630  1.00 162.40 ? 340 PHE B CD1   1 
ATOM   5854  C  CD2   . PHE B  2  324 ? -14.958 133.777 29.555  1.00 162.27 ? 340 PHE B CD2   1 
ATOM   5855  C  CE1   . PHE B  2  324 ? -12.281 133.657 30.274  1.00 162.30 ? 340 PHE B CE1   1 
ATOM   5856  C  CE2   . PHE B  2  324 ? -14.190 132.675 29.193  1.00 162.63 ? 340 PHE B CE2   1 
ATOM   5857  C  CZ    . PHE B  2  324 ? -12.849 132.615 29.555  1.00 162.40 ? 340 PHE B CZ    1 
ATOM   5858  N  N     . ASP B  2  325 ? -15.869 138.803 31.801  1.00 158.38 ? 341 ASP B N     1 
ATOM   5859  C  CA    . ASP B  2  325 ? -16.815 139.842 32.207  1.00 155.81 ? 341 ASP B CA    1 
ATOM   5860  C  C     . ASP B  2  325 ? -16.268 141.229 31.880  1.00 153.77 ? 341 ASP B C     1 
ATOM   5861  O  O     . ASP B  2  325 ? -16.161 142.088 32.754  1.00 153.51 ? 341 ASP B O     1 
ATOM   5862  C  CB    . ASP B  2  325 ? -17.106 139.737 33.711  1.00 156.16 ? 341 ASP B CB    1 
ATOM   5863  C  CG    . ASP B  2  325 ? -17.673 138.384 34.108  1.00 156.52 ? 341 ASP B CG    1 
ATOM   5864  O  OD1   . ASP B  2  325 ? -18.896 138.302 34.352  1.00 156.16 ? 341 ASP B OD1   1 
ATOM   5865  O  OD2   . ASP B  2  325 ? -16.899 137.404 34.184  1.00 156.87 ? 341 ASP B OD2   1 
ATOM   5866  N  N     . ALA B  2  326 ? -15.929 141.437 30.612  1.00 151.67 ? 342 ALA B N     1 
ATOM   5867  C  CA    . ALA B  2  326 ? -15.390 142.705 30.144  1.00 149.67 ? 342 ALA B CA    1 
ATOM   5868  C  C     . ALA B  2  326 ? -15.876 142.975 28.723  1.00 148.12 ? 342 ALA B C     1 
ATOM   5869  O  O     . ALA B  2  326 ? -17.023 143.377 28.524  1.00 148.10 ? 342 ALA B O     1 
ATOM   5870  C  CB    . ALA B  2  326 ? -13.862 142.681 30.197  1.00 149.75 ? 342 ALA B CB    1 
ATOM   5871  N  N     . VAL B  2  327 ? -15.009 142.734 27.743  1.00 146.27 ? 343 VAL B N     1 
ATOM   5872  C  CA    . VAL B  2  327 ? -15.342 142.945 26.335  1.00 144.49 ? 343 VAL B CA    1 
ATOM   5873  C  C     . VAL B  2  327 ? -16.555 142.113 25.913  1.00 143.10 ? 343 VAL B C     1 
ATOM   5874  O  O     . VAL B  2  327 ? -16.772 141.007 26.418  1.00 142.84 ? 343 VAL B O     1 
ATOM   5875  C  CB    . VAL B  2  327 ? -14.141 142.614 25.421  1.00 144.70 ? 343 VAL B CB    1 
ATOM   5876  C  CG1   . VAL B  2  327 ? -13.015 143.610 25.654  1.00 144.52 ? 343 VAL B CG1   1 
ATOM   5877  C  CG2   . VAL B  2  327 ? -13.651 141.196 25.684  1.00 145.15 ? 343 VAL B CG2   1 
ATOM   5878  N  N     . LYS B  2  328 ? -17.341 142.653 24.986  1.00 141.17 ? 344 LYS B N     1 
ATOM   5879  C  CA    . LYS B  2  328 ? -18.540 141.969 24.518  1.00 139.36 ? 344 LYS B CA    1 
ATOM   5880  C  C     . LYS B  2  328 ? -18.856 142.210 23.040  1.00 137.77 ? 344 LYS B C     1 
ATOM   5881  O  O     . LYS B  2  328 ? -19.999 142.037 22.611  1.00 137.38 ? 344 LYS B O     1 
ATOM   5882  C  CB    . LYS B  2  328 ? -19.738 142.395 25.368  1.00 140.08 ? 344 LYS B CB    1 
ATOM   5883  C  CG    . LYS B  2  328 ? -20.078 143.873 25.256  1.00 141.20 ? 344 LYS B CG    1 
ATOM   5884  C  CD    . LYS B  2  328 ? -21.509 144.139 25.686  1.00 142.08 ? 344 LYS B CD    1 
ATOM   5885  C  CE    . LYS B  2  328 ? -21.954 145.535 25.281  1.00 142.35 ? 344 LYS B CE    1 
ATOM   5886  N  NZ    . LYS B  2  328 ? -23.416 145.724 25.486  1.00 142.19 ? 344 LYS B NZ    1 
ATOM   5887  N  N     . ASP B  2  329 ? -17.851 142.603 22.263  1.00 135.89 ? 345 ASP B N     1 
ATOM   5888  C  CA    . ASP B  2  329 ? -18.049 142.860 20.838  1.00 134.12 ? 345 ASP B CA    1 
ATOM   5889  C  C     . ASP B  2  329 ? -16.957 142.260 19.966  1.00 132.86 ? 345 ASP B C     1 
ATOM   5890  O  O     . ASP B  2  329 ? -15.768 142.409 20.253  1.00 132.93 ? 345 ASP B O     1 
ATOM   5891  C  CB    . ASP B  2  329 ? -18.155 144.364 20.573  1.00 134.36 ? 345 ASP B CB    1 
ATOM   5892  C  CG    . ASP B  2  329 ? -19.587 144.816 20.357  1.00 134.75 ? 345 ASP B CG    1 
ATOM   5893  O  OD1   . ASP B  2  329 ? -20.401 144.721 21.302  1.00 135.12 ? 345 ASP B OD1   1 
ATOM   5894  O  OD2   . ASP B  2  329 ? -19.902 145.261 19.233  1.00 134.35 ? 345 ASP B OD2   1 
ATOM   5895  N  N     . PHE B  2  330 ? -17.370 141.602 18.884  1.00 131.27 ? 346 PHE B N     1 
ATOM   5896  C  CA    . PHE B  2  330 ? -16.425 140.975 17.968  1.00 129.46 ? 346 PHE B CA    1 
ATOM   5897  C  C     . PHE B  2  330 ? -16.618 141.384 16.509  1.00 127.61 ? 346 PHE B C     1 
ATOM   5898  O  O     . PHE B  2  330 ? -17.741 141.559 16.040  1.00 126.56 ? 346 PHE B O     1 
ATOM   5899  C  CB    . PHE B  2  330 ? -16.489 139.447 18.098  1.00 130.28 ? 346 PHE B CB    1 
ATOM   5900  C  CG    . PHE B  2  330 ? -15.492 138.724 17.235  1.00 130.97 ? 346 PHE B CG    1 
ATOM   5901  C  CD1   . PHE B  2  330 ? -15.915 137.789 16.298  1.00 131.64 ? 346 PHE B CD1   1 
ATOM   5902  C  CD2   . PHE B  2  330 ? -14.130 138.997 17.342  1.00 131.59 ? 346 PHE B CD2   1 
ATOM   5903  C  CE1   . PHE B  2  330 ? -14.997 137.137 15.474  1.00 132.32 ? 346 PHE B CE1   1 
ATOM   5904  C  CE2   . PHE B  2  330 ? -13.204 138.353 16.524  1.00 131.90 ? 346 PHE B CE2   1 
ATOM   5905  C  CZ    . PHE B  2  330 ? -13.637 137.421 15.589  1.00 132.39 ? 346 PHE B CZ    1 
ATOM   5906  N  N     . LYS B  2  331 ? -15.496 141.528 15.812  1.00 126.25 ? 347 LYS B N     1 
ATOM   5907  C  CA    . LYS B  2  331 ? -15.453 141.895 14.398  1.00 124.99 ? 347 LYS B CA    1 
ATOM   5908  C  C     . LYS B  2  331 ? -14.771 140.733 13.656  1.00 123.80 ? 347 LYS B C     1 
ATOM   5909  O  O     . LYS B  2  331 ? -14.976 139.573 14.006  1.00 124.07 ? 347 LYS B O     1 
ATOM   5910  C  CB    . LYS B  2  331 ? -14.655 143.201 14.219  1.00 125.13 ? 347 LYS B CB    1 
ATOM   5911  C  CG    . LYS B  2  331 ? -13.139 143.102 14.482  1.00 125.10 ? 347 LYS B CG    1 
ATOM   5912  C  CD    . LYS B  2  331 ? -12.801 142.644 15.897  1.00 124.89 ? 347 LYS B CD    1 
ATOM   5913  C  CE    . LYS B  2  331 ? -11.338 142.238 16.009  1.00 124.69 ? 347 LYS B CE    1 
ATOM   5914  N  NZ    . LYS B  2  331 ? -11.026 141.626 17.334  1.00 124.48 ? 347 LYS B NZ    1 
ATOM   5915  N  N     . LEU B  2  332 ? -13.996 141.036 12.619  1.00 121.80 ? 348 LEU B N     1 
ATOM   5916  C  CA    . LEU B  2  332 ? -13.271 140.010 11.879  1.00 119.75 ? 348 LEU B CA    1 
ATOM   5917  C  C     . LEU B  2  332 ? -12.242 140.646 10.965  1.00 118.08 ? 348 LEU B C     1 
ATOM   5918  O  O     . LEU B  2  332 ? -12.526 140.943 9.804   1.00 117.31 ? 348 LEU B O     1 
ATOM   5919  C  CB    . LEU B  2  332 ? -14.211 139.117 11.062  1.00 120.40 ? 348 LEU B CB    1 
ATOM   5920  C  CG    . LEU B  2  332 ? -13.528 137.889 10.437  1.00 120.43 ? 348 LEU B CG    1 
ATOM   5921  C  CD1   . LEU B  2  332 ? -13.069 136.936 11.529  1.00 120.04 ? 348 LEU B CD1   1 
ATOM   5922  C  CD2   . LEU B  2  332 ? -14.470 137.178 9.485   1.00 120.77 ? 348 LEU B CD2   1 
ATOM   5923  N  N     . GLY B  2  333 ? -11.048 140.867 11.506  1.00 116.86 ? 349 GLY B N     1 
ATOM   5924  C  CA    . GLY B  2  333 ? -9.978  141.457 10.725  1.00 116.03 ? 349 GLY B CA    1 
ATOM   5925  C  C     . GLY B  2  333 ? -9.417  140.429 9.766   1.00 115.17 ? 349 GLY B C     1 
ATOM   5926  O  O     . GLY B  2  333 ? -10.169 139.692 9.124   1.00 115.20 ? 349 GLY B O     1 
ATOM   5927  N  N     . LYS B  2  334 ? -8.096  140.389 9.646   1.00 114.40 ? 350 LYS B N     1 
ATOM   5928  C  CA    . LYS B  2  334 ? -7.462  139.423 8.766   1.00 113.77 ? 350 LYS B CA    1 
ATOM   5929  C  C     . LYS B  2  334 ? -7.322  138.073 9.461   1.00 113.08 ? 350 LYS B C     1 
ATOM   5930  O  O     . LYS B  2  334 ? -7.168  138.002 10.686  1.00 113.21 ? 350 LYS B O     1 
ATOM   5931  C  CB    . LYS B  2  334 ? -6.093  139.924 8.304   1.00 114.40 ? 350 LYS B CB    1 
ATOM   5932  C  CG    . LYS B  2  334 ? -6.143  140.853 7.104   1.00 115.03 ? 350 LYS B CG    1 
ATOM   5933  C  CD    . LYS B  2  334 ? -4.748  141.068 6.537   1.00 115.76 ? 350 LYS B CD    1 
ATOM   5934  C  CE    . LYS B  2  334 ? -4.790  141.789 5.199   1.00 116.37 ? 350 LYS B CE    1 
ATOM   5935  N  NZ    . LYS B  2  334 ? -3.426  141.924 4.616   1.00 116.12 ? 350 LYS B NZ    1 
ATOM   5936  N  N     . PHE B  2  335 ? -7.406  137.005 8.671   1.00 111.23 ? 351 PHE B N     1 
ATOM   5937  C  CA    . PHE B  2  335 ? -7.282  135.644 9.181   1.00 108.68 ? 351 PHE B CA    1 
ATOM   5938  C  C     . PHE B  2  335 ? -6.551  134.768 8.167   1.00 106.42 ? 351 PHE B C     1 
ATOM   5939  O  O     . PHE B  2  335 ? -5.949  135.277 7.217   1.00 106.52 ? 351 PHE B O     1 
ATOM   5940  C  CB    . PHE B  2  335 ? -8.664  135.055 9.515   1.00 109.45 ? 351 PHE B CB    1 
ATOM   5941  C  CG    . PHE B  2  335 ? -9.658  135.117 8.379   1.00 110.63 ? 351 PHE B CG    1 
ATOM   5942  C  CD1   . PHE B  2  335 ? -9.477  134.352 7.225   1.00 111.23 ? 351 PHE B CD1   1 
ATOM   5943  C  CD2   . PHE B  2  335 ? -10.789 135.923 8.474   1.00 110.65 ? 351 PHE B CD2   1 
ATOM   5944  C  CE1   . PHE B  2  335 ? -10.405 134.389 6.186   1.00 111.16 ? 351 PHE B CE1   1 
ATOM   5945  C  CE2   . PHE B  2  335 ? -11.723 135.966 7.441   1.00 110.77 ? 351 PHE B CE2   1 
ATOM   5946  C  CZ    . PHE B  2  335 ? -11.529 135.196 6.295   1.00 111.08 ? 351 PHE B CZ    1 
ATOM   5947  N  N     . ASN B  2  336 ? -6.594  133.455 8.384   1.00 103.43 ? 352 ASN B N     1 
ATOM   5948  C  CA    . ASN B  2  336 ? -5.951  132.500 7.488   1.00 99.59  ? 352 ASN B CA    1 
ATOM   5949  C  C     . ASN B  2  336 ? -6.939  131.435 7.030   1.00 97.39  ? 352 ASN B C     1 
ATOM   5950  O  O     . ASN B  2  336 ? -7.834  131.041 7.777   1.00 96.48  ? 352 ASN B O     1 
ATOM   5951  C  CB    . ASN B  2  336 ? -4.728  131.884 8.156   1.00 99.25  ? 352 ASN B CB    1 
ATOM   5952  C  CG    . ASN B  2  336 ? -3.596  132.879 8.306   1.00 98.67  ? 352 ASN B CG    1 
ATOM   5953  O  OD1   . ASN B  2  336 ? -2.950  133.253 7.327   1.00 97.08  ? 352 ASN B OD1   1 
ATOM   5954  N  ND2   . ASN B  2  336 ? -3.363  133.330 9.531   1.00 98.50  ? 352 ASN B ND2   1 
ATOM   5955  N  N     . TYR B  2  337 ? -6.749  130.953 5.806   1.00 94.89  ? 353 TYR B N     1 
ATOM   5956  C  CA    . TYR B  2  337 ? -7.659  129.980 5.209   1.00 92.20  ? 353 TYR B CA    1 
ATOM   5957  C  C     . TYR B  2  337 ? -6.971  128.747 4.618   1.00 91.56  ? 353 TYR B C     1 
ATOM   5958  O  O     . TYR B  2  337 ? -5.838  128.825 4.142   1.00 90.65  ? 353 TYR B O     1 
ATOM   5959  C  CB    . TYR B  2  337 ? -8.468  130.711 4.127   1.00 89.73  ? 353 TYR B CB    1 
ATOM   5960  C  CG    . TYR B  2  337 ? -9.424  129.877 3.312   1.00 86.71  ? 353 TYR B CG    1 
ATOM   5961  C  CD1   . TYR B  2  337 ? -10.610 129.399 3.865   1.00 85.92  ? 353 TYR B CD1   1 
ATOM   5962  C  CD2   . TYR B  2  337 ? -9.160  129.600 1.970   1.00 85.15  ? 353 TYR B CD2   1 
ATOM   5963  C  CE1   . TYR B  2  337 ? -11.513 128.667 3.102   1.00 85.06  ? 353 TYR B CE1   1 
ATOM   5964  C  CE2   . TYR B  2  337 ? -10.055 128.871 1.199   1.00 84.59  ? 353 TYR B CE2   1 
ATOM   5965  C  CZ    . TYR B  2  337 ? -11.231 128.407 1.771   1.00 84.99  ? 353 TYR B CZ    1 
ATOM   5966  O  OH    . TYR B  2  337 ? -12.128 127.688 1.016   1.00 85.43  ? 353 TYR B OH    1 
ATOM   5967  N  N     . VAL B  2  338 ? -7.661  127.608 4.681   1.00 90.86  ? 354 VAL B N     1 
ATOM   5968  C  CA    . VAL B  2  338 ? -7.160  126.345 4.130   1.00 89.84  ? 354 VAL B CA    1 
ATOM   5969  C  C     . VAL B  2  338 ? -8.273  125.501 3.524   1.00 88.71  ? 354 VAL B C     1 
ATOM   5970  O  O     . VAL B  2  338 ? -9.307  125.257 4.153   1.00 88.01  ? 354 VAL B O     1 
ATOM   5971  C  CB    . VAL B  2  338 ? -6.432  125.467 5.176   1.00 90.08  ? 354 VAL B CB    1 
ATOM   5972  C  CG1   . VAL B  2  338 ? -5.075  126.058 5.526   1.00 90.30  ? 354 VAL B CG1   1 
ATOM   5973  C  CG2   . VAL B  2  338 ? -7.303  125.284 6.406   1.00 89.79  ? 354 VAL B CG2   1 
ATOM   5974  N  N     . ALA B  2  339 ? -8.050  125.062 2.290   1.00 88.21  ? 355 ALA B N     1 
ATOM   5975  C  CA    . ALA B  2  339 ? -9.011  124.226 1.582   1.00 87.67  ? 355 ALA B CA    1 
ATOM   5976  C  C     . ALA B  2  339 ? -8.462  122.802 1.501   1.00 87.32  ? 355 ALA B C     1 
ATOM   5977  O  O     . ALA B  2  339 ? -7.352  122.578 1.006   1.00 86.46  ? 355 ALA B O     1 
ATOM   5978  C  CB    . ALA B  2  339 ? -9.263  124.778 0.184   1.00 87.78  ? 355 ALA B CB    1 
ATOM   5979  N  N     . VAL B  2  340 ? -9.232  121.852 2.027   1.00 86.06  ? 356 VAL B N     1 
ATOM   5980  C  CA    . VAL B  2  340 ? -8.847  120.445 2.021   1.00 84.33  ? 356 VAL B CA    1 
ATOM   5981  C  C     . VAL B  2  340 ? -10.004 119.604 1.489   1.00 83.57  ? 356 VAL B C     1 
ATOM   5982  O  O     . VAL B  2  340 ? -11.124 119.683 2.001   1.00 82.94  ? 356 VAL B O     1 
ATOM   5983  C  CB    . VAL B  2  340 ? -8.462  119.966 3.444   1.00 84.47  ? 356 VAL B CB    1 
ATOM   5984  C  CG1   . VAL B  2  340 ? -8.326  118.449 3.489   1.00 84.99  ? 356 VAL B CG1   1 
ATOM   5985  C  CG2   . VAL B  2  340 ? -7.159  120.611 3.880   1.00 84.19  ? 356 VAL B CG2   1 
ATOM   5986  N  N     . GLY B  2  341 ? -9.734  118.824 0.443   1.00 82.77  ? 357 GLY B N     1 
ATOM   5987  C  CA    . GLY B  2  341 ? -10.761 117.973 -0.138  1.00 81.51  ? 357 GLY B CA    1 
ATOM   5988  C  C     . GLY B  2  341 ? -10.949 118.204 -1.624  1.00 80.88  ? 357 GLY B C     1 
ATOM   5989  O  O     . GLY B  2  341 ? -9.996  118.106 -2.398  1.00 79.42  ? 357 GLY B O     1 
ATOM   5990  N  N     . ASP B  2  342 ? -12.188 118.484 -2.024  1.00 81.04  ? 358 ASP B N     1 
ATOM   5991  C  CA    . ASP B  2  342 ? -12.510 118.749 -3.424  1.00 81.93  ? 358 ASP B CA    1 
ATOM   5992  C  C     . ASP B  2  342 ? -12.084 120.188 -3.717  1.00 82.79  ? 358 ASP B C     1 
ATOM   5993  O  O     . ASP B  2  342 ? -12.900 121.108 -3.729  1.00 82.72  ? 358 ASP B O     1 
ATOM   5994  C  CB    . ASP B  2  342 ? -14.013 118.568 -3.662  1.00 80.71  ? 358 ASP B CB    1 
ATOM   5995  C  CG    . ASP B  2  342 ? -14.366 118.451 -5.134  1.00 80.65  ? 358 ASP B CG    1 
ATOM   5996  O  OD1   . ASP B  2  342 ? -15.556 118.217 -5.433  1.00 80.97  ? 358 ASP B OD1   1 
ATOM   5997  O  OD2   . ASP B  2  342 ? -13.462 118.585 -5.995  1.00 80.80  ? 358 ASP B OD2   1 
ATOM   5998  N  N     . VAL B  2  343 ? -10.788 120.359 -3.942  1.00 84.13  ? 359 VAL B N     1 
ATOM   5999  C  CA    . VAL B  2  343 ? -10.180 121.661 -4.193  1.00 85.55  ? 359 VAL B CA    1 
ATOM   6000  C  C     . VAL B  2  343 ? -10.753 122.507 -5.336  1.00 86.26  ? 359 VAL B C     1 
ATOM   6001  O  O     . VAL B  2  343 ? -11.023 123.693 -5.150  1.00 86.68  ? 359 VAL B O     1 
ATOM   6002  C  CB    . VAL B  2  343 ? -8.628  121.507 -4.324  1.00 85.48  ? 359 VAL B CB    1 
ATOM   6003  C  CG1   . VAL B  2  343 ? -8.025  122.569 -5.247  1.00 85.93  ? 359 VAL B CG1   1 
ATOM   6004  C  CG2   . VAL B  2  343 ? -7.991  121.597 -2.945  1.00 84.55  ? 359 VAL B CG2   1 
ATOM   6005  N  N     . SER B  2  344 ? -10.957 121.902 -6.501  1.00 86.64  ? 360 SER B N     1 
ATOM   6006  C  CA    . SER B  2  344 ? -11.473 122.630 -7.659  1.00 86.41  ? 360 SER B CA    1 
ATOM   6007  C  C     . SER B  2  344 ? -12.905 123.156 -7.482  1.00 86.28  ? 360 SER B C     1 
ATOM   6008  O  O     . SER B  2  344 ? -13.409 123.891 -8.330  1.00 86.45  ? 360 SER B O     1 
ATOM   6009  C  CB    . SER B  2  344 ? -11.379 121.751 -8.912  1.00 87.27  ? 360 SER B CB    1 
ATOM   6010  O  OG    . SER B  2  344 ? -10.989 122.500 -10.054 1.00 87.56  ? 360 SER B OG    1 
ATOM   6011  N  N     . ASN B  2  345 ? -13.553 122.786 -6.380  1.00 86.19  ? 361 ASN B N     1 
ATOM   6012  C  CA    . ASN B  2  345 ? -14.920 123.225 -6.099  1.00 86.64  ? 361 ASN B CA    1 
ATOM   6013  C  C     . ASN B  2  345 ? -15.035 123.863 -4.713  1.00 87.42  ? 361 ASN B C     1 
ATOM   6014  O  O     . ASN B  2  345 ? -16.087 123.810 -4.070  1.00 86.75  ? 361 ASN B O     1 
ATOM   6015  C  CB    . ASN B  2  345 ? -15.892 122.046 -6.206  1.00 86.59  ? 361 ASN B CB    1 
ATOM   6016  C  CG    . ASN B  2  345 ? -16.061 121.556 -7.627  1.00 87.63  ? 361 ASN B CG    1 
ATOM   6017  O  OD1   . ASN B  2  345 ? -16.918 122.046 -8.359  1.00 88.80  ? 361 ASN B OD1   1 
ATOM   6018  N  ND2   . ASN B  2  345 ? -15.248 120.580 -8.026  1.00 87.79  ? 361 ASN B ND2   1 
ATOM   6019  N  N     . LEU B  2  346 ? -13.949 124.482 -4.265  1.00 89.02  ? 362 LEU B N     1 
ATOM   6020  C  CA    . LEU B  2  346 ? -13.916 125.127 -2.957  1.00 90.95  ? 362 LEU B CA    1 
ATOM   6021  C  C     . LEU B  2  346 ? -13.499 126.593 -3.074  1.00 92.29  ? 362 LEU B C     1 
ATOM   6022  O  O     . LEU B  2  346 ? -12.732 126.961 -3.967  1.00 92.42  ? 362 LEU B O     1 
ATOM   6023  C  CB    . LEU B  2  346 ? -12.960 124.364 -2.031  1.00 90.57  ? 362 LEU B CB    1 
ATOM   6024  C  CG    . LEU B  2  346 ? -13.538 123.598 -0.832  1.00 89.57  ? 362 LEU B CG    1 
ATOM   6025  C  CD1   . LEU B  2  346 ? -14.912 123.039 -1.127  1.00 89.14  ? 362 LEU B CD1   1 
ATOM   6026  C  CD2   . LEU B  2  346 ? -12.577 122.486 -0.452  1.00 90.51  ? 362 LEU B CD2   1 
ATOM   6027  N  N     . PRO B  2  347 ? -13.996 127.448 -2.162  1.00 93.72  ? 363 PRO B N     1 
ATOM   6028  C  CA    . PRO B  2  347 ? -13.699 128.881 -2.135  1.00 95.05  ? 363 PRO B CA    1 
ATOM   6029  C  C     . PRO B  2  347 ? -12.225 129.206 -1.954  1.00 96.50  ? 363 PRO B C     1 
ATOM   6030  O  O     . PRO B  2  347 ? -11.432 128.382 -1.494  1.00 96.45  ? 363 PRO B O     1 
ATOM   6031  C  CB    . PRO B  2  347 ? -14.485 129.370 -0.914  1.00 94.65  ? 363 PRO B CB    1 
ATOM   6032  C  CG    . PRO B  2  347 ? -15.596 128.410 -0.806  1.00 95.17  ? 363 PRO B CG    1 
ATOM   6033  C  CD    . PRO B  2  347 ? -14.908 127.101 -1.062  1.00 94.82  ? 363 PRO B CD    1 
ATOM   6034  N  N     . TYR B  2  348 ? -11.867 130.417 -2.356  1.00 98.14  ? 364 TYR B N     1 
ATOM   6035  C  CA    . TYR B  2  348 ? -10.514 130.917 -2.199  1.00 100.00 ? 364 TYR B CA    1 
ATOM   6036  C  C     . TYR B  2  348 ? -10.601 132.009 -1.137  1.00 101.57 ? 364 TYR B C     1 
ATOM   6037  O  O     . TYR B  2  348 ? -11.700 132.428 -0.762  1.00 101.50 ? 364 TYR B O     1 
ATOM   6038  C  CB    . TYR B  2  348 ? -9.999  131.497 -3.509  1.00 99.46  ? 364 TYR B CB    1 
ATOM   6039  C  CG    . TYR B  2  348 ? -9.377  130.479 -4.432  1.00 99.73  ? 364 TYR B CG    1 
ATOM   6040  C  CD1   . TYR B  2  348 ? -8.000  130.259 -4.421  1.00 99.72  ? 364 TYR B CD1   1 
ATOM   6041  C  CD2   . TYR B  2  348 ? -10.155 129.754 -5.332  1.00 99.90  ? 364 TYR B CD2   1 
ATOM   6042  C  CE1   . TYR B  2  348 ? -7.409  129.345 -5.287  1.00 100.22 ? 364 TYR B CE1   1 
ATOM   6043  C  CE2   . TYR B  2  348 ? -9.573  128.834 -6.206  1.00 100.55 ? 364 TYR B CE2   1 
ATOM   6044  C  CZ    . TYR B  2  348 ? -8.198  128.636 -6.178  1.00 100.74 ? 364 TYR B CZ    1 
ATOM   6045  O  OH    . TYR B  2  348 ? -7.608  127.735 -7.037  1.00 99.95  ? 364 TYR B OH    1 
ATOM   6046  N  N     . LEU B  2  349 ? -9.454  132.453 -0.637  1.00 103.61 ? 365 LEU B N     1 
ATOM   6047  C  CA    . LEU B  2  349 ? -9.424  133.500 0.379   1.00 105.24 ? 365 LEU B CA    1 
ATOM   6048  C  C     . LEU B  2  349 ? -10.131 134.763 -0.132  1.00 106.60 ? 365 LEU B C     1 
ATOM   6049  O  O     . LEU B  2  349 ? -10.881 135.407 0.604   1.00 106.40 ? 365 LEU B O     1 
ATOM   6050  C  CB    . LEU B  2  349 ? -7.973  133.812 0.753   1.00 104.55 ? 365 LEU B CB    1 
ATOM   6051  C  CG    . LEU B  2  349 ? -7.709  134.782 1.905   1.00 105.00 ? 365 LEU B CG    1 
ATOM   6052  C  CD1   . LEU B  2  349 ? -8.421  134.329 3.178   1.00 104.06 ? 365 LEU B CD1   1 
ATOM   6053  C  CD2   . LEU B  2  349 ? -6.209  134.884 2.131   1.00 105.14 ? 365 LEU B CD2   1 
ATOM   6054  N  N     . ASP B  2  350 ? -9.935  135.053 -1.418  1.00 108.17 ? 366 ASP B N     1 
ATOM   6055  C  CA    . ASP B  2  350 ? -10.515 136.215 -2.092  1.00 109.46 ? 366 ASP B CA    1 
ATOM   6056  C  C     . ASP B  2  350 ? -12.023 136.349 -1.919  1.00 111.23 ? 366 ASP B C     1 
ATOM   6057  O  O     . ASP B  2  350 ? -12.503 137.249 -1.227  1.00 112.14 ? 366 ASP B O     1 
ATOM   6058  C  CB    . ASP B  2  350 ? -10.209 136.160 -3.593  1.00 108.49 ? 366 ASP B CB    1 
ATOM   6059  C  CG    . ASP B  2  350 ? -8.723  136.140 -3.898  1.00 108.98 ? 366 ASP B CG    1 
ATOM   6060  O  OD1   . ASP B  2  350 ? -8.376  136.326 -5.082  1.00 108.95 ? 366 ASP B OD1   1 
ATOM   6061  O  OD2   . ASP B  2  350 ? -7.902  135.931 -2.978  1.00 109.87 ? 366 ASP B OD2   1 
ATOM   6062  N  N     . GLU B  2  351 ? -12.763 135.446 -2.555  1.00 112.81 ? 367 GLU B N     1 
ATOM   6063  C  CA    . GLU B  2  351 ? -14.224 135.457 -2.519  1.00 114.58 ? 367 GLU B CA    1 
ATOM   6064  C  C     . GLU B  2  351 ? -14.893 135.327 -1.147  1.00 115.18 ? 367 GLU B C     1 
ATOM   6065  O  O     . GLU B  2  351 ? -16.124 135.328 -1.049  1.00 115.41 ? 367 GLU B O     1 
ATOM   6066  C  CB    . GLU B  2  351 ? -14.780 134.417 -3.501  1.00 115.43 ? 367 GLU B CB    1 
ATOM   6067  C  CG    . GLU B  2  351 ? -14.158 133.030 -3.396  1.00 115.18 ? 367 GLU B CG    1 
ATOM   6068  C  CD    . GLU B  2  351 ? -14.592 132.117 -4.527  1.00 115.30 ? 367 GLU B CD    1 
ATOM   6069  O  OE1   . GLU B  2  351 ? -15.744 131.624 -4.489  1.00 114.93 ? 367 GLU B OE1   1 
ATOM   6070  O  OE2   . GLU B  2  351 ? -13.782 131.900 -5.456  1.00 114.56 ? 367 GLU B OE2   1 
ATOM   6071  N  N     . LEU B  2  352 ? -14.089 135.236 -0.091  1.00 115.79 ? 368 LEU B N     1 
ATOM   6072  C  CA    . LEU B  2  352 ? -14.622 135.128 1.264   1.00 116.83 ? 368 LEU B CA    1 
ATOM   6073  C  C     . LEU B  2  352 ? -15.114 136.478 1.781   1.00 117.12 ? 368 LEU B C     1 
ATOM   6074  O  O     . LEU B  2  352 ? -16.292 136.552 2.202   1.00 116.90 ? 368 LEU B O     1 
ATOM   6075  C  CB    . LEU B  2  352 ? -13.571 134.556 2.219   1.00 117.30 ? 368 LEU B CB    1 
ATOM   6076  C  CG    . LEU B  2  352 ? -13.317 133.049 2.149   1.00 117.79 ? 368 LEU B CG    1 
ATOM   6077  C  CD1   . LEU B  2  352 ? -12.175 132.688 3.079   1.00 118.18 ? 368 LEU B CD1   1 
ATOM   6078  C  CD2   . LEU B  2  352 ? -14.579 132.286 2.526   1.00 117.46 ? 368 LEU B CD2   1 
ATOM   6079  O  OXT   . LEU B  2  352 ? -14.317 137.442 1.759   1.00 117.19 ? 368 LEU B OXT   1 
ATOM   6080  N  N     . MET C  3  1   ? -1.677  78.877  15.531  1.00 35.27  ? 1   MET C N     1 
ATOM   6081  C  CA    . MET C  3  1   ? -2.982  78.295  15.079  1.00 37.46  ? 1   MET C CA    1 
ATOM   6082  C  C     . MET C  3  1   ? -3.218  76.978  15.807  1.00 35.60  ? 1   MET C C     1 
ATOM   6083  O  O     . MET C  3  1   ? -2.335  76.496  16.505  1.00 36.02  ? 1   MET C O     1 
ATOM   6084  C  CB    . MET C  3  1   ? -2.943  78.064  13.563  1.00 40.50  ? 1   MET C CB    1 
ATOM   6085  C  CG    . MET C  3  1   ? -1.763  77.205  13.098  1.00 44.79  ? 1   MET C CG    1 
ATOM   6086  S  SD    . MET C  3  1   ? -1.553  77.146  11.308  1.00 46.11  ? 1   MET C SD    1 
ATOM   6087  C  CE    . MET C  3  1   ? -0.690  78.626  11.010  1.00 43.98  ? 1   MET C CE    1 
ATOM   6088  N  N     . ALA C  3  2   ? -4.403  76.399  15.660  1.00 35.34  ? 2   ALA C N     1 
ATOM   6089  C  CA    . ALA C  3  2   ? -4.708  75.123  16.314  1.00 36.17  ? 2   ALA C CA    1 
ATOM   6090  C  C     . ALA C  3  2   ? -3.674  74.062  15.892  1.00 37.98  ? 2   ALA C C     1 
ATOM   6091  O  O     . ALA C  3  2   ? -3.118  74.137  14.789  1.00 39.36  ? 2   ALA C O     1 
ATOM   6092  C  CB    . ALA C  3  2   ? -6.118  74.673  15.951  1.00 33.48  ? 2   ALA C CB    1 
ATOM   6093  N  N     . PHE C  3  3   ? -3.397  73.100  16.773  1.00 38.25  ? 3   PHE C N     1 
ATOM   6094  C  CA    . PHE C  3  3   ? -2.417  72.054  16.490  1.00 39.65  ? 3   PHE C CA    1 
ATOM   6095  C  C     . PHE C  3  3   ? -2.817  71.218  15.277  1.00 41.19  ? 3   PHE C C     1 
ATOM   6096  O  O     . PHE C  3  3   ? -1.951  70.801  14.494  1.00 43.31  ? 3   PHE C O     1 
ATOM   6097  C  CB    . PHE C  3  3   ? -2.237  71.141  17.716  1.00 39.30  ? 3   PHE C CB    1 
ATOM   6098  C  CG    . PHE C  3  3   ? -1.146  70.097  17.562  1.00 37.73  ? 3   PHE C CG    1 
ATOM   6099  C  CD1   . PHE C  3  3   ? -1.430  68.744  17.754  1.00 38.93  ? 3   PHE C CD1   1 
ATOM   6100  C  CD2   . PHE C  3  3   ? 0.168   70.467  17.244  1.00 38.46  ? 3   PHE C CD2   1 
ATOM   6101  C  CE1   . PHE C  3  3   ? -0.417  67.764  17.633  1.00 39.48  ? 3   PHE C CE1   1 
ATOM   6102  C  CE2   . PHE C  3  3   ? 1.191   69.497  17.118  1.00 39.08  ? 3   PHE C CE2   1 
ATOM   6103  C  CZ    . PHE C  3  3   ? 0.893   68.142  17.316  1.00 38.09  ? 3   PHE C CZ    1 
ATOM   6104  N  N     . ARG C  3  4   ? -4.124  71.000  15.115  1.00 40.07  ? 4   ARG C N     1 
ATOM   6105  C  CA    . ARG C  3  4   ? -4.635  70.207  14.008  1.00 39.62  ? 4   ARG C CA    1 
ATOM   6106  C  C     . ARG C  3  4   ? -4.315  70.867  12.668  1.00 39.65  ? 4   ARG C C     1 
ATOM   6107  O  O     . ARG C  3  4   ? -4.295  70.205  11.635  1.00 39.56  ? 4   ARG C O     1 
ATOM   6108  C  CB    . ARG C  3  4   ? -6.141  69.964  14.157  1.00 38.03  ? 4   ARG C CB    1 
ATOM   6109  C  CG    . ARG C  3  4   ? -7.015  71.124  13.714  1.00 39.71  ? 4   ARG C CG    1 
ATOM   6110  C  CD    . ARG C  3  4   ? -8.517  70.860  13.944  1.00 39.29  ? 4   ARG C CD    1 
ATOM   6111  N  NE    . ARG C  3  4   ? -9.314  71.891  13.276  1.00 41.81  ? 4   ARG C NE    1 
ATOM   6112  C  CZ    . ARG C  3  4   ? -9.658  73.058  13.819  1.00 43.13  ? 4   ARG C CZ    1 
ATOM   6113  N  NH1   . ARG C  3  4   ? -10.359 73.939  13.114  1.00 43.41  ? 4   ARG C NH1   1 
ATOM   6114  N  NH2   . ARG C  3  4   ? -9.352  73.325  15.081  1.00 44.59  ? 4   ARG C NH2   1 
ATOM   6115  N  N     . LYS C  3  5   ? -4.021  72.160  12.701  1.00 38.83  ? 5   LYS C N     1 
ATOM   6116  C  CA    . LYS C  3  5   ? -3.692  72.911  11.493  1.00 40.36  ? 5   LYS C CA    1 
ATOM   6117  C  C     . LYS C  3  5   ? -2.182  72.950  11.221  1.00 41.23  ? 5   LYS C C     1 
ATOM   6118  O  O     . LYS C  3  5   ? -1.741  72.868  10.071  1.00 41.87  ? 5   LYS C O     1 
ATOM   6119  C  CB    . LYS C  3  5   ? -4.202  74.355  11.619  1.00 40.78  ? 5   LYS C CB    1 
ATOM   6120  C  CG    . LYS C  3  5   ? -5.193  74.785  10.560  1.00 40.28  ? 5   LYS C CG    1 
ATOM   6121  C  CD    . LYS C  3  5   ? -6.588  74.856  11.119  1.00 40.77  ? 5   LYS C CD    1 
ATOM   6122  C  CE    . LYS C  3  5   ? -6.832  76.158  11.850  1.00 40.83  ? 5   LYS C CE    1 
ATOM   6123  N  NZ    . LYS C  3  5   ? -7.413  77.223  10.986  1.00 38.90  ? 5   LYS C NZ    1 
ATOM   6124  N  N     . SER C  3  6   ? -1.394  73.080  12.285  1.00 40.74  ? 6   SER C N     1 
ATOM   6125  C  CA    . SER C  3  6   ? 0.060   73.191  12.166  1.00 39.78  ? 6   SER C CA    1 
ATOM   6126  C  C     . SER C  3  6   ? 0.842   71.902  11.997  1.00 38.51  ? 6   SER C C     1 
ATOM   6127  O  O     . SER C  3  6   ? 1.878   71.902  11.328  1.00 39.10  ? 6   SER C O     1 
ATOM   6128  C  CB    . SER C  3  6   ? 0.629   73.957  13.355  1.00 39.77  ? 6   SER C CB    1 
ATOM   6129  O  OG    . SER C  3  6   ? 0.532   73.166  14.525  1.00 46.55  ? 6   SER C OG    1 
ATOM   6130  N  N     . ASN C  3  7   ? 0.396   70.824  12.637  1.00 36.94  ? 7   ASN C N     1 
ATOM   6131  C  CA    . ASN C  3  7   ? 1.111   69.556  12.522  1.00 36.90  ? 7   ASN C CA    1 
ATOM   6132  C  C     . ASN C  3  7   ? 1.087   69.059  11.082  1.00 37.41  ? 7   ASN C C     1 
ATOM   6133  O  O     . ASN C  3  7   ? 0.052   69.096  10.426  1.00 40.21  ? 7   ASN C O     1 
ATOM   6134  C  CB    . ASN C  3  7   ? 0.520   68.502  13.453  1.00 38.22  ? 7   ASN C CB    1 
ATOM   6135  C  CG    . ASN C  3  7   ? 1.235   67.170  13.337  1.00 40.14  ? 7   ASN C CG    1 
ATOM   6136  O  OD1   . ASN C  3  7   ? 0.716   66.222  12.749  1.00 39.93  ? 7   ASN C OD1   1 
ATOM   6137  N  ND2   . ASN C  3  7   ? 2.449   67.104  13.870  1.00 41.81  ? 7   ASN C ND2   1 
ATOM   6138  N  N     . VAL C  3  8   ? 2.223   68.579  10.599  1.00 37.42  ? 8   VAL C N     1 
ATOM   6139  C  CA    . VAL C  3  8   ? 2.332   68.086  9.226   1.00 36.68  ? 8   VAL C CA    1 
ATOM   6140  C  C     . VAL C  3  8   ? 1.328   66.973  8.869   1.00 37.45  ? 8   VAL C C     1 
ATOM   6141  O  O     . VAL C  3  8   ? 0.720   66.997  7.794   1.00 38.38  ? 8   VAL C O     1 
ATOM   6142  C  CB    . VAL C  3  8   ? 3.787   67.633  8.916   1.00 36.38  ? 8   VAL C CB    1 
ATOM   6143  C  CG1   . VAL C  3  8   ? 4.256   66.571  9.913   1.00 34.16  ? 8   VAL C CG1   1 
ATOM   6144  C  CG2   . VAL C  3  8   ? 3.888   67.132  7.502   1.00 36.77  ? 8   VAL C CG2   1 
ATOM   6145  N  N     . TYR C  3  9   ? 1.103   66.047  9.798   1.00 36.35  ? 9   TYR C N     1 
ATOM   6146  C  CA    . TYR C  3  9   ? 0.187   64.948  9.549   1.00 34.62  ? 9   TYR C CA    1 
ATOM   6147  C  C     . TYR C  3  9   ? -1.257  65.305  9.826   1.00 35.79  ? 9   TYR C C     1 
ATOM   6148  O  O     . TYR C  3  9   ? -2.138  64.989  9.025   1.00 36.19  ? 9   TYR C O     1 
ATOM   6149  C  CB    . TYR C  3  9   ? 0.598   63.706  10.350  1.00 33.14  ? 9   TYR C CB    1 
ATOM   6150  C  CG    . TYR C  3  9   ? 2.029   63.283  10.101  1.00 32.79  ? 9   TYR C CG    1 
ATOM   6151  C  CD1   . TYR C  3  9   ? 2.934   63.186  11.149  1.00 32.53  ? 9   TYR C CD1   1 
ATOM   6152  C  CD2   . TYR C  3  9   ? 2.495   63.037  8.806   1.00 34.11  ? 9   TYR C CD2   1 
ATOM   6153  C  CE1   . TYR C  3  9   ? 4.270   62.861  10.923  1.00 33.56  ? 9   TYR C CE1   1 
ATOM   6154  C  CE2   . TYR C  3  9   ? 3.836   62.715  8.566   1.00 35.28  ? 9   TYR C CE2   1 
ATOM   6155  C  CZ    . TYR C  3  9   ? 4.719   62.634  9.636   1.00 34.83  ? 9   TYR C CZ    1 
ATOM   6156  O  OH    . TYR C  3  9   ? 6.056   62.371  9.425   1.00 34.68  ? 9   TYR C OH    1 
ATOM   6157  N  N     . LEU C  3  10  ? -1.506  65.991  10.936  1.00 36.66  ? 10  LEU C N     1 
ATOM   6158  C  CA    . LEU C  3  10  ? -2.875  66.352  11.286  1.00 37.07  ? 10  LEU C CA    1 
ATOM   6159  C  C     . LEU C  3  10  ? -3.547  67.320  10.315  1.00 37.34  ? 10  LEU C C     1 
ATOM   6160  O  O     . LEU C  3  10  ? -4.762  67.235  10.105  1.00 37.38  ? 10  LEU C O     1 
ATOM   6161  C  CB    . LEU C  3  10  ? -2.968  66.862  12.730  1.00 37.57  ? 10  LEU C CB    1 
ATOM   6162  C  CG    . LEU C  3  10  ? -2.777  65.807  13.834  1.00 38.79  ? 10  LEU C CG    1 
ATOM   6163  C  CD1   . LEU C  3  10  ? -2.969  66.434  15.209  1.00 36.90  ? 10  LEU C CD1   1 
ATOM   6164  C  CD2   . LEU C  3  10  ? -3.759  64.665  13.646  1.00 37.98  ? 10  LEU C CD2   1 
ATOM   6165  N  N     . SER C  3  11  ? -2.769  68.207  9.695   1.00 36.64  ? 11  SER C N     1 
ATOM   6166  C  CA    . SER C  3  11  ? -3.346  69.163  8.751   1.00 38.50  ? 11  SER C CA    1 
ATOM   6167  C  C     . SER C  3  11  ? -3.989  68.464  7.558   1.00 39.31  ? 11  SER C C     1 
ATOM   6168  O  O     . SER C  3  11  ? -4.997  68.933  7.042   1.00 40.66  ? 11  SER C O     1 
ATOM   6169  C  CB    . SER C  3  11  ? -2.317  70.187  8.286   1.00 38.71  ? 11  SER C CB    1 
ATOM   6170  O  OG    . SER C  3  11  ? -1.254  69.564  7.609   1.00 44.39  ? 11  SER C OG    1 
ATOM   6171  N  N     . LEU C  3  12  ? -3.412  67.338  7.136   1.00 40.24  ? 12  LEU C N     1 
ATOM   6172  C  CA    . LEU C  3  12  ? -3.955  66.555  6.031   1.00 39.66  ? 12  LEU C CA    1 
ATOM   6173  C  C     . LEU C  3  12  ? -5.328  66.086  6.472   1.00 38.73  ? 12  LEU C C     1 
ATOM   6174  O  O     . LEU C  3  12  ? -6.314  66.291  5.773   1.00 40.66  ? 12  LEU C O     1 
ATOM   6175  C  CB    . LEU C  3  12  ? -3.089  65.322  5.760   1.00 44.38  ? 12  LEU C CB    1 
ATOM   6176  C  CG    . LEU C  3  12  ? -2.184  65.256  4.526   1.00 46.45  ? 12  LEU C CG    1 
ATOM   6177  C  CD1   . LEU C  3  12  ? -3.027  65.152  3.290   1.00 47.14  ? 12  LEU C CD1   1 
ATOM   6178  C  CD2   . LEU C  3  12  ? -1.285  66.473  4.458   1.00 48.87  ? 12  LEU C CD2   1 
ATOM   6179  N  N     . VAL C  3  13  ? -5.393  65.495  7.660   1.00 35.98  ? 13  VAL C N     1 
ATOM   6180  C  CA    . VAL C  3  13  ? -6.655  65.009  8.193   1.00 34.08  ? 13  VAL C CA    1 
ATOM   6181  C  C     . VAL C  3  13  ? -7.633  66.162  8.359   1.00 33.96  ? 13  VAL C C     1 
ATOM   6182  O  O     . VAL C  3  13  ? -8.794  66.025  8.025   1.00 36.81  ? 13  VAL C O     1 
ATOM   6183  C  CB    . VAL C  3  13  ? -6.457  64.294  9.550   1.00 33.98  ? 13  VAL C CB    1 
ATOM   6184  C  CG1   . VAL C  3  13  ? -7.794  63.847  10.127  1.00 31.88  ? 13  VAL C CG1   1 
ATOM   6185  C  CG2   . VAL C  3  13  ? -5.546  63.099  9.378   1.00 31.76  ? 13  VAL C CG2   1 
ATOM   6186  N  N     . ASN C  3  14  ? -7.151  67.309  8.829   1.00 34.46  ? 14  ASN C N     1 
ATOM   6187  C  CA    . ASN C  3  14  ? -7.999  68.490  9.040   1.00 33.10  ? 14  ASN C CA    1 
ATOM   6188  C  C     . ASN C  3  14  ? -8.597  69.007  7.735   1.00 34.99  ? 14  ASN C C     1 
ATOM   6189  O  O     . ASN C  3  14  ? -9.808  69.284  7.656   1.00 34.88  ? 14  ASN C O     1 
ATOM   6190  C  CB    . ASN C  3  14  ? -7.209  69.625  9.726   1.00 28.94  ? 14  ASN C CB    1 
ATOM   6191  C  CG    . ASN C  3  14  ? -8.065  70.871  9.998   1.00 28.78  ? 14  ASN C CG    1 
ATOM   6192  O  OD1   . ASN C  3  14  ? -7.789  71.955  9.472   1.00 29.03  ? 14  ASN C OD1   1 
ATOM   6193  N  ND2   . ASN C  3  14  ? -9.117  70.715  10.800  1.00 25.19  ? 14  ASN C ND2   1 
ATOM   6194  N  N     . SER C  3  15  ? -7.763  69.112  6.705   1.00 35.26  ? 15  SER C N     1 
ATOM   6195  C  CA    . SER C  3  15  ? -8.237  69.625  5.431   1.00 38.01  ? 15  SER C CA    1 
ATOM   6196  C  C     . SER C  3  15  ? -9.170  68.678  4.683   1.00 38.20  ? 15  SER C C     1 
ATOM   6197  O  O     . SER C  3  15  ? -10.065 69.124  3.971   1.00 39.97  ? 15  SER C O     1 
ATOM   6198  C  CB    . SER C  3  15  ? -7.071  70.056  4.549   1.00 36.81  ? 15  SER C CB    1 
ATOM   6199  O  OG    . SER C  3  15  ? -6.406  68.931  4.047   1.00 44.79  ? 15  SER C OG    1 
ATOM   6200  N  N     . TYR C  3  16  ? -9.028  67.381  4.902   1.00 38.62  ? 16  TYR C N     1 
ATOM   6201  C  CA    . TYR C  3  16  ? -9.882  66.420  4.211   1.00 39.25  ? 16  TYR C CA    1 
ATOM   6202  C  C     . TYR C  3  16  ? -11.100 65.948  4.983   1.00 40.36  ? 16  TYR C C     1 
ATOM   6203  O  O     . TYR C  3  16  ? -12.142 65.668  4.382   1.00 44.52  ? 16  TYR C O     1 
ATOM   6204  C  CB    . TYR C  3  16  ? -9.075  65.185  3.783   1.00 40.61  ? 16  TYR C CB    1 
ATOM   6205  C  CG    . TYR C  3  16  ? -8.229  65.379  2.543   1.00 43.07  ? 16  TYR C CG    1 
ATOM   6206  C  CD1   . TYR C  3  16  ? -6.990  66.015  2.607   1.00 43.55  ? 16  TYR C CD1   1 
ATOM   6207  C  CD2   . TYR C  3  16  ? -8.673  64.933  1.300   1.00 44.33  ? 16  TYR C CD2   1 
ATOM   6208  C  CE1   . TYR C  3  16  ? -6.218  66.201  1.465   1.00 46.47  ? 16  TYR C CE1   1 
ATOM   6209  C  CE2   . TYR C  3  16  ? -7.910  65.118  0.150   1.00 45.47  ? 16  TYR C CE2   1 
ATOM   6210  C  CZ    . TYR C  3  16  ? -6.687  65.751  0.237   1.00 47.57  ? 16  TYR C CZ    1 
ATOM   6211  O  OH    . TYR C  3  16  ? -5.936  65.945  -0.902  1.00 50.61  ? 16  TYR C OH    1 
ATOM   6212  N  N     . ILE C  3  17  ? -10.999 65.888  6.306   1.00 39.00  ? 17  ILE C N     1 
ATOM   6213  C  CA    . ILE C  3  17  ? -12.095 65.355  7.114   1.00 39.71  ? 17  ILE C CA    1 
ATOM   6214  C  C     . ILE C  3  17  ? -12.747 66.286  8.116   1.00 38.42  ? 17  ILE C C     1 
ATOM   6215  O  O     . ILE C  3  17  ? -13.900 66.068  8.489   1.00 38.20  ? 17  ILE C O     1 
ATOM   6216  C  CB    . ILE C  3  17  ? -11.605 64.088  7.885   1.00 42.58  ? 17  ILE C CB    1 
ATOM   6217  C  CG1   . ILE C  3  17  ? -11.348 62.949  6.899   1.00 48.52  ? 17  ILE C CG1   1 
ATOM   6218  C  CG2   . ILE C  3  17  ? -12.604 63.641  8.942   1.00 43.55  ? 17  ILE C CG2   1 
ATOM   6219  C  CD1   . ILE C  3  17  ? -10.721 61.727  7.544   1.00 52.16  ? 17  ILE C CD1   1 
ATOM   6220  N  N     . ILE C  3  18  ? -12.033 67.320  8.547   1.00 36.16  ? 18  ILE C N     1 
ATOM   6221  C  CA    . ILE C  3  18  ? -12.572 68.201  9.568   1.00 33.79  ? 18  ILE C CA    1 
ATOM   6222  C  C     . ILE C  3  18  ? -13.059 69.565  9.104   1.00 32.84  ? 18  ILE C C     1 
ATOM   6223  O  O     . ILE C  3  18  ? -14.227 69.882  9.278   1.00 29.48  ? 18  ILE C O     1 
ATOM   6224  C  CB    . ILE C  3  18  ? -11.545 68.324  10.757  1.00 36.79  ? 18  ILE C CB    1 
ATOM   6225  C  CG1   . ILE C  3  18  ? -11.237 66.926  11.315  1.00 36.06  ? 18  ILE C CG1   1 
ATOM   6226  C  CG2   . ILE C  3  18  ? -12.100 69.207  11.894  1.00 31.86  ? 18  ILE C CG2   1 
ATOM   6227  C  CD1   . ILE C  3  18  ? -10.087 66.897  12.305  1.00 39.14  ? 18  ILE C CD1   1 
ATOM   6228  N  N     . ASP C  3  19  ? -12.168 70.369  8.530   1.00 32.68  ? 19  ASP C N     1 
ATOM   6229  C  CA    . ASP C  3  19  ? -12.522 71.711  8.073   1.00 34.48  ? 19  ASP C CA    1 
ATOM   6230  C  C     . ASP C  3  19  ? -12.946 71.844  6.611   1.00 35.91  ? 19  ASP C C     1 
ATOM   6231  O  O     . ASP C  3  19  ? -13.290 72.937  6.165   1.00 38.17  ? 19  ASP C O     1 
ATOM   6232  C  CB    . ASP C  3  19  ? -11.370 72.682  8.342   1.00 36.54  ? 19  ASP C CB    1 
ATOM   6233  C  CG    . ASP C  3  19  ? -11.281 73.094  9.784   1.00 37.53  ? 19  ASP C CG    1 
ATOM   6234  O  OD1   . ASP C  3  19  ? -12.242 72.844  10.533  1.00 39.27  ? 19  ASP C OD1   1 
ATOM   6235  O  OD2   . ASP C  3  19  ? -10.259 73.690  10.170  1.00 38.18  ? 19  ASP C OD2   1 
ATOM   6236  N  N     . SER C  3  20  ? -12.883 70.751  5.861   1.00 35.42  ? 20  SER C N     1 
ATOM   6237  C  CA    . SER C  3  20  ? -13.260 70.736  4.454   1.00 33.68  ? 20  SER C CA    1 
ATOM   6238  C  C     . SER C  3  20  ? -14.620 71.397  4.265   1.00 32.98  ? 20  SER C C     1 
ATOM   6239  O  O     . SER C  3  20  ? -15.606 70.968  4.851   1.00 33.63  ? 20  SER C O     1 
ATOM   6240  C  CB    . SER C  3  20  ? -13.320 69.291  3.975   1.00 33.49  ? 20  SER C CB    1 
ATOM   6241  O  OG    . SER C  3  20  ? -13.665 69.234  2.612   1.00 37.68  ? 20  SER C OG    1 
ATOM   6242  N  N     . PRO C  3  21  ? -14.685 72.472  3.465   1.00 33.64  ? 21  PRO C N     1 
ATOM   6243  C  CA    . PRO C  3  21  ? -15.946 73.189  3.213   1.00 34.76  ? 21  PRO C CA    1 
ATOM   6244  C  C     . PRO C  3  21  ? -16.869 72.420  2.255   1.00 36.66  ? 21  PRO C C     1 
ATOM   6245  O  O     . PRO C  3  21  ? -16.541 72.224  1.074   1.00 35.94  ? 21  PRO C O     1 
ATOM   6246  C  CB    . PRO C  3  21  ? -15.476 74.503  2.571   1.00 33.55  ? 21  PRO C CB    1 
ATOM   6247  C  CG    . PRO C  3  21  ? -14.007 74.552  2.834   1.00 35.10  ? 21  PRO C CG    1 
ATOM   6248  C  CD    . PRO C  3  21  ? -13.580 73.126  2.759   1.00 32.03  ? 21  PRO C CD    1 
ATOM   6249  N  N     . GLN C  3  22  ? -18.014 71.980  2.761   1.00 36.95  ? 22  GLN C N     1 
ATOM   6250  C  CA    . GLN C  3  22  ? -18.958 71.237  1.931   1.00 39.33  ? 22  GLN C CA    1 
ATOM   6251  C  C     . GLN C  3  22  ? -20.171 72.092  1.552   1.00 41.07  ? 22  GLN C C     1 
ATOM   6252  O  O     . GLN C  3  22  ? -20.572 72.979  2.311   1.00 40.84  ? 22  GLN C O     1 
ATOM   6253  C  CB    . GLN C  3  22  ? -19.448 69.983  2.667   1.00 38.55  ? 22  GLN C CB    1 
ATOM   6254  C  CG    . GLN C  3  22  ? -18.361 69.023  3.107   1.00 40.60  ? 22  GLN C CG    1 
ATOM   6255  C  CD    . GLN C  3  22  ? -17.492 68.552  1.956   1.00 40.79  ? 22  GLN C CD    1 
ATOM   6256  O  OE1   . GLN C  3  22  ? -17.976 68.309  0.854   1.00 42.46  ? 22  GLN C OE1   1 
ATOM   6257  N  NE2   . GLN C  3  22  ? -16.199 68.441  2.205   1.00 40.67  ? 22  GLN C NE2   1 
ATOM   6258  N  N     . PRO C  3  23  ? -20.753 71.856  0.357   1.00 41.19  ? 23  PRO C N     1 
ATOM   6259  C  CA    . PRO C  3  23  ? -21.926 72.616  -0.087  1.00 39.15  ? 23  PRO C CA    1 
ATOM   6260  C  C     . PRO C  3  23  ? -23.057 72.224  0.849   1.00 38.38  ? 23  PRO C C     1 
ATOM   6261  O  O     . PRO C  3  23  ? -23.323 71.041  1.029   1.00 39.84  ? 23  PRO C O     1 
ATOM   6262  C  CB    . PRO C  3  23  ? -22.158 72.084  -1.499  1.00 38.43  ? 23  PRO C CB    1 
ATOM   6263  C  CG    . PRO C  3  23  ? -20.814 71.653  -1.940  1.00 38.62  ? 23  PRO C CG    1 
ATOM   6264  C  CD    . PRO C  3  23  ? -20.290 70.959  -0.712  1.00 41.76  ? 23  PRO C CD    1 
ATOM   6265  N  N     . SER C  3  24  ? -23.699 73.214  1.458   1.00 37.94  ? 24  SER C N     1 
ATOM   6266  C  CA    . SER C  3  24  ? -24.769 72.974  2.428   1.00 36.39  ? 24  SER C CA    1 
ATOM   6267  C  C     . SER C  3  24  ? -25.907 72.078  1.997   1.00 35.11  ? 24  SER C C     1 
ATOM   6268  O  O     . SER C  3  24  ? -26.555 71.469  2.842   1.00 36.12  ? 24  SER C O     1 
ATOM   6269  C  CB    . SER C  3  24  ? -25.356 74.304  2.915   1.00 36.50  ? 24  SER C CB    1 
ATOM   6270  O  OG    . SER C  3  24  ? -26.014 75.000  1.863   1.00 38.22  ? 24  SER C OG    1 
ATOM   6271  N  N     . SER C  3  25  ? -26.130 71.967  0.693   1.00 34.06  ? 25  SER C N     1 
ATOM   6272  C  CA    . SER C  3  25  ? -27.253 71.188  0.182   1.00 34.49  ? 25  SER C CA    1 
ATOM   6273  C  C     . SER C  3  25  ? -27.053 69.755  -0.311  1.00 35.33  ? 25  SER C C     1 
ATOM   6274  O  O     . SER C  3  25  ? -28.013 69.167  -0.808  1.00 36.55  ? 25  SER C O     1 
ATOM   6275  C  CB    . SER C  3  25  ? -27.960 71.978  -0.921  1.00 35.22  ? 25  SER C CB    1 
ATOM   6276  O  OG    . SER C  3  25  ? -27.097 72.214  -2.025  1.00 36.85  ? 25  SER C OG    1 
ATOM   6277  N  N     . ILE C  3  26  ? -25.857 69.178  -0.189  1.00 32.98  ? 26  ILE C N     1 
ATOM   6278  C  CA    . ILE C  3  26  ? -25.679 67.814  -0.681  1.00 32.59  ? 26  ILE C CA    1 
ATOM   6279  C  C     . ILE C  3  26  ? -26.617 66.829  0.020   1.00 33.18  ? 26  ILE C C     1 
ATOM   6280  O  O     . ILE C  3  26  ? -26.957 67.015  1.187   1.00 32.98  ? 26  ILE C O     1 
ATOM   6281  C  CB    . ILE C  3  26  ? -24.225 67.339  -0.601  1.00 34.01  ? 26  ILE C CB    1 
ATOM   6282  C  CG1   . ILE C  3  26  ? -23.668 67.524  0.806   1.00 33.69  ? 26  ILE C CG1   1 
ATOM   6283  C  CG2   . ILE C  3  26  ? -23.380 68.060  -1.632  1.00 32.37  ? 26  ILE C CG2   1 
ATOM   6284  C  CD1   . ILE C  3  26  ? -22.321 66.851  1.005   1.00 31.41  ? 26  ILE C CD1   1 
ATOM   6285  N  N     . ASN C  3  27  ? -27.098 65.831  -0.719  1.00 30.74  ? 27  ASN C N     1 
ATOM   6286  C  CA    . ASN C  3  27  ? -28.025 64.856  -0.154  1.00 31.35  ? 27  ASN C CA    1 
ATOM   6287  C  C     . ASN C  3  27  ? -27.376 63.499  0.149   1.00 32.58  ? 27  ASN C C     1 
ATOM   6288  O  O     . ASN C  3  27  ? -26.173 63.334  -0.050  1.00 34.20  ? 27  ASN C O     1 
ATOM   6289  C  CB    . ASN C  3  27  ? -29.266 64.708  -1.057  1.00 30.79  ? 27  ASN C CB    1 
ATOM   6290  C  CG    . ASN C  3  27  ? -28.931 64.220  -2.476  1.00 34.21  ? 27  ASN C CG    1 
ATOM   6291  O  OD1   . ASN C  3  27  ? -28.061 63.355  -2.683  1.00 34.01  ? 27  ASN C OD1   1 
ATOM   6292  N  ND2   . ASN C  3  27  ? -29.631 64.776  -3.460  1.00 33.08  ? 27  ASN C ND2   1 
ATOM   6293  N  N     . TYR C  3  28  ? -28.166 62.524  0.598   1.00 31.91  ? 28  TYR C N     1 
ATOM   6294  C  CA    . TYR C  3  28  ? -27.630 61.210  0.936   1.00 34.48  ? 28  TYR C CA    1 
ATOM   6295  C  C     . TYR C  3  28  ? -26.926 60.459  -0.186  1.00 35.29  ? 28  TYR C C     1 
ATOM   6296  O  O     . TYR C  3  28  ? -26.296 59.437  0.070   1.00 35.22  ? 28  TYR C O     1 
ATOM   6297  C  CB    . TYR C  3  28  ? -28.701 60.320  1.574   1.00 35.92  ? 28  TYR C CB    1 
ATOM   6298  C  CG    . TYR C  3  28  ? -28.918 60.570  3.050   1.00 38.88  ? 28  TYR C CG    1 
ATOM   6299  C  CD1   . TYR C  3  28  ? -28.078 59.985  4.008   1.00 39.59  ? 28  TYR C CD1   1 
ATOM   6300  C  CD2   . TYR C  3  28  ? -29.952 61.393  3.494   1.00 39.07  ? 28  TYR C CD2   1 
ATOM   6301  C  CE1   . TYR C  3  28  ? -28.262 60.218  5.375   1.00 41.13  ? 28  TYR C CE1   1 
ATOM   6302  C  CE2   . TYR C  3  28  ? -30.146 61.635  4.864   1.00 41.13  ? 28  TYR C CE2   1 
ATOM   6303  C  CZ    . TYR C  3  28  ? -29.298 61.047  5.794   1.00 42.90  ? 28  TYR C CZ    1 
ATOM   6304  O  OH    . TYR C  3  28  ? -29.470 61.301  7.139   1.00 45.20  ? 28  TYR C OH    1 
ATOM   6305  N  N     . TRP C  3  29  ? -27.039 60.945  -1.422  1.00 35.94  ? 29  TRP C N     1 
ATOM   6306  C  CA    . TRP C  3  29  ? -26.372 60.294  -2.554  1.00 36.15  ? 29  TRP C CA    1 
ATOM   6307  C  C     . TRP C  3  29  ? -24.870 60.544  -2.459  1.00 36.10  ? 29  TRP C C     1 
ATOM   6308  O  O     . TRP C  3  29  ? -24.060 59.802  -3.019  1.00 34.05  ? 29  TRP C O     1 
ATOM   6309  C  CB    . TRP C  3  29  ? -26.927 60.793  -3.904  1.00 36.79  ? 29  TRP C CB    1 
ATOM   6310  C  CG    . TRP C  3  29  ? -28.289 60.236  -4.220  1.00 37.37  ? 29  TRP C CG    1 
ATOM   6311  C  CD1   . TRP C  3  29  ? -29.470 60.907  -4.184  1.00 38.30  ? 29  TRP C CD1   1 
ATOM   6312  C  CD2   . TRP C  3  29  ? -28.614 58.870  -4.510  1.00 38.82  ? 29  TRP C CD2   1 
ATOM   6313  N  NE1   . TRP C  3  29  ? -30.515 60.048  -4.414  1.00 39.45  ? 29  TRP C NE1   1 
ATOM   6314  C  CE2   . TRP C  3  29  ? -30.020 58.791  -4.620  1.00 38.93  ? 29  TRP C CE2   1 
ATOM   6315  C  CE3   . TRP C  3  29  ? -27.854 57.705  -4.684  1.00 38.53  ? 29  TRP C CE3   1 
ATOM   6316  C  CZ2   . TRP C  3  29  ? -30.690 57.593  -4.894  1.00 40.41  ? 29  TRP C CZ2   1 
ATOM   6317  C  CZ3   . TRP C  3  29  ? -28.520 56.507  -4.958  1.00 43.51  ? 29  TRP C CZ3   1 
ATOM   6318  C  CH2   . TRP C  3  29  ? -29.930 56.463  -5.060  1.00 41.83  ? 29  TRP C CH2   1 
ATOM   6319  N  N     . TRP C  3  30  ? -24.509 61.580  -1.706  1.00 36.17  ? 30  TRP C N     1 
ATOM   6320  C  CA    . TRP C  3  30  ? -23.109 61.933  -1.504  1.00 35.89  ? 30  TRP C CA    1 
ATOM   6321  C  C     . TRP C  3  30  ? -22.439 61.135  -0.391  1.00 34.90  ? 30  TRP C C     1 
ATOM   6322  O  O     . TRP C  3  30  ? -21.256 61.317  -0.132  1.00 34.67  ? 30  TRP C O     1 
ATOM   6323  C  CB    . TRP C  3  30  ? -22.954 63.433  -1.257  1.00 35.34  ? 30  TRP C CB    1 
ATOM   6324  C  CG    . TRP C  3  30  ? -22.766 64.212  -2.519  1.00 35.05  ? 30  TRP C CG    1 
ATOM   6325  C  CD1   . TRP C  3  30  ? -21.592 64.720  -2.998  1.00 35.93  ? 30  TRP C CD1   1 
ATOM   6326  C  CD2   . TRP C  3  30  ? -23.779 64.591  -3.454  1.00 35.61  ? 30  TRP C CD2   1 
ATOM   6327  N  NE1   . TRP C  3  30  ? -21.808 65.399  -4.171  1.00 37.22  ? 30  TRP C NE1   1 
ATOM   6328  C  CE2   . TRP C  3  30  ? -23.144 65.337  -4.477  1.00 37.15  ? 30  TRP C CE2   1 
ATOM   6329  C  CE3   . TRP C  3  30  ? -25.166 64.381  -3.529  1.00 35.86  ? 30  TRP C CE3   1 
ATOM   6330  C  CZ2   . TRP C  3  30  ? -23.850 65.877  -5.567  1.00 33.76  ? 30  TRP C CZ2   1 
ATOM   6331  C  CZ3   . TRP C  3  30  ? -25.869 64.920  -4.616  1.00 36.16  ? 30  TRP C CZ3   1 
ATOM   6332  C  CH2   . TRP C  3  30  ? -25.205 65.660  -5.619  1.00 33.14  ? 30  TRP C CH2   1 
ATOM   6333  N  N     . ASN C  3  31  ? -23.201 60.237  0.234   1.00 35.64  ? 31  ASN C N     1 
ATOM   6334  C  CA    . ASN C  3  31  ? -22.706 59.364  1.302   1.00 35.98  ? 31  ASN C CA    1 
ATOM   6335  C  C     . ASN C  3  31  ? -22.092 58.052  0.790   1.00 35.54  ? 31  ASN C C     1 
ATOM   6336  O  O     . ASN C  3  31  ? -21.500 57.315  1.565   1.00 37.20  ? 31  ASN C O     1 
ATOM   6337  C  CB    . ASN C  3  31  ? -23.839 59.016  2.266   1.00 36.16  ? 31  ASN C CB    1 
ATOM   6338  C  CG    . ASN C  3  31  ? -24.271 60.192  3.116   1.00 40.79  ? 31  ASN C CG    1 
ATOM   6339  O  OD1   . ASN C  3  31  ? -24.186 61.347  2.702   1.00 46.08  ? 31  ASN C OD1   1 
ATOM   6340  N  ND2   . ASN C  3  31  ? -24.747 59.902  4.315   1.00 42.07  ? 31  ASN C ND2   1 
ATOM   6341  N  N     . MET C  3  32  ? -22.218 57.763  -0.505  1.00 35.39  ? 32  MET C N     1 
ATOM   6342  C  CA    . MET C  3  32  ? -21.696 56.516  -1.077  1.00 35.49  ? 32  MET C CA    1 
ATOM   6343  C  C     . MET C  3  32  ? -20.173 56.417  -1.066  1.00 35.85  ? 32  MET C C     1 
ATOM   6344  O  O     . MET C  3  32  ? -19.613 55.326  -0.939  1.00 36.57  ? 32  MET C O     1 
ATOM   6345  C  CB    . MET C  3  32  ? -22.217 56.313  -2.503  1.00 35.34  ? 32  MET C CB    1 
ATOM   6346  C  CG    . MET C  3  32  ? -23.731 56.344  -2.629  1.00 37.49  ? 32  MET C CG    1 
ATOM   6347  S  SD    . MET C  3  32  ? -24.533 55.062  -1.651  1.00 42.08  ? 32  MET C SD    1 
ATOM   6348  C  CE    . MET C  3  32  ? -25.216 55.999  -0.312  1.00 41.51  ? 32  MET C CE    1 
ATOM   6349  N  N     . GLY C  3  33  ? -19.505 57.557  -1.208  1.00 35.48  ? 33  GLY C N     1 
ATOM   6350  C  CA    . GLY C  3  33  ? -18.052 57.567  -1.207  1.00 35.22  ? 33  GLY C CA    1 
ATOM   6351  C  C     . GLY C  3  33  ? -17.432 56.991  0.059   1.00 34.88  ? 33  GLY C C     1 
ATOM   6352  O  O     . GLY C  3  33  ? -16.540 56.128  -0.007  1.00 35.11  ? 33  GLY C O     1 
ATOM   6353  N  N     . SER C  3  34  ? -17.896 57.467  1.213   1.00 32.98  ? 34  SER C N     1 
ATOM   6354  C  CA    . SER C  3  34  ? -17.371 56.990  2.484   1.00 33.07  ? 34  SER C CA    1 
ATOM   6355  C  C     . SER C  3  34  ? -17.679 55.510  2.606   1.00 32.61  ? 34  SER C C     1 
ATOM   6356  O  O     . SER C  3  34  ? -16.807 54.723  2.995   1.00 32.82  ? 34  SER C O     1 
ATOM   6357  C  CB    . SER C  3  34  ? -17.939 57.788  3.656   1.00 32.97  ? 34  SER C CB    1 
ATOM   6358  O  OG    . SER C  3  34  ? -19.349 57.848  3.603   1.00 37.05  ? 34  SER C OG    1 
ATOM   6359  N  N     . LEU C  3  35  ? -18.879 55.126  2.170   1.00 29.89  ? 35  LEU C N     1 
ATOM   6360  C  CA    . LEU C  3  35  ? -19.315 53.728  2.184   1.00 30.51  ? 35  LEU C CA    1 
ATOM   6361  C  C     . LEU C  3  35  ? -18.361 52.856  1.342   1.00 32.18  ? 35  LEU C C     1 
ATOM   6362  O  O     . LEU C  3  35  ? -18.110 51.687  1.663   1.00 32.90  ? 35  LEU C O     1 
ATOM   6363  C  CB    . LEU C  3  35  ? -20.737 53.633  1.649   1.00 31.69  ? 35  LEU C CB    1 
ATOM   6364  C  CG    . LEU C  3  35  ? -21.822 53.063  2.558   1.00 32.81  ? 35  LEU C CG    1 
ATOM   6365  C  CD1   . LEU C  3  35  ? -21.678 53.585  3.968   1.00 32.71  ? 35  LEU C CD1   1 
ATOM   6366  C  CD2   . LEU C  3  35  ? -23.176 53.425  1.980   1.00 32.31  ? 35  LEU C CD2   1 
ATOM   6367  N  N     . LEU C  3  36  ? -17.797 53.441  0.289   1.00 29.88  ? 36  LEU C N     1 
ATOM   6368  C  CA    . LEU C  3  36  ? -16.843 52.724  -0.538  1.00 29.48  ? 36  LEU C CA    1 
ATOM   6369  C  C     . LEU C  3  36  ? -15.492 52.530  0.175   1.00 29.42  ? 36  LEU C C     1 
ATOM   6370  O  O     . LEU C  3  36  ? -14.811 51.525  -0.042  1.00 26.11  ? 36  LEU C O     1 
ATOM   6371  C  CB    . LEU C  3  36  ? -16.672 53.432  -1.881  1.00 29.95  ? 36  LEU C CB    1 
ATOM   6372  C  CG    . LEU C  3  36  ? -17.877 53.211  -2.802  1.00 29.72  ? 36  LEU C CG    1 
ATOM   6373  C  CD1   . LEU C  3  36  ? -17.809 54.164  -3.950  1.00 29.76  ? 36  LEU C CD1   1 
ATOM   6374  C  CD2   . LEU C  3  36  ? -17.911 51.766  -3.297  1.00 27.57  ? 36  LEU C CD2   1 
ATOM   6375  N  N     . GLY C  3  37  ? -15.093 53.502  1.000   1.00 30.42  ? 37  GLY C N     1 
ATOM   6376  C  CA    . GLY C  3  37  ? -13.849 53.373  1.750   1.00 29.40  ? 37  GLY C CA    1 
ATOM   6377  C  C     . GLY C  3  37  ? -14.034 52.254  2.778   1.00 31.37  ? 37  GLY C C     1 
ATOM   6378  O  O     . GLY C  3  37  ? -13.210 51.350  2.901   1.00 30.39  ? 37  GLY C O     1 
ATOM   6379  N  N     . LEU C  3  38  ? -15.161 52.294  3.484   1.00 31.31  ? 38  LEU C N     1 
ATOM   6380  C  CA    . LEU C  3  38  ? -15.503 51.286  4.471   1.00 31.29  ? 38  LEU C CA    1 
ATOM   6381  C  C     . LEU C  3  38  ? -15.424 49.891  3.828   1.00 32.03  ? 38  LEU C C     1 
ATOM   6382  O  O     . LEU C  3  38  ? -14.819 48.979  4.390   1.00 32.91  ? 38  LEU C O     1 
ATOM   6383  C  CB    . LEU C  3  38  ? -16.928 51.527  4.983   1.00 31.68  ? 38  LEU C CB    1 
ATOM   6384  C  CG    . LEU C  3  38  ? -17.316 51.056  6.391   1.00 32.85  ? 38  LEU C CG    1 
ATOM   6385  C  CD1   . LEU C  3  38  ? -18.749 50.604  6.400   1.00 29.86  ? 38  LEU C CD1   1 
ATOM   6386  C  CD2   . LEU C  3  38  ? -16.418 49.944  6.893   1.00 32.59  ? 38  LEU C CD2   1 
ATOM   6387  N  N     . CYS C  3  39  ? -16.033 49.730  2.652   1.00 31.86  ? 39  CYS C N     1 
ATOM   6388  C  CA    . CYS C  3  39  ? -16.015 48.443  1.952   1.00 31.02  ? 39  CYS C CA    1 
ATOM   6389  C  C     . CYS C  3  39  ? -14.596 47.984  1.680   1.00 29.57  ? 39  CYS C C     1 
ATOM   6390  O  O     . CYS C  3  39  ? -14.261 46.816  1.867   1.00 29.91  ? 39  CYS C O     1 
ATOM   6391  C  CB    . CYS C  3  39  ? -16.787 48.509  0.625   1.00 31.01  ? 39  CYS C CB    1 
ATOM   6392  S  SG    . CYS C  3  39  ? -18.576 48.566  0.785   1.00 34.51  ? 39  CYS C SG    1 
ATOM   6393  N  N     . LEU C  3  40  ? -13.755 48.916  1.259   1.00 29.30  ? 40  LEU C N     1 
ATOM   6394  C  CA    . LEU C  3  40  ? -12.372 48.596  0.960   1.00 30.16  ? 40  LEU C CA    1 
ATOM   6395  C  C     . LEU C  3  40  ? -11.657 48.076  2.205   1.00 32.69  ? 40  LEU C C     1 
ATOM   6396  O  O     . LEU C  3  40  ? -10.911 47.093  2.124   1.00 34.92  ? 40  LEU C O     1 
ATOM   6397  C  CB    . LEU C  3  40  ? -11.658 49.819  0.390   1.00 27.55  ? 40  LEU C CB    1 
ATOM   6398  C  CG    . LEU C  3  40  ? -10.274 49.550  -0.173  1.00 28.13  ? 40  LEU C CG    1 
ATOM   6399  C  CD1   . LEU C  3  40  ? -10.361 48.488  -1.214  1.00 27.00  ? 40  LEU C CD1   1 
ATOM   6400  C  CD2   . LEU C  3  40  ? -9.703  50.811  -0.756  1.00 31.22  ? 40  LEU C CD2   1 
ATOM   6401  N  N     . VAL C  3  41  ? -11.926 48.690  3.360   1.00 32.06  ? 41  VAL C N     1 
ATOM   6402  C  CA    . VAL C  3  41  ? -11.296 48.256  4.599   1.00 33.22  ? 41  VAL C CA    1 
ATOM   6403  C  C     . VAL C  3  41  ? -11.786 46.854  4.967   1.00 33.13  ? 41  VAL C C     1 
ATOM   6404  O  O     . VAL C  3  41  ? -10.964 45.960  5.200   1.00 32.98  ? 41  VAL C O     1 
ATOM   6405  C  CB    . VAL C  3  41  ? -11.536 49.256  5.780   1.00 36.23  ? 41  VAL C CB    1 
ATOM   6406  C  CG1   . VAL C  3  41  ? -10.915 48.713  7.060   1.00 34.65  ? 41  VAL C CG1   1 
ATOM   6407  C  CG2   . VAL C  3  41  ? -10.911 50.612  5.479   1.00 34.40  ? 41  VAL C CG2   1 
ATOM   6408  N  N     . ILE C  3  42  ? -13.109 46.657  4.993   1.00 31.62  ? 42  ILE C N     1 
ATOM   6409  C  CA    . ILE C  3  42  ? -13.693 45.348  5.309   1.00 31.14  ? 42  ILE C CA    1 
ATOM   6410  C  C     . ILE C  3  42  ? -13.132 44.233  4.423   1.00 32.73  ? 42  ILE C C     1 
ATOM   6411  O  O     . ILE C  3  42  ? -12.954 43.095  4.876   1.00 34.17  ? 42  ILE C O     1 
ATOM   6412  C  CB    . ILE C  3  42  ? -15.223 45.323  5.127   1.00 31.35  ? 42  ILE C CB    1 
ATOM   6413  C  CG1   . ILE C  3  42  ? -15.910 46.138  6.223   1.00 30.50  ? 42  ILE C CG1   1 
ATOM   6414  C  CG2   . ILE C  3  42  ? -15.740 43.865  5.140   1.00 27.34  ? 42  ILE C CG2   1 
ATOM   6415  C  CD1   . ILE C  3  42  ? -17.424 46.259  6.015   1.00 27.36  ? 42  ILE C CD1   1 
ATOM   6416  N  N     . GLN C  3  43  ? -12.853 44.553  3.165   1.00 30.63  ? 43  GLN C N     1 
ATOM   6417  C  CA    . GLN C  3  43  ? -12.330 43.541  2.268   1.00 30.69  ? 43  GLN C CA    1 
ATOM   6418  C  C     . GLN C  3  43  ? -10.893 43.211  2.613   1.00 31.94  ? 43  GLN C C     1 
ATOM   6419  O  O     . GLN C  3  43  ? -10.515 42.040  2.642   1.00 35.51  ? 43  GLN C O     1 
ATOM   6420  C  CB    . GLN C  3  43  ? -12.438 43.980  0.800   1.00 30.05  ? 43  GLN C CB    1 
ATOM   6421  C  CG    . GLN C  3  43  ? -13.844 44.030  0.255   1.00 25.23  ? 43  GLN C CG    1 
ATOM   6422  C  CD    . GLN C  3  43  ? -14.609 42.782  0.572   1.00 28.73  ? 43  GLN C CD    1 
ATOM   6423  O  OE1   . GLN C  3  43  ? -14.336 41.707  0.031   1.00 29.70  ? 43  GLN C OE1   1 
ATOM   6424  N  NE2   . GLN C  3  43  ? -15.581 42.909  1.460   1.00 29.67  ? 43  GLN C NE2   1 
ATOM   6425  N  N     . ILE C  3  44  ? -10.092 44.235  2.897   1.00 30.25  ? 44  ILE C N     1 
ATOM   6426  C  CA    . ILE C  3  44  ? -8.691  44.010  3.228   1.00 29.30  ? 44  ILE C CA    1 
ATOM   6427  C  C     . ILE C  3  44  ? -8.492  43.288  4.570   1.00 30.29  ? 44  ILE C C     1 
ATOM   6428  O  O     . ILE C  3  44  ? -7.734  42.323  4.648   1.00 30.78  ? 44  ILE C O     1 
ATOM   6429  C  CB    . ILE C  3  44  ? -7.902  45.329  3.181   1.00 28.01  ? 44  ILE C CB    1 
ATOM   6430  C  CG1   . ILE C  3  44  ? -7.807  45.806  1.737   1.00 27.57  ? 44  ILE C CG1   1 
ATOM   6431  C  CG2   . ILE C  3  44  ? -6.505  45.157  3.782   1.00 25.91  ? 44  ILE C CG2   1 
ATOM   6432  C  CD1   . ILE C  3  44  ? -7.001  47.098  1.560   1.00 27.26  ? 44  ILE C CD1   1 
ATOM   6433  N  N     . VAL C  3  45  ? -9.202  43.730  5.608   1.00 30.06  ? 45  VAL C N     1 
ATOM   6434  C  CA    . VAL C  3  45  ? -9.096  43.123  6.928   1.00 29.33  ? 45  VAL C CA    1 
ATOM   6435  C  C     . VAL C  3  45  ? -9.495  41.644  6.940   1.00 30.42  ? 45  VAL C C     1 
ATOM   6436  O  O     . VAL C  3  45  ? -8.683  40.784  7.298   1.00 30.81  ? 45  VAL C O     1 
ATOM   6437  C  CB    . VAL C  3  45  ? -9.910  43.912  7.959   1.00 30.48  ? 45  VAL C CB    1 
ATOM   6438  C  CG1   . VAL C  3  45  ? -9.845  43.235  9.310   1.00 28.49  ? 45  VAL C CG1   1 
ATOM   6439  C  CG2   . VAL C  3  45  ? -9.373  45.347  8.055   1.00 26.60  ? 45  VAL C CG2   1 
ATOM   6440  N  N     . THR C  3  46  ? -10.719 41.334  6.514   1.00 31.09  ? 46  THR C N     1 
ATOM   6441  C  CA    . THR C  3  46  ? -11.183 39.935  6.476   1.00 30.48  ? 46  THR C CA    1 
ATOM   6442  C  C     . THR C  3  46  ? -10.317 39.080  5.545   1.00 31.31  ? 46  THR C C     1 
ATOM   6443  O  O     . THR C  3  46  ? -10.145 37.879  5.759   1.00 32.20  ? 46  THR C O     1 
ATOM   6444  C  CB    . THR C  3  46  ? -12.631 39.827  5.988   1.00 31.25  ? 46  THR C CB    1 
ATOM   6445  O  OG1   . THR C  3  46  ? -12.738 40.429  4.690   1.00 33.50  ? 46  THR C OG1   1 
ATOM   6446  C  CG2   . THR C  3  46  ? -13.578 40.521  6.964   1.00 28.23  ? 46  THR C CG2   1 
ATOM   6447  N  N     . GLY C  3  47  ? -9.758  39.702  4.516   1.00 29.01  ? 47  GLY C N     1 
ATOM   6448  C  CA    . GLY C  3  47  ? -8.912  38.952  3.612   1.00 30.31  ? 47  GLY C CA    1 
ATOM   6449  C  C     . GLY C  3  47  ? -7.582  38.524  4.209   1.00 31.24  ? 47  GLY C C     1 
ATOM   6450  O  O     . GLY C  3  47  ? -7.121  37.410  3.972   1.00 33.28  ? 47  GLY C O     1 
ATOM   6451  N  N     . ILE C  3  48  ? -6.944  39.409  4.965   1.00 31.02  ? 48  ILE C N     1 
ATOM   6452  C  CA    . ILE C  3  48  ? -5.665  39.091  5.581   1.00 31.57  ? 48  ILE C CA    1 
ATOM   6453  C  C     . ILE C  3  48  ? -5.827  37.996  6.643   1.00 31.98  ? 48  ILE C C     1 
ATOM   6454  O  O     . ILE C  3  48  ? -5.031  37.071  6.716   1.00 33.07  ? 48  ILE C O     1 
ATOM   6455  C  CB    . ILE C  3  48  ? -5.025  40.362  6.186   1.00 33.07  ? 48  ILE C CB    1 
ATOM   6456  C  CG1   . ILE C  3  48  ? -4.669  41.336  5.055   1.00 32.68  ? 48  ILE C CG1   1 
ATOM   6457  C  CG2   . ILE C  3  48  ? -3.785  40.007  7.021   1.00 31.02  ? 48  ILE C CG2   1 
ATOM   6458  C  CD1   . ILE C  3  48  ? -4.267  42.704  5.514   1.00 31.68  ? 48  ILE C CD1   1 
ATOM   6459  N  N     . PHE C  3  49  ? -6.875  38.077  7.447   1.00 31.55  ? 49  PHE C N     1 
ATOM   6460  C  CA    . PHE C  3  49  ? -7.077  37.060  8.456   1.00 32.79  ? 49  PHE C CA    1 
ATOM   6461  C  C     . PHE C  3  49  ? -7.336  35.688  7.856   1.00 32.79  ? 49  PHE C C     1 
ATOM   6462  O  O     . PHE C  3  49  ? -6.889  34.679  8.400   1.00 35.62  ? 49  PHE C O     1 
ATOM   6463  C  CB    . PHE C  3  49  ? -8.176  37.470  9.428   1.00 34.91  ? 49  PHE C CB    1 
ATOM   6464  C  CG    . PHE C  3  49  ? -7.705  38.430  10.499  1.00 35.35  ? 49  PHE C CG    1 
ATOM   6465  C  CD1   . PHE C  3  49  ? -7.867  39.802  10.351  1.00 35.18  ? 49  PHE C CD1   1 
ATOM   6466  C  CD2   . PHE C  3  49  ? -7.101  37.948  11.658  1.00 34.83  ? 49  PHE C CD2   1 
ATOM   6467  C  CE1   . PHE C  3  49  ? -7.436  40.684  11.347  1.00 39.49  ? 49  PHE C CE1   1 
ATOM   6468  C  CE2   . PHE C  3  49  ? -6.665  38.818  12.660  1.00 36.60  ? 49  PHE C CE2   1 
ATOM   6469  C  CZ    . PHE C  3  49  ? -6.829  40.184  12.510  1.00 37.83  ? 49  PHE C CZ    1 
ATOM   6470  N  N     . MET C  3  50  ? -8.011  35.632  6.712   1.00 32.36  ? 50  MET C N     1 
ATOM   6471  C  CA    . MET C  3  50  ? -8.254  34.337  6.076   1.00 30.38  ? 50  MET C CA    1 
ATOM   6472  C  C     . MET C  3  50  ? -6.988  33.834  5.398   1.00 30.01  ? 50  MET C C     1 
ATOM   6473  O  O     . MET C  3  50  ? -6.758  32.635  5.317   1.00 29.93  ? 50  MET C O     1 
ATOM   6474  C  CB    . MET C  3  50  ? -9.375  34.422  5.045   1.00 30.50  ? 50  MET C CB    1 
ATOM   6475  C  CG    . MET C  3  50  ? -10.770 34.435  5.621   1.00 30.38  ? 50  MET C CG    1 
ATOM   6476  S  SD    . MET C  3  50  ? -11.980 34.219  4.311   1.00 36.51  ? 50  MET C SD    1 
ATOM   6477  C  CE    . MET C  3  50  ? -11.778 35.706  3.452   1.00 31.45  ? 50  MET C CE    1 
ATOM   6478  N  N     . ALA C  3  51  ? -6.153  34.759  4.936   1.00 29.77  ? 51  ALA C N     1 
ATOM   6479  C  CA    . ALA C  3  51  ? -4.929  34.393  4.248   1.00 30.63  ? 51  ALA C CA    1 
ATOM   6480  C  C     . ALA C  3  51  ? -4.033  33.595  5.172   1.00 33.80  ? 51  ALA C C     1 
ATOM   6481  O  O     . ALA C  3  51  ? -3.163  32.848  4.727   1.00 34.01  ? 51  ALA C O     1 
ATOM   6482  C  CB    . ALA C  3  51  ? -4.221  35.631  3.761   1.00 28.96  ? 51  ALA C CB    1 
ATOM   6483  N  N     . MET C  3  52  ? -4.237  33.775  6.474   1.00 37.27  ? 52  MET C N     1 
ATOM   6484  C  CA    . MET C  3  52  ? -3.454  33.067  7.484   1.00 37.39  ? 52  MET C CA    1 
ATOM   6485  C  C     . MET C  3  52  ? -3.735  31.555  7.491   1.00 37.77  ? 52  MET C C     1 
ATOM   6486  O  O     . MET C  3  52  ? -2.874  30.749  7.841   1.00 39.42  ? 52  MET C O     1 
ATOM   6487  C  CB    . MET C  3  52  ? -3.753  33.660  8.853   1.00 37.37  ? 52  MET C CB    1 
ATOM   6488  C  CG    . MET C  3  52  ? -3.189  35.054  9.050   1.00 37.55  ? 52  MET C CG    1 
ATOM   6489  S  SD    . MET C  3  52  ? -3.678  35.796  10.619  1.00 38.13  ? 52  MET C SD    1 
ATOM   6490  C  CE    . MET C  3  52  ? -2.939  37.429  10.421  1.00 34.85  ? 52  MET C CE    1 
ATOM   6491  N  N     . HIS C  3  53  ? -4.920  31.178  7.024   1.00 37.20  ? 53  HIS C N     1 
ATOM   6492  C  CA    . HIS C  3  53  ? -5.337  29.789  7.002   1.00 35.46  ? 53  HIS C CA    1 
ATOM   6493  C  C     . HIS C  3  53  ? -5.501  29.198  5.594   1.00 37.50  ? 53  HIS C C     1 
ATOM   6494  O  O     . HIS C  3  53  ? -5.823  28.008  5.456   1.00 38.38  ? 53  HIS C O     1 
ATOM   6495  C  CB    . HIS C  3  53  ? -6.676  29.672  7.732   1.00 33.40  ? 53  HIS C CB    1 
ATOM   6496  C  CG    . HIS C  3  53  ? -6.685  30.280  9.100   1.00 32.16  ? 53  HIS C CG    1 
ATOM   6497  N  ND1   . HIS C  3  53  ? -6.072  29.691  10.183  1.00 32.24  ? 53  HIS C ND1   1 
ATOM   6498  C  CD2   . HIS C  3  53  ? -7.264  31.411  9.566   1.00 32.81  ? 53  HIS C CD2   1 
ATOM   6499  C  CE1   . HIS C  3  53  ? -6.273  30.430  11.259  1.00 32.31  ? 53  HIS C CE1   1 
ATOM   6500  N  NE2   . HIS C  3  53  ? -6.994  31.480  10.911  1.00 33.33  ? 53  HIS C NE2   1 
ATOM   6501  N  N     . TYR C  3  54  ? -5.277  30.013  4.560   1.00 36.51  ? 54  TYR C N     1 
ATOM   6502  C  CA    . TYR C  3  54  ? -5.457  29.584  3.166   1.00 35.42  ? 54  TYR C CA    1 
ATOM   6503  C  C     . TYR C  3  54  ? -4.229  29.010  2.465   1.00 33.82  ? 54  TYR C C     1 
ATOM   6504  O  O     . TYR C  3  54  ? -3.132  29.511  2.640   1.00 35.30  ? 54  TYR C O     1 
ATOM   6505  C  CB    . TYR C  3  54  ? -6.020  30.760  2.341   1.00 35.68  ? 54  TYR C CB    1 
ATOM   6506  C  CG    . TYR C  3  54  ? -6.188  30.497  0.846   1.00 34.35  ? 54  TYR C CG    1 
ATOM   6507  C  CD1   . TYR C  3  54  ? -7.338  29.888  0.357   1.00 33.74  ? 54  TYR C CD1   1 
ATOM   6508  C  CD2   . TYR C  3  54  ? -5.198  30.873  -0.075  1.00 34.05  ? 54  TYR C CD2   1 
ATOM   6509  C  CE1   . TYR C  3  54  ? -7.511  29.658  -0.998  1.00 32.53  ? 54  TYR C CE1   1 
ATOM   6510  C  CE2   . TYR C  3  54  ? -5.361  30.649  -1.435  1.00 32.78  ? 54  TYR C CE2   1 
ATOM   6511  C  CZ    . TYR C  3  54  ? -6.525  30.040  -1.887  1.00 33.48  ? 54  TYR C CZ    1 
ATOM   6512  O  OH    . TYR C  3  54  ? -6.729  29.823  -3.225  1.00 32.53  ? 54  TYR C OH    1 
ATOM   6513  N  N     . SER C  3  55  ? -4.436  27.980  1.649   1.00 33.32  ? 55  SER C N     1 
ATOM   6514  C  CA    . SER C  3  55  ? -3.356  27.356  0.877   1.00 35.67  ? 55  SER C CA    1 
ATOM   6515  C  C     . SER C  3  55  ? -3.712  27.541  -0.592  1.00 37.07  ? 55  SER C C     1 
ATOM   6516  O  O     . SER C  3  55  ? -4.823  27.199  -1.014  1.00 35.43  ? 55  SER C O     1 
ATOM   6517  C  CB    . SER C  3  55  ? -3.235  25.855  1.173   1.00 37.53  ? 55  SER C CB    1 
ATOM   6518  O  OG    . SER C  3  55  ? -2.904  25.615  2.527   1.00 39.83  ? 55  SER C OG    1 
ATOM   6519  N  N     . SER C  3  56  ? -2.772  28.084  -1.363  1.00 36.94  ? 56  SER C N     1 
ATOM   6520  C  CA    . SER C  3  56  ? -3.001  28.332  -2.776  1.00 38.89  ? 56  SER C CA    1 
ATOM   6521  C  C     . SER C  3  56  ? -2.823  27.148  -3.734  1.00 41.44  ? 56  SER C C     1 
ATOM   6522  O  O     . SER C  3  56  ? -3.254  27.236  -4.883  1.00 43.01  ? 56  SER C O     1 
ATOM   6523  C  CB    . SER C  3  56  ? -2.167  29.509  -3.247  1.00 36.82  ? 56  SER C CB    1 
ATOM   6524  O  OG    . SER C  3  56  ? -0.797  29.196  -3.189  1.00 42.48  ? 56  SER C OG    1 
ATOM   6525  N  N     . ASN C  3  57  ? -2.191  26.060  -3.286  1.00 42.82  ? 57  ASN C N     1 
ATOM   6526  C  CA    . ASN C  3  57  ? -2.010  24.874  -4.131  1.00 44.11  ? 57  ASN C CA    1 
ATOM   6527  C  C     . ASN C  3  57  ? -3.334  24.404  -4.666  1.00 44.04  ? 57  ASN C C     1 
ATOM   6528  O  O     . ASN C  3  57  ? -4.326  24.390  -3.948  1.00 45.48  ? 57  ASN C O     1 
ATOM   6529  C  CB    . ASN C  3  57  ? -1.383  23.726  -3.365  1.00 48.17  ? 57  ASN C CB    1 
ATOM   6530  C  CG    . ASN C  3  57  ? 0.085   23.885  -3.219  1.00 54.32  ? 57  ASN C CG    1 
ATOM   6531  O  OD1   . ASN C  3  57  ? 0.549   24.744  -2.464  1.00 59.02  ? 57  ASN C OD1   1 
ATOM   6532  N  ND2   . ASN C  3  57  ? 0.848   23.076  -3.954  1.00 55.56  ? 57  ASN C ND2   1 
ATOM   6533  N  N     . ILE C  3  58  ? -3.333  23.989  -5.925  1.00 43.11  ? 58  ILE C N     1 
ATOM   6534  C  CA    . ILE C  3  58  ? -4.543  23.545  -6.576  1.00 44.32  ? 58  ILE C CA    1 
ATOM   6535  C  C     . ILE C  3  58  ? -5.153  22.315  -5.919  1.00 46.42  ? 58  ILE C C     1 
ATOM   6536  O  O     . ILE C  3  58  ? -6.365  22.129  -5.977  1.00 45.88  ? 58  ILE C O     1 
ATOM   6537  C  CB    . ILE C  3  58  ? -4.302  23.321  -8.076  1.00 44.11  ? 58  ILE C CB    1 
ATOM   6538  C  CG1   . ILE C  3  58  ? -5.635  23.284  -8.818  1.00 45.80  ? 58  ILE C CG1   1 
ATOM   6539  C  CG2   . ILE C  3  58  ? -3.502  22.069  -8.297  1.00 42.75  ? 58  ILE C CG2   1 
ATOM   6540  C  CD1   . ILE C  3  58  ? -5.522  23.639  -10.287 1.00 48.26  ? 58  ILE C CD1   1 
ATOM   6541  N  N     . GLU C  3  59  ? -4.329  21.509  -5.249  1.00 48.71  ? 59  GLU C N     1 
ATOM   6542  C  CA    . GLU C  3  59  ? -4.835  20.316  -4.574  1.00 51.56  ? 59  GLU C CA    1 
ATOM   6543  C  C     . GLU C  3  59  ? -5.380  20.630  -3.184  1.00 51.29  ? 59  GLU C C     1 
ATOM   6544  O  O     . GLU C  3  59  ? -6.066  19.800  -2.593  1.00 52.78  ? 59  GLU C O     1 
ATOM   6545  C  CB    . GLU C  3  59  ? -3.752  19.244  -4.419  1.00 56.36  ? 59  GLU C CB    1 
ATOM   6546  C  CG    . GLU C  3  59  ? -2.899  18.982  -5.646  1.00 66.14  ? 59  GLU C CG    1 
ATOM   6547  C  CD    . GLU C  3  59  ? -1.709  19.936  -5.760  1.00 72.49  ? 59  GLU C CD    1 
ATOM   6548  O  OE1   . GLU C  3  59  ? -1.101  19.996  -6.853  1.00 76.04  ? 59  GLU C OE1   1 
ATOM   6549  O  OE2   . GLU C  3  59  ? -1.370  20.623  -4.763  1.00 75.50  ? 59  GLU C OE2   1 
ATOM   6550  N  N     . LEU C  3  60  ? -5.107  21.828  -2.670  1.00 49.07  ? 60  LEU C N     1 
ATOM   6551  C  CA    . LEU C  3  60  ? -5.552  22.176  -1.327  1.00 46.99  ? 60  LEU C CA    1 
ATOM   6552  C  C     . LEU C  3  60  ? -6.435  23.407  -1.195  1.00 47.28  ? 60  LEU C C     1 
ATOM   6553  O  O     . LEU C  3  60  ? -7.075  23.602  -0.153  1.00 48.48  ? 60  LEU C O     1 
ATOM   6554  C  CB    . LEU C  3  60  ? -4.334  22.350  -0.418  1.00 47.95  ? 60  LEU C CB    1 
ATOM   6555  C  CG    . LEU C  3  60  ? -3.305  21.210  -0.383  1.00 48.16  ? 60  LEU C CG    1 
ATOM   6556  C  CD1   . LEU C  3  60  ? -2.106  21.610  0.474   1.00 47.57  ? 60  LEU C CD1   1 
ATOM   6557  C  CD2   . LEU C  3  60  ? -3.955  19.957  0.157   1.00 46.53  ? 60  LEU C CD2   1 
ATOM   6558  N  N     . ALA C  3  61  ? -6.480  24.228  -2.241  1.00 44.87  ? 61  ALA C N     1 
ATOM   6559  C  CA    . ALA C  3  61  ? -7.258  25.463  -2.218  1.00 42.07  ? 61  ALA C CA    1 
ATOM   6560  C  C     . ALA C  3  61  ? -8.702  25.303  -1.759  1.00 41.64  ? 61  ALA C C     1 
ATOM   6561  O  O     . ALA C  3  61  ? -9.122  25.944  -0.788  1.00 39.94  ? 61  ALA C O     1 
ATOM   6562  C  CB    . ALA C  3  61  ? -7.203  26.150  -3.587  1.00 41.86  ? 61  ALA C CB    1 
ATOM   6563  N  N     . PHE C  3  62  ? -9.457  24.448  -2.449  1.00 40.28  ? 62  PHE C N     1 
ATOM   6564  C  CA    . PHE C  3  62  ? -10.859 24.228  -2.106  1.00 39.64  ? 62  PHE C CA    1 
ATOM   6565  C  C     . PHE C  3  62  ? -11.038 23.762  -0.665  1.00 39.47  ? 62  PHE C C     1 
ATOM   6566  O  O     . PHE C  3  62  ? -11.863 24.302  0.076   1.00 38.41  ? 62  PHE C O     1 
ATOM   6567  C  CB    . PHE C  3  62  ? -11.509 23.221  -3.059  1.00 38.05  ? 62  PHE C CB    1 
ATOM   6568  C  CG    . PHE C  3  62  ? -12.995 23.090  -2.869  1.00 37.25  ? 62  PHE C CG    1 
ATOM   6569  C  CD1   . PHE C  3  62  ? -13.866 23.887  -3.597  1.00 34.89  ? 62  PHE C CD1   1 
ATOM   6570  C  CD2   . PHE C  3  62  ? -13.520 22.203  -1.930  1.00 37.43  ? 62  PHE C CD2   1 
ATOM   6571  C  CE1   . PHE C  3  62  ? -15.232 23.818  -3.398  1.00 36.25  ? 62  PHE C CE1   1 
ATOM   6572  C  CE2   . PHE C  3  62  ? -14.892 22.121  -1.717  1.00 38.65  ? 62  PHE C CE2   1 
ATOM   6573  C  CZ    . PHE C  3  62  ? -15.752 22.930  -2.453  1.00 38.81  ? 62  PHE C CZ    1 
ATOM   6574  N  N     . SER C  3  63  ? -10.253 22.766  -0.269  1.00 39.75  ? 63  SER C N     1 
ATOM   6575  C  CA    . SER C  3  63  ? -10.344 22.242  1.087   1.00 40.56  ? 63  SER C CA    1 
ATOM   6576  C  C     . SER C  3  63  ? -9.898  23.231  2.154   1.00 40.28  ? 63  SER C C     1 
ATOM   6577  O  O     . SER C  3  63  ? -10.412 23.200  3.280   1.00 40.04  ? 63  SER C O     1 
ATOM   6578  C  CB    . SER C  3  63  ? -9.570  20.935  1.218   1.00 40.19  ? 63  SER C CB    1 
ATOM   6579  O  OG    . SER C  3  63  ? -10.290 19.879  0.620   1.00 42.46  ? 63  SER C OG    1 
ATOM   6580  N  N     . SER C  3  64  ? -8.963  24.117  1.811   1.00 38.92  ? 64  SER C N     1 
ATOM   6581  C  CA    . SER C  3  64  ? -8.504  25.092  2.795   1.00 37.55  ? 64  SER C CA    1 
ATOM   6582  C  C     . SER C  3  64  ? -9.600  26.107  3.070   1.00 35.45  ? 64  SER C C     1 
ATOM   6583  O  O     . SER C  3  64  ? -9.686  26.631  4.172   1.00 36.05  ? 64  SER C O     1 
ATOM   6584  C  CB    . SER C  3  64  ? -7.173  25.760  2.399   1.00 36.47  ? 64  SER C CB    1 
ATOM   6585  O  OG    . SER C  3  64  ? -7.331  26.756  1.421   1.00 39.30  ? 64  SER C OG    1 
ATOM   6586  N  N     . VAL C  3  65  ? -10.477 26.333  2.094   1.00 35.07  ? 65  VAL C N     1 
ATOM   6587  C  CA    . VAL C  3  65  ? -11.577 27.276  2.292   1.00 36.21  ? 65  VAL C CA    1 
ATOM   6588  C  C     . VAL C  3  65  ? -12.604 26.572  3.179   1.00 36.62  ? 65  VAL C C     1 
ATOM   6589  O  O     . VAL C  3  65  ? -13.214 27.198  4.047   1.00 35.34  ? 65  VAL C O     1 
ATOM   6590  C  CB    . VAL C  3  65  ? -12.219 27.772  0.942   1.00 36.42  ? 65  VAL C CB    1 
ATOM   6591  C  CG1   . VAL C  3  65  ? -13.344 28.758  1.210   1.00 34.55  ? 65  VAL C CG1   1 
ATOM   6592  C  CG2   . VAL C  3  65  ? -11.169 28.465  0.073   1.00 36.85  ? 65  VAL C CG2   1 
ATOM   6593  N  N     . GLU C  3  66  ? -12.773 25.262  2.977   1.00 38.26  ? 66  GLU C N     1 
ATOM   6594  C  CA    . GLU C  3  66  ? -13.686 24.473  3.813   1.00 38.01  ? 66  GLU C CA    1 
ATOM   6595  C  C     . GLU C  3  66  ? -13.147 24.432  5.247   1.00 39.07  ? 66  GLU C C     1 
ATOM   6596  O  O     . GLU C  3  66  ? -13.915 24.423  6.211   1.00 39.44  ? 66  GLU C O     1 
ATOM   6597  C  CB    . GLU C  3  66  ? -13.843 23.052  3.272   1.00 38.16  ? 66  GLU C CB    1 
ATOM   6598  C  CG    . GLU C  3  66  ? -14.959 22.897  2.244   1.00 37.49  ? 66  GLU C CG    1 
ATOM   6599  C  CD    . GLU C  3  66  ? -16.313 23.307  2.788   1.00 40.06  ? 66  GLU C CD    1 
ATOM   6600  O  OE1   . GLU C  3  66  ? -16.915 24.240  2.221   1.00 40.68  ? 66  GLU C OE1   1 
ATOM   6601  O  OE2   . GLU C  3  66  ? -16.786 22.700  3.776   1.00 37.80  ? 66  GLU C OE2   1 
ATOM   6602  N  N     . HIS C  3  67  ? -11.818 24.407  5.363   1.00 38.41  ? 67  HIS C N     1 
ATOM   6603  C  CA    . HIS C  3  67  ? -11.122 24.408  6.644   1.00 38.43  ? 67  HIS C CA    1 
ATOM   6604  C  C     . HIS C  3  67  ? -11.411 25.735  7.358   1.00 40.10  ? 67  HIS C C     1 
ATOM   6605  O  O     . HIS C  3  67  ? -11.597 25.769  8.584   1.00 41.57  ? 67  HIS C O     1 
ATOM   6606  C  CB    . HIS C  3  67  ? -9.626  24.234  6.386   1.00 38.53  ? 67  HIS C CB    1 
ATOM   6607  C  CG    . HIS C  3  67  ? -8.747  24.559  7.556   1.00 41.56  ? 67  HIS C CG    1 
ATOM   6608  N  ND1   . HIS C  3  67  ? -8.838  23.907  8.768   1.00 42.22  ? 67  HIS C ND1   1 
ATOM   6609  C  CD2   . HIS C  3  67  ? -7.708  25.421  7.673   1.00 42.69  ? 67  HIS C CD2   1 
ATOM   6610  C  CE1   . HIS C  3  67  ? -7.889  24.348  9.577   1.00 41.88  ? 67  HIS C CE1   1 
ATOM   6611  N  NE2   . HIS C  3  67  ? -7.190  25.267  8.937   1.00 41.83  ? 67  HIS C NE2   1 
ATOM   6612  N  N     . ILE C  3  68  ? -11.474 26.821  6.586   1.00 37.24  ? 68  ILE C N     1 
ATOM   6613  C  CA    . ILE C  3  68  ? -11.761 28.129  7.151   1.00 35.61  ? 68  ILE C CA    1 
ATOM   6614  C  C     . ILE C  3  68  ? -13.210 28.144  7.618   1.00 37.93  ? 68  ILE C C     1 
ATOM   6615  O  O     . ILE C  3  68  ? -13.542 28.779  8.622   1.00 37.60  ? 68  ILE C O     1 
ATOM   6616  C  CB    . ILE C  3  68  ? -11.542 29.275  6.107   1.00 33.09  ? 68  ILE C CB    1 
ATOM   6617  C  CG1   . ILE C  3  68  ? -10.060 29.407  5.777   1.00 28.31  ? 68  ILE C CG1   1 
ATOM   6618  C  CG2   . ILE C  3  68  ? -12.068 30.609  6.643   1.00 27.17  ? 68  ILE C CG2   1 
ATOM   6619  C  CD1   . ILE C  3  68  ? -9.762  30.384  4.700   1.00 27.64  ? 68  ILE C CD1   1 
ATOM   6620  N  N     . MET C  3  69  ? -14.061 27.420  6.890   1.00 39.21  ? 69  MET C N     1 
ATOM   6621  C  CA    . MET C  3  69  ? -15.491 27.349  7.188   1.00 39.14  ? 69  MET C CA    1 
ATOM   6622  C  C     . MET C  3  69  ? -15.848 26.492  8.394   1.00 40.43  ? 69  MET C C     1 
ATOM   6623  O  O     . MET C  3  69  ? -16.751 26.833  9.155   1.00 40.17  ? 69  MET C O     1 
ATOM   6624  C  CB    . MET C  3  69  ? -16.253 26.800  5.976   1.00 38.50  ? 69  MET C CB    1 
ATOM   6625  C  CG    . MET C  3  69  ? -16.308 27.717  4.754   1.00 38.11  ? 69  MET C CG    1 
ATOM   6626  S  SD    . MET C  3  69  ? -17.263 29.210  5.045   1.00 38.34  ? 69  MET C SD    1 
ATOM   6627  C  CE    . MET C  3  69  ? -18.859 28.573  5.317   1.00 35.42  ? 69  MET C CE    1 
ATOM   6628  N  N     . ARG C  3  70  ? -15.121 25.389  8.569   1.00 42.40  ? 70  ARG C N     1 
ATOM   6629  C  CA    . ARG C  3  70  ? -15.412 24.426  9.634   1.00 42.76  ? 70  ARG C CA    1 
ATOM   6630  C  C     . ARG C  3  70  ? -14.566 24.459  10.898  1.00 43.32  ? 70  ARG C C     1 
ATOM   6631  O  O     . ARG C  3  70  ? -15.103 24.254  11.983  1.00 43.88  ? 70  ARG C O     1 
ATOM   6632  C  CB    . ARG C  3  70  ? -15.362 22.999  9.062   1.00 41.64  ? 70  ARG C CB    1 
ATOM   6633  C  CG    . ARG C  3  70  ? -16.254 22.768  7.847   1.00 41.78  ? 70  ARG C CG    1 
ATOM   6634  C  CD    . ARG C  3  70  ? -15.983 21.433  7.167   1.00 40.77  ? 70  ARG C CD    1 
ATOM   6635  N  NE    . ARG C  3  70  ? -16.877 21.215  6.026   1.00 44.12  ? 70  ARG C NE    1 
ATOM   6636  C  CZ    . ARG C  3  70  ? -18.029 20.541  6.071   1.00 43.72  ? 70  ARG C CZ    1 
ATOM   6637  N  NH1   . ARG C  3  70  ? -18.768 20.409  4.977   1.00 41.12  ? 70  ARG C NH1   1 
ATOM   6638  N  NH2   . ARG C  3  70  ? -18.442 19.992  7.202   1.00 41.29  ? 70  ARG C NH2   1 
ATOM   6639  N  N     . ASP C  3  71  ? -13.262 24.714  10.763  1.00 41.54  ? 71  ASP C N     1 
ATOM   6640  C  CA    . ASP C  3  71  ? -12.340 24.696  11.901  1.00 39.54  ? 71  ASP C CA    1 
ATOM   6641  C  C     . ASP C  3  71  ? -11.885 26.023  12.520  1.00 40.90  ? 71  ASP C C     1 
ATOM   6642  O  O     . ASP C  3  71  ? -11.613 26.084  13.718  1.00 42.29  ? 71  ASP C O     1 
ATOM   6643  C  CB    . ASP C  3  71  ? -11.093 23.903  11.517  1.00 38.54  ? 71  ASP C CB    1 
ATOM   6644  C  CG    . ASP C  3  71  ? -11.417 22.643  10.742  1.00 40.06  ? 71  ASP C CG    1 
ATOM   6645  O  OD1   . ASP C  3  71  ? -10.601 22.239  9.882   1.00 38.37  ? 71  ASP C OD1   1 
ATOM   6646  O  OD2   . ASP C  3  71  ? -12.488 22.048  10.991  1.00 41.61  ? 71  ASP C OD2   1 
ATOM   6647  N  N     . VAL C  3  72  ? -11.714 27.054  11.697  1.00 38.44  ? 72  VAL C N     1 
ATOM   6648  C  CA    . VAL C  3  72  ? -11.255 28.344  12.182  1.00 35.53  ? 72  VAL C CA    1 
ATOM   6649  C  C     . VAL C  3  72  ? -12.340 29.008  13.010  1.00 38.42  ? 72  VAL C C     1 
ATOM   6650  O  O     . VAL C  3  72  ? -13.481 29.115  12.575  1.00 40.25  ? 72  VAL C O     1 
ATOM   6651  C  CB    . VAL C  3  72  ? -10.841 29.245  10.996  1.00 34.85  ? 72  VAL C CB    1 
ATOM   6652  C  CG1   . VAL C  3  72  ? -10.553 30.660  11.450  1.00 30.77  ? 72  VAL C CG1   1 
ATOM   6653  C  CG2   . VAL C  3  72  ? -9.629  28.653  10.298  1.00 32.55  ? 72  VAL C CG2   1 
ATOM   6654  N  N     . HIS C  3  73  ? -11.996 29.420  14.224  1.00 39.60  ? 73  HIS C N     1 
ATOM   6655  C  CA    . HIS C  3  73  ? -12.973 30.076  15.081  1.00 41.21  ? 73  HIS C CA    1 
ATOM   6656  C  C     . HIS C  3  73  ? -13.459 31.335  14.399  1.00 40.32  ? 73  HIS C C     1 
ATOM   6657  O  O     . HIS C  3  73  ? -12.660 32.177  13.966  1.00 40.52  ? 73  HIS C O     1 
ATOM   6658  C  CB    . HIS C  3  73  ? -12.384 30.365  16.468  1.00 44.84  ? 73  HIS C CB    1 
ATOM   6659  C  CG    . HIS C  3  73  ? -12.044 29.123  17.230  1.00 51.90  ? 73  HIS C CG    1 
ATOM   6660  N  ND1   . HIS C  3  73  ? -12.998 28.200  17.603  1.00 55.09  ? 73  HIS C ND1   1 
ATOM   6661  C  CD2   . HIS C  3  73  ? -10.850 28.596  17.594  1.00 53.32  ? 73  HIS C CD2   1 
ATOM   6662  C  CE1   . HIS C  3  73  ? -12.405 27.155  18.154  1.00 57.24  ? 73  HIS C CE1   1 
ATOM   6663  N  NE2   . HIS C  3  73  ? -11.102 27.370  18.160  1.00 55.99  ? 73  HIS C NE2   1 
ATOM   6664  N  N     . ASN C  3  74  ? -14.777 31.418  14.245  1.00 39.20  ? 74  ASN C N     1 
ATOM   6665  C  CA    . ASN C  3  74  ? -15.415 32.549  13.576  1.00 40.71  ? 74  ASN C CA    1 
ATOM   6666  C  C     . ASN C  3  74  ? -15.061 32.589  12.081  1.00 39.33  ? 74  ASN C C     1 
ATOM   6667  O  O     . ASN C  3  74  ? -15.312 33.579  11.403  1.00 39.72  ? 74  ASN C O     1 
ATOM   6668  C  CB    . ASN C  3  74  ? -15.025 33.869  14.250  1.00 41.71  ? 74  ASN C CB    1 
ATOM   6669  C  CG    . ASN C  3  74  ? -15.515 33.960  15.681  1.00 44.40  ? 74  ASN C CG    1 
ATOM   6670  O  OD1   . ASN C  3  74  ? -16.698 33.765  15.968  1.00 44.70  ? 74  ASN C OD1   1 
ATOM   6671  N  ND2   . ASN C  3  74  ? -14.604 34.267  16.590  1.00 44.31  ? 74  ASN C ND2   1 
ATOM   6672  N  N     . GLY C  3  75  ? -14.520 31.482  11.576  1.00 39.29  ? 75  GLY C N     1 
ATOM   6673  C  CA    . GLY C  3  75  ? -14.127 31.383  10.182  1.00 40.15  ? 75  GLY C CA    1 
ATOM   6674  C  C     . GLY C  3  75  ? -15.229 31.653  9.165   1.00 40.39  ? 75  GLY C C     1 
ATOM   6675  O  O     . GLY C  3  75  ? -15.024 32.390  8.200   1.00 40.32  ? 75  GLY C O     1 
ATOM   6676  N  N     . TYR C  3  76  ? -16.398 31.068  9.382   1.00 38.19  ? 76  TYR C N     1 
ATOM   6677  C  CA    . TYR C  3  76  ? -17.512 31.267  8.475   1.00 38.56  ? 76  TYR C CA    1 
ATOM   6678  C  C     . TYR C  3  76  ? -17.930 32.748  8.429   1.00 38.00  ? 76  TYR C C     1 
ATOM   6679  O  O     . TYR C  3  76  ? -18.403 33.223  7.393   1.00 39.79  ? 76  TYR C O     1 
ATOM   6680  C  CB    . TYR C  3  76  ? -18.694 30.359  8.864   1.00 38.63  ? 76  TYR C CB    1 
ATOM   6681  C  CG    . TYR C  3  76  ? -19.319 30.711  10.188  1.00 40.57  ? 76  TYR C CG    1 
ATOM   6682  C  CD1   . TYR C  3  76  ? -20.343 31.645  10.261  1.00 39.11  ? 76  TYR C CD1   1 
ATOM   6683  C  CD2   . TYR C  3  76  ? -18.851 30.151  11.373  1.00 42.11  ? 76  TYR C CD2   1 
ATOM   6684  C  CE1   . TYR C  3  76  ? -20.880 32.018  11.464  1.00 41.73  ? 76  TYR C CE1   1 
ATOM   6685  C  CE2   . TYR C  3  76  ? -19.387 30.523  12.591  1.00 42.00  ? 76  TYR C CE2   1 
ATOM   6686  C  CZ    . TYR C  3  76  ? -20.401 31.458  12.625  1.00 43.80  ? 76  TYR C CZ    1 
ATOM   6687  O  OH    . TYR C  3  76  ? -20.942 31.851  13.824  1.00 48.98  ? 76  TYR C OH    1 
ATOM   6688  N  N     . ILE C  3  77  ? -17.784 33.463  9.546   1.00 36.31  ? 77  ILE C N     1 
ATOM   6689  C  CA    . ILE C  3  77  ? -18.118 34.888  9.597   1.00 35.16  ? 77  ILE C CA    1 
ATOM   6690  C  C     . ILE C  3  77  ? -17.139 35.646  8.694   1.00 36.43  ? 77  ILE C C     1 
ATOM   6691  O  O     . ILE C  3  77  ? -17.516 36.584  8.001   1.00 37.57  ? 77  ILE C O     1 
ATOM   6692  C  CB    . ILE C  3  77  ? -17.979 35.476  11.016  1.00 34.07  ? 77  ILE C CB    1 
ATOM   6693  C  CG1   . ILE C  3  77  ? -19.128 35.021  11.894  1.00 35.53  ? 77  ILE C CG1   1 
ATOM   6694  C  CG2   . ILE C  3  77  ? -17.988 37.000  10.975  1.00 32.33  ? 77  ILE C CG2   1 
ATOM   6695  C  CD1   . ILE C  3  77  ? -19.080 35.621  13.306  1.00 37.39  ? 77  ILE C CD1   1 
ATOM   6696  N  N     . LEU C  3  78  ? -15.874 35.251  8.730   1.00 34.90  ? 78  LEU C N     1 
ATOM   6697  C  CA    . LEU C  3  78  ? -14.874 35.891  7.906   1.00 34.06  ? 78  LEU C CA    1 
ATOM   6698  C  C     . LEU C  3  78  ? -15.155 35.671  6.416   1.00 34.79  ? 78  LEU C C     1 
ATOM   6699  O  O     . LEU C  3  78  ? -15.173 36.633  5.637   1.00 37.00  ? 78  LEU C O     1 
ATOM   6700  C  CB    . LEU C  3  78  ? -13.469 35.392  8.273   1.00 33.18  ? 78  LEU C CB    1 
ATOM   6701  C  CG    . LEU C  3  78  ? -12.872 35.866  9.608   1.00 34.12  ? 78  LEU C CG    1 
ATOM   6702  C  CD1   . LEU C  3  78  ? -11.448 35.338  9.781   1.00 33.40  ? 78  LEU C CD1   1 
ATOM   6703  C  CD2   . LEU C  3  78  ? -12.858 37.379  9.657   1.00 35.83  ? 78  LEU C CD2   1 
ATOM   6704  N  N     . ARG C  3  79  ? -15.431 34.427  6.027   1.00 33.42  ? 79  ARG C N     1 
ATOM   6705  C  CA    . ARG C  3  79  ? -15.684 34.111  4.627   1.00 33.14  ? 79  ARG C CA    1 
ATOM   6706  C  C     . ARG C  3  79  ? -16.963 34.740  4.106   1.00 34.97  ? 79  ARG C C     1 
ATOM   6707  O  O     . ARG C  3  79  ? -16.953 35.340  3.032   1.00 34.92  ? 79  ARG C O     1 
ATOM   6708  C  CB    . ARG C  3  79  ? -15.689 32.602  4.382   1.00 33.17  ? 79  ARG C CB    1 
ATOM   6709  C  CG    . ARG C  3  79  ? -15.422 32.232  2.926   1.00 37.40  ? 79  ARG C CG    1 
ATOM   6710  C  CD    . ARG C  3  79  ? -16.690 32.188  2.078   1.00 36.49  ? 79  ARG C CD    1 
ATOM   6711  N  NE    . ARG C  3  79  ? -17.153 30.817  1.999   1.00 41.06  ? 79  ARG C NE    1 
ATOM   6712  C  CZ    . ARG C  3  79  ? -16.871 29.979  1.007   1.00 39.26  ? 79  ARG C CZ    1 
ATOM   6713  N  NH1   . ARG C  3  79  ? -17.325 28.740  1.065   1.00 40.21  ? 79  ARG C NH1   1 
ATOM   6714  N  NH2   . ARG C  3  79  ? -16.214 30.389  -0.068  1.00 35.93  ? 79  ARG C NH2   1 
ATOM   6715  N  N     . TYR C  3  80  ? -18.060 34.612  4.857   1.00 34.81  ? 80  TYR C N     1 
ATOM   6716  C  CA    . TYR C  3  80  ? -19.320 35.206  4.432   1.00 34.17  ? 80  TYR C CA    1 
ATOM   6717  C  C     . TYR C  3  80  ? -19.229 36.734  4.388   1.00 34.83  ? 80  TYR C C     1 
ATOM   6718  O  O     . TYR C  3  80  ? -19.888 37.366  3.559   1.00 37.87  ? 80  TYR C O     1 
ATOM   6719  C  CB    . TYR C  3  80  ? -20.480 34.752  5.321   1.00 32.70  ? 80  TYR C CB    1 
ATOM   6720  C  CG    . TYR C  3  80  ? -20.896 33.321  5.075   1.00 34.52  ? 80  TYR C CG    1 
ATOM   6721  C  CD1   . TYR C  3  80  ? -20.779 32.760  3.803   1.00 35.90  ? 80  TYR C CD1   1 
ATOM   6722  C  CD2   . TYR C  3  80  ? -21.401 32.514  6.113   1.00 33.74  ? 80  TYR C CD2   1 
ATOM   6723  C  CE1   . TYR C  3  80  ? -21.150 31.434  3.561   1.00 34.85  ? 80  TYR C CE1   1 
ATOM   6724  C  CE2   . TYR C  3  80  ? -21.773 31.183  5.882   1.00 31.56  ? 80  TYR C CE2   1 
ATOM   6725  C  CZ    . TYR C  3  80  ? -21.645 30.657  4.597   1.00 34.28  ? 80  TYR C CZ    1 
ATOM   6726  O  OH    . TYR C  3  80  ? -22.032 29.372  4.314   1.00 33.90  ? 80  TYR C OH    1 
ATOM   6727  N  N     . LEU C  3  81  ? -18.413 37.324  5.262   1.00 32.98  ? 81  LEU C N     1 
ATOM   6728  C  CA    . LEU C  3  81  ? -18.238 38.778  5.283   1.00 32.99  ? 81  LEU C CA    1 
ATOM   6729  C  C     . LEU C  3  81  ? -17.470 39.199  4.032   1.00 32.32  ? 81  LEU C C     1 
ATOM   6730  O  O     . LEU C  3  81  ? -17.878 40.109  3.311   1.00 29.54  ? 81  LEU C O     1 
ATOM   6731  C  CB    . LEU C  3  81  ? -17.452 39.220  6.512   1.00 32.46  ? 81  LEU C CB    1 
ATOM   6732  C  CG    . LEU C  3  81  ? -18.117 40.213  7.461   1.00 34.38  ? 81  LEU C CG    1 
ATOM   6733  C  CD1   . LEU C  3  81  ? -17.063 40.747  8.423   1.00 31.39  ? 81  LEU C CD1   1 
ATOM   6734  C  CD2   . LEU C  3  81  ? -18.745 41.360  6.689   1.00 35.83  ? 81  LEU C CD2   1 
ATOM   6735  N  N     . HIS C  3  82  ? -16.375 38.497  3.764   1.00 31.69  ? 82  HIS C N     1 
ATOM   6736  C  CA    . HIS C  3  82  ? -15.547 38.785  2.601   1.00 32.02  ? 82  HIS C CA    1 
ATOM   6737  C  C     . HIS C  3  82  ? -16.337 38.607  1.306   1.00 32.69  ? 82  HIS C C     1 
ATOM   6738  O  O     . HIS C  3  82  ? -16.337 39.495  0.441   1.00 34.95  ? 82  HIS C O     1 
ATOM   6739  C  CB    . HIS C  3  82  ? -14.319 37.868  2.588   1.00 30.06  ? 82  HIS C CB    1 
ATOM   6740  C  CG    . HIS C  3  82  ? -13.197 38.363  1.723   1.00 30.33  ? 82  HIS C CG    1 
ATOM   6741  N  ND1   . HIS C  3  82  ? -12.459 39.496  1.994   1.00 29.39  ? 82  HIS C ND1   1 
ATOM   6742  C  CD2   . HIS C  3  82  ? -12.668 37.843  0.584   1.00 29.53  ? 82  HIS C CD2   1 
ATOM   6743  C  CE1   . HIS C  3  82  ? -11.526 39.624  1.037   1.00 28.57  ? 82  HIS C CE1   1 
ATOM   6744  N  NE2   . HIS C  3  82  ? -11.611 38.647  0.155   1.00 30.62  ? 82  HIS C NE2   1 
ATOM   6745  N  N     . ALA C  3  83  ? -17.041 37.482  1.200   1.00 32.06  ? 83  ALA C N     1 
ATOM   6746  C  CA    . ALA C  3  83  ? -17.816 37.154  0.001   1.00 31.78  ? 83  ALA C CA    1 
ATOM   6747  C  C     . ALA C  3  83  ? -18.990 38.090  -0.213  1.00 31.94  ? 83  ALA C C     1 
ATOM   6748  O  O     . ALA C  3  83  ? -19.114 38.690  -1.278  1.00 33.98  ? 83  ALA C O     1 
ATOM   6749  C  CB    . ALA C  3  83  ? -18.281 35.703  0.037   1.00 27.62  ? 83  ALA C CB    1 
ATOM   6750  N  N     . ASN C  3  84  ? -19.848 38.227  0.792   1.00 31.89  ? 84  ASN C N     1 
ATOM   6751  C  CA    . ASN C  3  84  ? -20.987 39.126  0.664   1.00 31.79  ? 84  ASN C CA    1 
ATOM   6752  C  C     . ASN C  3  84  ? -20.543 40.583  0.586   1.00 31.19  ? 84  ASN C C     1 
ATOM   6753  O  O     . ASN C  3  84  ? -21.231 41.411  -0.005  1.00 33.95  ? 84  ASN C O     1 
ATOM   6754  C  CB    . ASN C  3  84  ? -21.970 38.915  1.809   1.00 32.03  ? 84  ASN C CB    1 
ATOM   6755  C  CG    . ASN C  3  84  ? -22.756 37.628  1.661   1.00 36.60  ? 84  ASN C CG    1 
ATOM   6756  O  OD1   . ASN C  3  84  ? -23.756 37.595  0.950   1.00 38.42  ? 84  ASN C OD1   1 
ATOM   6757  N  ND2   . ASN C  3  84  ? -22.290 36.553  2.301   1.00 34.74  ? 84  ASN C ND2   1 
ATOM   6758  N  N     . GLY C  3  85  ? -19.372 40.873  1.154   1.00 30.33  ? 85  GLY C N     1 
ATOM   6759  C  CA    . GLY C  3  85  ? -18.830 42.214  1.126   1.00 28.61  ? 85  GLY C CA    1 
ATOM   6760  C  C     . GLY C  3  85  ? -18.472 42.643  -0.281  1.00 28.83  ? 85  GLY C C     1 
ATOM   6761  O  O     . GLY C  3  85  ? -18.642 43.802  -0.636  1.00 29.17  ? 85  GLY C O     1 
ATOM   6762  N  N     . ALA C  3  86  ? -17.956 41.716  -1.082  1.00 29.54  ? 86  ALA C N     1 
ATOM   6763  C  CA    . ALA C  3  86  ? -17.596 42.016  -2.465  1.00 28.84  ? 86  ALA C CA    1 
ATOM   6764  C  C     . ALA C  3  86  ? -18.846 42.473  -3.230  1.00 30.77  ? 86  ALA C C     1 
ATOM   6765  O  O     . ALA C  3  86  ? -18.809 43.466  -3.967  1.00 31.78  ? 86  ALA C O     1 
ATOM   6766  C  CB    . ALA C  3  86  ? -16.986 40.782  -3.133  1.00 27.07  ? 86  ALA C CB    1 
ATOM   6767  N  N     . SER C  3  87  ? -19.960 41.774  -3.013  1.00 30.20  ? 87  SER C N     1 
ATOM   6768  C  CA    . SER C  3  87  ? -21.210 42.113  -3.677  1.00 30.66  ? 87  SER C CA    1 
ATOM   6769  C  C     . SER C  3  87  ? -21.658 43.483  -3.240  1.00 30.61  ? 87  SER C C     1 
ATOM   6770  O  O     . SER C  3  87  ? -21.994 44.328  -4.070  1.00 33.37  ? 87  SER C O     1 
ATOM   6771  C  CB    . SER C  3  87  ? -22.308 41.086  -3.361  1.00 31.76  ? 87  SER C CB    1 
ATOM   6772  O  OG    . SER C  3  87  ? -22.282 39.998  -4.270  1.00 32.47  ? 87  SER C OG    1 
ATOM   6773  N  N     . PHE C  3  88  ? -21.668 43.713  -1.934  1.00 29.57  ? 88  PHE C N     1 
ATOM   6774  C  CA    . PHE C  3  88  ? -22.087 45.013  -1.435  1.00 30.07  ? 88  PHE C CA    1 
ATOM   6775  C  C     . PHE C  3  88  ? -21.172 46.121  -1.970  1.00 30.35  ? 88  PHE C C     1 
ATOM   6776  O  O     . PHE C  3  88  ? -21.629 47.237  -2.224  1.00 32.89  ? 88  PHE C O     1 
ATOM   6777  C  CB    . PHE C  3  88  ? -22.162 45.015  0.095   1.00 29.83  ? 88  PHE C CB    1 
ATOM   6778  C  CG    . PHE C  3  88  ? -23.473 44.495  0.637   1.00 30.55  ? 88  PHE C CG    1 
ATOM   6779  C  CD1   . PHE C  3  88  ? -24.328 45.332  1.351   1.00 31.24  ? 88  PHE C CD1   1 
ATOM   6780  C  CD2   . PHE C  3  88  ? -23.866 43.181  0.405   1.00 28.61  ? 88  PHE C CD2   1 
ATOM   6781  C  CE1   . PHE C  3  88  ? -25.560 44.867  1.823   1.00 32.50  ? 88  PHE C CE1   1 
ATOM   6782  C  CE2   . PHE C  3  88  ? -25.094 42.705  0.871   1.00 30.22  ? 88  PHE C CE2   1 
ATOM   6783  C  CZ    . PHE C  3  88  ? -25.943 43.552  1.581   1.00 32.13  ? 88  PHE C CZ    1 
ATOM   6784  N  N     . PHE C  3  89  ? -19.904 45.783  -2.200  1.00 27.15  ? 89  PHE C N     1 
ATOM   6785  C  CA    . PHE C  3  89  ? -18.919 46.719  -2.730  1.00 28.42  ? 89  PHE C CA    1 
ATOM   6786  C  C     . PHE C  3  89  ? -19.413 47.202  -4.107  1.00 31.11  ? 89  PHE C C     1 
ATOM   6787  O  O     . PHE C  3  89  ? -19.370 48.404  -4.385  1.00 32.62  ? 89  PHE C O     1 
ATOM   6788  C  CB    . PHE C  3  89  ? -17.557 46.004  -2.852  1.00 30.01  ? 89  PHE C CB    1 
ATOM   6789  C  CG    . PHE C  3  89  ? -16.346 46.926  -2.905  1.00 28.23  ? 89  PHE C CG    1 
ATOM   6790  C  CD1   . PHE C  3  89  ? -16.479 48.294  -3.039  1.00 30.13  ? 89  PHE C CD1   1 
ATOM   6791  C  CD2   . PHE C  3  89  ? -15.067 46.403  -2.808  1.00 29.40  ? 89  PHE C CD2   1 
ATOM   6792  C  CE1   . PHE C  3  89  ? -15.363 49.126  -3.072  1.00 27.87  ? 89  PHE C CE1   1 
ATOM   6793  C  CE2   . PHE C  3  89  ? -13.948 47.229  -2.843  1.00 31.53  ? 89  PHE C CE2   1 
ATOM   6794  C  CZ    . PHE C  3  89  ? -14.105 48.596  -2.977  1.00 29.14  ? 89  PHE C CZ    1 
ATOM   6795  N  N     . PHE C  3  90  ? -19.915 46.280  -4.948  1.00 30.37  ? 90  PHE C N     1 
ATOM   6796  C  CA    . PHE C  3  90  ? -20.425 46.647  -6.277  1.00 29.50  ? 90  PHE C CA    1 
ATOM   6797  C  C     . PHE C  3  90  ? -21.776 47.352  -6.264  1.00 31.27  ? 90  PHE C C     1 
ATOM   6798  O  O     . PHE C  3  90  ? -22.018 48.217  -7.105  1.00 32.84  ? 90  PHE C O     1 
ATOM   6799  C  CB    . PHE C  3  90  ? -20.485 45.442  -7.221  1.00 27.91  ? 90  PHE C CB    1 
ATOM   6800  C  CG    . PHE C  3  90  ? -19.154 45.017  -7.732  1.00 28.68  ? 90  PHE C CG    1 
ATOM   6801  C  CD1   . PHE C  3  90  ? -18.566 45.687  -8.801  1.00 28.80  ? 90  PHE C CD1   1 
ATOM   6802  C  CD2   . PHE C  3  90  ? -18.439 44.007  -7.098  1.00 27.06  ? 90  PHE C CD2   1 
ATOM   6803  C  CE1   . PHE C  3  90  ? -17.272 45.359  -9.227  1.00 27.25  ? 90  PHE C CE1   1 
ATOM   6804  C  CE2   . PHE C  3  90  ? -17.144 43.669  -7.515  1.00 24.70  ? 90  PHE C CE2   1 
ATOM   6805  C  CZ    . PHE C  3  90  ? -16.562 44.348  -8.577  1.00 24.93  ? 90  PHE C CZ    1 
ATOM   6806  N  N     . MET C  3  91  ? -22.672 46.962  -5.352  1.00 31.49  ? 91  MET C N     1 
ATOM   6807  C  CA    . MET C  3  91  ? -23.980 47.610  -5.273  1.00 32.08  ? 91  MET C CA    1 
ATOM   6808  C  C     . MET C  3  91  ? -23.742 49.096  -5.003  1.00 31.56  ? 91  MET C C     1 
ATOM   6809  O  O     . MET C  3  91  ? -24.289 49.964  -5.678  1.00 32.45  ? 91  MET C O     1 
ATOM   6810  C  CB    . MET C  3  91  ? -24.838 47.022  -4.144  1.00 35.94  ? 91  MET C CB    1 
ATOM   6811  C  CG    . MET C  3  91  ? -25.295 45.576  -4.325  1.00 43.87  ? 91  MET C CG    1 
ATOM   6812  S  SD    . MET C  3  91  ? -26.194 44.878  -2.851  1.00 53.68  ? 91  MET C SD    1 
ATOM   6813  C  CE    . MET C  3  91  ? -26.599 43.222  -3.401  1.00 46.46  ? 91  MET C CE    1 
ATOM   6814  N  N     . VAL C  3  92  ? -22.865 49.373  -4.047  1.00 31.58  ? 92  VAL C N     1 
ATOM   6815  C  CA    . VAL C  3  92  ? -22.548 50.738  -3.658  1.00 31.57  ? 92  VAL C CA    1 
ATOM   6816  C  C     . VAL C  3  92  ? -21.772 51.493  -4.744  1.00 30.75  ? 92  VAL C C     1 
ATOM   6817  O  O     . VAL C  3  92  ? -21.974 52.693  -4.920  1.00 28.27  ? 92  VAL C O     1 
ATOM   6818  C  CB    . VAL C  3  92  ? -21.785 50.757  -2.298  1.00 31.21  ? 92  VAL C CB    1 
ATOM   6819  C  CG1   . VAL C  3  92  ? -21.348 52.169  -1.944  1.00 31.43  ? 92  VAL C CG1   1 
ATOM   6820  C  CG2   . VAL C  3  92  ? -22.682 50.222  -1.200  1.00 29.61  ? 92  VAL C CG2   1 
ATOM   6821  N  N     . MET C  3  93  ? -20.890 50.795  -5.462  1.00 30.57  ? 93  MET C N     1 
ATOM   6822  C  CA    . MET C  3  93  ? -20.127 51.427  -6.524  1.00 31.75  ? 93  MET C CA    1 
ATOM   6823  C  C     . MET C  3  93  ? -21.049 51.887  -7.664  1.00 34.04  ? 93  MET C C     1 
ATOM   6824  O  O     . MET C  3  93  ? -20.908 53.011  -8.160  1.00 33.98  ? 93  MET C O     1 
ATOM   6825  C  CB    . MET C  3  93  ? -19.030 50.499  -7.050  1.00 31.20  ? 93  MET C CB    1 
ATOM   6826  C  CG    . MET C  3  93  ? -17.884 51.257  -7.747  1.00 31.91  ? 93  MET C CG    1 
ATOM   6827  S  SD    . MET C  3  93  ? -16.435 50.266  -8.175  1.00 35.16  ? 93  MET C SD    1 
ATOM   6828  C  CE    . MET C  3  93  ? -15.530 50.269  -6.682  1.00 36.20  ? 93  MET C CE    1 
ATOM   6829  N  N     . PHE C  3  94  ? -22.004 51.036  -8.059  1.00 34.78  ? 94  PHE C N     1 
ATOM   6830  C  CA    . PHE C  3  94  ? -22.959 51.381  -9.120  1.00 33.83  ? 94  PHE C CA    1 
ATOM   6831  C  C     . PHE C  3  94  ? -23.756 52.639  -8.714  1.00 34.60  ? 94  PHE C C     1 
ATOM   6832  O  O     . PHE C  3  94  ? -23.992 53.533  -9.537  1.00 34.79  ? 94  PHE C O     1 
ATOM   6833  C  CB    . PHE C  3  94  ? -23.936 50.219  -9.399  1.00 33.06  ? 94  PHE C CB    1 
ATOM   6834  C  CG    . PHE C  3  94  ? -23.313 49.020  -10.102 1.00 33.25  ? 94  PHE C CG    1 
ATOM   6835  C  CD1   . PHE C  3  94  ? -22.348 49.180  -11.095 1.00 31.15  ? 94  PHE C CD1   1 
ATOM   6836  C  CD2   . PHE C  3  94  ? -23.705 47.729  -9.766  1.00 33.71  ? 94  PHE C CD2   1 
ATOM   6837  C  CE1   . PHE C  3  94  ? -21.780 48.080  -11.738 1.00 31.17  ? 94  PHE C CE1   1 
ATOM   6838  C  CE2   . PHE C  3  94  ? -23.141 46.616  -10.409 1.00 34.88  ? 94  PHE C CE2   1 
ATOM   6839  C  CZ    . PHE C  3  94  ? -22.172 46.796  -11.400 1.00 31.32  ? 94  PHE C CZ    1 
ATOM   6840  N  N     . MET C  3  95  ? -24.184 52.700  -7.453  1.00 32.97  ? 95  MET C N     1 
ATOM   6841  C  CA    . MET C  3  95  ? -24.928 53.858  -6.972  1.00 33.91  ? 95  MET C CA    1 
ATOM   6842  C  C     . MET C  3  95  ? -24.048 55.102  -6.963  1.00 33.95  ? 95  MET C C     1 
ATOM   6843  O  O     . MET C  3  95  ? -24.522 56.193  -7.252  1.00 34.43  ? 95  MET C O     1 
ATOM   6844  C  CB    . MET C  3  95  ? -25.499 53.603  -5.581  1.00 35.48  ? 95  MET C CB    1 
ATOM   6845  C  CG    . MET C  3  95  ? -26.703 52.666  -5.580  1.00 40.06  ? 95  MET C CG    1 
ATOM   6846  S  SD    . MET C  3  95  ? -26.946 51.892  -3.968  1.00 49.06  ? 95  MET C SD    1 
ATOM   6847  C  CE    . MET C  3  95  ? -28.147 52.969  -3.247  1.00 49.68  ? 95  MET C CE    1 
ATOM   6848  N  N     . HIS C  3  96  ? -22.763 54.923  -6.657  1.00 31.97  ? 96  HIS C N     1 
ATOM   6849  C  CA    . HIS C  3  96  ? -21.799 56.020  -6.635  1.00 30.06  ? 96  HIS C CA    1 
ATOM   6850  C  C     . HIS C  3  96  ? -21.655 56.533  -8.068  1.00 29.84  ? 96  HIS C C     1 
ATOM   6851  O  O     . HIS C  3  96  ? -21.709 57.731  -8.309  1.00 30.46  ? 96  HIS C O     1 
ATOM   6852  C  CB    . HIS C  3  96  ? -20.443 55.520  -6.106  1.00 27.88  ? 96  HIS C CB    1 
ATOM   6853  C  CG    . HIS C  3  96  ? -19.431 56.606  -5.876  1.00 27.40  ? 96  HIS C CG    1 
ATOM   6854  N  ND1   . HIS C  3  96  ? -19.660 57.733  -5.118  1.00 25.05  ? 96  HIS C ND1   1 
ATOM   6855  C  CD2   . HIS C  3  96  ? -18.146 56.712  -6.305  1.00 26.63  ? 96  HIS C CD2   1 
ATOM   6856  C  CE1   . HIS C  3  96  ? -18.524 58.469  -5.115  1.00 28.04  ? 96  HIS C CE1   1 
ATOM   6857  N  NE2   . HIS C  3  96  ? -17.571 57.890  -5.824  1.00 28.16  ? 96  HIS C NE2   1 
ATOM   6858  N  N     . MET C  3  97  ? -21.501 55.602  -9.008  1.00 30.13  ? 97  MET C N     1 
ATOM   6859  C  CA    . MET C  3  97  ? -21.364 55.913  -10.425 1.00 30.98  ? 97  MET C CA    1 
ATOM   6860  C  C     . MET C  3  97  ? -22.644 56.519  -11.009 1.00 31.26  ? 97  MET C C     1 
ATOM   6861  O  O     . MET C  3  97  ? -22.601 57.534  -11.705 1.00 33.24  ? 97  MET C O     1 
ATOM   6862  C  CB    . MET C  3  97  ? -20.984 54.654  -11.203 1.00 31.67  ? 97  MET C CB    1 
ATOM   6863  C  CG    . MET C  3  97  ? -19.543 54.222  -11.039 1.00 31.34  ? 97  MET C CG    1 
ATOM   6864  S  SD    . MET C  3  97  ? -19.212 52.573  -11.738 1.00 38.33  ? 97  MET C SD    1 
ATOM   6865  C  CE    . MET C  3  97  ? -18.969 52.978  -13.414 1.00 38.90  ? 97  MET C CE    1 
ATOM   6866  N  N     . ALA C  3  98  ? -23.782 55.907  -10.716 1.00 31.13  ? 98  ALA C N     1 
ATOM   6867  C  CA    . ALA C  3  98  ? -25.057 56.414  -11.214 1.00 31.47  ? 98  ALA C CA    1 
ATOM   6868  C  C     . ALA C  3  98  ? -25.302 57.836  -10.712 1.00 32.01  ? 98  ALA C C     1 
ATOM   6869  O  O     . ALA C  3  98  ? -25.821 58.670  -11.445 1.00 35.39  ? 98  ALA C O     1 
ATOM   6870  C  CB    . ALA C  3  98  ? -26.196 55.497  -10.788 1.00 32.01  ? 98  ALA C CB    1 
ATOM   6871  N  N     . LYS C  3  99  ? -24.938 58.099  -9.459  1.00 30.36  ? 99  LYS C N     1 
ATOM   6872  C  CA    . LYS C  3  99  ? -25.097 59.417  -8.843  1.00 29.20  ? 99  LYS C CA    1 
ATOM   6873  C  C     . LYS C  3  99  ? -24.294 60.434  -9.658  1.00 28.65  ? 99  LYS C C     1 
ATOM   6874  O  O     . LYS C  3  99  ? -24.732 61.559  -9.884  1.00 27.76  ? 99  LYS C O     1 
ATOM   6875  C  CB    . LYS C  3  99  ? -24.574 59.359  -7.395  1.00 29.62  ? 99  LYS C CB    1 
ATOM   6876  C  CG    . LYS C  3  99  ? -24.559 60.654  -6.589  1.00 31.11  ? 99  LYS C CG    1 
ATOM   6877  C  CD    . LYS C  3  99  ? -23.470 61.623  -7.026  1.00 31.86  ? 99  LYS C CD    1 
ATOM   6878  C  CE    . LYS C  3  99  ? -22.645 62.152  -5.876  1.00 34.22  ? 99  LYS C CE    1 
ATOM   6879  N  NZ    . LYS C  3  99  ? -21.311 61.496  -5.868  1.00 34.56  ? 99  LYS C NZ    1 
ATOM   6880  N  N     . GLY C  3  100 ? -23.110 60.023  -10.089 1.00 29.14  ? 100 GLY C N     1 
ATOM   6881  C  CA    . GLY C  3  100 ? -22.252 60.906  -10.853 1.00 31.83  ? 100 GLY C CA    1 
ATOM   6882  C  C     . GLY C  3  100 ? -22.817 61.217  -12.218 1.00 33.88  ? 100 GLY C C     1 
ATOM   6883  O  O     . GLY C  3  100 ? -22.707 62.347  -12.710 1.00 33.14  ? 100 GLY C O     1 
ATOM   6884  N  N     . LEU C  3  101 ? -23.432 60.198  -12.817 1.00 35.08  ? 101 LEU C N     1 
ATOM   6885  C  CA    . LEU C  3  101 ? -24.050 60.291  -14.135 1.00 34.36  ? 101 LEU C CA    1 
ATOM   6886  C  C     . LEU C  3  101 ? -25.211 61.264  -14.119 1.00 34.38  ? 101 LEU C C     1 
ATOM   6887  O  O     . LEU C  3  101 ? -25.306 62.152  -14.972 1.00 36.02  ? 101 LEU C O     1 
ATOM   6888  C  CB    . LEU C  3  101 ? -24.581 58.924  -14.544 1.00 36.41  ? 101 LEU C CB    1 
ATOM   6889  C  CG    . LEU C  3  101 ? -23.975 58.225  -15.746 1.00 37.36  ? 101 LEU C CG    1 
ATOM   6890  C  CD1   . LEU C  3  101 ? -22.476 58.227  -15.653 1.00 38.15  ? 101 LEU C CD1   1 
ATOM   6891  C  CD2   . LEU C  3  101 ? -24.506 56.814  -15.794 1.00 38.30  ? 101 LEU C CD2   1 
ATOM   6892  N  N     . TYR C  3  102 ? -26.088 61.083  -13.140 1.00 32.86  ? 102 TYR C N     1 
ATOM   6893  C  CA    . TYR C  3  102 ? -27.276 61.902  -12.984 1.00 32.02  ? 102 TYR C CA    1 
ATOM   6894  C  C     . TYR C  3  102 ? -26.996 63.375  -12.694 1.00 33.10  ? 102 TYR C C     1 
ATOM   6895  O  O     . TYR C  3  102 ? -27.636 64.246  -13.274 1.00 35.29  ? 102 TYR C O     1 
ATOM   6896  C  CB    . TYR C  3  102 ? -28.158 61.308  -11.884 1.00 31.77  ? 102 TYR C CB    1 
ATOM   6897  C  CG    . TYR C  3  102 ? -29.480 62.013  -11.697 1.00 34.26  ? 102 TYR C CG    1 
ATOM   6898  C  CD1   . TYR C  3  102 ? -30.607 61.625  -12.423 1.00 34.57  ? 102 TYR C CD1   1 
ATOM   6899  C  CD2   . TYR C  3  102 ? -29.606 63.081  -10.811 1.00 36.13  ? 102 TYR C CD2   1 
ATOM   6900  C  CE1   . TYR C  3  102 ? -31.818 62.278  -12.278 1.00 35.55  ? 102 TYR C CE1   1 
ATOM   6901  C  CE2   . TYR C  3  102 ? -30.827 63.747  -10.657 1.00 38.08  ? 102 TYR C CE2   1 
ATOM   6902  C  CZ    . TYR C  3  102 ? -31.924 63.340  -11.396 1.00 37.73  ? 102 TYR C CZ    1 
ATOM   6903  O  OH    . TYR C  3  102 ? -33.118 64.011  -11.262 1.00 40.35  ? 102 TYR C OH    1 
ATOM   6904  N  N     . TYR C  3  103 ? -26.025 63.660  -11.825 1.00 33.61  ? 103 TYR C N     1 
ATOM   6905  C  CA    . TYR C  3  103 ? -25.716 65.049  -11.459 1.00 31.19  ? 103 TYR C CA    1 
ATOM   6906  C  C     . TYR C  3  103 ? -24.608 65.733  -12.264 1.00 32.62  ? 103 TYR C C     1 
ATOM   6907  O  O     . TYR C  3  103 ? -24.205 66.858  -11.954 1.00 32.87  ? 103 TYR C O     1 
ATOM   6908  C  CB    . TYR C  3  103 ? -25.414 65.144  -9.968  1.00 27.24  ? 103 TYR C CB    1 
ATOM   6909  C  CG    . TYR C  3  103 ? -26.599 64.834  -9.091  1.00 26.11  ? 103 TYR C CG    1 
ATOM   6910  C  CD1   . TYR C  3  103 ? -26.690 63.621  -8.402  1.00 25.26  ? 103 TYR C CD1   1 
ATOM   6911  C  CD2   . TYR C  3  103 ? -27.618 65.772  -8.919  1.00 27.12  ? 103 TYR C CD2   1 
ATOM   6912  C  CE1   . TYR C  3  103 ? -27.770 63.355  -7.558  1.00 23.83  ? 103 TYR C CE1   1 
ATOM   6913  C  CE2   . TYR C  3  103 ? -28.690 65.525  -8.087  1.00 25.35  ? 103 TYR C CE2   1 
ATOM   6914  C  CZ    . TYR C  3  103 ? -28.759 64.315  -7.409  1.00 27.51  ? 103 TYR C CZ    1 
ATOM   6915  O  OH    . TYR C  3  103 ? -29.826 64.091  -6.580  1.00 31.89  ? 103 TYR C OH    1 
ATOM   6916  N  N     . GLY C  3  104 ? -24.110 65.060  -13.293 1.00 31.70  ? 104 GLY C N     1 
ATOM   6917  C  CA    . GLY C  3  104 ? -23.072 65.657  -14.107 1.00 31.15  ? 104 GLY C CA    1 
ATOM   6918  C  C     . GLY C  3  104 ? -21.781 65.859  -13.349 1.00 33.12  ? 104 GLY C C     1 
ATOM   6919  O  O     . GLY C  3  104 ? -21.057 66.825  -13.592 1.00 34.07  ? 104 GLY C O     1 
ATOM   6920  N  N     . SER C  3  105 ? -21.475 64.917  -12.460 1.00 32.94  ? 105 SER C N     1 
ATOM   6921  C  CA    . SER C  3  105 ? -20.264 64.970  -11.644 1.00 32.76  ? 105 SER C CA    1 
ATOM   6922  C  C     . SER C  3  105 ? -19.040 64.774  -12.527 1.00 32.34  ? 105 SER C C     1 
ATOM   6923  O  O     . SER C  3  105 ? -17.965 65.247  -12.208 1.00 32.05  ? 105 SER C O     1 
ATOM   6924  C  CB    . SER C  3  105 ? -20.305 63.876  -10.582 1.00 33.35  ? 105 SER C CB    1 
ATOM   6925  O  OG    . SER C  3  105 ? -21.556 63.867  -9.905  1.00 36.52  ? 105 SER C OG    1 
ATOM   6926  N  N     . TYR C  3  106 ? -19.234 64.121  -13.667 1.00 32.97  ? 106 TYR C N     1 
ATOM   6927  C  CA    . TYR C  3  106 ? -18.155 63.851  -14.610 1.00 33.30  ? 106 TYR C CA    1 
ATOM   6928  C  C     . TYR C  3  106 ? -17.737 65.080  -15.411 1.00 33.00  ? 106 TYR C C     1 
ATOM   6929  O  O     . TYR C  3  106 ? -16.756 65.028  -16.149 1.00 31.86  ? 106 TYR C O     1 
ATOM   6930  C  CB    . TYR C  3  106 ? -18.592 62.759  -15.596 1.00 35.13  ? 106 TYR C CB    1 
ATOM   6931  C  CG    . TYR C  3  106 ? -19.835 63.127  -16.371 1.00 35.39  ? 106 TYR C CG    1 
ATOM   6932  C  CD1   . TYR C  3  106 ? -19.759 63.919  -17.526 1.00 36.30  ? 106 TYR C CD1   1 
ATOM   6933  C  CD2   . TYR C  3  106 ? -21.098 62.779  -15.897 1.00 34.43  ? 106 TYR C CD2   1 
ATOM   6934  C  CE1   . TYR C  3  106 ? -20.909 64.361  -18.165 1.00 33.58  ? 106 TYR C CE1   1 
ATOM   6935  C  CE2   . TYR C  3  106 ? -22.244 63.219  -16.538 1.00 33.32  ? 106 TYR C CE2   1 
ATOM   6936  C  CZ    . TYR C  3  106 ? -22.141 64.010  -17.660 1.00 33.38  ? 106 TYR C CZ    1 
ATOM   6937  O  OH    . TYR C  3  106 ? -23.293 64.477  -18.246 1.00 38.01  ? 106 TYR C OH    1 
ATOM   6938  N  N     . ARG C  3  107 ? -18.516 66.154  -15.321 1.00 32.08  ? 107 ARG C N     1 
ATOM   6939  C  CA    . ARG C  3  107 ? -18.217 67.367  -16.084 1.00 35.16  ? 107 ARG C CA    1 
ATOM   6940  C  C     . ARG C  3  107 ? -17.026 68.151  -15.581 1.00 36.53  ? 107 ARG C C     1 
ATOM   6941  O  O     . ARG C  3  107 ? -16.613 68.022  -14.425 1.00 38.04  ? 107 ARG C O     1 
ATOM   6942  C  CB    . ARG C  3  107 ? -19.389 68.341  -16.062 1.00 35.23  ? 107 ARG C CB    1 
ATOM   6943  C  CG    . ARG C  3  107 ? -20.607 67.958  -16.831 1.00 35.18  ? 107 ARG C CG    1 
ATOM   6944  C  CD    . ARG C  3  107 ? -21.598 69.084  -16.676 1.00 36.21  ? 107 ARG C CD    1 
ATOM   6945  N  NE    . ARG C  3  107 ? -22.359 69.255  -17.901 1.00 43.89  ? 107 ARG C NE    1 
ATOM   6946  C  CZ    . ARG C  3  107 ? -22.335 70.337  -18.672 1.00 41.35  ? 107 ARG C CZ    1 
ATOM   6947  N  NH1   . ARG C  3  107 ? -23.073 70.348  -19.761 1.00 46.88  ? 107 ARG C NH1   1 
ATOM   6948  N  NH2   . ARG C  3  107 ? -21.608 71.400  -18.358 1.00 38.45  ? 107 ARG C NH2   1 
ATOM   6949  N  N     . SER C  3  108 ? -16.548 69.035  -16.448 1.00 34.80  ? 108 SER C N     1 
ATOM   6950  C  CA    . SER C  3  108 ? -15.455 69.932  -16.142 1.00 35.19  ? 108 SER C CA    1 
ATOM   6951  C  C     . SER C  3  108 ? -15.929 70.764  -14.930 1.00 35.29  ? 108 SER C C     1 
ATOM   6952  O  O     . SER C  3  108 ? -17.091 71.169  -14.868 1.00 34.65  ? 108 SER C O     1 
ATOM   6953  C  CB    . SER C  3  108 ? -15.218 70.828  -17.366 1.00 35.31  ? 108 SER C CB    1 
ATOM   6954  O  OG    . SER C  3  108 ? -14.433 71.964  -17.058 1.00 41.93  ? 108 SER C OG    1 
ATOM   6955  N  N     . PRO C  3  109 ? -15.030 71.078  -13.981 1.00 34.41  ? 109 PRO C N     1 
ATOM   6956  C  CA    . PRO C  3  109 ? -13.607 70.752  -13.905 1.00 34.06  ? 109 PRO C CA    1 
ATOM   6957  C  C     . PRO C  3  109 ? -13.267 69.456  -13.142 1.00 34.14  ? 109 PRO C C     1 
ATOM   6958  O  O     . PRO C  3  109 ? -12.172 69.334  -12.587 1.00 36.66  ? 109 PRO C O     1 
ATOM   6959  C  CB    . PRO C  3  109 ? -13.052 71.969  -13.175 1.00 34.55  ? 109 PRO C CB    1 
ATOM   6960  C  CG    . PRO C  3  109 ? -14.121 72.193  -12.121 1.00 34.06  ? 109 PRO C CG    1 
ATOM   6961  C  CD    . PRO C  3  109 ? -15.410 72.010  -12.899 1.00 35.16  ? 109 PRO C CD    1 
ATOM   6962  N  N     . ARG C  3  110 ? -14.161 68.476  -13.163 1.00 30.92  ? 110 ARG C N     1 
ATOM   6963  C  CA    . ARG C  3  110 ? -13.921 67.225  -12.459 1.00 27.77  ? 110 ARG C CA    1 
ATOM   6964  C  C     . ARG C  3  110 ? -13.680 66.031  -13.384 1.00 28.90  ? 110 ARG C C     1 
ATOM   6965  O  O     . ARG C  3  110 ? -13.911 64.872  -13.006 1.00 27.92  ? 110 ARG C O     1 
ATOM   6966  C  CB    . ARG C  3  110 ? -15.074 66.963  -11.481 1.00 26.39  ? 110 ARG C CB    1 
ATOM   6967  C  CG    . ARG C  3  110 ? -15.176 68.072  -10.425 1.00 29.54  ? 110 ARG C CG    1 
ATOM   6968  C  CD    . ARG C  3  110 ? -16.380 67.959  -9.535  1.00 30.72  ? 110 ARG C CD    1 
ATOM   6969  N  NE    . ARG C  3  110 ? -17.238 69.119  -9.713  1.00 39.60  ? 110 ARG C NE    1 
ATOM   6970  C  CZ    . ARG C  3  110 ? -17.234 70.186  -8.924  1.00 41.75  ? 110 ARG C CZ    1 
ATOM   6971  N  NH1   . ARG C  3  110 ? -18.056 71.196  -9.174  1.00 42.76  ? 110 ARG C NH1   1 
ATOM   6972  N  NH2   . ARG C  3  110 ? -16.409 70.249  -7.895  1.00 39.63  ? 110 ARG C NH2   1 
ATOM   6973  N  N     . VAL C  3  111 ? -13.154 66.302  -14.577 1.00 27.53  ? 111 VAL C N     1 
ATOM   6974  C  CA    . VAL C  3  111 ? -12.886 65.229  -15.533 1.00 27.42  ? 111 VAL C CA    1 
ATOM   6975  C  C     . VAL C  3  111 ? -11.853 64.246  -14.979 1.00 29.46  ? 111 VAL C C     1 
ATOM   6976  O  O     . VAL C  3  111 ? -12.065 63.027  -15.025 1.00 29.71  ? 111 VAL C O     1 
ATOM   6977  C  CB    . VAL C  3  111 ? -12.482 65.794  -16.939 1.00 26.78  ? 111 VAL C CB    1 
ATOM   6978  C  CG1   . VAL C  3  111 ? -11.899 64.707  -17.834 1.00 22.84  ? 111 VAL C CG1   1 
ATOM   6979  C  CG2   . VAL C  3  111 ? -13.724 66.381  -17.625 1.00 24.82  ? 111 VAL C CG2   1 
ATOM   6980  N  N     . THR C  3  112 ? -10.740 64.773  -14.464 1.00 30.29  ? 112 THR C N     1 
ATOM   6981  C  CA    . THR C  3  112 ? -9.692  63.936  -13.874 1.00 30.85  ? 112 THR C CA    1 
ATOM   6982  C  C     . THR C  3  112 ? -10.273 63.063  -12.749 1.00 30.29  ? 112 THR C C     1 
ATOM   6983  O  O     . THR C  3  112 ? -9.950  61.885  -12.615 1.00 30.82  ? 112 THR C O     1 
ATOM   6984  C  CB    . THR C  3  112 ? -8.566  64.792  -13.310 1.00 31.58  ? 112 THR C CB    1 
ATOM   6985  O  OG1   . THR C  3  112 ? -7.874  65.421  -14.393 1.00 36.24  ? 112 THR C OG1   1 
ATOM   6986  C  CG2   . THR C  3  112 ? -7.576  63.936  -12.526 1.00 31.55  ? 112 THR C CG2   1 
ATOM   6987  N  N     . LEU C  3  113 ? -11.182 63.645  -11.984 1.00 28.82  ? 113 LEU C N     1 
ATOM   6988  C  CA    . LEU C  3  113 ? -11.822 62.946  -10.899 1.00 30.05  ? 113 LEU C CA    1 
ATOM   6989  C  C     . LEU C  3  113 ? -12.597 61.743  -11.452 1.00 31.47  ? 113 LEU C C     1 
ATOM   6990  O  O     . LEU C  3  113 ? -12.514 60.636  -10.921 1.00 34.72  ? 113 LEU C O     1 
ATOM   6991  C  CB    . LEU C  3  113 ? -12.747 63.914  -10.163 1.00 27.79  ? 113 LEU C CB    1 
ATOM   6992  C  CG    . LEU C  3  113 ? -13.537 63.393  -8.979  1.00 27.06  ? 113 LEU C CG    1 
ATOM   6993  C  CD1   . LEU C  3  113 ? -12.604 62.695  -7.989  1.00 27.64  ? 113 LEU C CD1   1 
ATOM   6994  C  CD2   . LEU C  3  113 ? -14.261 64.559  -8.332  1.00 28.88  ? 113 LEU C CD2   1 
ATOM   6995  N  N     . TRP C  3  114 ? -13.305 61.958  -12.556 1.00 33.11  ? 114 TRP C N     1 
ATOM   6996  C  CA    . TRP C  3  114 ? -14.099 60.918  -13.200 1.00 29.72  ? 114 TRP C CA    1 
ATOM   6997  C  C     . TRP C  3  114 ? -13.246 59.840  -13.858 1.00 29.52  ? 114 TRP C C     1 
ATOM   6998  O  O     . TRP C  3  114 ? -13.568 58.662  -13.760 1.00 30.62  ? 114 TRP C O     1 
ATOM   6999  C  CB    . TRP C  3  114 ? -15.046 61.559  -14.217 1.00 28.41  ? 114 TRP C CB    1 
ATOM   7000  C  CG    . TRP C  3  114 ? -15.911 60.600  -15.002 1.00 29.90  ? 114 TRP C CG    1 
ATOM   7001  C  CD1   . TRP C  3  114 ? -15.721 60.199  -16.292 1.00 27.65  ? 114 TRP C CD1   1 
ATOM   7002  C  CD2   . TRP C  3  114 ? -17.117 59.955  -14.556 1.00 29.36  ? 114 TRP C CD2   1 
ATOM   7003  N  NE1   . TRP C  3  114 ? -16.729 59.353  -16.676 1.00 29.78  ? 114 TRP C NE1   1 
ATOM   7004  C  CE2   . TRP C  3  114 ? -17.596 59.182  -15.633 1.00 28.80  ? 114 TRP C CE2   1 
ATOM   7005  C  CE3   . TRP C  3  114 ? -17.838 59.963  -13.351 1.00 27.81  ? 114 TRP C CE3   1 
ATOM   7006  C  CZ2   . TRP C  3  114 ? -18.757 58.420  -15.547 1.00 30.15  ? 114 TRP C CZ2   1 
ATOM   7007  C  CZ3   . TRP C  3  114 ? -18.989 59.215  -13.262 1.00 29.20  ? 114 TRP C CZ3   1 
ATOM   7008  C  CH2   . TRP C  3  114 ? -19.443 58.448  -14.354 1.00 30.97  ? 114 TRP C CH2   1 
ATOM   7009  N  N     . ASN C  3  115 ? -12.142 60.230  -14.486 1.00 30.04  ? 115 ASN C N     1 
ATOM   7010  C  CA    . ASN C  3  115 ? -11.275 59.263  -15.160 1.00 31.13  ? 115 ASN C CA    1 
ATOM   7011  C  C     . ASN C  3  115 ? -10.564 58.340  -14.200 1.00 32.30  ? 115 ASN C C     1 
ATOM   7012  O  O     . ASN C  3  115 ? -10.404 57.151  -14.493 1.00 32.92  ? 115 ASN C O     1 
ATOM   7013  C  CB    . ASN C  3  115 ? -10.258 59.955  -16.073 1.00 32.55  ? 115 ASN C CB    1 
ATOM   7014  C  CG    . ASN C  3  115 ? -10.913 60.622  -17.281 1.00 34.39  ? 115 ASN C CG    1 
ATOM   7015  O  OD1   . ASN C  3  115 ? -12.089 60.391  -17.573 1.00 34.96  ? 115 ASN C OD1   1 
ATOM   7016  N  ND2   . ASN C  3  115 ? -10.154 61.457  -17.982 1.00 36.02  ? 115 ASN C ND2   1 
ATOM   7017  N  N     . VAL C  3  116 ? -10.131 58.876  -13.055 1.00 31.63  ? 116 VAL C N     1 
ATOM   7018  C  CA    . VAL C  3  116 ? -9.460  58.045  -12.058 1.00 31.38  ? 116 VAL C CA    1 
ATOM   7019  C  C     . VAL C  3  116 ? -10.477 57.024  -11.519 1.00 32.49  ? 116 VAL C C     1 
ATOM   7020  O  O     . VAL C  3  116 ? -10.142 55.858  -11.259 1.00 32.38  ? 116 VAL C O     1 
ATOM   7021  C  CB    . VAL C  3  116 ? -8.854  58.893  -10.903 1.00 31.76  ? 116 VAL C CB    1 
ATOM   7022  C  CG1   . VAL C  3  116 ? -8.468  57.989  -9.732  1.00 28.69  ? 116 VAL C CG1   1 
ATOM   7023  C  CG2   . VAL C  3  116 ? -7.613  59.627  -11.395 1.00 27.31  ? 116 VAL C CG2   1 
ATOM   7024  N  N     . GLY C  3  117 ? -11.729 57.460  -11.423 1.00 30.53  ? 117 GLY C N     1 
ATOM   7025  C  CA    . GLY C  3  117 ? -12.786 56.594  -10.948 1.00 32.34  ? 117 GLY C CA    1 
ATOM   7026  C  C     . GLY C  3  117 ? -13.034 55.419  -11.873 1.00 34.95  ? 117 GLY C C     1 
ATOM   7027  O  O     . GLY C  3  117 ? -13.404 54.331  -11.415 1.00 35.76  ? 117 GLY C O     1 
ATOM   7028  N  N     . VAL C  3  118 ? -12.870 55.642  -13.177 1.00 33.43  ? 118 VAL C N     1 
ATOM   7029  C  CA    . VAL C  3  118 ? -13.066 54.572  -14.155 1.00 32.40  ? 118 VAL C CA    1 
ATOM   7030  C  C     . VAL C  3  118 ? -11.962 53.517  -13.964 1.00 32.63  ? 118 VAL C C     1 
ATOM   7031  O  O     . VAL C  3  118 ? -12.230 52.306  -13.985 1.00 30.83  ? 118 VAL C O     1 
ATOM   7032  C  CB    . VAL C  3  118 ? -13.064 55.126  -15.617 1.00 31.12  ? 118 VAL C CB    1 
ATOM   7033  C  CG1   . VAL C  3  118 ? -12.987 53.989  -16.624 1.00 26.82  ? 118 VAL C CG1   1 
ATOM   7034  C  CG2   . VAL C  3  118 ? -14.326 55.959  -15.858 1.00 25.12  ? 118 VAL C CG2   1 
ATOM   7035  N  N     . ILE C  3  119 ? -10.735 53.988  -13.732 1.00 30.95  ? 119 ILE C N     1 
ATOM   7036  C  CA    . ILE C  3  119 ? -9.600  53.102  -13.511 1.00 31.02  ? 119 ILE C CA    1 
ATOM   7037  C  C     . ILE C  3  119 ? -9.844  52.231  -12.272 1.00 31.00  ? 119 ILE C C     1 
ATOM   7038  O  O     . ILE C  3  119 ? -9.595  51.028  -12.301 1.00 30.77  ? 119 ILE C O     1 
ATOM   7039  C  CB    . ILE C  3  119 ? -8.301  53.912  -13.356 1.00 32.80  ? 119 ILE C CB    1 
ATOM   7040  C  CG1   . ILE C  3  119 ? -7.969  54.595  -14.689 1.00 35.01  ? 119 ILE C CG1   1 
ATOM   7041  C  CG2   . ILE C  3  119 ? -7.129  53.016  -12.896 1.00 31.61  ? 119 ILE C CG2   1 
ATOM   7042  C  CD1   . ILE C  3  119 ? -6.778  55.557  -14.618 1.00 33.24  ? 119 ILE C CD1   1 
ATOM   7043  N  N     . ILE C  3  120 ? -10.349 52.843  -11.202 1.00 29.87  ? 120 ILE C N     1 
ATOM   7044  C  CA    . ILE C  3  120 ? -10.649 52.124  -9.969  1.00 30.58  ? 120 ILE C CA    1 
ATOM   7045  C  C     . ILE C  3  120 ? -11.672 51.010  -10.219 1.00 31.93  ? 120 ILE C C     1 
ATOM   7046  O  O     . ILE C  3  120 ? -11.505 49.889  -9.736  1.00 32.06  ? 120 ILE C O     1 
ATOM   7047  C  CB    . ILE C  3  120 ? -11.175 53.083  -8.876  1.00 29.10  ? 120 ILE C CB    1 
ATOM   7048  C  CG1   . ILE C  3  120 ? -10.035 53.972  -8.384  1.00 27.93  ? 120 ILE C CG1   1 
ATOM   7049  C  CG2   . ILE C  3  120 ? -11.782 52.299  -7.712  1.00 24.19  ? 120 ILE C CG2   1 
ATOM   7050  C  CD1   . ILE C  3  120 ? -10.493 55.105  -7.492  1.00 26.83  ? 120 ILE C CD1   1 
ATOM   7051  N  N     . PHE C  3  121 ? -12.717 51.327  -10.984 1.00 32.68  ? 121 PHE C N     1 
ATOM   7052  C  CA    . PHE C  3  121 ? -13.772 50.376  -11.329 1.00 30.92  ? 121 PHE C CA    1 
ATOM   7053  C  C     . PHE C  3  121 ? -13.158 49.159  -12.026 1.00 30.17  ? 121 PHE C C     1 
ATOM   7054  O  O     . PHE C  3  121 ? -13.444 48.023  -11.667 1.00 32.02  ? 121 PHE C O     1 
ATOM   7055  C  CB    . PHE C  3  121 ? -14.809 51.061  -12.226 1.00 30.70  ? 121 PHE C CB    1 
ATOM   7056  C  CG    . PHE C  3  121 ? -15.931 50.166  -12.667 1.00 33.35  ? 121 PHE C CG    1 
ATOM   7057  C  CD1   . PHE C  3  121 ? -16.708 49.475  -11.731 1.00 33.78  ? 121 PHE C CD1   1 
ATOM   7058  C  CD2   . PHE C  3  121 ? -16.228 50.026  -14.023 1.00 32.26  ? 121 PHE C CD2   1 
ATOM   7059  C  CE1   . PHE C  3  121 ? -17.768 48.663  -12.139 1.00 33.71  ? 121 PHE C CE1   1 
ATOM   7060  C  CE2   . PHE C  3  121 ? -17.282 49.220  -14.439 1.00 34.36  ? 121 PHE C CE2   1 
ATOM   7061  C  CZ    . PHE C  3  121 ? -18.055 48.534  -13.498 1.00 34.31  ? 121 PHE C CZ    1 
ATOM   7062  N  N     . THR C  3  122 ? -12.273 49.400  -12.984 1.00 30.35  ? 122 THR C N     1 
ATOM   7063  C  CA    . THR C  3  122 ? -11.615 48.309  -13.691 1.00 31.58  ? 122 THR C CA    1 
ATOM   7064  C  C     . THR C  3  122 ? -10.779 47.463  -12.730 1.00 31.64  ? 122 THR C C     1 
ATOM   7065  O  O     . THR C  3  122 ? -10.864 46.231  -12.760 1.00 31.65  ? 122 THR C O     1 
ATOM   7066  C  CB    . THR C  3  122 ? -10.719 48.837  -14.853 1.00 32.92  ? 122 THR C CB    1 
ATOM   7067  O  OG1   . THR C  3  122 ? -11.556 49.325  -15.906 1.00 35.46  ? 122 THR C OG1   1 
ATOM   7068  C  CG2   . THR C  3  122 ? -9.826  47.735  -15.412 1.00 30.40  ? 122 THR C CG2   1 
ATOM   7069  N  N     . LEU C  3  123 ? -9.993  48.122  -11.874 1.00 29.43  ? 123 LEU C N     1 
ATOM   7070  C  CA    . LEU C  3  123 ? -9.148  47.416  -10.913 1.00 28.42  ? 123 LEU C CA    1 
ATOM   7071  C  C     . LEU C  3  123 ? -9.984  46.578  -9.931  1.00 29.60  ? 123 LEU C C     1 
ATOM   7072  O  O     . LEU C  3  123 ? -9.595  45.464  -9.551  1.00 27.72  ? 123 LEU C O     1 
ATOM   7073  C  CB    . LEU C  3  123 ? -8.248  48.399  -10.161 1.00 26.69  ? 123 LEU C CB    1 
ATOM   7074  C  CG    . LEU C  3  123 ? -7.120  49.069  -10.967 1.00 28.15  ? 123 LEU C CG    1 
ATOM   7075  C  CD1   . LEU C  3  123 ? -6.358  50.024  -10.097 1.00 26.38  ? 123 LEU C CD1   1 
ATOM   7076  C  CD2   . LEU C  3  123 ? -6.152  48.045  -11.538 1.00 28.21  ? 123 LEU C CD2   1 
ATOM   7077  N  N     . THR C  3  124 ? -11.173 47.075  -9.595  1.00 28.92  ? 124 THR C N     1 
ATOM   7078  C  CA    . THR C  3  124 ? -12.054 46.365  -8.675  1.00 28.40  ? 124 THR C CA    1 
ATOM   7079  C  C     . THR C  3  124 ? -12.609 45.105  -9.338  1.00 32.16  ? 124 THR C C     1 
ATOM   7080  O  O     . THR C  3  124 ? -12.675 44.037  -8.712  1.00 32.92  ? 124 THR C O     1 
ATOM   7081  C  CB    . THR C  3  124 ? -13.198 47.269  -8.177  1.00 27.89  ? 124 THR C CB    1 
ATOM   7082  O  OG1   . THR C  3  124 ? -12.645 48.482  -7.649  1.00 23.61  ? 124 THR C OG1   1 
ATOM   7083  C  CG2   . THR C  3  124 ? -14.010 46.564  -7.092  1.00 26.14  ? 124 THR C CG2   1 
ATOM   7084  N  N     . ILE C  3  125 ? -13.001 45.218  -10.606 1.00 32.10  ? 125 ILE C N     1 
ATOM   7085  C  CA    . ILE C  3  125 ? -13.506 44.057  -11.328 1.00 30.47  ? 125 ILE C CA    1 
ATOM   7086  C  C     . ILE C  3  125 ? -12.414 42.992  -11.359 1.00 30.09  ? 125 ILE C C     1 
ATOM   7087  O  O     . ILE C  3  125 ? -12.664 41.843  -11.014 1.00 30.68  ? 125 ILE C O     1 
ATOM   7088  C  CB    . ILE C  3  125 ? -13.964 44.448  -12.771 1.00 33.17  ? 125 ILE C CB    1 
ATOM   7089  C  CG1   . ILE C  3  125 ? -15.369 45.053  -12.699 1.00 32.50  ? 125 ILE C CG1   1 
ATOM   7090  C  CG2   . ILE C  3  125 ? -13.942 43.242  -13.721 1.00 29.71  ? 125 ILE C CG2   1 
ATOM   7091  C  CD1   . ILE C  3  125 ? -15.792 45.801  -13.943 1.00 36.39  ? 125 ILE C CD1   1 
ATOM   7092  N  N     . ALA C  3  126 ? -11.194 43.393  -11.716 1.00 28.36  ? 126 ALA C N     1 
ATOM   7093  C  CA    . ALA C  3  126 ? -10.058 42.464  -11.778 1.00 29.09  ? 126 ALA C CA    1 
ATOM   7094  C  C     . ALA C  3  126 ? -9.775  41.788  -10.423 1.00 31.64  ? 126 ALA C C     1 
ATOM   7095  O  O     . ALA C  3  126 ? -9.449  40.592  -10.359 1.00 33.09  ? 126 ALA C O     1 
ATOM   7096  C  CB    . ALA C  3  126 ? -8.811  43.187  -12.264 1.00 22.07  ? 126 ALA C CB    1 
ATOM   7097  N  N     . THR C  3  127 ? -9.899  42.566  -9.349  1.00 30.87  ? 127 THR C N     1 
ATOM   7098  C  CA    . THR C  3  127 ? -9.661  42.074  -8.009  1.00 28.43  ? 127 THR C CA    1 
ATOM   7099  C  C     . THR C  3  127 ? -10.681 41.028  -7.598  1.00 28.67  ? 127 THR C C     1 
ATOM   7100  O  O     . THR C  3  127 ? -10.315 39.932  -7.192  1.00 30.24  ? 127 THR C O     1 
ATOM   7101  C  CB    . THR C  3  127 ? -9.646  43.241  -7.004  1.00 29.94  ? 127 THR C CB    1 
ATOM   7102  O  OG1   . THR C  3  127 ? -8.529  44.086  -7.297  1.00 29.98  ? 127 THR C OG1   1 
ATOM   7103  C  CG2   . THR C  3  127 ? -9.517  42.745  -5.566  1.00 28.43  ? 127 THR C CG2   1 
ATOM   7104  N  N     . ALA C  3  128 ? -11.960 41.349  -7.726  1.00 28.10  ? 128 ALA C N     1 
ATOM   7105  C  CA    . ALA C  3  128 ? -13.011 40.409  -7.344  1.00 28.17  ? 128 ALA C CA    1 
ATOM   7106  C  C     . ALA C  3  128 ? -12.898 39.105  -8.137  1.00 31.13  ? 128 ALA C C     1 
ATOM   7107  O  O     . ALA C  3  128 ? -13.051 38.010  -7.591  1.00 31.74  ? 128 ALA C O     1 
ATOM   7108  C  CB    . ALA C  3  128 ? -14.373 41.036  -7.537  1.00 23.31  ? 128 ALA C CB    1 
ATOM   7109  N  N     . PHE C  3  129 ? -12.600 39.221  -9.422  1.00 32.18  ? 129 PHE C N     1 
ATOM   7110  C  CA    . PHE C  3  129 ? -12.470 38.043  -10.259 1.00 34.68  ? 129 PHE C CA    1 
ATOM   7111  C  C     . PHE C  3  129 ? -11.341 37.122  -9.761  1.00 33.83  ? 129 PHE C C     1 
ATOM   7112  O  O     . PHE C  3  129 ? -11.526 35.905  -9.653  1.00 29.42  ? 129 PHE C O     1 
ATOM   7113  C  CB    . PHE C  3  129 ? -12.260 38.457  -11.735 1.00 39.90  ? 129 PHE C CB    1 
ATOM   7114  C  CG    . PHE C  3  129 ? -11.573 37.408  -12.574 1.00 41.32  ? 129 PHE C CG    1 
ATOM   7115  C  CD1   . PHE C  3  129 ? -12.284 36.316  -13.058 1.00 41.36  ? 129 PHE C CD1   1 
ATOM   7116  C  CD2   . PHE C  3  129 ? -10.191 37.488  -12.819 1.00 41.92  ? 129 PHE C CD2   1 
ATOM   7117  C  CE1   . PHE C  3  129 ? -11.638 35.307  -13.764 1.00 44.59  ? 129 PHE C CE1   1 
ATOM   7118  C  CE2   . PHE C  3  129 ? -9.526  36.491  -13.524 1.00 44.80  ? 129 PHE C CE2   1 
ATOM   7119  C  CZ    . PHE C  3  129 ? -10.250 35.388  -14.001 1.00 46.80  ? 129 PHE C CZ    1 
ATOM   7120  N  N     . LEU C  3  130 ? -10.171 37.700  -9.481  1.00 33.31  ? 130 LEU C N     1 
ATOM   7121  C  CA    . LEU C  3  130 ? -9.039  36.912  -9.002  1.00 32.42  ? 130 LEU C CA    1 
ATOM   7122  C  C     . LEU C  3  130 ? -9.382  36.205  -7.691  1.00 34.17  ? 130 LEU C C     1 
ATOM   7123  O  O     . LEU C  3  130 ? -8.974  35.063  -7.469  1.00 33.28  ? 130 LEU C O     1 
ATOM   7124  C  CB    . LEU C  3  130 ? -7.825  37.795  -8.800  1.00 30.60  ? 130 LEU C CB    1 
ATOM   7125  C  CG    . LEU C  3  130 ? -7.122  38.340  -10.043 1.00 31.65  ? 130 LEU C CG    1 
ATOM   7126  C  CD1   . LEU C  3  130 ? -6.068  39.372  -9.617  1.00 27.77  ? 130 LEU C CD1   1 
ATOM   7127  C  CD2   . LEU C  3  130 ? -6.497  37.197  -10.838 1.00 29.50  ? 130 LEU C CD2   1 
ATOM   7128  N  N     . GLY C  3  131 ? -10.150 36.889  -6.842  1.00 36.25  ? 131 GLY C N     1 
ATOM   7129  C  CA    . GLY C  3  131 ? -10.569 36.329  -5.569  1.00 39.07  ? 131 GLY C CA    1 
ATOM   7130  C  C     . GLY C  3  131 ? -11.498 35.163  -5.813  1.00 41.90  ? 131 GLY C C     1 
ATOM   7131  O  O     . GLY C  3  131 ? -11.405 34.112  -5.168  1.00 43.83  ? 131 GLY C O     1 
ATOM   7132  N  N     . TYR C  3  132 ? -12.364 35.335  -6.802  1.00 43.91  ? 132 TYR C N     1 
ATOM   7133  C  CA    . TYR C  3  132 ? -13.318 34.309  -7.177  1.00 43.86  ? 132 TYR C CA    1 
ATOM   7134  C  C     . TYR C  3  132 ? -12.610 33.017  -7.572  1.00 42.74  ? 132 TYR C C     1 
ATOM   7135  O  O     . TYR C  3  132 ? -13.059 31.928  -7.227  1.00 42.92  ? 132 TYR C O     1 
ATOM   7136  C  CB    . TYR C  3  132 ? -14.185 34.799  -8.332  1.00 47.90  ? 132 TYR C CB    1 
ATOM   7137  C  CG    . TYR C  3  132 ? -15.477 34.064  -8.390  1.00 54.70  ? 132 TYR C CG    1 
ATOM   7138  C  CD1   . TYR C  3  132 ? -16.319 34.053  -7.279  1.00 58.65  ? 132 TYR C CD1   1 
ATOM   7139  C  CD2   . TYR C  3  132 ? -15.814 33.279  -9.497  1.00 58.03  ? 132 TYR C CD2   1 
ATOM   7140  C  CE1   . TYR C  3  132 ? -17.458 33.265  -7.252  1.00 64.12  ? 132 TYR C CE1   1 
ATOM   7141  C  CE2   . TYR C  3  132 ? -16.958 32.485  -9.487  1.00 61.55  ? 132 TYR C CE2   1 
ATOM   7142  C  CZ    . TYR C  3  132 ? -17.773 32.478  -8.352  1.00 64.42  ? 132 TYR C CZ    1 
ATOM   7143  O  OH    . TYR C  3  132 ? -18.870 31.644  -8.274  1.00 68.29  ? 132 TYR C OH    1 
ATOM   7144  N  N     . CYS C  3  133 ? -11.476 33.153  -8.252  1.00 42.03  ? 133 CYS C N     1 
ATOM   7145  C  CA    . CYS C  3  133 ? -10.692 32.012  -8.712  1.00 41.24  ? 133 CYS C CA    1 
ATOM   7146  C  C     . CYS C  3  133 ? -9.995  31.269  -7.580  1.00 40.69  ? 133 CYS C C     1 
ATOM   7147  O  O     . CYS C  3  133 ? -9.649  30.096  -7.734  1.00 41.84  ? 133 CYS C O     1 
ATOM   7148  C  CB    . CYS C  3  133 ? -9.641  32.463  -9.739  1.00 40.91  ? 133 CYS C CB    1 
ATOM   7149  S  SG    . CYS C  3  133 ? -10.311 33.179  -11.272 1.00 45.80  ? 133 CYS C SG    1 
ATOM   7150  N  N     . CYS C  3  134 ? -9.782  31.945  -6.455  1.00 38.47  ? 134 CYS C N     1 
ATOM   7151  C  CA    . CYS C  3  134 ? -9.089  31.337  -5.320  1.00 38.32  ? 134 CYS C CA    1 
ATOM   7152  C  C     . CYS C  3  134 ? -9.874  30.246  -4.591  1.00 37.98  ? 134 CYS C C     1 
ATOM   7153  O  O     . CYS C  3  134 ? -9.289  29.430  -3.878  1.00 38.78  ? 134 CYS C O     1 
ATOM   7154  C  CB    . CYS C  3  134 ? -8.639  32.416  -4.327  1.00 39.92  ? 134 CYS C CB    1 
ATOM   7155  S  SG    . CYS C  3  134 ? -7.319  33.487  -4.947  1.00 38.30  ? 134 CYS C SG    1 
ATOM   7156  N  N     . VAL C  3  135 ? -11.193 30.242  -4.756  1.00 36.48  ? 135 VAL C N     1 
ATOM   7157  C  CA    . VAL C  3  135 ? -12.047 29.245  -4.117  1.00 36.01  ? 135 VAL C CA    1 
ATOM   7158  C  C     . VAL C  3  135 ? -11.860 27.903  -4.810  1.00 36.94  ? 135 VAL C C     1 
ATOM   7159  O  O     . VAL C  3  135 ? -12.002 26.840  -4.209  1.00 37.44  ? 135 VAL C O     1 
ATOM   7160  C  CB    . VAL C  3  135 ? -13.536 29.613  -4.261  1.00 34.80  ? 135 VAL C CB    1 
ATOM   7161  C  CG1   . VAL C  3  135 ? -14.401 28.558  -3.587  1.00 35.80  ? 135 VAL C CG1   1 
ATOM   7162  C  CG2   . VAL C  3  135 ? -13.813 30.988  -3.678  1.00 34.92  ? 135 VAL C CG2   1 
ATOM   7163  N  N     . TYR C  3  136 ? -11.517 27.994  -6.086  1.00 36.47  ? 136 TYR C N     1 
ATOM   7164  C  CA    . TYR C  3  136 ? -11.329 26.869  -6.970  1.00 35.15  ? 136 TYR C CA    1 
ATOM   7165  C  C     . TYR C  3  136 ? -12.494 25.896  -6.990  1.00 33.88  ? 136 TYR C C     1 
ATOM   7166  O  O     . TYR C  3  136 ? -12.323 24.694  -6.815  1.00 34.89  ? 136 TYR C O     1 
ATOM   7167  C  CB    . TYR C  3  136 ? -9.997  26.160  -6.767  1.00 35.28  ? 136 TYR C CB    1 
ATOM   7168  C  CG    . TYR C  3  136 ? -9.675  25.287  -7.967  1.00 41.58  ? 136 TYR C CG    1 
ATOM   7169  C  CD1   . TYR C  3  136 ? -9.346  25.862  -9.198  1.00 42.81  ? 136 TYR C CD1   1 
ATOM   7170  C  CD2   . TYR C  3  136 ? -9.787  23.887  -7.904  1.00 42.60  ? 136 TYR C CD2   1 
ATOM   7171  C  CE1   . TYR C  3  136 ? -9.146  25.069  -10.341 1.00 44.65  ? 136 TYR C CE1   1 
ATOM   7172  C  CE2   . TYR C  3  136 ? -9.587  23.089  -9.039  1.00 43.11  ? 136 TYR C CE2   1 
ATOM   7173  C  CZ    . TYR C  3  136 ? -9.270  23.688  -10.251 1.00 45.16  ? 136 TYR C CZ    1 
ATOM   7174  O  OH    . TYR C  3  136 ? -9.089  22.916  -11.376 1.00 48.19  ? 136 TYR C OH    1 
ATOM   7175  N  N     . GLY C  3  137 ? -13.693 26.448  -7.127  1.00 33.38  ? 137 GLY C N     1 
ATOM   7176  C  CA    . GLY C  3  137 ? -14.892 25.638  -7.244  1.00 35.01  ? 137 GLY C CA    1 
ATOM   7177  C  C     . GLY C  3  137 ? -15.114 25.416  -8.742  1.00 37.33  ? 137 GLY C C     1 
ATOM   7178  O  O     . GLY C  3  137 ? -14.203 25.659  -9.541  1.00 38.25  ? 137 GLY C O     1 
ATOM   7179  N  N     . GLN C  3  138 ? -16.283 24.921  -9.143  1.00 37.79  ? 138 GLN C N     1 
ATOM   7180  C  CA    . GLN C  3  138 ? -16.547 24.721  -10.568 1.00 39.31  ? 138 GLN C CA    1 
ATOM   7181  C  C     . GLN C  3  138 ? -16.567 26.063  -11.320 1.00 40.82  ? 138 GLN C C     1 
ATOM   7182  O  O     . GLN C  3  138 ? -15.902 26.212  -12.353 1.00 40.33  ? 138 GLN C O     1 
ATOM   7183  C  CB    . GLN C  3  138 ? -17.864 23.969  -10.790 1.00 38.85  ? 138 GLN C CB    1 
ATOM   7184  C  CG    . GLN C  3  138 ? -17.718 22.463  -10.795 1.00 39.63  ? 138 GLN C CG    1 
ATOM   7185  C  CD    . GLN C  3  138 ? -17.091 21.933  -12.075 1.00 40.46  ? 138 GLN C CD    1 
ATOM   7186  O  OE1   . GLN C  3  138 ? -15.907 22.132  -12.342 1.00 42.28  ? 138 GLN C OE1   1 
ATOM   7187  N  NE2   . GLN C  3  138 ? -17.885 21.236  -12.864 1.00 41.09  ? 138 GLN C NE2   1 
ATOM   7188  N  N     . MET C  3  139 ? -17.295 27.044  -10.781 1.00 41.07  ? 139 MET C N     1 
ATOM   7189  C  CA    . MET C  3  139 ? -17.369 28.355  -11.411 1.00 42.29  ? 139 MET C CA    1 
ATOM   7190  C  C     . MET C  3  139 ? -16.005 29.017  -11.503 1.00 42.30  ? 139 MET C C     1 
ATOM   7191  O  O     . MET C  3  139 ? -15.667 29.612  -12.522 1.00 44.91  ? 139 MET C O     1 
ATOM   7192  C  CB    . MET C  3  139 ? -18.352 29.254  -10.677 1.00 44.52  ? 139 MET C CB    1 
ATOM   7193  C  CG    . MET C  3  139 ? -19.816 28.904  -10.940 1.00 49.41  ? 139 MET C CG    1 
ATOM   7194  S  SD    . MET C  3  139 ? -20.332 29.176  -12.678 1.00 55.77  ? 139 MET C SD    1 
ATOM   7195  C  CE    . MET C  3  139 ? -20.067 27.543  -13.354 1.00 53.86  ? 139 MET C CE    1 
ATOM   7196  N  N     . SER C  3  140 ? -15.201 28.852  -10.458 1.00 41.74  ? 140 SER C N     1 
ATOM   7197  C  CA    . SER C  3  140 ? -13.864 29.422  -10.404 1.00 41.01  ? 140 SER C CA    1 
ATOM   7198  C  C     . SER C  3  140 ? -13.018 28.983  -11.589 1.00 42.04  ? 140 SER C C     1 
ATOM   7199  O  O     . SER C  3  140 ? -12.496 29.819  -12.340 1.00 42.18  ? 140 SER C O     1 
ATOM   7200  C  CB    . SER C  3  140 ? -13.161 28.985  -9.121  1.00 40.20  ? 140 SER C CB    1 
ATOM   7201  O  OG    . SER C  3  140 ? -13.900 29.377  -7.991  1.00 43.61  ? 140 SER C OG    1 
ATOM   7202  N  N     . HIS C  3  141 ? -12.884 27.664  -11.748 1.00 41.88  ? 141 HIS C N     1 
ATOM   7203  C  CA    . HIS C  3  141 ? -12.086 27.094  -12.826 1.00 40.77  ? 141 HIS C CA    1 
ATOM   7204  C  C     . HIS C  3  141 ? -12.495 27.568  -14.217 1.00 41.02  ? 141 HIS C C     1 
ATOM   7205  O  O     . HIS C  3  141 ? -11.652 27.974  -15.013 1.00 42.11  ? 141 HIS C O     1 
ATOM   7206  C  CB    . HIS C  3  141 ? -12.127 25.570  -12.785 1.00 41.93  ? 141 HIS C CB    1 
ATOM   7207  C  CG    . HIS C  3  141 ? -11.242 24.925  -13.802 1.00 43.50  ? 141 HIS C CG    1 
ATOM   7208  N  ND1   . HIS C  3  141 ? -9.942  24.560  -13.528 1.00 46.94  ? 141 HIS C ND1   1 
ATOM   7209  C  CD2   . HIS C  3  141 ? -11.447 24.640  -15.109 1.00 44.27  ? 141 HIS C CD2   1 
ATOM   7210  C  CE1   . HIS C  3  141 ? -9.381  24.082  -14.625 1.00 48.56  ? 141 HIS C CE1   1 
ATOM   7211  N  NE2   . HIS C  3  141 ? -10.273 24.120  -15.599 1.00 47.74  ? 141 HIS C NE2   1 
ATOM   7212  N  N     . TRP C  3  142 ? -13.785 27.542  -14.510 1.00 38.45  ? 142 TRP C N     1 
ATOM   7213  C  CA    . TRP C  3  142 ? -14.207 27.953  -15.827 1.00 40.84  ? 142 TRP C CA    1 
ATOM   7214  C  C     . TRP C  3  142 ? -14.074 29.450  -16.040 1.00 43.23  ? 142 TRP C C     1 
ATOM   7215  O  O     . TRP C  3  142 ? -13.676 29.891  -17.132 1.00 43.96  ? 142 TRP C O     1 
ATOM   7216  C  CB    . TRP C  3  142 ? -15.588 27.371  -16.162 1.00 39.89  ? 142 TRP C CB    1 
ATOM   7217  C  CG    . TRP C  3  142 ? -15.478 25.874  -16.228 1.00 37.19  ? 142 TRP C CG    1 
ATOM   7218  C  CD1   . TRP C  3  142 ? -15.982 24.972  -15.331 1.00 35.91  ? 142 TRP C CD1   1 
ATOM   7219  C  CD2   . TRP C  3  142 ? -14.628 25.127  -17.108 1.00 35.28  ? 142 TRP C CD2   1 
ATOM   7220  N  NE1   . TRP C  3  142 ? -15.470 23.722  -15.575 1.00 34.12  ? 142 TRP C NE1   1 
ATOM   7221  C  CE2   . TRP C  3  142 ? -14.637 23.785  -16.659 1.00 34.66  ? 142 TRP C CE2   1 
ATOM   7222  C  CE3   . TRP C  3  142 ? -13.849 25.465  -18.222 1.00 35.66  ? 142 TRP C CE3   1 
ATOM   7223  C  CZ2   . TRP C  3  142 ? -13.892 22.779  -17.282 1.00 34.24  ? 142 TRP C CZ2   1 
ATOM   7224  C  CZ3   . TRP C  3  142 ? -13.104 24.463  -18.847 1.00 36.99  ? 142 TRP C CZ3   1 
ATOM   7225  C  CH2   . TRP C  3  142 ? -13.132 23.134  -18.370 1.00 36.34  ? 142 TRP C CH2   1 
ATOM   7226  N  N     . GLY C  3  143 ? -14.288 30.219  -14.969 1.00 42.36  ? 143 GLY C N     1 
ATOM   7227  C  CA    . GLY C  3  143 ? -14.128 31.663  -15.053 1.00 39.99  ? 143 GLY C CA    1 
ATOM   7228  C  C     . GLY C  3  143 ? -12.671 31.993  -15.364 1.00 38.95  ? 143 GLY C C     1 
ATOM   7229  O  O     . GLY C  3  143 ? -12.382 32.793  -16.254 1.00 38.34  ? 143 GLY C O     1 
ATOM   7230  N  N     . ALA C  3  144 ? -11.753 31.344  -14.645 1.00 37.69  ? 144 ALA C N     1 
ATOM   7231  C  CA    . ALA C  3  144 ? -10.317 31.533  -14.849 1.00 39.44  ? 144 ALA C CA    1 
ATOM   7232  C  C     . ALA C  3  144 ? -9.961  31.170  -16.289 1.00 40.67  ? 144 ALA C C     1 
ATOM   7233  O  O     . ALA C  3  144 ? -9.087  31.787  -16.897 1.00 40.97  ? 144 ALA C O     1 
ATOM   7234  C  CB    . ALA C  3  144 ? -9.518  30.656  -13.884 1.00 34.06  ? 144 ALA C CB    1 
ATOM   7235  N  N     . THR C  3  145 ? -10.658 30.167  -16.822 1.00 40.91  ? 145 THR C N     1 
ATOM   7236  C  CA    . THR C  3  145 ? -10.446 29.687  -18.184 1.00 41.54  ? 145 THR C CA    1 
ATOM   7237  C  C     . THR C  3  145 ? -10.954 30.702  -19.217 1.00 40.22  ? 145 THR C C     1 
ATOM   7238  O  O     . THR C  3  145 ? -10.222 31.092  -20.126 1.00 38.86  ? 145 THR C O     1 
ATOM   7239  C  CB    . THR C  3  145 ? -11.135 28.299  -18.382 1.00 44.24  ? 145 THR C CB    1 
ATOM   7240  O  OG1   . THR C  3  145 ? -10.429 27.306  -17.621 1.00 46.58  ? 145 THR C OG1   1 
ATOM   7241  C  CG2   . THR C  3  145 ? -11.166 27.885  -19.860 1.00 41.13  ? 145 THR C CG2   1 
ATOM   7242  N  N     . VAL C  3  146 ? -12.203 31.126  -19.063 1.00 37.99  ? 146 VAL C N     1 
ATOM   7243  C  CA    . VAL C  3  146 ? -12.809 32.095  -19.968 1.00 39.54  ? 146 VAL C CA    1 
ATOM   7244  C  C     . VAL C  3  146 ? -12.076 33.460  -19.990 1.00 42.95  ? 146 VAL C C     1 
ATOM   7245  O  O     . VAL C  3  146 ? -11.594 33.888  -21.041 1.00 43.11  ? 146 VAL C O     1 
ATOM   7246  C  CB    . VAL C  3  146 ? -14.321 32.280  -19.643 1.00 38.22  ? 146 VAL C CB    1 
ATOM   7247  C  CG1   . VAL C  3  146 ? -14.901 33.458  -20.397 1.00 39.87  ? 146 VAL C CG1   1 
ATOM   7248  C  CG2   . VAL C  3  146 ? -15.093 31.020  -20.007 1.00 38.18  ? 146 VAL C CG2   1 
ATOM   7249  N  N     . ILE C  3  147 ? -11.948 34.110  -18.829 1.00 43.70  ? 147 ILE C N     1 
ATOM   7250  C  CA    . ILE C  3  147 ? -11.282 35.408  -18.743 1.00 42.26  ? 147 ILE C CA    1 
ATOM   7251  C  C     . ILE C  3  147 ? -9.849  35.409  -19.260 1.00 42.23  ? 147 ILE C C     1 
ATOM   7252  O  O     . ILE C  3  147 ? -9.423  36.381  -19.867 1.00 42.05  ? 147 ILE C O     1 
ATOM   7253  C  CB    . ILE C  3  147 ? -11.349 36.026  -17.291 1.00 44.09  ? 147 ILE C CB    1 
ATOM   7254  C  CG1   . ILE C  3  147 ? -12.642 36.824  -17.096 1.00 44.79  ? 147 ILE C CG1   1 
ATOM   7255  C  CG2   . ILE C  3  147 ? -10.208 36.987  -17.037 1.00 43.47  ? 147 ILE C CG2   1 
ATOM   7256  C  CD1   . ILE C  3  147 ? -13.878 35.975  -16.889 1.00 49.00  ? 147 ILE C CD1   1 
ATOM   7257  N  N     . THR C  3  148 ? -9.080  34.363  -18.990 1.00 43.23  ? 148 THR C N     1 
ATOM   7258  C  CA    . THR C  3  148 ? -7.710  34.349  -19.486 1.00 45.30  ? 148 THR C CA    1 
ATOM   7259  C  C     . THR C  3  148 ? -7.718  34.141  -20.997 1.00 46.84  ? 148 THR C C     1 
ATOM   7260  O  O     . THR C  3  148 ? -6.856  34.659  -21.708 1.00 46.47  ? 148 THR C O     1 
ATOM   7261  C  CB    . THR C  3  148 ? -6.848  33.260  -18.835 1.00 46.43  ? 148 THR C CB    1 
ATOM   7262  O  OG1   . THR C  3  148 ? -7.509  31.997  -18.926 1.00 50.44  ? 148 THR C OG1   1 
ATOM   7263  C  CG2   . THR C  3  148 ? -6.584  33.583  -17.392 1.00 48.84  ? 148 THR C CG2   1 
ATOM   7264  N  N     . ASN C  3  149 ? -8.705  33.396  -21.488 1.00 46.78  ? 149 ASN C N     1 
ATOM   7265  C  CA    . ASN C  3  149 ? -8.798  33.145  -22.916 1.00 46.84  ? 149 ASN C CA    1 
ATOM   7266  C  C     . ASN C  3  149 ? -9.202  34.412  -23.672 1.00 46.85  ? 149 ASN C C     1 
ATOM   7267  O  O     . ASN C  3  149 ? -8.947  34.535  -24.869 1.00 48.59  ? 149 ASN C O     1 
ATOM   7268  C  CB    . ASN C  3  149 ? -9.766  31.992  -23.209 1.00 46.58  ? 149 ASN C CB    1 
ATOM   7269  C  CG    . ASN C  3  149 ? -9.055  30.661  -23.383 1.00 46.54  ? 149 ASN C CG    1 
ATOM   7270  O  OD1   . ASN C  3  149 ? -7.973  30.592  -23.964 1.00 47.83  ? 149 ASN C OD1   1 
ATOM   7271  N  ND2   . ASN C  3  149 ? -9.666  29.592  -22.890 1.00 47.38  ? 149 ASN C ND2   1 
ATOM   7272  N  N     . LEU C  3  150 ? -9.813  35.354  -22.963 1.00 45.08  ? 150 LEU C N     1 
ATOM   7273  C  CA    . LEU C  3  150 ? -10.239 36.623  -23.544 1.00 45.72  ? 150 LEU C CA    1 
ATOM   7274  C  C     . LEU C  3  150 ? -9.084  37.250  -24.341 1.00 48.37  ? 150 LEU C C     1 
ATOM   7275  O  O     . LEU C  3  150 ? -9.292  37.894  -25.363 1.00 48.80  ? 150 LEU C O     1 
ATOM   7276  C  CB    . LEU C  3  150 ? -10.639 37.560  -22.417 1.00 43.34  ? 150 LEU C CB    1 
ATOM   7277  C  CG    . LEU C  3  150 ? -11.903 38.397  -22.487 1.00 44.96  ? 150 LEU C CG    1 
ATOM   7278  C  CD1   . LEU C  3  150 ? -13.087 37.571  -22.926 1.00 41.19  ? 150 LEU C CD1   1 
ATOM   7279  C  CD2   . LEU C  3  150 ? -12.138 38.990  -21.097 1.00 44.75  ? 150 LEU C CD2   1 
ATOM   7280  N  N     . PHE C  3  151 ? -7.860  37.008  -23.887 1.00 51.31  ? 151 PHE C N     1 
ATOM   7281  C  CA    . PHE C  3  151 ? -6.669  37.533  -24.537 1.00 54.37  ? 151 PHE C CA    1 
ATOM   7282  C  C     . PHE C  3  151 ? -6.253  36.851  -25.847 1.00 56.19  ? 151 PHE C C     1 
ATOM   7283  O  O     . PHE C  3  151 ? -5.457  37.400  -26.609 1.00 57.70  ? 151 PHE C O     1 
ATOM   7284  C  CB    . PHE C  3  151 ? -5.510  37.534  -23.546 1.00 54.09  ? 151 PHE C CB    1 
ATOM   7285  C  CG    . PHE C  3  151 ? -5.745  38.423  -22.375 1.00 56.48  ? 151 PHE C CG    1 
ATOM   7286  C  CD1   . PHE C  3  151 ? -5.297  39.739  -22.386 1.00 58.98  ? 151 PHE C CD1   1 
ATOM   7287  C  CD2   . PHE C  3  151 ? -6.472  37.967  -21.282 1.00 57.51  ? 151 PHE C CD2   1 
ATOM   7288  C  CE1   . PHE C  3  151 ? -5.581  40.596  -21.320 1.00 61.14  ? 151 PHE C CE1   1 
ATOM   7289  C  CE2   . PHE C  3  151 ? -6.763  38.810  -20.209 1.00 58.65  ? 151 PHE C CE2   1 
ATOM   7290  C  CZ    . PHE C  3  151 ? -6.321  40.127  -20.226 1.00 60.26  ? 151 PHE C CZ    1 
ATOM   7291  N  N     . SER C  3  152 ? -6.777  35.661  -26.117 1.00 57.05  ? 152 SER C N     1 
ATOM   7292  C  CA    . SER C  3  152 ? -6.422  34.968  -27.352 1.00 59.25  ? 152 SER C CA    1 
ATOM   7293  C  C     . SER C  3  152 ? -6.992  35.703  -28.572 1.00 62.01  ? 152 SER C C     1 
ATOM   7294  O  O     . SER C  3  152 ? -6.569  35.460  -29.705 1.00 63.81  ? 152 SER C O     1 
ATOM   7295  C  CB    . SER C  3  152 ? -6.898  33.508  -27.329 1.00 56.59  ? 152 SER C CB    1 
ATOM   7296  O  OG    . SER C  3  152 ? -8.307  33.409  -27.354 1.00 52.54  ? 152 SER C OG    1 
ATOM   7297  N  N     . ALA C  3  153 ? -7.927  36.621  -28.323 1.00 63.07  ? 153 ALA C N     1 
ATOM   7298  C  CA    . ALA C  3  153 ? -8.555  37.405  -29.378 1.00 65.13  ? 153 ALA C CA    1 
ATOM   7299  C  C     . ALA C  3  153 ? -7.554  38.331  -30.057 1.00 67.18  ? 153 ALA C C     1 
ATOM   7300  O  O     . ALA C  3  153 ? -7.771  38.763  -31.188 1.00 69.12  ? 153 ALA C O     1 
ATOM   7301  C  CB    . ALA C  3  153 ? -9.717  38.205  -28.820 1.00 64.40  ? 153 ALA C CB    1 
ATOM   7302  N  N     . ILE C  3  154 ? -6.469  38.653  -29.360 1.00 69.65  ? 154 ILE C N     1 
ATOM   7303  C  CA    . ILE C  3  154 ? -5.432  39.513  -29.920 1.00 71.94  ? 154 ILE C CA    1 
ATOM   7304  C  C     . ILE C  3  154 ? -4.757  38.735  -31.049 1.00 74.99  ? 154 ILE C C     1 
ATOM   7305  O  O     . ILE C  3  154 ? -4.375  37.575  -30.880 1.00 75.54  ? 154 ILE C O     1 
ATOM   7306  C  CB    . ILE C  3  154 ? -4.386  39.909  -28.851 1.00 71.46  ? 154 ILE C CB    1 
ATOM   7307  C  CG1   . ILE C  3  154 ? -5.056  40.732  -27.747 1.00 71.61  ? 154 ILE C CG1   1 
ATOM   7308  C  CG2   . ILE C  3  154 ? -3.241  40.701  -29.483 1.00 70.88  ? 154 ILE C CG2   1 
ATOM   7309  C  CD1   . ILE C  3  154 ? -4.118  41.140  -26.626 1.00 72.16  ? 154 ILE C CD1   1 
ATOM   7310  N  N     . PRO C  3  155 ? -4.663  39.345  -32.238 1.00 77.32  ? 155 PRO C N     1 
ATOM   7311  C  CA    . PRO C  3  155 ? -4.041  38.709  -33.404 1.00 78.80  ? 155 PRO C CA    1 
ATOM   7312  C  C     . PRO C  3  155 ? -2.549  38.427  -33.235 1.00 80.28  ? 155 PRO C C     1 
ATOM   7313  O  O     . PRO C  3  155 ? -1.830  39.196  -32.595 1.00 80.34  ? 155 PRO C O     1 
ATOM   7314  C  CB    . PRO C  3  155 ? -4.293  39.729  -34.513 1.00 79.00  ? 155 PRO C CB    1 
ATOM   7315  C  CG    . PRO C  3  155 ? -4.304  41.041  -33.766 1.00 78.76  ? 155 PRO C CG    1 
ATOM   7316  C  CD    . PRO C  3  155 ? -5.142  40.698  -32.569 1.00 77.59  ? 155 PRO C CD    1 
ATOM   7317  N  N     . PHE C  3  156 ? -2.110  37.307  -33.810 1.00 82.38  ? 156 PHE C N     1 
ATOM   7318  C  CA    . PHE C  3  156 ? -0.711  36.858  -33.792 1.00 84.32  ? 156 PHE C CA    1 
ATOM   7319  C  C     . PHE C  3  156 ? -0.210  36.236  -32.485 1.00 84.02  ? 156 PHE C C     1 
ATOM   7320  O  O     . PHE C  3  156 ? -0.031  35.018  -32.396 1.00 84.11  ? 156 PHE C O     1 
ATOM   7321  C  CB    . PHE C  3  156 ? 0.243   37.993  -34.209 1.00 87.15  ? 156 PHE C CB    1 
ATOM   7322  C  CG    . PHE C  3  156 ? -0.061  38.588  -35.558 1.00 90.68  ? 156 PHE C CG    1 
ATOM   7323  C  CD1   . PHE C  3  156 ? -0.141  39.975  -35.715 1.00 91.29  ? 156 PHE C CD1   1 
ATOM   7324  C  CD2   . PHE C  3  156 ? -0.262  37.767  -36.675 1.00 92.15  ? 156 PHE C CD2   1 
ATOM   7325  C  CE1   . PHE C  3  156 ? -0.418  40.542  -36.965 1.00 92.73  ? 156 PHE C CE1   1 
ATOM   7326  C  CE2   . PHE C  3  156 ? -0.540  38.318  -37.933 1.00 92.66  ? 156 PHE C CE2   1 
ATOM   7327  C  CZ    . PHE C  3  156 ? -0.618  39.710  -38.079 1.00 93.38  ? 156 PHE C CZ    1 
ATOM   7328  N  N     . VAL C  3  157 ? 0.034   37.081  -31.485 1.00 82.79  ? 157 VAL C N     1 
ATOM   7329  C  CA    . VAL C  3  157 ? 0.553   36.640  -30.192 1.00 80.99  ? 157 VAL C CA    1 
ATOM   7330  C  C     . VAL C  3  157 ? -0.469  36.180  -29.150 1.00 80.17  ? 157 VAL C C     1 
ATOM   7331  O  O     . VAL C  3  157 ? -0.112  35.495  -28.198 1.00 80.44  ? 157 VAL C O     1 
ATOM   7332  C  CB    . VAL C  3  157 ? 1.428   37.743  -29.561 1.00 80.41  ? 157 VAL C CB    1 
ATOM   7333  C  CG1   . VAL C  3  157 ? 2.679   37.962  -30.396 1.00 79.05  ? 157 VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C  3  157 ? 0.637   39.037  -29.439 1.00 79.81  ? 157 VAL C CG2   1 
ATOM   7335  N  N     . GLY C  3  158 ? -1.731  36.545  -29.347 1.00 79.21  ? 158 GLY C N     1 
ATOM   7336  C  CA    . GLY C  3  158 ? -2.799  36.203  -28.417 1.00 78.51  ? 158 GLY C CA    1 
ATOM   7337  C  C     . GLY C  3  158 ? -2.796  34.883  -27.661 1.00 77.73  ? 158 GLY C C     1 
ATOM   7338  O  O     . GLY C  3  158 ? -3.020  34.871  -26.451 1.00 78.83  ? 158 GLY C O     1 
ATOM   7339  N  N     . ASN C  3  159 ? -2.582  33.772  -28.359 1.00 76.24  ? 159 ASN C N     1 
ATOM   7340  C  CA    . ASN C  3  159 ? -2.577  32.464  -27.710 1.00 75.15  ? 159 ASN C CA    1 
ATOM   7341  C  C     . ASN C  3  159 ? -1.330  32.281  -26.854 1.00 74.11  ? 159 ASN C C     1 
ATOM   7342  O  O     . ASN C  3  159 ? -1.300  31.438  -25.959 1.00 74.05  ? 159 ASN C O     1 
ATOM   7343  C  CB    . ASN C  3  159 ? -2.702  31.339  -28.749 1.00 75.81  ? 159 ASN C CB    1 
ATOM   7344  C  CG    . ASN C  3  159 ? -4.005  31.413  -29.541 1.00 76.36  ? 159 ASN C CG    1 
ATOM   7345  O  OD1   . ASN C  3  159 ? -5.011  30.806  -29.165 1.00 76.10  ? 159 ASN C OD1   1 
ATOM   7346  N  ND2   . ASN C  3  159 ? -3.993  32.174  -30.636 1.00 76.94  ? 159 ASN C ND2   1 
ATOM   7347  N  N     . ASP C  3  160 ? -0.298  33.069  -27.146 1.00 73.40  ? 160 ASP C N     1 
ATOM   7348  C  CA    . ASP C  3  160 ? 0.949   33.021  -26.390 1.00 72.41  ? 160 ASP C CA    1 
ATOM   7349  C  C     . ASP C  3  160 ? 0.750   33.698  -25.041 1.00 70.31  ? 160 ASP C C     1 
ATOM   7350  O  O     . ASP C  3  160 ? 1.090   33.122  -24.009 1.00 70.52  ? 160 ASP C O     1 
ATOM   7351  C  CB    . ASP C  3  160 ? 2.096   33.693  -27.161 1.00 74.06  ? 160 ASP C CB    1 
ATOM   7352  C  CG    . ASP C  3  160 ? 2.778   32.750  -28.158 1.00 75.53  ? 160 ASP C CG    1 
ATOM   7353  O  OD1   . ASP C  3  160 ? 3.714   33.203  -28.853 1.00 76.60  ? 160 ASP C OD1   1 
ATOM   7354  O  OD2   . ASP C  3  160 ? 2.400   31.559  -28.239 1.00 74.88  ? 160 ASP C OD2   1 
ATOM   7355  N  N     . ILE C  3  161 ? 0.180   34.906  -25.056 1.00 67.75  ? 161 ILE C N     1 
ATOM   7356  C  CA    . ILE C  3  161 ? -0.100  35.668  -23.831 1.00 65.31  ? 161 ILE C CA    1 
ATOM   7357  C  C     . ILE C  3  161 ? -0.874  34.761  -22.861 1.00 63.98  ? 161 ILE C C     1 
ATOM   7358  O  O     . ILE C  3  161 ? -0.669  34.803  -21.642 1.00 63.47  ? 161 ILE C O     1 
ATOM   7359  C  CB    . ILE C  3  161 ? -1.027  36.888  -24.101 1.00 65.44  ? 161 ILE C CB    1 
ATOM   7360  C  CG1   . ILE C  3  161 ? -0.603  37.657  -25.361 1.00 65.41  ? 161 ILE C CG1   1 
ATOM   7361  C  CG2   . ILE C  3  161 ? -1.074  37.789  -22.868 1.00 63.23  ? 161 ILE C CG2   1 
ATOM   7362  C  CD1   . ILE C  3  161 ? 0.517   38.632  -25.166 1.00 64.33  ? 161 ILE C CD1   1 
ATOM   7363  N  N     . VAL C  3  162 ? -1.772  33.957  -23.432 1.00 60.58  ? 162 VAL C N     1 
ATOM   7364  C  CA    . VAL C  3  162 ? -2.613  33.028  -22.692 1.00 57.21  ? 162 VAL C CA    1 
ATOM   7365  C  C     . VAL C  3  162 ? -1.837  31.891  -22.039 1.00 57.36  ? 162 VAL C C     1 
ATOM   7366  O  O     . VAL C  3  162 ? -2.001  31.645  -20.850 1.00 57.74  ? 162 VAL C O     1 
ATOM   7367  C  CB    . VAL C  3  162 ? -3.739  32.463  -23.590 1.00 54.72  ? 162 VAL C CB    1 
ATOM   7368  C  CG1   . VAL C  3  162 ? -4.534  31.382  -22.859 1.00 52.24  ? 162 VAL C CG1   1 
ATOM   7369  C  CG2   . VAL C  3  162 ? -4.663  33.589  -24.011 1.00 54.49  ? 162 VAL C CG2   1 
ATOM   7370  N  N     . SER C  3  163 ? -1.005  31.187  -22.799 1.00 58.15  ? 163 SER C N     1 
ATOM   7371  C  CA    . SER C  3  163 ? -0.234  30.088  -22.216 1.00 60.02  ? 163 SER C CA    1 
ATOM   7372  C  C     . SER C  3  163 ? 0.743   30.662  -21.168 1.00 59.73  ? 163 SER C C     1 
ATOM   7373  O  O     . SER C  3  163 ? 1.128   29.982  -20.205 1.00 58.75  ? 163 SER C O     1 
ATOM   7374  C  CB    . SER C  3  163 ? 0.501   29.281  -23.304 1.00 60.58  ? 163 SER C CB    1 
ATOM   7375  O  OG    . SER C  3  163 ? 1.609   29.991  -23.840 1.00 64.66  ? 163 SER C OG    1 
ATOM   7376  N  N     . TRP C  3  164 ? 1.115   31.925  -21.371 1.00 58.96  ? 164 TRP C N     1 
ATOM   7377  C  CA    . TRP C  3  164 ? 1.995   32.652  -20.464 1.00 58.62  ? 164 TRP C CA    1 
ATOM   7378  C  C     . TRP C  3  164 ? 1.214   32.868  -19.158 1.00 59.18  ? 164 TRP C C     1 
ATOM   7379  O  O     . TRP C  3  164 ? 1.637   32.413  -18.095 1.00 61.20  ? 164 TRP C O     1 
ATOM   7380  C  CB    . TRP C  3  164 ? 2.383   33.998  -21.087 1.00 57.63  ? 164 TRP C CB    1 
ATOM   7381  C  CG    . TRP C  3  164 ? 3.187   34.897  -20.192 1.00 58.49  ? 164 TRP C CG    1 
ATOM   7382  C  CD1   . TRP C  3  164 ? 4.487   34.720  -19.804 1.00 59.27  ? 164 TRP C CD1   1 
ATOM   7383  C  CD2   . TRP C  3  164 ? 2.755   36.129  -19.591 1.00 57.92  ? 164 TRP C CD2   1 
ATOM   7384  N  NE1   . TRP C  3  164 ? 4.890   35.765  -19.002 1.00 58.95  ? 164 TRP C NE1   1 
ATOM   7385  C  CE2   . TRP C  3  164 ? 3.848   36.642  -18.855 1.00 57.58  ? 164 TRP C CE2   1 
ATOM   7386  C  CE3   . TRP C  3  164 ? 1.553   36.849  -19.604 1.00 58.54  ? 164 TRP C CE3   1 
ATOM   7387  C  CZ2   . TRP C  3  164 ? 3.774   37.840  -18.141 1.00 56.53  ? 164 TRP C CZ2   1 
ATOM   7388  C  CZ3   . TRP C  3  164 ? 1.480   38.045  -18.891 1.00 57.69  ? 164 TRP C CZ3   1 
ATOM   7389  C  CH2   . TRP C  3  164 ? 2.585   38.525  -18.171 1.00 56.97  ? 164 TRP C CH2   1 
ATOM   7390  N  N     . LEU C  3  165 ? 0.050   33.511  -19.262 1.00 58.04  ? 165 LEU C N     1 
ATOM   7391  C  CA    . LEU C  3  165 ? -0.815  33.776  -18.112 1.00 57.32  ? 165 LEU C CA    1 
ATOM   7392  C  C     . LEU C  3  165 ? -1.124  32.518  -17.300 1.00 57.08  ? 165 LEU C C     1 
ATOM   7393  O  O     . LEU C  3  165 ? -1.198  32.567  -16.073 1.00 57.84  ? 165 LEU C O     1 
ATOM   7394  C  CB    . LEU C  3  165 ? -2.132  34.420  -18.569 1.00 57.49  ? 165 LEU C CB    1 
ATOM   7395  C  CG    . LEU C  3  165 ? -2.185  35.941  -18.740 1.00 57.83  ? 165 LEU C CG    1 
ATOM   7396  C  CD1   . LEU C  3  165 ? -3.374  36.340  -19.592 1.00 57.46  ? 165 LEU C CD1   1 
ATOM   7397  C  CD2   . LEU C  3  165 ? -2.243  36.609  -17.382 1.00 58.09  ? 165 LEU C CD2   1 
ATOM   7398  N  N     . TRP C  3  166 ? -1.296  31.395  -17.988 1.00 56.31  ? 166 TRP C N     1 
ATOM   7399  C  CA    . TRP C  3  166 ? -1.607  30.122  -17.341 1.00 56.76  ? 166 TRP C CA    1 
ATOM   7400  C  C     . TRP C  3  166 ? -0.388  29.508  -16.685 1.00 55.25  ? 166 TRP C C     1 
ATOM   7401  O  O     . TRP C  3  166 ? -0.502  28.821  -15.669 1.00 51.70  ? 166 TRP C O     1 
ATOM   7402  C  CB    . TRP C  3  166 ? -2.128  29.107  -18.363 1.00 59.93  ? 166 TRP C CB    1 
ATOM   7403  C  CG    . TRP C  3  166 ? -3.548  29.283  -18.801 1.00 62.41  ? 166 TRP C CG    1 
ATOM   7404  C  CD1   . TRP C  3  166 ? -4.510  30.063  -18.218 1.00 63.87  ? 166 TRP C CD1   1 
ATOM   7405  C  CD2   . TRP C  3  166 ? -4.176  28.631  -19.908 1.00 62.89  ? 166 TRP C CD2   1 
ATOM   7406  N  NE1   . TRP C  3  166 ? -5.700  29.932  -18.898 1.00 63.59  ? 166 TRP C NE1   1 
ATOM   7407  C  CE2   . TRP C  3  166 ? -5.521  29.059  -19.939 1.00 62.85  ? 166 TRP C CE2   1 
ATOM   7408  C  CE3   . TRP C  3  166 ? -3.730  27.724  -20.876 1.00 63.89  ? 166 TRP C CE3   1 
ATOM   7409  C  CZ2   . TRP C  3  166 ? -6.426  28.610  -20.901 1.00 64.12  ? 166 TRP C CZ2   1 
ATOM   7410  C  CZ3   . TRP C  3  166 ? -4.628  27.276  -21.833 1.00 66.04  ? 166 TRP C CZ3   1 
ATOM   7411  C  CH2   . TRP C  3  166 ? -5.965  27.722  -21.837 1.00 65.97  ? 166 TRP C CH2   1 
ATOM   7412  N  N     . GLY C  3  167 ? 0.768   29.730  -17.302 1.00 54.93  ? 167 GLY C N     1 
ATOM   7413  C  CA    . GLY C  3  167 ? 1.996   29.159  -16.795 1.00 57.15  ? 167 GLY C CA    1 
ATOM   7414  C  C     . GLY C  3  167 ? 2.023   27.678  -17.132 1.00 59.64  ? 167 GLY C C     1 
ATOM   7415  O  O     . GLY C  3  167 ? 2.626   26.878  -16.416 1.00 59.74  ? 167 GLY C O     1 
ATOM   7416  N  N     . GLY C  3  168 ? 1.347   27.313  -18.221 1.00 62.30  ? 168 GLY C N     1 
ATOM   7417  C  CA    . GLY C  3  168 ? 1.302   25.925  -18.642 1.00 64.58  ? 168 GLY C CA    1 
ATOM   7418  C  C     . GLY C  3  168 ? 0.318   25.620  -19.757 1.00 66.46  ? 168 GLY C C     1 
ATOM   7419  O  O     . GLY C  3  168 ? -0.109  26.512  -20.496 1.00 64.57  ? 168 GLY C O     1 
ATOM   7420  N  N     . PHE C  3  169 ? -0.052  24.342  -19.849 1.00 69.42  ? 169 PHE C N     1 
ATOM   7421  C  CA    . PHE C  3  169 ? -0.978  23.836  -20.866 1.00 71.57  ? 169 PHE C CA    1 
ATOM   7422  C  C     . PHE C  3  169 ? -2.436  24.250  -20.666 1.00 71.39  ? 169 PHE C C     1 
ATOM   7423  O  O     . PHE C  3  169 ? -3.193  24.343  -21.636 1.00 72.93  ? 169 PHE C O     1 
ATOM   7424  C  CB    . PHE C  3  169 ? -0.908  22.302  -20.934 1.00 74.00  ? 169 PHE C CB    1 
ATOM   7425  C  CG    . PHE C  3  169 ? 0.361   21.768  -21.551 1.00 77.73  ? 169 PHE C CG    1 
ATOM   7426  C  CD1   . PHE C  3  169 ? 1.053   22.500  -22.520 1.00 79.43  ? 169 PHE C CD1   1 
ATOM   7427  C  CD2   . PHE C  3  169 ? 0.848   20.511  -21.187 1.00 79.06  ? 169 PHE C CD2   1 
ATOM   7428  C  CE1   . PHE C  3  169 ? 2.216   21.988  -23.118 1.00 80.39  ? 169 PHE C CE1   1 
ATOM   7429  C  CE2   . PHE C  3  169 ? 2.006   19.989  -21.777 1.00 80.28  ? 169 PHE C CE2   1 
ATOM   7430  C  CZ    . PHE C  3  169 ? 2.690   20.729  -22.747 1.00 80.36  ? 169 PHE C CZ    1 
ATOM   7431  N  N     . SER C  3  170 ? -2.828  24.476  -19.414 1.00 69.03  ? 170 SER C N     1 
ATOM   7432  C  CA    . SER C  3  170 ? -4.202  24.864  -19.094 1.00 67.52  ? 170 SER C CA    1 
ATOM   7433  C  C     . SER C  3  170 ? -4.269  25.487  -17.708 1.00 65.24  ? 170 SER C C     1 
ATOM   7434  O  O     . SER C  3  170 ? -3.236  25.665  -17.058 1.00 65.07  ? 170 SER C O     1 
ATOM   7435  C  CB    . SER C  3  170 ? -5.114  23.632  -19.124 1.00 68.95  ? 170 SER C CB    1 
ATOM   7436  O  OG    . SER C  3  170 ? -4.727  22.694  -18.128 1.00 70.14  ? 170 SER C OG    1 
ATOM   7437  N  N     . VAL C  3  171 ? -5.477  25.837  -17.266 1.00 62.20  ? 171 VAL C N     1 
ATOM   7438  C  CA    . VAL C  3  171 ? -5.654  26.408  -15.936 1.00 60.06  ? 171 VAL C CA    1 
ATOM   7439  C  C     . VAL C  3  171 ? -5.257  25.286  -14.986 1.00 59.41  ? 171 VAL C C     1 
ATOM   7440  O  O     . VAL C  3  171 ? -5.924  24.251  -14.919 1.00 59.81  ? 171 VAL C O     1 
ATOM   7441  C  CB    . VAL C  3  171 ? -7.115  26.869  -15.691 1.00 59.21  ? 171 VAL C CB    1 
ATOM   7442  C  CG1   . VAL C  3  171 ? -7.357  27.136  -14.208 1.00 55.56  ? 171 VAL C CG1   1 
ATOM   7443  C  CG2   . VAL C  3  171 ? -7.392  28.133  -16.493 1.00 58.39  ? 171 VAL C CG2   1 
ATOM   7444  N  N     . SER C  3  172 ? -4.134  25.489  -14.298 1.00 58.40  ? 172 SER C N     1 
ATOM   7445  C  CA    . SER C  3  172 ? -3.573  24.500  -13.385 1.00 56.84  ? 172 SER C CA    1 
ATOM   7446  C  C     . SER C  3  172 ? -2.943  25.112  -12.126 1.00 55.99  ? 172 SER C C     1 
ATOM   7447  O  O     . SER C  3  172 ? -3.240  26.259  -11.764 1.00 55.40  ? 172 SER C O     1 
ATOM   7448  C  CB    . SER C  3  172 ? -2.524  23.692  -14.146 1.00 58.06  ? 172 SER C CB    1 
ATOM   7449  O  OG    . SER C  3  172 ? -1.665  24.566  -14.875 1.00 57.46  ? 172 SER C OG    1 
ATOM   7450  N  N     . ASN C  3  173 ? -2.055  24.346  -11.481 1.00 53.59  ? 173 ASN C N     1 
ATOM   7451  C  CA    . ASN C  3  173 ? -1.383  24.794  -10.262 1.00 51.35  ? 173 ASN C CA    1 
ATOM   7452  C  C     . ASN C  3  173 ? -0.536  26.071  -10.389 1.00 50.71  ? 173 ASN C C     1 
ATOM   7453  O  O     . ASN C  3  173 ? -0.223  26.702  -9.378  1.00 52.21  ? 173 ASN C O     1 
ATOM   7454  C  CB    . ASN C  3  173 ? -0.573  23.670  -9.596  1.00 48.50  ? 173 ASN C CB    1 
ATOM   7455  C  CG    . ASN C  3  173 ? -0.049  24.078  -8.225  1.00 45.65  ? 173 ASN C CG    1 
ATOM   7456  O  OD1   . ASN C  3  173 ? 1.149   24.280  -8.044  1.00 43.54  ? 173 ASN C OD1   1 
ATOM   7457  N  ND2   . ASN C  3  173 ? -0.961  24.297  -7.282  1.00 43.97  ? 173 ASN C ND2   1 
ATOM   7458  N  N     . PRO C  3  174 ? -0.017  26.379  -11.584 1.00 47.92  ? 174 PRO C N     1 
ATOM   7459  C  CA    . PRO C  3  174 ? 0.753   27.621  -11.647 1.00 45.89  ? 174 PRO C CA    1 
ATOM   7460  C  C     . PRO C  3  174 ? -0.223  28.802  -11.763 1.00 45.65  ? 174 PRO C C     1 
ATOM   7461  O  O     . PRO C  3  174 ? 0.084   29.910  -11.339 1.00 45.92  ? 174 PRO C O     1 
ATOM   7462  C  CB    . PRO C  3  174 ? 1.568   27.446  -12.925 1.00 45.10  ? 174 PRO C CB    1 
ATOM   7463  C  CG    . PRO C  3  174 ? 1.804   25.999  -12.960 1.00 47.48  ? 174 PRO C CG    1 
ATOM   7464  C  CD    . PRO C  3  174 ? 0.443   25.449  -12.626 1.00 48.24  ? 174 PRO C CD    1 
ATOM   7465  N  N     . THR C  3  175 ? -1.421  28.531  -12.279 1.00 43.76  ? 175 THR C N     1 
ATOM   7466  C  CA    . THR C  3  175 ? -2.448  29.550  -12.473 1.00 43.30  ? 175 THR C CA    1 
ATOM   7467  C  C     . THR C  3  175 ? -3.045  30.076  -11.162 1.00 42.25  ? 175 THR C C     1 
ATOM   7468  O  O     . THR C  3  175 ? -2.930  31.261  -10.865 1.00 44.13  ? 175 THR C O     1 
ATOM   7469  C  CB    . THR C  3  175 ? -3.589  29.019  -13.382 1.00 43.42  ? 175 THR C CB    1 
ATOM   7470  O  OG1   . THR C  3  175 ? -3.018  28.341  -14.505 1.00 45.96  ? 175 THR C OG1   1 
ATOM   7471  C  CG2   . THR C  3  175 ? -4.461  30.168  -13.895 1.00 40.53  ? 175 THR C CG2   1 
ATOM   7472  N  N     . ILE C  3  176 ? -3.703  29.200  -10.410 1.00 39.30  ? 176 ILE C N     1 
ATOM   7473  C  CA    . ILE C  3  176 ? -4.324  29.537  -9.124  1.00 39.93  ? 176 ILE C CA    1 
ATOM   7474  C  C     . ILE C  3  176 ? -3.374  30.147  -8.076  1.00 40.70  ? 176 ILE C C     1 
ATOM   7475  O  O     . ILE C  3  176 ? -3.789  30.981  -7.268  1.00 42.18  ? 176 ILE C O     1 
ATOM   7476  C  CB    . ILE C  3  176 ? -5.035  28.287  -8.505  1.00 39.95  ? 176 ILE C CB    1 
ATOM   7477  C  CG1   . ILE C  3  176 ? -5.953  27.636  -9.548  1.00 39.16  ? 176 ILE C CG1   1 
ATOM   7478  C  CG2   . ILE C  3  176 ? -5.881  28.689  -7.301  1.00 38.21  ? 176 ILE C CG2   1 
ATOM   7479  C  CD1   . ILE C  3  176 ? -7.033  28.560  -10.104 1.00 37.94  ? 176 ILE C CD1   1 
ATOM   7480  N  N     . GLN C  3  177 ? -2.114  29.717  -8.073  1.00 39.98  ? 177 GLN C N     1 
ATOM   7481  C  CA    . GLN C  3  177 ? -1.133  30.230  -7.134  1.00 39.75  ? 177 GLN C CA    1 
ATOM   7482  C  C     . GLN C  3  177 ? -0.740  31.650  -7.516  1.00 40.34  ? 177 GLN C C     1 
ATOM   7483  O  O     . GLN C  3  177 ? -0.543  32.478  -6.629  1.00 43.51  ? 177 GLN C O     1 
ATOM   7484  C  CB    . GLN C  3  177 ? 0.102   29.320  -7.037  1.00 38.02  ? 177 GLN C CB    1 
ATOM   7485  C  CG    . GLN C  3  177 ? -0.196  27.951  -6.438  1.00 39.59  ? 177 GLN C CG    1 
ATOM   7486  C  CD    . GLN C  3  177 ? 0.989   27.334  -5.679  1.00 40.22  ? 177 GLN C CD    1 
ATOM   7487  O  OE1   . GLN C  3  177 ? 1.912   26.781  -6.280  1.00 40.41  ? 177 GLN C OE1   1 
ATOM   7488  N  NE2   . GLN C  3  177 ? 0.942   27.400  -4.351  1.00 36.46  ? 177 GLN C NE2   1 
ATOM   7489  N  N     . ARG C  3  178 ? -0.635  31.947  -8.814  1.00 37.30  ? 178 ARG C N     1 
ATOM   7490  C  CA    . ARG C  3  178 ? -0.287  33.314  -9.218  1.00 36.59  ? 178 ARG C CA    1 
ATOM   7491  C  C     . ARG C  3  178 ? -1.510  34.217  -9.046  1.00 35.21  ? 178 ARG C C     1 
ATOM   7492  O  O     . ARG C  3  178 ? -1.388  35.416  -8.766  1.00 34.69  ? 178 ARG C O     1 
ATOM   7493  C  CB    . ARG C  3  178 ? 0.247   33.392  -10.655 1.00 36.69  ? 178 ARG C CB    1 
ATOM   7494  C  CG    . ARG C  3  178 ? -0.787  33.246  -11.758 1.00 38.23  ? 178 ARG C CG    1 
ATOM   7495  C  CD    . ARG C  3  178 ? -0.100  33.081  -13.103 1.00 41.40  ? 178 ARG C CD    1 
ATOM   7496  N  NE    . ARG C  3  178 ? 0.962   32.068  -13.045 1.00 44.48  ? 178 ARG C NE    1 
ATOM   7497  C  CZ    . ARG C  3  178 ? 1.866   31.849  -14.001 1.00 46.12  ? 178 ARG C CZ    1 
ATOM   7498  N  NH1   . ARG C  3  178 ? 2.788   30.916  -13.830 1.00 40.77  ? 178 ARG C NH1   1 
ATOM   7499  N  NH2   . ARG C  3  178 ? 1.835   32.540  -15.141 1.00 47.01  ? 178 ARG C NH2   1 
ATOM   7500  N  N     . PHE C  3  179 ? -2.690  33.623  -9.161  1.00 32.66  ? 179 PHE C N     1 
ATOM   7501  C  CA    . PHE C  3  179 ? -3.913  34.382  -8.986  1.00 33.57  ? 179 PHE C CA    1 
ATOM   7502  C  C     . PHE C  3  179 ? -4.048  34.809  -7.524  1.00 32.58  ? 179 PHE C C     1 
ATOM   7503  O  O     . PHE C  3  179 ? -4.477  35.924  -7.252  1.00 31.97  ? 179 PHE C O     1 
ATOM   7504  C  CB    . PHE C  3  179 ? -5.151  33.598  -9.474  1.00 35.26  ? 179 PHE C CB    1 
ATOM   7505  C  CG    . PHE C  3  179 ? -5.365  33.660  -10.962 1.00 37.74  ? 179 PHE C CG    1 
ATOM   7506  C  CD1   . PHE C  3  179 ? -4.377  34.166  -11.806 1.00 42.40  ? 179 PHE C CD1   1 
ATOM   7507  C  CD2   . PHE C  3  179 ? -6.549  33.199  -11.525 1.00 41.63  ? 179 PHE C CD2   1 
ATOM   7508  C  CE1   . PHE C  3  179 ? -4.558  34.215  -13.206 1.00 42.72  ? 179 PHE C CE1   1 
ATOM   7509  C  CE2   . PHE C  3  179 ? -6.752  33.240  -12.917 1.00 42.41  ? 179 PHE C CE2   1 
ATOM   7510  C  CZ    . PHE C  3  179 ? -5.748  33.750  -13.757 1.00 42.85  ? 179 PHE C CZ    1 
ATOM   7511  N  N     . PHE C  3  180 ? -3.655  33.948  -6.587  1.00 32.21  ? 180 PHE C N     1 
ATOM   7512  C  CA    . PHE C  3  180 ? -3.724  34.319  -5.173  1.00 33.13  ? 180 PHE C CA    1 
ATOM   7513  C  C     . PHE C  3  180 ? -2.741  35.454  -4.865  1.00 32.73  ? 180 PHE C C     1 
ATOM   7514  O  O     . PHE C  3  180 ? -3.074  36.427  -4.171  1.00 32.05  ? 180 PHE C O     1 
ATOM   7515  C  CB    . PHE C  3  180 ? -3.416  33.142  -4.243  1.00 31.33  ? 180 PHE C CB    1 
ATOM   7516  C  CG    . PHE C  3  180 ? -3.273  33.552  -2.803  1.00 27.77  ? 180 PHE C CG    1 
ATOM   7517  C  CD1   . PHE C  3  180 ? -2.060  33.416  -2.145  1.00 26.54  ? 180 PHE C CD1   1 
ATOM   7518  C  CD2   . PHE C  3  180 ? -4.332  34.160  -2.135  1.00 27.13  ? 180 PHE C CD2   1 
ATOM   7519  C  CE1   . PHE C  3  180 ? -1.902  33.889  -0.842  1.00 28.16  ? 180 PHE C CE1   1 
ATOM   7520  C  CE2   . PHE C  3  180 ? -4.182  34.635  -0.834  1.00 26.94  ? 180 PHE C CE2   1 
ATOM   7521  C  CZ    . PHE C  3  180 ? -2.970  34.502  -0.190  1.00 26.48  ? 180 PHE C CZ    1 
ATOM   7522  N  N     . ALA C  3  181 ? -1.524  35.308  -5.366  1.00 32.01  ? 181 ALA C N     1 
ATOM   7523  C  CA    . ALA C  3  181 ? -0.503  36.326  -5.168  1.00 33.95  ? 181 ALA C CA    1 
ATOM   7524  C  C     . ALA C  3  181 ? -1.026  37.666  -5.699  1.00 35.54  ? 181 ALA C C     1 
ATOM   7525  O  O     . ALA C  3  181 ? -0.916  38.695  -5.037  1.00 37.64  ? 181 ALA C O     1 
ATOM   7526  C  CB    . ALA C  3  181 ? 0.773   35.928  -5.896  1.00 31.92  ? 181 ALA C CB    1 
ATOM   7527  N  N     . LEU C  3  182 ? -1.648  37.626  -6.873  1.00 34.46  ? 182 LEU C N     1 
ATOM   7528  C  CA    . LEU C  3  182 ? -2.182  38.815  -7.497  1.00 31.58  ? 182 LEU C CA    1 
ATOM   7529  C  C     . LEU C  3  182 ? -3.403  39.389  -6.770  1.00 31.80  ? 182 LEU C C     1 
ATOM   7530  O  O     . LEU C  3  182 ? -3.571  40.605  -6.707  1.00 33.32  ? 182 LEU C O     1 
ATOM   7531  C  CB    . LEU C  3  182 ? -2.504  38.503  -8.960  1.00 31.65  ? 182 LEU C CB    1 
ATOM   7532  C  CG    . LEU C  3  182 ? -1.580  39.067  -10.050 1.00 32.16  ? 182 LEU C CG    1 
ATOM   7533  C  CD1   . LEU C  3  182 ? -0.276  39.544  -9.468  1.00 27.06  ? 182 LEU C CD1   1 
ATOM   7534  C  CD2   . LEU C  3  182 ? -1.348  38.035  -11.139 1.00 28.37  ? 182 LEU C CD2   1 
ATOM   7535  N  N     . HIS C  3  183 ? -4.246  38.528  -6.210  1.00 28.48  ? 183 HIS C N     1 
ATOM   7536  C  CA    . HIS C  3  183 ? -5.446  38.989  -5.510  1.00 27.39  ? 183 HIS C CA    1 
ATOM   7537  C  C     . HIS C  3  183 ? -5.088  39.785  -4.262  1.00 29.84  ? 183 HIS C C     1 
ATOM   7538  O  O     . HIS C  3  183 ? -5.839  40.660  -3.818  1.00 32.65  ? 183 HIS C O     1 
ATOM   7539  C  CB    . HIS C  3  183 ? -6.324  37.794  -5.115  1.00 26.89  ? 183 HIS C CB    1 
ATOM   7540  C  CG    . HIS C  3  183 ? -7.592  38.172  -4.407  1.00 29.37  ? 183 HIS C CG    1 
ATOM   7541  N  ND1   . HIS C  3  183 ? -8.497  39.096  -4.888  1.00 30.60  ? 183 HIS C ND1   1 
ATOM   7542  C  CD2   . HIS C  3  183 ? -8.095  37.747  -3.217  1.00 27.06  ? 183 HIS C CD2   1 
ATOM   7543  C  CE1   . HIS C  3  183 ? -9.490  39.205  -3.995  1.00 29.47  ? 183 HIS C CE1   1 
ATOM   7544  N  NE2   . HIS C  3  183 ? -9.291  38.407  -2.966  1.00 28.97  ? 183 HIS C NE2   1 
ATOM   7545  N  N     . TYR C  3  184 ? -3.938  39.460  -3.688  1.00 30.02  ? 184 TYR C N     1 
ATOM   7546  C  CA    . TYR C  3  184 ? -3.462  40.114  -2.483  1.00 27.89  ? 184 TYR C CA    1 
ATOM   7547  C  C     . TYR C  3  184 ? -2.879  41.472  -2.857  1.00 27.44  ? 184 TYR C C     1 
ATOM   7548  O  O     . TYR C  3  184 ? -3.089  42.436  -2.154  1.00 27.15  ? 184 TYR C O     1 
ATOM   7549  C  CB    . TYR C  3  184 ? -2.375  39.225  -1.856  1.00 30.00  ? 184 TYR C CB    1 
ATOM   7550  C  CG    . TYR C  3  184 ? -2.093  39.419  -0.377  1.00 31.39  ? 184 TYR C CG    1 
ATOM   7551  C  CD1   . TYR C  3  184 ? -1.934  38.318  0.471   1.00 31.58  ? 184 TYR C CD1   1 
ATOM   7552  C  CD2   . TYR C  3  184 ? -1.940  40.692  0.167   1.00 33.83  ? 184 TYR C CD2   1 
ATOM   7553  C  CE1   . TYR C  3  184 ? -1.626  38.486  1.820   1.00 33.60  ? 184 TYR C CE1   1 
ATOM   7554  C  CE2   . TYR C  3  184 ? -1.636  40.873  1.504   1.00 34.14  ? 184 TYR C CE2   1 
ATOM   7555  C  CZ    . TYR C  3  184 ? -1.481  39.770  2.327   1.00 35.10  ? 184 TYR C CZ    1 
ATOM   7556  O  OH    . TYR C  3  184 ? -1.207  39.972  3.651   1.00 33.90  ? 184 TYR C OH    1 
ATOM   7557  N  N     . LEU C  3  185 ? -2.179  41.543  -3.986  1.00 27.81  ? 185 LEU C N     1 
ATOM   7558  C  CA    . LEU C  3  185 ? -1.524  42.772  -4.440  1.00 28.17  ? 185 LEU C CA    1 
ATOM   7559  C  C     . LEU C  3  185 ? -2.439  43.897  -4.877  1.00 30.33  ? 185 LEU C C     1 
ATOM   7560  O  O     . LEU C  3  185 ? -2.332  45.010  -4.377  1.00 31.52  ? 185 LEU C O     1 
ATOM   7561  C  CB    . LEU C  3  185 ? -0.582  42.471  -5.611  1.00 28.26  ? 185 LEU C CB    1 
ATOM   7562  C  CG    . LEU C  3  185 ? 0.572   43.412  -6.014  1.00 31.55  ? 185 LEU C CG    1 
ATOM   7563  C  CD1   . LEU C  3  185 ? 0.599   43.575  -7.516  1.00 25.18  ? 185 LEU C CD1   1 
ATOM   7564  C  CD2   . LEU C  3  185 ? 0.505   44.771  -5.334  1.00 29.60  ? 185 LEU C CD2   1 
ATOM   7565  N  N     . VAL C  3  186 ? -3.337  43.603  -5.809  1.00 30.75  ? 186 VAL C N     1 
ATOM   7566  C  CA    . VAL C  3  186 ? -4.206  44.623  -6.371  1.00 31.42  ? 186 VAL C CA    1 
ATOM   7567  C  C     . VAL C  3  186 ? -4.980  45.544  -5.417  1.00 32.95  ? 186 VAL C C     1 
ATOM   7568  O  O     . VAL C  3  186 ? -5.085  46.746  -5.689  1.00 35.03  ? 186 VAL C O     1 
ATOM   7569  C  CB    . VAL C  3  186 ? -5.100  44.035  -7.499  1.00 33.00  ? 186 VAL C CB    1 
ATOM   7570  C  CG1   . VAL C  3  186 ? -5.807  45.154  -8.273  1.00 29.39  ? 186 VAL C CG1   1 
ATOM   7571  C  CG2   . VAL C  3  186 ? -4.236  43.193  -8.445  1.00 30.35  ? 186 VAL C CG2   1 
ATOM   7572  N  N     . PRO C  3  187 ? -5.522  45.017  -4.298  1.00 32.11  ? 187 PRO C N     1 
ATOM   7573  C  CA    . PRO C  3  187 ? -6.258  45.893  -3.372  1.00 30.70  ? 187 PRO C CA    1 
ATOM   7574  C  C     . PRO C  3  187 ? -5.428  47.087  -2.876  1.00 32.02  ? 187 PRO C C     1 
ATOM   7575  O  O     . PRO C  3  187 ? -5.975  48.169  -2.666  1.00 34.42  ? 187 PRO C O     1 
ATOM   7576  C  CB    . PRO C  3  187 ? -6.632  44.953  -2.239  1.00 29.83  ? 187 PRO C CB    1 
ATOM   7577  C  CG    . PRO C  3  187 ? -6.875  43.674  -2.966  1.00 30.40  ? 187 PRO C CG    1 
ATOM   7578  C  CD    . PRO C  3  187 ? -5.696  43.607  -3.913  1.00 30.81  ? 187 PRO C CD    1 
ATOM   7579  N  N     . PHE C  3  188 ? -4.117  46.909  -2.724  1.00 29.63  ? 188 PHE C N     1 
ATOM   7580  C  CA    . PHE C  3  188 ? -3.248  48.013  -2.295  1.00 32.15  ? 188 PHE C CA    1 
ATOM   7581  C  C     . PHE C  3  188 ? -3.015  49.038  -3.414  1.00 32.96  ? 188 PHE C C     1 
ATOM   7582  O  O     . PHE C  3  188 ? -2.650  50.188  -3.155  1.00 31.63  ? 188 PHE C O     1 
ATOM   7583  C  CB    . PHE C  3  188 ? -1.917  47.497  -1.754  1.00 32.20  ? 188 PHE C CB    1 
ATOM   7584  C  CG    . PHE C  3  188 ? -2.059  46.687  -0.508  1.00 34.66  ? 188 PHE C CG    1 
ATOM   7585  C  CD1   . PHE C  3  188 ? -2.141  45.299  -0.566  1.00 33.35  ? 188 PHE C CD1   1 
ATOM   7586  C  CD2   . PHE C  3  188 ? -2.140  47.312  0.729   1.00 36.45  ? 188 PHE C CD2   1 
ATOM   7587  C  CE1   . PHE C  3  188 ? -2.305  44.551  0.592   1.00 34.55  ? 188 PHE C CE1   1 
ATOM   7588  C  CE2   . PHE C  3  188 ? -2.303  46.565  1.890   1.00 37.43  ? 188 PHE C CE2   1 
ATOM   7589  C  CZ    . PHE C  3  188 ? -2.386  45.183  1.815   1.00 35.22  ? 188 PHE C CZ    1 
ATOM   7590  N  N     . ILE C  3  189 ? -3.215  48.615  -4.658  1.00 33.56  ? 189 ILE C N     1 
ATOM   7591  C  CA    . ILE C  3  189 ? -3.088  49.528  -5.788  1.00 32.32  ? 189 ILE C CA    1 
ATOM   7592  C  C     . ILE C  3  189 ? -4.391  50.341  -5.830  1.00 32.05  ? 189 ILE C C     1 
ATOM   7593  O  O     . ILE C  3  189 ? -4.365  51.545  -6.076  1.00 30.29  ? 189 ILE C O     1 
ATOM   7594  C  CB    . ILE C  3  189 ? -2.840  48.759  -7.115  1.00 33.22  ? 189 ILE C CB    1 
ATOM   7595  C  CG1   . ILE C  3  189 ? -1.474  48.061  -7.026  1.00 33.25  ? 189 ILE C CG1   1 
ATOM   7596  C  CG2   . ILE C  3  189 ? -2.875  49.707  -8.310  1.00 26.75  ? 189 ILE C CG2   1 
ATOM   7597  C  CD1   . ILE C  3  189 ? -1.028  47.338  -8.276  1.00 35.60  ? 189 ILE C CD1   1 
ATOM   7598  N  N     . ILE C  3  190 ? -5.512  49.702  -5.485  1.00 29.69  ? 190 ILE C N     1 
ATOM   7599  C  CA    . ILE C  3  190 ? -6.795  50.402  -5.463  1.00 28.80  ? 190 ILE C CA    1 
ATOM   7600  C  C     . ILE C  3  190 ? -6.736  51.504  -4.390  1.00 30.08  ? 190 ILE C C     1 
ATOM   7601  O  O     . ILE C  3  190 ? -7.237  52.624  -4.591  1.00 28.33  ? 190 ILE C O     1 
ATOM   7602  C  CB    . ILE C  3  190 ? -7.991  49.437  -5.159  1.00 28.36  ? 190 ILE C CB    1 
ATOM   7603  C  CG1   . ILE C  3  190 ? -8.207  48.467  -6.320  1.00 26.93  ? 190 ILE C CG1   1 
ATOM   7604  C  CG2   . ILE C  3  190 ? -9.287  50.228  -4.884  1.00 23.53  ? 190 ILE C CG2   1 
ATOM   7605  C  CD1   . ILE C  3  190 ? -9.289  47.400  -6.051  1.00 28.19  ? 190 ILE C CD1   1 
ATOM   7606  N  N     . ALA C  3  191 ? -6.119  51.176  -3.258  1.00 28.70  ? 191 ALA C N     1 
ATOM   7607  C  CA    . ALA C  3  191 ? -5.980  52.117  -2.151  1.00 29.32  ? 191 ALA C CA    1 
ATOM   7608  C  C     . ALA C  3  191 ? -5.220  53.358  -2.585  1.00 28.51  ? 191 ALA C C     1 
ATOM   7609  O  O     . ALA C  3  191 ? -5.600  54.474  -2.237  1.00 29.91  ? 191 ALA C O     1 
ATOM   7610  C  CB    . ALA C  3  191 ? -5.258  51.452  -0.956  1.00 28.97  ? 191 ALA C CB    1 
ATOM   7611  N  N     . ALA C  3  192 ? -4.120  53.154  -3.304  1.00 27.74  ? 192 ALA C N     1 
ATOM   7612  C  CA    . ALA C  3  192 ? -3.305  54.260  -3.795  1.00 26.66  ? 192 ALA C CA    1 
ATOM   7613  C  C     . ALA C  3  192 ? -4.111  55.057  -4.811  1.00 27.07  ? 192 ALA C C     1 
ATOM   7614  O  O     . ALA C  3  192 ? -4.086  56.282  -4.800  1.00 29.26  ? 192 ALA C O     1 
ATOM   7615  C  CB    . ALA C  3  192 ? -2.024  53.739  -4.416  1.00 23.80  ? 192 ALA C CB    1 
ATOM   7616  N  N     . MET C  3  193 ? -4.864  54.356  -5.654  1.00 28.52  ? 193 MET C N     1 
ATOM   7617  C  CA    . MET C  3  193 ? -5.712  55.007  -6.635  1.00 29.42  ? 193 MET C CA    1 
ATOM   7618  C  C     . MET C  3  193 ? -6.821  55.785  -5.921  1.00 29.56  ? 193 MET C C     1 
ATOM   7619  O  O     . MET C  3  193 ? -7.194  56.868  -6.356  1.00 30.92  ? 193 MET C O     1 
ATOM   7620  C  CB    . MET C  3  193 ? -6.289  53.981  -7.612  1.00 36.06  ? 193 MET C CB    1 
ATOM   7621  C  CG    . MET C  3  193 ? -5.266  53.442  -8.649  1.00 40.36  ? 193 MET C CG    1 
ATOM   7622  S  SD    . MET C  3  193 ? -4.701  54.725  -9.813  1.00 46.06  ? 193 MET C SD    1 
ATOM   7623  C  CE    . MET C  3  193 ? -3.087  55.049  -9.218  1.00 44.52  ? 193 MET C CE    1 
ATOM   7624  N  N     . VAL C  3  194 ? -7.333  55.255  -4.814  1.00 28.07  ? 194 VAL C N     1 
ATOM   7625  C  CA    . VAL C  3  194 ? -8.359  55.967  -4.061  1.00 28.11  ? 194 VAL C CA    1 
ATOM   7626  C  C     . VAL C  3  194 ? -7.804  57.279  -3.490  1.00 30.03  ? 194 VAL C C     1 
ATOM   7627  O  O     . VAL C  3  194 ? -8.525  58.271  -3.361  1.00 30.14  ? 194 VAL C O     1 
ATOM   7628  C  CB    . VAL C  3  194 ? -8.979  55.090  -2.924  1.00 28.34  ? 194 VAL C CB    1 
ATOM   7629  C  CG1   . VAL C  3  194 ? -9.769  55.960  -1.922  1.00 21.91  ? 194 VAL C CG1   1 
ATOM   7630  C  CG2   . VAL C  3  194 ? -9.926  54.059  -3.538  1.00 23.05  ? 194 VAL C CG2   1 
ATOM   7631  N  N     . ILE C  3  195 ? -6.515  57.303  -3.177  1.00 32.43  ? 195 ILE C N     1 
ATOM   7632  C  CA    . ILE C  3  195 ? -5.908  58.523  -2.648  1.00 34.38  ? 195 ILE C CA    1 
ATOM   7633  C  C     . ILE C  3  195 ? -5.837  59.591  -3.744  1.00 35.56  ? 195 ILE C C     1 
ATOM   7634  O  O     . ILE C  3  195 ? -6.138  60.756  -3.487  1.00 36.15  ? 195 ILE C O     1 
ATOM   7635  C  CB    . ILE C  3  195 ? -4.524  58.239  -2.029  1.00 35.33  ? 195 ILE C CB    1 
ATOM   7636  C  CG1   . ILE C  3  195 ? -4.709  57.510  -0.700  1.00 37.09  ? 195 ILE C CG1   1 
ATOM   7637  C  CG2   . ILE C  3  195 ? -3.755  59.532  -1.794  1.00 37.02  ? 195 ILE C CG2   1 
ATOM   7638  C  CD1   . ILE C  3  195 ? -3.405  57.104  -0.046  1.00 41.43  ? 195 ILE C CD1   1 
ATOM   7639  N  N     . MET C  3  196 ? -5.467  59.185  -4.963  1.00 35.43  ? 196 MET C N     1 
ATOM   7640  C  CA    . MET C  3  196 ? -5.409  60.099  -6.114  1.00 35.20  ? 196 MET C CA    1 
ATOM   7641  C  C     . MET C  3  196 ? -6.819  60.626  -6.459  1.00 33.90  ? 196 MET C C     1 
ATOM   7642  O  O     . MET C  3  196 ? -6.987  61.771  -6.883  1.00 34.03  ? 196 MET C O     1 
ATOM   7643  C  CB    . MET C  3  196 ? -4.785  59.391  -7.321  1.00 35.08  ? 196 MET C CB    1 
ATOM   7644  C  CG    . MET C  3  196 ? -3.288  59.169  -7.166  1.00 37.96  ? 196 MET C CG    1 
ATOM   7645  S  SD    . MET C  3  196 ? -2.560  58.155  -8.457  1.00 43.13  ? 196 MET C SD    1 
ATOM   7646  C  CE    . MET C  3  196 ? -2.250  59.340  -9.727  1.00 41.71  ? 196 MET C CE    1 
ATOM   7647  N  N     . HIS C  3  197 ? -7.824  59.781  -6.253  1.00 31.43  ? 197 HIS C N     1 
ATOM   7648  C  CA    . HIS C  3  197 ? -9.212  60.136  -6.490  1.00 30.93  ? 197 HIS C CA    1 
ATOM   7649  C  C     . HIS C  3  197 ? -9.524  61.283  -5.522  1.00 31.18  ? 197 HIS C C     1 
ATOM   7650  O  O     . HIS C  3  197 ? -10.006 62.335  -5.933  1.00 32.01  ? 197 HIS C O     1 
ATOM   7651  C  CB    . HIS C  3  197 ? -10.100 58.906  -6.202  1.00 30.20  ? 197 HIS C CB    1 
ATOM   7652  C  CG    . HIS C  3  197 ? -11.548 59.065  -6.574  1.00 30.22  ? 197 HIS C CG    1 
ATOM   7653  N  ND1   . HIS C  3  197 ? -12.003 59.266  -7.859  1.00 28.82  ? 197 HIS C ND1   1 
ATOM   7654  C  CD2   . HIS C  3  197 ? -12.667 58.905  -5.816  1.00 29.50  ? 197 HIS C CD2   1 
ATOM   7655  C  CE1   . HIS C  3  197 ? -13.350 59.200  -7.843  1.00 28.85  ? 197 HIS C CE1   1 
ATOM   7656  N  NE2   . HIS C  3  197 ? -13.810 58.983  -6.625  1.00 28.53  ? 197 HIS C NE2   1 
ATOM   7657  N  N     . LEU C  3  198 ? -9.194  61.095  -4.246  1.00 30.52  ? 198 LEU C N     1 
ATOM   7658  C  CA    . LEU C  3  198 ? -9.444  62.122  -3.235  1.00 32.14  ? 198 LEU C CA    1 
ATOM   7659  C  C     . LEU C  3  198 ? -8.659  63.420  -3.455  1.00 32.63  ? 198 LEU C C     1 
ATOM   7660  O  O     . LEU C  3  198 ? -9.146  64.501  -3.150  1.00 33.14  ? 198 LEU C O     1 
ATOM   7661  C  CB    . LEU C  3  198 ? -9.175  61.571  -1.840  1.00 31.61  ? 198 LEU C CB    1 
ATOM   7662  C  CG    . LEU C  3  198 ? -10.129 60.463  -1.392  1.00 32.99  ? 198 LEU C CG    1 
ATOM   7663  C  CD1   . LEU C  3  198 ? -9.622  59.881  -0.089  1.00 31.55  ? 198 LEU C CD1   1 
ATOM   7664  C  CD2   . LEU C  3  198 ? -11.541 61.014  -1.222  1.00 31.70  ? 198 LEU C CD2   1 
ATOM   7665  N  N     . MET C  3  199 ? -7.445  63.313  -3.981  1.00 33.38  ? 199 MET C N     1 
ATOM   7666  C  CA    . MET C  3  199 ? -6.633  64.488  -4.244  1.00 34.39  ? 199 MET C CA    1 
ATOM   7667  C  C     . MET C  3  199 ? -7.312  65.320  -5.319  1.00 35.82  ? 199 MET C C     1 
ATOM   7668  O  O     . MET C  3  199 ? -7.366  66.538  -5.221  1.00 38.23  ? 199 MET C O     1 
ATOM   7669  C  CB    . MET C  3  199 ? -5.241  64.089  -4.733  1.00 34.65  ? 199 MET C CB    1 
ATOM   7670  C  CG    . MET C  3  199 ? -4.252  63.707  -3.649  1.00 37.28  ? 199 MET C CG    1 
ATOM   7671  S  SD    . MET C  3  199 ? -2.700  63.026  -4.322  1.00 38.73  ? 199 MET C SD    1 
ATOM   7672  C  CE    . MET C  3  199 ? -1.999  64.505  -4.999  1.00 40.04  ? 199 MET C CE    1 
ATOM   7673  N  N     . ALA C  3  200 ? -7.832  64.648  -6.343  1.00 35.74  ? 200 ALA C N     1 
ATOM   7674  C  CA    . ALA C  3  200 ? -8.504  65.314  -7.454  1.00 34.66  ? 200 ALA C CA    1 
ATOM   7675  C  C     . ALA C  3  200 ? -9.822  65.943  -7.007  1.00 35.08  ? 200 ALA C C     1 
ATOM   7676  O  O     . ALA C  3  200 ? -10.246 66.953  -7.546  1.00 37.01  ? 200 ALA C O     1 
ATOM   7677  C  CB    . ALA C  3  200 ? -8.740  64.324  -8.591  1.00 32.25  ? 200 ALA C CB    1 
ATOM   7678  N  N     . LEU C  3  201 ? -10.469 65.325  -6.029  1.00 34.41  ? 201 LEU C N     1 
ATOM   7679  C  CA    . LEU C  3  201 ? -11.722 65.822  -5.489  1.00 33.12  ? 201 LEU C CA    1 
ATOM   7680  C  C     . LEU C  3  201 ? -11.510 67.087  -4.657  1.00 33.87  ? 201 LEU C C     1 
ATOM   7681  O  O     . LEU C  3  201 ? -12.353 67.983  -4.642  1.00 34.84  ? 201 LEU C O     1 
ATOM   7682  C  CB    . LEU C  3  201 ? -12.367 64.749  -4.599  1.00 29.95  ? 201 LEU C CB    1 
ATOM   7683  C  CG    . LEU C  3  201 ? -13.537 65.239  -3.731  1.00 28.56  ? 201 LEU C CG    1 
ATOM   7684  C  CD1   . LEU C  3  201 ? -14.740 65.568  -4.608  1.00 26.24  ? 201 LEU C CD1   1 
ATOM   7685  C  CD2   . LEU C  3  201 ? -13.900 64.202  -2.678  1.00 27.02  ? 201 LEU C CD2   1 
ATOM   7686  N  N     . HIS C  3  202 ? -10.388 67.132  -3.949  1.00 36.15  ? 202 HIS C N     1 
ATOM   7687  C  CA    . HIS C  3  202 ? -10.049 68.238  -3.066  1.00 37.42  ? 202 HIS C CA    1 
ATOM   7688  C  C     . HIS C  3  202 ? -9.771  69.577  -3.760  1.00 38.83  ? 202 HIS C C     1 
ATOM   7689  O  O     . HIS C  3  202 ? -10.062 70.638  -3.196  1.00 38.97  ? 202 HIS C O     1 
ATOM   7690  C  CB    . HIS C  3  202 ? -8.856  67.829  -2.210  1.00 41.72  ? 202 HIS C CB    1 
ATOM   7691  C  CG    . HIS C  3  202 ? -8.671  68.655  -0.979  1.00 45.99  ? 202 HIS C CG    1 
ATOM   7692  N  ND1   . HIS C  3  202 ? -9.540  68.596  0.090   1.00 48.47  ? 202 HIS C ND1   1 
ATOM   7693  C  CD2   . HIS C  3  202 ? -7.691  69.520  -0.625  1.00 47.37  ? 202 HIS C CD2   1 
ATOM   7694  C  CE1   . HIS C  3  202 ? -9.097  69.385  1.054   1.00 50.96  ? 202 HIS C CE1   1 
ATOM   7695  N  NE2   . HIS C  3  202 ? -7.977  69.957  0.645   1.00 51.87  ? 202 HIS C NE2   1 
ATOM   7696  N  N     . ILE C  3  203 ? -9.254  69.555  -4.986  1.00 38.36  ? 203 ILE C N     1 
ATOM   7697  C  CA    . ILE C  3  203 ? -8.969  70.828  -5.644  1.00 40.95  ? 203 ILE C CA    1 
ATOM   7698  C  C     . ILE C  3  203 ? -10.159 71.686  -6.029  1.00 37.74  ? 203 ILE C C     1 
ATOM   7699  O  O     . ILE C  3  203 ? -10.056 72.896  -5.991  1.00 38.74  ? 203 ILE C O     1 
ATOM   7700  C  CB    . ILE C  3  203 ? -7.952  70.718  -6.822  1.00 43.71  ? 203 ILE C CB    1 
ATOM   7701  C  CG1   . ILE C  3  203 ? -8.430  69.756  -7.889  1.00 44.94  ? 203 ILE C CG1   1 
ATOM   7702  C  CG2   . ILE C  3  203 ? -6.577  70.268  -6.288  1.00 46.73  ? 203 ILE C CG2   1 
ATOM   7703  C  CD1   . ILE C  3  203 ? -7.436  69.585  -9.020  1.00 47.47  ? 203 ILE C CD1   1 
ATOM   7704  N  N     . HIS C  3  204 ? -11.295 71.072  -6.342  1.00 37.31  ? 204 HIS C N     1 
ATOM   7705  C  CA    . HIS C  3  204 ? -12.504 71.828  -6.708  1.00 35.59  ? 204 HIS C CA    1 
ATOM   7706  C  C     . HIS C  3  204 ? -13.667 71.529  -5.771  1.00 33.16  ? 204 HIS C C     1 
ATOM   7707  O  O     . HIS C  3  204 ? -14.684 72.213  -5.795  1.00 30.79  ? 204 HIS C O     1 
ATOM   7708  C  CB    . HIS C  3  204 ? -12.925 71.542  -8.147  1.00 36.63  ? 204 HIS C CB    1 
ATOM   7709  C  CG    . HIS C  3  204 ? -11.915 71.965  -9.161  1.00 36.56  ? 204 HIS C CG    1 
ATOM   7710  N  ND1   . HIS C  3  204 ? -11.129 71.062  -9.849  1.00 37.97  ? 204 HIS C ND1   1 
ATOM   7711  C  CD2   . HIS C  3  204 ? -11.548 73.194  -9.594  1.00 33.78  ? 204 HIS C CD2   1 
ATOM   7712  C  CE1   . HIS C  3  204 ? -10.322 71.720  -10.662 1.00 37.00  ? 204 HIS C CE1   1 
ATOM   7713  N  NE2   . HIS C  3  204 ? -10.555 73.014  -10.527 1.00 37.94  ? 204 HIS C NE2   1 
ATOM   7714  N  N     . GLY C  3  205 ? -13.521 70.493  -4.956  1.00 30.91  ? 205 GLY C N     1 
ATOM   7715  C  CA    . GLY C  3  205 ? -14.573 70.164  -4.014  1.00 32.08  ? 205 GLY C CA    1 
ATOM   7716  C  C     . GLY C  3  205 ? -15.725 69.392  -4.611  1.00 30.79  ? 205 GLY C C     1 
ATOM   7717  O  O     . GLY C  3  205 ? -15.715 69.061  -5.782  1.00 33.37  ? 205 GLY C O     1 
ATOM   7718  N  N     . SER C  3  206 ? -16.698 69.060  -3.785  1.00 29.86  ? 206 SER C N     1 
ATOM   7719  C  CA    . SER C  3  206 ? -17.852 68.313  -4.231  1.00 31.00  ? 206 SER C CA    1 
ATOM   7720  C  C     . SER C  3  206 ? -18.796 69.220  -4.994  1.00 32.72  ? 206 SER C C     1 
ATOM   7721  O  O     . SER C  3  206 ? -18.746 70.450  -4.851  1.00 34.52  ? 206 SER C O     1 
ATOM   7722  C  CB    . SER C  3  206 ? -18.606 67.724  -3.035  1.00 29.63  ? 206 SER C CB    1 
ATOM   7723  O  OG    . SER C  3  206 ? -17.813 66.793  -2.337  1.00 34.37  ? 206 SER C OG    1 
ATOM   7724  N  N     . SER C  3  207 ? -19.608 68.606  -5.849  1.00 30.84  ? 207 SER C N     1 
ATOM   7725  C  CA    . SER C  3  207 ? -20.613 69.326  -6.596  1.00 32.45  ? 207 SER C CA    1 
ATOM   7726  C  C     . SER C  3  207 ? -21.832 69.230  -5.685  1.00 34.17  ? 207 SER C C     1 
ATOM   7727  O  O     . SER C  3  207 ? -21.712 68.784  -4.554  1.00 35.62  ? 207 SER C O     1 
ATOM   7728  C  CB    . SER C  3  207 ? -20.886 68.630  -7.919  1.00 31.10  ? 207 SER C CB    1 
ATOM   7729  O  OG    . SER C  3  207 ? -21.831 69.359  -8.661  1.00 34.13  ? 207 SER C OG    1 
ATOM   7730  N  N     . ASN C  3  208 ? -22.996 69.656  -6.151  1.00 34.19  ? 208 ASN C N     1 
ATOM   7731  C  CA    . ASN C  3  208 ? -24.195 69.573  -5.328  1.00 35.01  ? 208 ASN C CA    1 
ATOM   7732  C  C     . ASN C  3  208 ? -25.408 69.265  -6.219  1.00 36.12  ? 208 ASN C C     1 
ATOM   7733  O  O     . ASN C  3  208 ? -25.328 69.356  -7.445  1.00 36.71  ? 208 ASN C O     1 
ATOM   7734  C  CB    . ASN C  3  208 ? -24.376 70.863  -4.519  1.00 35.22  ? 208 ASN C CB    1 
ATOM   7735  C  CG    . ASN C  3  208 ? -24.613 72.068  -5.396  1.00 37.56  ? 208 ASN C CG    1 
ATOM   7736  O  OD1   . ASN C  3  208 ? -23.707 72.862  -5.647  1.00 38.10  ? 208 ASN C OD1   1 
ATOM   7737  N  ND2   . ASN C  3  208 ? -25.838 72.207  -5.875  1.00 37.78  ? 208 ASN C ND2   1 
ATOM   7738  N  N     . PRO C  3  209 ? -26.549 68.899  -5.621  1.00 36.64  ? 209 PRO C N     1 
ATOM   7739  C  CA    . PRO C  3  209 ? -27.717 68.587  -6.449  1.00 36.92  ? 209 PRO C CA    1 
ATOM   7740  C  C     . PRO C  3  209 ? -28.280 69.691  -7.362  1.00 36.69  ? 209 PRO C C     1 
ATOM   7741  O  O     . PRO C  3  209 ? -28.906 69.388  -8.365  1.00 38.11  ? 209 PRO C O     1 
ATOM   7742  C  CB    . PRO C  3  209 ? -28.725 68.062  -5.427  1.00 36.58  ? 209 PRO C CB    1 
ATOM   7743  C  CG    . PRO C  3  209 ? -28.364 68.770  -4.194  1.00 36.63  ? 209 PRO C CG    1 
ATOM   7744  C  CD    . PRO C  3  209 ? -26.865 68.734  -4.193  1.00 37.37  ? 209 PRO C CD    1 
ATOM   7745  N  N     . LEU C  3  210 ? -28.038 70.957  -7.044  1.00 35.93  ? 210 LEU C N     1 
ATOM   7746  C  CA    . LEU C  3  210 ? -28.528 72.038  -7.891  1.00 35.33  ? 210 LEU C CA    1 
ATOM   7747  C  C     . LEU C  3  210 ? -27.658 72.204  -9.144  1.00 36.37  ? 210 LEU C C     1 
ATOM   7748  O  O     . LEU C  3  210 ? -28.064 72.871  -10.096 1.00 37.00  ? 210 LEU C O     1 
ATOM   7749  C  CB    . LEU C  3  210 ? -28.586 73.362  -7.129  1.00 33.19  ? 210 LEU C CB    1 
ATOM   7750  C  CG    . LEU C  3  210 ? -29.475 73.391  -5.895  1.00 33.39  ? 210 LEU C CG    1 
ATOM   7751  C  CD1   . LEU C  3  210 ? -29.662 74.838  -5.457  1.00 32.34  ? 210 LEU C CD1   1 
ATOM   7752  C  CD2   . LEU C  3  210 ? -30.813 72.750  -6.206  1.00 34.33  ? 210 LEU C CD2   1 
ATOM   7753  N  N     . GLY C  3  211 ? -26.457 71.624  -9.125  1.00 34.79  ? 211 GLY C N     1 
ATOM   7754  C  CA    . GLY C  3  211 ? -25.565 71.710  -10.270 1.00 35.72  ? 211 GLY C CA    1 
ATOM   7755  C  C     . GLY C  3  211 ? -24.815 73.017  -10.421 1.00 37.14  ? 211 GLY C C     1 
ATOM   7756  O  O     . GLY C  3  211 ? -23.997 73.164  -11.328 1.00 38.67  ? 211 GLY C O     1 
ATOM   7757  N  N     . ILE C  3  212 ? -25.081 73.967  -9.536  1.00 37.43  ? 212 ILE C N     1 
ATOM   7758  C  CA    . ILE C  3  212 ? -24.401 75.250  -9.583  1.00 39.05  ? 212 ILE C CA    1 
ATOM   7759  C  C     . ILE C  3  212 ? -23.312 75.357  -8.500  1.00 40.51  ? 212 ILE C C     1 
ATOM   7760  O  O     . ILE C  3  212 ? -23.006 74.380  -7.812  1.00 39.66  ? 212 ILE C O     1 
ATOM   7761  C  CB    . ILE C  3  212 ? -25.410 76.405  -9.442  1.00 42.29  ? 212 ILE C CB    1 
ATOM   7762  C  CG1   . ILE C  3  212 ? -26.209 76.266  -8.141  1.00 43.28  ? 212 ILE C CG1   1 
ATOM   7763  C  CG2   . ILE C  3  212 ? -26.343 76.440  -10.653 1.00 39.77  ? 212 ILE C CG2   1 
ATOM   7764  C  CD1   . ILE C  3  212 ? -27.234 77.369  -7.944  1.00 43.67  ? 212 ILE C CD1   1 
ATOM   7765  N  N     . THR C  3  213 ? -22.735 76.548  -8.345  1.00 40.69  ? 213 THR C N     1 
ATOM   7766  C  CA    . THR C  3  213 ? -21.678 76.780  -7.361  1.00 40.14  ? 213 THR C CA    1 
ATOM   7767  C  C     . THR C  3  213 ? -22.095 76.602  -5.901  1.00 39.86  ? 213 THR C C     1 
ATOM   7768  O  O     . THR C  3  213 ? -23.234 76.873  -5.526  1.00 39.86  ? 213 THR C O     1 
ATOM   7769  C  CB    . THR C  3  213 ? -21.076 78.182  -7.492  1.00 39.74  ? 213 THR C CB    1 
ATOM   7770  O  OG1   . THR C  3  213 ? -19.922 78.280  -6.649  1.00 38.87  ? 213 THR C OG1   1 
ATOM   7771  C  CG2   . THR C  3  213 ? -22.080 79.220  -7.041  1.00 40.99  ? 213 THR C CG2   1 
ATOM   7772  N  N     . GLY C  3  214 ? -21.132 76.184  -5.082  1.00 40.33  ? 214 GLY C N     1 
ATOM   7773  C  CA    . GLY C  3  214 ? -21.372 75.978  -3.667  1.00 38.92  ? 214 GLY C CA    1 
ATOM   7774  C  C     . GLY C  3  214 ? -20.603 76.995  -2.853  1.00 37.98  ? 214 GLY C C     1 
ATOM   7775  O  O     . GLY C  3  214 ? -20.805 77.100  -1.644  1.00 39.11  ? 214 GLY C O     1 
ATOM   7776  N  N     . ASN C  3  215 ? -19.803 77.810  -3.539  1.00 36.18  ? 215 ASN C N     1 
ATOM   7777  C  CA    . ASN C  3  215 ? -18.960 78.826  -2.911  1.00 35.70  ? 215 ASN C CA    1 
ATOM   7778  C  C     . ASN C  3  215 ? -19.628 79.902  -2.050  1.00 37.48  ? 215 ASN C C     1 
ATOM   7779  O  O     . ASN C  3  215 ? -18.949 80.572  -1.277  1.00 41.20  ? 215 ASN C O     1 
ATOM   7780  C  CB    . ASN C  3  215 ? -18.075 79.508  -3.961  1.00 33.38  ? 215 ASN C CB    1 
ATOM   7781  C  CG    . ASN C  3  215 ? -17.001 78.585  -4.526  1.00 35.09  ? 215 ASN C CG    1 
ATOM   7782  O  OD1   . ASN C  3  215 ? -16.743 77.510  -3.994  1.00 38.33  ? 215 ASN C OD1   1 
ATOM   7783  N  ND2   . ASN C  3  215 ? -16.359 79.017  -5.601  1.00 33.91  ? 215 ASN C ND2   1 
ATOM   7784  N  N     . LEU C  3  216 ? -20.937 80.081  -2.177  1.00 37.71  ? 216 LEU C N     1 
ATOM   7785  C  CA    . LEU C  3  216 ? -21.627 81.106  -1.403  1.00 38.87  ? 216 LEU C CA    1 
ATOM   7786  C  C     . LEU C  3  216 ? -22.166 80.637  -0.063  1.00 39.51  ? 216 LEU C C     1 
ATOM   7787  O  O     . LEU C  3  216 ? -22.500 81.463  0.794   1.00 41.63  ? 216 LEU C O     1 
ATOM   7788  C  CB    . LEU C  3  216 ? -22.764 81.740  -2.217  1.00 42.23  ? 216 LEU C CB    1 
ATOM   7789  C  CG    . LEU C  3  216 ? -22.380 82.668  -3.384  1.00 44.37  ? 216 LEU C CG    1 
ATOM   7790  C  CD1   . LEU C  3  216 ? -21.781 81.879  -4.542  1.00 44.34  ? 216 LEU C CD1   1 
ATOM   7791  C  CD2   . LEU C  3  216 ? -23.600 83.396  -3.855  1.00 42.40  ? 216 LEU C CD2   1 
ATOM   7792  N  N     . ASP C  3  217 ? -22.219 79.326  0.143   1.00 38.59  ? 217 ASP C N     1 
ATOM   7793  C  CA    . ASP C  3  217 ? -22.740 78.798  1.398   1.00 37.65  ? 217 ASP C CA    1 
ATOM   7794  C  C     . ASP C  3  217 ? -22.218 77.407  1.753   1.00 37.48  ? 217 ASP C C     1 
ATOM   7795  O  O     . ASP C  3  217 ? -22.865 76.405  1.439   1.00 38.59  ? 217 ASP C O     1 
ATOM   7796  C  CB    . ASP C  3  217 ? -24.270 78.790  1.342   1.00 35.97  ? 217 ASP C CB    1 
ATOM   7797  C  CG    . ASP C  3  217 ? -24.906 78.459  2.674   1.00 40.54  ? 217 ASP C CG    1 
ATOM   7798  O  OD1   . ASP C  3  217 ? -24.553 79.104  3.684   1.00 43.94  ? 217 ASP C OD1   1 
ATOM   7799  O  OD2   . ASP C  3  217 ? -25.793 77.579  2.716   1.00 40.85  ? 217 ASP C OD2   1 
ATOM   7800  N  N     . ARG C  3  218 ? -21.036 77.336  2.369   1.00 37.43  ? 218 ARG C N     1 
ATOM   7801  C  CA    . ARG C  3  218 ? -20.504 76.038  2.781   1.00 38.54  ? 218 ARG C CA    1 
ATOM   7802  C  C     . ARG C  3  218 ? -20.516 75.845  4.292   1.00 38.25  ? 218 ARG C C     1 
ATOM   7803  O  O     . ARG C  3  218 ? -20.606 76.809  5.038   1.00 40.33  ? 218 ARG C O     1 
ATOM   7804  C  CB    . ARG C  3  218 ? -19.091 75.743  2.257   1.00 36.77  ? 218 ARG C CB    1 
ATOM   7805  C  CG    . ARG C  3  218 ? -18.412 76.769  1.404   1.00 37.92  ? 218 ARG C CG    1 
ATOM   7806  C  CD    . ARG C  3  218 ? -18.333 76.363  -0.074  1.00 37.86  ? 218 ARG C CD    1 
ATOM   7807  N  NE    . ARG C  3  218 ? -17.998 74.967  -0.322  1.00 37.30  ? 218 ARG C NE    1 
ATOM   7808  C  CZ    . ARG C  3  218 ? -17.695 74.468  -1.528  1.00 38.78  ? 218 ARG C CZ    1 
ATOM   7809  N  NH1   . ARG C  3  218 ? -17.413 73.179  -1.662  1.00 36.32  ? 218 ARG C NH1   1 
ATOM   7810  N  NH2   . ARG C  3  218 ? -17.665 75.245  -2.606  1.00 33.28  ? 218 ARG C NH2   1 
ATOM   7811  N  N     . ILE C  3  219 ? -20.544 74.581  4.717   1.00 37.83  ? 219 ILE C N     1 
ATOM   7812  C  CA    . ILE C  3  219 ? -20.494 74.205  6.129   1.00 37.29  ? 219 ILE C CA    1 
ATOM   7813  C  C     . ILE C  3  219 ? -19.403 73.134  6.272   1.00 38.29  ? 219 ILE C C     1 
ATOM   7814  O  O     . ILE C  3  219 ? -19.191 72.335  5.357   1.00 38.76  ? 219 ILE C O     1 
ATOM   7815  C  CB    . ILE C  3  219 ? -21.827 73.676  6.656   1.00 37.54  ? 219 ILE C CB    1 
ATOM   7816  C  CG1   . ILE C  3  219 ? -22.307 72.489  5.827   1.00 38.97  ? 219 ILE C CG1   1 
ATOM   7817  C  CG2   . ILE C  3  219 ? -22.861 74.792  6.663   1.00 39.75  ? 219 ILE C CG2   1 
ATOM   7818  C  CD1   . ILE C  3  219 ? -23.694 71.992  6.220   1.00 36.44  ? 219 ILE C CD1   1 
ATOM   7819  N  N     . PRO C  3  220 ? -18.657 73.149  7.396   1.00 37.71  ? 220 PRO C N     1 
ATOM   7820  C  CA    . PRO C  3  220 ? -17.567 72.218  7.718   1.00 35.99  ? 220 PRO C CA    1 
ATOM   7821  C  C     . PRO C  3  220 ? -17.931 70.747  7.608   1.00 35.01  ? 220 PRO C C     1 
ATOM   7822  O  O     . PRO C  3  220 ? -19.049 70.344  7.942   1.00 33.76  ? 220 PRO C O     1 
ATOM   7823  C  CB    . PRO C  3  220 ? -17.265 72.551  9.179   1.00 36.61  ? 220 PRO C CB    1 
ATOM   7824  C  CG    . PRO C  3  220 ? -17.584 73.986  9.266   1.00 38.51  ? 220 PRO C CG    1 
ATOM   7825  C  CD    . PRO C  3  220 ? -18.890 74.059  8.529   1.00 37.29  ? 220 PRO C CD    1 
ATOM   7826  N  N     . MET C  3  221 ? -16.983 69.943  7.140   1.00 32.88  ? 221 MET C N     1 
ATOM   7827  C  CA    . MET C  3  221 ? -17.216 68.514  7.060   1.00 34.12  ? 221 MET C CA    1 
ATOM   7828  C  C     . MET C  3  221 ? -17.441 68.060  8.493   1.00 34.59  ? 221 MET C C     1 
ATOM   7829  O  O     . MET C  3  221 ? -18.406 67.365  8.777   1.00 35.90  ? 221 MET C O     1 
ATOM   7830  C  CB    . MET C  3  221 ? -15.998 67.783  6.507   1.00 34.61  ? 221 MET C CB    1 
ATOM   7831  C  CG    . MET C  3  221 ? -16.161 66.281  6.494   1.00 38.71  ? 221 MET C CG    1 
ATOM   7832  S  SD    . MET C  3  221 ? -17.060 65.711  5.038   1.00 47.05  ? 221 MET C SD    1 
ATOM   7833  C  CE    . MET C  3  221 ? -15.732 65.504  3.960   1.00 44.29  ? 221 MET C CE    1 
ATOM   7834  N  N     . HIS C  3  222 ? -16.586 68.506  9.414   1.00 38.94  ? 222 HIS C N     1 
ATOM   7835  C  CA    . HIS C  3  222 ? -16.760 68.079  10.782  1.00 40.83  ? 222 HIS C CA    1 
ATOM   7836  C  C     . HIS C  3  222 ? -17.990 68.552  11.492  1.00 42.86  ? 222 HIS C C     1 
ATOM   7837  O  O     . HIS C  3  222 ? -18.210 69.745  11.736  1.00 38.49  ? 222 HIS C O     1 
ATOM   7838  C  CB    . HIS C  3  222 ? -15.572 68.273  11.710  1.00 42.91  ? 222 HIS C CB    1 
ATOM   7839  C  CG    . HIS C  3  222 ? -15.861 67.773  13.095  1.00 43.23  ? 222 HIS C CG    1 
ATOM   7840  N  ND1   . HIS C  3  222 ? -16.488 66.561  13.314  1.00 42.01  ? 222 HIS C ND1   1 
ATOM   7841  C  CD2   . HIS C  3  222 ? -15.777 68.376  14.306  1.00 41.17  ? 222 HIS C CD2   1 
ATOM   7842  C  CE1   . HIS C  3  222 ? -16.791 66.446  14.595  1.00 41.27  ? 222 HIS C CE1   1 
ATOM   7843  N  NE2   . HIS C  3  222 ? -16.370 67.534  15.219  1.00 43.51  ? 222 HIS C NE2   1 
ATOM   7844  N  N     . SER C  3  223 ? -18.643 67.502  11.974  1.00 46.52  ? 223 SER C N     1 
ATOM   7845  C  CA    . SER C  3  223 ? -19.877 67.458  12.711  1.00 45.60  ? 223 SER C CA    1 
ATOM   7846  C  C     . SER C  3  223 ? -20.990 67.118  11.743  1.00 42.77  ? 223 SER C C     1 
ATOM   7847  O  O     . SER C  3  223 ? -21.403 65.962  11.678  1.00 44.12  ? 223 SER C O     1 
ATOM   7848  C  CB    . SER C  3  223 ? -20.145 68.738  13.482  1.00 47.31  ? 223 SER C CB    1 
ATOM   7849  O  OG    . SER C  3  223 ? -20.775 68.417  14.703  1.00 52.99  ? 223 SER C OG    1 
ATOM   7850  N  N     . TYR C  3  224 ? -21.334 68.058  10.875  1.00 38.59  ? 224 TYR C N     1 
ATOM   7851  C  CA    . TYR C  3  224 ? -22.440 67.858  9.948   1.00 38.24  ? 224 TYR C CA    1 
ATOM   7852  C  C     . TYR C  3  224 ? -22.413 66.596  9.099   1.00 39.31  ? 224 TYR C C     1 
ATOM   7853  O  O     . TYR C  3  224 ? -23.321 65.762  9.179   1.00 39.39  ? 224 TYR C O     1 
ATOM   7854  C  CB    . TYR C  3  224 ? -22.605 69.082  9.062   1.00 37.58  ? 224 TYR C CB    1 
ATOM   7855  C  CG    . TYR C  3  224 ? -22.886 70.328  9.856   1.00 35.49  ? 224 TYR C CG    1 
ATOM   7856  C  CD1   . TYR C  3  224 ? -21.931 71.328  9.971   1.00 35.10  ? 224 TYR C CD1   1 
ATOM   7857  C  CD2   . TYR C  3  224 ? -24.090 70.483  10.532  1.00 35.42  ? 224 TYR C CD2   1 
ATOM   7858  C  CE1   . TYR C  3  224 ? -22.165 72.446  10.740  1.00 37.64  ? 224 TYR C CE1   1 
ATOM   7859  C  CE2   . TYR C  3  224 ? -24.335 71.599  11.314  1.00 35.56  ? 224 TYR C CE2   1 
ATOM   7860  C  CZ    . TYR C  3  224 ? -23.369 72.575  11.414  1.00 38.02  ? 224 TYR C CZ    1 
ATOM   7861  O  OH    . TYR C  3  224 ? -23.587 73.678  12.206  1.00 40.96  ? 224 TYR C OH    1 
ATOM   7862  N  N     . PHE C  3  225 ? -21.358 66.429  8.314   1.00 38.53  ? 225 PHE C N     1 
ATOM   7863  C  CA    . PHE C  3  225 ? -21.273 65.266  7.459   1.00 37.38  ? 225 PHE C CA    1 
ATOM   7864  C  C     . PHE C  3  225 ? -20.655 64.028  8.090   1.00 39.54  ? 225 PHE C C     1 
ATOM   7865  O  O     . PHE C  3  225 ? -20.881 62.906  7.605   1.00 40.59  ? 225 PHE C O     1 
ATOM   7866  C  CB    . PHE C  3  225 ? -20.648 65.650  6.127   1.00 33.83  ? 225 PHE C CB    1 
ATOM   7867  C  CG    . PHE C  3  225 ? -21.451 66.681  5.393   1.00 31.94  ? 225 PHE C CG    1 
ATOM   7868  C  CD1   . PHE C  3  225 ? -21.089 68.022  5.429   1.00 30.79  ? 225 PHE C CD1   1 
ATOM   7869  C  CD2   . PHE C  3  225 ? -22.622 66.324  4.736   1.00 31.65  ? 225 PHE C CD2   1 
ATOM   7870  C  CE1   . PHE C  3  225 ? -21.882 68.988  4.826   1.00 29.35  ? 225 PHE C CE1   1 
ATOM   7871  C  CE2   . PHE C  3  225 ? -23.423 67.279  4.130   1.00 30.56  ? 225 PHE C CE2   1 
ATOM   7872  C  CZ    . PHE C  3  225 ? -23.056 68.618  4.174   1.00 30.98  ? 225 PHE C CZ    1 
ATOM   7873  N  N     . ILE C  3  226 ? -19.911 64.206  9.183   1.00 38.61  ? 226 ILE C N     1 
ATOM   7874  C  CA    . ILE C  3  226 ? -19.336 63.050  9.868   1.00 38.25  ? 226 ILE C CA    1 
ATOM   7875  C  C     . ILE C  3  226 ? -20.517 62.280  10.453  1.00 38.33  ? 226 ILE C C     1 
ATOM   7876  O  O     . ILE C  3  226 ? -20.651 61.073  10.264  1.00 38.81  ? 226 ILE C O     1 
ATOM   7877  C  CB    . ILE C  3  226 ? -18.385 63.465  11.016  1.00 39.74  ? 226 ILE C CB    1 
ATOM   7878  C  CG1   . ILE C  3  226 ? -17.063 64.009  10.457  1.00 39.08  ? 226 ILE C CG1   1 
ATOM   7879  C  CG2   . ILE C  3  226 ? -18.122 62.281  11.947  1.00 38.49  ? 226 ILE C CG2   1 
ATOM   7880  C  CD1   . ILE C  3  226 ? -16.210 62.988  9.747   1.00 36.14  ? 226 ILE C CD1   1 
ATOM   7881  N  N     . PHE C  3  227 ? -21.424 63.005  11.097  1.00 38.96  ? 227 PHE C N     1 
ATOM   7882  C  CA    . PHE C  3  227 ? -22.591 62.370  11.696  1.00 39.74  ? 227 PHE C CA    1 
ATOM   7883  C  C     . PHE C  3  227 ? -23.642 61.909  10.709  1.00 38.97  ? 227 PHE C C     1 
ATOM   7884  O  O     . PHE C  3  227 ? -24.390 60.974  10.991  1.00 39.60  ? 227 PHE C O     1 
ATOM   7885  C  CB    . PHE C  3  227 ? -23.185 63.234  12.811  1.00 40.36  ? 227 PHE C CB    1 
ATOM   7886  C  CG    . PHE C  3  227 ? -22.431 63.119  14.100  1.00 41.79  ? 227 PHE C CG    1 
ATOM   7887  C  CD1   . PHE C  3  227 ? -21.395 64.000  14.405  1.00 42.89  ? 227 PHE C CD1   1 
ATOM   7888  C  CD2   . PHE C  3  227 ? -22.706 62.077  14.979  1.00 44.02  ? 227 PHE C CD2   1 
ATOM   7889  C  CE1   . PHE C  3  227 ? -20.638 63.841  15.567  1.00 44.87  ? 227 PHE C CE1   1 
ATOM   7890  C  CE2   . PHE C  3  227 ? -21.954 61.908  16.146  1.00 47.19  ? 227 PHE C CE2   1 
ATOM   7891  C  CZ    . PHE C  3  227 ? -20.915 62.795  16.439  1.00 44.80  ? 227 PHE C CZ    1 
ATOM   7892  N  N     . LYS C  3  228 ? -23.691 62.544  9.544   1.00 37.95  ? 228 LYS C N     1 
ATOM   7893  C  CA    . LYS C  3  228 ? -24.642 62.135  8.526   1.00 36.63  ? 228 LYS C CA    1 
ATOM   7894  C  C     . LYS C  3  228 ? -24.094 60.839  7.894   1.00 36.58  ? 228 LYS C C     1 
ATOM   7895  O  O     . LYS C  3  228 ? -24.861 59.931  7.580   1.00 37.10  ? 228 LYS C O     1 
ATOM   7896  C  CB    . LYS C  3  228 ? -24.814 63.241  7.482   1.00 37.13  ? 228 LYS C CB    1 
ATOM   7897  C  CG    . LYS C  3  228 ? -26.033 63.092  6.593   1.00 35.96  ? 228 LYS C CG    1 
ATOM   7898  C  CD    . LYS C  3  228 ? -26.171 64.291  5.672   1.00 34.43  ? 228 LYS C CD    1 
ATOM   7899  C  CE    . LYS C  3  228 ? -27.320 64.108  4.690   1.00 32.01  ? 228 LYS C CE    1 
ATOM   7900  N  NZ    . LYS C  3  228 ? -27.388 65.265  3.757   1.00 29.79  ? 228 LYS C NZ    1 
ATOM   7901  N  N     . ASP C  3  229 ? -22.770 60.743  7.748   1.00 36.66  ? 229 ASP C N     1 
ATOM   7902  C  CA    . ASP C  3  229 ? -22.140 59.540  7.186   1.00 38.36  ? 229 ASP C CA    1 
ATOM   7903  C  C     . ASP C  3  229 ? -22.414 58.336  8.101   1.00 39.05  ? 229 ASP C C     1 
ATOM   7904  O  O     . ASP C  3  229 ? -22.622 57.201  7.643   1.00 37.57  ? 229 ASP C O     1 
ATOM   7905  C  CB    . ASP C  3  229 ? -20.620 59.720  7.033   1.00 38.39  ? 229 ASP C CB    1 
ATOM   7906  C  CG    . ASP C  3  229 ? -20.224 60.366  5.712   1.00 43.94  ? 229 ASP C CG    1 
ATOM   7907  O  OD1   . ASP C  3  229 ? -21.056 60.417  4.775   1.00 50.31  ? 229 ASP C OD1   1 
ATOM   7908  O  OD2   . ASP C  3  229 ? -19.067 60.828  5.593   1.00 45.13  ? 229 ASP C OD2   1 
ATOM   7909  N  N     . LEU C  3  230 ? -22.447 58.602  9.401   1.00 38.17  ? 230 LEU C N     1 
ATOM   7910  C  CA    . LEU C  3  230 ? -22.682 57.562  10.389  1.00 37.96  ? 230 LEU C CA    1 
ATOM   7911  C  C     . LEU C  3  230 ? -24.029 56.890  10.189  1.00 38.36  ? 230 LEU C C     1 
ATOM   7912  O  O     . LEU C  3  230 ? -24.162 55.687  10.406  1.00 38.65  ? 230 LEU C O     1 
ATOM   7913  C  CB    . LEU C  3  230 ? -22.609 58.173  11.780  1.00 39.73  ? 230 LEU C CB    1 
ATOM   7914  C  CG    . LEU C  3  230 ? -21.816 57.420  12.830  1.00 38.65  ? 230 LEU C CG    1 
ATOM   7915  C  CD1   . LEU C  3  230 ? -20.434 57.086  12.289  1.00 40.67  ? 230 LEU C CD1   1 
ATOM   7916  C  CD2   . LEU C  3  230 ? -21.725 58.286  14.066  1.00 39.68  ? 230 LEU C CD2   1 
ATOM   7917  N  N     . VAL C  3  231 ? -25.026 57.673  9.773   1.00 38.04  ? 231 VAL C N     1 
ATOM   7918  C  CA    . VAL C  3  231 ? -26.372 57.156  9.530   1.00 35.35  ? 231 VAL C CA    1 
ATOM   7919  C  C     . VAL C  3  231 ? -26.375 56.049  8.480   1.00 35.87  ? 231 VAL C C     1 
ATOM   7920  O  O     . VAL C  3  231 ? -26.947 54.988  8.710   1.00 37.66  ? 231 VAL C O     1 
ATOM   7921  C  CB    . VAL C  3  231 ? -27.338 58.282  9.083   1.00 35.65  ? 231 VAL C CB    1 
ATOM   7922  C  CG1   . VAL C  3  231 ? -28.666 57.707  8.594   1.00 32.85  ? 231 VAL C CG1   1 
ATOM   7923  C  CG2   . VAL C  3  231 ? -27.587 59.242  10.226  1.00 35.89  ? 231 VAL C CG2   1 
ATOM   7924  N  N     . THR C  3  232 ? -25.735 56.290  7.335   1.00 35.57  ? 232 THR C N     1 
ATOM   7925  C  CA    . THR C  3  232 ? -25.694 55.289  6.268   1.00 34.42  ? 232 THR C CA    1 
ATOM   7926  C  C     . THR C  3  232 ? -24.710 54.166  6.539   1.00 35.36  ? 232 THR C C     1 
ATOM   7927  O  O     . THR C  3  232 ? -24.875 53.063  6.019   1.00 38.68  ? 232 THR C O     1 
ATOM   7928  C  CB    . THR C  3  232 ? -25.423 55.900  4.867   1.00 33.35  ? 232 THR C CB    1 
ATOM   7929  O  OG1   . THR C  3  232 ? -24.367 56.857  4.952   1.00 33.20  ? 232 THR C OG1   1 
ATOM   7930  C  CG2   . THR C  3  232 ? -26.672 56.583  4.316   1.00 32.80  ? 232 THR C CG2   1 
ATOM   7931  N  N     . VAL C  3  233 ? -23.679 54.440  7.329   1.00 34.75  ? 233 VAL C N     1 
ATOM   7932  C  CA    . VAL C  3  233 ? -22.704 53.405  7.680   1.00 34.54  ? 233 VAL C CA    1 
ATOM   7933  C  C     . VAL C  3  233 ? -23.404 52.297  8.484   1.00 34.12  ? 233 VAL C C     1 
ATOM   7934  O  O     . VAL C  3  233 ? -23.200 51.108  8.238   1.00 33.24  ? 233 VAL C O     1 
ATOM   7935  C  CB    . VAL C  3  233 ? -21.520 53.988  8.517   1.00 35.65  ? 233 VAL C CB    1 
ATOM   7936  C  CG1   . VAL C  3  233 ? -20.770 52.872  9.237   1.00 33.84  ? 233 VAL C CG1   1 
ATOM   7937  C  CG2   . VAL C  3  233 ? -20.561 54.774  7.605   1.00 33.49  ? 233 VAL C CG2   1 
ATOM   7938  N  N     . PHE C  3  234 ? -24.259 52.704  9.418   1.00 33.58  ? 234 PHE C N     1 
ATOM   7939  C  CA    . PHE C  3  234 ? -24.987 51.760  10.246  1.00 33.97  ? 234 PHE C CA    1 
ATOM   7940  C  C     . PHE C  3  234 ? -26.054 51.015  9.458   1.00 35.80  ? 234 PHE C C     1 
ATOM   7941  O  O     . PHE C  3  234 ? -26.279 49.815  9.678   1.00 37.53  ? 234 PHE C O     1 
ATOM   7942  C  CB    . PHE C  3  234 ? -25.597 52.462  11.457  1.00 33.31  ? 234 PHE C CB    1 
ATOM   7943  C  CG    . PHE C  3  234 ? -24.610 52.770  12.540  1.00 31.44  ? 234 PHE C CG    1 
ATOM   7944  C  CD1   . PHE C  3  234 ? -24.610 54.004  13.166  1.00 31.98  ? 234 PHE C CD1   1 
ATOM   7945  C  CD2   . PHE C  3  234 ? -23.663 51.829  12.920  1.00 30.47  ? 234 PHE C CD2   1 
ATOM   7946  C  CE1   . PHE C  3  234 ? -23.676 54.301  14.156  1.00 32.68  ? 234 PHE C CE1   1 
ATOM   7947  C  CE2   . PHE C  3  234 ? -22.724 52.115  13.909  1.00 30.60  ? 234 PHE C CE2   1 
ATOM   7948  C  CZ    . PHE C  3  234 ? -22.730 53.355  14.525  1.00 30.50  ? 234 PHE C CZ    1 
ATOM   7949  N  N     . LEU C  3  235 ? -26.710 51.722  8.539   1.00 35.88  ? 235 LEU C N     1 
ATOM   7950  C  CA    . LEU C  3  235 ? -27.743 51.113  7.700   1.00 34.15  ? 235 LEU C CA    1 
ATOM   7951  C  C     . LEU C  3  235 ? -27.088 50.092  6.791   1.00 33.46  ? 235 LEU C C     1 
ATOM   7952  O  O     . LEU C  3  235 ? -27.620 49.018  6.560   1.00 33.46  ? 235 LEU C O     1 
ATOM   7953  C  CB    . LEU C  3  235 ? -28.439 52.172  6.859   1.00 35.37  ? 235 LEU C CB    1 
ATOM   7954  C  CG    . LEU C  3  235 ? -29.521 51.634  5.925   1.00 38.15  ? 235 LEU C CG    1 
ATOM   7955  C  CD1   . LEU C  3  235 ? -30.495 50.736  6.697   1.00 38.83  ? 235 LEU C CD1   1 
ATOM   7956  C  CD2   . LEU C  3  235 ? -30.233 52.804  5.285   1.00 36.17  ? 235 LEU C CD2   1 
ATOM   7957  N  N     . PHE C  3  236 ? -25.910 50.440  6.292   1.00 33.72  ? 236 PHE C N     1 
ATOM   7958  C  CA    . PHE C  3  236 ? -25.147 49.557  5.424   1.00 33.54  ? 236 PHE C CA    1 
ATOM   7959  C  C     . PHE C  3  236 ? -24.774 48.291  6.195   1.00 33.88  ? 236 PHE C C     1 
ATOM   7960  O  O     . PHE C  3  236 ? -24.853 47.187  5.659   1.00 34.85  ? 236 PHE C O     1 
ATOM   7961  C  CB    . PHE C  3  236 ? -23.880 50.275  4.924   1.00 30.94  ? 236 PHE C CB    1 
ATOM   7962  C  CG    . PHE C  3  236 ? -22.915 49.379  4.192   1.00 29.32  ? 236 PHE C CG    1 
ATOM   7963  C  CD1   . PHE C  3  236 ? -23.071 49.135  2.829   1.00 28.14  ? 236 PHE C CD1   1 
ATOM   7964  C  CD2   . PHE C  3  236 ? -21.847 48.790  4.861   1.00 26.78  ? 236 PHE C CD2   1 
ATOM   7965  C  CE1   . PHE C  3  236 ? -22.189 48.322  2.149   1.00 27.59  ? 236 PHE C CE1   1 
ATOM   7966  C  CE2   . PHE C  3  236 ? -20.958 47.975  4.190   1.00 27.59  ? 236 PHE C CE2   1 
ATOM   7967  C  CZ    . PHE C  3  236 ? -21.126 47.739  2.829   1.00 30.11  ? 236 PHE C CZ    1 
ATOM   7968  N  N     . MET C  3  237 ? -24.346 48.455  7.442   1.00 33.78  ? 237 MET C N     1 
ATOM   7969  C  CA    . MET C  3  237 ? -23.963 47.311  8.258   1.00 35.70  ? 237 MET C CA    1 
ATOM   7970  C  C     . MET C  3  237 ? -25.154 46.400  8.624   1.00 37.21  ? 237 MET C C     1 
ATOM   7971  O  O     . MET C  3  237 ? -25.029 45.165  8.648   1.00 33.66  ? 237 MET C O     1 
ATOM   7972  C  CB    . MET C  3  237 ? -23.259 47.790  9.516   1.00 38.92  ? 237 MET C CB    1 
ATOM   7973  C  CG    . MET C  3  237 ? -21.794 48.102  9.331   1.00 41.09  ? 237 MET C CG    1 
ATOM   7974  S  SD    . MET C  3  237 ? -21.138 48.829  10.832  1.00 47.08  ? 237 MET C SD    1 
ATOM   7975  C  CE    . MET C  3  237 ? -19.442 49.074  10.357  1.00 43.45  ? 237 MET C CE    1 
ATOM   7976  N  N     . LEU C  3  238 ? -26.307 47.012  8.906   1.00 36.79  ? 238 LEU C N     1 
ATOM   7977  C  CA    . LEU C  3  238 ? -27.506 46.256  9.251   1.00 36.04  ? 238 LEU C CA    1 
ATOM   7978  C  C     . LEU C  3  238 ? -27.845 45.294  8.105   1.00 37.16  ? 238 LEU C C     1 
ATOM   7979  O  O     . LEU C  3  238 ? -27.969 44.079  8.300   1.00 38.88  ? 238 LEU C O     1 
ATOM   7980  C  CB    . LEU C  3  238 ? -28.679 47.210  9.465   1.00 35.14  ? 238 LEU C CB    1 
ATOM   7981  C  CG    . LEU C  3  238 ? -29.800 46.895  10.458  1.00 35.75  ? 238 LEU C CG    1 
ATOM   7982  C  CD1   . LEU C  3  238 ? -31.092 47.537  9.971   1.00 30.19  ? 238 LEU C CD1   1 
ATOM   7983  C  CD2   . LEU C  3  238 ? -29.987 45.409  10.638  1.00 34.01  ? 238 LEU C CD2   1 
ATOM   7984  N  N     . ILE C  3  239 ? -27.947 45.836  6.897   1.00 35.76  ? 239 ILE C N     1 
ATOM   7985  C  CA    . ILE C  3  239 ? -28.281 45.023  5.745   1.00 35.48  ? 239 ILE C CA    1 
ATOM   7986  C  C     . ILE C  3  239 ? -27.235 43.944  5.442   1.00 36.21  ? 239 ILE C C     1 
ATOM   7987  O  O     . ILE C  3  239 ? -27.583 42.795  5.155   1.00 37.50  ? 239 ILE C O     1 
ATOM   7988  C  CB    . ILE C  3  239 ? -28.583 45.903  4.514   1.00 36.53  ? 239 ILE C CB    1 
ATOM   7989  C  CG1   . ILE C  3  239 ? -29.617 46.963  4.902   1.00 33.74  ? 239 ILE C CG1   1 
ATOM   7990  C  CG2   . ILE C  3  239 ? -29.139 45.040  3.364   1.00 35.47  ? 239 ILE C CG2   1 
ATOM   7991  C  CD1   . ILE C  3  239 ? -30.127 47.751  3.762   1.00 36.14  ? 239 ILE C CD1   1 
ATOM   7992  N  N     . LEU C  3  240 ? -25.956 44.287  5.538   1.00 34.36  ? 240 LEU C N     1 
ATOM   7993  C  CA    . LEU C  3  240 ? -24.922 43.292  5.288   1.00 34.41  ? 240 LEU C CA    1 
ATOM   7994  C  C     . LEU C  3  240 ? -25.030 42.172  6.332   1.00 35.74  ? 240 LEU C C     1 
ATOM   7995  O  O     . LEU C  3  240 ? -24.838 40.997  6.019   1.00 36.91  ? 240 LEU C O     1 
ATOM   7996  C  CB    . LEU C  3  240 ? -23.538 43.939  5.333   1.00 33.79  ? 240 LEU C CB    1 
ATOM   7997  C  CG    . LEU C  3  240 ? -22.317 43.058  5.060   1.00 34.65  ? 240 LEU C CG    1 
ATOM   7998  C  CD1   . LEU C  3  240 ? -22.495 42.278  3.777   1.00 35.96  ? 240 LEU C CD1   1 
ATOM   7999  C  CD2   . LEU C  3  240 ? -21.065 43.920  4.971   1.00 36.47  ? 240 LEU C CD2   1 
ATOM   8000  N  N     . ALA C  3  241 ? -25.401 42.544  7.558   1.00 36.77  ? 241 ALA C N     1 
ATOM   8001  C  CA    . ALA C  3  241 ? -25.541 41.596  8.656   1.00 36.13  ? 241 ALA C CA    1 
ATOM   8002  C  C     . ALA C  3  241 ? -26.612 40.572  8.339   1.00 37.36  ? 241 ALA C C     1 
ATOM   8003  O  O     . ALA C  3  241 ? -26.405 39.369  8.563   1.00 36.11  ? 241 ALA C O     1 
ATOM   8004  C  CB    . ALA C  3  241 ? -25.874 42.320  9.942   1.00 36.09  ? 241 ALA C CB    1 
ATOM   8005  N  N     . LEU C  3  242 ? -27.736 41.047  7.793   1.00 37.88  ? 242 LEU C N     1 
ATOM   8006  C  CA    . LEU C  3  242 ? -28.853 40.173  7.422   1.00 38.98  ? 242 LEU C CA    1 
ATOM   8007  C  C     . LEU C  3  242 ? -28.428 39.101  6.423   1.00 39.21  ? 242 LEU C C     1 
ATOM   8008  O  O     . LEU C  3  242 ? -28.808 37.938  6.562   1.00 40.70  ? 242 LEU C O     1 
ATOM   8009  C  CB    . LEU C  3  242 ? -30.035 40.981  6.885   1.00 40.49  ? 242 LEU C CB    1 
ATOM   8010  C  CG    . LEU C  3  242 ? -30.689 41.964  7.872   1.00 41.82  ? 242 LEU C CG    1 
ATOM   8011  C  CD1   . LEU C  3  242 ? -31.744 42.773  7.165   1.00 42.15  ? 242 LEU C CD1   1 
ATOM   8012  C  CD2   . LEU C  3  242 ? -31.320 41.215  9.015   1.00 42.84  ? 242 LEU C CD2   1 
ATOM   8013  N  N     . PHE C  3  243 ? -27.598 39.462  5.449   1.00 38.09  ? 243 PHE C N     1 
ATOM   8014  C  CA    . PHE C  3  243 ? -27.126 38.458  4.490   1.00 38.22  ? 243 PHE C CA    1 
ATOM   8015  C  C     . PHE C  3  243 ? -26.095 37.521  5.112   1.00 38.83  ? 243 PHE C C     1 
ATOM   8016  O  O     . PHE C  3  243 ? -26.197 36.315  4.973   1.00 40.62  ? 243 PHE C O     1 
ATOM   8017  C  CB    . PHE C  3  243 ? -26.524 39.105  3.234   1.00 36.80  ? 243 PHE C CB    1 
ATOM   8018  C  CG    . PHE C  3  243 ? -27.551 39.586  2.251   1.00 35.70  ? 243 PHE C CG    1 
ATOM   8019  C  CD1   . PHE C  3  243 ? -28.257 40.771  2.479   1.00 32.32  ? 243 PHE C CD1   1 
ATOM   8020  C  CD2   . PHE C  3  243 ? -27.843 38.830  1.123   1.00 31.92  ? 243 PHE C CD2   1 
ATOM   8021  C  CE1   . PHE C  3  243 ? -29.241 41.190  1.605   1.00 32.85  ? 243 PHE C CE1   1 
ATOM   8022  C  CE2   . PHE C  3  243 ? -28.826 39.238  0.239   1.00 33.31  ? 243 PHE C CE2   1 
ATOM   8023  C  CZ    . PHE C  3  243 ? -29.534 40.424  0.477   1.00 33.66  ? 243 PHE C CZ    1 
ATOM   8024  N  N     . VAL C  3  244 ? -25.124 38.078  5.833   1.00 37.79  ? 244 VAL C N     1 
ATOM   8025  C  CA    . VAL C  3  244 ? -24.071 37.281  6.437   1.00 35.51  ? 244 VAL C CA    1 
ATOM   8026  C  C     . VAL C  3  244 ? -24.555 36.207  7.396   1.00 36.93  ? 244 VAL C C     1 
ATOM   8027  O  O     . VAL C  3  244 ? -24.089 35.077  7.342   1.00 36.99  ? 244 VAL C O     1 
ATOM   8028  C  CB    . VAL C  3  244 ? -23.036 38.183  7.135   1.00 36.57  ? 244 VAL C CB    1 
ATOM   8029  C  CG1   . VAL C  3  244 ? -21.979 37.343  7.860   1.00 33.66  ? 244 VAL C CG1   1 
ATOM   8030  C  CG2   . VAL C  3  244 ? -22.368 39.093  6.105   1.00 36.04  ? 244 VAL C CG2   1 
ATOM   8031  N  N     . PHE C  3  245 ? -25.478 36.560  8.281   1.00 39.12  ? 245 PHE C N     1 
ATOM   8032  C  CA    . PHE C  3  245 ? -25.995 35.605  9.260   1.00 39.74  ? 245 PHE C CA    1 
ATOM   8033  C  C     . PHE C  3  245 ? -27.245 34.819  8.833   1.00 41.32  ? 245 PHE C C     1 
ATOM   8034  O  O     . PHE C  3  245 ? -27.358 33.623  9.108   1.00 42.44  ? 245 PHE C O     1 
ATOM   8035  C  CB    . PHE C  3  245 ? -26.243 36.317  10.593  1.00 36.59  ? 245 PHE C CB    1 
ATOM   8036  C  CG    . PHE C  3  245 ? -24.996 36.847  11.228  1.00 37.22  ? 245 PHE C CG    1 
ATOM   8037  C  CD1   . PHE C  3  245 ? -24.598 38.160  11.012  1.00 39.08  ? 245 PHE C CD1   1 
ATOM   8038  C  CD2   . PHE C  3  245 ? -24.193 36.025  12.015  1.00 36.40  ? 245 PHE C CD2   1 
ATOM   8039  C  CE1   . PHE C  3  245 ? -23.416 38.648  11.567  1.00 36.64  ? 245 PHE C CE1   1 
ATOM   8040  C  CE2   . PHE C  3  245 ? -23.008 36.505  12.573  1.00 35.59  ? 245 PHE C CE2   1 
ATOM   8041  C  CZ    . PHE C  3  245 ? -22.620 37.818  12.345  1.00 36.37  ? 245 PHE C CZ    1 
ATOM   8042  N  N     . TYR C  3  246 ? -28.163 35.480  8.140   1.00 41.14  ? 246 TYR C N     1 
ATOM   8043  C  CA    . TYR C  3  246 ? -29.395 34.836  7.721   1.00 43.41  ? 246 TYR C CA    1 
ATOM   8044  C  C     . TYR C  3  246 ? -29.506 34.270  6.301   1.00 44.53  ? 246 TYR C C     1 
ATOM   8045  O  O     . TYR C  3  246 ? -30.304 33.364  6.071   1.00 46.07  ? 246 TYR C O     1 
ATOM   8046  C  CB    . TYR C  3  246 ? -30.572 35.765  8.003   1.00 41.98  ? 246 TYR C CB    1 
ATOM   8047  C  CG    . TYR C  3  246 ? -30.752 36.028  9.474   1.00 44.24  ? 246 TYR C CG    1 
ATOM   8048  C  CD1   . TYR C  3  246 ? -30.476 37.280  10.025  1.00 45.41  ? 246 TYR C CD1   1 
ATOM   8049  C  CD2   . TYR C  3  246 ? -31.168 35.010  10.329  1.00 44.81  ? 246 TYR C CD2   1 
ATOM   8050  C  CE1   . TYR C  3  246 ? -30.608 37.504  11.400  1.00 46.05  ? 246 TYR C CE1   1 
ATOM   8051  C  CE2   . TYR C  3  246 ? -31.301 35.223  11.689  1.00 45.74  ? 246 TYR C CE2   1 
ATOM   8052  C  CZ    . TYR C  3  246 ? -31.023 36.467  12.220  1.00 45.78  ? 246 TYR C CZ    1 
ATOM   8053  O  OH    . TYR C  3  246 ? -31.176 36.660  13.568  1.00 48.41  ? 246 TYR C OH    1 
ATOM   8054  N  N     . SER C  3  247 ? -28.694 34.752  5.364   1.00 44.05  ? 247 SER C N     1 
ATOM   8055  C  CA    . SER C  3  247 ? -28.787 34.285  3.979   1.00 42.36  ? 247 SER C CA    1 
ATOM   8056  C  C     . SER C  3  247 ? -27.445 34.431  3.252   1.00 41.91  ? 247 SER C C     1 
ATOM   8057  O  O     . SER C  3  247 ? -27.384 34.960  2.142   1.00 41.90  ? 247 SER C O     1 
ATOM   8058  C  CB    . SER C  3  247 ? -29.847 35.132  3.273   1.00 42.52  ? 247 SER C CB    1 
ATOM   8059  O  OG    . SER C  3  247 ? -30.385 34.453  2.165   1.00 45.20  ? 247 SER C OG    1 
ATOM   8060  N  N     . PRO C  3  248 ? -26.366 33.888  3.838   1.00 40.84  ? 248 PRO C N     1 
ATOM   8061  C  CA    . PRO C  3  248 ? -24.994 33.929  3.323   1.00 40.54  ? 248 PRO C CA    1 
ATOM   8062  C  C     . PRO C  3  248 ? -24.701 33.454  1.901   1.00 41.32  ? 248 PRO C C     1 
ATOM   8063  O  O     . PRO C  3  248 ? -23.716 33.892  1.289   1.00 43.17  ? 248 PRO C O     1 
ATOM   8064  C  CB    . PRO C  3  248 ? -24.236 33.093  4.349   1.00 40.17  ? 248 PRO C CB    1 
ATOM   8065  C  CG    . PRO C  3  248 ? -25.256 32.086  4.776   1.00 39.09  ? 248 PRO C CG    1 
ATOM   8066  C  CD    . PRO C  3  248 ? -26.449 32.966  4.988   1.00 40.01  ? 248 PRO C CD    1 
ATOM   8067  N  N     . ASN C  3  249 ? -25.533 32.565  1.369   1.00 39.46  ? 249 ASN C N     1 
ATOM   8068  C  CA    . ASN C  3  249 ? -25.289 32.044  0.029   1.00 38.58  ? 249 ASN C CA    1 
ATOM   8069  C  C     . ASN C  3  249 ? -26.248 32.491  -1.079  1.00 38.70  ? 249 ASN C C     1 
ATOM   8070  O  O     . ASN C  3  249 ? -26.153 32.011  -2.211  1.00 40.49  ? 249 ASN C O     1 
ATOM   8071  C  CB    . ASN C  3  249 ? -25.205 30.524  0.078   1.00 34.63  ? 249 ASN C CB    1 
ATOM   8072  C  CG    . ASN C  3  249 ? -24.060 30.038  0.937   1.00 38.11  ? 249 ASN C CG    1 
ATOM   8073  O  OD1   . ASN C  3  249 ? -22.899 30.124  0.546   1.00 37.35  ? 249 ASN C OD1   1 
ATOM   8074  N  ND2   . ASN C  3  249 ? -24.382 29.521  2.116   1.00 38.02  ? 249 ASN C ND2   1 
ATOM   8075  N  N     . THR C  3  250 ? -27.158 33.406  -0.768  1.00 37.31  ? 250 THR C N     1 
ATOM   8076  C  CA    . THR C  3  250 ? -28.101 33.896  -1.756  1.00 40.25  ? 250 THR C CA    1 
ATOM   8077  C  C     . THR C  3  250 ? -27.443 34.609  -2.946  1.00 42.16  ? 250 THR C C     1 
ATOM   8078  O  O     . THR C  3  250 ? -27.923 34.502  -4.075  1.00 44.98  ? 250 THR C O     1 
ATOM   8079  C  CB    . THR C  3  250 ? -29.150 34.809  -1.098  1.00 43.43  ? 250 THR C CB    1 
ATOM   8080  O  OG1   . THR C  3  250 ? -29.984 34.010  -0.251  1.00 46.91  ? 250 THR C OG1   1 
ATOM   8081  C  CG2   . THR C  3  250 ? -30.018 35.517  -2.142  1.00 42.03  ? 250 THR C CG2   1 
ATOM   8082  N  N     . LEU C  3  251 ? -26.327 35.289  -2.705  1.00 42.14  ? 251 LEU C N     1 
ATOM   8083  C  CA    . LEU C  3  251 ? -25.620 36.008  -3.758  1.00 42.65  ? 251 LEU C CA    1 
ATOM   8084  C  C     . LEU C  3  251 ? -24.467 35.215  -4.364  1.00 43.98  ? 251 LEU C C     1 
ATOM   8085  O  O     . LEU C  3  251 ? -23.615 35.780  -5.050  1.00 48.34  ? 251 LEU C O     1 
ATOM   8086  C  CB    . LEU C  3  251 ? -25.114 37.350  -3.226  1.00 40.63  ? 251 LEU C CB    1 
ATOM   8087  C  CG    . LEU C  3  251 ? -26.200 38.274  -2.688  1.00 40.39  ? 251 LEU C CG    1 
ATOM   8088  C  CD1   . LEU C  3  251 ? -25.567 39.444  -1.960  1.00 40.85  ? 251 LEU C CD1   1 
ATOM   8089  C  CD2   . LEU C  3  251 ? -27.093 38.739  -3.825  1.00 38.49  ? 251 LEU C CD2   1 
ATOM   8090  N  N     . GLY C  3  252 ? -24.423 33.919  -4.091  1.00 45.09  ? 252 GLY C N     1 
ATOM   8091  C  CA    . GLY C  3  252 ? -23.365 33.080  -4.632  1.00 48.00  ? 252 GLY C CA    1 
ATOM   8092  C  C     . GLY C  3  252 ? -23.924 32.044  -5.586  1.00 49.81  ? 252 GLY C C     1 
ATOM   8093  O  O     . GLY C  3  252 ? -25.087 32.119  -5.968  1.00 52.75  ? 252 GLY C O     1 
ATOM   8094  N  N     . HIS C  3  253 ? -23.106 31.075  -5.978  1.00 52.41  ? 253 HIS C N     1 
ATOM   8095  C  CA    . HIS C  3  253 ? -23.554 30.024  -6.894  1.00 53.79  ? 253 HIS C CA    1 
ATOM   8096  C  C     . HIS C  3  253 ? -23.256 28.655  -6.288  1.00 50.32  ? 253 HIS C C     1 
ATOM   8097  O  O     . HIS C  3  253 ? -22.114 28.368  -5.915  1.00 48.20  ? 253 HIS C O     1 
ATOM   8098  C  CB    . HIS C  3  253 ? -22.824 30.109  -8.243  1.00 62.95  ? 253 HIS C CB    1 
ATOM   8099  C  CG    . HIS C  3  253 ? -22.585 31.504  -8.729  1.00 71.32  ? 253 HIS C CG    1 
ATOM   8100  N  ND1   . HIS C  3  253 ? -23.559 32.261  -9.348  1.00 74.62  ? 253 HIS C ND1   1 
ATOM   8101  C  CD2   . HIS C  3  253 ? -21.475 32.278  -8.686  1.00 73.84  ? 253 HIS C CD2   1 
ATOM   8102  C  CE1   . HIS C  3  253 ? -23.057 33.444  -9.662  1.00 76.03  ? 253 HIS C CE1   1 
ATOM   8103  N  NE2   . HIS C  3  253 ? -21.794 33.480  -9.273  1.00 76.46  ? 253 HIS C NE2   1 
ATOM   8104  N  N     . PRO C  3  254 ? -24.260 27.766  -6.268  1.00 47.27  ? 254 PRO C N     1 
ATOM   8105  C  CA    . PRO C  3  254 ? -24.131 26.412  -5.719  1.00 45.56  ? 254 PRO C CA    1 
ATOM   8106  C  C     . PRO C  3  254 ? -22.989 25.632  -6.359  1.00 44.42  ? 254 PRO C C     1 
ATOM   8107  O  O     . PRO C  3  254 ? -22.351 24.807  -5.709  1.00 43.57  ? 254 PRO C O     1 
ATOM   8108  C  CB    . PRO C  3  254 ? -25.477 25.783  -6.061  1.00 45.76  ? 254 PRO C CB    1 
ATOM   8109  C  CG    . PRO C  3  254 ? -26.412 26.955  -6.032  1.00 45.60  ? 254 PRO C CG    1 
ATOM   8110  C  CD    . PRO C  3  254 ? -25.624 27.999  -6.769  1.00 45.44  ? 254 PRO C CD    1 
ATOM   8111  N  N     . ASP C  3  255 ? -22.706 25.917  -7.625  1.00 43.82  ? 255 ASP C N     1 
ATOM   8112  C  CA    . ASP C  3  255 ? -21.642 25.201  -8.320  1.00 43.45  ? 255 ASP C CA    1 
ATOM   8113  C  C     . ASP C  3  255 ? -20.265 25.431  -7.741  1.00 41.76  ? 255 ASP C C     1 
ATOM   8114  O  O     . ASP C  3  255 ? -19.327 24.693  -8.052  1.00 40.88  ? 255 ASP C O     1 
ATOM   8115  C  CB    . ASP C  3  255 ? -21.659 25.514  -9.818  1.00 44.93  ? 255 ASP C CB    1 
ATOM   8116  C  CG    . ASP C  3  255 ? -22.749 24.770  -10.549 1.00 45.11  ? 255 ASP C CG    1 
ATOM   8117  O  OD1   . ASP C  3  255 ? -22.811 23.530  -10.430 1.00 47.92  ? 255 ASP C OD1   1 
ATOM   8118  O  OD2   . ASP C  3  255 ? -23.545 25.423  -11.242 1.00 50.47  ? 255 ASP C OD2   1 
ATOM   8119  N  N     . ASN C  3  256 ? -20.131 26.457  -6.904  1.00 41.18  ? 256 ASN C N     1 
ATOM   8120  C  CA    . ASN C  3  256 ? -18.831 26.725  -6.303  1.00 40.27  ? 256 ASN C CA    1 
ATOM   8121  C  C     . ASN C  3  256 ? -18.566 25.911  -5.046  1.00 39.13  ? 256 ASN C C     1 
ATOM   8122  O  O     . ASN C  3  256 ? -17.490 25.993  -4.459  1.00 39.17  ? 256 ASN C O     1 
ATOM   8123  C  CB    . ASN C  3  256 ? -18.582 28.214  -6.100  1.00 41.09  ? 256 ASN C CB    1 
ATOM   8124  C  CG    . ASN C  3  256 ? -17.452 28.728  -6.975  1.00 41.07  ? 256 ASN C CG    1 
ATOM   8125  O  OD1   . ASN C  3  256 ? -16.894 27.992  -7.796  1.00 38.70  ? 256 ASN C OD1   1 
ATOM   8126  N  ND2   . ASN C  3  256 ? -17.105 29.994  -6.799  1.00 44.04  ? 256 ASN C ND2   1 
ATOM   8127  N  N     . TYR C  3  257 ? -19.554 25.109  -4.653  1.00 38.59  ? 257 TYR C N     1 
ATOM   8128  C  CA    . TYR C  3  257 ? -19.398 24.204  -3.523  1.00 37.73  ? 257 TYR C CA    1 
ATOM   8129  C  C     . TYR C  3  257 ? -19.035 22.828  -4.075  1.00 38.82  ? 257 TYR C C     1 
ATOM   8130  O  O     . TYR C  3  257 ? -19.138 21.829  -3.375  1.00 41.65  ? 257 TYR C O     1 
ATOM   8131  C  CB    . TYR C  3  257 ? -20.651 24.140  -2.665  1.00 34.09  ? 257 TYR C CB    1 
ATOM   8132  C  CG    . TYR C  3  257 ? -20.742 25.274  -1.673  1.00 35.65  ? 257 TYR C CG    1 
ATOM   8133  C  CD1   . TYR C  3  257 ? -21.797 26.195  -1.717  1.00 34.43  ? 257 TYR C CD1   1 
ATOM   8134  C  CD2   . TYR C  3  257 ? -19.778 25.424  -0.678  1.00 34.98  ? 257 TYR C CD2   1 
ATOM   8135  C  CE1   . TYR C  3  257 ? -21.886 27.231  -0.788  1.00 33.25  ? 257 TYR C CE1   1 
ATOM   8136  C  CE2   . TYR C  3  257 ? -19.857 26.453  0.250   1.00 34.48  ? 257 TYR C CE2   1 
ATOM   8137  C  CZ    . TYR C  3  257 ? -20.911 27.346  0.191   1.00 35.92  ? 257 TYR C CZ    1 
ATOM   8138  O  OH    . TYR C  3  257 ? -20.994 28.349  1.126   1.00 40.78  ? 257 TYR C OH    1 
ATOM   8139  N  N     . ILE C  3  258 ? -18.640 22.796  -5.351  1.00 37.78  ? 258 ILE C N     1 
ATOM   8140  C  CA    . ILE C  3  258 ? -18.206 21.582  -6.039  1.00 36.84  ? 258 ILE C CA    1 
ATOM   8141  C  C     . ILE C  3  258 ? -16.793 21.910  -6.521  1.00 37.14  ? 258 ILE C C     1 
ATOM   8142  O  O     . ILE C  3  258 ? -16.576 22.922  -7.180  1.00 37.93  ? 258 ILE C O     1 
ATOM   8143  C  CB    . ILE C  3  258 ? -19.062 21.285  -7.292  1.00 38.37  ? 258 ILE C CB    1 
ATOM   8144  C  CG1   . ILE C  3  258 ? -20.530 21.117  -6.924  1.00 39.40  ? 258 ILE C CG1   1 
ATOM   8145  C  CG2   . ILE C  3  258 ? -18.564 20.034  -8.005  1.00 37.18  ? 258 ILE C CG2   1 
ATOM   8146  C  CD1   . ILE C  3  258 ? -21.447 20.980  -8.158  1.00 42.59  ? 258 ILE C CD1   1 
ATOM   8147  N  N     . PRO C  3  259 ? -15.813 21.069  -6.189  1.00 36.97  ? 259 PRO C N     1 
ATOM   8148  C  CA    . PRO C  3  259 ? -14.416 21.278  -6.593  1.00 36.91  ? 259 PRO C CA    1 
ATOM   8149  C  C     . PRO C  3  259 ? -14.266 21.378  -8.108  1.00 37.80  ? 259 PRO C C     1 
ATOM   8150  O  O     . PRO C  3  259 ? -14.936 20.672  -8.848  1.00 40.04  ? 259 PRO C O     1 
ATOM   8151  C  CB    . PRO C  3  259 ? -13.721 20.024  -6.065  1.00 34.79  ? 259 PRO C CB    1 
ATOM   8152  C  CG    . PRO C  3  259 ? -14.530 19.683  -4.875  1.00 34.32  ? 259 PRO C CG    1 
ATOM   8153  C  CD    . PRO C  3  259 ? -15.944 19.866  -5.355  1.00 35.82  ? 259 PRO C CD    1 
ATOM   8154  N  N     . GLY C  3  260 ? -13.367 22.242  -8.559  1.00 39.75  ? 260 GLY C N     1 
ATOM   8155  C  CA    . GLY C  3  260 ? -13.145 22.416  -9.983  1.00 40.65  ? 260 GLY C CA    1 
ATOM   8156  C  C     . GLY C  3  260 ? -12.794 21.122  -10.686 1.00 41.10  ? 260 GLY C C     1 
ATOM   8157  O  O     . GLY C  3  260 ? -12.048 20.312  -10.151 1.00 40.78  ? 260 GLY C O     1 
ATOM   8158  N  N     . ASN C  3  261 ? -13.320 20.945  -11.895 1.00 42.74  ? 261 ASN C N     1 
ATOM   8159  C  CA    . ASN C  3  261 ? -13.091 19.743  -12.699 1.00 43.25  ? 261 ASN C CA    1 
ATOM   8160  C  C     . ASN C  3  261 ? -12.699 20.139  -14.132 1.00 45.08  ? 261 ASN C C     1 
ATOM   8161  O  O     . ASN C  3  261 ? -13.529 20.625  -14.899 1.00 46.70  ? 261 ASN C O     1 
ATOM   8162  C  CB    . ASN C  3  261 ? -14.381 18.929  -12.716 1.00 41.79  ? 261 ASN C CB    1 
ATOM   8163  C  CG    . ASN C  3  261 ? -14.213 17.569  -13.348 1.00 42.53  ? 261 ASN C CG    1 
ATOM   8164  O  OD1   . ASN C  3  261 ? -13.207 17.283  -14.010 1.00 41.81  ? 261 ASN C OD1   1 
ATOM   8165  N  ND2   . ASN C  3  261 ? -15.211 16.712  -13.147 1.00 39.58  ? 261 ASN C ND2   1 
ATOM   8166  N  N     . PRO C  3  262 ? -11.437 19.904  -14.521 1.00 46.51  ? 262 PRO C N     1 
ATOM   8167  C  CA    . PRO C  3  262 ? -10.915 20.233  -15.853 1.00 47.21  ? 262 PRO C CA    1 
ATOM   8168  C  C     . PRO C  3  262 ? -11.681 19.610  -17.025 1.00 48.04  ? 262 PRO C C     1 
ATOM   8169  O  O     . PRO C  3  262 ? -11.693 20.177  -18.117 1.00 50.90  ? 262 PRO C O     1 
ATOM   8170  C  CB    . PRO C  3  262 ? -9.489  19.679  -15.814 1.00 45.11  ? 262 PRO C CB    1 
ATOM   8171  C  CG    . PRO C  3  262 ? -9.150  19.687  -14.394 1.00 48.07  ? 262 PRO C CG    1 
ATOM   8172  C  CD    . PRO C  3  262 ? -10.412 19.201  -13.738 1.00 48.35  ? 262 PRO C CD    1 
ATOM   8173  N  N     . LEU C  3  263 ? -12.327 18.470  -16.797 1.00 46.30  ? 263 LEU C N     1 
ATOM   8174  C  CA    . LEU C  3  263 ? -13.048 17.765  -17.859 1.00 46.34  ? 263 LEU C CA    1 
ATOM   8175  C  C     . LEU C  3  263 ? -14.550 18.034  -18.013 1.00 47.06  ? 263 LEU C C     1 
ATOM   8176  O  O     . LEU C  3  263 ? -15.150 17.593  -18.994 1.00 47.98  ? 263 LEU C O     1 
ATOM   8177  C  CB    . LEU C  3  263 ? -12.873 16.253  -17.686 1.00 43.70  ? 263 LEU C CB    1 
ATOM   8178  C  CG    . LEU C  3  263 ? -11.502 15.709  -17.320 1.00 42.57  ? 263 LEU C CG    1 
ATOM   8179  C  CD1   . LEU C  3  263 ? -11.559 14.202  -17.291 1.00 42.78  ? 263 LEU C CD1   1 
ATOM   8180  C  CD2   . LEU C  3  263 ? -10.467 16.197  -18.312 1.00 43.34  ? 263 LEU C CD2   1 
ATOM   8181  N  N     . VAL C  3  264 ? -15.162 18.732  -17.058 1.00 47.04  ? 264 VAL C N     1 
ATOM   8182  C  CA    . VAL C  3  264 ? -16.603 18.965  -17.108 1.00 45.09  ? 264 VAL C CA    1 
ATOM   8183  C  C     . VAL C  3  264 ? -17.018 20.380  -16.788 1.00 45.60  ? 264 VAL C C     1 
ATOM   8184  O  O     . VAL C  3  264 ? -16.725 20.881  -15.704 1.00 49.08  ? 264 VAL C O     1 
ATOM   8185  C  CB    . VAL C  3  264 ? -17.340 18.006  -16.119 1.00 44.72  ? 264 VAL C CB    1 
ATOM   8186  C  CG1   . VAL C  3  264 ? -18.786 18.415  -15.928 1.00 44.08  ? 264 VAL C CG1   1 
ATOM   8187  C  CG2   . VAL C  3  264 ? -17.279 16.581  -16.628 1.00 44.50  ? 264 VAL C CG2   1 
ATOM   8188  N  N     . THR C  3  265 ? -17.706 21.020  -17.727 1.00 43.72  ? 265 THR C N     1 
ATOM   8189  C  CA    . THR C  3  265 ? -18.195 22.373  -17.520 1.00 44.26  ? 265 THR C CA    1 
ATOM   8190  C  C     . THR C  3  265 ? -19.671 22.227  -17.181 1.00 46.21  ? 265 THR C C     1 
ATOM   8191  O  O     . THR C  3  265 ? -20.393 21.495  -17.852 1.00 46.37  ? 265 THR C O     1 
ATOM   8192  C  CB    . THR C  3  265 ? -18.035 23.251  -18.784 1.00 44.20  ? 265 THR C CB    1 
ATOM   8193  O  OG1   . THR C  3  265 ? -16.660 23.266  -19.185 1.00 43.46  ? 265 THR C OG1   1 
ATOM   8194  C  CG2   . THR C  3  265 ? -18.490 24.683  -18.510 1.00 41.87  ? 265 THR C CG2   1 
ATOM   8195  N  N     . PRO C  3  266 ? -20.132 22.898  -16.113 1.00 47.31  ? 266 PRO C N     1 
ATOM   8196  C  CA    . PRO C  3  266 ? -21.527 22.845  -15.669 1.00 47.24  ? 266 PRO C CA    1 
ATOM   8197  C  C     . PRO C  3  266 ? -22.515 23.121  -16.789 1.00 48.74  ? 266 PRO C C     1 
ATOM   8198  O  O     . PRO C  3  266 ? -22.251 23.935  -17.666 1.00 48.91  ? 266 PRO C O     1 
ATOM   8199  C  CB    . PRO C  3  266 ? -21.575 23.921  -14.589 1.00 47.44  ? 266 PRO C CB    1 
ATOM   8200  C  CG    . PRO C  3  266 ? -20.229 23.822  -13.984 1.00 47.96  ? 266 PRO C CG    1 
ATOM   8201  C  CD    . PRO C  3  266 ? -19.330 23.728  -15.197 1.00 47.37  ? 266 PRO C CD    1 
ATOM   8202  N  N     . ALA C  3  267 ? -23.655 22.437  -16.739 1.00 51.34  ? 267 ALA C N     1 
ATOM   8203  C  CA    . ALA C  3  267 ? -24.700 22.566  -17.748 1.00 52.78  ? 267 ALA C CA    1 
ATOM   8204  C  C     . ALA C  3  267 ? -25.308 23.952  -17.793 1.00 54.74  ? 267 ALA C C     1 
ATOM   8205  O  O     . ALA C  3  267 ? -25.854 24.360  -18.811 1.00 56.93  ? 267 ALA C O     1 
ATOM   8206  C  CB    . ALA C  3  267 ? -25.780 21.533  -17.513 1.00 52.03  ? 267 ALA C CB    1 
ATOM   8207  N  N     . SER C  3  268 ? -25.232 24.668  -16.681 1.00 56.56  ? 268 SER C N     1 
ATOM   8208  C  CA    . SER C  3  268 ? -25.776 26.016  -16.619 1.00 59.34  ? 268 SER C CA    1 
ATOM   8209  C  C     . SER C  3  268 ? -24.807 26.927  -15.889 1.00 59.67  ? 268 SER C C     1 
ATOM   8210  O  O     . SER C  3  268 ? -24.599 26.803  -14.680 1.00 61.94  ? 268 SER C O     1 
ATOM   8211  C  CB    . SER C  3  268 ? -27.132 26.025  -15.911 1.00 61.11  ? 268 SER C CB    1 
ATOM   8212  O  OG    . SER C  3  268 ? -27.628 27.352  -15.807 1.00 65.14  ? 268 SER C OG    1 
ATOM   8213  N  N     . ILE C  3  269 ? -24.200 27.841  -16.631 1.00 57.88  ? 269 ILE C N     1 
ATOM   8214  C  CA    . ILE C  3  269 ? -23.255 28.759  -16.033 1.00 56.34  ? 269 ILE C CA    1 
ATOM   8215  C  C     . ILE C  3  269 ? -23.829 30.178  -15.949 1.00 55.03  ? 269 ILE C C     1 
ATOM   8216  O  O     . ILE C  3  269 ? -24.277 30.749  -16.945 1.00 54.94  ? 269 ILE C O     1 
ATOM   8217  C  CB    . ILE C  3  269 ? -21.869 28.714  -16.764 1.00 56.31  ? 269 ILE C CB    1 
ATOM   8218  C  CG1   . ILE C  3  269 ? -21.842 29.618  -17.992 1.00 57.14  ? 269 ILE C CG1   1 
ATOM   8219  C  CG2   . ILE C  3  269 ? -21.542 27.297  -17.196 1.00 55.89  ? 269 ILE C CG2   1 
ATOM   8220  C  CD1   . ILE C  3  269 ? -21.291 30.998  -17.696 1.00 56.75  ? 269 ILE C CD1   1 
ATOM   8221  N  N     . VAL C  3  270 ? -23.913 30.686  -14.723 1.00 52.15  ? 270 VAL C N     1 
ATOM   8222  C  CA    . VAL C  3  270 ? -24.411 32.028  -14.461 1.00 49.17  ? 270 VAL C CA    1 
ATOM   8223  C  C     . VAL C  3  270 ? -23.339 32.738  -13.639 1.00 49.32  ? 270 VAL C C     1 
ATOM   8224  O  O     . VAL C  3  270 ? -23.107 32.405  -12.479 1.00 51.14  ? 270 VAL C O     1 
ATOM   8225  C  CB    . VAL C  3  270 ? -25.722 32.001  -13.674 1.00 47.43  ? 270 VAL C CB    1 
ATOM   8226  C  CG1   . VAL C  3  270 ? -26.155 33.401  -13.328 1.00 48.40  ? 270 VAL C CG1   1 
ATOM   8227  C  CG2   . VAL C  3  270 ? -26.796 31.314  -14.477 1.00 49.64  ? 270 VAL C CG2   1 
ATOM   8228  N  N     . PRO C  3  271 ? -22.630 33.695  -14.252 1.00 47.53  ? 271 PRO C N     1 
ATOM   8229  C  CA    . PRO C  3  271 ? -21.573 34.449  -13.578 1.00 44.94  ? 271 PRO C CA    1 
ATOM   8230  C  C     . PRO C  3  271 ? -22.098 35.309  -12.432 1.00 42.14  ? 271 PRO C C     1 
ATOM   8231  O  O     . PRO C  3  271 ? -23.303 35.412  -12.206 1.00 39.93  ? 271 PRO C O     1 
ATOM   8232  C  CB    . PRO C  3  271 ? -21.028 35.334  -14.700 1.00 46.37  ? 271 PRO C CB    1 
ATOM   8233  C  CG    . PRO C  3  271 ? -21.353 34.578  -15.938 1.00 47.91  ? 271 PRO C CG    1 
ATOM   8234  C  CD    . PRO C  3  271 ? -22.744 34.116  -15.656 1.00 47.68  ? 271 PRO C CD    1 
ATOM   8235  N  N     . GLU C  3  272 ? -21.172 35.939  -11.728 1.00 41.09  ? 272 GLU C N     1 
ATOM   8236  C  CA    . GLU C  3  272 ? -21.508 36.822  -10.623 1.00 42.98  ? 272 GLU C CA    1 
ATOM   8237  C  C     . GLU C  3  272 ? -22.489 37.889  -11.123 1.00 41.52  ? 272 GLU C C     1 
ATOM   8238  O  O     . GLU C  3  272 ? -22.299 38.470  -12.193 1.00 43.13  ? 272 GLU C O     1 
ATOM   8239  C  CB    . GLU C  3  272 ? -20.230 37.473  -10.083 1.00 44.77  ? 272 GLU C CB    1 
ATOM   8240  C  CG    . GLU C  3  272 ? -19.280 36.507  -9.387  1.00 50.09  ? 272 GLU C CG    1 
ATOM   8241  C  CD    . GLU C  3  272 ? -19.637 36.281  -7.926  1.00 55.40  ? 272 GLU C CD    1 
ATOM   8242  O  OE1   . GLU C  3  272 ? -19.082 37.009  -7.061  1.00 58.87  ? 272 GLU C OE1   1 
ATOM   8243  O  OE2   . GLU C  3  272 ? -20.463 35.384  -7.639  1.00 56.20  ? 272 GLU C OE2   1 
ATOM   8244  N  N     . TRP C  3  273 ? -23.531 38.141  -10.339 1.00 37.95  ? 273 TRP C N     1 
ATOM   8245  C  CA    . TRP C  3  273 ? -24.555 39.104  -10.692 1.00 35.92  ? 273 TRP C CA    1 
ATOM   8246  C  C     . TRP C  3  273 ? -24.065 40.454  -11.196 1.00 34.81  ? 273 TRP C C     1 
ATOM   8247  O  O     . TRP C  3  273 ? -24.714 41.060  -12.036 1.00 36.20  ? 273 TRP C O     1 
ATOM   8248  C  CB    . TRP C  3  273 ? -25.520 39.300  -9.520  1.00 38.12  ? 273 TRP C CB    1 
ATOM   8249  C  CG    . TRP C  3  273 ? -24.972 40.138  -8.382  1.00 39.51  ? 273 TRP C CG    1 
ATOM   8250  C  CD1   . TRP C  3  273 ? -24.360 39.685  -7.246  1.00 39.85  ? 273 TRP C CD1   1 
ATOM   8251  C  CD2   . TRP C  3  273 ? -24.987 41.570  -8.284  1.00 39.11  ? 273 TRP C CD2   1 
ATOM   8252  N  NE1   . TRP C  3  273 ? -23.995 40.745  -6.452  1.00 41.51  ? 273 TRP C NE1   1 
ATOM   8253  C  CE2   . TRP C  3  273 ? -24.367 41.913  -7.064  1.00 40.14  ? 273 TRP C CE2   1 
ATOM   8254  C  CE3   . TRP C  3  273 ? -25.463 42.597  -9.112  1.00 39.26  ? 273 TRP C CE3   1 
ATOM   8255  C  CZ2   . TRP C  3  273 ? -24.205 43.243  -6.651  1.00 38.35  ? 273 TRP C CZ2   1 
ATOM   8256  C  CZ3   . TRP C  3  273 ? -25.299 43.923  -8.701  1.00 39.91  ? 273 TRP C CZ3   1 
ATOM   8257  C  CH2   . TRP C  3  273 ? -24.676 44.229  -7.481  1.00 38.91  ? 273 TRP C CH2   1 
ATOM   8258  N  N     . TYR C  3  274 ? -22.941 40.937  -10.676 1.00 35.26  ? 274 TYR C N     1 
ATOM   8259  C  CA    . TYR C  3  274 ? -22.414 42.239  -11.088 1.00 35.06  ? 274 TYR C CA    1 
ATOM   8260  C  C     . TYR C  3  274 ? -21.640 42.191  -12.388 1.00 35.54  ? 274 TYR C C     1 
ATOM   8261  O  O     . TYR C  3  274 ? -21.162 43.217  -12.862 1.00 35.26  ? 274 TYR C O     1 
ATOM   8262  C  CB    . TYR C  3  274 ? -21.569 42.885  -9.983  1.00 34.66  ? 274 TYR C CB    1 
ATOM   8263  C  CG    . TYR C  3  274 ? -20.501 41.990  -9.416  1.00 33.53  ? 274 TYR C CG    1 
ATOM   8264  C  CD1   . TYR C  3  274 ? -19.273 41.863  -10.045 1.00 31.74  ? 274 TYR C CD1   1 
ATOM   8265  C  CD2   . TYR C  3  274 ? -20.731 41.246  -8.254  1.00 34.73  ? 274 TYR C CD2   1 
ATOM   8266  C  CE1   . TYR C  3  274 ? -18.294 41.013  -9.537  1.00 32.51  ? 274 TYR C CE1   1 
ATOM   8267  C  CE2   . TYR C  3  274 ? -19.752 40.393  -7.733  1.00 31.71  ? 274 TYR C CE2   1 
ATOM   8268  C  CZ    . TYR C  3  274 ? -18.541 40.286  -8.382  1.00 32.27  ? 274 TYR C CZ    1 
ATOM   8269  O  OH    . TYR C  3  274 ? -17.569 39.467  -7.866  1.00 34.19  ? 274 TYR C OH    1 
ATOM   8270  N  N     . LEU C  3  275 ? -21.456 40.992  -12.929 1.00 35.03  ? 275 LEU C N     1 
ATOM   8271  C  CA    . LEU C  3  275 ? -20.778 40.849  -14.214 1.00 36.30  ? 275 LEU C CA    1 
ATOM   8272  C  C     . LEU C  3  275 ? -21.791 40.492  -15.320 1.00 38.05  ? 275 LEU C C     1 
ATOM   8273  O  O     . LEU C  3  275 ? -21.492 40.606  -16.503 1.00 39.58  ? 275 LEU C O     1 
ATOM   8274  C  CB    . LEU C  3  275 ? -19.675 39.787  -14.145 1.00 36.08  ? 275 LEU C CB    1 
ATOM   8275  C  CG    . LEU C  3  275 ? -18.438 40.084  -13.274 1.00 35.47  ? 275 LEU C CG    1 
ATOM   8276  C  CD1   . LEU C  3  275 ? -17.393 39.021  -13.522 1.00 33.69  ? 275 LEU C CD1   1 
ATOM   8277  C  CD2   . LEU C  3  275 ? -17.857 41.447  -13.596 1.00 33.64  ? 275 LEU C CD2   1 
ATOM   8278  N  N     . LEU C  3  276 ? -23.009 40.120  -14.927 1.00 37.83  ? 276 LEU C N     1 
ATOM   8279  C  CA    . LEU C  3  276 ? -24.044 39.726  -15.878 1.00 37.17  ? 276 LEU C CA    1 
ATOM   8280  C  C     . LEU C  3  276 ? -24.277 40.687  -17.043 1.00 37.37  ? 276 LEU C C     1 
ATOM   8281  O  O     . LEU C  3  276 ? -24.347 40.253  -18.185 1.00 36.93  ? 276 LEU C O     1 
ATOM   8282  C  CB    . LEU C  3  276 ? -25.370 39.432  -15.160 1.00 36.87  ? 276 LEU C CB    1 
ATOM   8283  C  CG    . LEU C  3  276 ? -25.460 38.168  -14.294 1.00 35.25  ? 276 LEU C CG    1 
ATOM   8284  C  CD1   . LEU C  3  276 ? -26.839 38.096  -13.632 1.00 29.94  ? 276 LEU C CD1   1 
ATOM   8285  C  CD2   . LEU C  3  276 ? -25.187 36.930  -15.147 1.00 33.88  ? 276 LEU C CD2   1 
ATOM   8286  N  N     . PRO C  3  277 ? -24.404 42.001  -16.773 1.00 37.56  ? 277 PRO C N     1 
ATOM   8287  C  CA    . PRO C  3  277 ? -24.627 42.936  -17.884 1.00 36.31  ? 277 PRO C CA    1 
ATOM   8288  C  C     . PRO C  3  277 ? -23.508 42.873  -18.927 1.00 37.82  ? 277 PRO C C     1 
ATOM   8289  O  O     . PRO C  3  277 ? -23.749 43.020  -20.121 1.00 38.94  ? 277 PRO C O     1 
ATOM   8290  C  CB    . PRO C  3  277 ? -24.657 44.294  -17.186 1.00 35.16  ? 277 PRO C CB    1 
ATOM   8291  C  CG    . PRO C  3  277 ? -25.234 43.956  -15.845 1.00 35.95  ? 277 PRO C CG    1 
ATOM   8292  C  CD    . PRO C  3  277 ? -24.462 42.707  -15.479 1.00 35.26  ? 277 PRO C CD    1 
ATOM   8293  N  N     . PHE C  3  278 ? -22.290 42.614  -18.474 1.00 37.15  ? 278 PHE C N     1 
ATOM   8294  C  CA    . PHE C  3  278 ? -21.161 42.537  -19.372 1.00 37.96  ? 278 PHE C CA    1 
ATOM   8295  C  C     . PHE C  3  278 ? -21.134 41.204  -20.080 1.00 37.90  ? 278 PHE C C     1 
ATOM   8296  O  O     . PHE C  3  278 ? -20.709 41.117  -21.222 1.00 41.71  ? 278 PHE C O     1 
ATOM   8297  C  CB    . PHE C  3  278 ? -19.868 42.789  -18.601 1.00 39.98  ? 278 PHE C CB    1 
ATOM   8298  C  CG    . PHE C  3  278 ? -19.858 44.099  -17.886 1.00 41.44  ? 278 PHE C CG    1 
ATOM   8299  C  CD1   . PHE C  3  278 ? -19.928 44.153  -16.497 1.00 43.16  ? 278 PHE C CD1   1 
ATOM   8300  C  CD2   . PHE C  3  278 ? -19.851 45.291  -18.605 1.00 42.43  ? 278 PHE C CD2   1 
ATOM   8301  C  CE1   . PHE C  3  278 ? -19.997 45.385  -15.828 1.00 43.37  ? 278 PHE C CE1   1 
ATOM   8302  C  CE2   . PHE C  3  278 ? -19.921 46.522  -17.952 1.00 44.29  ? 278 PHE C CE2   1 
ATOM   8303  C  CZ    . PHE C  3  278 ? -19.995 46.566  -16.559 1.00 44.13  ? 278 PHE C CZ    1 
ATOM   8304  N  N     . TYR C  3  279 ? -21.610 40.169  -19.401 1.00 37.83  ? 279 TYR C N     1 
ATOM   8305  C  CA    . TYR C  3  279 ? -21.672 38.814  -19.955 1.00 37.78  ? 279 TYR C CA    1 
ATOM   8306  C  C     . TYR C  3  279 ? -22.691 38.785  -21.107 1.00 38.42  ? 279 TYR C C     1 
ATOM   8307  O  O     . TYR C  3  279 ? -22.467 38.150  -22.136 1.00 36.95  ? 279 TYR C O     1 
ATOM   8308  C  CB    . TYR C  3  279 ? -22.085 37.847  -18.843 1.00 37.24  ? 279 TYR C CB    1 
ATOM   8309  C  CG    . TYR C  3  279 ? -22.339 36.416  -19.255 1.00 37.53  ? 279 TYR C CG    1 
ATOM   8310  C  CD1   . TYR C  3  279 ? -21.303 35.590  -19.692 1.00 37.80  ? 279 TYR C CD1   1 
ATOM   8311  C  CD2   . TYR C  3  279 ? -23.604 35.855  -19.104 1.00 39.07  ? 279 TYR C CD2   1 
ATOM   8312  C  CE1   . TYR C  3  279 ? -21.524 34.236  -19.953 1.00 37.34  ? 279 TYR C CE1   1 
ATOM   8313  C  CE2   . TYR C  3  279 ? -23.833 34.508  -19.360 1.00 39.93  ? 279 TYR C CE2   1 
ATOM   8314  C  CZ    . TYR C  3  279 ? -22.791 33.707  -19.780 1.00 39.89  ? 279 TYR C CZ    1 
ATOM   8315  O  OH    . TYR C  3  279 ? -23.036 32.375  -20.014 1.00 43.04  ? 279 TYR C OH    1 
ATOM   8316  N  N     . ALA C  3  280 ? -23.796 39.499  -20.928 1.00 37.03  ? 280 ALA C N     1 
ATOM   8317  C  CA    . ALA C  3  280 ? -24.827 39.576  -21.944 1.00 40.12  ? 280 ALA C CA    1 
ATOM   8318  C  C     . ALA C  3  280 ? -24.314 40.282  -23.204 1.00 41.99  ? 280 ALA C C     1 
ATOM   8319  O  O     . ALA C  3  280 ? -24.606 39.853  -24.317 1.00 44.48  ? 280 ALA C O     1 
ATOM   8320  C  CB    . ALA C  3  280 ? -26.053 40.299  -21.393 1.00 39.60  ? 280 ALA C CB    1 
ATOM   8321  N  N     . ILE C  3  281 ? -23.559 41.365  -23.018 1.00 42.29  ? 281 ILE C N     1 
ATOM   8322  C  CA    . ILE C  3  281 ? -23.004 42.128  -24.123 1.00 40.51  ? 281 ILE C CA    1 
ATOM   8323  C  C     . ILE C  3  281 ? -22.050 41.252  -24.902 1.00 42.32  ? 281 ILE C C     1 
ATOM   8324  O  O     . ILE C  3  281 ? -22.115 41.210  -26.123 1.00 44.53  ? 281 ILE C O     1 
ATOM   8325  C  CB    . ILE C  3  281 ? -22.296 43.410  -23.628 1.00 38.82  ? 281 ILE C CB    1 
ATOM   8326  C  CG1   . ILE C  3  281 ? -23.340 44.448  -23.206 1.00 37.47  ? 281 ILE C CG1   1 
ATOM   8327  C  CG2   . ILE C  3  281 ? -21.392 43.988  -24.704 1.00 37.23  ? 281 ILE C CG2   1 
ATOM   8328  C  CD1   . ILE C  3  281 ? -22.760 45.643  -22.475 1.00 37.62  ? 281 ILE C CD1   1 
ATOM   8329  N  N     . LEU C  3  282 ? -21.207 40.509  -24.196 1.00 43.65  ? 282 LEU C N     1 
ATOM   8330  C  CA    . LEU C  3  282 ? -20.245 39.612  -24.845 1.00 45.88  ? 282 LEU C CA    1 
ATOM   8331  C  C     . LEU C  3  282 ? -20.989 38.590  -25.716 1.00 47.07  ? 282 LEU C C     1 
ATOM   8332  O  O     . LEU C  3  282 ? -20.733 38.479  -26.910 1.00 48.12  ? 282 LEU C O     1 
ATOM   8333  C  CB    . LEU C  3  282 ? -19.401 38.884  -23.784 1.00 43.29  ? 282 LEU C CB    1 
ATOM   8334  C  CG    . LEU C  3  282 ? -18.311 37.894  -24.222 1.00 43.17  ? 282 LEU C CG    1 
ATOM   8335  C  CD1   . LEU C  3  282 ? -17.216 38.607  -24.991 1.00 40.91  ? 282 LEU C CD1   1 
ATOM   8336  C  CD2   . LEU C  3  282 ? -17.713 37.200  -23.002 1.00 40.12  ? 282 LEU C CD2   1 
ATOM   8337  N  N     . ARG C  3  283 ? -21.956 37.908  -25.109 1.00 48.06  ? 283 ARG C N     1 
ATOM   8338  C  CA    . ARG C  3  283 ? -22.770 36.877  -25.754 1.00 48.60  ? 283 ARG C CA    1 
ATOM   8339  C  C     . ARG C  3  283 ? -23.586 37.335  -26.964 1.00 51.15  ? 283 ARG C C     1 
ATOM   8340  O  O     . ARG C  3  283 ? -23.936 36.529  -27.824 1.00 53.55  ? 283 ARG C O     1 
ATOM   8341  C  CB    . ARG C  3  283 ? -23.735 36.291  -24.725 1.00 46.06  ? 283 ARG C CB    1 
ATOM   8342  C  CG    . ARG C  3  283 ? -23.511 34.852  -24.421 1.00 45.63  ? 283 ARG C CG    1 
ATOM   8343  C  CD    . ARG C  3  283 ? -24.018 34.506  -23.044 1.00 46.12  ? 283 ARG C CD    1 
ATOM   8344  N  NE    . ARG C  3  283 ? -25.414 34.879  -22.845 1.00 47.48  ? 283 ARG C NE    1 
ATOM   8345  C  CZ    . ARG C  3  283 ? -26.263 34.214  -22.061 1.00 46.50  ? 283 ARG C CZ    1 
ATOM   8346  N  NH1   . ARG C  3  283 ? -27.516 34.637  -21.933 1.00 43.68  ? 283 ARG C NH1   1 
ATOM   8347  N  NH2   . ARG C  3  283 ? -25.866 33.120  -21.422 1.00 43.09  ? 283 ARG C NH2   1 
ATOM   8348  N  N     . SER C  3  284 ? -23.903 38.621  -27.021 1.00 51.77  ? 284 SER C N     1 
ATOM   8349  C  CA    . SER C  3  284 ? -24.710 39.162  -28.105 1.00 50.87  ? 284 SER C CA    1 
ATOM   8350  C  C     . SER C  3  284 ? -24.009 39.354  -29.453 1.00 51.01  ? 284 SER C C     1 
ATOM   8351  O  O     . SER C  3  284 ? -24.669 39.602  -30.467 1.00 51.34  ? 284 SER C O     1 
ATOM   8352  C  CB    . SER C  3  284 ? -25.364 40.467  -27.651 1.00 51.01  ? 284 SER C CB    1 
ATOM   8353  O  OG    . SER C  3  284 ? -26.296 40.221  -26.611 1.00 51.99  ? 284 SER C OG    1 
ATOM   8354  N  N     . ILE C  3  285 ? -22.686 39.231  -29.474 1.00 50.40  ? 285 ILE C N     1 
ATOM   8355  C  CA    . ILE C  3  285 ? -21.931 39.407  -30.714 1.00 51.60  ? 285 ILE C CA    1 
ATOM   8356  C  C     . ILE C  3  285 ? -21.429 38.057  -31.220 1.00 51.71  ? 285 ILE C C     1 
ATOM   8357  O  O     . ILE C  3  285 ? -20.505 37.490  -30.655 1.00 51.90  ? 285 ILE C O     1 
ATOM   8358  C  CB    . ILE C  3  285 ? -20.705 40.334  -30.514 1.00 52.88  ? 285 ILE C CB    1 
ATOM   8359  C  CG1   . ILE C  3  285 ? -21.077 41.585  -29.706 1.00 50.94  ? 285 ILE C CG1   1 
ATOM   8360  C  CG2   . ILE C  3  285 ? -20.099 40.702  -31.867 1.00 53.94  ? 285 ILE C CG2   1 
ATOM   8361  C  CD1   . ILE C  3  285 ? -22.193 42.411  -30.291 1.00 51.68  ? 285 ILE C CD1   1 
ATOM   8362  N  N     . PRO C  3  286 ? -22.009 37.547  -32.320 1.00 53.74  ? 286 PRO C N     1 
ATOM   8363  C  CA    . PRO C  3  286 ? -21.626 36.256  -32.911 1.00 53.70  ? 286 PRO C CA    1 
ATOM   8364  C  C     . PRO C  3  286 ? -20.220 36.166  -33.524 1.00 52.74  ? 286 PRO C C     1 
ATOM   8365  O  O     . PRO C  3  286 ? -19.982 35.349  -34.407 1.00 55.46  ? 286 PRO C O     1 
ATOM   8366  C  CB    . PRO C  3  286 ? -22.714 36.032  -33.957 1.00 52.71  ? 286 PRO C CB    1 
ATOM   8367  C  CG    . PRO C  3  286 ? -23.007 37.426  -34.414 1.00 54.16  ? 286 PRO C CG    1 
ATOM   8368  C  CD    . PRO C  3  286 ? -23.089 38.177  -33.105 1.00 54.04  ? 286 PRO C CD    1 
ATOM   8369  N  N     . ASP C  3  287 ? -19.296 36.992  -33.045 1.00 52.07  ? 287 ASP C N     1 
ATOM   8370  C  CA    . ASP C  3  287 ? -17.909 36.984  -33.515 1.00 50.06  ? 287 ASP C CA    1 
ATOM   8371  C  C     . ASP C  3  287 ? -17.008 37.050  -32.282 1.00 48.87  ? 287 ASP C C     1 
ATOM   8372  O  O     . ASP C  3  287 ? -17.264 37.829  -31.366 1.00 49.36  ? 287 ASP C O     1 
ATOM   8373  C  CB    . ASP C  3  287 ? -17.627 38.181  -34.432 1.00 50.47  ? 287 ASP C CB    1 
ATOM   8374  C  CG    . ASP C  3  287 ? -16.220 38.154  -35.017 1.00 52.73  ? 287 ASP C CG    1 
ATOM   8375  O  OD1   . ASP C  3  287 ? -15.838 37.129  -35.616 1.00 56.20  ? 287 ASP C OD1   1 
ATOM   8376  O  OD2   . ASP C  3  287 ? -15.486 39.150  -34.882 1.00 54.04  ? 287 ASP C OD2   1 
ATOM   8377  N  N     . LYS C  3  288 ? -15.954 36.239  -32.270 1.00 47.41  ? 288 LYS C N     1 
ATOM   8378  C  CA    . LYS C  3  288 ? -15.020 36.181  -31.147 1.00 45.63  ? 288 LYS C CA    1 
ATOM   8379  C  C     . LYS C  3  288 ? -14.331 37.508  -30.847 1.00 46.19  ? 288 LYS C C     1 
ATOM   8380  O  O     . LYS C  3  288 ? -14.506 38.064  -29.766 1.00 45.65  ? 288 LYS C O     1 
ATOM   8381  C  CB    . LYS C  3  288 ? -13.966 35.103  -31.384 1.00 42.80  ? 288 LYS C CB    1 
ATOM   8382  C  CG    . LYS C  3  288 ? -12.936 35.003  -30.286 1.00 42.12  ? 288 LYS C CG    1 
ATOM   8383  C  CD    . LYS C  3  288 ? -12.004 33.830  -30.524 1.00 42.48  ? 288 LYS C CD    1 
ATOM   8384  C  CE    . LYS C  3  288 ? -11.080 33.598  -29.354 1.00 41.25  ? 288 LYS C CE    1 
ATOM   8385  N  NZ    . LYS C  3  288 ? -10.217 32.404  -29.567 1.00 42.37  ? 288 LYS C NZ    1 
ATOM   8386  N  N     . LEU C  3  289 ? -13.572 38.013  -31.814 1.00 45.68  ? 289 LEU C N     1 
ATOM   8387  C  CA    . LEU C  3  289 ? -12.842 39.258  -31.653 1.00 46.41  ? 289 LEU C CA    1 
ATOM   8388  C  C     . LEU C  3  289 ? -13.740 40.449  -31.355 1.00 47.10  ? 289 LEU C C     1 
ATOM   8389  O  O     . LEU C  3  289 ? -13.491 41.216  -30.425 1.00 48.85  ? 289 LEU C O     1 
ATOM   8390  C  CB    . LEU C  3  289 ? -11.998 39.547  -32.894 1.00 47.20  ? 289 LEU C CB    1 
ATOM   8391  C  CG    . LEU C  3  289 ? -11.179 40.851  -32.867 1.00 50.74  ? 289 LEU C CG    1 
ATOM   8392  C  CD1   . LEU C  3  289 ? -10.100 40.797  -31.792 1.00 48.06  ? 289 LEU C CD1   1 
ATOM   8393  C  CD2   . LEU C  3  289 ? -10.562 41.124  -34.229 1.00 50.24  ? 289 LEU C CD2   1 
ATOM   8394  N  N     . LEU C  3  290 ? -14.778 40.612  -32.156 1.00 47.63  ? 290 LEU C N     1 
ATOM   8395  C  CA    . LEU C  3  290 ? -15.687 41.726  -31.978 1.00 47.52  ? 290 LEU C CA    1 
ATOM   8396  C  C     . LEU C  3  290 ? -16.444 41.622  -30.673 1.00 46.62  ? 290 LEU C C     1 
ATOM   8397  O  O     . LEU C  3  290 ? -16.832 42.638  -30.090 1.00 46.20  ? 290 LEU C O     1 
ATOM   8398  C  CB    . LEU C  3  290 ? -16.645 41.807  -33.164 1.00 49.92  ? 290 LEU C CB    1 
ATOM   8399  C  CG    . LEU C  3  290 ? -15.956 42.299  -34.444 1.00 52.76  ? 290 LEU C CG    1 
ATOM   8400  C  CD1   . LEU C  3  290 ? -16.892 42.167  -35.648 1.00 55.01  ? 290 LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C  3  290 ? -15.529 43.752  -34.250 1.00 53.79  ? 290 LEU C CD2   1 
ATOM   8402  N  N     . GLY C  3  291 ? -16.632 40.389  -30.213 1.00 45.74  ? 291 GLY C N     1 
ATOM   8403  C  CA    . GLY C  3  291 ? -17.332 40.154  -28.964 1.00 43.49  ? 291 GLY C CA    1 
ATOM   8404  C  C     . GLY C  3  291 ? -16.583 40.733  -27.775 1.00 44.05  ? 291 GLY C C     1 
ATOM   8405  O  O     . GLY C  3  291 ? -17.167 41.472  -26.974 1.00 43.39  ? 291 GLY C O     1 
ATOM   8406  N  N     . VAL C  3  292 ? -15.285 40.444  -27.679 1.00 42.24  ? 292 VAL C N     1 
ATOM   8407  C  CA    . VAL C  3  292 ? -14.500 40.953  -26.570 1.00 42.02  ? 292 VAL C CA    1 
ATOM   8408  C  C     . VAL C  3  292 ? -14.244 42.449  -26.670 1.00 42.32  ? 292 VAL C C     1 
ATOM   8409  O  O     . VAL C  3  292 ? -14.231 43.130  -25.656 1.00 45.43  ? 292 VAL C O     1 
ATOM   8410  C  CB    . VAL C  3  292 ? -13.170 40.151  -26.331 1.00 41.82  ? 292 VAL C CB    1 
ATOM   8411  C  CG1   . VAL C  3  292 ? -13.350 38.690  -26.687 1.00 40.85  ? 292 VAL C CG1   1 
ATOM   8412  C  CG2   . VAL C  3  292 ? -12.002 40.768  -27.047 1.00 42.76  ? 292 VAL C CG2   1 
ATOM   8413  N  N     . ILE C  3  293 ? -14.093 42.967  -27.885 1.00 41.97  ? 293 ILE C N     1 
ATOM   8414  C  CA    . ILE C  3  293 ? -13.851 44.401  -28.085 1.00 40.46  ? 293 ILE C CA    1 
ATOM   8415  C  C     . ILE C  3  293 ? -15.051 45.234  -27.634 1.00 39.38  ? 293 ILE C C     1 
ATOM   8416  O  O     . ILE C  3  293 ? -14.891 46.272  -27.000 1.00 38.52  ? 293 ILE C O     1 
ATOM   8417  C  CB    . ILE C  3  293 ? -13.534 44.738  -29.580 1.00 42.29  ? 293 ILE C CB    1 
ATOM   8418  C  CG1   . ILE C  3  293 ? -12.130 44.245  -29.949 1.00 43.70  ? 293 ILE C CG1   1 
ATOM   8419  C  CG2   . ILE C  3  293 ? -13.649 46.246  -29.846 1.00 39.28  ? 293 ILE C CG2   1 
ATOM   8420  C  CD1   . ILE C  3  293 ? -11.698 44.617  -31.367 1.00 44.52  ? 293 ILE C CD1   1 
ATOM   8421  N  N     . THR C  3  294 ? -16.251 44.771  -27.955 1.00 39.49  ? 294 THR C N     1 
ATOM   8422  C  CA    . THR C  3  294 ? -17.466 45.489  -27.585 1.00 39.63  ? 294 THR C CA    1 
ATOM   8423  C  C     . THR C  3  294 ? -17.695 45.481  -26.076 1.00 40.36  ? 294 THR C C     1 
ATOM   8424  O  O     . THR C  3  294 ? -18.188 46.464  -25.511 1.00 40.22  ? 294 THR C O     1 
ATOM   8425  C  CB    . THR C  3  294 ? -18.695 44.912  -28.311 1.00 39.09  ? 294 THR C CB    1 
ATOM   8426  O  OG1   . THR C  3  294 ? -18.397 44.820  -29.706 1.00 39.86  ? 294 THR C OG1   1 
ATOM   8427  C  CG2   . THR C  3  294 ? -19.914 45.816  -28.133 1.00 34.69  ? 294 THR C CG2   1 
ATOM   8428  N  N     . MET C  3  295 ? -17.321 44.381  -25.427 1.00 40.84  ? 295 MET C N     1 
ATOM   8429  C  CA    . MET C  3  295 ? -17.473 44.262  -23.987 1.00 40.19  ? 295 MET C CA    1 
ATOM   8430  C  C     . MET C  3  295 ? -16.561 45.277  -23.296 1.00 40.18  ? 295 MET C C     1 
ATOM   8431  O  O     . MET C  3  295 ? -17.025 46.044  -22.457 1.00 39.41  ? 295 MET C O     1 
ATOM   8432  C  CB    . MET C  3  295 ? -17.133 42.855  -23.523 1.00 41.07  ? 295 MET C CB    1 
ATOM   8433  C  CG    . MET C  3  295 ? -17.473 42.601  -22.067 1.00 41.40  ? 295 MET C CG    1 
ATOM   8434  S  SD    . MET C  3  295 ? -16.801 41.032  -21.528 1.00 44.31  ? 295 MET C SD    1 
ATOM   8435  C  CE    . MET C  3  295 ? -15.062 41.390  -21.454 1.00 40.15  ? 295 MET C CE    1 
ATOM   8436  N  N     . PHE C  3  296 ? -15.282 45.300  -23.672 1.00 38.63  ? 296 PHE C N     1 
ATOM   8437  C  CA    . PHE C  3  296 ? -14.337 46.245  -23.086 1.00 40.86  ? 296 PHE C CA    1 
ATOM   8438  C  C     . PHE C  3  296 ? -14.778 47.681  -23.360 1.00 41.46  ? 296 PHE C C     1 
ATOM   8439  O  O     . PHE C  3  296 ? -14.581 48.575  -22.528 1.00 43.12  ? 296 PHE C O     1 
ATOM   8440  C  CB    . PHE C  3  296 ? -12.923 46.043  -23.644 1.00 43.62  ? 296 PHE C CB    1 
ATOM   8441  C  CG    . PHE C  3  296 ? -12.202 44.844  -23.087 1.00 47.92  ? 296 PHE C CG    1 
ATOM   8442  C  CD1   . PHE C  3  296 ? -11.150 44.265  -23.795 1.00 50.92  ? 296 PHE C CD1   1 
ATOM   8443  C  CD2   . PHE C  3  296 ? -12.577 44.278  -21.866 1.00 49.33  ? 296 PHE C CD2   1 
ATOM   8444  C  CE1   . PHE C  3  296 ? -10.483 43.133  -23.296 1.00 51.56  ? 296 PHE C CE1   1 
ATOM   8445  C  CE2   . PHE C  3  296 ? -11.920 43.149  -21.359 1.00 48.31  ? 296 PHE C CE2   1 
ATOM   8446  C  CZ    . PHE C  3  296 ? -10.875 42.579  -22.074 1.00 50.95  ? 296 PHE C CZ    1 
ATOM   8447  N  N     . ALA C  3  297 ? -15.391 47.894  -24.522 1.00 39.09  ? 297 ALA C N     1 
ATOM   8448  C  CA    . ALA C  3  297 ? -15.854 49.220  -24.916 1.00 36.75  ? 297 ALA C CA    1 
ATOM   8449  C  C     . ALA C  3  297 ? -17.034 49.670  -24.058 1.00 35.99  ? 297 ALA C C     1 
ATOM   8450  O  O     . ALA C  3  297 ? -17.284 50.874  -23.923 1.00 36.17  ? 297 ALA C O     1 
ATOM   8451  C  CB    . ALA C  3  297 ? -16.223 49.240  -26.409 1.00 35.38  ? 297 ALA C CB    1 
ATOM   8452  N  N     . ALA C  3  298 ? -17.760 48.706  -23.492 1.00 32.30  ? 298 ALA C N     1 
ATOM   8453  C  CA    . ALA C  3  298 ? -18.899 49.011  -22.633 1.00 32.23  ? 298 ALA C CA    1 
ATOM   8454  C  C     . ALA C  3  298 ? -18.438 49.764  -21.371 1.00 33.39  ? 298 ALA C C     1 
ATOM   8455  O  O     . ALA C  3  298 ? -19.209 50.500  -20.755 1.00 33.18  ? 298 ALA C O     1 
ATOM   8456  C  CB    . ALA C  3  298 ? -19.617 47.735  -22.251 1.00 32.10  ? 298 ALA C CB    1 
ATOM   8457  N  N     . ILE C  3  299 ? -17.178 49.561  -20.995 1.00 32.47  ? 299 ILE C N     1 
ATOM   8458  C  CA    . ILE C  3  299 ? -16.595 50.214  -19.841 1.00 33.56  ? 299 ILE C CA    1 
ATOM   8459  C  C     . ILE C  3  299 ? -15.900 51.525  -20.250 1.00 34.16  ? 299 ILE C C     1 
ATOM   8460  O  O     . ILE C  3  299 ? -16.152 52.582  -19.663 1.00 33.81  ? 299 ILE C O     1 
ATOM   8461  C  CB    . ILE C  3  299 ? -15.582 49.278  -19.151 1.00 35.93  ? 299 ILE C CB    1 
ATOM   8462  C  CG1   . ILE C  3  299 ? -16.286 48.021  -18.651 1.00 34.36  ? 299 ILE C CG1   1 
ATOM   8463  C  CG2   . ILE C  3  299 ? -14.899 49.984  -17.991 1.00 37.01  ? 299 ILE C CG2   1 
ATOM   8464  C  CD1   . ILE C  3  299 ? -15.323 46.985  -18.121 1.00 35.55  ? 299 ILE C CD1   1 
ATOM   8465  N  N     . LEU C  3  300 ? -15.045 51.456  -21.268 1.00 33.46  ? 300 LEU C N     1 
ATOM   8466  C  CA    . LEU C  3  300 ? -14.323 52.637  -21.746 1.00 34.06  ? 300 LEU C CA    1 
ATOM   8467  C  C     . LEU C  3  300 ? -15.225 53.770  -22.250 1.00 33.26  ? 300 LEU C C     1 
ATOM   8468  O  O     . LEU C  3  300 ? -14.834 54.935  -22.227 1.00 34.81  ? 300 LEU C O     1 
ATOM   8469  C  CB    . LEU C  3  300 ? -13.336 52.254  -22.853 1.00 35.17  ? 300 LEU C CB    1 
ATOM   8470  C  CG    . LEU C  3  300 ? -12.271 51.201  -22.517 1.00 39.84  ? 300 LEU C CG    1 
ATOM   8471  C  CD1   . LEU C  3  300 ? -11.519 50.799  -23.791 1.00 39.72  ? 300 LEU C CD1   1 
ATOM   8472  C  CD2   . LEU C  3  300 ? -11.310 51.700  -21.429 1.00 35.98  ? 300 LEU C CD2   1 
ATOM   8473  N  N     . VAL C  3  301 ? -16.438 53.448  -22.683 1.00 33.09  ? 301 VAL C N     1 
ATOM   8474  C  CA    . VAL C  3  301 ? -17.340 54.481  -23.194 1.00 32.06  ? 301 VAL C CA    1 
ATOM   8475  C  C     . VAL C  3  301 ? -17.710 55.532  -22.118 1.00 33.29  ? 301 VAL C C     1 
ATOM   8476  O  O     . VAL C  3  301 ? -18.137 56.645  -22.429 1.00 33.30  ? 301 VAL C O     1 
ATOM   8477  C  CB    . VAL C  3  301 ? -18.591 53.844  -23.873 1.00 30.91  ? 301 VAL C CB    1 
ATOM   8478  C  CG1   . VAL C  3  301 ? -19.555 53.270  -22.837 1.00 29.78  ? 301 VAL C CG1   1 
ATOM   8479  C  CG2   . VAL C  3  301 ? -19.264 54.839  -24.780 1.00 27.32  ? 301 VAL C CG2   1 
ATOM   8480  N  N     . LEU C  3  302 ? -17.509 55.177  -20.854 1.00 34.09  ? 302 LEU C N     1 
ATOM   8481  C  CA    . LEU C  3  302 ? -17.772 56.081  -19.735 1.00 33.68  ? 302 LEU C CA    1 
ATOM   8482  C  C     . LEU C  3  302 ? -16.869 57.322  -19.848 1.00 33.31  ? 302 LEU C C     1 
ATOM   8483  O  O     . LEU C  3  302 ? -17.221 58.406  -19.368 1.00 31.33  ? 302 LEU C O     1 
ATOM   8484  C  CB    . LEU C  3  302 ? -17.494 55.358  -18.413 1.00 33.66  ? 302 LEU C CB    1 
ATOM   8485  C  CG    . LEU C  3  302 ? -18.612 54.597  -17.691 1.00 35.99  ? 302 LEU C CG    1 
ATOM   8486  C  CD1   . LEU C  3  302 ? -19.537 53.939  -18.659 1.00 39.71  ? 302 LEU C CD1   1 
ATOM   8487  C  CD2   . LEU C  3  302 ? -18.010 53.549  -16.773 1.00 34.97  ? 302 LEU C CD2   1 
ATOM   8488  N  N     . LEU C  3  303 ? -15.728 57.157  -20.520 1.00 32.29  ? 303 LEU C N     1 
ATOM   8489  C  CA    . LEU C  3  303 ? -14.757 58.231  -20.708 1.00 34.09  ? 303 LEU C CA    1 
ATOM   8490  C  C     . LEU C  3  303 ? -15.248 59.346  -21.645 1.00 36.58  ? 303 LEU C C     1 
ATOM   8491  O  O     . LEU C  3  303 ? -14.812 60.495  -21.561 1.00 38.01  ? 303 LEU C O     1 
ATOM   8492  C  CB    . LEU C  3  303 ? -13.450 57.652  -21.252 1.00 30.86  ? 303 LEU C CB    1 
ATOM   8493  C  CG    . LEU C  3  303 ? -12.683 56.691  -20.336 1.00 32.73  ? 303 LEU C CG    1 
ATOM   8494  C  CD1   . LEU C  3  303 ? -11.426 56.162  -21.033 1.00 29.89  ? 303 LEU C CD1   1 
ATOM   8495  C  CD2   . LEU C  3  303 ? -12.308 57.399  -19.040 1.00 31.94  ? 303 LEU C CD2   1 
ATOM   8496  N  N     . VAL C  3  304 ? -16.177 58.989  -22.521 1.00 37.42  ? 304 VAL C N     1 
ATOM   8497  C  CA    . VAL C  3  304 ? -16.740 59.882  -23.529 1.00 36.47  ? 304 VAL C CA    1 
ATOM   8498  C  C     . VAL C  3  304 ? -17.745 60.924  -23.029 1.00 36.68  ? 304 VAL C C     1 
ATOM   8499  O  O     . VAL C  3  304 ? -17.863 62.006  -23.591 1.00 35.57  ? 304 VAL C O     1 
ATOM   8500  C  CB    . VAL C  3  304 ? -17.368 59.006  -24.651 1.00 36.98  ? 304 VAL C CB    1 
ATOM   8501  C  CG1   . VAL C  3  304 ? -18.563 59.652  -25.260 1.00 38.41  ? 304 VAL C CG1   1 
ATOM   8502  C  CG2   . VAL C  3  304 ? -16.331 58.702  -25.714 1.00 38.38  ? 304 VAL C CG2   1 
ATOM   8503  N  N     . LEU C  3  305 ? -18.429 60.617  -21.939 1.00 37.78  ? 305 LEU C N     1 
ATOM   8504  C  CA    . LEU C  3  305 ? -19.459 61.490  -21.400 1.00 37.77  ? 305 LEU C CA    1 
ATOM   8505  C  C     . LEU C  3  305 ? -19.157 62.985  -21.194 1.00 39.78  ? 305 LEU C C     1 
ATOM   8506  O  O     . LEU C  3  305 ? -20.046 63.814  -21.363 1.00 40.83  ? 305 LEU C O     1 
ATOM   8507  C  CB    . LEU C  3  305 ? -20.048 60.853  -20.150 1.00 38.05  ? 305 LEU C CB    1 
ATOM   8508  C  CG    . LEU C  3  305 ? -21.511 61.104  -19.810 1.00 41.02  ? 305 LEU C CG    1 
ATOM   8509  C  CD1   . LEU C  3  305 ? -22.377 61.008  -21.044 1.00 41.81  ? 305 LEU C CD1   1 
ATOM   8510  C  CD2   . LEU C  3  305 ? -21.932 60.059  -18.790 1.00 45.26  ? 305 LEU C CD2   1 
ATOM   8511  N  N     . PRO C  3  306 ? -17.918 63.357  -20.817 1.00 41.75  ? 306 PRO C N     1 
ATOM   8512  C  CA    . PRO C  3  306 ? -17.649 64.792  -20.630 1.00 41.32  ? 306 PRO C CA    1 
ATOM   8513  C  C     . PRO C  3  306 ? -17.720 65.574  -21.944 1.00 43.71  ? 306 PRO C C     1 
ATOM   8514  O  O     . PRO C  3  306 ? -17.998 66.778  -21.942 1.00 45.38  ? 306 PRO C O     1 
ATOM   8515  C  CB    . PRO C  3  306 ? -16.228 64.807  -20.075 1.00 39.22  ? 306 PRO C CB    1 
ATOM   8516  C  CG    . PRO C  3  306 ? -16.149 63.510  -19.330 1.00 41.22  ? 306 PRO C CG    1 
ATOM   8517  C  CD    . PRO C  3  306 ? -16.800 62.551  -20.290 1.00 41.60  ? 306 PRO C CD    1 
ATOM   8518  N  N     . PHE C  3  307 ? -17.477 64.884  -23.058 1.00 42.97  ? 307 PHE C N     1 
ATOM   8519  C  CA    . PHE C  3  307 ? -17.503 65.508  -24.375 1.00 44.20  ? 307 PHE C CA    1 
ATOM   8520  C  C     . PHE C  3  307 ? -18.873 65.447  -25.069 1.00 43.68  ? 307 PHE C C     1 
ATOM   8521  O  O     . PHE C  3  307 ? -19.271 66.405  -25.726 1.00 45.38  ? 307 PHE C O     1 
ATOM   8522  C  CB    . PHE C  3  307 ? -16.416 64.896  -25.261 1.00 47.93  ? 307 PHE C CB    1 
ATOM   8523  C  CG    . PHE C  3  307 ? -15.064 64.833  -24.589 1.00 54.79  ? 307 PHE C CG    1 
ATOM   8524  C  CD1   . PHE C  3  307 ? -14.643 63.665  -23.934 1.00 53.93  ? 307 PHE C CD1   1 
ATOM   8525  C  CD2   . PHE C  3  307 ? -14.233 65.961  -24.552 1.00 55.56  ? 307 PHE C CD2   1 
ATOM   8526  C  CE1   . PHE C  3  307 ? -13.425 63.624  -23.248 1.00 54.00  ? 307 PHE C CE1   1 
ATOM   8527  C  CE2   . PHE C  3  307 ? -13.007 65.927  -23.866 1.00 54.38  ? 307 PHE C CE2   1 
ATOM   8528  C  CZ    . PHE C  3  307 ? -12.605 64.755  -23.212 1.00 54.33  ? 307 PHE C CZ    1 
ATOM   8529  N  N     . THR C  3  308 ? -19.608 64.348  -24.906 1.00 41.04  ? 308 THR C N     1 
ATOM   8530  C  CA    . THR C  3  308 ? -20.914 64.232  -25.545 1.00 37.18  ? 308 THR C CA    1 
ATOM   8531  C  C     . THR C  3  308 ? -22.041 64.943  -24.815 1.00 37.51  ? 308 THR C C     1 
ATOM   8532  O  O     . THR C  3  308 ? -23.114 65.104  -25.375 1.00 38.89  ? 308 THR C O     1 
ATOM   8533  C  CB    . THR C  3  308 ? -21.328 62.771  -25.836 1.00 37.20  ? 308 THR C CB    1 
ATOM   8534  O  OG1   . THR C  3  308 ? -21.512 62.058  -24.610 1.00 37.38  ? 308 THR C OG1   1 
ATOM   8535  C  CG2   . THR C  3  308 ? -20.282 62.070  -26.717 1.00 32.67  ? 308 THR C CG2   1 
ATOM   8536  N  N     . ASP C  3  309 ? -21.832 65.336  -23.558 1.00 37.31  ? 309 ASP C N     1 
ATOM   8537  C  CA    . ASP C  3  309 ? -22.873 66.074  -22.835 1.00 35.53  ? 309 ASP C CA    1 
ATOM   8538  C  C     . ASP C  3  309 ? -22.729 67.514  -23.332 1.00 35.75  ? 309 ASP C C     1 
ATOM   8539  O  O     . ASP C  3  309 ? -21.810 68.226  -22.950 1.00 36.36  ? 309 ASP C O     1 
ATOM   8540  C  CB    . ASP C  3  309 ? -22.676 65.995  -21.314 1.00 32.66  ? 309 ASP C CB    1 
ATOM   8541  C  CG    . ASP C  3  309 ? -23.742 66.784  -20.533 1.00 34.43  ? 309 ASP C CG    1 
ATOM   8542  O  OD1   . ASP C  3  309 ? -24.654 67.380  -21.156 1.00 33.66  ? 309 ASP C OD1   1 
ATOM   8543  O  OD2   . ASP C  3  309 ? -23.665 66.830  -19.287 1.00 29.68  ? 309 ASP C OD2   1 
ATOM   8544  N  N     . ARG C  3  310 ? -23.635 67.923  -24.210 1.00 37.48  ? 310 ARG C N     1 
ATOM   8545  C  CA    . ARG C  3  310 ? -23.584 69.252  -24.806 1.00 38.19  ? 310 ARG C CA    1 
ATOM   8546  C  C     . ARG C  3  310 ? -24.268 70.343  -23.996 1.00 38.33  ? 310 ARG C C     1 
ATOM   8547  O  O     . ARG C  3  310 ? -24.151 71.520  -24.330 1.00 39.23  ? 310 ARG C O     1 
ATOM   8548  C  CB    . ARG C  3  310 ? -24.186 69.206  -26.211 1.00 39.91  ? 310 ARG C CB    1 
ATOM   8549  C  CG    . ARG C  3  310 ? -23.583 68.147  -27.117 1.00 41.13  ? 310 ARG C CG    1 
ATOM   8550  C  CD    . ARG C  3  310 ? -22.137 68.458  -27.414 1.00 44.31  ? 310 ARG C CD    1 
ATOM   8551  N  NE    . ARG C  3  310 ? -22.011 69.699  -28.171 1.00 49.50  ? 310 ARG C NE    1 
ATOM   8552  C  CZ    . ARG C  3  310 ? -20.897 70.422  -28.255 1.00 51.12  ? 310 ARG C CZ    1 
ATOM   8553  N  NH1   . ARG C  3  310 ? -20.888 71.537  -28.977 1.00 51.13  ? 310 ARG C NH1   1 
ATOM   8554  N  NH2   . ARG C  3  310 ? -19.800 70.041  -27.606 1.00 49.94  ? 310 ARG C NH2   1 
ATOM   8555  N  N     . SER C  3  311 ? -24.970 69.957  -22.933 1.00 36.78  ? 311 SER C N     1 
ATOM   8556  C  CA    . SER C  3  311 ? -25.680 70.919  -22.093 1.00 35.25  ? 311 SER C CA    1 
ATOM   8557  C  C     . SER C  3  311 ? -24.841 72.099  -21.603 1.00 35.15  ? 311 SER C C     1 
ATOM   8558  O  O     . SER C  3  311 ? -23.619 72.095  -21.660 1.00 36.23  ? 311 SER C O     1 
ATOM   8559  C  CB    . SER C  3  311 ? -26.339 70.217  -20.906 1.00 34.02  ? 311 SER C CB    1 
ATOM   8560  O  OG    . SER C  3  311 ? -27.037 71.153  -20.100 1.00 34.06  ? 311 SER C OG    1 
ATOM   8561  N  N     . VAL C  3  312 ? -25.525 73.121  -21.131 1.00 35.75  ? 312 VAL C N     1 
ATOM   8562  C  CA    . VAL C  3  312 ? -24.874 74.317  -20.655 1.00 35.27  ? 312 VAL C CA    1 
ATOM   8563  C  C     . VAL C  3  312 ? -24.995 74.375  -19.110 1.00 36.65  ? 312 VAL C C     1 
ATOM   8564  O  O     . VAL C  3  312 ? -24.369 75.209  -18.443 1.00 36.20  ? 312 VAL C O     1 
ATOM   8565  C  CB    . VAL C  3  312 ? -25.505 75.541  -21.404 1.00 35.29  ? 312 VAL C CB    1 
ATOM   8566  C  CG1   . VAL C  3  312 ? -26.490 76.310  -20.542 1.00 33.23  ? 312 VAL C CG1   1 
ATOM   8567  C  CG2   . VAL C  3  312 ? -24.437 76.412  -21.964 1.00 36.05  ? 312 VAL C CG2   1 
ATOM   8568  N  N     . VAL C  3  313 ? -25.818 73.487  -18.554 1.00 36.95  ? 313 VAL C N     1 
ATOM   8569  C  CA    . VAL C  3  313 ? -26.006 73.398  -17.107 1.00 36.69  ? 313 VAL C CA    1 
ATOM   8570  C  C     . VAL C  3  313 ? -25.586 71.997  -16.649 1.00 37.65  ? 313 VAL C C     1 
ATOM   8571  O  O     . VAL C  3  313 ? -25.678 71.043  -17.411 1.00 39.69  ? 313 VAL C O     1 
ATOM   8572  C  CB    . VAL C  3  313 ? -27.477 73.730  -16.666 1.00 35.90  ? 313 VAL C CB    1 
ATOM   8573  C  CG1   . VAL C  3  313 ? -28.298 74.234  -17.843 1.00 34.02  ? 313 VAL C CG1   1 
ATOM   8574  C  CG2   . VAL C  3  313 ? -28.138 72.551  -15.980 1.00 32.95  ? 313 VAL C CG2   1 
ATOM   8575  N  N     . ARG C  3  314 ? -25.097 71.883  -15.418 1.00 37.10  ? 314 ARG C N     1 
ATOM   8576  C  CA    . ARG C  3  314 ? -24.651 70.604  -14.878 1.00 35.54  ? 314 ARG C CA    1 
ATOM   8577  C  C     . ARG C  3  314 ? -25.753 69.829  -14.169 1.00 34.48  ? 314 ARG C C     1 
ATOM   8578  O  O     . ARG C  3  314 ? -26.410 70.347  -13.268 1.00 34.64  ? 314 ARG C O     1 
ATOM   8579  C  CB    . ARG C  3  314 ? -23.476 70.848  -13.919 1.00 36.40  ? 314 ARG C CB    1 
ATOM   8580  C  CG    . ARG C  3  314 ? -22.887 69.603  -13.200 1.00 37.40  ? 314 ARG C CG    1 
ATOM   8581  C  CD    . ARG C  3  314 ? -21.501 69.917  -12.616 1.00 33.55  ? 314 ARG C CD    1 
ATOM   8582  N  NE    . ARG C  3  314 ? -21.458 71.315  -12.237 1.00 33.04  ? 314 ARG C NE    1 
ATOM   8583  C  CZ    . ARG C  3  314 ? -20.559 72.199  -12.652 1.00 31.08  ? 314 ARG C CZ    1 
ATOM   8584  N  NH1   . ARG C  3  314 ? -20.678 73.450  -12.258 1.00 32.86  ? 314 ARG C NH1   1 
ATOM   8585  N  NH2   . ARG C  3  314 ? -19.507 71.840  -13.368 1.00 28.62  ? 314 ARG C NH2   1 
ATOM   8586  N  N     . GLY C  3  315 ? -25.953 68.587  -14.586 1.00 32.94  ? 315 GLY C N     1 
ATOM   8587  C  CA    . GLY C  3  315 ? -26.947 67.748  -13.939 1.00 34.17  ? 315 GLY C CA    1 
ATOM   8588  C  C     . GLY C  3  315 ? -28.327 67.675  -14.553 1.00 35.00  ? 315 GLY C C     1 
ATOM   8589  O  O     . GLY C  3  315 ? -28.734 68.555  -15.318 1.00 35.90  ? 315 GLY C O     1 
ATOM   8590  N  N     . ASN C  3  316 ? -29.073 66.648  -14.152 1.00 34.61  ? 316 ASN C N     1 
ATOM   8591  C  CA    . ASN C  3  316 ? -30.415 66.413  -14.667 1.00 34.39  ? 316 ASN C CA    1 
ATOM   8592  C  C     . ASN C  3  316 ? -31.543 66.933  -13.784 1.00 35.99  ? 316 ASN C C     1 
ATOM   8593  O  O     . ASN C  3  316 ? -32.700 66.735  -14.119 1.00 38.96  ? 316 ASN C O     1 
ATOM   8594  C  CB    . ASN C  3  316 ? -30.630 64.910  -14.910 1.00 32.53  ? 316 ASN C CB    1 
ATOM   8595  C  CG    . ASN C  3  316 ? -29.667 64.324  -15.933 1.00 32.27  ? 316 ASN C CG    1 
ATOM   8596  O  OD1   . ASN C  3  316 ? -29.027 65.048  -16.699 1.00 34.00  ? 316 ASN C OD1   1 
ATOM   8597  N  ND2   . ASN C  3  316 ? -29.562 62.997  -15.950 1.00 31.98  ? 316 ASN C ND2   1 
ATOM   8598  N  N     . THR C  3  317 ? -31.233 67.607  -12.680 1.00 35.43  ? 317 THR C N     1 
ATOM   8599  C  CA    . THR C  3  317 ? -32.278 68.105  -11.775 1.00 36.75  ? 317 THR C CA    1 
ATOM   8600  C  C     . THR C  3  317 ? -33.394 68.933  -12.425 1.00 38.69  ? 317 THR C C     1 
ATOM   8601  O  O     . THR C  3  317 ? -34.571 68.742  -12.111 1.00 40.68  ? 317 THR C O     1 
ATOM   8602  C  CB    . THR C  3  317 ? -31.692 68.939  -10.630 1.00 37.88  ? 317 THR C CB    1 
ATOM   8603  O  OG1   . THR C  3  317 ? -30.613 68.224  -10.027 1.00 43.78  ? 317 THR C OG1   1 
ATOM   8604  C  CG2   . THR C  3  317 ? -32.743 69.213  -9.570  1.00 37.88  ? 317 THR C CG2   1 
ATOM   8605  N  N     . PHE C  3  318 ? -33.022 69.861  -13.303 1.00 38.80  ? 318 PHE C N     1 
ATOM   8606  C  CA    . PHE C  3  318 ? -33.988 70.723  -13.982 1.00 39.90  ? 318 PHE C CA    1 
ATOM   8607  C  C     . PHE C  3  318 ? -34.131 70.369  -15.467 1.00 42.16  ? 318 PHE C C     1 
ATOM   8608  O  O     . PHE C  3  318 ? -34.292 71.262  -16.306 1.00 44.41  ? 318 PHE C O     1 
ATOM   8609  C  CB    . PHE C  3  318 ? -33.544 72.185  -13.861 1.00 37.46  ? 318 PHE C CB    1 
ATOM   8610  C  CG    . PHE C  3  318 ? -33.327 72.644  -12.446 1.00 35.90  ? 318 PHE C CG    1 
ATOM   8611  C  CD1   . PHE C  3  318 ? -32.057 73.009  -12.010 1.00 36.03  ? 318 PHE C CD1   1 
ATOM   8612  C  CD2   . PHE C  3  318 ? -34.391 72.730  -11.550 1.00 34.58  ? 318 PHE C CD2   1 
ATOM   8613  C  CE1   . PHE C  3  318 ? -31.850 73.451  -10.704 1.00 34.26  ? 318 PHE C CE1   1 
ATOM   8614  C  CE2   . PHE C  3  318 ? -34.192 73.174  -10.237 1.00 33.56  ? 318 PHE C CE2   1 
ATOM   8615  C  CZ    . PHE C  3  318 ? -32.923 73.533  -9.816  1.00 33.52  ? 318 PHE C CZ    1 
ATOM   8616  N  N     . LYS C  3  319 ? -34.061 69.080  -15.803 1.00 42.20  ? 319 LYS C N     1 
ATOM   8617  C  CA    . LYS C  3  319 ? -34.157 68.667  -17.207 1.00 43.02  ? 319 LYS C CA    1 
ATOM   8618  C  C     . LYS C  3  319 ? -35.083 67.472  -17.460 1.00 44.27  ? 319 LYS C C     1 
ATOM   8619  O  O     . LYS C  3  319 ? -34.670 66.316  -17.320 1.00 46.70  ? 319 LYS C O     1 
ATOM   8620  C  CB    . LYS C  3  319 ? -32.769 68.334  -17.750 1.00 42.80  ? 319 LYS C CB    1 
ATOM   8621  C  CG    . LYS C  3  319 ? -31.747 69.444  -17.674 1.00 41.58  ? 319 LYS C CG    1 
ATOM   8622  C  CD    . LYS C  3  319 ? -30.424 68.918  -18.204 1.00 41.66  ? 319 LYS C CD    1 
ATOM   8623  C  CE    . LYS C  3  319 ? -29.303 69.910  -18.045 1.00 39.75  ? 319 LYS C CE    1 
ATOM   8624  N  NZ    . LYS C  3  319 ? -28.026 69.218  -18.314 1.00 38.42  ? 319 LYS C NZ    1 
ATOM   8625  N  N     . VAL C  3  320 ? -36.291 67.763  -17.938 1.00 44.18  ? 320 VAL C N     1 
ATOM   8626  C  CA    . VAL C  3  320 ? -37.315 66.759  -18.226 1.00 44.68  ? 320 VAL C CA    1 
ATOM   8627  C  C     . VAL C  3  320 ? -36.888 65.622  -19.158 1.00 42.85  ? 320 VAL C C     1 
ATOM   8628  O  O     . VAL C  3  320 ? -37.053 64.451  -18.833 1.00 43.63  ? 320 VAL C O     1 
ATOM   8629  C  CB    . VAL C  3  320 ? -38.581 67.431  -18.823 1.00 48.17  ? 320 VAL C CB    1 
ATOM   8630  C  CG1   . VAL C  3  320 ? -39.704 66.417  -18.999 1.00 48.20  ? 320 VAL C CG1   1 
ATOM   8631  C  CG2   . VAL C  3  320 ? -39.040 68.568  -17.922 1.00 51.99  ? 320 VAL C CG2   1 
ATOM   8632  N  N     . LEU C  3  321 ? -36.361 65.957  -20.322 1.00 41.66  ? 321 LEU C N     1 
ATOM   8633  C  CA    . LEU C  3  321 ? -35.955 64.925  -21.262 1.00 43.23  ? 321 LEU C CA    1 
ATOM   8634  C  C     . LEU C  3  321 ? -34.780 64.088  -20.766 1.00 43.10  ? 321 LEU C C     1 
ATOM   8635  O  O     . LEU C  3  321 ? -34.754 62.877  -20.955 1.00 45.38  ? 321 LEU C O     1 
ATOM   8636  C  CB    . LEU C  3  321 ? -35.656 65.542  -22.637 1.00 46.19  ? 321 LEU C CB    1 
ATOM   8637  C  CG    . LEU C  3  321 ? -36.821 65.767  -23.629 1.00 49.54  ? 321 LEU C CG    1 
ATOM   8638  C  CD1   . LEU C  3  321 ? -38.136 66.100  -22.934 1.00 48.08  ? 321 LEU C CD1   1 
ATOM   8639  C  CD2   . LEU C  3  321 ? -36.445 66.871  -24.613 1.00 50.84  ? 321 LEU C CD2   1 
ATOM   8640  N  N     . SER C  3  322 ? -33.818 64.724  -20.107 1.00 42.47  ? 322 SER C N     1 
ATOM   8641  C  CA    . SER C  3  322 ? -32.654 64.010  -19.597 1.00 39.88  ? 322 SER C CA    1 
ATOM   8642  C  C     . SER C  3  322 ? -32.979 63.055  -18.441 1.00 38.06  ? 322 SER C C     1 
ATOM   8643  O  O     . SER C  3  322 ? -32.412 61.963  -18.361 1.00 34.49  ? 322 SER C O     1 
ATOM   8644  C  CB    . SER C  3  322 ? -31.551 64.994  -19.203 1.00 41.70  ? 322 SER C CB    1 
ATOM   8645  O  OG    . SER C  3  322 ? -30.863 65.467  -20.351 1.00 42.52  ? 322 SER C OG    1 
ATOM   8646  N  N     . LYS C  3  323 ? -33.875 63.464  -17.544 1.00 35.84  ? 323 LYS C N     1 
ATOM   8647  C  CA    . LYS C  3  323 ? -34.257 62.595  -16.433 1.00 37.08  ? 323 LYS C CA    1 
ATOM   8648  C  C     . LYS C  3  323 ? -34.911 61.333  -16.975 1.00 37.28  ? 323 LYS C C     1 
ATOM   8649  O  O     . LYS C  3  323 ? -34.548 60.220  -16.607 1.00 37.33  ? 323 LYS C O     1 
ATOM   8650  C  CB    . LYS C  3  323 ? -35.215 63.310  -15.489 1.00 35.80  ? 323 LYS C CB    1 
ATOM   8651  C  CG    . LYS C  3  323 ? -34.521 64.374  -14.678 1.00 38.05  ? 323 LYS C CG    1 
ATOM   8652  C  CD    . LYS C  3  323 ? -35.471 65.396  -14.098 1.00 36.14  ? 323 LYS C CD    1 
ATOM   8653  C  CE    . LYS C  3  323 ? -36.214 64.856  -12.927 1.00 35.85  ? 323 LYS C CE    1 
ATOM   8654  N  NZ    . LYS C  3  323 ? -36.871 65.981  -12.233 1.00 39.89  ? 323 LYS C NZ    1 
ATOM   8655  N  N     . PHE C  3  324 ? -35.837 61.522  -17.903 1.00 37.97  ? 324 PHE C N     1 
ATOM   8656  C  CA    . PHE C  3  324 ? -36.552 60.418  -18.521 1.00 37.52  ? 324 PHE C CA    1 
ATOM   8657  C  C     . PHE C  3  324 ? -35.581 59.427  -19.148 1.00 37.11  ? 324 PHE C C     1 
ATOM   8658  O  O     . PHE C  3  324 ? -35.618 58.232  -18.851 1.00 38.21  ? 324 PHE C O     1 
ATOM   8659  C  CB    . PHE C  3  324 ? -37.524 60.944  -19.592 1.00 37.18  ? 324 PHE C CB    1 
ATOM   8660  C  CG    . PHE C  3  324 ? -38.388 59.878  -20.197 1.00 37.37  ? 324 PHE C CG    1 
ATOM   8661  C  CD1   . PHE C  3  324 ? -38.009 59.237  -21.375 1.00 38.04  ? 324 PHE C CD1   1 
ATOM   8662  C  CD2   . PHE C  3  324 ? -39.555 59.476  -19.557 1.00 37.10  ? 324 PHE C CD2   1 
ATOM   8663  C  CE1   . PHE C  3  324 ? -38.776 58.199  -21.908 1.00 39.40  ? 324 PHE C CE1   1 
ATOM   8664  C  CE2   . PHE C  3  324 ? -40.329 58.447  -20.075 1.00 40.29  ? 324 PHE C CE2   1 
ATOM   8665  C  CZ    . PHE C  3  324 ? -39.937 57.799  -21.261 1.00 40.38  ? 324 PHE C CZ    1 
ATOM   8666  N  N     . PHE C  3  325 ? -34.704 59.920  -20.008 1.00 35.84  ? 325 PHE C N     1 
ATOM   8667  C  CA    . PHE C  3  325 ? -33.767 59.029  -20.660 1.00 38.44  ? 325 PHE C CA    1 
ATOM   8668  C  C     . PHE C  3  325 ? -32.743 58.419  -19.721 1.00 39.43  ? 325 PHE C C     1 
ATOM   8669  O  O     . PHE C  3  325 ? -32.240 57.321  -19.979 1.00 39.03  ? 325 PHE C O     1 
ATOM   8670  C  CB    . PHE C  3  325 ? -33.118 59.708  -21.865 1.00 40.05  ? 325 PHE C CB    1 
ATOM   8671  C  CG    . PHE C  3  325 ? -33.988 59.695  -23.088 1.00 41.19  ? 325 PHE C CG    1 
ATOM   8672  C  CD1   . PHE C  3  325 ? -34.716 60.819  -23.450 1.00 41.73  ? 325 PHE C CD1   1 
ATOM   8673  C  CD2   . PHE C  3  325 ? -34.130 58.530  -23.839 1.00 42.89  ? 325 PHE C CD2   1 
ATOM   8674  C  CE1   . PHE C  3  325 ? -35.587 60.790  -24.541 1.00 43.86  ? 325 PHE C CE1   1 
ATOM   8675  C  CE2   . PHE C  3  325 ? -34.999 58.482  -24.934 1.00 44.25  ? 325 PHE C CE2   1 
ATOM   8676  C  CZ    . PHE C  3  325 ? -35.730 59.618  -25.284 1.00 44.94  ? 325 PHE C CZ    1 
ATOM   8677  N  N     . PHE C  3  326 ? -32.460 59.114  -18.617 1.00 40.27  ? 326 PHE C N     1 
ATOM   8678  C  CA    . PHE C  3  326 ? -31.518 58.607  -17.621 1.00 38.59  ? 326 PHE C CA    1 
ATOM   8679  C  C     . PHE C  3  326 ? -32.058 57.274  -17.103 1.00 37.30  ? 326 PHE C C     1 
ATOM   8680  O  O     . PHE C  3  326 ? -31.322 56.292  -17.001 1.00 36.48  ? 326 PHE C O     1 
ATOM   8681  C  CB    . PHE C  3  326 ? -31.360 59.586  -16.443 1.00 37.40  ? 326 PHE C CB    1 
ATOM   8682  C  CG    . PHE C  3  326 ? -30.581 59.016  -15.299 1.00 35.29  ? 326 PHE C CG    1 
ATOM   8683  C  CD1   . PHE C  3  326 ? -29.192 58.980  -15.343 1.00 35.04  ? 326 PHE C CD1   1 
ATOM   8684  C  CD2   . PHE C  3  326 ? -31.236 58.425  -14.213 1.00 35.86  ? 326 PHE C CD2   1 
ATOM   8685  C  CE1   . PHE C  3  326 ? -28.453 58.350  -14.323 1.00 34.65  ? 326 PHE C CE1   1 
ATOM   8686  C  CE2   . PHE C  3  326 ? -30.512 57.792  -13.185 1.00 33.08  ? 326 PHE C CE2   1 
ATOM   8687  C  CZ    . PHE C  3  326 ? -29.119 57.755  -13.246 1.00 32.95  ? 326 PHE C CZ    1 
ATOM   8688  N  N     . PHE C  3  327 ? -33.352 57.242  -16.801 1.00 37.35  ? 327 PHE C N     1 
ATOM   8689  C  CA    . PHE C  3  327 ? -33.968 56.023  -16.298 1.00 40.20  ? 327 PHE C CA    1 
ATOM   8690  C  C     . PHE C  3  327 ? -34.151 54.923  -17.343 1.00 40.19  ? 327 PHE C C     1 
ATOM   8691  O  O     . PHE C  3  327 ? -34.217 53.740  -16.990 1.00 41.81  ? 327 PHE C O     1 
ATOM   8692  C  CB    . PHE C  3  327 ? -35.256 56.331  -15.533 1.00 39.83  ? 327 PHE C CB    1 
ATOM   8693  C  CG    . PHE C  3  327 ? -35.012 57.027  -14.224 1.00 40.95  ? 327 PHE C CG    1 
ATOM   8694  C  CD1   . PHE C  3  327 ? -35.282 58.388  -14.078 1.00 41.71  ? 327 PHE C CD1   1 
ATOM   8695  C  CD2   . PHE C  3  327 ? -34.448 56.340  -13.156 1.00 40.88  ? 327 PHE C CD2   1 
ATOM   8696  C  CE1   . PHE C  3  327 ? -34.985 59.058  -12.884 1.00 41.56  ? 327 PHE C CE1   1 
ATOM   8697  C  CE2   . PHE C  3  327 ? -34.147 57.000  -11.959 1.00 42.47  ? 327 PHE C CE2   1 
ATOM   8698  C  CZ    . PHE C  3  327 ? -34.415 58.363  -11.826 1.00 42.28  ? 327 PHE C CZ    1 
ATOM   8699  N  N     . ILE C  3  328 ? -34.217 55.298  -18.620 1.00 38.01  ? 328 ILE C N     1 
ATOM   8700  C  CA    . ILE C  3  328 ? -34.325 54.295  -19.668 1.00 36.78  ? 328 ILE C CA    1 
ATOM   8701  C  C     . ILE C  3  328 ? -32.988 53.560  -19.585 1.00 37.94  ? 328 ILE C C     1 
ATOM   8702  O  O     . ILE C  3  328 ? -32.942 52.325  -19.543 1.00 38.92  ? 328 ILE C O     1 
ATOM   8703  C  CB    . ILE C  3  328 ? -34.470 54.926  -21.080 1.00 36.31  ? 328 ILE C CB    1 
ATOM   8704  C  CG1   . ILE C  3  328 ? -35.851 55.553  -21.243 1.00 34.19  ? 328 ILE C CG1   1 
ATOM   8705  C  CG2   . ILE C  3  328 ? -34.206 53.874  -22.179 1.00 31.20  ? 328 ILE C CG2   1 
ATOM   8706  C  CD1   . ILE C  3  328 ? -36.968 54.557  -21.457 1.00 34.01  ? 328 ILE C CD1   1 
ATOM   8707  N  N     . PHE C  3  329 ? -31.910 54.338  -19.490 1.00 36.93  ? 329 PHE C N     1 
ATOM   8708  C  CA    . PHE C  3  329 ? -30.563 53.780  -19.384 1.00 36.85  ? 329 PHE C CA    1 
ATOM   8709  C  C     . PHE C  3  329 ? -30.403 52.867  -18.159 1.00 36.99  ? 329 PHE C C     1 
ATOM   8710  O  O     . PHE C  3  329 ? -29.798 51.797  -18.249 1.00 36.28  ? 329 PHE C O     1 
ATOM   8711  C  CB    . PHE C  3  329 ? -29.507 54.889  -19.324 1.00 34.66  ? 329 PHE C CB    1 
ATOM   8712  C  CG    . PHE C  3  329 ? -28.108 54.371  -19.132 1.00 35.68  ? 329 PHE C CG    1 
ATOM   8713  C  CD1   . PHE C  3  329 ? -27.376 53.897  -20.218 1.00 35.08  ? 329 PHE C CD1   1 
ATOM   8714  C  CD2   . PHE C  3  329 ? -27.547 54.290  -17.856 1.00 35.05  ? 329 PHE C CD2   1 
ATOM   8715  C  CE1   . PHE C  3  329 ? -26.109 53.341  -20.044 1.00 34.24  ? 329 PHE C CE1   1 
ATOM   8716  C  CE2   . PHE C  3  329 ? -26.285 53.738  -17.666 1.00 35.42  ? 329 PHE C CE2   1 
ATOM   8717  C  CZ    . PHE C  3  329 ? -25.561 53.258  -18.771 1.00 35.82  ? 329 PHE C CZ    1 
ATOM   8718  N  N     . VAL C  3  330 ? -30.931 53.291  -17.016 1.00 36.82  ? 330 VAL C N     1 
ATOM   8719  C  CA    . VAL C  3  330 ? -30.802 52.481  -15.813 1.00 37.63  ? 330 VAL C CA    1 
ATOM   8720  C  C     . VAL C  3  330 ? -31.480 51.128  -15.951 1.00 37.30  ? 330 VAL C C     1 
ATOM   8721  O  O     . VAL C  3  330 ? -30.845 50.090  -15.738 1.00 35.60  ? 330 VAL C O     1 
ATOM   8722  C  CB    . VAL C  3  330 ? -31.326 53.212  -14.556 1.00 37.22  ? 330 VAL C CB    1 
ATOM   8723  C  CG1   . VAL C  3  330 ? -31.533 52.234  -13.415 1.00 35.26  ? 330 VAL C CG1   1 
ATOM   8724  C  CG2   . VAL C  3  330 ? -30.339 54.255  -14.139 1.00 35.32  ? 330 VAL C CG2   1 
ATOM   8725  N  N     . PHE C  3  331 ? -32.755 51.141  -16.332 1.00 37.65  ? 331 PHE C N     1 
ATOM   8726  C  CA    . PHE C  3  331 ? -33.509 49.899  -16.482 1.00 37.55  ? 331 PHE C CA    1 
ATOM   8727  C  C     . PHE C  3  331 ? -33.049 49.044  -17.657 1.00 37.11  ? 331 PHE C C     1 
ATOM   8728  O  O     . PHE C  3  331 ? -33.237 47.826  -17.663 1.00 36.86  ? 331 PHE C O     1 
ATOM   8729  C  CB    . PHE C  3  331 ? -35.001 50.186  -16.524 1.00 37.88  ? 331 PHE C CB    1 
ATOM   8730  C  CG    . PHE C  3  331 ? -35.537 50.698  -15.227 1.00 39.14  ? 331 PHE C CG    1 
ATOM   8731  C  CD1   . PHE C  3  331 ? -35.971 52.011  -15.107 1.00 40.18  ? 331 PHE C CD1   1 
ATOM   8732  C  CD2   . PHE C  3  331 ? -35.553 49.881  -14.104 1.00 41.26  ? 331 PHE C CD2   1 
ATOM   8733  C  CE1   . PHE C  3  331 ? -36.412 52.511  -13.878 1.00 43.33  ? 331 PHE C CE1   1 
ATOM   8734  C  CE2   . PHE C  3  331 ? -35.990 50.367  -12.869 1.00 44.38  ? 331 PHE C CE2   1 
ATOM   8735  C  CZ    . PHE C  3  331 ? -36.420 51.687  -12.755 1.00 44.50  ? 331 PHE C CZ    1 
ATOM   8736  N  N     . ASN C  3  332 ? -32.395 49.676  -18.626 1.00 36.77  ? 332 ASN C N     1 
ATOM   8737  C  CA    . ASN C  3  332 ? -31.870 48.939  -19.759 1.00 36.90  ? 332 ASN C CA    1 
ATOM   8738  C  C     . ASN C  3  332 ? -30.701 48.109  -19.243 1.00 36.91  ? 332 ASN C C     1 
ATOM   8739  O  O     . ASN C  3  332 ? -30.490 46.980  -19.684 1.00 37.64  ? 332 ASN C O     1 
ATOM   8740  C  CB    . ASN C  3  332 ? -31.400 49.879  -20.876 1.00 36.71  ? 332 ASN C CB    1 
ATOM   8741  C  CG    . ASN C  3  332 ? -30.890 49.115  -22.094 1.00 39.77  ? 332 ASN C CG    1 
ATOM   8742  O  OD1   . ASN C  3  332 ? -29.685 48.935  -22.271 1.00 40.38  ? 332 ASN C OD1   1 
ATOM   8743  N  ND2   . ASN C  3  332 ? -31.815 48.615  -22.908 1.00 39.16  ? 332 ASN C ND2   1 
ATOM   8744  N  N     . PHE C  3  333 ? -29.952 48.683  -18.299 1.00 37.23  ? 333 PHE C N     1 
ATOM   8745  C  CA    . PHE C  3  333 ? -28.797 48.024  -17.687 1.00 36.92  ? 333 PHE C CA    1 
ATOM   8746  C  C     . PHE C  3  333 ? -29.256 46.803  -16.881 1.00 36.75  ? 333 PHE C C     1 
ATOM   8747  O  O     . PHE C  3  333 ? -28.645 45.733  -16.951 1.00 35.21  ? 333 PHE C O     1 
ATOM   8748  C  CB    . PHE C  3  333 ? -28.053 49.008  -16.774 1.00 36.50  ? 333 PHE C CB    1 
ATOM   8749  C  CG    . PHE C  3  333 ? -26.695 48.520  -16.328 1.00 37.59  ? 333 PHE C CG    1 
ATOM   8750  C  CD1   . PHE C  3  333 ? -26.432 48.281  -14.976 1.00 35.75  ? 333 PHE C CD1   1 
ATOM   8751  C  CD2   . PHE C  3  333 ? -25.674 48.311  -17.259 1.00 36.38  ? 333 PHE C CD2   1 
ATOM   8752  C  CE1   . PHE C  3  333 ? -25.176 47.842  -14.564 1.00 37.47  ? 333 PHE C CE1   1 
ATOM   8753  C  CE2   . PHE C  3  333 ? -24.419 47.873  -16.852 1.00 36.80  ? 333 PHE C CE2   1 
ATOM   8754  C  CZ    . PHE C  3  333 ? -24.167 47.638  -15.498 1.00 36.62  ? 333 PHE C CZ    1 
ATOM   8755  N  N     . VAL C  3  334 ? -30.319 46.976  -16.100 1.00 36.61  ? 334 VAL C N     1 
ATOM   8756  C  CA    . VAL C  3  334 ? -30.882 45.879  -15.317 1.00 37.65  ? 334 VAL C CA    1 
ATOM   8757  C  C     . VAL C  3  334 ? -31.351 44.772  -16.284 1.00 39.26  ? 334 VAL C C     1 
ATOM   8758  O  O     . VAL C  3  334 ? -31.090 43.592  -16.049 1.00 38.04  ? 334 VAL C O     1 
ATOM   8759  C  CB    . VAL C  3  334 ? -32.093 46.367  -14.467 1.00 38.84  ? 334 VAL C CB    1 
ATOM   8760  C  CG1   . VAL C  3  334 ? -32.778 45.188  -13.781 1.00 36.02  ? 334 VAL C CG1   1 
ATOM   8761  C  CG2   . VAL C  3  334 ? -31.633 47.393  -13.447 1.00 35.75  ? 334 VAL C CG2   1 
ATOM   8762  N  N     . LEU C  3  335 ? -32.013 45.164  -17.381 1.00 39.40  ? 335 LEU C N     1 
ATOM   8763  C  CA    . LEU C  3  335 ? -32.498 44.210  -18.380 1.00 40.09  ? 335 LEU C CA    1 
ATOM   8764  C  C     . LEU C  3  335 ? -31.335 43.371  -18.919 1.00 39.76  ? 335 LEU C C     1 
ATOM   8765  O  O     . LEU C  3  335 ? -31.416 42.146  -18.982 1.00 38.41  ? 335 LEU C O     1 
ATOM   8766  C  CB    . LEU C  3  335 ? -33.199 44.948  -19.526 1.00 42.75  ? 335 LEU C CB    1 
ATOM   8767  C  CG    . LEU C  3  335 ? -34.070 44.191  -20.553 1.00 44.27  ? 335 LEU C CG    1 
ATOM   8768  C  CD1   . LEU C  3  335 ? -33.222 43.555  -21.632 1.00 45.00  ? 335 LEU C CD1   1 
ATOM   8769  C  CD2   . LEU C  3  335 ? -34.949 43.154  -19.858 1.00 42.58  ? 335 LEU C CD2   1 
ATOM   8770  N  N     . LEU C  3  336 ? -30.251 44.040  -19.292 1.00 38.54  ? 336 LEU C N     1 
ATOM   8771  C  CA    . LEU C  3  336 ? -29.063 43.369  -19.795 1.00 39.10  ? 336 LEU C CA    1 
ATOM   8772  C  C     . LEU C  3  336 ? -28.643 42.293  -18.795 1.00 39.92  ? 336 LEU C C     1 
ATOM   8773  O  O     . LEU C  3  336 ? -28.225 41.194  -19.178 1.00 39.57  ? 336 LEU C O     1 
ATOM   8774  C  CB    . LEU C  3  336 ? -27.923 44.380  -19.945 1.00 40.67  ? 336 LEU C CB    1 
ATOM   8775  C  CG    . LEU C  3  336 ? -27.284 44.751  -21.283 1.00 40.98  ? 336 LEU C CG    1 
ATOM   8776  C  CD1   . LEU C  3  336 ? -27.858 43.957  -22.438 1.00 37.97  ? 336 LEU C CD1   1 
ATOM   8777  C  CD2   . LEU C  3  336 ? -27.480 46.229  -21.489 1.00 42.87  ? 336 LEU C CD2   1 
ATOM   8778  N  N     . GLY C  3  337 ? -28.759 42.626  -17.508 1.00 39.67  ? 337 GLY C N     1 
ATOM   8779  C  CA    . GLY C  3  337 ? -28.396 41.697  -16.454 1.00 39.57  ? 337 GLY C CA    1 
ATOM   8780  C  C     . GLY C  3  337 ? -29.319 40.497  -16.430 1.00 39.87  ? 337 GLY C C     1 
ATOM   8781  O  O     . GLY C  3  337 ? -28.880 39.366  -16.253 1.00 38.83  ? 337 GLY C O     1 
ATOM   8782  N  N     . GLN C  3  338 ? -30.611 40.748  -16.592 1.00 41.14  ? 338 GLN C N     1 
ATOM   8783  C  CA    . GLN C  3  338 ? -31.588 39.674  -16.606 1.00 43.83  ? 338 GLN C CA    1 
ATOM   8784  C  C     . GLN C  3  338 ? -31.339 38.740  -17.817 1.00 45.24  ? 338 GLN C C     1 
ATOM   8785  O  O     . GLN C  3  338 ? -31.380 37.507  -17.679 1.00 44.47  ? 338 GLN C O     1 
ATOM   8786  C  CB    . GLN C  3  338 ? -32.994 40.269  -16.616 1.00 44.78  ? 338 GLN C CB    1 
ATOM   8787  C  CG    . GLN C  3  338 ? -34.123 39.248  -16.635 1.00 54.59  ? 338 GLN C CG    1 
ATOM   8788  C  CD    . GLN C  3  338 ? -34.052 38.227  -15.504 1.00 57.87  ? 338 GLN C CD    1 
ATOM   8789  O  OE1   . GLN C  3  338 ? -34.301 38.551  -14.339 1.00 59.84  ? 338 GLN C OE1   1 
ATOM   8790  N  NE2   . GLN C  3  338 ? -33.737 36.979  -15.852 1.00 57.18  ? 338 GLN C NE2   1 
ATOM   8791  N  N     . ILE C  3  339 ? -31.020 39.327  -18.976 1.00 44.38  ? 339 ILE C N     1 
ATOM   8792  C  CA    . ILE C  3  339 ? -30.736 38.558  -20.183 1.00 43.35  ? 339 ILE C CA    1 
ATOM   8793  C  C     . ILE C  3  339 ? -29.524 37.664  -19.924 1.00 42.99  ? 339 ILE C C     1 
ATOM   8794  O  O     . ILE C  3  339 ? -29.495 36.514  -20.352 1.00 43.31  ? 339 ILE C O     1 
ATOM   8795  C  CB    . ILE C  3  339 ? -30.430 39.483  -21.408 1.00 45.52  ? 339 ILE C CB    1 
ATOM   8796  C  CG1   . ILE C  3  339 ? -31.660 40.303  -21.797 1.00 44.43  ? 339 ILE C CG1   1 
ATOM   8797  C  CG2   . ILE C  3  339 ? -29.952 38.667  -22.614 1.00 43.27  ? 339 ILE C CG2   1 
ATOM   8798  C  CD1   . ILE C  3  339 ? -32.825 39.483  -22.177 1.00 45.75  ? 339 ILE C CD1   1 
ATOM   8799  N  N     . GLY C  3  340 ? -28.532 38.200  -19.215 1.00 42.98  ? 340 GLY C N     1 
ATOM   8800  C  CA    . GLY C  3  340 ? -27.327 37.439  -18.900 1.00 41.54  ? 340 GLY C CA    1 
ATOM   8801  C  C     . GLY C  3  340 ? -27.563 36.179  -18.079 1.00 40.94  ? 340 GLY C C     1 
ATOM   8802  O  O     . GLY C  3  340 ? -26.791 35.235  -18.165 1.00 40.59  ? 340 GLY C O     1 
ATOM   8803  N  N     . ALA C  3  341 ? -28.635 36.159  -17.290 1.00 41.47  ? 341 ALA C N     1 
ATOM   8804  C  CA    . ALA C  3  341 ? -28.975 35.008  -16.464 1.00 43.36  ? 341 ALA C CA    1 
ATOM   8805  C  C     . ALA C  3  341 ? -29.833 33.973  -17.208 1.00 45.97  ? 341 ALA C C     1 
ATOM   8806  O  O     . ALA C  3  341 ? -30.134 32.907  -16.679 1.00 48.31  ? 341 ALA C O     1 
ATOM   8807  C  CB    . ALA C  3  341 ? -29.687 35.469  -15.222 1.00 41.51  ? 341 ALA C CB    1 
ATOM   8808  N  N     . CYS C  3  342 ? -30.249 34.298  -18.424 1.00 47.06  ? 342 CYS C N     1 
ATOM   8809  C  CA    . CYS C  3  342 ? -31.058 33.386  -19.222 1.00 48.34  ? 342 CYS C CA    1 
ATOM   8810  C  C     . CYS C  3  342 ? -30.208 32.584  -20.201 1.00 48.79  ? 342 CYS C C     1 
ATOM   8811  O  O     . CYS C  3  342 ? -29.021 32.857  -20.374 1.00 48.30  ? 342 CYS C O     1 
ATOM   8812  C  CB    . CYS C  3  342 ? -32.118 34.161  -20.002 1.00 48.06  ? 342 CYS C CB    1 
ATOM   8813  S  SG    . CYS C  3  342 ? -33.356 34.946  -18.993 1.00 53.50  ? 342 CYS C SG    1 
ATOM   8814  N  N     . HIS C  3  343 ? -30.817 31.568  -20.812 1.00 50.86  ? 343 HIS C N     1 
ATOM   8815  C  CA    . HIS C  3  343 ? -30.132 30.740  -21.804 1.00 52.77  ? 343 HIS C CA    1 
ATOM   8816  C  C     . HIS C  3  343 ? -30.122 31.456  -23.143 1.00 52.37  ? 343 HIS C C     1 
ATOM   8817  O  O     . HIS C  3  343 ? -30.933 32.354  -23.383 1.00 51.32  ? 343 HIS C O     1 
ATOM   8818  C  CB    . HIS C  3  343 ? -30.832 29.396  -21.958 1.00 55.25  ? 343 HIS C CB    1 
ATOM   8819  C  CG    . HIS C  3  343 ? -30.643 28.486  -20.787 1.00 60.43  ? 343 HIS C CG    1 
ATOM   8820  N  ND1   . HIS C  3  343 ? -29.459 27.821  -20.547 1.00 61.68  ? 343 HIS C ND1   1 
ATOM   8821  C  CD2   . HIS C  3  343 ? -31.479 28.147  -19.776 1.00 60.43  ? 343 HIS C CD2   1 
ATOM   8822  C  CE1   . HIS C  3  343 ? -29.572 27.113  -19.436 1.00 61.86  ? 343 HIS C CE1   1 
ATOM   8823  N  NE2   . HIS C  3  343 ? -30.788 27.294  -18.950 1.00 62.29  ? 343 HIS C NE2   1 
ATOM   8824  N  N     . VAL C  3  344 ? -29.165 31.114  -23.993 1.00 52.41  ? 344 VAL C N     1 
ATOM   8825  C  CA    . VAL C  3  344 ? -29.116 31.738  -25.303 1.00 53.65  ? 344 VAL C CA    1 
ATOM   8826  C  C     . VAL C  3  344 ? -30.260 31.086  -26.090 1.00 54.42  ? 344 VAL C C     1 
ATOM   8827  O  O     . VAL C  3  344 ? -30.097 30.012  -26.674 1.00 54.49  ? 344 VAL C O     1 
ATOM   8828  C  CB    . VAL C  3  344 ? -27.750 31.501  -25.998 1.00 54.61  ? 344 VAL C CB    1 
ATOM   8829  C  CG1   . VAL C  3  344 ? -27.690 32.238  -27.326 1.00 54.18  ? 344 VAL C CG1   1 
ATOM   8830  C  CG2   . VAL C  3  344 ? -26.613 31.964  -25.101 1.00 54.97  ? 344 VAL C CG2   1 
ATOM   8831  N  N     . GLU C  3  345 ? -31.446 31.683  -25.969 1.00 54.38  ? 345 GLU C N     1 
ATOM   8832  C  CA    . GLU C  3  345 ? -32.657 31.215  -26.635 1.00 54.46  ? 345 GLU C CA    1 
ATOM   8833  C  C     . GLU C  3  345 ? -33.359 32.362  -27.356 1.00 56.86  ? 345 GLU C C     1 
ATOM   8834  O  O     . GLU C  3  345 ? -33.101 33.533  -27.067 1.00 58.51  ? 345 GLU C O     1 
ATOM   8835  C  CB    . GLU C  3  345 ? -33.588 30.515  -25.651 1.00 52.55  ? 345 GLU C CB    1 
ATOM   8836  C  CG    . GLU C  3  345 ? -33.030 29.184  -25.165 1.00 51.04  ? 345 GLU C CG    1 
ATOM   8837  C  CD    . GLU C  3  345 ? -33.913 28.482  -24.141 1.00 52.14  ? 345 GLU C CD    1 
ATOM   8838  O  OE1   . GLU C  3  345 ? -34.902 29.082  -23.643 1.00 50.35  ? 345 GLU C OE1   1 
ATOM   8839  O  OE2   . GLU C  3  345 ? -33.601 27.310  -23.833 1.00 51.71  ? 345 GLU C OE2   1 
ATOM   8840  N  N     . VAL C  3  346 ? -34.320 32.013  -28.212 1.00 57.49  ? 346 VAL C N     1 
ATOM   8841  C  CA    . VAL C  3  346 ? -35.001 32.971  -29.074 1.00 57.99  ? 346 VAL C CA    1 
ATOM   8842  C  C     . VAL C  3  346 ? -35.428 34.392  -28.714 1.00 59.60  ? 346 VAL C C     1 
ATOM   8843  O  O     . VAL C  3  346 ? -34.851 35.360  -29.252 1.00 64.62  ? 346 VAL C O     1 
ATOM   8844  C  CB    . VAL C  3  346 ? -36.049 32.285  -29.966 1.00 57.36  ? 346 VAL C CB    1 
ATOM   8845  C  CG1   . VAL C  3  346 ? -37.044 33.296  -30.552 1.00 55.58  ? 346 VAL C CG1   1 
ATOM   8846  C  CG2   . VAL C  3  346 ? -35.316 31.605  -31.111 1.00 58.44  ? 346 VAL C CG2   1 
ATOM   8847  N  N     . PRO C  3  347 ? -36.397 34.568  -27.808 1.00 55.25  ? 347 PRO C N     1 
ATOM   8848  C  CA    . PRO C  3  347 ? -36.697 35.993  -27.593 1.00 52.18  ? 347 PRO C CA    1 
ATOM   8849  C  C     . PRO C  3  347 ? -35.534 36.762  -26.948 1.00 53.01  ? 347 PRO C C     1 
ATOM   8850  O  O     . PRO C  3  347 ? -35.287 37.920  -27.289 1.00 55.09  ? 347 PRO C O     1 
ATOM   8851  C  CB    . PRO C  3  347 ? -37.945 35.956  -26.720 1.00 48.39  ? 347 PRO C CB    1 
ATOM   8852  C  CG    . PRO C  3  347 ? -37.724 34.713  -25.896 1.00 52.12  ? 347 PRO C CG    1 
ATOM   8853  C  CD    . PRO C  3  347 ? -37.064 33.696  -26.829 1.00 51.32  ? 347 PRO C CD    1 
ATOM   8854  N  N     . TYR C  3  348 ? -34.738 36.056  -26.143 1.00 50.69  ? 348 TYR C N     1 
ATOM   8855  C  CA    . TYR C  3  348 ? -33.619 36.641  -25.403 1.00 48.61  ? 348 TYR C CA    1 
ATOM   8856  C  C     . TYR C  3  348 ? -32.420 37.173  -26.197 1.00 49.04  ? 348 TYR C C     1 
ATOM   8857  O  O     . TYR C  3  348 ? -31.891 38.241  -25.877 1.00 47.94  ? 348 TYR C O     1 
ATOM   8858  C  CB    . TYR C  3  348 ? -33.143 35.656  -24.334 1.00 44.47  ? 348 TYR C CB    1 
ATOM   8859  C  CG    . TYR C  3  348 ? -34.248 35.149  -23.435 1.00 40.81  ? 348 TYR C CG    1 
ATOM   8860  C  CD1   . TYR C  3  348 ? -34.260 33.820  -22.986 1.00 38.57  ? 348 TYR C CD1   1 
ATOM   8861  C  CD2   . TYR C  3  348 ? -35.273 35.996  -23.024 1.00 40.78  ? 348 TYR C CD2   1 
ATOM   8862  C  CE1   . TYR C  3  348 ? -35.268 33.351  -22.148 1.00 37.75  ? 348 TYR C CE1   1 
ATOM   8863  C  CE2   . TYR C  3  348 ? -36.288 35.543  -22.183 1.00 41.90  ? 348 TYR C CE2   1 
ATOM   8864  C  CZ    . TYR C  3  348 ? -36.279 34.221  -21.746 1.00 41.31  ? 348 TYR C CZ    1 
ATOM   8865  O  OH    . TYR C  3  348 ? -37.268 33.793  -20.886 1.00 42.91  ? 348 TYR C OH    1 
ATOM   8866  N  N     . VAL C  3  349 ? -31.993 36.440  -27.220 1.00 48.47  ? 349 VAL C N     1 
ATOM   8867  C  CA    . VAL C  3  349 ? -30.853 36.857  -28.039 1.00 48.32  ? 349 VAL C CA    1 
ATOM   8868  C  C     . VAL C  3  349 ? -31.090 38.200  -28.740 1.00 48.94  ? 349 VAL C C     1 
ATOM   8869  O  O     . VAL C  3  349 ? -30.222 39.069  -28.761 1.00 51.22  ? 349 VAL C O     1 
ATOM   8870  C  CB    . VAL C  3  349 ? -30.502 35.777  -29.103 1.00 47.89  ? 349 VAL C CB    1 
ATOM   8871  C  CG1   . VAL C  3  349 ? -29.344 36.239  -29.980 1.00 45.15  ? 349 VAL C CG1   1 
ATOM   8872  C  CG2   . VAL C  3  349 ? -30.148 34.468  -28.418 1.00 45.80  ? 349 VAL C CG2   1 
ATOM   8873  N  N     . LEU C  3  350 ? -32.274 38.370  -29.308 1.00 49.13  ? 350 LEU C N     1 
ATOM   8874  C  CA    . LEU C  3  350 ? -32.604 39.604  -29.995 1.00 48.83  ? 350 LEU C CA    1 
ATOM   8875  C  C     . LEU C  3  350 ? -32.770 40.727  -28.965 1.00 48.69  ? 350 LEU C C     1 
ATOM   8876  O  O     . LEU C  3  350 ? -32.346 41.859  -29.198 1.00 50.26  ? 350 LEU C O     1 
ATOM   8877  C  CB    . LEU C  3  350 ? -33.877 39.404  -30.826 1.00 47.64  ? 350 LEU C CB    1 
ATOM   8878  C  CG    . LEU C  3  350 ? -34.220 40.348  -31.995 1.00 49.76  ? 350 LEU C CG    1 
ATOM   8879  C  CD1   . LEU C  3  350 ? -35.362 41.285  -31.610 1.00 51.25  ? 350 LEU C CD1   1 
ATOM   8880  C  CD2   . LEU C  3  350 ? -32.993 41.115  -32.496 1.00 46.03  ? 350 LEU C CD2   1 
ATOM   8881  N  N     . MET C  3  351 ? -33.374 40.412  -27.823 1.00 47.55  ? 351 MET C N     1 
ATOM   8882  C  CA    . MET C  3  351 ? -33.556 41.406  -26.767 1.00 48.04  ? 351 MET C CA    1 
ATOM   8883  C  C     . MET C  3  351 ? -32.180 41.875  -26.266 1.00 49.00  ? 351 MET C C     1 
ATOM   8884  O  O     . MET C  3  351 ? -31.968 43.063  -25.997 1.00 47.14  ? 351 MET C O     1 
ATOM   8885  C  CB    . MET C  3  351 ? -34.355 40.817  -25.604 1.00 46.65  ? 351 MET C CB    1 
ATOM   8886  C  CG    . MET C  3  351 ? -35.812 40.607  -25.897 1.00 47.63  ? 351 MET C CG    1 
ATOM   8887  S  SD    . MET C  3  351 ? -36.654 39.749  -24.571 1.00 51.16  ? 351 MET C SD    1 
ATOM   8888  C  CE    . MET C  3  351 ? -36.950 41.125  -23.444 1.00 46.52  ? 351 MET C CE    1 
ATOM   8889  N  N     . GLY C  3  352 ? -31.253 40.923  -26.166 1.00 48.93  ? 352 GLY C N     1 
ATOM   8890  C  CA    . GLY C  3  352 ? -29.909 41.224  -25.717 1.00 48.72  ? 352 GLY C CA    1 
ATOM   8891  C  C     . GLY C  3  352 ? -29.221 42.147  -26.693 1.00 49.47  ? 352 GLY C C     1 
ATOM   8892  O  O     . GLY C  3  352 ? -28.562 43.114  -26.293 1.00 50.58  ? 352 GLY C O     1 
ATOM   8893  N  N     . GLN C  3  353 ? -29.396 41.865  -27.982 1.00 48.49  ? 353 GLN C N     1 
ATOM   8894  C  CA    . GLN C  3  353 ? -28.790 42.687  -29.022 1.00 47.16  ? 353 GLN C CA    1 
ATOM   8895  C  C     . GLN C  3  353 ? -29.333 44.111  -29.051 1.00 45.50  ? 353 GLN C C     1 
ATOM   8896  O  O     . GLN C  3  353 ? -28.563 45.052  -29.181 1.00 45.93  ? 353 GLN C O     1 
ATOM   8897  C  CB    . GLN C  3  353 ? -28.917 42.014  -30.385 1.00 46.94  ? 353 GLN C CB    1 
ATOM   8898  C  CG    . GLN C  3  353 ? -27.979 40.832  -30.526 1.00 48.64  ? 353 GLN C CG    1 
ATOM   8899  C  CD    . GLN C  3  353 ? -28.284 39.950  -31.720 1.00 48.29  ? 353 GLN C CD    1 
ATOM   8900  O  OE1   . GLN C  3  353 ? -29.377 39.997  -32.279 1.00 49.46  ? 353 GLN C OE1   1 
ATOM   8901  N  NE2   . GLN C  3  353 ? -27.323 39.113  -32.096 1.00 48.58  ? 353 GLN C NE2   1 
ATOM   8902  N  N     . ILE C  3  354 ? -30.638 44.278  -28.873 1.00 44.20  ? 354 ILE C N     1 
ATOM   8903  C  CA    . ILE C  3  354 ? -31.221 45.614  -28.873 1.00 44.60  ? 354 ILE C CA    1 
ATOM   8904  C  C     . ILE C  3  354 ? -30.789 46.400  -27.631 1.00 43.67  ? 354 ILE C C     1 
ATOM   8905  O  O     . ILE C  3  354 ? -30.429 47.569  -27.739 1.00 44.75  ? 354 ILE C O     1 
ATOM   8906  C  CB    . ILE C  3  354 ? -32.766 45.560  -28.985 1.00 46.84  ? 354 ILE C CB    1 
ATOM   8907  C  CG1   . ILE C  3  354 ? -33.157 44.963  -30.343 1.00 48.53  ? 354 ILE C CG1   1 
ATOM   8908  C  CG2   . ILE C  3  354 ? -33.381 46.957  -28.831 1.00 42.51  ? 354 ILE C CG2   1 
ATOM   8909  C  CD1   . ILE C  3  354 ? -34.659 44.739  -30.514 1.00 49.26  ? 354 ILE C CD1   1 
ATOM   8910  N  N     . ALA C  3  355 ? -30.801 45.752  -26.466 1.00 42.81  ? 355 ALA C N     1 
ATOM   8911  C  CA    . ALA C  3  355 ? -30.393 46.388  -25.204 1.00 40.37  ? 355 ALA C CA    1 
ATOM   8912  C  C     . ALA C  3  355 ? -28.944 46.869  -25.289 1.00 40.21  ? 355 ALA C C     1 
ATOM   8913  O  O     . ALA C  3  355 ? -28.618 47.952  -24.786 1.00 40.49  ? 355 ALA C O     1 
ATOM   8914  C  CB    . ALA C  3  355 ? -30.551 45.428  -24.047 1.00 37.86  ? 355 ALA C CB    1 
ATOM   8915  N  N     . THR C  3  356 ? -28.079 46.061  -25.909 1.00 36.35  ? 356 THR C N     1 
ATOM   8916  C  CA    . THR C  3  356 ? -26.684 46.444  -26.090 1.00 34.06  ? 356 THR C CA    1 
ATOM   8917  C  C     . THR C  3  356 ? -26.647 47.700  -26.948 1.00 34.70  ? 356 THR C C     1 
ATOM   8918  O  O     . THR C  3  356 ? -25.902 48.618  -26.662 1.00 39.04  ? 356 THR C O     1 
ATOM   8919  C  CB    . THR C  3  356 ? -25.870 45.376  -26.836 1.00 33.79  ? 356 THR C CB    1 
ATOM   8920  O  OG1   . THR C  3  356 ? -25.823 44.171  -26.065 1.00 36.42  ? 356 THR C OG1   1 
ATOM   8921  C  CG2   . THR C  3  356 ? -24.446 45.869  -27.102 1.00 27.99  ? 356 THR C CG2   1 
ATOM   8922  N  N     . PHE C  3  357 ? -27.431 47.730  -28.019 1.00 34.20  ? 357 PHE C N     1 
ATOM   8923  C  CA    . PHE C  3  357 ? -27.451 48.895  -28.873 1.00 33.27  ? 357 PHE C CA    1 
ATOM   8924  C  C     . PHE C  3  357 ? -27.829 50.108  -28.026 1.00 34.16  ? 357 PHE C C     1 
ATOM   8925  O  O     . PHE C  3  357 ? -27.094 51.089  -27.980 1.00 35.29  ? 357 PHE C O     1 
ATOM   8926  C  CB    . PHE C  3  357 ? -28.443 48.722  -30.040 1.00 32.93  ? 357 PHE C CB    1 
ATOM   8927  C  CG    . PHE C  3  357 ? -28.575 49.956  -30.901 1.00 32.00  ? 357 PHE C CG    1 
ATOM   8928  C  CD1   . PHE C  3  357 ? -27.539 50.331  -31.755 1.00 31.17  ? 357 PHE C CD1   1 
ATOM   8929  C  CD2   . PHE C  3  357 ? -29.678 50.806  -30.768 1.00 33.00  ? 357 PHE C CD2   1 
ATOM   8930  C  CE1   . PHE C  3  357 ? -27.589 51.536  -32.460 1.00 31.49  ? 357 PHE C CE1   1 
ATOM   8931  C  CE2   . PHE C  3  357 ? -29.743 52.020  -31.468 1.00 33.10  ? 357 PHE C CE2   1 
ATOM   8932  C  CZ    . PHE C  3  357 ? -28.691 52.386  -32.314 1.00 33.34  ? 357 PHE C CZ    1 
ATOM   8933  N  N     . ILE C  3  358 ? -28.964 50.027  -27.340 1.00 33.97  ? 358 ILE C N     1 
ATOM   8934  C  CA    . ILE C  3  358 ? -29.430 51.120  -26.498 1.00 36.22  ? 358 ILE C CA    1 
ATOM   8935  C  C     . ILE C  3  358 ? -28.362 51.627  -25.504 1.00 39.29  ? 358 ILE C C     1 
ATOM   8936  O  O     . ILE C  3  358 ? -28.199 52.843  -25.339 1.00 40.35  ? 358 ILE C O     1 
ATOM   8937  C  CB    . ILE C  3  358 ? -30.714 50.718  -25.733 1.00 37.07  ? 358 ILE C CB    1 
ATOM   8938  C  CG1   . ILE C  3  358 ? -31.835 50.386  -26.729 1.00 37.02  ? 358 ILE C CG1   1 
ATOM   8939  C  CG2   . ILE C  3  358 ? -31.147 51.845  -24.795 1.00 36.61  ? 358 ILE C CG2   1 
ATOM   8940  C  CD1   . ILE C  3  358 ? -33.196 50.090  -26.092 1.00 33.97  ? 358 ILE C CD1   1 
ATOM   8941  N  N     . TYR C  3  359 ? -27.630 50.701  -24.871 1.00 37.62  ? 359 TYR C N     1 
ATOM   8942  C  CA    . TYR C  3  359 ? -26.584 51.041  -23.913 1.00 36.96  ? 359 TYR C CA    1 
ATOM   8943  C  C     . TYR C  3  359 ? -25.553 52.012  -24.509 1.00 38.29  ? 359 TYR C C     1 
ATOM   8944  O  O     . TYR C  3  359 ? -25.271 53.071  -23.930 1.00 39.23  ? 359 TYR C O     1 
ATOM   8945  C  CB    . TYR C  3  359 ? -25.892 49.765  -23.415 1.00 37.07  ? 359 TYR C CB    1 
ATOM   8946  C  CG    . TYR C  3  359 ? -24.744 49.986  -22.433 1.00 38.01  ? 359 TYR C CG    1 
ATOM   8947  C  CD1   . TYR C  3  359 ? -24.943 49.868  -21.060 1.00 39.36  ? 359 TYR C CD1   1 
ATOM   8948  C  CD2   . TYR C  3  359 ? -23.463 50.291  -22.884 1.00 37.74  ? 359 TYR C CD2   1 
ATOM   8949  C  CE1   . TYR C  3  359 ? -23.898 50.049  -20.168 1.00 41.73  ? 359 TYR C CE1   1 
ATOM   8950  C  CE2   . TYR C  3  359 ? -22.414 50.475  -22.012 1.00 39.74  ? 359 TYR C CE2   1 
ATOM   8951  C  CZ    . TYR C  3  359 ? -22.631 50.356  -20.651 1.00 43.80  ? 359 TYR C CZ    1 
ATOM   8952  O  OH    . TYR C  3  359 ? -21.581 50.560  -19.773 1.00 45.79  ? 359 TYR C OH    1 
ATOM   8953  N  N     . PHE C  3  360 ? -24.985 51.647  -25.655 1.00 36.23  ? 360 PHE C N     1 
ATOM   8954  C  CA    . PHE C  3  360 ? -23.999 52.495  -26.323 1.00 36.68  ? 360 PHE C CA    1 
ATOM   8955  C  C     . PHE C  3  360 ? -24.609 53.790  -26.918 1.00 38.83  ? 360 PHE C C     1 
ATOM   8956  O  O     . PHE C  3  360 ? -23.974 54.850  -26.914 1.00 41.11  ? 360 PHE C O     1 
ATOM   8957  C  CB    . PHE C  3  360 ? -23.306 51.705  -27.433 1.00 33.28  ? 360 PHE C CB    1 
ATOM   8958  C  CG    . PHE C  3  360 ? -22.225 50.791  -26.947 1.00 32.42  ? 360 PHE C CG    1 
ATOM   8959  C  CD1   . PHE C  3  360 ? -22.470 49.432  -26.778 1.00 31.11  ? 360 PHE C CD1   1 
ATOM   8960  C  CD2   . PHE C  3  360 ? -20.949 51.282  -26.682 1.00 30.41  ? 360 PHE C CD2   1 
ATOM   8961  C  CE1   . PHE C  3  360 ? -21.459 48.570  -26.356 1.00 30.77  ? 360 PHE C CE1   1 
ATOM   8962  C  CE2   . PHE C  3  360 ? -19.929 50.427  -26.259 1.00 33.47  ? 360 PHE C CE2   1 
ATOM   8963  C  CZ    . PHE C  3  360 ? -20.186 49.065  -26.097 1.00 32.36  ? 360 PHE C CZ    1 
ATOM   8964  N  N     . ALA C  3  361 ? -25.834 53.696  -27.425 1.00 37.19  ? 361 ALA C N     1 
ATOM   8965  C  CA    . ALA C  3  361 ? -26.519 54.831  -28.029 1.00 38.21  ? 361 ALA C CA    1 
ATOM   8966  C  C     . ALA C  3  361 ? -26.786 55.956  -27.028 1.00 39.06  ? 361 ALA C C     1 
ATOM   8967  O  O     . ALA C  3  361 ? -26.888 57.132  -27.400 1.00 38.28  ? 361 ALA C O     1 
ATOM   8968  C  CB    . ALA C  3  361 ? -27.835 54.365  -28.669 1.00 35.99  ? 361 ALA C CB    1 
ATOM   8969  N  N     . TYR C  3  362 ? -26.911 55.593  -25.754 1.00 40.04  ? 362 TYR C N     1 
ATOM   8970  C  CA    . TYR C  3  362 ? -27.165 56.585  -24.706 1.00 38.68  ? 362 TYR C CA    1 
ATOM   8971  C  C     . TYR C  3  362 ? -26.027 57.596  -24.637 1.00 37.88  ? 362 TYR C C     1 
ATOM   8972  O  O     . TYR C  3  362 ? -26.247 58.800  -24.612 1.00 38.19  ? 362 TYR C O     1 
ATOM   8973  C  CB    . TYR C  3  362 ? -27.317 55.899  -23.342 1.00 37.43  ? 362 TYR C CB    1 
ATOM   8974  C  CG    . TYR C  3  362 ? -27.542 56.873  -22.205 1.00 33.50  ? 362 TYR C CG    1 
ATOM   8975  C  CD1   . TYR C  3  362 ? -28.748 57.560  -22.076 1.00 33.42  ? 362 TYR C CD1   1 
ATOM   8976  C  CD2   . TYR C  3  362 ? -26.529 57.151  -21.297 1.00 32.10  ? 362 TYR C CD2   1 
ATOM   8977  C  CE1   . TYR C  3  362 ? -28.932 58.503  -21.075 1.00 32.27  ? 362 TYR C CE1   1 
ATOM   8978  C  CE2   . TYR C  3  362 ? -26.704 58.090  -20.296 1.00 30.58  ? 362 TYR C CE2   1 
ATOM   8979  C  CZ    . TYR C  3  362 ? -27.901 58.758  -20.192 1.00 30.59  ? 362 TYR C CZ    1 
ATOM   8980  O  OH    . TYR C  3  362 ? -28.070 59.679  -19.201 1.00 31.53  ? 362 TYR C OH    1 
ATOM   8981  N  N     . PHE C  3  363 ? -24.807 57.078  -24.641 1.00 37.86  ? 363 PHE C N     1 
ATOM   8982  C  CA    . PHE C  3  363 ? -23.610 57.887  -24.558 1.00 37.55  ? 363 PHE C CA    1 
ATOM   8983  C  C     . PHE C  3  363 ? -23.285 58.603  -25.849 1.00 37.81  ? 363 PHE C C     1 
ATOM   8984  O  O     . PHE C  3  363 ? -22.911 59.764  -25.831 1.00 38.86  ? 363 PHE C O     1 
ATOM   8985  C  CB    . PHE C  3  363 ? -22.416 57.001  -24.184 1.00 38.25  ? 363 PHE C CB    1 
ATOM   8986  C  CG    . PHE C  3  363 ? -22.547 56.334  -22.845 1.00 40.96  ? 363 PHE C CG    1 
ATOM   8987  C  CD1   . PHE C  3  363 ? -22.797 54.971  -22.752 1.00 41.27  ? 363 PHE C CD1   1 
ATOM   8988  C  CD2   . PHE C  3  363 ? -22.433 57.074  -21.671 1.00 41.17  ? 363 PHE C CD2   1 
ATOM   8989  C  CE1   . PHE C  3  363 ? -22.932 54.356  -21.514 1.00 40.60  ? 363 PHE C CE1   1 
ATOM   8990  C  CE2   . PHE C  3  363 ? -22.566 56.466  -20.428 1.00 41.00  ? 363 PHE C CE2   1 
ATOM   8991  C  CZ    . PHE C  3  363 ? -22.817 55.108  -20.351 1.00 41.34  ? 363 PHE C CZ    1 
ATOM   8992  N  N     . LEU C  3  364 ? -23.415 57.902  -26.968 1.00 38.68  ? 364 LEU C N     1 
ATOM   8993  C  CA    . LEU C  3  364 ? -23.059 58.463  -28.264 1.00 39.11  ? 364 LEU C CA    1 
ATOM   8994  C  C     . LEU C  3  364 ? -24.121 59.209  -29.078 1.00 40.58  ? 364 LEU C C     1 
ATOM   8995  O  O     . LEU C  3  364 ? -23.773 60.041  -29.918 1.00 41.73  ? 364 LEU C O     1 
ATOM   8996  C  CB    . LEU C  3  364 ? -22.434 57.363  -29.124 1.00 37.79  ? 364 LEU C CB    1 
ATOM   8997  C  CG    . LEU C  3  364 ? -21.294 56.583  -28.468 1.00 39.15  ? 364 LEU C CG    1 
ATOM   8998  C  CD1   . LEU C  3  364 ? -20.847 55.445  -29.369 1.00 38.55  ? 364 LEU C CD1   1 
ATOM   8999  C  CD2   . LEU C  3  364 ? -20.128 57.513  -28.163 1.00 38.21  ? 364 LEU C CD2   1 
ATOM   9000  N  N     . ILE C  3  365 ? -25.403 58.948  -28.830 1.00 40.08  ? 365 ILE C N     1 
ATOM   9001  C  CA    . ILE C  3  365 ? -26.460 59.586  -29.620 1.00 38.84  ? 365 ILE C CA    1 
ATOM   9002  C  C     . ILE C  3  365 ? -27.496 60.341  -28.797 1.00 38.52  ? 365 ILE C C     1 
ATOM   9003  O  O     . ILE C  3  365 ? -27.702 61.538  -28.996 1.00 38.89  ? 365 ILE C O     1 
ATOM   9004  C  CB    . ILE C  3  365 ? -27.170 58.521  -30.533 1.00 40.41  ? 365 ILE C CB    1 
ATOM   9005  C  CG1   . ILE C  3  365 ? -26.146 57.897  -31.487 1.00 41.54  ? 365 ILE C CG1   1 
ATOM   9006  C  CG2   . ILE C  3  365 ? -28.310 59.143  -31.325 1.00 38.20  ? 365 ILE C CG2   1 
ATOM   9007  C  CD1   . ILE C  3  365 ? -26.685 56.759  -32.305 1.00 44.01  ? 365 ILE C CD1   1 
ATOM   9008  N  N     . ILE C  3  366 ? -28.157 59.636  -27.885 1.00 37.40  ? 366 ILE C N     1 
ATOM   9009  C  CA    . ILE C  3  366 ? -29.181 60.234  -27.041 1.00 37.14  ? 366 ILE C CA    1 
ATOM   9010  C  C     . ILE C  3  366 ? -28.727 61.459  -26.229 1.00 38.75  ? 366 ILE C C     1 
ATOM   9011  O  O     . ILE C  3  366 ? -29.315 62.531  -26.363 1.00 42.09  ? 366 ILE C O     1 
ATOM   9012  C  CB    . ILE C  3  366 ? -29.816 59.171  -26.119 1.00 37.14  ? 366 ILE C CB    1 
ATOM   9013  C  CG1   . ILE C  3  366 ? -30.622 58.186  -26.962 1.00 38.56  ? 366 ILE C CG1   1 
ATOM   9014  C  CG2   . ILE C  3  366 ? -30.709 59.815  -25.074 1.00 35.72  ? 366 ILE C CG2   1 
ATOM   9015  C  CD1   . ILE C  3  366 ? -31.145 56.983  -26.193 1.00 40.40  ? 366 ILE C CD1   1 
ATOM   9016  N  N     . VAL C  3  367 ? -27.669 61.326  -25.430 1.00 37.77  ? 367 VAL C N     1 
ATOM   9017  C  CA    . VAL C  3  367 ? -27.200 62.451  -24.621 1.00 35.93  ? 367 VAL C CA    1 
ATOM   9018  C  C     . VAL C  3  367 ? -26.849 63.694  -25.446 1.00 36.85  ? 367 VAL C C     1 
ATOM   9019  O  O     . VAL C  3  367 ? -27.319 64.788  -25.130 1.00 36.97  ? 367 VAL C O     1 
ATOM   9020  C  CB    . VAL C  3  367 ? -26.036 62.052  -23.647 1.00 33.85  ? 367 VAL C CB    1 
ATOM   9021  C  CG1   . VAL C  3  367 ? -25.374 63.289  -23.063 1.00 32.94  ? 367 VAL C CG1   1 
ATOM   9022  C  CG2   . VAL C  3  367 ? -26.582 61.215  -22.500 1.00 31.18  ? 367 VAL C CG2   1 
ATOM   9023  N  N     . PRO C  3  368 ? -26.011 63.555  -26.492 1.00 35.77  ? 368 PRO C N     1 
ATOM   9024  C  CA    . PRO C  3  368 ? -25.694 64.761  -27.271 1.00 36.65  ? 368 PRO C CA    1 
ATOM   9025  C  C     . PRO C  3  368 ? -26.910 65.392  -27.956 1.00 39.39  ? 368 PRO C C     1 
ATOM   9026  O  O     . PRO C  3  368 ? -27.067 66.624  -27.946 1.00 39.41  ? 368 PRO C O     1 
ATOM   9027  C  CB    . PRO C  3  368 ? -24.643 64.275  -28.282 1.00 34.99  ? 368 PRO C CB    1 
ATOM   9028  C  CG    . PRO C  3  368 ? -24.796 62.764  -28.293 1.00 36.22  ? 368 PRO C CG    1 
ATOM   9029  C  CD    . PRO C  3  368 ? -25.140 62.430  -26.877 1.00 35.67  ? 368 PRO C CD    1 
ATOM   9030  N  N     . VAL C  3  369 ? -27.801 64.554  -28.492 1.00 39.50  ? 369 VAL C N     1 
ATOM   9031  C  CA    . VAL C  3  369 ? -28.990 65.061  -29.169 1.00 38.72  ? 369 VAL C CA    1 
ATOM   9032  C  C     . VAL C  3  369 ? -29.930 65.760  -28.181 1.00 39.24  ? 369 VAL C C     1 
ATOM   9033  O  O     . VAL C  3  369 ? -30.283 66.933  -28.364 1.00 40.19  ? 369 VAL C O     1 
ATOM   9034  C  CB    . VAL C  3  369 ? -29.732 63.925  -29.945 1.00 38.92  ? 369 VAL C CB    1 
ATOM   9035  C  CG1   . VAL C  3  369 ? -31.082 64.403  -30.433 1.00 36.19  ? 369 VAL C CG1   1 
ATOM   9036  C  CG2   . VAL C  3  369 ? -28.899 63.475  -31.141 1.00 35.94  ? 369 VAL C CG2   1 
ATOM   9037  N  N     . ILE C  3  370 ? -30.309 65.044  -27.128 1.00 38.54  ? 370 ILE C N     1 
ATOM   9038  C  CA    . ILE C  3  370 ? -31.209 65.570  -26.109 1.00 38.96  ? 370 ILE C CA    1 
ATOM   9039  C  C     . ILE C  3  370 ? -30.702 66.851  -25.437 1.00 40.60  ? 370 ILE C C     1 
ATOM   9040  O  O     . ILE C  3  370 ? -31.461 67.811  -25.270 1.00 39.39  ? 370 ILE C O     1 
ATOM   9041  C  CB    . ILE C  3  370 ? -31.474 64.511  -25.017 1.00 40.78  ? 370 ILE C CB    1 
ATOM   9042  C  CG1   . ILE C  3  370 ? -32.169 63.290  -25.626 1.00 43.89  ? 370 ILE C CG1   1 
ATOM   9043  C  CG2   . ILE C  3  370 ? -32.321 65.098  -23.891 1.00 40.53  ? 370 ILE C CG2   1 
ATOM   9044  C  CD1   . ILE C  3  370 ? -33.506 63.601  -26.300 1.00 45.09  ? 370 ILE C CD1   1 
ATOM   9045  N  N     . SER C  3  371 ? -29.426 66.863  -25.045 1.00 40.92  ? 371 SER C N     1 
ATOM   9046  C  CA    . SER C  3  371 ? -28.851 68.025  -24.378 1.00 40.72  ? 371 SER C CA    1 
ATOM   9047  C  C     . SER C  3  371 ? -28.870 69.266  -25.267 1.00 41.17  ? 371 SER C C     1 
ATOM   9048  O  O     . SER C  3  371 ? -29.088 70.382  -24.779 1.00 41.16  ? 371 SER C O     1 
ATOM   9049  C  CB    . SER C  3  371 ? -27.450 67.722  -23.839 1.00 39.21  ? 371 SER C CB    1 
ATOM   9050  O  OG    . SER C  3  371 ? -26.608 67.164  -24.823 1.00 40.23  ? 371 SER C OG    1 
ATOM   9051  N  N     . THR C  3  372 ? -28.672 69.066  -26.569 1.00 41.03  ? 372 THR C N     1 
ATOM   9052  C  CA    . THR C  3  372 ? -28.717 70.169  -27.531 1.00 40.78  ? 372 THR C CA    1 
ATOM   9053  C  C     . THR C  3  372 ? -30.158 70.700  -27.596 1.00 39.97  ? 372 THR C C     1 
ATOM   9054  O  O     . THR C  3  372 ? -30.395 71.899  -27.478 1.00 38.24  ? 372 THR C O     1 
ATOM   9055  C  CB    . THR C  3  372 ? -28.329 69.700  -28.943 1.00 42.28  ? 372 THR C CB    1 
ATOM   9056  O  OG1   . THR C  3  372 ? -27.067 69.017  -28.896 1.00 43.39  ? 372 THR C OG1   1 
ATOM   9057  C  CG2   . THR C  3  372 ? -28.236 70.898  -29.883 1.00 41.11  ? 372 THR C CG2   1 
ATOM   9058  N  N     . ILE C  3  373 ? -31.119 69.794  -27.765 1.00 39.57  ? 373 ILE C N     1 
ATOM   9059  C  CA    . ILE C  3  373 ? -32.520 70.184  -27.835 1.00 39.06  ? 373 ILE C CA    1 
ATOM   9060  C  C     . ILE C  3  373 ? -32.926 70.938  -26.576 1.00 39.78  ? 373 ILE C C     1 
ATOM   9061  O  O     . ILE C  3  373 ? -33.529 72.000  -26.660 1.00 41.30  ? 373 ILE C O     1 
ATOM   9062  C  CB    . ILE C  3  373 ? -33.432 68.967  -28.056 1.00 38.55  ? 373 ILE C CB    1 
ATOM   9063  C  CG1   . ILE C  3  373 ? -33.180 68.377  -29.451 1.00 40.34  ? 373 ILE C CG1   1 
ATOM   9064  C  CG2   . ILE C  3  373 ? -34.891 69.347  -27.890 1.00 35.09  ? 373 ILE C CG2   1 
ATOM   9065  C  CD1   . ILE C  3  373 ? -33.931 67.068  -29.738 1.00 38.50  ? 373 ILE C CD1   1 
ATOM   9066  N  N     . GLU C  3  374 ? -32.512 70.441  -25.414 1.00 41.14  ? 374 GLU C N     1 
ATOM   9067  C  CA    . GLU C  3  374 ? -32.858 71.100  -24.159 1.00 39.65  ? 374 GLU C CA    1 
ATOM   9068  C  C     . GLU C  3  374 ? -32.251 72.502  -24.047 1.00 38.50  ? 374 GLU C C     1 
ATOM   9069  O  O     . GLU C  3  374 ? -32.882 73.414  -23.500 1.00 37.52  ? 374 GLU C O     1 
ATOM   9070  C  CB    . GLU C  3  374 ? -32.492 70.221  -22.960 1.00 39.08  ? 374 GLU C CB    1 
ATOM   9071  C  CG    . GLU C  3  374 ? -33.447 69.045  -22.756 1.00 38.98  ? 374 GLU C CG    1 
ATOM   9072  C  CD    . GLU C  3  374 ? -33.096 68.151  -21.557 1.00 39.23  ? 374 GLU C CD    1 
ATOM   9073  O  OE1   . GLU C  3  374 ? -34.030 67.624  -20.921 1.00 35.13  ? 374 GLU C OE1   1 
ATOM   9074  O  OE2   . GLU C  3  374 ? -31.898 67.952  -21.257 1.00 38.95  ? 374 GLU C OE2   1 
ATOM   9075  N  N     . ASN C  3  375 ? -31.056 72.683  -24.610 1.00 36.73  ? 375 ASN C N     1 
ATOM   9076  C  CA    . ASN C  3  375 ? -30.387 73.986  -24.587 1.00 37.93  ? 375 ASN C CA    1 
ATOM   9077  C  C     . ASN C  3  375 ? -31.250 75.006  -25.295 1.00 39.00  ? 375 ASN C C     1 
ATOM   9078  O  O     . ASN C  3  375 ? -31.504 76.082  -24.771 1.00 40.66  ? 375 ASN C O     1 
ATOM   9079  C  CB    . ASN C  3  375 ? -29.026 73.940  -25.300 1.00 36.62  ? 375 ASN C CB    1 
ATOM   9080  C  CG    . ASN C  3  375 ? -27.899 73.452  -24.404 1.00 34.78  ? 375 ASN C CG    1 
ATOM   9081  O  OD1   . ASN C  3  375 ? -27.990 73.514  -23.171 1.00 34.09  ? 375 ASN C OD1   1 
ATOM   9082  N  ND2   . ASN C  3  375 ? -26.814 72.994  -25.022 1.00 29.47  ? 375 ASN C ND2   1 
ATOM   9083  N  N     . VAL C  3  376 ? -31.720 74.634  -26.484 1.00 41.92  ? 376 VAL C N     1 
ATOM   9084  C  CA    . VAL C  3  376 ? -32.555 75.502  -27.307 1.00 41.65  ? 376 VAL C CA    1 
ATOM   9085  C  C     . VAL C  3  376 ? -33.894 75.793  -26.639 1.00 41.76  ? 376 VAL C C     1 
ATOM   9086  O  O     . VAL C  3  376 ? -34.318 76.948  -26.582 1.00 42.30  ? 376 VAL C O     1 
ATOM   9087  C  CB    . VAL C  3  376 ? -32.758 74.911  -28.716 1.00 41.51  ? 376 VAL C CB    1 
ATOM   9088  C  CG1   . VAL C  3  376 ? -33.583 75.854  -29.566 1.00 41.91  ? 376 VAL C CG1   1 
ATOM   9089  C  CG2   . VAL C  3  376 ? -31.405 74.670  -29.375 1.00 41.16  ? 376 VAL C CG2   1 
ATOM   9090  N  N     . LEU C  3  377 ? -34.542 74.759  -26.113 1.00 40.67  ? 377 LEU C N     1 
ATOM   9091  C  CA    . LEU C  3  377 ? -35.823 74.933  -25.428 1.00 42.52  ? 377 LEU C CA    1 
ATOM   9092  C  C     . LEU C  3  377 ? -35.682 75.987  -24.320 1.00 44.13  ? 377 LEU C C     1 
ATOM   9093  O  O     . LEU C  3  377 ? -36.491 76.907  -24.228 1.00 44.12  ? 377 LEU C O     1 
ATOM   9094  C  CB    . LEU C  3  377 ? -36.294 73.600  -24.835 1.00 43.87  ? 377 LEU C CB    1 
ATOM   9095  C  CG    . LEU C  3  377 ? -37.445 72.811  -25.478 1.00 46.88  ? 377 LEU C CG    1 
ATOM   9096  C  CD1   . LEU C  3  377 ? -37.641 73.190  -26.943 1.00 48.57  ? 377 LEU C CD1   1 
ATOM   9097  C  CD2   . LEU C  3  377 ? -37.193 71.305  -25.336 1.00 43.98  ? 377 LEU C CD2   1 
ATOM   9098  N  N     . PHE C  3  378 ? -34.613 75.879  -23.525 1.00 46.31  ? 378 PHE C N     1 
ATOM   9099  C  CA    . PHE C  3  378 ? -34.351 76.814  -22.432 1.00 45.71  ? 378 PHE C CA    1 
ATOM   9100  C  C     . PHE C  3  378 ? -34.261 78.256  -22.919 1.00 47.05  ? 378 PHE C C     1 
ATOM   9101  O  O     . PHE C  3  378 ? -34.713 79.176  -22.235 1.00 46.99  ? 378 PHE C O     1 
ATOM   9102  C  CB    . PHE C  3  378 ? -33.061 76.436  -21.689 1.00 44.49  ? 378 PHE C CB    1 
ATOM   9103  C  CG    . PHE C  3  378 ? -33.263 75.449  -20.575 1.00 41.36  ? 378 PHE C CG    1 
ATOM   9104  C  CD1   . PHE C  3  378 ? -34.315 75.598  -19.678 1.00 40.75  ? 378 PHE C CD1   1 
ATOM   9105  C  CD2   . PHE C  3  378 ? -32.427 74.349  -20.444 1.00 40.26  ? 378 PHE C CD2   1 
ATOM   9106  C  CE1   . PHE C  3  378 ? -34.531 74.657  -18.671 1.00 38.11  ? 378 PHE C CE1   1 
ATOM   9107  C  CE2   . PHE C  3  378 ? -32.637 73.411  -19.445 1.00 37.62  ? 378 PHE C CE2   1 
ATOM   9108  C  CZ    . PHE C  3  378 ? -33.690 73.563  -18.559 1.00 36.64  ? 378 PHE C CZ    1 
ATOM   9109  N  N     . TYR C  3  379 ? -33.695 78.437  -24.107 1.00 48.59  ? 379 TYR C N     1 
ATOM   9110  C  CA    . TYR C  3  379 ? -33.534 79.757  -24.707 1.00 51.91  ? 379 TYR C CA    1 
ATOM   9111  C  C     . TYR C  3  379 ? -34.836 80.383  -25.235 1.00 53.29  ? 379 TYR C C     1 
ATOM   9112  O  O     . TYR C  3  379 ? -35.254 81.450  -24.765 1.00 53.10  ? 379 TYR C O     1 
ATOM   9113  C  CB    . TYR C  3  379 ? -32.499 79.685  -25.832 1.00 53.03  ? 379 TYR C CB    1 
ATOM   9114  C  CG    . TYR C  3  379 ? -32.251 80.995  -26.549 1.00 56.41  ? 379 TYR C CG    1 
ATOM   9115  C  CD1   . TYR C  3  379 ? -31.323 81.920  -26.059 1.00 56.78  ? 379 TYR C CD1   1 
ATOM   9116  C  CD2   . TYR C  3  379 ? -32.918 81.298  -27.740 1.00 56.93  ? 379 TYR C CD2   1 
ATOM   9117  C  CE1   . TYR C  3  379 ? -31.061 83.113  -26.741 1.00 59.71  ? 379 TYR C CE1   1 
ATOM   9118  C  CE2   . TYR C  3  379 ? -32.665 82.486  -28.432 1.00 59.16  ? 379 TYR C CE2   1 
ATOM   9119  C  CZ    . TYR C  3  379 ? -31.736 83.389  -27.932 1.00 59.96  ? 379 TYR C CZ    1 
ATOM   9120  O  OH    . TYR C  3  379 ? -31.473 84.548  -28.626 1.00 57.42  ? 379 TYR C OH    1 
ATOM   9121  N  N     . ILE C  3  380 ? -35.485 79.701  -26.182 1.00 54.14  ? 380 ILE C N     1 
ATOM   9122  C  CA    . ILE C  3  380 ? -36.716 80.202  -26.796 1.00 53.89  ? 380 ILE C CA    1 
ATOM   9123  C  C     . ILE C  3  380 ? -37.901 80.331  -25.851 1.00 55.99  ? 380 ILE C C     1 
ATOM   9124  O  O     . ILE C  3  380 ? -38.919 80.896  -26.224 1.00 56.80  ? 380 ILE C O     1 
ATOM   9125  C  CB    . ILE C  3  380 ? -37.145 79.365  -28.030 1.00 50.72  ? 380 ILE C CB    1 
ATOM   9126  C  CG1   . ILE C  3  380 ? -37.732 78.027  -27.594 1.00 48.18  ? 380 ILE C CG1   1 
ATOM   9127  C  CG2   . ILE C  3  380 ? -35.962 79.143  -28.965 1.00 50.04  ? 380 ILE C CG2   1 
ATOM   9128  C  CD1   . ILE C  3  380 ? -38.080 77.126  -28.738 1.00 44.00  ? 380 ILE C CD1   1 
ATOM   9129  N  N     . GLY C  3  381 ? -37.769 79.826  -24.631 1.00 57.88  ? 381 GLY C N     1 
ATOM   9130  C  CA    . GLY C  3  381 ? -38.866 79.924  -23.686 1.00 60.55  ? 381 GLY C CA    1 
ATOM   9131  C  C     . GLY C  3  381 ? -38.846 81.216  -22.890 1.00 63.64  ? 381 GLY C C     1 
ATOM   9132  O  O     . GLY C  3  381 ? -39.752 81.470  -22.088 1.00 61.63  ? 381 GLY C O     1 
ATOM   9133  N  N     . ARG C  3  382 ? -37.833 82.049  -23.127 1.00 67.05  ? 382 ARG C N     1 
ATOM   9134  C  CA    . ARG C  3  382 ? -37.699 83.306  -22.389 1.00 72.69  ? 382 ARG C CA    1 
ATOM   9135  C  C     . ARG C  3  382 ? -37.313 84.535  -23.222 1.00 77.99  ? 382 ARG C C     1 
ATOM   9136  O  O     . ARG C  3  382 ? -37.635 85.666  -22.842 1.00 78.63  ? 382 ARG C O     1 
ATOM   9137  C  CB    . ARG C  3  382 ? -36.713 83.134  -21.215 1.00 68.71  ? 382 ARG C CB    1 
ATOM   9138  C  CG    . ARG C  3  382 ? -36.174 81.712  -21.043 1.00 64.21  ? 382 ARG C CG    1 
ATOM   9139  C  CD    . ARG C  3  382 ? -35.486 81.480  -19.703 1.00 59.11  ? 382 ARG C CD    1 
ATOM   9140  N  NE    . ARG C  3  382 ? -34.254 82.250  -19.537 1.00 53.15  ? 382 ARG C NE    1 
ATOM   9141  C  CZ    . ARG C  3  382 ? -33.150 82.101  -20.267 1.00 49.03  ? 382 ARG C CZ    1 
ATOM   9142  N  NH1   . ARG C  3  382 ? -32.100 82.859  -20.016 1.00 46.82  ? 382 ARG C NH1   1 
ATOM   9143  N  NH2   . ARG C  3  382 ? -33.085 81.204  -21.242 1.00 44.93  ? 382 ARG C NH2   1 
ATOM   9144  N  N     . VAL C  3  383 ? -36.614 84.322  -24.335 1.00 84.15  ? 383 VAL C N     1 
ATOM   9145  C  CA    . VAL C  3  383 ? -36.195 85.429  -25.201 1.00 90.95  ? 383 VAL C CA    1 
ATOM   9146  C  C     . VAL C  3  383 ? -37.372 85.915  -26.043 1.00 96.20  ? 383 VAL C C     1 
ATOM   9147  O  O     . VAL C  3  383 ? -38.005 85.126  -26.751 1.00 97.03  ? 383 VAL C O     1 
ATOM   9148  C  CB    . VAL C  3  383 ? -35.042 85.011  -26.138 1.00 90.82  ? 383 VAL C CB    1 
ATOM   9149  C  CG1   . VAL C  3  383 ? -34.484 86.227  -26.869 1.00 91.80  ? 383 VAL C CG1   1 
ATOM   9150  C  CG2   . VAL C  3  383 ? -33.950 84.317  -25.346 1.00 91.58  ? 383 VAL C CG2   1 
ATOM   9151  N  N     . ASN C  3  384 ? -37.652 87.216  -25.977 1.00 102.17 ? 384 ASN C N     1 
ATOM   9152  C  CA    . ASN C  3  384 ? -38.774 87.796  -26.715 1.00 108.35 ? 384 ASN C CA    1 
ATOM   9153  C  C     . ASN C  3  384 ? -38.422 88.556  -27.995 1.00 111.64 ? 384 ASN C C     1 
ATOM   9154  O  O     . ASN C  3  384 ? -38.810 89.718  -28.159 1.00 112.56 ? 384 ASN C O     1 
ATOM   9155  C  CB    . ASN C  3  384 ? -39.619 88.682  -25.789 1.00 109.38 ? 384 ASN C CB    1 
ATOM   9156  C  CG    . ASN C  3  384 ? -40.425 87.875  -24.783 1.00 111.01 ? 384 ASN C CG    1 
ATOM   9157  O  OD1   . ASN C  3  384 ? -41.341 87.138  -25.155 1.00 111.89 ? 384 ASN C OD1   1 
ATOM   9158  N  ND2   . ASN C  3  384 ? -40.084 88.006  -23.504 1.00 111.13 ? 384 ASN C ND2   1 
ATOM   9159  N  N     . LYS C  3  385 ? -37.716 87.883  -28.905 1.00 114.84 ? 385 LYS C N     1 
ATOM   9160  C  CA    . LYS C  3  385 ? -37.316 88.463  -30.194 1.00 117.80 ? 385 LYS C CA    1 
ATOM   9161  C  C     . LYS C  3  385 ? -36.441 87.498  -31.000 1.00 118.84 ? 385 LYS C C     1 
ATOM   9162  O  O     . LYS C  3  385 ? -35.291 87.229  -30.578 1.00 119.09 ? 385 LYS C O     1 
ATOM   9163  C  CB    . LYS C  3  385 ? -36.582 89.800  -30.003 1.00 119.48 ? 385 LYS C CB    1 
ATOM   9164  C  CG    . LYS C  3  385 ? -36.307 90.561  -31.303 1.00 120.32 ? 385 LYS C CG    1 
ATOM   9165  C  CD    . LYS C  3  385 ? -35.822 91.977  -31.025 1.00 121.27 ? 385 LYS C CD    1 
ATOM   9166  C  CE    . LYS C  3  385 ? -36.895 92.799  -30.317 1.00 121.77 ? 385 LYS C CE    1 
ATOM   9167  N  NZ    . LYS C  3  385 ? -36.418 94.167  -29.966 1.00 122.29 ? 385 LYS C NZ    1 
ATOM   9168  O  OXT   . LYS C  3  385 ? -36.921 87.026  -32.055 1.00 119.67 ? 385 LYS C OXT   1 
ATOM   9169  N  N     . MET D  4  1   ? -36.027 26.551  -22.621 1.00 83.01  ? 62  MET D N     1 
ATOM   9170  C  CA    . MET D  4  1   ? -35.534 25.161  -22.413 1.00 82.99  ? 62  MET D CA    1 
ATOM   9171  C  C     . MET D  4  1   ? -36.691 24.288  -21.924 1.00 82.53  ? 62  MET D C     1 
ATOM   9172  O  O     . MET D  4  1   ? -37.491 24.726  -21.092 1.00 82.55  ? 62  MET D O     1 
ATOM   9173  C  CB    . MET D  4  1   ? -34.395 25.186  -21.396 1.00 85.03  ? 62  MET D CB    1 
ATOM   9174  C  CG    . MET D  4  1   ? -33.676 23.870  -21.201 1.00 87.12  ? 62  MET D CG    1 
ATOM   9175  S  SD    . MET D  4  1   ? -32.127 24.055  -20.277 1.00 89.57  ? 62  MET D SD    1 
ATOM   9176  C  CE    . MET D  4  1   ? -30.932 24.004  -21.656 1.00 87.72  ? 62  MET D CE    1 
ATOM   9177  N  N     . THR D  4  2   ? -36.789 23.065  -22.452 1.00 80.63  ? 63  THR D N     1 
ATOM   9178  C  CA    . THR D  4  2   ? -37.868 22.144  -22.079 1.00 79.21  ? 63  THR D CA    1 
ATOM   9179  C  C     . THR D  4  2   ? -37.851 21.799  -20.598 1.00 78.60  ? 63  THR D C     1 
ATOM   9180  O  O     . THR D  4  2   ? -36.788 21.703  -19.986 1.00 79.12  ? 63  THR D O     1 
ATOM   9181  C  CB    . THR D  4  2   ? -37.826 20.823  -22.887 1.00 78.72  ? 63  THR D CB    1 
ATOM   9182  O  OG1   . THR D  4  2   ? -36.727 20.016  -22.449 1.00 79.33  ? 63  THR D OG1   1 
ATOM   9183  C  CG2   . THR D  4  2   ? -37.672 21.106  -24.369 1.00 79.10  ? 63  THR D CG2   1 
ATOM   9184  N  N     . ALA D  4  3   ? -39.038 21.593  -20.035 1.00 77.89  ? 64  ALA D N     1 
ATOM   9185  C  CA    . ALA D  4  3   ? -39.187 21.256  -18.620 1.00 77.06  ? 64  ALA D CA    1 
ATOM   9186  C  C     . ALA D  4  3   ? -38.406 19.998  -18.224 1.00 75.72  ? 64  ALA D C     1 
ATOM   9187  O  O     . ALA D  4  3   ? -37.833 19.936  -17.137 1.00 74.53  ? 64  ALA D O     1 
ATOM   9188  C  CB    . ALA D  4  3   ? -40.668 21.090  -18.276 1.00 77.39  ? 64  ALA D CB    1 
ATOM   9189  N  N     . ALA D  4  4   ? -38.386 19.005  -19.111 1.00 74.25  ? 65  ALA D N     1 
ATOM   9190  C  CA    . ALA D  4  4   ? -37.672 17.759  -18.857 1.00 73.80  ? 65  ALA D CA    1 
ATOM   9191  C  C     . ALA D  4  4   ? -36.185 18.011  -18.620 1.00 73.49  ? 65  ALA D C     1 
ATOM   9192  O  O     . ALA D  4  4   ? -35.548 17.318  -17.823 1.00 73.25  ? 65  ALA D O     1 
ATOM   9193  C  CB    . ALA D  4  4   ? -37.861 16.791  -20.023 1.00 73.08  ? 65  ALA D CB    1 
ATOM   9194  N  N     . GLU D  4  5   ? -35.645 19.013  -19.308 1.00 73.22  ? 66  GLU D N     1 
ATOM   9195  C  CA    . GLU D  4  5   ? -34.238 19.365  -19.181 1.00 72.86  ? 66  GLU D CA    1 
ATOM   9196  C  C     . GLU D  4  5   ? -33.941 20.123  -17.886 1.00 71.66  ? 66  GLU D C     1 
ATOM   9197  O  O     . GLU D  4  5   ? -33.003 19.778  -17.176 1.00 71.21  ? 66  GLU D O     1 
ATOM   9198  C  CB    . GLU D  4  5   ? -33.771 20.146  -20.412 1.00 73.92  ? 66  GLU D CB    1 
ATOM   9199  C  CG    . GLU D  4  5   ? -33.744 19.302  -21.690 1.00 77.29  ? 66  GLU D CG    1 
ATOM   9200  C  CD    . GLU D  4  5   ? -33.405 20.091  -22.960 1.00 79.03  ? 66  GLU D CD    1 
ATOM   9201  O  OE1   . GLU D  4  5   ? -33.480 19.502  -24.057 1.00 79.37  ? 66  GLU D OE1   1 
ATOM   9202  O  OE2   . GLU D  4  5   ? -33.062 21.288  -22.879 1.00 81.41  ? 66  GLU D OE2   1 
ATOM   9203  N  N     . HIS D  4  6   ? -34.758 21.125  -17.559 1.00 71.28  ? 67  HIS D N     1 
ATOM   9204  C  CA    . HIS D  4  6   ? -34.569 21.900  -16.329 1.00 71.40  ? 67  HIS D CA    1 
ATOM   9205  C  C     . HIS D  4  6   ? -34.800 21.022  -15.114 1.00 68.91  ? 67  HIS D C     1 
ATOM   9206  O  O     . HIS D  4  6   ? -34.057 21.095  -14.142 1.00 69.02  ? 67  HIS D O     1 
ATOM   9207  C  CB    . HIS D  4  6   ? -35.543 23.086  -16.250 1.00 75.80  ? 67  HIS D CB    1 
ATOM   9208  C  CG    . HIS D  4  6   ? -35.154 24.265  -17.093 1.00 81.73  ? 67  HIS D CG    1 
ATOM   9209  N  ND1   . HIS D  4  6   ? -33.845 24.669  -17.258 1.00 83.81  ? 67  HIS D ND1   1 
ATOM   9210  C  CD2   . HIS D  4  6   ? -35.910 25.144  -17.795 1.00 83.48  ? 67  HIS D CD2   1 
ATOM   9211  C  CE1   . HIS D  4  6   ? -33.812 25.747  -18.023 1.00 85.22  ? 67  HIS D CE1   1 
ATOM   9212  N  NE2   . HIS D  4  6   ? -35.051 26.056  -18.363 1.00 85.58  ? 67  HIS D NE2   1 
ATOM   9213  N  N     . GLY D  4  7   ? -35.829 20.185  -15.189 1.00 67.21  ? 68  GLY D N     1 
ATOM   9214  C  CA    . GLY D  4  7   ? -36.176 19.309  -14.084 1.00 64.71  ? 68  GLY D CA    1 
ATOM   9215  C  C     . GLY D  4  7   ? -37.375 19.882  -13.355 1.00 63.56  ? 68  GLY D C     1 
ATOM   9216  O  O     . GLY D  4  7   ? -37.580 21.096  -13.366 1.00 63.94  ? 68  GLY D O     1 
ATOM   9217  N  N     . LEU D  4  8   ? -38.177 19.022  -12.735 1.00 62.11  ? 69  LEU D N     1 
ATOM   9218  C  CA    . LEU D  4  8   ? -39.366 19.472  -12.011 1.00 60.88  ? 69  LEU D CA    1 
ATOM   9219  C  C     . LEU D  4  8   ? -38.964 20.301  -10.788 1.00 60.07  ? 69  LEU D C     1 
ATOM   9220  O  O     . LEU D  4  8   ? -38.106 19.897  -10.004 1.00 59.94  ? 69  LEU D O     1 
ATOM   9221  C  CB    . LEU D  4  8   ? -40.204 18.265  -11.577 1.00 61.53  ? 69  LEU D CB    1 
ATOM   9222  C  CG    . LEU D  4  8   ? -41.734 18.343  -11.509 1.00 60.94  ? 69  LEU D CG    1 
ATOM   9223  C  CD1   . LEU D  4  8   ? -42.188 17.754  -10.199 1.00 61.21  ? 69  LEU D CD1   1 
ATOM   9224  C  CD2   . LEU D  4  8   ? -42.240 19.762  -11.643 1.00 59.83  ? 69  LEU D CD2   1 
ATOM   9225  N  N     . HIS D  4  9   ? -39.579 21.468  -10.643 1.00 59.76  ? 70  HIS D N     1 
ATOM   9226  C  CA    . HIS D  4  9   ? -39.292 22.361  -9.530  1.00 59.87  ? 70  HIS D CA    1 
ATOM   9227  C  C     . HIS D  4  9   ? -39.708 21.745  -8.203  1.00 56.85  ? 70  HIS D C     1 
ATOM   9228  O  O     . HIS D  4  9   ? -40.861 21.358  -8.025  1.00 57.24  ? 70  HIS D O     1 
ATOM   9229  C  CB    . HIS D  4  9   ? -40.015 23.702  -9.730  1.00 66.73  ? 70  HIS D CB    1 
ATOM   9230  C  CG    . HIS D  4  9   ? -39.842 24.667  -8.591  1.00 74.75  ? 70  HIS D CG    1 
ATOM   9231  N  ND1   . HIS D  4  9   ? -40.854 24.959  -7.698  1.00 76.92  ? 70  HIS D ND1   1 
ATOM   9232  C  CD2   . HIS D  4  9   ? -38.771 25.401  -8.196  1.00 77.33  ? 70  HIS D CD2   1 
ATOM   9233  C  CE1   . HIS D  4  9   ? -40.415 25.828  -6.802  1.00 77.30  ? 70  HIS D CE1   1 
ATOM   9234  N  NE2   . HIS D  4  9   ? -39.154 26.113  -7.082  1.00 78.00  ? 70  HIS D NE2   1 
ATOM   9235  N  N     . ALA D  4  10  ? -38.767 21.673  -7.269  1.00 53.21  ? 71  ALA D N     1 
ATOM   9236  C  CA    . ALA D  4  10  ? -39.041 21.120  -5.951  1.00 51.26  ? 71  ALA D CA    1 
ATOM   9237  C  C     . ALA D  4  10  ? -39.897 22.110  -5.160  1.00 49.34  ? 71  ALA D C     1 
ATOM   9238  O  O     . ALA D  4  10  ? -39.630 23.306  -5.165  1.00 48.32  ? 71  ALA D O     1 
ATOM   9239  C  CB    . ALA D  4  10  ? -37.739 20.832  -5.221  1.00 49.99  ? 71  ALA D CB    1 
ATOM   9240  N  N     . PRO D  4  11  ? -40.975 21.625  -4.519  1.00 48.33  ? 72  PRO D N     1 
ATOM   9241  C  CA    . PRO D  4  11  ? -41.878 22.461  -3.728  1.00 47.19  ? 72  PRO D CA    1 
ATOM   9242  C  C     . PRO D  4  11  ? -41.275 22.760  -2.371  1.00 47.87  ? 72  PRO D C     1 
ATOM   9243  O  O     . PRO D  4  11  ? -40.279 22.148  -1.986  1.00 47.24  ? 72  PRO D O     1 
ATOM   9244  C  CB    . PRO D  4  11  ? -43.117 21.586  -3.609  1.00 46.67  ? 72  PRO D CB    1 
ATOM   9245  C  CG    . PRO D  4  11  ? -42.532 20.235  -3.496  1.00 46.71  ? 72  PRO D CG    1 
ATOM   9246  C  CD    . PRO D  4  11  ? -41.463 20.237  -4.565  1.00 46.81  ? 72  PRO D CD    1 
ATOM   9247  N  N     . ALA D  4  12  ? -41.923 23.649  -1.623  1.00 49.00  ? 73  ALA D N     1 
ATOM   9248  C  CA    . ALA D  4  12  ? -41.426 24.058  -0.311  1.00 50.01  ? 73  ALA D CA    1 
ATOM   9249  C  C     . ALA D  4  12  ? -42.001 23.357  0.921   1.00 50.62  ? 73  ALA D C     1 
ATOM   9250  O  O     . ALA D  4  12  ? -43.062 23.745  1.420   1.00 52.62  ? 73  ALA D O     1 
ATOM   9251  C  CB    . ALA D  4  12  ? -41.569 25.577  -0.156  1.00 45.97  ? 73  ALA D CB    1 
ATOM   9252  N  N     . TYR D  4  13  ? -41.276 22.362  1.432   1.00 50.44  ? 74  TYR D N     1 
ATOM   9253  C  CA    . TYR D  4  13  ? -41.686 21.647  2.647   1.00 50.33  ? 74  TYR D CA    1 
ATOM   9254  C  C     . TYR D  4  13  ? -41.373 22.502  3.885   1.00 50.16  ? 74  TYR D C     1 
ATOM   9255  O  O     . TYR D  4  13  ? -40.430 23.298  3.878   1.00 51.79  ? 74  TYR D O     1 
ATOM   9256  C  CB    . TYR D  4  13  ? -40.987 20.295  2.734   1.00 49.57  ? 74  TYR D CB    1 
ATOM   9257  C  CG    . TYR D  4  13  ? -41.462 19.333  1.676   1.00 51.97  ? 74  TYR D CG    1 
ATOM   9258  C  CD1   . TYR D  4  13  ? -42.769 18.847  1.692   1.00 53.34  ? 74  TYR D CD1   1 
ATOM   9259  C  CD2   . TYR D  4  13  ? -40.624 18.935  0.639   1.00 52.52  ? 74  TYR D CD2   1 
ATOM   9260  C  CE1   . TYR D  4  13  ? -43.232 17.990  0.696   1.00 56.21  ? 74  TYR D CE1   1 
ATOM   9261  C  CE2   . TYR D  4  13  ? -41.074 18.076  -0.364  1.00 53.91  ? 74  TYR D CE2   1 
ATOM   9262  C  CZ    . TYR D  4  13  ? -42.381 17.609  -0.331  1.00 56.98  ? 74  TYR D CZ    1 
ATOM   9263  O  OH    . TYR D  4  13  ? -42.844 16.775  -1.334  1.00 60.11  ? 74  TYR D OH    1 
ATOM   9264  N  N     . ALA D  4  14  ? -42.177 22.356  4.935   1.00 48.81  ? 75  ALA D N     1 
ATOM   9265  C  CA    . ALA D  4  14  ? -41.998 23.146  6.152   1.00 47.48  ? 75  ALA D CA    1 
ATOM   9266  C  C     . ALA D  4  14  ? -40.955 22.580  7.106   1.00 48.92  ? 75  ALA D C     1 
ATOM   9267  O  O     . ALA D  4  14  ? -41.302 21.969  8.120   1.00 50.83  ? 75  ALA D O     1 
ATOM   9268  C  CB    . ALA D  4  14  ? -43.330 23.313  6.866   1.00 45.60  ? 75  ALA D CB    1 
ATOM   9269  N  N     . TRP D  4  15  ? -39.678 22.796  6.789   1.00 47.47  ? 76  TRP D N     1 
ATOM   9270  C  CA    . TRP D  4  15  ? -38.591 22.306  7.624   1.00 45.90  ? 76  TRP D CA    1 
ATOM   9271  C  C     . TRP D  4  15  ? -38.571 23.067  8.933   1.00 48.33  ? 76  TRP D C     1 
ATOM   9272  O  O     . TRP D  4  15  ? -38.747 24.287  8.946   1.00 47.95  ? 76  TRP D O     1 
ATOM   9273  C  CB    . TRP D  4  15  ? -37.259 22.476  6.924   1.00 41.50  ? 76  TRP D CB    1 
ATOM   9274  C  CG    . TRP D  4  15  ? -37.191 21.776  5.636   1.00 38.66  ? 76  TRP D CG    1 
ATOM   9275  C  CD1   . TRP D  4  15  ? -37.524 22.279  4.419   1.00 38.35  ? 76  TRP D CD1   1 
ATOM   9276  C  CD2   . TRP D  4  15  ? -36.765 20.430  5.416   1.00 38.82  ? 76  TRP D CD2   1 
ATOM   9277  N  NE1   . TRP D  4  15  ? -37.334 21.327  3.444   1.00 39.39  ? 76  TRP D NE1   1 
ATOM   9278  C  CE2   . TRP D  4  15  ? -36.873 20.179  4.029   1.00 38.94  ? 76  TRP D CE2   1 
ATOM   9279  C  CE3   . TRP D  4  15  ? -36.304 19.407  6.256   1.00 38.59  ? 76  TRP D CE3   1 
ATOM   9280  C  CZ2   . TRP D  4  15  ? -36.538 18.941  3.456   1.00 38.50  ? 76  TRP D CZ2   1 
ATOM   9281  C  CZ3   . TRP D  4  15  ? -35.968 18.169  5.686   1.00 39.41  ? 76  TRP D CZ3   1 
ATOM   9282  C  CH2   . TRP D  4  15  ? -36.091 17.952  4.299   1.00 38.11  ? 76  TRP D CH2   1 
ATOM   9283  N  N     . SER D  4  16  ? -38.356 22.343  10.029  1.00 49.35  ? 77  SER D N     1 
ATOM   9284  C  CA    . SER D  4  16  ? -38.332 22.955  11.348  1.00 51.34  ? 77  SER D CA    1 
ATOM   9285  C  C     . SER D  4  16  ? -37.177 23.950  11.509  1.00 52.36  ? 77  SER D C     1 
ATOM   9286  O  O     . SER D  4  16  ? -37.216 24.811  12.393  1.00 52.84  ? 77  SER D O     1 
ATOM   9287  C  CB    . SER D  4  16  ? -38.325 21.882  12.450  1.00 51.42  ? 77  SER D CB    1 
ATOM   9288  O  OG    . SER D  4  16  ? -37.348 20.884  12.206  1.00 54.57  ? 77  SER D OG    1 
ATOM   9289  N  N     . HIS D  4  17  ? -36.156 23.841  10.658  1.00 52.29  ? 78  HIS D N     1 
ATOM   9290  C  CA    . HIS D  4  17  ? -35.034 24.776  10.724  1.00 51.93  ? 78  HIS D CA    1 
ATOM   9291  C  C     . HIS D  4  17  ? -35.171 26.050  9.858   1.00 52.68  ? 78  HIS D C     1 
ATOM   9292  O  O     . HIS D  4  17  ? -34.292 26.914  9.880   1.00 52.93  ? 78  HIS D O     1 
ATOM   9293  C  CB    . HIS D  4  17  ? -33.696 24.070  10.491  1.00 50.55  ? 78  HIS D CB    1 
ATOM   9294  C  CG    . HIS D  4  17  ? -33.680 23.140  9.320   1.00 49.96  ? 78  HIS D CG    1 
ATOM   9295  N  ND1   . HIS D  4  17  ? -33.130 23.485  8.105   1.00 51.50  ? 78  HIS D ND1   1 
ATOM   9296  C  CD2   . HIS D  4  17  ? -34.083 21.855  9.197   1.00 50.25  ? 78  HIS D CD2   1 
ATOM   9297  C  CE1   . HIS D  4  17  ? -33.192 22.452  7.284   1.00 48.72  ? 78  HIS D CE1   1 
ATOM   9298  N  NE2   . HIS D  4  17  ? -33.765 21.450  7.922   1.00 49.71  ? 78  HIS D NE2   1 
ATOM   9299  N  N     . ASN D  4  18  ? -36.273 26.162  9.109   1.00 51.83  ? 79  ASN D N     1 
ATOM   9300  C  CA    . ASN D  4  18  ? -36.543 27.343  8.284   1.00 51.70  ? 79  ASN D CA    1 
ATOM   9301  C  C     . ASN D  4  18  ? -37.004 28.449  9.215   1.00 52.49  ? 79  ASN D C     1 
ATOM   9302  O  O     . ASN D  4  18  ? -37.882 28.234  10.056  1.00 54.08  ? 79  ASN D O     1 
ATOM   9303  C  CB    . ASN D  4  18  ? -37.687 27.094  7.304   1.00 50.39  ? 79  ASN D CB    1 
ATOM   9304  C  CG    . ASN D  4  18  ? -37.270 26.321  6.082   1.00 50.37  ? 79  ASN D CG    1 
ATOM   9305  O  OD1   . ASN D  4  18  ? -38.108 26.024  5.240   1.00 52.15  ? 79  ASN D OD1   1 
ATOM   9306  N  ND2   . ASN D  4  18  ? -35.985 25.991  5.966   1.00 51.65  ? 79  ASN D ND2   1 
ATOM   9307  N  N     . GLY D  4  19  ? -36.457 29.643  9.041   1.00 51.18  ? 80  GLY D N     1 
ATOM   9308  C  CA    . GLY D  4  19  ? -36.862 30.736  9.902   1.00 49.40  ? 80  GLY D CA    1 
ATOM   9309  C  C     . GLY D  4  19  ? -35.680 31.274  10.666  1.00 48.89  ? 80  GLY D C     1 
ATOM   9310  O  O     . GLY D  4  19  ? -34.868 30.504  11.191  1.00 48.76  ? 80  GLY D O     1 
ATOM   9311  N  N     . PRO D  4  20  ? -35.569 32.605  10.762  1.00 47.95  ? 81  PRO D N     1 
ATOM   9312  C  CA    . PRO D  4  20  ? -34.475 33.273  11.467  1.00 49.06  ? 81  PRO D CA    1 
ATOM   9313  C  C     . PRO D  4  20  ? -34.200 32.781  12.892  1.00 50.12  ? 81  PRO D C     1 
ATOM   9314  O  O     . PRO D  4  20  ? -33.041 32.626  13.275  1.00 52.09  ? 81  PRO D O     1 
ATOM   9315  C  CB    . PRO D  4  20  ? -34.893 34.751  11.426  1.00 48.35  ? 81  PRO D CB    1 
ATOM   9316  C  CG    . PRO D  4  20  ? -36.382 34.695  11.298  1.00 47.46  ? 81  PRO D CG    1 
ATOM   9317  C  CD    . PRO D  4  20  ? -36.569 33.583  10.308  1.00 46.95  ? 81  PRO D CD    1 
ATOM   9318  N  N     . PHE D  4  21  ? -35.253 32.458  13.640  1.00 50.02  ? 82  PHE D N     1 
ATOM   9319  C  CA    . PHE D  4  21  ? -35.092 32.014  15.022  1.00 50.59  ? 82  PHE D CA    1 
ATOM   9320  C  C     . PHE D  4  21  ? -35.088 30.507  15.246  1.00 50.70  ? 82  PHE D C     1 
ATOM   9321  O  O     . PHE D  4  21  ? -35.226 30.069  16.385  1.00 52.86  ? 82  PHE D O     1 
ATOM   9322  C  CB    . PHE D  4  21  ? -36.199 32.607  15.897  1.00 50.17  ? 82  PHE D CB    1 
ATOM   9323  C  CG    . PHE D  4  21  ? -36.486 34.055  15.630  1.00 49.96  ? 82  PHE D CG    1 
ATOM   9324  C  CD1   . PHE D  4  21  ? -37.778 34.473  15.338  1.00 48.43  ? 82  PHE D CD1   1 
ATOM   9325  C  CD2   . PHE D  4  21  ? -35.476 35.004  15.691  1.00 50.17  ? 82  PHE D CD2   1 
ATOM   9326  C  CE1   . PHE D  4  21  ? -38.061 35.819  15.114  1.00 49.20  ? 82  PHE D CE1   1 
ATOM   9327  C  CE2   . PHE D  4  21  ? -35.755 36.356  15.467  1.00 50.44  ? 82  PHE D CE2   1 
ATOM   9328  C  CZ    . PHE D  4  21  ? -37.049 36.761  15.179  1.00 48.49  ? 82  PHE D CZ    1 
ATOM   9329  N  N     . GLU D  4  22  ? -34.892 29.713  14.197  1.00 50.69  ? 83  GLU D N     1 
ATOM   9330  C  CA    . GLU D  4  22  ? -34.938 28.255  14.354  1.00 50.12  ? 83  GLU D CA    1 
ATOM   9331  C  C     . GLU D  4  22  ? -33.646 27.449  14.240  1.00 49.85  ? 83  GLU D C     1 
ATOM   9332  O  O     . GLU D  4  22  ? -32.868 27.609  13.297  1.00 51.37  ? 83  GLU D O     1 
ATOM   9333  C  CB    . GLU D  4  22  ? -35.968 27.659  13.389  1.00 50.72  ? 83  GLU D CB    1 
ATOM   9334  C  CG    . GLU D  4  22  ? -37.312 28.379  13.358  1.00 51.79  ? 83  GLU D CG    1 
ATOM   9335  C  CD    . GLU D  4  22  ? -38.025 28.385  14.693  1.00 53.13  ? 83  GLU D CD    1 
ATOM   9336  O  OE1   . GLU D  4  22  ? -38.666 29.409  15.000  1.00 52.67  ? 83  GLU D OE1   1 
ATOM   9337  O  OE2   . GLU D  4  22  ? -37.958 27.373  15.430  1.00 55.75  ? 83  GLU D OE2   1 
ATOM   9338  N  N     . THR D  4  23  ? -33.461 26.532  15.183  1.00 49.11  ? 84  THR D N     1 
ATOM   9339  C  CA    . THR D  4  23  ? -32.294 25.653  15.197  1.00 49.89  ? 84  THR D CA    1 
ATOM   9340  C  C     . THR D  4  23  ? -32.637 24.360  14.461  1.00 49.92  ? 84  THR D C     1 
ATOM   9341  O  O     . THR D  4  23  ? -33.793 24.115  14.139  1.00 50.96  ? 84  THR D O     1 
ATOM   9342  C  CB    . THR D  4  23  ? -31.919 25.243  16.633  1.00 50.63  ? 84  THR D CB    1 
ATOM   9343  O  OG1   . THR D  4  23  ? -33.045 24.616  17.262  1.00 51.61  ? 84  THR D OG1   1 
ATOM   9344  C  CG2   . THR D  4  23  ? -31.493 26.447  17.448  1.00 52.73  ? 84  THR D CG2   1 
ATOM   9345  N  N     . PHE D  4  24  ? -31.634 23.541  14.175  1.00 50.44  ? 85  PHE D N     1 
ATOM   9346  C  CA    . PHE D  4  24  ? -31.893 22.255  13.548  1.00 52.65  ? 85  PHE D CA    1 
ATOM   9347  C  C     . PHE D  4  24  ? -32.623 21.449  14.627  1.00 54.62  ? 85  PHE D C     1 
ATOM   9348  O  O     . PHE D  4  24  ? -32.689 21.866  15.788  1.00 54.56  ? 85  PHE D O     1 
ATOM   9349  C  CB    . PHE D  4  24  ? -30.582 21.510  13.259  1.00 53.28  ? 85  PHE D CB    1 
ATOM   9350  C  CG    . PHE D  4  24  ? -29.890 21.920  11.993  1.00 54.72  ? 85  PHE D CG    1 
ATOM   9351  C  CD1   . PHE D  4  24  ? -28.500 22.000  11.951  1.00 55.19  ? 85  PHE D CD1   1 
ATOM   9352  C  CD2   . PHE D  4  24  ? -30.608 22.175  10.831  1.00 55.08  ? 85  PHE D CD2   1 
ATOM   9353  C  CE1   . PHE D  4  24  ? -27.835 22.323  10.769  1.00 55.24  ? 85  PHE D CE1   1 
ATOM   9354  C  CE2   . PHE D  4  24  ? -29.952 22.498  9.644   1.00 55.80  ? 85  PHE D CE2   1 
ATOM   9355  C  CZ    . PHE D  4  24  ? -28.563 22.572  9.615   1.00 55.45  ? 85  PHE D CZ    1 
ATOM   9356  N  N     . ASP D  4  25  ? -33.188 20.311  14.241  1.00 56.35  ? 86  ASP D N     1 
ATOM   9357  C  CA    . ASP D  4  25  ? -33.838 19.422  15.192  1.00 56.84  ? 86  ASP D CA    1 
ATOM   9358  C  C     . ASP D  4  25  ? -32.769 18.345  15.356  1.00 56.02  ? 86  ASP D C     1 
ATOM   9359  O  O     . ASP D  4  25  ? -32.507 17.578  14.429  1.00 55.62  ? 86  ASP D O     1 
ATOM   9360  C  CB    . ASP D  4  25  ? -35.109 18.837  14.591  1.00 60.10  ? 86  ASP D CB    1 
ATOM   9361  C  CG    . ASP D  4  25  ? -35.867 17.960  15.565  1.00 64.12  ? 86  ASP D CG    1 
ATOM   9362  O  OD1   . ASP D  4  25  ? -37.048 18.266  15.833  1.00 67.77  ? 86  ASP D OD1   1 
ATOM   9363  O  OD2   . ASP D  4  25  ? -35.295 16.961  16.051  1.00 65.25  ? 86  ASP D OD2   1 
ATOM   9364  N  N     . HIS D  4  26  ? -32.120 18.312  16.514  1.00 55.23  ? 87  HIS D N     1 
ATOM   9365  C  CA    . HIS D  4  26  ? -31.048 17.346  16.731  1.00 55.79  ? 87  HIS D CA    1 
ATOM   9366  C  C     . HIS D  4  26  ? -31.444 15.874  16.810  1.00 56.16  ? 87  HIS D C     1 
ATOM   9367  O  O     . HIS D  4  26  ? -30.616 14.991  16.564  1.00 56.38  ? 87  HIS D O     1 
ATOM   9368  C  CB    . HIS D  4  26  ? -30.176 17.780  17.902  1.00 55.52  ? 87  HIS D CB    1 
ATOM   9369  C  CG    . HIS D  4  26  ? -29.419 19.046  17.633  1.00 57.15  ? 87  HIS D CG    1 
ATOM   9370  N  ND1   . HIS D  4  26  ? -28.045 19.088  17.535  1.00 57.16  ? 87  HIS D ND1   1 
ATOM   9371  C  CD2   . HIS D  4  26  ? -29.852 20.309  17.396  1.00 55.48  ? 87  HIS D CD2   1 
ATOM   9372  C  CE1   . HIS D  4  26  ? -27.665 20.321  17.247  1.00 55.98  ? 87  HIS D CE1   1 
ATOM   9373  N  NE2   . HIS D  4  26  ? -28.742 21.080  17.157  1.00 53.84  ? 87  HIS D NE2   1 
ATOM   9374  N  N     . ALA D  4  27  ? -32.714 15.610  17.112  1.00 56.15  ? 88  ALA D N     1 
ATOM   9375  C  CA    . ALA D  4  27  ? -33.210 14.238  17.171  1.00 55.42  ? 88  ALA D CA    1 
ATOM   9376  C  C     . ALA D  4  27  ? -33.239 13.733  15.733  1.00 55.29  ? 88  ALA D C     1 
ATOM   9377  O  O     . ALA D  4  27  ? -32.824 12.606  15.440  1.00 55.77  ? 88  ALA D O     1 
ATOM   9378  C  CB    . ALA D  4  27  ? -34.604 14.202  17.774  1.00 53.59  ? 88  ALA D CB    1 
ATOM   9379  N  N     . SER D  4  28  ? -33.680 14.612  14.833  1.00 55.19  ? 89  SER D N     1 
ATOM   9380  C  CA    . SER D  4  28  ? -33.762 14.303  13.412  1.00 53.97  ? 89  SER D CA    1 
ATOM   9381  C  C     . SER D  4  28  ? -32.359 14.103  12.838  1.00 53.03  ? 89  SER D C     1 
ATOM   9382  O  O     . SER D  4  28  ? -32.144 13.232  11.990  1.00 51.76  ? 89  SER D O     1 
ATOM   9383  C  CB    . SER D  4  28  ? -34.483 15.423  12.678  1.00 54.94  ? 89  SER D CB    1 
ATOM   9384  O  OG    . SER D  4  28  ? -34.924 14.974  11.411  1.00 58.31  ? 89  SER D OG    1 
ATOM   9385  N  N     . ILE D  4  29  ? -31.398 14.888  13.325  1.00 51.41  ? 90  ILE D N     1 
ATOM   9386  C  CA    . ILE D  4  29  ? -30.020 14.754  12.867  1.00 51.28  ? 90  ILE D CA    1 
ATOM   9387  C  C     . ILE D  4  29  ? -29.535 13.353  13.250  1.00 51.42  ? 90  ILE D C     1 
ATOM   9388  O  O     . ILE D  4  29  ? -29.011 12.620  12.406  1.00 50.36  ? 90  ILE D O     1 
ATOM   9389  C  CB    . ILE D  4  29  ? -29.100 15.835  13.492  1.00 51.15  ? 90  ILE D CB    1 
ATOM   9390  C  CG1   . ILE D  4  29  ? -29.545 17.225  13.042  1.00 51.69  ? 90  ILE D CG1   1 
ATOM   9391  C  CG2   . ILE D  4  29  ? -27.655 15.601  13.086  1.00 48.48  ? 90  ILE D CG2   1 
ATOM   9392  C  CD1   . ILE D  4  29  ? -28.731 18.353  13.633  1.00 52.28  ? 90  ILE D CD1   1 
ATOM   9393  N  N     . ARG D  4  30  ? -29.778 12.973  14.509  1.00 52.77  ? 91  ARG D N     1 
ATOM   9394  C  CA    . ARG D  4  30  ? -29.397 11.655  15.049  1.00 53.48  ? 91  ARG D CA    1 
ATOM   9395  C  C     . ARG D  4  30  ? -29.929 10.507  14.186  1.00 51.56  ? 91  ARG D C     1 
ATOM   9396  O  O     . ARG D  4  30  ? -29.159 9.649   13.739  1.00 49.83  ? 91  ARG D O     1 
ATOM   9397  C  CB    . ARG D  4  30  ? -29.907 11.504  16.489  1.00 55.62  ? 91  ARG D CB    1 
ATOM   9398  C  CG    . ARG D  4  30  ? -29.493 10.209  17.191  1.00 57.66  ? 91  ARG D CG    1 
ATOM   9399  C  CD    . ARG D  4  30  ? -29.847 10.282  18.679  1.00 60.75  ? 91  ARG D CD    1 
ATOM   9400  N  NE    . ARG D  4  30  ? -29.636 9.022   19.392  1.00 62.06  ? 91  ARG D NE    1 
ATOM   9401  C  CZ    . ARG D  4  30  ? -28.478 8.633   19.918  1.00 64.16  ? 91  ARG D CZ    1 
ATOM   9402  N  NH1   . ARG D  4  30  ? -28.401 7.472   20.551  1.00 67.08  ? 91  ARG D NH1   1 
ATOM   9403  N  NH2   . ARG D  4  30  ? -27.393 9.389   19.811  1.00 63.63  ? 91  ARG D NH2   1 
ATOM   9404  N  N     . ARG D  4  31  ? -31.239 10.514  13.942  1.00 50.10  ? 92  ARG D N     1 
ATOM   9405  C  CA    . ARG D  4  31  ? -31.876 9.494   13.114  1.00 51.47  ? 92  ARG D CA    1 
ATOM   9406  C  C     . ARG D  4  31  ? -31.252 9.480   11.722  1.00 52.69  ? 92  ARG D C     1 
ATOM   9407  O  O     . ARG D  4  31  ? -30.901 8.417   11.200  1.00 53.55  ? 92  ARG D O     1 
ATOM   9408  C  CB    . ARG D  4  31  ? -33.375 9.771   12.983  1.00 51.26  ? 92  ARG D CB    1 
ATOM   9409  C  CG    . ARG D  4  31  ? -34.248 9.147   14.056  1.00 49.82  ? 92  ARG D CG    1 
ATOM   9410  C  CD    . ARG D  4  31  ? -35.705 9.515   13.845  1.00 47.16  ? 92  ARG D CD    1 
ATOM   9411  N  NE    . ARG D  4  31  ? -36.170 10.472  14.839  1.00 48.06  ? 92  ARG D NE    1 
ATOM   9412  C  CZ    . ARG D  4  31  ? -36.835 11.587  14.557  1.00 50.18  ? 92  ARG D CZ    1 
ATOM   9413  N  NH1   . ARG D  4  31  ? -37.221 12.395  15.538  1.00 52.28  ? 92  ARG D NH1   1 
ATOM   9414  N  NH2   . ARG D  4  31  ? -37.091 11.910  13.297  1.00 49.69  ? 92  ARG D NH2   1 
ATOM   9415  N  N     . GLY D  4  32  ? -31.101 10.676  11.144  1.00 52.83  ? 93  GLY D N     1 
ATOM   9416  C  CA    . GLY D  4  32  ? -30.524 10.821  9.821   1.00 50.72  ? 93  GLY D CA    1 
ATOM   9417  C  C     . GLY D  4  32  ? -29.174 10.154  9.705   1.00 51.13  ? 93  GLY D C     1 
ATOM   9418  O  O     . GLY D  4  32  ? -28.867 9.548   8.679   1.00 49.50  ? 93  GLY D O     1 
ATOM   9419  N  N     . TYR D  4  33  ? -28.362 10.266  10.756  1.00 52.42  ? 94  TYR D N     1 
ATOM   9420  C  CA    . TYR D  4  33  ? -27.050 9.637   10.747  1.00 54.52  ? 94  TYR D CA    1 
ATOM   9421  C  C     . TYR D  4  33  ? -27.180 8.120   10.559  1.00 54.92  ? 94  TYR D C     1 
ATOM   9422  O  O     . TYR D  4  33  ? -26.391 7.508   9.825   1.00 53.22  ? 94  TYR D O     1 
ATOM   9423  C  CB    . TYR D  4  33  ? -26.259 9.931   12.034  1.00 55.02  ? 94  TYR D CB    1 
ATOM   9424  C  CG    . TYR D  4  33  ? -24.957 9.159   12.055  1.00 56.04  ? 94  TYR D CG    1 
ATOM   9425  C  CD1   . TYR D  4  33  ? -23.861 9.591   11.306  1.00 56.80  ? 94  TYR D CD1   1 
ATOM   9426  C  CD2   . TYR D  4  33  ? -24.874 7.916   12.681  1.00 55.99  ? 94  TYR D CD2   1 
ATOM   9427  C  CE1   . TYR D  4  33  ? -22.725 8.800   11.161  1.00 57.53  ? 94  TYR D CE1   1 
ATOM   9428  C  CE2   . TYR D  4  33  ? -23.746 7.113   12.541  1.00 57.33  ? 94  TYR D CE2   1 
ATOM   9429  C  CZ    . TYR D  4  33  ? -22.676 7.555   11.774  1.00 58.69  ? 94  TYR D CZ    1 
ATOM   9430  O  OH    . TYR D  4  33  ? -21.589 6.732   11.561  1.00 58.91  ? 94  TYR D OH    1 
ATOM   9431  N  N     . GLN D  4  34  ? -28.169 7.522   11.231  1.00 55.63  ? 95  GLN D N     1 
ATOM   9432  C  CA    . GLN D  4  34  ? -28.402 6.075   11.146  1.00 56.46  ? 95  GLN D CA    1 
ATOM   9433  C  C     . GLN D  4  34  ? -28.785 5.660   9.729   1.00 55.56  ? 95  GLN D C     1 
ATOM   9434  O  O     . GLN D  4  34  ? -28.281 4.658   9.208   1.00 55.82  ? 95  GLN D O     1 
ATOM   9435  C  CB    . GLN D  4  34  ? -29.486 5.632   12.135  1.00 57.48  ? 95  GLN D CB    1 
ATOM   9436  C  CG    . GLN D  4  34  ? -29.599 4.113   12.285  1.00 59.70  ? 95  GLN D CG    1 
ATOM   9437  C  CD    . GLN D  4  34  ? -30.745 3.674   13.196  1.00 60.51  ? 95  GLN D CD    1 
ATOM   9438  O  OE1   . GLN D  4  34  ? -31.207 4.429   14.060  1.00 59.82  ? 95  GLN D OE1   1 
ATOM   9439  N  NE2   . GLN D  4  34  ? -31.212 2.446   12.996  1.00 59.31  ? 95  GLN D NE2   1 
ATOM   9440  N  N     . VAL D  4  35  ? -29.649 6.459   9.101   1.00 53.59  ? 96  VAL D N     1 
ATOM   9441  C  CA    . VAL D  4  35  ? -30.091 6.196   7.740   1.00 50.70  ? 96  VAL D CA    1 
ATOM   9442  C  C     . VAL D  4  35  ? -28.902 6.300   6.808   1.00 50.28  ? 96  VAL D C     1 
ATOM   9443  O  O     . VAL D  4  35  ? -28.804 5.559   5.833   1.00 51.65  ? 96  VAL D O     1 
ATOM   9444  C  CB    . VAL D  4  35  ? -31.162 7.192   7.289   1.00 50.16  ? 96  VAL D CB    1 
ATOM   9445  C  CG1   . VAL D  4  35  ? -31.578 6.904   5.858   1.00 49.71  ? 96  VAL D CG1   1 
ATOM   9446  C  CG2   . VAL D  4  35  ? -32.363 7.124   8.209   1.00 49.63  ? 96  VAL D CG2   1 
ATOM   9447  N  N     . TYR D  4  36  ? -27.994 7.221   7.107   1.00 49.46  ? 97  TYR D N     1 
ATOM   9448  C  CA    . TYR D  4  36  ? -26.814 7.384   6.277   1.00 51.06  ? 97  TYR D CA    1 
ATOM   9449  C  C     . TYR D  4  36  ? -25.897 6.168   6.399   1.00 53.48  ? 97  TYR D C     1 
ATOM   9450  O  O     . TYR D  4  36  ? -25.368 5.677   5.399   1.00 53.18  ? 97  TYR D O     1 
ATOM   9451  C  CB    . TYR D  4  36  ? -26.035 8.659   6.642   1.00 50.23  ? 97  TYR D CB    1 
ATOM   9452  C  CG    . TYR D  4  36  ? -24.651 8.660   6.039   1.00 47.65  ? 97  TYR D CG    1 
ATOM   9453  C  CD1   . TYR D  4  36  ? -24.468 8.906   4.685   1.00 46.72  ? 97  TYR D CD1   1 
ATOM   9454  C  CD2   . TYR D  4  36  ? -23.546 8.256   6.787   1.00 47.18  ? 97  TYR D CD2   1 
ATOM   9455  C  CE1   . TYR D  4  36  ? -23.227 8.731   4.087   1.00 47.61  ? 97  TYR D CE1   1 
ATOM   9456  C  CE2   . TYR D  4  36  ? -22.303 8.076   6.198   1.00 46.29  ? 97  TYR D CE2   1 
ATOM   9457  C  CZ    . TYR D  4  36  ? -22.153 8.311   4.849   1.00 47.87  ? 97  TYR D CZ    1 
ATOM   9458  O  OH    . TYR D  4  36  ? -20.935 8.102   4.245   1.00 51.06  ? 97  TYR D OH    1 
ATOM   9459  N  N     . ARG D  4  37  ? -25.685 5.717   7.634   1.00 55.94  ? 98  ARG D N     1 
ATOM   9460  C  CA    . ARG D  4  37  ? -24.824 4.570   7.905   1.00 58.34  ? 98  ARG D CA    1 
ATOM   9461  C  C     . ARG D  4  37  ? -25.386 3.259   7.349   1.00 60.49  ? 98  ARG D C     1 
ATOM   9462  O  O     . ARG D  4  37  ? -24.657 2.478   6.717   1.00 59.99  ? 98  ARG D O     1 
ATOM   9463  C  CB    . ARG D  4  37  ? -24.581 4.440   9.416   1.00 59.96  ? 98  ARG D CB    1 
ATOM   9464  C  CG    . ARG D  4  37  ? -23.803 3.193   9.855   1.00 60.96  ? 98  ARG D CG    1 
ATOM   9465  C  CD    . ARG D  4  37  ? -22.456 3.085   9.156   1.00 63.52  ? 98  ARG D CD    1 
ATOM   9466  N  NE    . ARG D  4  37  ? -21.615 4.251   9.406   1.00 66.11  ? 98  ARG D NE    1 
ATOM   9467  C  CZ    . ARG D  4  37  ? -20.668 4.681   8.578   1.00 65.99  ? 98  ARG D CZ    1 
ATOM   9468  N  NH1   . ARG D  4  37  ? -19.956 5.752   8.893   1.00 67.23  ? 98  ARG D NH1   1 
ATOM   9469  N  NH2   . ARG D  4  37  ? -20.436 4.044   7.438   1.00 65.43  ? 98  ARG D NH2   1 
ATOM   9470  N  N     . GLU D  4  38  ? -26.682 3.033   7.559   1.00 60.64  ? 99  GLU D N     1 
ATOM   9471  C  CA    . GLU D  4  38  ? -27.317 1.806   7.100   1.00 62.24  ? 99  GLU D CA    1 
ATOM   9472  C  C     . GLU D  4  38  ? -27.728 1.725   5.636   1.00 62.92  ? 99  GLU D C     1 
ATOM   9473  O  O     . GLU D  4  38  ? -27.864 0.624   5.093   1.00 64.58  ? 99  GLU D O     1 
ATOM   9474  C  CB    . GLU D  4  38  ? -28.488 1.452   8.008   1.00 62.59  ? 99  GLU D CB    1 
ATOM   9475  C  CG    . GLU D  4  38  ? -28.028 0.773   9.288   1.00 64.63  ? 99  GLU D CG    1 
ATOM   9476  C  CD    . GLU D  4  38  ? -29.070 0.791   10.386  1.00 66.76  ? 99  GLU D CD    1 
ATOM   9477  O  OE1   . GLU D  4  38  ? -30.270 0.615   10.077  1.00 66.82  ? 99  GLU D OE1   1 
ATOM   9478  O  OE2   . GLU D  4  38  ? -28.681 0.981   11.562  1.00 68.30  ? 99  GLU D OE2   1 
ATOM   9479  N  N     . VAL D  4  39  ? -27.883 2.870   4.978   1.00 62.39  ? 100 VAL D N     1 
ATOM   9480  C  CA    . VAL D  4  39  ? -28.292 2.870   3.576   1.00 60.53  ? 100 VAL D CA    1 
ATOM   9481  C  C     . VAL D  4  39  ? -27.290 3.526   2.620   1.00 60.55  ? 100 VAL D C     1 
ATOM   9482  O  O     . VAL D  4  39  ? -26.670 2.849   1.786   1.00 60.20  ? 100 VAL D O     1 
ATOM   9483  C  CB    . VAL D  4  39  ? -29.672 3.558   3.395   1.00 59.40  ? 100 VAL D CB    1 
ATOM   9484  C  CG1   . VAL D  4  39  ? -30.142 3.436   1.959   1.00 58.69  ? 100 VAL D CG1   1 
ATOM   9485  C  CG2   . VAL D  4  39  ? -30.695 2.953   4.335   1.00 59.36  ? 100 VAL D CG2   1 
ATOM   9486  N  N     . CYS D  4  40  ? -27.114 4.836   2.783   1.00 58.51  ? 101 CYS D N     1 
ATOM   9487  C  CA    . CYS D  4  40  ? -26.258 5.644   1.921   1.00 55.10  ? 101 CYS D CA    1 
ATOM   9488  C  C     . CYS D  4  40  ? -24.759 5.357   1.898   1.00 54.03  ? 101 CYS D C     1 
ATOM   9489  O  O     . CYS D  4  40  ? -24.156 5.331   0.822   1.00 53.41  ? 101 CYS D O     1 
ATOM   9490  C  CB    . CYS D  4  40  ? -26.497 7.116   2.223   1.00 54.60  ? 101 CYS D CB    1 
ATOM   9491  S  SG    . CYS D  4  40  ? -28.234 7.524   2.592   1.00 54.73  ? 101 CYS D SG    1 
ATOM   9492  N  N     . ALA D  4  41  ? -24.167 5.134   3.071   1.00 52.75  ? 102 ALA D N     1 
ATOM   9493  C  CA    . ALA D  4  41  ? -22.731 4.873   3.193   1.00 52.08  ? 102 ALA D CA    1 
ATOM   9494  C  C     . ALA D  4  41  ? -22.205 3.760   2.304   1.00 53.57  ? 102 ALA D C     1 
ATOM   9495  O  O     . ALA D  4  41  ? -20.994 3.641   2.102   1.00 55.66  ? 102 ALA D O     1 
ATOM   9496  C  CB    . ALA D  4  41  ? -22.368 4.594   4.626   1.00 50.63  ? 102 ALA D CB    1 
ATOM   9497  N  N     . ALA D  4  42  ? -23.115 2.945   1.781   1.00 54.50  ? 103 ALA D N     1 
ATOM   9498  C  CA    . ALA D  4  42  ? -22.754 1.836   0.909   1.00 55.96  ? 103 ALA D CA    1 
ATOM   9499  C  C     . ALA D  4  42  ? -22.152 2.348   -0.397  1.00 57.29  ? 103 ALA D C     1 
ATOM   9500  O  O     . ALA D  4  42  ? -21.305 1.682   -0.998  1.00 56.57  ? 103 ALA D O     1 
ATOM   9501  C  CB    . ALA D  4  42  ? -23.980 0.988   0.623   1.00 56.61  ? 103 ALA D CB    1 
ATOM   9502  N  N     . CYS D  4  43  ? -22.577 3.542   -0.817  1.00 58.35  ? 104 CYS D N     1 
ATOM   9503  C  CA    . CYS D  4  43  ? -22.087 4.145   -2.062  1.00 58.91  ? 104 CYS D CA    1 
ATOM   9504  C  C     . CYS D  4  43  ? -21.597 5.599   -1.937  1.00 58.14  ? 104 CYS D C     1 
ATOM   9505  O  O     . CYS D  4  43  ? -20.873 6.079   -2.810  1.00 58.57  ? 104 CYS D O     1 
ATOM   9506  C  CB    . CYS D  4  43  ? -23.179 4.098   -3.135  1.00 58.53  ? 104 CYS D CB    1 
ATOM   9507  S  SG    . CYS D  4  43  ? -24.175 2.580   -3.164  1.00 58.91  ? 104 CYS D SG    1 
ATOM   9508  N  N     . HIS D  4  44  ? -21.997 6.290   -0.869  1.00 55.72  ? 105 HIS D N     1 
ATOM   9509  C  CA    . HIS D  4  44  ? -21.623 7.685   -0.669  1.00 53.70  ? 105 HIS D CA    1 
ATOM   9510  C  C     . HIS D  4  44  ? -20.635 7.954   0.455   1.00 53.82  ? 105 HIS D C     1 
ATOM   9511  O  O     . HIS D  4  44  ? -20.834 7.522   1.593   1.00 55.11  ? 105 HIS D O     1 
ATOM   9512  C  CB    . HIS D  4  44  ? -22.869 8.541   -0.409  1.00 53.56  ? 105 HIS D CB    1 
ATOM   9513  C  CG    . HIS D  4  44  ? -23.727 8.761   -1.615  1.00 53.76  ? 105 HIS D CG    1 
ATOM   9514  N  ND1   . HIS D  4  44  ? -23.321 9.444   -2.741  1.00 54.71  ? 105 HIS D ND1   1 
ATOM   9515  C  CD2   . HIS D  4  44  ? -25.012 8.396   -1.853  1.00 53.85  ? 105 HIS D CD2   1 
ATOM   9516  C  CE1   . HIS D  4  44  ? -24.351 9.468   -3.604  1.00 54.23  ? 105 HIS D CE1   1 
ATOM   9517  N  NE2   . HIS D  4  44  ? -25.404 8.843   -3.111  1.00 51.59  ? 105 HIS D NE2   1 
ATOM   9518  N  N     . SER D  4  45  ? -19.598 8.726   0.144   1.00 52.07  ? 106 SER D N     1 
ATOM   9519  C  CA    . SER D  4  45  ? -18.610 9.103   1.142   1.00 50.00  ? 106 SER D CA    1 
ATOM   9520  C  C     . SER D  4  45  ? -19.082 10.386  1.823   1.00 49.83  ? 106 SER D C     1 
ATOM   9521  O  O     . SER D  4  45  ? -20.018 11.033  1.365   1.00 50.49  ? 106 SER D O     1 
ATOM   9522  C  CB    . SER D  4  45  ? -17.243 9.319   0.498   1.00 49.90  ? 106 SER D CB    1 
ATOM   9523  O  OG    . SER D  4  45  ? -17.269 10.410  -0.397  1.00 50.36  ? 106 SER D OG    1 
ATOM   9524  N  N     . LEU D  4  46  ? -18.431 10.744  2.923   1.00 50.53  ? 107 LEU D N     1 
ATOM   9525  C  CA    . LEU D  4  46  ? -18.768 11.939  3.688   1.00 50.34  ? 107 LEU D CA    1 
ATOM   9526  C  C     . LEU D  4  46  ? -17.426 12.483  4.206   1.00 51.18  ? 107 LEU D C     1 
ATOM   9527  O  O     . LEU D  4  46  ? -17.274 12.829  5.384   1.00 51.36  ? 107 LEU D O     1 
ATOM   9528  C  CB    . LEU D  4  46  ? -19.705 11.545  4.838   1.00 50.83  ? 107 LEU D CB    1 
ATOM   9529  C  CG    . LEU D  4  46  ? -20.528 12.623  5.544   1.00 53.62  ? 107 LEU D CG    1 
ATOM   9530  C  CD1   . LEU D  4  46  ? -21.436 13.334  4.555   1.00 54.33  ? 107 LEU D CD1   1 
ATOM   9531  C  CD2   . LEU D  4  46  ? -21.363 11.984  6.635   1.00 55.16  ? 107 LEU D CD2   1 
ATOM   9532  N  N     . ASP D  4  47  ? -16.473 12.565  3.273   1.00 50.40  ? 108 ASP D N     1 
ATOM   9533  C  CA    . ASP D  4  47  ? -15.093 12.997  3.487   1.00 48.68  ? 108 ASP D CA    1 
ATOM   9534  C  C     . ASP D  4  47  ? -14.767 14.186  4.372   1.00 48.47  ? 108 ASP D C     1 
ATOM   9535  O  O     . ASP D  4  47  ? -13.756 14.166  5.068   1.00 47.80  ? 108 ASP D O     1 
ATOM   9536  C  CB    . ASP D  4  47  ? -14.405 13.220  2.139   1.00 49.70  ? 108 ASP D CB    1 
ATOM   9537  C  CG    . ASP D  4  47  ? -14.009 11.923  1.438   1.00 53.51  ? 108 ASP D CG    1 
ATOM   9538  O  OD1   . ASP D  4  47  ? -13.494 12.022  0.301   1.00 55.45  ? 108 ASP D OD1   1 
ATOM   9539  O  OD2   . ASP D  4  47  ? -14.191 10.817  2.002   1.00 55.48  ? 108 ASP D OD2   1 
ATOM   9540  N  N     . ARG D  4  48  ? -15.594 15.225  4.334   1.00 49.10  ? 109 ARG D N     1 
ATOM   9541  C  CA    . ARG D  4  48  ? -15.326 16.443  5.105   1.00 48.40  ? 109 ARG D CA    1 
ATOM   9542  C  C     . ARG D  4  48  ? -15.806 16.461  6.555   1.00 48.22  ? 109 ARG D C     1 
ATOM   9543  O  O     . ARG D  4  48  ? -15.506 17.398  7.300   1.00 48.86  ? 109 ARG D O     1 
ATOM   9544  C  CB    . ARG D  4  48  ? -15.847 17.676  4.348   1.00 49.08  ? 109 ARG D CB    1 
ATOM   9545  C  CG    . ARG D  4  48  ? -15.781 17.532  2.823   1.00 50.07  ? 109 ARG D CG    1 
ATOM   9546  C  CD    . ARG D  4  48  ? -15.689 18.860  2.094   1.00 49.43  ? 109 ARG D CD    1 
ATOM   9547  N  NE    . ARG D  4  48  ? -14.357 19.013  1.517   1.00 50.23  ? 109 ARG D NE    1 
ATOM   9548  C  CZ    . ARG D  4  48  ? -14.077 18.889  0.223   1.00 50.55  ? 109 ARG D CZ    1 
ATOM   9549  N  NH1   . ARG D  4  48  ? -12.833 19.037  -0.202  1.00 52.62  ? 109 ARG D NH1   1 
ATOM   9550  N  NH2   . ARG D  4  48  ? -15.038 18.633  -0.652  1.00 51.57  ? 109 ARG D NH2   1 
ATOM   9551  N  N     . VAL D  4  49  ? -16.544 15.433  6.962   1.00 48.36  ? 110 VAL D N     1 
ATOM   9552  C  CA    . VAL D  4  49  ? -17.037 15.353  8.340   1.00 48.48  ? 110 VAL D CA    1 
ATOM   9553  C  C     . VAL D  4  49  ? -16.100 14.547  9.259   1.00 48.75  ? 110 VAL D C     1 
ATOM   9554  O  O     . VAL D  4  49  ? -15.685 13.442  8.922   1.00 48.46  ? 110 VAL D O     1 
ATOM   9555  C  CB    . VAL D  4  49  ? -18.461 14.775  8.387   1.00 46.71  ? 110 VAL D CB    1 
ATOM   9556  C  CG1   . VAL D  4  49  ? -18.900 14.559  9.821   1.00 47.78  ? 110 VAL D CG1   1 
ATOM   9557  C  CG2   . VAL D  4  49  ? -19.421 15.733  7.700   1.00 46.51  ? 110 VAL D CG2   1 
ATOM   9558  N  N     . ALA D  4  50  ? -15.732 15.138  10.394  1.00 49.58  ? 111 ALA D N     1 
ATOM   9559  C  CA    . ALA D  4  50  ? -14.851 14.484  11.367  1.00 49.76  ? 111 ALA D CA    1 
ATOM   9560  C  C     . ALA D  4  50  ? -15.686 13.935  12.519  1.00 49.80  ? 111 ALA D C     1 
ATOM   9561  O  O     . ALA D  4  50  ? -16.627 14.594  12.973  1.00 49.30  ? 111 ALA D O     1 
ATOM   9562  C  CB    . ALA D  4  50  ? -13.816 15.465  11.889  1.00 47.85  ? 111 ALA D CB    1 
ATOM   9563  N  N     . TRP D  4  51  ? -15.328 12.739  12.994  1.00 49.87  ? 112 TRP D N     1 
ATOM   9564  C  CA    . TRP D  4  51  ? -16.051 12.080  14.084  1.00 48.23  ? 112 TRP D CA    1 
ATOM   9565  C  C     . TRP D  4  51  ? -16.342 13.021  15.247  1.00 48.75  ? 112 TRP D C     1 
ATOM   9566  O  O     . TRP D  4  51  ? -17.478 13.094  15.705  1.00 49.29  ? 112 TRP D O     1 
ATOM   9567  C  CB    . TRP D  4  51  ? -15.282 10.847  14.585  1.00 47.11  ? 112 TRP D CB    1 
ATOM   9568  C  CG    . TRP D  4  51  ? -15.196 9.688   13.607  1.00 43.39  ? 112 TRP D CG    1 
ATOM   9569  C  CD1   . TRP D  4  51  ? -14.075 9.230   12.983  1.00 43.83  ? 112 TRP D CD1   1 
ATOM   9570  C  CD2   . TRP D  4  51  ? -16.269 8.846   13.165  1.00 42.69  ? 112 TRP D CD2   1 
ATOM   9571  N  NE1   . TRP D  4  51  ? -14.377 8.158   12.174  1.00 42.83  ? 112 TRP D NE1   1 
ATOM   9572  C  CE2   . TRP D  4  51  ? -15.719 7.902   12.270  1.00 43.89  ? 112 TRP D CE2   1 
ATOM   9573  C  CE3   . TRP D  4  51  ? -17.642 8.797   13.438  1.00 44.35  ? 112 TRP D CE3   1 
ATOM   9574  C  CZ2   . TRP D  4  51  ? -16.496 6.920   11.644  1.00 43.87  ? 112 TRP D CZ2   1 
ATOM   9575  C  CZ3   . TRP D  4  51  ? -18.416 7.822   12.815  1.00 44.62  ? 112 TRP D CZ3   1 
ATOM   9576  C  CH2   . TRP D  4  51  ? -17.838 6.897   11.927  1.00 44.71  ? 112 TRP D CH2   1 
ATOM   9577  N  N     . ARG D  4  52  ? -15.331 13.775  15.680  1.00 49.46  ? 113 ARG D N     1 
ATOM   9578  C  CA    . ARG D  4  52  ? -15.477 14.718  16.797  1.00 51.05  ? 113 ARG D CA    1 
ATOM   9579  C  C     . ARG D  4  52  ? -16.628 15.706  16.684  1.00 52.44  ? 113 ARG D C     1 
ATOM   9580  O  O     . ARG D  4  52  ? -17.209 16.094  17.703  1.00 54.02  ? 113 ARG D O     1 
ATOM   9581  C  CB    . ARG D  4  52  ? -14.182 15.499  17.056  1.00 51.41  ? 113 ARG D CB    1 
ATOM   9582  C  CG    . ARG D  4  52  ? -13.240 15.596  15.870  1.00 54.14  ? 113 ARG D CG    1 
ATOM   9583  C  CD    . ARG D  4  52  ? -12.229 16.714  16.023  1.00 53.53  ? 113 ARG D CD    1 
ATOM   9584  N  NE    . ARG D  4  52  ? -12.789 17.980  15.567  1.00 56.06  ? 113 ARG D NE    1 
ATOM   9585  C  CZ    . ARG D  4  52  ? -12.482 18.557  14.409  1.00 54.41  ? 113 ARG D CZ    1 
ATOM   9586  N  NH1   . ARG D  4  52  ? -13.050 19.705  14.076  1.00 54.55  ? 113 ARG D NH1   1 
ATOM   9587  N  NH2   . ARG D  4  52  ? -11.594 18.000  13.597  1.00 51.61  ? 113 ARG D NH2   1 
ATOM   9588  N  N     . THR D  4  53  ? -16.965 16.114  15.461  1.00 52.32  ? 114 THR D N     1 
ATOM   9589  C  CA    . THR D  4  53  ? -18.055 17.074  15.257  1.00 51.76  ? 114 THR D CA    1 
ATOM   9590  C  C     . THR D  4  53  ? -19.433 16.498  15.596  1.00 51.00  ? 114 THR D C     1 
ATOM   9591  O  O     . THR D  4  53  ? -20.401 17.244  15.738  1.00 49.01  ? 114 THR D O     1 
ATOM   9592  C  CB    . THR D  4  53  ? -18.069 17.650  13.820  1.00 53.00  ? 114 THR D CB    1 
ATOM   9593  O  OG1   . THR D  4  53  ? -18.475 16.630  12.892  1.00 54.84  ? 114 THR D OG1   1 
ATOM   9594  C  CG2   . THR D  4  53  ? -16.675 18.180  13.439  1.00 49.66  ? 114 THR D CG2   1 
ATOM   9595  N  N     . LEU D  4  54  ? -19.523 15.172  15.706  1.00 51.99  ? 115 LEU D N     1 
ATOM   9596  C  CA    . LEU D  4  54  ? -20.785 14.523  16.070  1.00 51.60  ? 115 LEU D CA    1 
ATOM   9597  C  C     . LEU D  4  54  ? -21.066 14.649  17.572  1.00 50.84  ? 115 LEU D C     1 
ATOM   9598  O  O     . LEU D  4  54  ? -22.219 14.783  17.990  1.00 50.29  ? 115 LEU D O     1 
ATOM   9599  C  CB    . LEU D  4  54  ? -20.788 13.054  15.651  1.00 52.24  ? 115 LEU D CB    1 
ATOM   9600  C  CG    . LEU D  4  54  ? -21.593 12.751  14.378  1.00 56.32  ? 115 LEU D CG    1 
ATOM   9601  C  CD1   . LEU D  4  54  ? -20.905 13.369  13.170  1.00 55.45  ? 115 LEU D CD1   1 
ATOM   9602  C  CD2   . LEU D  4  54  ? -21.734 11.243  14.190  1.00 56.09  ? 115 LEU D CD2   1 
ATOM   9603  N  N     . VAL D  4  55  ? -20.000 14.660  18.371  1.00 51.05  ? 116 VAL D N     1 
ATOM   9604  C  CA    . VAL D  4  55  ? -20.112 14.778  19.824  1.00 50.95  ? 116 VAL D CA    1 
ATOM   9605  C  C     . VAL D  4  55  ? -20.808 16.062  20.257  1.00 51.86  ? 116 VAL D C     1 
ATOM   9606  O  O     . VAL D  4  55  ? -20.372 17.165  19.920  1.00 52.69  ? 116 VAL D O     1 
ATOM   9607  C  CB    . VAL D  4  55  ? -18.736 14.739  20.495  1.00 49.35  ? 116 VAL D CB    1 
ATOM   9608  C  CG1   . VAL D  4  55  ? -18.872 15.004  21.986  1.00 45.62  ? 116 VAL D CG1   1 
ATOM   9609  C  CG2   . VAL D  4  55  ? -18.067 13.404  20.228  1.00 48.43  ? 116 VAL D CG2   1 
ATOM   9610  N  N     . GLY D  4  56  ? -21.878 15.907  21.026  1.00 51.57  ? 117 GLY D N     1 
ATOM   9611  C  CA    . GLY D  4  56  ? -22.613 17.058  21.506  1.00 50.84  ? 117 GLY D CA    1 
ATOM   9612  C  C     . GLY D  4  56  ? -23.605 17.587  20.499  1.00 51.87  ? 117 GLY D C     1 
ATOM   9613  O  O     . GLY D  4  56  ? -24.291 18.574  20.773  1.00 52.87  ? 117 GLY D O     1 
ATOM   9614  N  N     . VAL D  4  57  ? -23.685 16.939  19.336  1.00 51.29  ? 118 VAL D N     1 
ATOM   9615  C  CA    . VAL D  4  57  ? -24.609 17.370  18.293  1.00 51.70  ? 118 VAL D CA    1 
ATOM   9616  C  C     . VAL D  4  57  ? -25.701 16.341  18.089  1.00 52.70  ? 118 VAL D C     1 
ATOM   9617  O  O     . VAL D  4  57  ? -26.888 16.660  18.173  1.00 53.16  ? 118 VAL D O     1 
ATOM   9618  C  CB    . VAL D  4  57  ? -23.890 17.607  16.930  1.00 51.53  ? 118 VAL D CB    1 
ATOM   9619  C  CG1   . VAL D  4  57  ? -24.910 17.975  15.845  1.00 48.08  ? 118 VAL D CG1   1 
ATOM   9620  C  CG2   . VAL D  4  57  ? -22.843 18.707  17.065  1.00 48.71  ? 118 VAL D CG2   1 
ATOM   9621  N  N     . SER D  4  58  ? -25.288 15.106  17.830  1.00 52.41  ? 119 SER D N     1 
ATOM   9622  C  CA    . SER D  4  58  ? -26.228 14.019  17.595  1.00 54.44  ? 119 SER D CA    1 
ATOM   9623  C  C     . SER D  4  58  ? -25.907 12.748  18.402  1.00 56.96  ? 119 SER D C     1 
ATOM   9624  O  O     . SER D  4  58  ? -26.701 11.807  18.431  1.00 57.10  ? 119 SER D O     1 
ATOM   9625  C  CB    . SER D  4  58  ? -26.225 13.674  16.110  1.00 51.59  ? 119 SER D CB    1 
ATOM   9626  O  OG    . SER D  4  58  ? -24.952 13.191  15.726  1.00 49.30  ? 119 SER D OG    1 
ATOM   9627  N  N     . HIS D  4  59  ? -24.726 12.708  19.012  1.00 58.40  ? 120 HIS D N     1 
ATOM   9628  C  CA    . HIS D  4  59  ? -24.287 11.554  19.787  1.00 59.92  ? 120 HIS D CA    1 
ATOM   9629  C  C     . HIS D  4  59  ? -23.388 11.976  20.940  1.00 60.72  ? 120 HIS D C     1 
ATOM   9630  O  O     . HIS D  4  59  ? -22.845 13.080  20.940  1.00 62.09  ? 120 HIS D O     1 
ATOM   9631  C  CB    . HIS D  4  59  ? -23.517 10.584  18.891  1.00 61.01  ? 120 HIS D CB    1 
ATOM   9632  C  CG    . HIS D  4  59  ? -24.333 10.008  17.778  1.00 63.33  ? 120 HIS D CG    1 
ATOM   9633  N  ND1   . HIS D  4  59  ? -24.725 10.747  16.683  1.00 64.12  ? 120 HIS D ND1   1 
ATOM   9634  C  CD2   . HIS D  4  59  ? -24.822 8.762   17.583  1.00 64.19  ? 120 HIS D CD2   1 
ATOM   9635  C  CE1   . HIS D  4  59  ? -25.418 9.980   15.863  1.00 65.54  ? 120 HIS D CE1   1 
ATOM   9636  N  NE2   . HIS D  4  59  ? -25.491 8.770   16.385  1.00 64.09  ? 120 HIS D NE2   1 
ATOM   9637  N  N     . THR D  4  60  ? -23.237 11.095  21.925  1.00 61.17  ? 121 THR D N     1 
ATOM   9638  C  CA    . THR D  4  60  ? -22.388 11.382  23.077  1.00 61.50  ? 121 THR D CA    1 
ATOM   9639  C  C     . THR D  4  60  ? -20.938 11.102  22.724  1.00 62.42  ? 121 THR D C     1 
ATOM   9640  O  O     . THR D  4  60  ? -20.637 10.419  21.739  1.00 61.55  ? 121 THR D O     1 
ATOM   9641  C  CB    . THR D  4  60  ? -22.747 10.518  24.308  1.00 60.83  ? 121 THR D CB    1 
ATOM   9642  O  OG1   . THR D  4  60  ? -22.486 9.138   24.017  1.00 61.57  ? 121 THR D OG1   1 
ATOM   9643  C  CG2   . THR D  4  60  ? -24.206 10.697  24.691  1.00 58.54  ? 121 THR D CG2   1 
ATOM   9644  N  N     . ASN D  4  61  ? -20.044 11.600  23.568  1.00 64.13  ? 122 ASN D N     1 
ATOM   9645  C  CA    . ASN D  4  61  ? -18.618 11.416  23.374  1.00 66.31  ? 122 ASN D CA    1 
ATOM   9646  C  C     . ASN D  4  61  ? -18.295 9.925   23.290  1.00 67.57  ? 122 ASN D C     1 
ATOM   9647  O  O     . ASN D  4  61  ? -17.522 9.491   22.436  1.00 66.87  ? 122 ASN D O     1 
ATOM   9648  C  CB    . ASN D  4  61  ? -17.863 12.062  24.534  1.00 67.94  ? 122 ASN D CB    1 
ATOM   9649  C  CG    . ASN D  4  61  ? -16.383 12.176  24.267  1.00 70.78  ? 122 ASN D CG    1 
ATOM   9650  O  OD1   . ASN D  4  61  ? -15.663 11.176  24.257  1.00 72.27  ? 122 ASN D OD1   1 
ATOM   9651  N  ND2   . ASN D  4  61  ? -15.918 13.399  24.031  1.00 71.65  ? 122 ASN D ND2   1 
ATOM   9652  N  N     . GLU D  4  62  ? -18.932 9.148   24.161  1.00 69.50  ? 123 GLU D N     1 
ATOM   9653  C  CA    . GLU D  4  62  ? -18.737 7.702   24.219  1.00 70.60  ? 123 GLU D CA    1 
ATOM   9654  C  C     . GLU D  4  62  ? -19.217 7.009   22.947  1.00 69.88  ? 123 GLU D C     1 
ATOM   9655  O  O     . GLU D  4  62  ? -18.473 6.226   22.347  1.00 68.81  ? 123 GLU D O     1 
ATOM   9656  C  CB    . GLU D  4  62  ? -19.461 7.106   25.436  1.00 73.66  ? 123 GLU D CB    1 
ATOM   9657  C  CG    . GLU D  4  62  ? -18.871 7.487   26.802  1.00 78.65  ? 123 GLU D CG    1 
ATOM   9658  C  CD    . GLU D  4  62  ? -19.059 8.961   27.169  1.00 80.94  ? 123 GLU D CD    1 
ATOM   9659  O  OE1   . GLU D  4  62  ? -20.196 9.477   27.045  1.00 81.06  ? 123 GLU D OE1   1 
ATOM   9660  O  OE2   . GLU D  4  62  ? -18.065 9.598   27.593  1.00 81.75  ? 123 GLU D OE2   1 
ATOM   9661  N  N     . GLU D  4  63  ? -20.453 7.309   22.536  1.00 68.97  ? 124 GLU D N     1 
ATOM   9662  C  CA    . GLU D  4  63  ? -21.046 6.714   21.333  1.00 67.56  ? 124 GLU D CA    1 
ATOM   9663  C  C     . GLU D  4  63  ? -20.193 6.909   20.088  1.00 67.30  ? 124 GLU D C     1 
ATOM   9664  O  O     . GLU D  4  63  ? -20.015 5.976   19.302  1.00 67.19  ? 124 GLU D O     1 
ATOM   9665  C  CB    . GLU D  4  63  ? -22.429 7.294   21.061  1.00 67.11  ? 124 GLU D CB    1 
ATOM   9666  C  CG    . GLU D  4  63  ? -23.461 7.008   22.118  1.00 67.71  ? 124 GLU D CG    1 
ATOM   9667  C  CD    . GLU D  4  63  ? -24.818 7.562   21.745  1.00 68.46  ? 124 GLU D CD    1 
ATOM   9668  O  OE1   . GLU D  4  63  ? -25.592 6.835   21.084  1.00 68.23  ? 124 GLU D OE1   1 
ATOM   9669  O  OE2   . GLU D  4  63  ? -25.104 8.726   22.102  1.00 68.64  ? 124 GLU D OE2   1 
ATOM   9670  N  N     . VAL D  4  64  ? -19.680 8.124   19.905  1.00 66.08  ? 125 VAL D N     1 
ATOM   9671  C  CA    . VAL D  4  64  ? -18.853 8.427   18.746  1.00 65.93  ? 125 VAL D CA    1 
ATOM   9672  C  C     . VAL D  4  64  ? -17.534 7.670   18.807  1.00 67.00  ? 125 VAL D C     1 
ATOM   9673  O  O     . VAL D  4  64  ? -17.027 7.209   17.780  1.00 66.37  ? 125 VAL D O     1 
ATOM   9674  C  CB    . VAL D  4  64  ? -18.575 9.944   18.618  1.00 64.98  ? 125 VAL D CB    1 
ATOM   9675  C  CG1   . VAL D  4  64  ? -17.708 10.222  17.403  1.00 62.37  ? 125 VAL D CG1   1 
ATOM   9676  C  CG2   . VAL D  4  64  ? -19.881 10.706  18.508  1.00 64.31  ? 125 VAL D CG2   1 
ATOM   9677  N  N     . ARG D  4  65  ? -16.990 7.526   20.014  1.00 68.77  ? 126 ARG D N     1 
ATOM   9678  C  CA    . ARG D  4  65  ? -15.728 6.819   20.194  1.00 70.52  ? 126 ARG D CA    1 
ATOM   9679  C  C     . ARG D  4  65  ? -15.885 5.362   19.768  1.00 69.36  ? 126 ARG D C     1 
ATOM   9680  O  O     . ARG D  4  65  ? -15.029 4.824   19.069  1.00 68.06  ? 126 ARG D O     1 
ATOM   9681  C  CB    . ARG D  4  65  ? -15.242 6.932   21.645  1.00 75.12  ? 126 ARG D CB    1 
ATOM   9682  C  CG    . ARG D  4  65  ? -13.856 6.324   21.894  1.00 81.09  ? 126 ARG D CG    1 
ATOM   9683  C  CD    . ARG D  4  65  ? -13.315 6.662   23.282  1.00 85.44  ? 126 ARG D CD    1 
ATOM   9684  N  NE    . ARG D  4  65  ? -12.601 7.943   23.307  1.00 89.78  ? 126 ARG D NE    1 
ATOM   9685  C  CZ    . ARG D  4  65  ? -12.935 8.985   24.069  1.00 91.34  ? 126 ARG D CZ    1 
ATOM   9686  N  NH1   . ARG D  4  65  ? -12.216 10.101  24.023  1.00 89.94  ? 126 ARG D NH1   1 
ATOM   9687  N  NH2   . ARG D  4  65  ? -13.996 8.918   24.866  1.00 92.88  ? 126 ARG D NH2   1 
ATOM   9688  N  N     . ASN D  4  66  ? -17.007 4.749   20.141  1.00 69.37  ? 127 ASN D N     1 
ATOM   9689  C  CA    . ASN D  4  66  ? -17.278 3.360   19.771  1.00 70.32  ? 127 ASN D CA    1 
ATOM   9690  C  C     . ASN D  4  66  ? -17.424 3.224   18.260  1.00 69.79  ? 127 ASN D C     1 
ATOM   9691  O  O     . ASN D  4  66  ? -16.875 2.297   17.664  1.00 70.66  ? 127 ASN D O     1 
ATOM   9692  C  CB    . ASN D  4  66  ? -18.549 2.835   20.457  1.00 71.91  ? 127 ASN D CB    1 
ATOM   9693  C  CG    . ASN D  4  66  ? -18.389 2.694   21.968  1.00 74.00  ? 127 ASN D CG    1 
ATOM   9694  O  OD1   . ASN D  4  66  ? -19.319 2.965   22.732  1.00 74.06  ? 127 ASN D OD1   1 
ATOM   9695  N  ND2   . ASN D  4  66  ? -17.205 2.272   22.404  1.00 74.52  ? 127 ASN D ND2   1 
ATOM   9696  N  N     . MET D  4  67  ? -18.151 4.161   17.651  1.00 69.29  ? 128 MET D N     1 
ATOM   9697  C  CA    . MET D  4  67  ? -18.378 4.163   16.207  1.00 68.81  ? 128 MET D CA    1 
ATOM   9698  C  C     . MET D  4  67  ? -17.102 4.300   15.393  1.00 69.11  ? 128 MET D C     1 
ATOM   9699  O  O     . MET D  4  67  ? -16.926 3.614   14.382  1.00 68.76  ? 128 MET D O     1 
ATOM   9700  C  CB    . MET D  4  67  ? -19.334 5.283   15.812  1.00 69.87  ? 128 MET D CB    1 
ATOM   9701  C  CG    . MET D  4  67  ? -20.780 5.025   16.164  1.00 71.68  ? 128 MET D CG    1 
ATOM   9702  S  SD    . MET D  4  67  ? -21.857 6.249   15.406  1.00 74.86  ? 128 MET D SD    1 
ATOM   9703  C  CE    . MET D  4  67  ? -21.876 7.503   16.673  1.00 72.40  ? 128 MET D CE    1 
ATOM   9704  N  N     . ALA D  4  68  ? -16.217 5.192   15.831  1.00 69.14  ? 129 ALA D N     1 
ATOM   9705  C  CA    . ALA D  4  68  ? -14.953 5.427   15.140  1.00 69.74  ? 129 ALA D CA    1 
ATOM   9706  C  C     . ALA D  4  68  ? -14.003 4.235   15.213  1.00 70.98  ? 129 ALA D C     1 
ATOM   9707  O  O     . ALA D  4  68  ? -13.281 3.950   14.257  1.00 71.39  ? 129 ALA D O     1 
ATOM   9708  C  CB    . ALA D  4  68  ? -14.280 6.664   15.699  1.00 68.61  ? 129 ALA D CB    1 
ATOM   9709  N  N     . GLU D  4  69  ? -14.024 3.528   16.341  1.00 72.58  ? 130 GLU D N     1 
ATOM   9710  C  CA    . GLU D  4  69  ? -13.146 2.380   16.533  1.00 73.70  ? 130 GLU D CA    1 
ATOM   9711  C  C     . GLU D  4  69  ? -13.481 1.131   15.713  1.00 74.16  ? 130 GLU D C     1 
ATOM   9712  O  O     . GLU D  4  69  ? -12.650 0.226   15.588  1.00 74.44  ? 130 GLU D O     1 
ATOM   9713  C  CB    . GLU D  4  69  ? -13.009 2.059   18.021  1.00 74.27  ? 130 GLU D CB    1 
ATOM   9714  C  CG    . GLU D  4  69  ? -12.370 3.205   18.799  1.00 77.58  ? 130 GLU D CG    1 
ATOM   9715  C  CD    . GLU D  4  69  ? -11.812 2.789   20.147  1.00 79.37  ? 130 GLU D CD    1 
ATOM   9716  O  OE1   . GLU D  4  69  ? -12.354 3.240   21.183  1.00 79.76  ? 130 GLU D OE1   1 
ATOM   9717  O  OE2   . GLU D  4  69  ? -10.814 2.032   20.169  1.00 80.82  ? 130 GLU D OE2   1 
ATOM   9718  N  N     . GLU D  4  70  ? -14.676 1.096   15.126  1.00 73.73  ? 131 GLU D N     1 
ATOM   9719  C  CA    . GLU D  4  70  ? -15.077 -0.035  14.292  1.00 73.57  ? 131 GLU D CA    1 
ATOM   9720  C  C     . GLU D  4  70  ? -14.351 0.008   12.948  1.00 72.82  ? 131 GLU D C     1 
ATOM   9721  O  O     . GLU D  4  70  ? -14.386 -0.960  12.187  1.00 72.93  ? 131 GLU D O     1 
ATOM   9722  C  CB    . GLU D  4  70  ? -16.584 -0.019  14.040  1.00 75.38  ? 131 GLU D CB    1 
ATOM   9723  C  CG    . GLU D  4  70  ? -17.448 -0.220  15.272  1.00 78.81  ? 131 GLU D CG    1 
ATOM   9724  C  CD    . GLU D  4  70  ? -18.926 -0.277  14.927  1.00 81.88  ? 131 GLU D CD    1 
ATOM   9725  O  OE1   . GLU D  4  70  ? -19.298 -1.103  14.063  1.00 82.97  ? 131 GLU D OE1   1 
ATOM   9726  O  OE2   . GLU D  4  70  ? -19.713 0.508   15.505  1.00 82.30  ? 131 GLU D OE2   1 
ATOM   9727  N  N     . PHE D  4  71  ? -13.717 1.143   12.652  1.00 71.90  ? 132 PHE D N     1 
ATOM   9728  C  CA    . PHE D  4  71  ? -12.994 1.328   11.395  1.00 70.61  ? 132 PHE D CA    1 
ATOM   9729  C  C     . PHE D  4  71  ? -11.496 1.369   11.617  1.00 71.88  ? 132 PHE D C     1 
ATOM   9730  O  O     . PHE D  4  71  ? -11.031 1.754   12.689  1.00 72.86  ? 132 PHE D O     1 
ATOM   9731  C  CB    . PHE D  4  71  ? -13.437 2.623   10.703  1.00 68.00  ? 132 PHE D CB    1 
ATOM   9732  C  CG    . PHE D  4  71  ? -14.860 2.602   10.224  1.00 64.76  ? 132 PHE D CG    1 
ATOM   9733  C  CD1   . PHE D  4  71  ? -15.891 3.059   11.041  1.00 63.20  ? 132 PHE D CD1   1 
ATOM   9734  C  CD2   . PHE D  4  71  ? -15.173 2.120   8.959   1.00 63.38  ? 132 PHE D CD2   1 
ATOM   9735  C  CE1   . PHE D  4  71  ? -17.212 3.038   10.607  1.00 61.82  ? 132 PHE D CE1   1 
ATOM   9736  C  CE2   . PHE D  4  71  ? -16.489 2.095   8.515   1.00 63.49  ? 132 PHE D CE2   1 
ATOM   9737  C  CZ    . PHE D  4  71  ? -17.513 2.556   9.343   1.00 63.03  ? 132 PHE D CZ    1 
ATOM   9738  N  N     . GLU D  4  72  ? -10.748 0.966   10.594  1.00 72.93  ? 133 GLU D N     1 
ATOM   9739  C  CA    . GLU D  4  72  ? -9.293  0.959   10.651  1.00 74.32  ? 133 GLU D CA    1 
ATOM   9740  C  C     . GLU D  4  72  ? -8.695  2.057   9.781   1.00 73.84  ? 133 GLU D C     1 
ATOM   9741  O  O     . GLU D  4  72  ? -9.192  2.347   8.689   1.00 73.14  ? 133 GLU D O     1 
ATOM   9742  C  CB    . GLU D  4  72  ? -8.745  -0.394  10.196  1.00 78.06  ? 133 GLU D CB    1 
ATOM   9743  C  CG    . GLU D  4  72  ? -8.953  -1.538  11.181  1.00 83.20  ? 133 GLU D CG    1 
ATOM   9744  C  CD    . GLU D  4  72  ? -8.479  -2.871  10.620  1.00 86.19  ? 133 GLU D CD    1 
ATOM   9745  O  OE1   . GLU D  4  72  ? -7.258  -3.022  10.393  1.00 86.82  ? 133 GLU D OE1   1 
ATOM   9746  O  OE2   . GLU D  4  72  ? -9.332  -3.760  10.393  1.00 87.65  ? 133 GLU D OE2   1 
ATOM   9747  N  N     . TYR D  4  73  ? -7.617  2.656   10.274  1.00 73.08  ? 134 TYR D N     1 
ATOM   9748  C  CA    . TYR D  4  73  ? -6.915  3.716   9.561   1.00 72.98  ? 134 TYR D CA    1 
ATOM   9749  C  C     . TYR D  4  73  ? -5.426  3.386   9.578   1.00 74.25  ? 134 TYR D C     1 
ATOM   9750  O  O     . TYR D  4  73  ? -4.971  2.636   10.441  1.00 74.53  ? 134 TYR D O     1 
ATOM   9751  C  CB    . TYR D  4  73  ? -7.131  5.064   10.257  1.00 70.72  ? 134 TYR D CB    1 
ATOM   9752  C  CG    . TYR D  4  73  ? -8.563  5.552   10.311  1.00 67.52  ? 134 TYR D CG    1 
ATOM   9753  C  CD1   . TYR D  4  73  ? -8.977  6.636   9.540   1.00 65.82  ? 134 TYR D CD1   1 
ATOM   9754  C  CD2   . TYR D  4  73  ? -9.494  4.952   11.155  1.00 66.20  ? 134 TYR D CD2   1 
ATOM   9755  C  CE1   . TYR D  4  73  ? -10.280 7.112   9.610   1.00 64.90  ? 134 TYR D CE1   1 
ATOM   9756  C  CE2   . TYR D  4  73  ? -10.800 5.419   11.234  1.00 65.58  ? 134 TYR D CE2   1 
ATOM   9757  C  CZ    . TYR D  4  73  ? -11.188 6.502   10.460  1.00 66.17  ? 134 TYR D CZ    1 
ATOM   9758  O  OH    . TYR D  4  73  ? -12.481 6.979   10.546  1.00 65.99  ? 134 TYR D OH    1 
ATOM   9759  N  N     . ASP D  4  74  ? -4.673  3.936   8.626   1.00 75.64  ? 135 ASP D N     1 
ATOM   9760  C  CA    . ASP D  4  74  ? -3.231  3.706   8.566   1.00 77.68  ? 135 ASP D CA    1 
ATOM   9761  C  C     . ASP D  4  74  ? -2.550  4.408   9.737   1.00 78.71  ? 135 ASP D C     1 
ATOM   9762  O  O     . ASP D  4  74  ? -2.759  5.599   9.963   1.00 78.34  ? 135 ASP D O     1 
ATOM   9763  C  CB    . ASP D  4  74  ? -2.637  4.238   7.256   1.00 79.09  ? 135 ASP D CB    1 
ATOM   9764  C  CG    . ASP D  4  74  ? -3.204  3.552   6.026   1.00 81.99  ? 135 ASP D CG    1 
ATOM   9765  O  OD1   . ASP D  4  74  ? -3.248  4.203   4.956   1.00 83.36  ? 135 ASP D OD1   1 
ATOM   9766  O  OD2   . ASP D  4  74  ? -3.595  2.367   6.119   1.00 83.05  ? 135 ASP D OD2   1 
ATOM   9767  N  N     . ASP D  4  75  ? -1.760  3.658   10.497  1.00 80.57  ? 136 ASP D N     1 
ATOM   9768  C  CA    . ASP D  4  75  ? -1.040  4.213   11.636  1.00 82.08  ? 136 ASP D CA    1 
ATOM   9769