data_1PD3
# 
_entry.id   1PD3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PD3         
RCSB  RCSB019242   
WWPDB D_1000019242 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PD3 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Baudin, F.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the M1 protein-binding domain of the influenza A virus nuclear export protein (NEP/NS2).' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            22 
_citation.page_first                4646 
_citation.page_last                 4655 
_citation.year                      2003 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12970177 
_citation.pdbx_database_id_DOI      10.1093/emboj/cdg449 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Akarsu, H.'       1 
primary 'Burmeister, W.P.' 2 
primary 'Petosa, C.'       3 
primary 'Petit, I.'        4 
primary 'Muller, C.W.'     5 
primary 'Ruigrok, R.W.'    6 
primary 'Baudin, F.'       7 
# 
_cell.entry_id           1PD3 
_cell.length_a           82.691 
_cell.length_b           82.691 
_cell.length_c           61.111 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PD3 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Nonstructural protein NS2' 
_entity.formula_weight             7241.248 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Residues 59-116' 
_entity.details                    'M1-binding domain of NEP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       QNRNGKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF 
_entity_poly.pdbx_seq_one_letter_code_can   QNRNGKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLN n 
1 2  ASN n 
1 3  ARG n 
1 4  ASN n 
1 5  GLY n 
1 6  LYS n 
1 7  TRP n 
1 8  ARG n 
1 9  GLU n 
1 10 GLN n 
1 11 LEU n 
1 12 GLY n 
1 13 GLN n 
1 14 LYS n 
1 15 PHE n 
1 16 GLU n 
1 17 GLU n 
1 18 ILE n 
1 19 ARG n 
1 20 TRP n 
1 21 LEU n 
1 22 ILE n 
1 23 GLU n 
1 24 GLU n 
1 25 VAL n 
1 26 ARG n 
1 27 HIS n 
1 28 ARG n 
1 29 LEU n 
1 30 LYS n 
1 31 ILE n 
1 32 THR n 
1 33 GLU n 
1 34 ASN n 
1 35 SER n 
1 36 PHE n 
1 37 GLU n 
1 38 GLN n 
1 39 ILE n 
1 40 THR n 
1 41 PHE n 
1 42 MET n 
1 43 GLN n 
1 44 ALA n 
1 45 LEU n 
1 46 GLN n 
1 47 LEU n 
1 48 LEU n 
1 49 LEU n 
1 50 GLU n 
1 51 VAL n 
1 52 GLU n 
1 53 GLN n 
1 54 GLU n 
1 55 ILE n 
1 56 ARG n 
1 57 THR n 
1 58 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'Influenzavirus A' 
_entity_src_gen.pdbx_gene_src_gene                 NS2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Influenza A virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11320 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VNS2_IAPUE 
_struct_ref.pdbx_db_accession          P03508 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDPNTVSSFQDILMRMSKMQLGSSSEDLNGIITQFESLKLYRDSLGKAVMRMGDLHSLQNRNGKWREQLGQKFEEIRWLI
EEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTFSFQLI
;
_struct_ref.pdbx_align_begin           59 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PD3 A 1 ? 58 ? P03508 59 ? 116 ? 59 116 
2 1 1PD3 B 1 ? 58 ? P03508 59 ? 116 ? 59 116 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PD3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.62 
_exptl_crystal.density_percent_sol   73.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;PROTEIN IN 20 MM TRIS-HCL PH7.5, 150 MM NACL, HANGING DROP METHOD, ROOM TEMPERATURE, vapor diffusion, hanging drop, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-09-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1PD3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.6 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   7302 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              0.09 
_reflns.pdbx_netI_over_sigmaI        6.0 
_reflns.B_iso_Wilson_estimate        48.47 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.32 
_reflns_shell.pdbx_Rsym_value        0.32 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1PD3 
_refine.ls_number_reflns_obs                     6962 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.88 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.179 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  340 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.B_iso_mean                               43.46 
_refine.aniso_B[1][1]                            3.60000 
_refine.aniso_B[2][2]                            3.60000 
_refine.aniso_B[3][3]                            -5.40000 
_refine.aniso_B[1][2]                            1.80000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.269 
_refine.pdbx_overall_ESU_R_Free                  0.244 
_refine.overall_SU_ML                            0.162 
_refine.overall_SU_B                             7.689 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        948 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               948 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        19.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.043 0.021 ? 964  'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3.302 1.933 ? 1290 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.127 5.000 ? 106  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.188 0.200 ? 138  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.013 0.020 ? 718  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.268 0.200 ? 424  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.263 0.200 ? 31   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.323 0.200 ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.695 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.773 1.500 ? 534  'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.534 2.000 ? 864  'X-RAY DIFFRACTION' ? 
r_scbond_it              5.826 3.000 ? 430  'X-RAY DIFFRACTION' ? 
r_scangle_it             9.585 4.500 ? 426  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.67 
_refine_ls_shell.number_reflns_R_work             465 
_refine_ls_shell.R_factor_R_work                  0.225 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             23 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1PD3 
_struct.title                     'Influenza A NEP M1-binding domain' 
_struct.pdbx_descriptor           'Nonstructural protein NS2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PD3 
_struct_keywords.pdbx_keywords   'UNKNOWN FUNCTION' 
_struct_keywords.text            'influenza virus A, NEP/NS2, UNKNOWN FUNCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 2 SER A 35 ? PHE A 58 ? SER A 93 PHE A 116 1 ? 24 
HELX_P HELX_P2 3 LYS B 6  ? LEU B 29 ? LYS B 64 LEU B 87  1 ? 24 
HELX_P HELX_P3 4 SER B 35 ? THR B 57 ? SER B 93 THR B 115 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1PD3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PD3 
_atom_sites.fract_transf_matrix[1][1]   0.012093 
_atom_sites.fract_transf_matrix[1][2]   0.006982 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013964 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016364 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N   . GLY A 1 5  ? 37.780 0.014  1.898  1.00 60.80  ? 63  GLY A N   1 
ATOM 2   C CA  . GLY A 1 5  ? 36.859 -0.353 3.012  1.00 61.47  ? 63  GLY A CA  1 
ATOM 3   C C   . GLY A 1 5  ? 36.240 0.803  3.826  1.00 61.88  ? 63  GLY A C   1 
ATOM 4   O O   . GLY A 1 5  ? 36.787 1.891  3.890  1.00 62.71  ? 63  GLY A O   1 
ATOM 5   N N   . LYS A 1 6  ? 35.098 0.561  4.465  1.00 61.12  ? 64  LYS A N   1 
ATOM 6   C CA  . LYS A 1 6  ? 34.287 1.622  5.106  1.00 61.42  ? 64  LYS A CA  1 
ATOM 7   C C   . LYS A 1 6  ? 34.939 2.656  6.114  1.00 58.44  ? 64  LYS A C   1 
ATOM 8   O O   . LYS A 1 6  ? 34.519 3.816  6.231  1.00 57.35  ? 64  LYS A O   1 
ATOM 9   C CB  . LYS A 1 6  ? 32.926 1.055  5.667  1.00 61.59  ? 64  LYS A CB  1 
ATOM 10  C CG  . LYS A 1 6  ? 31.670 1.970  5.202  1.00 71.36  ? 64  LYS A CG  1 
ATOM 11  C CD  . LYS A 1 6  ? 32.028 2.828  3.808  1.00 80.55  ? 64  LYS A CD  1 
ATOM 12  C CE  . LYS A 1 6  ? 30.852 3.465  3.015  1.00 82.41  ? 64  LYS A CE  1 
ATOM 13  N NZ  . LYS A 1 6  ? 30.369 4.621  3.834  1.00 84.66  ? 64  LYS A NZ  1 
ATOM 14  N N   . TRP A 1 7  ? 35.920 2.207  6.868  1.00 55.94  ? 65  TRP A N   1 
ATOM 15  C CA  . TRP A 1 7  ? 36.529 3.090  7.849  1.00 53.53  ? 65  TRP A CA  1 
ATOM 16  C C   . TRP A 1 7  ? 37.364 4.222  7.182  1.00 50.63  ? 65  TRP A C   1 
ATOM 17  O O   . TRP A 1 7  ? 37.198 5.392  7.537  1.00 50.55  ? 65  TRP A O   1 
ATOM 18  C CB  . TRP A 1 7  ? 37.391 2.298  8.821  1.00 52.62  ? 65  TRP A CB  1 
ATOM 19  C CG  . TRP A 1 7  ? 37.863 3.137  9.966  1.00 55.36  ? 65  TRP A CG  1 
ATOM 20  C CD1 . TRP A 1 7  ? 37.107 3.665  11.080 1.00 54.08  ? 65  TRP A CD1 1 
ATOM 21  C CD2 . TRP A 1 7  ? 39.225 3.590  10.162 1.00 56.42  ? 65  TRP A CD2 1 
ATOM 22  N NE1 . TRP A 1 7  ? 37.959 4.370  11.916 1.00 56.62  ? 65  TRP A NE1 1 
ATOM 23  C CE2 . TRP A 1 7  ? 39.243 4.373  11.387 1.00 54.94  ? 65  TRP A CE2 1 
ATOM 24  C CE3 . TRP A 1 7  ? 40.426 3.471  9.391  1.00 54.11  ? 65  TRP A CE3 1 
ATOM 25  C CZ2 . TRP A 1 7  ? 40.416 4.995  11.847 1.00 53.24  ? 65  TRP A CZ2 1 
ATOM 26  C CZ3 . TRP A 1 7  ? 41.611 4.054  9.868  1.00 54.93  ? 65  TRP A CZ3 1 
ATOM 27  C CH2 . TRP A 1 7  ? 41.604 4.794  11.090 1.00 55.39  ? 65  TRP A CH2 1 
ATOM 28  N N   . ARG A 1 8  ? 38.265 3.848  6.275  1.00 47.16  ? 66  ARG A N   1 
ATOM 29  C CA  . ARG A 1 8  ? 38.977 4.783  5.453  1.00 45.03  ? 66  ARG A CA  1 
ATOM 30  C C   . ARG A 1 8  ? 38.102 5.755  4.678  1.00 45.03  ? 66  ARG A C   1 
ATOM 31  O O   . ARG A 1 8  ? 38.410 6.878  4.498  1.00 46.36  ? 66  ARG A O   1 
ATOM 32  C CB  . ARG A 1 8  ? 39.730 4.044  4.464  1.00 42.84  ? 66  ARG A CB  1 
ATOM 33  C CG  . ARG A 1 8  ? 41.077 3.704  4.949  1.00 45.45  ? 66  ARG A CG  1 
ATOM 34  C CD  . ARG A 1 8  ? 41.774 3.267  3.715  1.00 52.46  ? 66  ARG A CD  1 
ATOM 35  N NE  . ARG A 1 8  ? 43.094 2.718  3.875  1.00 60.43  ? 66  ARG A NE  1 
ATOM 36  C CZ  . ARG A 1 8  ? 43.799 2.250  2.836  1.00 71.99  ? 66  ARG A CZ  1 
ATOM 37  N NH1 . ARG A 1 8  ? 43.246 2.241  1.614  1.00 75.72  ? 66  ARG A NH1 1 
ATOM 38  N NH2 . ARG A 1 8  ? 45.040 1.728  3.002  1.00 77.08  ? 66  ARG A NH2 1 
ATOM 39  N N   . GLU A 1 9  ? 36.975 5.326  4.226  1.00 44.48  ? 67  GLU A N   1 
ATOM 40  C CA  . GLU A 1 9  ? 36.202 6.077  3.348  1.00 42.94  ? 67  GLU A CA  1 
ATOM 41  C C   . GLU A 1 9  ? 35.496 7.086  4.193  1.00 42.20  ? 67  GLU A C   1 
ATOM 42  O O   . GLU A 1 9  ? 35.315 8.212  3.779  1.00 43.13  ? 67  GLU A O   1 
ATOM 43  C CB  . GLU A 1 9  ? 35.225 5.085  2.674  1.00 44.44  ? 67  GLU A CB  1 
ATOM 44  C CG  . GLU A 1 9  ? 34.322 5.583  1.577  1.00 48.67  ? 67  GLU A CG  1 
ATOM 45  C CD  . GLU A 1 9  ? 35.134 6.257  0.471  1.00 60.49  ? 67  GLU A CD  1 
ATOM 46  O OE1 . GLU A 1 9  ? 34.606 7.379  0.061  1.00 64.34  ? 67  GLU A OE1 1 
ATOM 47  O OE2 . GLU A 1 9  ? 36.284 5.680  0.096  1.00 59.23  ? 67  GLU A OE2 1 
ATOM 48  N N   . GLN A 1 10 ? 35.070 6.706  5.386  1.00 42.62  ? 68  GLN A N   1 
ATOM 49  C CA  . GLN A 1 10 ? 34.425 7.648  6.315  1.00 41.78  ? 68  GLN A CA  1 
ATOM 50  C C   . GLN A 1 10 ? 35.427 8.667  6.862  1.00 38.61  ? 68  GLN A C   1 
ATOM 51  O O   . GLN A 1 10 ? 35.084 9.801  6.962  1.00 37.89  ? 68  GLN A O   1 
ATOM 52  C CB  . GLN A 1 10 ? 33.684 6.935  7.388  1.00 42.74  ? 68  GLN A CB  1 
ATOM 53  C CG  . GLN A 1 10 ? 32.174 6.749  7.026  1.00 53.70  ? 68  GLN A CG  1 
ATOM 54  C CD  . GLN A 1 10 ? 31.361 6.331  8.336  1.00 70.69  ? 68  GLN A CD  1 
ATOM 55  O OE1 . GLN A 1 10 ? 31.306 7.144  9.351  1.00 75.49  ? 68  GLN A OE1 1 
ATOM 56  N NE2 . GLN A 1 10 ? 30.799 5.067  8.351  1.00 67.54  ? 68  GLN A NE2 1 
ATOM 57  N N   . LEU A 1 11 ? 36.660 8.285  7.126  1.00 36.40  ? 69  LEU A N   1 
ATOM 58  C CA  . LEU A 1 11 ? 37.663 9.252  7.549  1.00 37.97  ? 69  LEU A CA  1 
ATOM 59  C C   . LEU A 1 11 ? 37.864 10.321 6.447  1.00 38.35  ? 69  LEU A C   1 
ATOM 60  O O   . LEU A 1 11 ? 37.710 11.528 6.732  1.00 37.94  ? 69  LEU A O   1 
ATOM 61  C CB  . LEU A 1 11 ? 39.048 8.648  7.769  1.00 36.77  ? 69  LEU A CB  1 
ATOM 62  C CG  . LEU A 1 11 ? 39.237 8.224  9.154  1.00 36.90  ? 69  LEU A CG  1 
ATOM 63  C CD1 . LEU A 1 11 ? 40.605 7.695  9.135  1.00 34.90  ? 69  LEU A CD1 1 
ATOM 64  C CD2 . LEU A 1 11 ? 39.110 9.437  10.084 1.00 35.72  ? 69  LEU A CD2 1 
ATOM 65  N N   . GLY A 1 12 ? 38.187 9.837  5.225  1.00 36.18  ? 70  GLY A N   1 
ATOM 66  C CA  . GLY A 1 12 ? 38.385 10.645 4.091  1.00 35.00  ? 70  GLY A CA  1 
ATOM 67  C C   . GLY A 1 12 ? 37.171 11.506 3.964  1.00 35.86  ? 70  GLY A C   1 
ATOM 68  O O   . GLY A 1 12 ? 37.305 12.565 3.520  1.00 37.19  ? 70  GLY A O   1 
ATOM 69  N N   . GLN A 1 13 ? 35.973 11.136 4.372  1.00 36.21  ? 71  GLN A N   1 
ATOM 70  C CA  . GLN A 1 13 ? 34.901 12.126 4.149  1.00 36.74  ? 71  GLN A CA  1 
ATOM 71  C C   . GLN A 1 13 ? 34.954 13.245 5.218  1.00 35.45  ? 71  GLN A C   1 
ATOM 72  O O   . GLN A 1 13 ? 34.613 14.443 4.966  1.00 36.42  ? 71  GLN A O   1 
ATOM 73  C CB  . GLN A 1 13 ? 33.464 11.523 4.050  1.00 36.89  ? 71  GLN A CB  1 
ATOM 74  C CG  . GLN A 1 13 ? 33.108 10.624 2.802  1.00 49.96  ? 71  GLN A CG  1 
ATOM 75  C CD  . GLN A 1 13 ? 32.014 9.334  3.090  1.00 67.38  ? 71  GLN A CD  1 
ATOM 76  O OE1 . GLN A 1 13 ? 31.183 9.321  4.102  1.00 67.85  ? 71  GLN A OE1 1 
ATOM 77  N NE2 . GLN A 1 13 ? 32.055 8.288  2.160  1.00 71.29  ? 71  GLN A NE2 1 
ATOM 78  N N   . LYS A 1 14 ? 35.386 12.874 6.405  1.00 31.95  ? 72  LYS A N   1 
ATOM 79  C CA  . LYS A 1 14 ? 35.536 13.830 7.436  1.00 31.54  ? 72  LYS A CA  1 
ATOM 80  C C   . LYS A 1 14 ? 36.653 14.784 7.038  1.00 30.63  ? 72  LYS A C   1 
ATOM 81  O O   . LYS A 1 14 ? 36.511 15.983 7.216  1.00 29.25  ? 72  LYS A O   1 
ATOM 82  C CB  . LYS A 1 14 ? 35.770 13.132 8.781  1.00 32.80  ? 72  LYS A CB  1 
ATOM 83  C CG  . LYS A 1 14 ? 34.465 12.460 9.223  1.00 33.68  ? 72  LYS A CG  1 
ATOM 84  C CD  . LYS A 1 14 ? 34.438 11.931 10.592 1.00 43.67  ? 72  LYS A CD  1 
ATOM 85  C CE  . LYS A 1 14 ? 33.046 11.355 10.883 1.00 44.76  ? 72  LYS A CE  1 
ATOM 86  N NZ  . LYS A 1 14 ? 33.243 9.961  11.390 1.00 45.68  ? 72  LYS A NZ  1 
ATOM 87  N N   . PHE A 1 15 ? 37.705 14.307 6.393  1.00 30.16  ? 73  PHE A N   1 
ATOM 88  C CA  . PHE A 1 15 ? 38.779 15.237 5.985  1.00 30.33  ? 73  PHE A CA  1 
ATOM 89  C C   . PHE A 1 15 ? 38.356 16.249 4.936  1.00 29.73  ? 73  PHE A C   1 
ATOM 90  O O   . PHE A 1 15 ? 38.637 17.450 5.029  1.00 30.86  ? 73  PHE A O   1 
ATOM 91  C CB  . PHE A 1 15 ? 40.017 14.541 5.585  1.00 30.04  ? 73  PHE A CB  1 
ATOM 92  C CG  . PHE A 1 15 ? 40.757 14.037 6.709  1.00 35.43  ? 73  PHE A CG  1 
ATOM 93  C CD1 . PHE A 1 15 ? 40.914 12.710 6.877  1.00 47.17  ? 73  PHE A CD1 1 
ATOM 94  C CD2 . PHE A 1 15 ? 41.419 14.897 7.534  1.00 50.24  ? 73  PHE A CD2 1 
ATOM 95  C CE1 . PHE A 1 15 ? 41.633 12.203 7.856  1.00 49.22  ? 73  PHE A CE1 1 
ATOM 96  C CE2 . PHE A 1 15 ? 42.151 14.408 8.583  1.00 56.43  ? 73  PHE A CE2 1 
ATOM 97  C CZ  . PHE A 1 15 ? 42.242 13.017 8.714  1.00 54.94  ? 73  PHE A CZ  1 
ATOM 98  N N   . GLU A 1 16 ? 37.635 15.792 3.965  1.00 26.97  ? 74  GLU A N   1 
ATOM 99  C CA  . GLU A 1 16 ? 37.058 16.671 3.021  1.00 28.77  ? 74  GLU A CA  1 
ATOM 100 C C   . GLU A 1 16 ? 36.158 17.672 3.659  1.00 28.27  ? 74  GLU A C   1 
ATOM 101 O O   . GLU A 1 16 ? 36.131 18.777 3.226  1.00 31.07  ? 74  GLU A O   1 
ATOM 102 C CB  . GLU A 1 16 ? 36.133 15.803 2.234  1.00 30.17  ? 74  GLU A CB  1 
ATOM 103 C CG  . GLU A 1 16 ? 36.159 15.805 0.763  1.00 35.07  ? 74  GLU A CG  1 
ATOM 104 C CD  . GLU A 1 16 ? 37.366 16.381 0.060  1.00 40.17  ? 74  GLU A CD  1 
ATOM 105 O OE1 . GLU A 1 16 ? 38.400 15.662 0.002  1.00 37.98  ? 74  GLU A OE1 1 
ATOM 106 O OE2 . GLU A 1 16 ? 37.216 17.544 -0.507 1.00 44.52  ? 74  GLU A OE2 1 
ATOM 107 N N   . GLU A 1 17 ? 35.366 17.311 4.655  1.00 27.23  ? 75  GLU A N   1 
ATOM 108 C CA  . GLU A 1 17 ? 34.505 18.277 5.280  1.00 26.58  ? 75  GLU A CA  1 
ATOM 109 C C   . GLU A 1 17 ? 35.233 19.377 6.149  1.00 26.82  ? 75  GLU A C   1 
ATOM 110 O O   . GLU A 1 17 ? 34.899 20.640 6.093  1.00 26.33  ? 75  GLU A O   1 
ATOM 111 C CB  . GLU A 1 17 ? 33.554 17.482 6.155  1.00 28.27  ? 75  GLU A CB  1 
ATOM 112 C CG  . GLU A 1 17 ? 32.606 18.376 6.976  1.00 30.29  ? 75  GLU A CG  1 
ATOM 113 C CD  . GLU A 1 17 ? 31.623 19.204 6.130  1.00 35.91  ? 75  GLU A CD  1 
ATOM 114 O OE1 . GLU A 1 17 ? 31.441 18.968 4.899  1.00 42.04  ? 75  GLU A OE1 1 
ATOM 115 O OE2 . GLU A 1 17 ? 31.058 20.171 6.662  1.00 43.08  ? 75  GLU A OE2 1 
ATOM 116 N N   . ILE A 1 18 ? 36.235 18.925 6.949  1.00 24.77  ? 76  ILE A N   1 
ATOM 117 C CA  . ILE A 1 18 ? 37.148 19.817 7.660  1.00 22.70  ? 76  ILE A CA  1 
ATOM 118 C C   . ILE A 1 18 ? 37.801 20.848 6.689  1.00 23.47  ? 76  ILE A C   1 
ATOM 119 O O   . ILE A 1 18 ? 37.843 22.145 6.980  1.00 22.55  ? 76  ILE A O   1 
ATOM 120 C CB  . ILE A 1 18 ? 38.230 19.083 8.312  1.00 21.32  ? 76  ILE A CB  1 
ATOM 121 C CG1 . ILE A 1 18 ? 37.665 18.108 9.369  1.00 23.07  ? 76  ILE A CG1 1 
ATOM 122 C CG2 . ILE A 1 18 ? 39.160 20.078 8.998  1.00 19.98  ? 76  ILE A CG2 1 
ATOM 123 C CD1 . ILE A 1 18 ? 38.803 17.118 10.036 1.00 22.24  ? 76  ILE A CD1 1 
ATOM 124 N N   . ARG A 1 19 ? 38.239 20.326 5.533  1.00 21.74  ? 77  ARG A N   1 
ATOM 125 C CA  . ARG A 1 19 ? 38.975 21.210 4.595  1.00 22.59  ? 77  ARG A CA  1 
ATOM 126 C C   . ARG A 1 19 ? 37.982 22.166 4.061  1.00 22.54  ? 77  ARG A C   1 
ATOM 127 O O   . ARG A 1 19 ? 38.202 23.382 4.095  1.00 25.17  ? 77  ARG A O   1 
ATOM 128 C CB  . ARG A 1 19 ? 39.726 20.496 3.502  1.00 20.81  ? 77  ARG A CB  1 
ATOM 129 C CG  . ARG A 1 19 ? 40.611 21.395 2.652  1.00 22.59  ? 77  ARG A CG  1 
ATOM 130 C CD  . ARG A 1 19 ? 41.443 20.511 1.585  1.00 20.57  ? 77  ARG A CD  1 
ATOM 131 N NE  . ARG A 1 19 ? 40.488 20.167 0.569  1.00 27.60  ? 77  ARG A NE  1 
ATOM 132 C CZ  . ARG A 1 19 ? 39.856 19.059 0.301  1.00 28.23  ? 77  ARG A CZ  1 
ATOM 133 N NH1 . ARG A 1 19 ? 40.125 17.878 0.927  1.00 34.24  ? 77  ARG A NH1 1 
ATOM 134 N NH2 . ARG A 1 19 ? 39.014 19.138 -0.733 1.00 26.19  ? 77  ARG A NH2 1 
ATOM 135 N N   . TRP A 1 20 ? 36.829 21.657 3.678  1.00 23.88  ? 78  TRP A N   1 
ATOM 136 C CA  . TRP A 1 20 ? 35.807 22.549 3.193  1.00 25.25  ? 78  TRP A CA  1 
ATOM 137 C C   . TRP A 1 20 ? 35.426 23.615 4.248  1.00 25.54  ? 78  TRP A C   1 
ATOM 138 O O   . TRP A 1 20 ? 35.480 24.791 3.918  1.00 27.37  ? 78  TRP A O   1 
ATOM 139 C CB  . TRP A 1 20 ? 34.608 21.776 2.814  1.00 24.97  ? 78  TRP A CB  1 
ATOM 140 C CG  . TRP A 1 20 ? 33.366 22.672 2.600  1.00 25.97  ? 78  TRP A CG  1 
ATOM 141 C CD1 . TRP A 1 20 ? 32.201 22.649 3.331  1.00 26.85  ? 78  TRP A CD1 1 
ATOM 142 C CD2 . TRP A 1 20 ? 33.125 23.577 1.508  1.00 25.35  ? 78  TRP A CD2 1 
ATOM 143 N NE1 . TRP A 1 20 ? 31.289 23.522 2.788  1.00 27.46  ? 78  TRP A NE1 1 
ATOM 144 C CE2 . TRP A 1 20 ? 31.821 24.111 1.680  1.00 27.52  ? 78  TRP A CE2 1 
ATOM 145 C CE3 . TRP A 1 20 ? 33.840 23.923 0.338  1.00 26.52  ? 78  TRP A CE3 1 
ATOM 146 C CZ2 . TRP A 1 20 ? 31.237 25.061 0.745  1.00 29.41  ? 78  TRP A CZ2 1 
ATOM 147 C CZ3 . TRP A 1 20 ? 33.351 24.951 -0.512 1.00 28.37  ? 78  TRP A CZ3 1 
ATOM 148 C CH2 . TRP A 1 20 ? 32.047 25.507 -0.307 1.00 27.46  ? 78  TRP A CH2 1 
ATOM 149 N N   . LEU A 1 21 ? 35.148 23.279 5.508  1.00 24.28  ? 79  LEU A N   1 
ATOM 150 C CA  . LEU A 1 21 ? 34.888 24.373 6.456  1.00 23.72  ? 79  LEU A CA  1 
ATOM 151 C C   . LEU A 1 21 ? 36.060 25.328 6.615  1.00 25.12  ? 79  LEU A C   1 
ATOM 152 O O   . LEU A 1 21 ? 35.889 26.514 6.832  1.00 27.36  ? 79  LEU A O   1 
ATOM 153 C CB  . LEU A 1 21 ? 34.670 23.737 7.813  1.00 25.51  ? 79  LEU A CB  1 
ATOM 154 C CG  . LEU A 1 21 ? 33.522 22.672 7.873  1.00 25.01  ? 79  LEU A CG  1 
ATOM 155 C CD1 . LEU A 1 21 ? 33.664 21.821 9.040  1.00 19.09  ? 79  LEU A CD1 1 
ATOM 156 C CD2 . LEU A 1 21 ? 32.163 23.412 7.900  1.00 19.98  ? 79  LEU A CD2 1 
ATOM 157 N N   . ILE A 1 22 ? 37.302 24.840 6.558  1.00 23.89  ? 80  ILE A N   1 
ATOM 158 C CA  . ILE A 1 22 ? 38.338 25.772 6.584  1.00 22.00  ? 80  ILE A CA  1 
ATOM 159 C C   . ILE A 1 22 ? 38.400 26.686 5.400  1.00 23.94  ? 80  ILE A C   1 
ATOM 160 O O   . ILE A 1 22 ? 38.721 27.845 5.589  1.00 24.66  ? 80  ILE A O   1 
ATOM 161 C CB  . ILE A 1 22 ? 39.598 25.090 6.908  1.00 22.41  ? 80  ILE A CB  1 
ATOM 162 C CG1 . ILE A 1 22 ? 39.570 24.719 8.389  1.00 19.50  ? 80  ILE A CG1 1 
ATOM 163 C CG2 . ILE A 1 22 ? 40.859 25.972 6.727  1.00 18.65  ? 80  ILE A CG2 1 
ATOM 164 C CD1 . ILE A 1 22 ? 40.641 23.615 8.207  1.00 34.18  ? 80  ILE A CD1 1 
ATOM 165 N N   . GLU A 1 23 ? 38.143 26.210 4.192  1.00 24.38  ? 81  GLU A N   1 
ATOM 166 C CA  . GLU A 1 23 ? 38.150 27.115 3.037  1.00 26.17  ? 81  GLU A CA  1 
ATOM 167 C C   . GLU A 1 23 ? 37.052 28.235 3.129  1.00 28.45  ? 81  GLU A C   1 
ATOM 168 O O   . GLU A 1 23 ? 37.248 29.335 2.665  1.00 30.99  ? 81  GLU A O   1 
ATOM 169 C CB  . GLU A 1 23 ? 37.774 26.317 1.804  1.00 25.11  ? 81  GLU A CB  1 
ATOM 170 C CG  . GLU A 1 23 ? 38.815 25.335 1.529  1.00 24.87  ? 81  GLU A CG  1 
ATOM 171 C CD  . GLU A 1 23 ? 40.070 25.953 0.848  1.00 29.60  ? 81  GLU A CD  1 
ATOM 172 O OE1 . GLU A 1 23 ? 40.409 27.184 0.963  1.00 30.67  ? 81  GLU A OE1 1 
ATOM 173 O OE2 . GLU A 1 23 ? 40.766 25.175 0.180  1.00 27.79  ? 81  GLU A OE2 1 
ATOM 174 N N   . GLU A 1 24 ? 35.894 27.908 3.671  1.00 26.29  ? 82  GLU A N   1 
ATOM 175 C CA  . GLU A 1 24 ? 34.858 28.782 3.769  1.00 27.37  ? 82  GLU A CA  1 
ATOM 176 C C   . GLU A 1 24 ? 35.182 29.896 4.804  1.00 29.97  ? 82  GLU A C   1 
ATOM 177 O O   . GLU A 1 24 ? 34.893 31.135 4.606  1.00 30.06  ? 82  GLU A O   1 
ATOM 178 C CB  . GLU A 1 24 ? 33.713 27.991 4.387  1.00 27.60  ? 82  GLU A CB  1 
ATOM 179 C CG  . GLU A 1 24 ? 33.064 27.009 3.521  1.00 25.26  ? 82  GLU A CG  1 
ATOM 180 C CD  . GLU A 1 24 ? 31.748 26.665 4.164  1.00 36.60  ? 82  GLU A CD  1 
ATOM 181 O OE1 . GLU A 1 24 ? 31.691 25.865 5.132  1.00 31.43  ? 82  GLU A OE1 1 
ATOM 182 O OE2 . GLU A 1 24 ? 30.735 27.244 3.697  1.00 42.97  ? 82  GLU A OE2 1 
ATOM 183 N N   . VAL A 1 25 ? 35.661 29.510 5.953  1.00 29.08  ? 83  VAL A N   1 
ATOM 184 C CA  . VAL A 1 25 ? 36.027 30.623 6.780  1.00 31.71  ? 83  VAL A CA  1 
ATOM 185 C C   . VAL A 1 25 ? 37.169 31.373 6.046  1.00 33.14  ? 83  VAL A C   1 
ATOM 186 O O   . VAL A 1 25 ? 37.112 32.555 6.134  1.00 37.80  ? 83  VAL A O   1 
ATOM 187 C CB  . VAL A 1 25 ? 36.270 30.332 8.392  1.00 32.29  ? 83  VAL A CB  1 
ATOM 188 C CG1 . VAL A 1 25 ? 35.288 29.261 8.987  1.00 31.16  ? 83  VAL A CG1 1 
ATOM 189 C CG2 . VAL A 1 25 ? 37.507 29.692 8.664  1.00 32.89  ? 83  VAL A CG2 1 
ATOM 190 N N   . ARG A 1 26 ? 38.160 30.794 5.331  1.00 31.04  ? 84  ARG A N   1 
ATOM 191 C CA  . ARG A 1 26 ? 39.230 31.638 4.734  1.00 30.40  ? 84  ARG A CA  1 
ATOM 192 C C   . ARG A 1 26 ? 38.619 32.580 3.637  1.00 32.28  ? 84  ARG A C   1 
ATOM 193 O O   . ARG A 1 26 ? 39.169 33.658 3.363  1.00 33.23  ? 84  ARG A O   1 
ATOM 194 C CB  . ARG A 1 26 ? 40.369 30.789 4.072  1.00 28.40  ? 84  ARG A CB  1 
ATOM 195 C CG  . ARG A 1 26 ? 41.143 31.472 3.075  1.00 22.80  ? 84  ARG A CG  1 
ATOM 196 C CD  . ARG A 1 26 ? 41.945 32.543 3.720  1.00 30.33  ? 84  ARG A CD  1 
ATOM 197 N NE  . ARG A 1 26 ? 42.751 33.365 2.778  1.00 32.40  ? 84  ARG A NE  1 
ATOM 198 C CZ  . ARG A 1 26 ? 42.374 34.529 2.206  1.00 33.96  ? 84  ARG A CZ  1 
ATOM 199 N NH1 . ARG A 1 26 ? 41.174 35.147 2.457  1.00 27.16  ? 84  ARG A NH1 1 
ATOM 200 N NH2 . ARG A 1 26 ? 43.248 35.084 1.364  1.00 36.86  ? 84  ARG A NH2 1 
ATOM 201 N N   . HIS A 1 27 ? 37.532 32.139 3.019  1.00 31.36  ? 85  HIS A N   1 
ATOM 202 C CA  . HIS A 1 27 ? 36.978 32.817 1.923  1.00 34.90  ? 85  HIS A CA  1 
ATOM 203 C C   . HIS A 1 27 ? 36.283 34.063 2.403  1.00 36.00  ? 85  HIS A C   1 
ATOM 204 O O   . HIS A 1 27 ? 36.269 35.075 1.738  1.00 39.18  ? 85  HIS A O   1 
ATOM 205 C CB  . HIS A 1 27 ? 36.049 31.910 1.183  1.00 35.47  ? 85  HIS A CB  1 
ATOM 206 C CG  . HIS A 1 27 ? 35.135 32.610 0.192  1.00 41.38  ? 85  HIS A CG  1 
ATOM 207 N ND1 . HIS A 1 27 ? 35.583 33.167 -1.006 1.00 39.06  ? 85  HIS A ND1 1 
ATOM 208 C CD2 . HIS A 1 27 ? 33.782 32.762 0.201  1.00 37.87  ? 85  HIS A CD2 1 
ATOM 209 C CE1 . HIS A 1 27 ? 34.554 33.664 -1.656 1.00 37.17  ? 85  HIS A CE1 1 
ATOM 210 N NE2 . HIS A 1 27 ? 33.451 33.412 -0.956 1.00 39.88  ? 85  HIS A NE2 1 
ATOM 211 N N   . ARG A 1 28 ? 35.744 34.034 3.578  1.00 36.16  ? 86  ARG A N   1 
ATOM 212 C CA  . ARG A 1 28 ? 35.168 35.243 4.134  1.00 36.58  ? 86  ARG A CA  1 
ATOM 213 C C   . ARG A 1 28 ? 36.197 36.216 4.628  1.00 38.38  ? 86  ARG A C   1 
ATOM 214 O O   . ARG A 1 28 ? 35.831 37.205 5.110  1.00 39.68  ? 86  ARG A O   1 
ATOM 215 C CB  . ARG A 1 28 ? 34.184 34.912 5.257  1.00 33.93  ? 86  ARG A CB  1 
ATOM 216 C CG  . ARG A 1 28 ? 33.187 34.294 4.562  1.00 33.45  ? 86  ARG A CG  1 
ATOM 217 C CD  . ARG A 1 28 ? 31.973 34.435 5.033  1.00 38.85  ? 86  ARG A CD  1 
ATOM 218 N NE  . ARG A 1 28 ? 31.029 33.551 4.381  1.00 36.71  ? 86  ARG A NE  1 
ATOM 219 C CZ  . ARG A 1 28 ? 29.769 33.622 4.787  1.00 40.47  ? 86  ARG A CZ  1 
ATOM 220 N NH1 . ARG A 1 28 ? 29.455 34.579 5.704  1.00 32.32  ? 86  ARG A NH1 1 
ATOM 221 N NH2 . ARG A 1 28 ? 28.839 32.799 4.323  1.00 39.26  ? 86  ARG A NH2 1 
ATOM 222 N N   . LEU A 1 29 ? 37.480 35.952 4.576  1.00 40.15  ? 87  LEU A N   1 
ATOM 223 C CA  . LEU A 1 29 ? 38.372 36.953 5.098  1.00 40.50  ? 87  LEU A CA  1 
ATOM 224 C C   . LEU A 1 29 ? 38.982 37.735 3.966  1.00 44.68  ? 87  LEU A C   1 
ATOM 225 O O   . LEU A 1 29 ? 39.015 37.258 2.799  1.00 46.28  ? 87  LEU A O   1 
ATOM 226 C CB  . LEU A 1 29 ? 39.432 36.321 5.904  1.00 37.16  ? 87  LEU A CB  1 
ATOM 227 C CG  . LEU A 1 29 ? 38.880 35.455 7.017  1.00 36.14  ? 87  LEU A CG  1 
ATOM 228 C CD1 . LEU A 1 29 ? 40.088 34.687 7.750  1.00 25.60  ? 87  LEU A CD1 1 
ATOM 229 C CD2 . LEU A 1 29 ? 38.150 36.321 7.977  1.00 30.40  ? 87  LEU A CD2 1 
ATOM 230 N N   . LYS A 1 30 ? 39.448 38.949 4.274  1.00 48.38  ? 88  LYS A N   1 
ATOM 231 C CA  . LYS A 1 30 ? 40.119 39.768 3.270  1.00 51.18  ? 88  LYS A CA  1 
ATOM 232 C C   . LYS A 1 30 ? 41.351 40.093 4.020  1.00 51.78  ? 88  LYS A C   1 
ATOM 233 O O   . LYS A 1 30 ? 41.302 40.907 5.001  1.00 52.08  ? 88  LYS A O   1 
ATOM 234 C CB  . LYS A 1 30 ? 39.351 41.081 3.021  1.00 52.43  ? 88  LYS A CB  1 
ATOM 235 C CG  . LYS A 1 30 ? 38.202 40.964 2.066  1.00 60.17  ? 88  LYS A CG  1 
ATOM 236 C CD  . LYS A 1 30 ? 38.578 40.225 0.726  1.00 70.11  ? 88  LYS A CD  1 
ATOM 237 C CE  . LYS A 1 30 ? 37.251 39.834 -0.037 1.00 75.09  ? 88  LYS A CE  1 
ATOM 238 N NZ  . LYS A 1 30 ? 37.430 39.654 -1.551 1.00 78.69  ? 88  LYS A NZ  1 
ATOM 239 N N   . ILE A 1 31 ? 42.430 39.421 3.589  1.00 51.76  ? 89  ILE A N   1 
ATOM 240 C CA  . ILE A 1 31 ? 43.740 39.440 4.270  1.00 49.91  ? 89  ILE A CA  1 
ATOM 241 C C   . ILE A 1 31 ? 44.847 39.423 3.204  1.00 50.43  ? 89  ILE A C   1 
ATOM 242 O O   . ILE A 1 31 ? 44.605 39.022 2.099  1.00 51.14  ? 89  ILE A O   1 
ATOM 243 C CB  . ILE A 1 31 ? 43.905 38.206 5.225  1.00 49.35  ? 89  ILE A CB  1 
ATOM 244 C CG1 . ILE A 1 31 ? 43.396 36.939 4.565  1.00 45.60  ? 89  ILE A CG1 1 
ATOM 245 C CG2 . ILE A 1 31 ? 43.250 38.428 6.544  1.00 44.31  ? 89  ILE A CG2 1 
ATOM 246 C CD1 . ILE A 1 31 ? 44.017 35.613 5.122  1.00 45.96  ? 89  ILE A CD1 1 
ATOM 247 N N   . THR A 1 32 ? 46.054 39.812 3.560  1.00 50.22  ? 90  THR A N   1 
ATOM 248 C CA  . THR A 1 32 ? 47.112 39.968 2.591  1.00 50.82  ? 90  THR A CA  1 
ATOM 249 C C   . THR A 1 32 ? 47.934 38.722 2.489  1.00 52.84  ? 90  THR A C   1 
ATOM 250 O O   . THR A 1 32 ? 48.009 37.916 3.439  1.00 54.13  ? 90  THR A O   1 
ATOM 251 C CB  . THR A 1 32 ? 48.066 41.219 2.950  1.00 51.74  ? 90  THR A CB  1 
ATOM 252 O OG1 . THR A 1 32 ? 48.918 40.961 4.109  1.00 43.64  ? 90  THR A OG1 1 
ATOM 253 C CG2 . THR A 1 32 ? 47.179 42.540 3.187  1.00 50.02  ? 90  THR A CG2 1 
ATOM 254 N N   . GLU A 1 33 ? 48.661 38.638 1.403  1.00 53.61  ? 91  GLU A N   1 
ATOM 255 C CA  . GLU A 1 33 ? 49.317 37.433 0.995  1.00 55.77  ? 91  GLU A CA  1 
ATOM 256 C C   . GLU A 1 33 ? 50.488 37.142 1.822  1.00 54.56  ? 91  GLU A C   1 
ATOM 257 O O   . GLU A 1 33 ? 51.012 36.041 1.754  1.00 56.10  ? 91  GLU A O   1 
ATOM 258 C CB  . GLU A 1 33 ? 49.827 37.613 -0.437 1.00 58.94  ? 91  GLU A CB  1 
ATOM 259 C CG  . GLU A 1 33 ? 49.975 36.270 -1.189 1.00 74.16  ? 91  GLU A CG  1 
ATOM 260 C CD  . GLU A 1 33 ? 48.687 35.262 -1.280 1.00 85.96  ? 91  GLU A CD  1 
ATOM 261 O OE1 . GLU A 1 33 ? 47.474 35.486 -0.776 1.00 83.94  ? 91  GLU A OE1 1 
ATOM 262 O OE2 . GLU A 1 33 ? 48.945 34.163 -1.940 1.00 92.02  ? 91  GLU A OE2 1 
ATOM 263 N N   . ASN A 1 34 ? 51.014 38.105 2.554  1.00 52.62  ? 92  ASN A N   1 
ATOM 264 C CA  . ASN A 1 34 ? 52.039 37.702 3.472  1.00 50.39  ? 92  ASN A CA  1 
ATOM 265 C C   . ASN A 1 34 ? 51.683 37.905 4.946  1.00 46.27  ? 92  ASN A C   1 
ATOM 266 O O   . ASN A 1 34 ? 52.604 37.879 5.765  1.00 43.57  ? 92  ASN A O   1 
ATOM 267 C CB  . ASN A 1 34 ? 53.347 38.415 3.140  1.00 54.23  ? 92  ASN A CB  1 
ATOM 268 C CG  . ASN A 1 34 ? 54.480 37.434 2.788  1.00 62.70  ? 92  ASN A CG  1 
ATOM 269 O OD1 . ASN A 1 34 ? 54.723 36.413 3.494  1.00 68.99  ? 92  ASN A OD1 1 
ATOM 270 N ND2 . ASN A 1 34 ? 55.126 37.687 1.613  1.00 72.96  ? 92  ASN A ND2 1 
ATOM 271 N N   . SER A 1 35 ? 50.383 38.098 5.256  1.00 42.58  ? 93  SER A N   1 
ATOM 272 C CA  . SER A 1 35 ? 49.905 38.064 6.632  1.00 41.26  ? 93  SER A CA  1 
ATOM 273 C C   . SER A 1 35 ? 50.282 36.795 7.357  1.00 40.91  ? 93  SER A C   1 
ATOM 274 O O   . SER A 1 35 ? 50.354 35.695 6.787  1.00 40.85  ? 93  SER A O   1 
ATOM 275 C CB  . SER A 1 35 ? 48.424 38.308 6.757  1.00 41.12  ? 93  SER A CB  1 
ATOM 276 O OG  . SER A 1 35 ? 47.580 37.361 6.130  1.00 46.66  ? 93  SER A OG  1 
ATOM 277 N N   . PHE A 1 36 ? 50.579 36.896 8.633  1.00 39.42  ? 94  PHE A N   1 
ATOM 278 C CA  . PHE A 1 36 ? 50.667 35.674 9.338  1.00 37.53  ? 94  PHE A CA  1 
ATOM 279 C C   . PHE A 1 36 ? 49.317 34.828 9.147  1.00 37.93  ? 94  PHE A C   1 
ATOM 280 O O   . PHE A 1 36 ? 49.220 33.566 9.092  1.00 35.82  ? 94  PHE A O   1 
ATOM 281 C CB  . PHE A 1 36 ? 50.895 36.041 10.737 1.00 35.19  ? 94  PHE A CB  1 
ATOM 282 C CG  . PHE A 1 36 ? 50.685 34.926 11.682 1.00 31.82  ? 94  PHE A CG  1 
ATOM 283 C CD1 . PHE A 1 36 ? 51.736 34.064 12.102 1.00 25.67  ? 94  PHE A CD1 1 
ATOM 284 C CD2 . PHE A 1 36 ? 49.364 34.735 12.159 1.00 32.19  ? 94  PHE A CD2 1 
ATOM 285 C CE1 . PHE A 1 36 ? 51.460 33.011 13.109 1.00 29.45  ? 94  PHE A CE1 1 
ATOM 286 C CE2 . PHE A 1 36 ? 49.052 33.759 13.050 1.00 29.23  ? 94  PHE A CE2 1 
ATOM 287 C CZ  . PHE A 1 36 ? 50.117 32.904 13.607 1.00 23.70  ? 94  PHE A CZ  1 
ATOM 288 N N   . GLU A 1 37 ? 48.245 35.531 9.035  1.00 36.94  ? 95  GLU A N   1 
ATOM 289 C CA  . GLU A 1 37 ? 47.095 34.761 8.879  1.00 38.67  ? 95  GLU A CA  1 
ATOM 290 C C   . GLU A 1 37 ? 46.876 33.834 7.592  1.00 37.64  ? 95  GLU A C   1 
ATOM 291 O O   . GLU A 1 37 ? 46.393 32.676 7.689  1.00 34.48  ? 95  GLU A O   1 
ATOM 292 C CB  . GLU A 1 37 ? 46.069 35.777 8.903  1.00 40.71  ? 95  GLU A CB  1 
ATOM 293 C CG  . GLU A 1 37 ? 44.802 35.155 9.220  1.00 50.66  ? 95  GLU A CG  1 
ATOM 294 C CD  . GLU A 1 37 ? 44.366 35.661 10.509 1.00 64.99  ? 95  GLU A CD  1 
ATOM 295 O OE1 . GLU A 1 37 ? 44.492 36.963 10.705 1.00 71.48  ? 95  GLU A OE1 1 
ATOM 296 O OE2 . GLU A 1 37 ? 43.906 34.720 11.261 1.00 73.04  ? 95  GLU A OE2 1 
ATOM 297 N N   . GLN A 1 38 ? 47.091 34.442 6.415  1.00 35.58  ? 96  GLN A N   1 
ATOM 298 C CA  . GLN A 1 38 ? 47.247 33.776 5.191  1.00 34.07  ? 96  GLN A CA  1 
ATOM 299 C C   . GLN A 1 38 ? 48.298 32.660 5.267  1.00 34.30  ? 96  GLN A C   1 
ATOM 300 O O   . GLN A 1 38 ? 48.017 31.521 4.897  1.00 35.10  ? 96  GLN A O   1 
ATOM 301 C CB  . GLN A 1 38 ? 47.636 34.788 4.161  1.00 33.44  ? 96  GLN A CB  1 
ATOM 302 C CG  . GLN A 1 38 ? 48.001 34.150 2.876  1.00 35.67  ? 96  GLN A CG  1 
ATOM 303 C CD  . GLN A 1 38 ? 46.812 33.428 2.143  1.00 40.79  ? 96  GLN A CD  1 
ATOM 304 O OE1 . GLN A 1 38 ? 45.624 33.734 2.370  1.00 48.21  ? 96  GLN A OE1 1 
ATOM 305 N NE2 . GLN A 1 38 ? 47.151 32.554 1.194  1.00 34.55  ? 96  GLN A NE2 1 
ATOM 306 N N   . ILE A 1 39 ? 49.505 32.940 5.742  1.00 32.37  ? 97  ILE A N   1 
ATOM 307 C CA  . ILE A 1 39 ? 50.511 31.903 5.809  1.00 30.93  ? 97  ILE A CA  1 
ATOM 308 C C   . ILE A 1 39 ? 50.004 30.719 6.660  1.00 32.51  ? 97  ILE A C   1 
ATOM 309 O O   . ILE A 1 39 ? 50.243 29.564 6.285  1.00 35.80  ? 97  ILE A O   1 
ATOM 310 C CB  . ILE A 1 39 ? 51.784 32.471 6.388  1.00 31.48  ? 97  ILE A CB  1 
ATOM 311 C CG1 . ILE A 1 39 ? 52.419 33.457 5.414  1.00 32.76  ? 97  ILE A CG1 1 
ATOM 312 C CG2 . ILE A 1 39 ? 52.851 31.417 6.892  1.00 28.01  ? 97  ILE A CG2 1 
ATOM 313 C CD1 . ILE A 1 39 ? 53.670 34.311 6.128  1.00 32.58  ? 97  ILE A CD1 1 
ATOM 314 N N   . THR A 1 40 ? 49.307 30.984 7.789  1.00 32.00  ? 98  THR A N   1 
ATOM 315 C CA  . THR A 1 40 ? 48.807 29.975 8.697  1.00 29.14  ? 98  THR A CA  1 
ATOM 316 C C   . THR A 1 40 ? 47.690 29.152 8.029  1.00 29.00  ? 98  THR A C   1 
ATOM 317 O O   . THR A 1 40 ? 47.864 27.962 7.994  1.00 28.85  ? 98  THR A O   1 
ATOM 318 C CB  . THR A 1 40 ? 48.509 30.580 9.950  1.00 30.02  ? 98  THR A CB  1 
ATOM 319 O OG1 . THR A 1 40 ? 49.728 31.125 10.440 1.00 30.97  ? 98  THR A OG1 1 
ATOM 320 C CG2 . THR A 1 40 ? 48.192 29.494 11.114 1.00 33.12  ? 98  THR A CG2 1 
ATOM 321 N N   . PHE A 1 41 ? 46.748 29.744 7.302  1.00 28.52  ? 99  PHE A N   1 
ATOM 322 C CA  . PHE A 1 41 ? 45.747 29.014 6.554  1.00 30.64  ? 99  PHE A CA  1 
ATOM 323 C C   . PHE A 1 41 ? 46.334 28.114 5.500  1.00 32.48  ? 99  PHE A C   1 
ATOM 324 O O   . PHE A 1 41 ? 45.980 26.954 5.468  1.00 33.05  ? 99  PHE A O   1 
ATOM 325 C CB  . PHE A 1 41 ? 44.827 29.925 5.813  1.00 28.85  ? 99  PHE A CB  1 
ATOM 326 C CG  . PHE A 1 41 ? 43.594 30.273 6.616  1.00 34.83  ? 99  PHE A CG  1 
ATOM 327 C CD1 . PHE A 1 41 ? 43.467 31.546 7.256  1.00 34.43  ? 99  PHE A CD1 1 
ATOM 328 C CD2 . PHE A 1 41 ? 42.553 29.355 6.784  1.00 38.05  ? 99  PHE A CD2 1 
ATOM 329 C CE1 . PHE A 1 41 ? 42.348 31.888 8.008  1.00 31.06  ? 99  PHE A CE1 1 
ATOM 330 C CE2 . PHE A 1 41 ? 41.345 29.711 7.562  1.00 35.62  ? 99  PHE A CE2 1 
ATOM 331 C CZ  . PHE A 1 41 ? 41.267 30.962 8.173  1.00 32.34  ? 99  PHE A CZ  1 
ATOM 332 N N   . MET A 1 42 ? 47.293 28.593 4.718  1.00 33.65  ? 100 MET A N   1 
ATOM 333 C CA  . MET A 1 42 ? 47.967 27.744 3.720  1.00 34.89  ? 100 MET A CA  1 
ATOM 334 C C   . MET A 1 42 ? 48.646 26.573 4.343  1.00 33.28  ? 100 MET A C   1 
ATOM 335 O O   . MET A 1 42 ? 48.597 25.460 3.854  1.00 30.55  ? 100 MET A O   1 
ATOM 336 C CB  . MET A 1 42 ? 48.999 28.523 2.945  1.00 34.88  ? 100 MET A CB  1 
ATOM 337 C CG  . MET A 1 42 ? 48.177 29.297 1.926  1.00 42.27  ? 100 MET A CG  1 
ATOM 338 S SD  . MET A 1 42 ? 49.273 29.996 0.749  1.00 56.29  ? 100 MET A SD  1 
ATOM 339 C CE  . MET A 1 42 ? 49.862 31.538 1.577  1.00 55.68  ? 100 MET A CE  1 
ATOM 340 N N   . GLN A 1 43 ? 49.226 26.810 5.501  1.00 31.99  ? 101 GLN A N   1 
ATOM 341 C CA  . GLN A 1 43 ? 49.979 25.755 6.066  1.00 30.63  ? 101 GLN A CA  1 
ATOM 342 C C   . GLN A 1 43 ? 49.003 24.675 6.609  1.00 29.17  ? 101 GLN A C   1 
ATOM 343 O O   . GLN A 1 43 ? 49.292 23.512 6.527  1.00 28.66  ? 101 GLN A O   1 
ATOM 344 C CB  . GLN A 1 43 ? 50.853 26.483 7.031  1.00 31.28  ? 101 GLN A CB  1 
ATOM 345 C CG  . GLN A 1 43 ? 51.952 25.781 7.759  1.00 41.34  ? 101 GLN A CG  1 
ATOM 346 C CD  . GLN A 1 43 ? 52.680 26.822 8.770  1.00 53.27  ? 101 GLN A CD  1 
ATOM 347 O OE1 . GLN A 1 43 ? 52.736 28.077 8.469  1.00 50.97  ? 101 GLN A OE1 1 
ATOM 348 N NE2 . GLN A 1 43 ? 53.151 26.302 9.989  1.00 51.30  ? 101 GLN A NE2 1 
ATOM 349 N N   . ALA A 1 44 ? 47.790 25.067 7.063  1.00 27.13  ? 102 ALA A N   1 
ATOM 350 C CA  . ALA A 1 44 ? 46.861 24.153 7.599  1.00 24.37  ? 102 ALA A CA  1 
ATOM 351 C C   . ALA A 1 44 ? 46.279 23.378 6.451  1.00 24.78  ? 102 ALA A C   1 
ATOM 352 O O   . ALA A 1 44 ? 46.045 22.194 6.599  1.00 24.79  ? 102 ALA A O   1 
ATOM 353 C CB  . ALA A 1 44 ? 45.800 24.858 8.301  1.00 23.83  ? 102 ALA A CB  1 
ATOM 354 N N   . LEU A 1 45 ? 45.929 24.037 5.338  1.00 24.29  ? 103 LEU A N   1 
ATOM 355 C CA  . LEU A 1 45 ? 45.343 23.393 4.200  1.00 23.51  ? 103 LEU A CA  1 
ATOM 356 C C   . LEU A 1 45 ? 46.337 22.365 3.666  1.00 25.70  ? 103 LEU A C   1 
ATOM 357 O O   . LEU A 1 45 ? 45.979 21.184 3.402  1.00 27.10  ? 103 LEU A O   1 
ATOM 358 C CB  . LEU A 1 45 ? 45.030 24.370 3.139  1.00 23.17  ? 103 LEU A CB  1 
ATOM 359 C CG  . LEU A 1 45 ? 43.809 25.112 3.692  1.00 24.24  ? 103 LEU A CG  1 
ATOM 360 C CD1 . LEU A 1 45 ? 43.663 26.405 2.812  1.00 28.01  ? 103 LEU A CD1 1 
ATOM 361 C CD2 . LEU A 1 45 ? 42.560 24.311 3.646  1.00 19.78  ? 103 LEU A CD2 1 
ATOM 362 N N   . GLN A 1 46 ? 47.587 22.737 3.572  1.00 24.59  ? 104 GLN A N   1 
ATOM 363 C CA  . GLN A 1 46 ? 48.552 21.772 3.103  1.00 25.80  ? 104 GLN A CA  1 
ATOM 364 C C   . GLN A 1 46 ? 48.684 20.590 3.981  1.00 27.13  ? 104 GLN A C   1 
ATOM 365 O O   . GLN A 1 46 ? 48.905 19.487 3.439  1.00 26.25  ? 104 GLN A O   1 
ATOM 366 C CB  . GLN A 1 46 ? 49.957 22.355 2.797  1.00 24.00  ? 104 GLN A CB  1 
ATOM 367 C CG  . GLN A 1 46 ? 49.788 23.483 1.809  1.00 24.97  ? 104 GLN A CG  1 
ATOM 368 C CD  . GLN A 1 46 ? 51.072 24.209 1.470  1.00 33.15  ? 104 GLN A CD  1 
ATOM 369 O OE1 . GLN A 1 46 ? 51.531 25.068 2.249  1.00 40.71  ? 104 GLN A OE1 1 
ATOM 370 N NE2 . GLN A 1 46 ? 51.675 23.890 0.309  1.00 35.70  ? 104 GLN A NE2 1 
ATOM 371 N N   . LEU A 1 47 ? 48.603 20.797 5.300  1.00 28.29  ? 105 LEU A N   1 
ATOM 372 C CA  . LEU A 1 47 ? 48.881 19.710 6.225  1.00 29.50  ? 105 LEU A CA  1 
ATOM 373 C C   . LEU A 1 47 ? 47.712 18.727 6.191  1.00 29.66  ? 105 LEU A C   1 
ATOM 374 O O   . LEU A 1 47 ? 47.896 17.536 6.120  1.00 30.98  ? 105 LEU A O   1 
ATOM 375 C CB  . LEU A 1 47 ? 49.040 20.286 7.534  1.00 29.77  ? 105 LEU A CB  1 
ATOM 376 C CG  . LEU A 1 47 ? 49.701 19.384 8.528  1.00 36.84  ? 105 LEU A CG  1 
ATOM 377 C CD1 . LEU A 1 47 ? 50.987 18.705 8.025  1.00 37.90  ? 105 LEU A CD1 1 
ATOM 378 C CD2 . LEU A 1 47 ? 49.982 20.432 9.624  1.00 38.66  ? 105 LEU A CD2 1 
ATOM 379 N N   . LEU A 1 48 ? 46.534 19.279 6.033  1.00 28.45  ? 106 LEU A N   1 
ATOM 380 C CA  . LEU A 1 48 ? 45.316 18.608 5.881  1.00 28.12  ? 106 LEU A CA  1 
ATOM 381 C C   . LEU A 1 48 ? 45.255 17.788 4.602  1.00 29.05  ? 106 LEU A C   1 
ATOM 382 O O   . LEU A 1 48 ? 44.826 16.699 4.711  1.00 28.55  ? 106 LEU A O   1 
ATOM 383 C CB  . LEU A 1 48 ? 44.279 19.691 5.878  1.00 27.38  ? 106 LEU A CB  1 
ATOM 384 C CG  . LEU A 1 48 ? 42.934 19.382 6.452  1.00 31.95  ? 106 LEU A CG  1 
ATOM 385 C CD1 . LEU A 1 48 ? 42.909 18.431 7.643  1.00 25.37  ? 106 LEU A CD1 1 
ATOM 386 C CD2 . LEU A 1 48 ? 42.233 20.682 6.787  1.00 32.78  ? 106 LEU A CD2 1 
ATOM 387 N N   . LEU A 1 49 ? 45.649 18.305 3.394  1.00 29.13  ? 107 LEU A N   1 
ATOM 388 C CA  . LEU A 1 49 ? 45.790 17.505 2.156  1.00 27.94  ? 107 LEU A CA  1 
ATOM 389 C C   . LEU A 1 49 ? 46.775 16.369 2.316  1.00 30.19  ? 107 LEU A C   1 
ATOM 390 O O   . LEU A 1 49 ? 46.566 15.248 1.845  1.00 31.14  ? 107 LEU A O   1 
ATOM 391 C CB  . LEU A 1 49 ? 46.183 18.303 0.963  1.00 24.65  ? 107 LEU A CB  1 
ATOM 392 C CG  . LEU A 1 49 ? 44.890 19.140 0.643  1.00 28.72  ? 107 LEU A CG  1 
ATOM 393 C CD1 . LEU A 1 49 ? 45.159 20.392 -0.144 1.00 12.77  ? 107 LEU A CD1 1 
ATOM 394 C CD2 . LEU A 1 49 ? 43.704 18.370 -0.072 1.00 30.16  ? 107 LEU A CD2 1 
ATOM 395 N N   . GLU A 1 50 ? 47.835 16.624 3.030  1.00 32.80  ? 108 GLU A N   1 
ATOM 396 C CA  . GLU A 1 50 ? 48.880 15.652 3.174  1.00 35.91  ? 108 GLU A CA  1 
ATOM 397 C C   . GLU A 1 50 ? 48.356 14.526 4.069  1.00 36.47  ? 108 GLU A C   1 
ATOM 398 O O   . GLU A 1 50 ? 48.486 13.346 3.730  1.00 37.20  ? 108 GLU A O   1 
ATOM 399 C CB  . GLU A 1 50 ? 50.119 16.279 3.744  1.00 35.40  ? 108 GLU A CB  1 
ATOM 400 C CG  . GLU A 1 50 ? 51.160 15.269 4.083  1.00 46.75  ? 108 GLU A CG  1 
ATOM 401 C CD  . GLU A 1 50 ? 52.284 15.852 4.949  1.00 64.68  ? 108 GLU A CD  1 
ATOM 402 O OE1 . GLU A 1 50 ? 52.538 17.107 4.862  1.00 70.45  ? 108 GLU A OE1 1 
ATOM 403 O OE2 . GLU A 1 50 ? 52.926 15.076 5.754  1.00 71.56  ? 108 GLU A OE2 1 
ATOM 404 N N   . VAL A 1 51 ? 47.648 14.879 5.121  1.00 35.62  ? 109 VAL A N   1 
ATOM 405 C CA  . VAL A 1 51 ? 47.137 13.850 5.971  1.00 35.20  ? 109 VAL A CA  1 
ATOM 406 C C   . VAL A 1 51 ? 46.065 12.970 5.263  1.00 35.87  ? 109 VAL A C   1 
ATOM 407 O O   . VAL A 1 51 ? 46.053 11.796 5.427  1.00 35.34  ? 109 VAL A O   1 
ATOM 408 C CB  . VAL A 1 51 ? 46.634 14.476 7.215  1.00 34.70  ? 109 VAL A CB  1 
ATOM 409 C CG1 . VAL A 1 51 ? 45.726 13.599 7.877  1.00 34.72  ? 109 VAL A CG1 1 
ATOM 410 C CG2 . VAL A 1 51 ? 47.793 14.848 8.127  1.00 33.94  ? 109 VAL A CG2 1 
ATOM 411 N N   . GLU A 1 52 ? 45.131 13.552 4.539  1.00 37.00  ? 110 GLU A N   1 
ATOM 412 C CA  . GLU A 1 52 ? 44.202 12.869 3.708  1.00 36.79  ? 110 GLU A CA  1 
ATOM 413 C C   . GLU A 1 52 ? 44.978 12.039 2.648  1.00 37.84  ? 110 GLU A C   1 
ATOM 414 O O   . GLU A 1 52 ? 44.623 10.931 2.385  1.00 36.77  ? 110 GLU A O   1 
ATOM 415 C CB  . GLU A 1 52 ? 43.369 13.934 3.039  1.00 37.03  ? 110 GLU A CB  1 
ATOM 416 C CG  . GLU A 1 52 ? 42.197 13.381 2.276  1.00 41.05  ? 110 GLU A CG  1 
ATOM 417 C CD  . GLU A 1 52 ? 41.088 14.403 1.986  1.00 48.41  ? 110 GLU A CD  1 
ATOM 418 O OE1 . GLU A 1 52 ? 41.301 15.670 2.277  1.00 46.48  ? 110 GLU A OE1 1 
ATOM 419 O OE2 . GLU A 1 52 ? 40.013 13.927 1.419  1.00 46.90  ? 110 GLU A OE2 1 
ATOM 420 N N   . GLN A 1 53 ? 46.068 12.491 2.056  1.00 39.35  ? 111 GLN A N   1 
ATOM 421 C CA  . GLN A 1 53 ? 46.772 11.510 1.206  1.00 41.91  ? 111 GLN A CA  1 
ATOM 422 C C   . GLN A 1 53 ? 47.300 10.291 1.956  1.00 41.98  ? 111 GLN A C   1 
ATOM 423 O O   . GLN A 1 53 ? 47.432 9.223  1.394  1.00 43.64  ? 111 GLN A O   1 
ATOM 424 C CB  . GLN A 1 53 ? 47.973 12.111 0.505  1.00 42.54  ? 111 GLN A CB  1 
ATOM 425 C CG  . GLN A 1 53 ? 47.661 13.349 -0.301 1.00 51.19  ? 111 GLN A CG  1 
ATOM 426 C CD  . GLN A 1 53 ? 47.138 12.988 -1.667 1.00 60.63  ? 111 GLN A CD  1 
ATOM 427 O OE1 . GLN A 1 53 ? 46.444 11.984 -1.746 1.00 61.80  ? 111 GLN A OE1 1 
ATOM 428 N NE2 . GLN A 1 53 ? 47.433 13.803 -2.748 1.00 56.61  ? 111 GLN A NE2 1 
ATOM 429 N N   . GLU A 1 54 ? 47.725 10.489 3.189  1.00 40.69  ? 112 GLU A N   1 
ATOM 430 C CA  . GLU A 1 54 ? 48.338 9.461  3.933  1.00 41.17  ? 112 GLU A CA  1 
ATOM 431 C C   . GLU A 1 54 ? 47.290 8.395  4.353  1.00 42.24  ? 112 GLU A C   1 
ATOM 432 O O   . GLU A 1 54 ? 47.558 7.183  4.354  1.00 42.77  ? 112 GLU A O   1 
ATOM 433 C CB  . GLU A 1 54 ? 48.957 10.046 5.164  1.00 40.18  ? 112 GLU A CB  1 
ATOM 434 C CG  . GLU A 1 54 ? 50.404 10.376 5.090  1.00 47.63  ? 112 GLU A CG  1 
ATOM 435 C CD  . GLU A 1 54 ? 50.868 10.937 6.475  1.00 58.97  ? 112 GLU A CD  1 
ATOM 436 O OE1 . GLU A 1 54 ? 50.713 10.163 7.475  1.00 61.42  ? 112 GLU A OE1 1 
ATOM 437 O OE2 . GLU A 1 54 ? 51.370 12.131 6.605  1.00 58.09  ? 112 GLU A OE2 1 
ATOM 438 N N   . ILE A 1 55 ? 46.100 8.828  4.744  1.00 41.85  ? 113 ILE A N   1 
ATOM 439 C CA  . ILE A 1 55 ? 45.064 7.894  4.976  1.00 41.09  ? 113 ILE A CA  1 
ATOM 440 C C   . ILE A 1 55 ? 44.684 7.104  3.725  1.00 43.82  ? 113 ILE A C   1 
ATOM 441 O O   . ILE A 1 55 ? 44.251 5.961  3.837  1.00 44.82  ? 113 ILE A O   1 
ATOM 442 C CB  . ILE A 1 55 ? 43.997 8.628  5.503  1.00 39.16  ? 113 ILE A CB  1 
ATOM 443 C CG1 . ILE A 1 55 ? 44.351 8.928  6.931  1.00 40.55  ? 113 ILE A CG1 1 
ATOM 444 C CG2 . ILE A 1 55 ? 42.788 7.870  5.562  1.00 35.79  ? 113 ILE A CG2 1 
ATOM 445 C CD1 . ILE A 1 55 ? 43.356 9.983  7.325  1.00 45.76  ? 113 ILE A CD1 1 
ATOM 446 N N   . ARG A 1 56 ? 44.871 7.673  2.540  1.00 44.90  ? 114 ARG A N   1 
ATOM 447 C CA  . ARG A 1 56 ? 44.462 7.025  1.343  1.00 46.40  ? 114 ARG A CA  1 
ATOM 448 C C   . ARG A 1 56 ? 45.490 5.946  1.081  1.00 49.34  ? 114 ARG A C   1 
ATOM 449 O O   . ARG A 1 56 ? 45.218 4.962  0.448  1.00 49.44  ? 114 ARG A O   1 
ATOM 450 C CB  . ARG A 1 56 ? 44.481 8.014  0.220  1.00 45.38  ? 114 ARG A CB  1 
ATOM 451 C CG  . ARG A 1 56 ? 43.562 7.706  -0.828 1.00 43.24  ? 114 ARG A CG  1 
ATOM 452 C CD  . ARG A 1 56 ? 43.635 8.688  -1.940 1.00 40.56  ? 114 ARG A CD  1 
ATOM 453 N NE  . ARG A 1 56 ? 44.747 8.287  -2.772 1.00 55.77  ? 114 ARG A NE  1 
ATOM 454 C CZ  . ARG A 1 56 ? 45.734 9.144  -3.082 1.00 59.42  ? 114 ARG A CZ  1 
ATOM 455 N NH1 . ARG A 1 56 ? 45.600 10.392 -2.593 1.00 58.75  ? 114 ARG A NH1 1 
ATOM 456 N NH2 . ARG A 1 56 ? 46.808 8.805  -3.861 1.00 51.58  ? 114 ARG A NH2 1 
ATOM 457 N N   . THR A 1 57 ? 46.677 6.107  1.606  1.00 53.00  ? 115 THR A N   1 
ATOM 458 C CA  . THR A 1 57 ? 47.825 5.362  1.091  1.00 56.39  ? 115 THR A CA  1 
ATOM 459 C C   . THR A 1 57 ? 48.304 4.312  2.027  1.00 59.20  ? 115 THR A C   1 
ATOM 460 O O   . THR A 1 57 ? 49.109 3.510  1.628  1.00 60.53  ? 115 THR A O   1 
ATOM 461 C CB  . THR A 1 57 ? 48.918 6.405  0.779  1.00 57.47  ? 115 THR A CB  1 
ATOM 462 O OG1 . THR A 1 57 ? 48.795 6.711  -0.631 1.00 57.20  ? 115 THR A OG1 1 
ATOM 463 C CG2 . THR A 1 57 ? 50.524 5.999  1.229  1.00 55.79  ? 115 THR A CG2 1 
ATOM 464 N N   . PHE A 1 58 ? 47.841 4.378  3.281  1.00 62.10  ? 116 PHE A N   1 
ATOM 465 C CA  . PHE A 1 58 ? 47.963 3.361  4.314  1.00 65.30  ? 116 PHE A CA  1 
ATOM 466 C C   . PHE A 1 58 ? 47.720 1.919  3.716  1.00 66.75  ? 116 PHE A C   1 
ATOM 467 O O   . PHE A 1 58 ? 48.192 0.859  4.234  1.00 69.06  ? 116 PHE A O   1 
ATOM 468 C CB  . PHE A 1 58 ? 46.937 3.756  5.404  1.00 65.88  ? 116 PHE A CB  1 
ATOM 469 C CG  . PHE A 1 58 ? 47.011 2.968  6.698  1.00 72.10  ? 116 PHE A CG  1 
ATOM 470 C CD1 . PHE A 1 58 ? 48.228 2.849  7.442  1.00 80.90  ? 116 PHE A CD1 1 
ATOM 471 C CD2 . PHE A 1 58 ? 45.847 2.385  7.216  1.00 76.05  ? 116 PHE A CD2 1 
ATOM 472 C CE1 . PHE A 1 58 ? 48.282 2.100  8.706  1.00 83.58  ? 116 PHE A CE1 1 
ATOM 473 C CE2 . PHE A 1 58 ? 45.855 1.655  8.455  1.00 80.93  ? 116 PHE A CE2 1 
ATOM 474 C CZ  . PHE A 1 58 ? 47.063 1.513  9.217  1.00 83.88  ? 116 PHE A CZ  1 
ATOM 475 N N   . GLY B 1 5  ? 52.163 0.509  16.444 1.00 101.12 ? 63  GLY B N   1 
ATOM 476 C CA  . GLY B 1 5  ? 52.793 1.149  15.256 1.00 100.74 ? 63  GLY B CA  1 
ATOM 477 C C   . GLY B 1 5  ? 52.953 2.681  15.386 1.00 100.42 ? 63  GLY B C   1 
ATOM 478 O O   . GLY B 1 5  ? 52.039 3.406  15.849 1.00 99.75  ? 63  GLY B O   1 
ATOM 479 N N   . LYS B 1 6  ? 54.136 3.149  14.939 1.00 99.25  ? 64  LYS B N   1 
ATOM 480 C CA  . LYS B 1 6  ? 54.546 4.568  14.701 1.00 97.01  ? 64  LYS B CA  1 
ATOM 481 C C   . LYS B 1 6  ? 53.670 5.427  13.685 1.00 94.09  ? 64  LYS B C   1 
ATOM 482 O O   . LYS B 1 6  ? 53.914 6.638  13.482 1.00 93.76  ? 64  LYS B O   1 
ATOM 483 C CB  . LYS B 1 6  ? 56.045 4.525  14.273 1.00 97.63  ? 64  LYS B CB  1 
ATOM 484 C CG  . LYS B 1 6  ? 56.902 5.835  14.360 1.00 101.78 ? 64  LYS B CG  1 
ATOM 485 C CD  . LYS B 1 6  ? 58.326 5.663  15.093 1.00 108.39 ? 64  LYS B CD  1 
ATOM 486 C CE  . LYS B 1 6  ? 59.560 6.447  14.409 1.00 110.01 ? 64  LYS B CE  1 
ATOM 487 N NZ  . LYS B 1 6  ? 59.800 7.892  14.871 1.00 111.88 ? 64  LYS B NZ  1 
ATOM 488 N N   . TRP B 1 7  ? 52.674 4.800  13.051 1.00 90.09  ? 65  TRP B N   1 
ATOM 489 C CA  . TRP B 1 7  ? 51.742 5.494  12.121 1.00 87.03  ? 65  TRP B CA  1 
ATOM 490 C C   . TRP B 1 7  ? 50.737 6.351  12.913 1.00 82.76  ? 65  TRP B C   1 
ATOM 491 O O   . TRP B 1 7  ? 50.436 7.479  12.561 1.00 82.46  ? 65  TRP B O   1 
ATOM 492 C CB  . TRP B 1 7  ? 50.962 4.495  11.207 1.00 87.73  ? 65  TRP B CB  1 
ATOM 493 C CG  . TRP B 1 7  ? 50.212 3.267  11.972 1.00 91.09  ? 65  TRP B CG  1 
ATOM 494 C CD1 . TRP B 1 7  ? 50.775 2.063  12.447 1.00 92.59  ? 65  TRP B CD1 1 
ATOM 495 C CD2 . TRP B 1 7  ? 48.802 3.183  12.283 1.00 91.85  ? 65  TRP B CD2 1 
ATOM 496 N NE1 . TRP B 1 7  ? 49.798 1.299  13.040 1.00 92.20  ? 65  TRP B NE1 1 
ATOM 497 C CE2 . TRP B 1 7  ? 48.587 1.946  12.951 1.00 89.83  ? 65  TRP B CE2 1 
ATOM 498 C CE3 . TRP B 1 7  ? 47.688 4.039  12.057 1.00 92.10  ? 65  TRP B CE3 1 
ATOM 499 C CZ2 . TRP B 1 7  ? 47.321 1.547  13.399 1.00 91.13  ? 65  TRP B CZ2 1 
ATOM 500 C CZ3 . TRP B 1 7  ? 46.409 3.630  12.509 1.00 92.66  ? 65  TRP B CZ3 1 
ATOM 501 C CH2 . TRP B 1 7  ? 46.242 2.386  13.163 1.00 91.83  ? 65  TRP B CH2 1 
ATOM 502 N N   . ARG B 1 8  ? 50.245 5.775  13.989 1.00 77.51  ? 66  ARG B N   1 
ATOM 503 C CA  . ARG B 1 8  ? 49.319 6.390  14.884 1.00 73.51  ? 66  ARG B CA  1 
ATOM 504 C C   . ARG B 1 8  ? 49.894 7.620  15.534 1.00 70.34  ? 66  ARG B C   1 
ATOM 505 O O   . ARG B 1 8  ? 49.210 8.592  15.914 1.00 70.15  ? 66  ARG B O   1 
ATOM 506 C CB  . ARG B 1 8  ? 49.052 5.413  15.981 1.00 73.75  ? 66  ARG B CB  1 
ATOM 507 C CG  . ARG B 1 8  ? 47.640 5.040  16.083 1.00 76.39  ? 66  ARG B CG  1 
ATOM 508 C CD  . ARG B 1 8  ? 47.421 3.847  16.974 1.00 80.71  ? 66  ARG B CD  1 
ATOM 509 N NE  . ARG B 1 8  ? 46.287 3.079  16.509 1.00 82.76  ? 66  ARG B NE  1 
ATOM 510 C CZ  . ARG B 1 8  ? 45.693 2.211  17.256 1.00 86.20  ? 66  ARG B CZ  1 
ATOM 511 N NH1 . ARG B 1 8  ? 46.175 2.038  18.491 1.00 89.51  ? 66  ARG B NH1 1 
ATOM 512 N NH2 . ARG B 1 8  ? 44.636 1.522  16.796 1.00 86.66  ? 66  ARG B NH2 1 
ATOM 513 N N   . GLU B 1 9  ? 51.174 7.536  15.691 1.00 66.66  ? 67  GLU B N   1 
ATOM 514 C CA  . GLU B 1 9  ? 51.859 8.526  16.365 1.00 63.87  ? 67  GLU B CA  1 
ATOM 515 C C   . GLU B 1 9  ? 52.275 9.582  15.396 1.00 61.60  ? 67  GLU B C   1 
ATOM 516 O O   . GLU B 1 9  ? 52.406 10.700 15.773 1.00 61.50  ? 67  GLU B O   1 
ATOM 517 C CB  . GLU B 1 9  ? 53.043 7.900  17.048 1.00 63.97  ? 67  GLU B CB  1 
ATOM 518 C CG  . GLU B 1 9  ? 53.708 8.852  18.025 1.00 68.82  ? 67  GLU B CG  1 
ATOM 519 C CD  . GLU B 1 9  ? 52.841 9.195  19.270 1.00 74.22  ? 67  GLU B CD  1 
ATOM 520 O OE1 . GLU B 1 9  ? 52.026 8.328  19.738 1.00 76.72  ? 67  GLU B OE1 1 
ATOM 521 O OE2 . GLU B 1 9  ? 52.982 10.351 19.773 1.00 73.58  ? 67  GLU B OE2 1 
ATOM 522 N N   . GLN B 1 10 ? 52.528 9.284  14.137 1.00 60.05  ? 68  GLN B N   1 
ATOM 523 C CA  . GLN B 1 10 ? 52.894 10.407 13.260 1.00 57.46  ? 68  GLN B CA  1 
ATOM 524 C C   . GLN B 1 10 ? 51.622 11.197 12.876 1.00 52.58  ? 68  GLN B C   1 
ATOM 525 O O   . GLN B 1 10 ? 51.626 12.412 12.751 1.00 49.85  ? 68  GLN B O   1 
ATOM 526 C CB  . GLN B 1 10 ? 53.677 9.933  12.027 1.00 59.20  ? 68  GLN B CB  1 
ATOM 527 C CG  . GLN B 1 10 ? 55.197 10.379 12.059 1.00 67.07  ? 68  GLN B CG  1 
ATOM 528 C CD  . GLN B 1 10 ? 56.113 9.442  11.160 1.00 77.91  ? 68  GLN B CD  1 
ATOM 529 O OE1 . GLN B 1 10 ? 55.834 9.254  9.936  1.00 81.46  ? 68  GLN B OE1 1 
ATOM 530 N NE2 . GLN B 1 10 ? 57.163 8.840  11.775 1.00 77.93  ? 68  GLN B NE2 1 
ATOM 531 N N   . LEU B 1 11 ? 50.538 10.463 12.714 1.00 47.91  ? 69  LEU B N   1 
ATOM 532 C CA  . LEU B 1 11 ? 49.335 11.028 12.271 1.00 45.51  ? 69  LEU B CA  1 
ATOM 533 C C   . LEU B 1 11 ? 48.750 11.962 13.372 1.00 46.25  ? 69  LEU B C   1 
ATOM 534 O O   . LEU B 1 11 ? 48.409 13.107 13.085 1.00 46.43  ? 69  LEU B O   1 
ATOM 535 C CB  . LEU B 1 11 ? 48.436 9.904  11.946 1.00 44.52  ? 69  LEU B CB  1 
ATOM 536 C CG  . LEU B 1 11 ? 47.543 9.981  10.728 1.00 44.86  ? 69  LEU B CG  1 
ATOM 537 C CD1 . LEU B 1 11 ? 48.195 10.469 9.528  1.00 38.33  ? 69  LEU B CD1 1 
ATOM 538 C CD2 . LEU B 1 11 ? 47.124 8.537  10.508 1.00 48.04  ? 69  LEU B CD2 1 
ATOM 539 N N   . GLY B 1 12 ? 48.665 11.493 14.629 1.00 45.00  ? 70  GLY B N   1 
ATOM 540 C CA  . GLY B 1 12 ? 48.345 12.343 15.722 1.00 42.80  ? 70  GLY B CA  1 
ATOM 541 C C   . GLY B 1 12 ? 49.192 13.587 15.828 1.00 43.23  ? 70  GLY B C   1 
ATOM 542 O O   . GLY B 1 12 ? 48.663 14.602 16.219 1.00 45.76  ? 70  GLY B O   1 
ATOM 543 N N   . GLN B 1 13 ? 50.469 13.590 15.536 1.00 42.59  ? 71  GLN B N   1 
ATOM 544 C CA  . GLN B 1 13 ? 51.145 14.878 15.591 1.00 45.22  ? 71  GLN B CA  1 
ATOM 545 C C   . GLN B 1 13 ? 50.640 15.818 14.515 1.00 43.06  ? 71  GLN B C   1 
ATOM 546 O O   . GLN B 1 13 ? 50.749 17.061 14.632 1.00 43.56  ? 71  GLN B O   1 
ATOM 547 C CB  . GLN B 1 13 ? 52.694 14.821 15.418 1.00 47.49  ? 71  GLN B CB  1 
ATOM 548 C CG  . GLN B 1 13 ? 53.496 13.858 16.357 1.00 62.79  ? 71  GLN B CG  1 
ATOM 549 C CD  . GLN B 1 13 ? 52.964 13.849 17.893 1.00 81.17  ? 71  GLN B CD  1 
ATOM 550 O OE1 . GLN B 1 13 ? 52.373 14.873 18.416 1.00 85.22  ? 71  GLN B OE1 1 
ATOM 551 N NE2 . GLN B 1 13 ? 53.221 12.710 18.608 1.00 84.48  ? 71  GLN B NE2 1 
ATOM 552 N N   . LYS B 1 14 ? 50.217 15.227 13.402 1.00 41.49  ? 72  LYS B N   1 
ATOM 553 C CA  . LYS B 1 14 ? 49.868 15.986 12.247 1.00 39.38  ? 72  LYS B CA  1 
ATOM 554 C C   . LYS B 1 14 ? 48.576 16.743 12.649 1.00 38.10  ? 72  LYS B C   1 
ATOM 555 O O   . LYS B 1 14 ? 48.497 17.970 12.513 1.00 36.63  ? 72  LYS B O   1 
ATOM 556 C CB  . LYS B 1 14 ? 49.807 15.034 11.084 1.00 38.85  ? 72  LYS B CB  1 
ATOM 557 C CG  . LYS B 1 14 ? 50.936 15.291 10.140 1.00 43.66  ? 72  LYS B CG  1 
ATOM 558 C CD  . LYS B 1 14 ? 51.641 14.062 9.594  1.00 50.34  ? 72  LYS B CD  1 
ATOM 559 C CE  . LYS B 1 14 ? 53.005 14.554 9.094  1.00 55.92  ? 72  LYS B CE  1 
ATOM 560 N NZ  . LYS B 1 14 ? 53.465 13.582 8.094  1.00 60.83  ? 72  LYS B NZ  1 
ATOM 561 N N   . PHE B 1 15 ? 47.658 16.027 13.302 1.00 37.88  ? 73  PHE B N   1 
ATOM 562 C CA  . PHE B 1 15 ? 46.405 16.595 13.826 1.00 39.42  ? 73  PHE B CA  1 
ATOM 563 C C   . PHE B 1 15 ? 46.542 17.607 14.930 1.00 37.79  ? 73  PHE B C   1 
ATOM 564 O O   . PHE B 1 15 ? 45.807 18.518 14.925 1.00 39.39  ? 73  PHE B O   1 
ATOM 565 C CB  . PHE B 1 15 ? 45.429 15.568 14.349 1.00 41.76  ? 73  PHE B CB  1 
ATOM 566 C CG  . PHE B 1 15 ? 44.976 14.587 13.348 1.00 44.96  ? 73  PHE B CG  1 
ATOM 567 C CD1 . PHE B 1 15 ? 44.898 13.247 13.682 1.00 49.31  ? 73  PHE B CD1 1 
ATOM 568 C CD2 . PHE B 1 15 ? 44.637 14.997 12.118 1.00 51.65  ? 73  PHE B CD2 1 
ATOM 569 C CE1 . PHE B 1 15 ? 44.502 12.297 12.775 1.00 53.36  ? 73  PHE B CE1 1 
ATOM 570 C CE2 . PHE B 1 15 ? 44.276 14.082 11.172 1.00 54.89  ? 73  PHE B CE2 1 
ATOM 571 C CZ  . PHE B 1 15 ? 44.215 12.708 11.507 1.00 56.51  ? 73  PHE B CZ  1 
ATOM 572 N N   . GLU B 1 16 ? 47.427 17.420 15.888 1.00 36.02  ? 74  GLU B N   1 
ATOM 573 C CA  . GLU B 1 16 ? 47.890 18.477 16.743 1.00 33.17  ? 74  GLU B CA  1 
ATOM 574 C C   . GLU B 1 16 ? 48.327 19.670 15.983 1.00 32.81  ? 74  GLU B C   1 
ATOM 575 O O   . GLU B 1 16 ? 47.866 20.789 16.291 1.00 36.65  ? 74  GLU B O   1 
ATOM 576 C CB  . GLU B 1 16 ? 49.012 18.007 17.674 1.00 32.42  ? 74  GLU B CB  1 
ATOM 577 C CG  . GLU B 1 16 ? 48.565 17.051 18.759 1.00 33.40  ? 74  GLU B CG  1 
ATOM 578 C CD  . GLU B 1 16 ? 47.430 17.657 19.683 1.00 41.86  ? 74  GLU B CD  1 
ATOM 579 O OE1 . GLU B 1 16 ? 47.521 18.853 20.233 1.00 40.20  ? 74  GLU B OE1 1 
ATOM 580 O OE2 . GLU B 1 16 ? 46.413 16.945 19.856 1.00 35.07  ? 74  GLU B OE2 1 
ATOM 581 N N   . GLU B 1 17 ? 49.185 19.526 15.003 1.00 29.97  ? 75  GLU B N   1 
ATOM 582 C CA  . GLU B 1 17 ? 49.626 20.685 14.328 1.00 29.21  ? 75  GLU B CA  1 
ATOM 583 C C   . GLU B 1 17 ? 48.481 21.414 13.538 1.00 29.53  ? 75  GLU B C   1 
ATOM 584 O O   . GLU B 1 17 ? 48.434 22.651 13.511 1.00 30.57  ? 75  GLU B O   1 
ATOM 585 C CB  . GLU B 1 17 ? 50.804 20.231 13.450 1.00 30.42  ? 75  GLU B CB  1 
ATOM 586 C CG  . GLU B 1 17 ? 51.571 21.347 12.706 1.00 32.68  ? 75  GLU B CG  1 
ATOM 587 C CD  . GLU B 1 17 ? 52.034 22.556 13.545 1.00 40.71  ? 75  GLU B CD  1 
ATOM 588 O OE1 . GLU B 1 17 ? 52.196 22.468 14.799 1.00 41.25  ? 75  GLU B OE1 1 
ATOM 589 O OE2 . GLU B 1 17 ? 52.255 23.641 12.942 1.00 41.13  ? 75  GLU B OE2 1 
ATOM 590 N N   . ILE B 1 18 ? 47.562 20.663 12.895 1.00 27.28  ? 76  ILE B N   1 
ATOM 591 C CA  . ILE B 1 18 ? 46.581 21.262 12.057 1.00 24.82  ? 76  ILE B CA  1 
ATOM 592 C C   . ILE B 1 18 ? 45.692 22.044 12.999 1.00 28.24  ? 76  ILE B C   1 
ATOM 593 O O   . ILE B 1 18 ? 45.318 23.250 12.737 1.00 28.46  ? 76  ILE B O   1 
ATOM 594 C CB  . ILE B 1 18 ? 45.714 20.179 11.413 1.00 25.19  ? 76  ILE B CB  1 
ATOM 595 C CG1 . ILE B 1 18 ? 46.554 19.462 10.352 1.00 21.52  ? 76  ILE B CG1 1 
ATOM 596 C CG2 . ILE B 1 18 ? 44.416 20.789 10.754 1.00 13.04  ? 76  ILE B CG2 1 
ATOM 597 C CD1 . ILE B 1 18 ? 45.841 18.321 9.720  1.00 27.18  ? 76  ILE B CD1 1 
ATOM 598 N N   . ARG B 1 19 ? 45.326 21.377 14.099 1.00 27.89  ? 77  ARG B N   1 
ATOM 599 C CA  . ARG B 1 19 ? 44.441 22.005 15.108 1.00 28.99  ? 77  ARG B CA  1 
ATOM 600 C C   . ARG B 1 19 ? 45.019 23.281 15.672 1.00 28.75  ? 77  ARG B C   1 
ATOM 601 O O   . ARG B 1 19 ? 44.398 24.290 15.652 1.00 28.55  ? 77  ARG B O   1 
ATOM 602 C CB  . ARG B 1 19 ? 44.122 21.083 16.292 1.00 30.03  ? 77  ARG B CB  1 
ATOM 603 C CG  . ARG B 1 19 ? 42.870 21.556 17.140 1.00 31.13  ? 77  ARG B CG  1 
ATOM 604 C CD  . ARG B 1 19 ? 42.479 20.591 18.194 1.00 35.68  ? 77  ARG B CD  1 
ATOM 605 N NE  . ARG B 1 19 ? 43.403 20.833 19.270 1.00 35.35  ? 77  ARG B NE  1 
ATOM 606 C CZ  . ARG B 1 19 ? 44.349 19.997 19.629 1.00 30.40  ? 77  ARG B CZ  1 
ATOM 607 N NH1 . ARG B 1 19 ? 44.505 18.922 18.939 1.00 27.50  ? 77  ARG B NH1 1 
ATOM 608 N NH2 . ARG B 1 19 ? 45.180 20.302 20.618 1.00 33.76  ? 77  ARG B NH2 1 
ATOM 609 N N   . TRP B 1 20 ? 46.228 23.234 16.142 1.00 29.29  ? 78  TRP B N   1 
ATOM 610 C CA  . TRP B 1 20 ? 46.929 24.408 16.574 1.00 28.70  ? 78  TRP B CA  1 
ATOM 611 C C   . TRP B 1 20 ? 46.947 25.499 15.519 1.00 27.76  ? 78  TRP B C   1 
ATOM 612 O O   . TRP B 1 20 ? 46.685 26.705 15.852 1.00 26.83  ? 78  TRP B O   1 
ATOM 613 C CB  . TRP B 1 20 ? 48.372 23.987 16.889 1.00 31.21  ? 78  TRP B CB  1 
ATOM 614 C CG  . TRP B 1 20 ? 49.299 25.186 17.180 1.00 34.12  ? 78  TRP B CG  1 
ATOM 615 C CD1 . TRP B 1 20 ? 50.397 25.539 16.468 1.00 33.95  ? 78  TRP B CD1 1 
ATOM 616 C CD2 . TRP B 1 20 ? 49.218 26.128 18.294 1.00 32.72  ? 78  TRP B CD2 1 
ATOM 617 N NE1 . TRP B 1 20 ? 50.982 26.658 17.020 1.00 39.01  ? 78  TRP B NE1 1 
ATOM 618 C CE2 . TRP B 1 20 ? 50.285 27.031 18.149 1.00 37.61  ? 78  TRP B CE2 1 
ATOM 619 C CE3 . TRP B 1 20 ? 48.331 26.319 19.347 1.00 29.34  ? 78  TRP B CE3 1 
ATOM 620 C CZ2 . TRP B 1 20 ? 50.475 28.110 19.021 1.00 33.53  ? 78  TRP B CZ2 1 
ATOM 621 C CZ3 . TRP B 1 20 ? 48.514 27.350 20.205 1.00 30.69  ? 78  TRP B CZ3 1 
ATOM 622 C CH2 . TRP B 1 20 ? 49.572 28.241 20.056 1.00 30.94  ? 78  TRP B CH2 1 
ATOM 623 N N   . LEU B 1 21 ? 47.242 25.171 14.260 1.00 26.65  ? 79  LEU B N   1 
ATOM 624 C CA  . LEU B 1 21 ? 47.341 26.294 13.299 1.00 26.49  ? 79  LEU B CA  1 
ATOM 625 C C   . LEU B 1 21 ? 45.914 26.880 13.149 1.00 27.32  ? 79  LEU B C   1 
ATOM 626 O O   . LEU B 1 21 ? 45.751 28.104 13.128 1.00 28.26  ? 79  LEU B O   1 
ATOM 627 C CB  . LEU B 1 21 ? 47.691 25.780 11.946 1.00 27.83  ? 79  LEU B CB  1 
ATOM 628 C CG  . LEU B 1 21 ? 49.060 25.538 11.279 1.00 28.41  ? 79  LEU B CG  1 
ATOM 629 C CD1 . LEU B 1 21 ? 50.204 26.082 11.990 1.00 15.52  ? 79  LEU B CD1 1 
ATOM 630 C CD2 . LEU B 1 21 ? 49.180 24.102 10.955 1.00 24.36  ? 79  LEU B CD2 1 
ATOM 631 N N   . ILE B 1 22 ? 44.860 26.035 13.080 1.00 25.38  ? 80  ILE B N   1 
ATOM 632 C CA  . ILE B 1 22 ? 43.533 26.585 13.049 1.00 24.93  ? 80  ILE B CA  1 
ATOM 633 C C   . ILE B 1 22 ? 43.181 27.474 14.201 1.00 27.70  ? 80  ILE B C   1 
ATOM 634 O O   . ILE B 1 22 ? 42.527 28.512 14.052 1.00 26.88  ? 80  ILE B O   1 
ATOM 635 C CB  . ILE B 1 22 ? 42.486 25.543 12.805 1.00 25.94  ? 80  ILE B CB  1 
ATOM 636 C CG1 . ILE B 1 22 ? 42.625 25.196 11.291 1.00 24.48  ? 80  ILE B CG1 1 
ATOM 637 C CG2 . ILE B 1 22 ? 41.056 26.119 13.116 1.00 21.27  ? 80  ILE B CG2 1 
ATOM 638 C CD1 . ILE B 1 22 ? 42.095 23.719 11.309 1.00 39.23  ? 80  ILE B CD1 1 
ATOM 639 N N   . GLU B 1 23 ? 43.689 27.079 15.352 1.00 30.47  ? 81  GLU B N   1 
ATOM 640 C CA  . GLU B 1 23 ? 43.495 27.794 16.557 1.00 33.86  ? 81  GLU B CA  1 
ATOM 641 C C   . GLU B 1 23 ? 44.230 29.121 16.568 1.00 34.03  ? 81  GLU B C   1 
ATOM 642 O O   . GLU B 1 23 ? 43.711 30.134 17.011 1.00 34.14  ? 81  GLU B O   1 
ATOM 643 C CB  . GLU B 1 23 ? 43.672 26.875 17.836 1.00 33.05  ? 81  GLU B CB  1 
ATOM 644 C CG  . GLU B 1 23 ? 42.402 27.343 18.605 1.00 43.22  ? 81  GLU B CG  1 
ATOM 645 C CD  . GLU B 1 23 ? 41.574 26.275 19.173 1.00 50.11  ? 81  GLU B CD  1 
ATOM 646 O OE1 . GLU B 1 23 ? 41.955 25.137 19.162 1.00 55.08  ? 81  GLU B OE1 1 
ATOM 647 O OE2 . GLU B 1 23 ? 40.568 26.595 19.697 1.00 57.51  ? 81  GLU B OE2 1 
ATOM 648 N N   . GLU B 1 24 ? 45.422 29.158 15.997 1.00 35.71  ? 82  GLU B N   1 
ATOM 649 C CA  . GLU B 1 24 ? 46.102 30.463 15.935 1.00 35.40  ? 82  GLU B CA  1 
ATOM 650 C C   . GLU B 1 24 ? 45.416 31.410 15.009 1.00 34.44  ? 82  GLU B C   1 
ATOM 651 O O   . GLU B 1 24 ? 45.420 32.547 15.271 1.00 36.65  ? 82  GLU B O   1 
ATOM 652 C CB  . GLU B 1 24 ? 47.485 30.330 15.385 1.00 34.33  ? 82  GLU B CB  1 
ATOM 653 C CG  . GLU B 1 24 ? 48.264 29.393 16.188 1.00 34.34  ? 82  GLU B CG  1 
ATOM 654 C CD  . GLU B 1 24 ? 49.683 29.337 15.636 1.00 37.27  ? 82  GLU B CD  1 
ATOM 655 O OE1 . GLU B 1 24 ? 50.546 30.032 16.130 1.00 39.20  ? 82  GLU B OE1 1 
ATOM 656 O OE2 . GLU B 1 24 ? 49.959 28.640 14.682 1.00 43.42  ? 82  GLU B OE2 1 
ATOM 657 N N   . VAL B 1 25 ? 44.943 30.973 13.892 1.00 31.66  ? 83  VAL B N   1 
ATOM 658 C CA  . VAL B 1 25 ? 44.260 31.853 12.983 1.00 32.68  ? 83  VAL B CA  1 
ATOM 659 C C   . VAL B 1 25 ? 42.918 32.280 13.656 1.00 34.90  ? 83  VAL B C   1 
ATOM 660 O O   . VAL B 1 25 ? 42.572 33.498 13.640 1.00 37.78  ? 83  VAL B O   1 
ATOM 661 C CB  . VAL B 1 25 ? 44.074 31.012 11.734 1.00 34.75  ? 83  VAL B CB  1 
ATOM 662 C CG1 . VAL B 1 25 ? 42.790 31.125 11.130 1.00 35.15  ? 83  VAL B CG1 1 
ATOM 663 C CG2 . VAL B 1 25 ? 45.302 30.996 10.802 1.00 32.90  ? 83  VAL B CG2 1 
ATOM 664 N N   . ARG B 1 26 ? 42.142 31.373 14.309 1.00 32.27  ? 84  ARG B N   1 
ATOM 665 C CA  . ARG B 1 26 ? 40.940 31.860 15.040 1.00 30.41  ? 84  ARG B CA  1 
ATOM 666 C C   . ARG B 1 26 ? 41.288 32.929 16.118 1.00 31.64  ? 84  ARG B C   1 
ATOM 667 O O   . ARG B 1 26 ? 40.525 33.871 16.396 1.00 32.00  ? 84  ARG B O   1 
ATOM 668 C CB  . ARG B 1 26 ? 40.147 30.707 15.703 1.00 28.19  ? 84  ARG B CB  1 
ATOM 669 C CG  . ARG B 1 26 ? 39.070 31.178 16.666 1.00 25.69  ? 84  ARG B CG  1 
ATOM 670 C CD  . ARG B 1 26 ? 37.936 31.969 15.916 1.00 23.23  ? 84  ARG B CD  1 
ATOM 671 N NE  . ARG B 1 26 ? 36.932 32.452 16.861 1.00 28.35  ? 84  ARG B NE  1 
ATOM 672 C CZ  . ARG B 1 26 ? 36.984 33.603 17.579 1.00 34.93  ? 84  ARG B CZ  1 
ATOM 673 N NH1 . ARG B 1 26 ? 37.972 34.574 17.425 1.00 28.18  ? 84  ARG B NH1 1 
ATOM 674 N NH2 . ARG B 1 26 ? 35.959 33.773 18.417 1.00 31.90  ? 84  ARG B NH2 1 
ATOM 675 N N   . HIS B 1 27 ? 42.394 32.740 16.811 1.00 32.45  ? 85  HIS B N   1 
ATOM 676 C CA  . HIS B 1 27 ? 42.760 33.651 17.864 1.00 34.64  ? 85  HIS B CA  1 
ATOM 677 C C   . HIS B 1 27 ? 42.935 35.110 17.382 1.00 36.55  ? 85  HIS B C   1 
ATOM 678 O O   . HIS B 1 27 ? 42.832 36.051 18.115 1.00 36.45  ? 85  HIS B O   1 
ATOM 679 C CB  . HIS B 1 27 ? 44.077 33.207 18.367 1.00 33.95  ? 85  HIS B CB  1 
ATOM 680 C CG  . HIS B 1 27 ? 44.587 34.057 19.454 1.00 39.55  ? 85  HIS B CG  1 
ATOM 681 N ND1 . HIS B 1 27 ? 43.859 34.283 20.615 1.00 45.23  ? 85  HIS B ND1 1 
ATOM 682 C CD2 . HIS B 1 27 ? 45.736 34.768 19.576 1.00 41.73  ? 85  HIS B CD2 1 
ATOM 683 C CE1 . HIS B 1 27 ? 44.540 35.091 21.408 1.00 40.94  ? 85  HIS B CE1 1 
ATOM 684 N NE2 . HIS B 1 27 ? 45.671 35.413 20.792 1.00 43.03  ? 85  HIS B NE2 1 
ATOM 685 N N   . ARG B 1 28 ? 43.278 35.297 16.135 1.00 38.96  ? 86  ARG B N   1 
ATOM 686 C CA  . ARG B 1 28 ? 43.518 36.652 15.681 1.00 40.29  ? 86  ARG B CA  1 
ATOM 687 C C   . ARG B 1 28 ? 42.286 37.300 15.200 1.00 39.52  ? 86  ARG B C   1 
ATOM 688 O O   . ARG B 1 28 ? 42.381 38.410 14.912 1.00 40.93  ? 86  ARG B O   1 
ATOM 689 C CB  . ARG B 1 28 ? 44.478 36.691 14.501 1.00 40.33  ? 86  ARG B CB  1 
ATOM 690 C CG  . ARG B 1 28 ? 45.693 36.014 14.756 1.00 43.13  ? 86  ARG B CG  1 
ATOM 691 C CD  . ARG B 1 28 ? 46.737 36.954 14.941 1.00 45.11  ? 86  ARG B CD  1 
ATOM 692 N NE  . ARG B 1 28 ? 47.971 36.308 15.308 1.00 43.04  ? 86  ARG B NE  1 
ATOM 693 C CZ  . ARG B 1 28 ? 49.170 36.729 14.857 1.00 46.02  ? 86  ARG B CZ  1 
ATOM 694 N NH1 . ARG B 1 28 ? 49.279 37.754 13.997 1.00 40.98  ? 86  ARG B NH1 1 
ATOM 695 N NH2 . ARG B 1 28 ? 50.271 36.097 15.237 1.00 48.13  ? 86  ARG B NH2 1 
ATOM 696 N N   . LEU B 1 29 ? 41.182 36.626 15.001 1.00 40.17  ? 87  LEU B N   1 
ATOM 697 C CA  . LEU B 1 29 ? 39.993 37.277 14.526 1.00 41.52  ? 87  LEU B CA  1 
ATOM 698 C C   . LEU B 1 29 ? 39.145 37.771 15.738 1.00 46.43  ? 87  LEU B C   1 
ATOM 699 O O   . LEU B 1 29 ? 39.203 37.174 16.834 1.00 48.62  ? 87  LEU B O   1 
ATOM 700 C CB  . LEU B 1 29 ? 39.177 36.303 13.709 1.00 38.47  ? 87  LEU B CB  1 
ATOM 701 C CG  . LEU B 1 29 ? 39.843 35.571 12.602 1.00 37.34  ? 87  LEU B CG  1 
ATOM 702 C CD1 . LEU B 1 29 ? 38.832 34.650 12.081 1.00 25.94  ? 87  LEU B CD1 1 
ATOM 703 C CD2 . LEU B 1 29 ? 40.201 36.688 11.534 1.00 34.88  ? 87  LEU B CD2 1 
ATOM 704 N N   . LYS B 1 30 ? 38.364 38.858 15.559 1.00 50.70  ? 88  LYS B N   1 
ATOM 705 C CA  . LYS B 1 30 ? 37.361 39.305 16.513 1.00 53.90  ? 88  LYS B CA  1 
ATOM 706 C C   . LYS B 1 30 ? 36.087 39.164 15.736 1.00 53.52  ? 88  LYS B C   1 
ATOM 707 O O   . LYS B 1 30 ? 35.883 39.855 14.726 1.00 54.54  ? 88  LYS B O   1 
ATOM 708 C CB  . LYS B 1 30 ? 37.629 40.764 16.969 1.00 56.80  ? 88  LYS B CB  1 
ATOM 709 C CG  . LYS B 1 30 ? 38.717 40.861 18.097 1.00 63.42  ? 88  LYS B CG  1 
ATOM 710 C CD  . LYS B 1 30 ? 39.722 42.025 17.876 1.00 77.21  ? 88  LYS B CD  1 
ATOM 711 C CE  . LYS B 1 30 ? 40.999 41.837 18.776 1.00 81.90  ? 88  LYS B CE  1 
ATOM 712 N NZ  . LYS B 1 30 ? 41.082 42.990 19.741 1.00 85.11  ? 88  LYS B NZ  1 
ATOM 713 N N   . ILE B 1 31 ? 35.282 38.203 16.170 1.00 52.45  ? 89  ILE B N   1 
ATOM 714 C CA  . ILE B 1 31 ? 34.059 37.811 15.484 1.00 51.05  ? 89  ILE B CA  1 
ATOM 715 C C   . ILE B 1 31 ? 33.090 37.384 16.582 1.00 51.61  ? 89  ILE B C   1 
ATOM 716 O O   . ILE B 1 31 ? 33.504 37.168 17.735 1.00 51.62  ? 89  ILE B O   1 
ATOM 717 C CB  . ILE B 1 31 ? 34.323 36.685 14.471 1.00 50.42  ? 89  ILE B CB  1 
ATOM 718 C CG1 . ILE B 1 31 ? 35.443 35.728 14.946 1.00 49.24  ? 89  ILE B CG1 1 
ATOM 719 C CG2 . ILE B 1 31 ? 34.840 37.334 13.240 1.00 50.49  ? 89  ILE B CG2 1 
ATOM 720 C CD1 . ILE B 1 31 ? 35.271 34.222 14.659 1.00 39.49  ? 89  ILE B CD1 1 
ATOM 721 N N   . THR B 1 32 ? 31.798 37.300 16.265 1.00 50.67  ? 90  THR B N   1 
ATOM 722 C CA  . THR B 1 32 ? 30.821 37.190 17.330 1.00 48.06  ? 90  THR B CA  1 
ATOM 723 C C   . THR B 1 32 ? 30.354 35.728 17.452 1.00 49.24  ? 90  THR B C   1 
ATOM 724 O O   . THR B 1 32 ? 30.554 34.934 16.534 1.00 48.53  ? 90  THR B O   1 
ATOM 725 C CB  . THR B 1 32 ? 29.596 38.252 17.118 1.00 49.10  ? 90  THR B CB  1 
ATOM 726 O OG1 . THR B 1 32 ? 28.650 37.795 16.118 1.00 44.24  ? 90  THR B OG1 1 
ATOM 727 C CG2 . THR B 1 32 ? 30.096 39.649 16.705 1.00 43.60  ? 90  THR B CG2 1 
ATOM 728 N N   . GLU B 1 33 ? 29.684 35.360 18.537 1.00 48.67  ? 91  GLU B N   1 
ATOM 729 C CA  . GLU B 1 33 ? 29.596 33.960 18.858 1.00 49.16  ? 91  GLU B CA  1 
ATOM 730 C C   . GLU B 1 33 ? 28.623 33.351 18.002 1.00 48.98  ? 91  GLU B C   1 
ATOM 731 O O   . GLU B 1 33 ? 28.532 32.095 17.940 1.00 49.91  ? 91  GLU B O   1 
ATOM 732 C CB  . GLU B 1 33 ? 29.180 33.707 20.301 1.00 50.99  ? 91  GLU B CB  1 
ATOM 733 C CG  . GLU B 1 33 ? 27.766 34.257 20.639 1.00 59.53  ? 91  GLU B CG  1 
ATOM 734 C CD  . GLU B 1 33 ? 26.937 33.426 21.629 1.00 69.41  ? 91  GLU B CD  1 
ATOM 735 O OE1 . GLU B 1 33 ? 27.494 32.874 22.692 1.00 64.18  ? 91  GLU B OE1 1 
ATOM 736 O OE2 . GLU B 1 33 ? 25.679 33.388 21.316 1.00 75.11  ? 91  GLU B OE2 1 
ATOM 737 N N   . ASN B 1 34 ? 27.822 34.185 17.334 1.00 49.02  ? 92  ASN B N   1 
ATOM 738 C CA  . ASN B 1 34 ? 26.848 33.594 16.378 1.00 47.92  ? 92  ASN B CA  1 
ATOM 739 C C   . ASN B 1 34 ? 27.107 33.924 14.907 1.00 43.81  ? 92  ASN B C   1 
ATOM 740 O O   . ASN B 1 34 ? 26.261 33.651 14.065 1.00 42.26  ? 92  ASN B O   1 
ATOM 741 C CB  . ASN B 1 34 ? 25.419 33.986 16.711 1.00 51.12  ? 92  ASN B CB  1 
ATOM 742 C CG  . ASN B 1 34 ? 24.585 32.823 17.255 1.00 61.65  ? 92  ASN B CG  1 
ATOM 743 O OD1 . ASN B 1 34 ? 24.363 31.734 16.594 1.00 64.06  ? 92  ASN B OD1 1 
ATOM 744 N ND2 . ASN B 1 34 ? 24.064 33.063 18.512 1.00 72.63  ? 92  ASN B ND2 1 
ATOM 745 N N   . SER B 1 35 ? 28.256 34.526 14.595 1.00 41.13  ? 93  SER B N   1 
ATOM 746 C CA  . SER B 1 35 ? 28.677 34.654 13.191 1.00 40.05  ? 93  SER B CA  1 
ATOM 747 C C   . SER B 1 35 ? 28.843 33.253 12.505 1.00 40.18  ? 93  SER B C   1 
ATOM 748 O O   . SER B 1 35 ? 29.087 32.204 13.150 1.00 39.14  ? 93  SER B O   1 
ATOM 749 C CB  . SER B 1 35 ? 29.936 35.422 13.115 1.00 38.31  ? 93  SER B CB  1 
ATOM 750 O OG  . SER B 1 35 ? 30.769 34.756 13.948 1.00 37.95  ? 93  SER B OG  1 
ATOM 751 N N   . PHE B 1 36 ? 28.588 33.235 11.210 1.00 38.84  ? 94  PHE B N   1 
ATOM 752 C CA  . PHE B 1 36 ? 28.850 32.071 10.449 1.00 37.88  ? 94  PHE B CA  1 
ATOM 753 C C   . PHE B 1 36 ? 30.350 31.599 10.606 1.00 37.66  ? 94  PHE B C   1 
ATOM 754 O O   . PHE B 1 36 ? 30.747 30.418 10.726 1.00 37.15  ? 94  PHE B O   1 
ATOM 755 C CB  . PHE B 1 36 ? 28.566 32.475 9.060  1.00 35.40  ? 94  PHE B CB  1 
ATOM 756 C CG  . PHE B 1 36 ? 29.068 31.512 8.078  1.00 36.51  ? 94  PHE B CG  1 
ATOM 757 C CD1 . PHE B 1 36 ? 28.351 30.338 7.729  1.00 27.76  ? 94  PHE B CD1 1 
ATOM 758 C CD2 . PHE B 1 36 ? 30.340 31.741 7.517  1.00 37.71  ? 94  PHE B CD2 1 
ATOM 759 C CE1 . PHE B 1 36 ? 28.907 29.502 6.778  1.00 28.09  ? 94  PHE B CE1 1 
ATOM 760 C CE2 . PHE B 1 36 ? 30.874 30.887 6.678  1.00 32.23  ? 94  PHE B CE2 1 
ATOM 761 C CZ  . PHE B 1 36 ? 30.158 29.760 6.267  1.00 27.89  ? 94  PHE B CZ  1 
ATOM 762 N N   . GLU B 1 37 ? 31.198 32.567 10.602 1.00 38.62  ? 95  GLU B N   1 
ATOM 763 C CA  . GLU B 1 37 ? 32.592 32.312 10.834 1.00 40.87  ? 95  GLU B CA  1 
ATOM 764 C C   . GLU B 1 37 ? 32.902 31.480 12.108 1.00 39.96  ? 95  GLU B C   1 
ATOM 765 O O   . GLU B 1 37 ? 33.702 30.543 12.039 1.00 39.71  ? 95  GLU B O   1 
ATOM 766 C CB  . GLU B 1 37 ? 33.181 33.655 10.991 1.00 41.27  ? 95  GLU B CB  1 
ATOM 767 C CG  . GLU B 1 37 ? 34.592 33.721 10.677 1.00 49.56  ? 95  GLU B CG  1 
ATOM 768 C CD  . GLU B 1 37 ? 34.705 34.096 9.285  1.00 62.62  ? 95  GLU B CD  1 
ATOM 769 O OE1 . GLU B 1 37 ? 34.109 35.222 8.930  1.00 72.18  ? 95  GLU B OE1 1 
ATOM 770 O OE2 . GLU B 1 37 ? 35.349 33.231 8.602  1.00 66.82  ? 95  GLU B OE2 1 
ATOM 771 N N   . GLN B 1 38 ? 32.298 31.886 13.237 1.00 38.00  ? 96  GLN B N   1 
ATOM 772 C CA  . GLN B 1 38 ? 32.524 31.325 14.530 1.00 37.11  ? 96  GLN B CA  1 
ATOM 773 C C   . GLN B 1 38 ? 31.950 29.959 14.555 1.00 35.63  ? 96  GLN B C   1 
ATOM 774 O O   . GLN B 1 38 ? 32.570 29.028 15.108 1.00 35.92  ? 96  GLN B O   1 
ATOM 775 C CB  . GLN B 1 38 ? 31.841 32.124 15.606 1.00 37.17  ? 96  GLN B CB  1 
ATOM 776 C CG  . GLN B 1 38 ? 31.857 31.497 16.983 1.00 41.52  ? 96  GLN B CG  1 
ATOM 777 C CD  . GLN B 1 38 ? 33.296 31.254 17.571 1.00 46.25  ? 96  GLN B CD  1 
ATOM 778 O OE1 . GLN B 1 38 ? 34.274 31.898 17.172 1.00 43.59  ? 96  GLN B OE1 1 
ATOM 779 N NE2 . GLN B 1 38 ? 33.389 30.332 18.565 1.00 47.20  ? 96  GLN B NE2 1 
ATOM 780 N N   . ILE B 1 39 ? 30.767 29.836 14.010 1.00 34.02  ? 97  ILE B N   1 
ATOM 781 C CA  . ILE B 1 39 ? 30.104 28.561 13.925 1.00 34.53  ? 97  ILE B CA  1 
ATOM 782 C C   . ILE B 1 39 ? 30.970 27.585 13.119 1.00 34.55  ? 97  ILE B C   1 
ATOM 783 O O   . ILE B 1 39 ? 31.129 26.437 13.491 1.00 33.20  ? 97  ILE B O   1 
ATOM 784 C CB  . ILE B 1 39 ? 28.788 28.742 13.269 1.00 34.80  ? 97  ILE B CB  1 
ATOM 785 C CG1 . ILE B 1 39 ? 27.813 29.271 14.326 1.00 39.38  ? 97  ILE B CG1 1 
ATOM 786 C CG2 . ILE B 1 39 ? 28.166 27.426 12.678 1.00 37.30  ? 97  ILE B CG2 1 
ATOM 787 C CD1 . ILE B 1 39 ? 26.547 30.136 13.691 1.00 35.30  ? 97  ILE B CD1 1 
ATOM 788 N N   . THR B 1 40 ? 31.489 28.070 11.977 1.00 35.26  ? 98  THR B N   1 
ATOM 789 C CA  . THR B 1 40 ? 32.236 27.261 11.021 1.00 32.24  ? 98  THR B CA  1 
ATOM 790 C C   . THR B 1 40 ? 33.577 26.907 11.690 1.00 31.01  ? 98  THR B C   1 
ATOM 791 O O   . THR B 1 40 ? 33.905 25.742 11.700 1.00 29.72  ? 98  THR B O   1 
ATOM 792 C CB  . THR B 1 40 ? 32.346 27.990 9.677  1.00 32.40  ? 98  THR B CB  1 
ATOM 793 O OG1 . THR B 1 40 ? 31.026 28.117 9.140  1.00 29.86  ? 98  THR B OG1 1 
ATOM 794 C CG2 . THR B 1 40 ? 32.969 27.070 8.629  1.00 32.76  ? 98  THR B CG2 1 
ATOM 795 N N   . PHE B 1 41 ? 34.284 27.847 12.315 1.00 29.44  ? 99  PHE B N   1 
ATOM 796 C CA  . PHE B 1 41 ? 35.442 27.456 13.129 1.00 31.67  ? 99  PHE B CA  1 
ATOM 797 C C   . PHE B 1 41 ? 35.107 26.379 14.138 1.00 33.87  ? 99  PHE B C   1 
ATOM 798 O O   . PHE B 1 41 ? 35.913 25.519 14.322 1.00 37.51  ? 99  PHE B O   1 
ATOM 799 C CB  . PHE B 1 41 ? 36.063 28.582 13.911 1.00 29.29  ? 99  PHE B CB  1 
ATOM 800 C CG  . PHE B 1 41 ? 37.161 29.319 13.131 1.00 34.50  ? 99  PHE B CG  1 
ATOM 801 C CD1 . PHE B 1 41 ? 36.915 30.617 12.532 1.00 39.88  ? 99  PHE B CD1 1 
ATOM 802 C CD2 . PHE B 1 41 ? 38.410 28.761 12.933 1.00 35.33  ? 99  PHE B CD2 1 
ATOM 803 C CE1 . PHE B 1 41 ? 37.909 31.299 11.796 1.00 36.19  ? 99  PHE B CE1 1 
ATOM 804 C CE2 . PHE B 1 41 ? 39.413 29.428 12.151 1.00 35.34  ? 99  PHE B CE2 1 
ATOM 805 C CZ  . PHE B 1 41 ? 39.178 30.694 11.630 1.00 31.06  ? 99  PHE B CZ  1 
ATOM 806 N N   . MET B 1 42 ? 33.942 26.355 14.770 1.00 33.87  ? 100 MET B N   1 
ATOM 807 C CA  . MET B 1 42 ? 33.819 25.410 15.827 1.00 33.52  ? 100 MET B CA  1 
ATOM 808 C C   . MET B 1 42 ? 33.404 24.079 15.273 1.00 33.55  ? 100 MET B C   1 
ATOM 809 O O   . MET B 1 42 ? 33.810 23.116 15.824 1.00 33.35  ? 100 MET B O   1 
ATOM 810 C CB  . MET B 1 42 ? 32.876 25.902 16.878 1.00 33.97  ? 100 MET B CB  1 
ATOM 811 C CG  . MET B 1 42 ? 33.492 26.995 17.739 1.00 37.35  ? 100 MET B CG  1 
ATOM 812 S SD  . MET B 1 42 ? 32.302 27.024 19.115 1.00 55.77  ? 100 MET B SD  1 
ATOM 813 C CE  . MET B 1 42 ? 30.596 28.064 18.534 1.00 43.16  ? 100 MET B CE  1 
ATOM 814 N N   . GLN B 1 43 ? 32.608 23.983 14.186 1.00 32.41  ? 101 GLN B N   1 
ATOM 815 C CA  . GLN B 1 43 ? 32.428 22.689 13.542 1.00 31.54  ? 101 GLN B CA  1 
ATOM 816 C C   . GLN B 1 43 ? 33.799 22.021 13.116 1.00 28.90  ? 101 GLN B C   1 
ATOM 817 O O   . GLN B 1 43 ? 33.984 20.823 13.394 1.00 29.48  ? 101 GLN B O   1 
ATOM 818 C CB  . GLN B 1 43 ? 31.386 22.669 12.434 1.00 30.36  ? 101 GLN B CB  1 
ATOM 819 C CG  . GLN B 1 43 ? 30.225 23.361 12.912 1.00 41.60  ? 101 GLN B CG  1 
ATOM 820 C CD  . GLN B 1 43 ? 29.285 23.903 11.774 1.00 51.50  ? 101 GLN B CD  1 
ATOM 821 O OE1 . GLN B 1 43 ? 29.707 24.148 10.635 1.00 48.02  ? 101 GLN B OE1 1 
ATOM 822 N NE2 . GLN B 1 43 ? 27.990 24.081 12.132 1.00 54.22  ? 101 GLN B NE2 1 
ATOM 823 N N   . ALA B 1 44 ? 34.704 22.792 12.537 1.00 24.14  ? 102 ALA B N   1 
ATOM 824 C CA  . ALA B 1 44 ? 36.006 22.330 12.012 1.00 22.28  ? 102 ALA B CA  1 
ATOM 825 C C   . ALA B 1 44 ? 36.786 21.839 13.224 1.00 23.93  ? 102 ALA B C   1 
ATOM 826 O O   . ALA B 1 44 ? 37.353 20.768 13.140 1.00 24.48  ? 102 ALA B O   1 
ATOM 827 C CB  . ALA B 1 44 ? 36.798 23.429 11.322 1.00 15.51  ? 102 ALA B CB  1 
ATOM 828 N N   . LEU B 1 45 ? 36.828 22.576 14.358 1.00 24.39  ? 103 LEU B N   1 
ATOM 829 C CA  . LEU B 1 45 ? 37.655 22.160 15.464 1.00 23.98  ? 103 LEU B CA  1 
ATOM 830 C C   . LEU B 1 45 ? 36.999 20.902 16.063 1.00 25.76  ? 103 LEU B C   1 
ATOM 831 O O   . LEU B 1 45 ? 37.709 19.946 16.442 1.00 26.41  ? 103 LEU B O   1 
ATOM 832 C CB  . LEU B 1 45 ? 37.875 23.205 16.595 1.00 23.63  ? 103 LEU B CB  1 
ATOM 833 C CG  . LEU B 1 45 ? 38.713 24.420 16.194 1.00 26.72  ? 103 LEU B CG  1 
ATOM 834 C CD1 . LEU B 1 45 ? 38.288 25.579 17.123 1.00 23.44  ? 103 LEU B CD1 1 
ATOM 835 C CD2 . LEU B 1 45 ? 40.295 24.226 16.230 1.00 19.59  ? 103 LEU B CD2 1 
ATOM 836 N N   . GLN B 1 46 ? 35.690 20.877 16.236 1.00 27.70  ? 104 GLN B N   1 
ATOM 837 C CA  . GLN B 1 46 ? 35.056 19.612 16.613 1.00 29.30  ? 104 GLN B CA  1 
ATOM 838 C C   . GLN B 1 46 ? 35.346 18.465 15.738 1.00 28.96  ? 104 GLN B C   1 
ATOM 839 O O   . GLN B 1 46 ? 35.741 17.462 16.293 1.00 30.16  ? 104 GLN B O   1 
ATOM 840 C CB  . GLN B 1 46 ? 33.612 19.754 16.813 1.00 29.58  ? 104 GLN B CB  1 
ATOM 841 C CG  . GLN B 1 46 ? 33.433 20.642 18.031 1.00 35.37  ? 104 GLN B CG  1 
ATOM 842 C CD  . GLN B 1 46 ? 31.958 21.027 18.267 1.00 37.10  ? 104 GLN B CD  1 
ATOM 843 O OE1 . GLN B 1 46 ? 31.320 21.669 17.425 1.00 45.62  ? 104 GLN B OE1 1 
ATOM 844 N NE2 . GLN B 1 46 ? 31.430 20.634 19.408 1.00 33.15  ? 104 GLN B NE2 1 
ATOM 845 N N   . LEU B 1 47 ? 35.274 18.605 14.421 1.00 29.59  ? 105 LEU B N   1 
ATOM 846 C CA  . LEU B 1 47 ? 35.558 17.490 13.577 1.00 31.00  ? 105 LEU B CA  1 
ATOM 847 C C   . LEU B 1 47 ? 37.026 17.113 13.674 1.00 30.63  ? 105 LEU B C   1 
ATOM 848 O O   . LEU B 1 47 ? 37.321 15.967 13.722 1.00 34.61  ? 105 LEU B O   1 
ATOM 849 C CB  . LEU B 1 47 ? 35.239 17.737 12.141 1.00 32.51  ? 105 LEU B CB  1 
ATOM 850 C CG  . LEU B 1 47 ? 33.838 17.304 11.819 1.00 38.43  ? 105 LEU B CG  1 
ATOM 851 C CD1 . LEU B 1 47 ? 33.559 17.940 10.386 1.00 43.02  ? 105 LEU B CD1 1 
ATOM 852 C CD2 . LEU B 1 47 ? 33.993 15.897 11.809 1.00 40.62  ? 105 LEU B CD2 1 
ATOM 853 N N   . LEU B 1 48 ? 37.965 18.010 13.710 1.00 29.37  ? 106 LEU B N   1 
ATOM 854 C CA  . LEU B 1 48 ? 39.330 17.547 13.892 1.00 30.60  ? 106 LEU B CA  1 
ATOM 855 C C   . LEU B 1 48 ? 39.535 16.789 15.168 1.00 30.15  ? 106 LEU B C   1 
ATOM 856 O O   . LEU B 1 48 ? 40.381 15.988 15.101 1.00 32.63  ? 106 LEU B O   1 
ATOM 857 C CB  . LEU B 1 48 ? 40.406 18.629 13.996 1.00 29.71  ? 106 LEU B CB  1 
ATOM 858 C CG  . LEU B 1 48 ? 40.899 19.323 12.791 1.00 34.93  ? 106 LEU B CG  1 
ATOM 859 C CD1 . LEU B 1 48 ? 41.502 20.682 13.173 1.00 30.82  ? 106 LEU B CD1 1 
ATOM 860 C CD2 . LEU B 1 48 ? 41.894 18.347 12.214 1.00 32.51  ? 106 LEU B CD2 1 
ATOM 861 N N   . LEU B 1 49 ? 38.914 17.119 16.321 1.00 28.88  ? 107 LEU B N   1 
ATOM 862 C CA  . LEU B 1 49 ? 39.135 16.417 17.560 1.00 28.17  ? 107 LEU B CA  1 
ATOM 863 C C   . LEU B 1 49 ? 38.428 15.071 17.471 1.00 28.81  ? 107 LEU B C   1 
ATOM 864 O O   . LEU B 1 49 ? 38.993 14.121 17.854 1.00 29.94  ? 107 LEU B O   1 
ATOM 865 C CB  . LEU B 1 49 ? 38.713 17.167 18.832 1.00 26.33  ? 107 LEU B CB  1 
ATOM 866 C CG  . LEU B 1 49 ? 39.652 18.323 19.154 1.00 27.92  ? 107 LEU B CG  1 
ATOM 867 C CD1 . LEU B 1 49 ? 38.823 19.410 19.865 1.00 20.61  ? 107 LEU B CD1 1 
ATOM 868 C CD2 . LEU B 1 49 ? 40.764 17.784 20.008 1.00 26.60  ? 107 LEU B CD2 1 
ATOM 869 N N   . GLU B 1 50 ? 37.252 14.962 16.923 1.00 28.90  ? 108 GLU B N   1 
ATOM 870 C CA  . GLU B 1 50 ? 36.676 13.654 16.696 1.00 29.63  ? 108 GLU B CA  1 
ATOM 871 C C   . GLU B 1 50 ? 37.519 12.721 15.743 1.00 29.23  ? 108 GLU B C   1 
ATOM 872 O O   . GLU B 1 50 ? 37.736 11.583 16.053 1.00 26.35  ? 108 GLU B O   1 
ATOM 873 C CB  . GLU B 1 50 ? 35.362 13.913 16.062 1.00 30.31  ? 108 GLU B CB  1 
ATOM 874 C CG  . GLU B 1 50 ? 34.771 12.672 15.448 1.00 37.56  ? 108 GLU B CG  1 
ATOM 875 C CD  . GLU B 1 50 ? 33.454 13.111 14.823 1.00 53.97  ? 108 GLU B CD  1 
ATOM 876 O OE1 . GLU B 1 50 ? 32.702 13.916 15.539 1.00 58.87  ? 108 GLU B OE1 1 
ATOM 877 O OE2 . GLU B 1 50 ? 33.184 12.744 13.613 1.00 58.06  ? 108 GLU B OE2 1 
ATOM 878 N N   . VAL B 1 51 ? 37.969 13.177 14.570 1.00 29.26  ? 109 VAL B N   1 
ATOM 879 C CA  . VAL B 1 51 ? 38.949 12.392 13.789 1.00 30.24  ? 109 VAL B CA  1 
ATOM 880 C C   . VAL B 1 51 ? 40.200 11.985 14.575 1.00 32.49  ? 109 VAL B C   1 
ATOM 881 O O   . VAL B 1 51 ? 40.688 10.883 14.394 1.00 32.26  ? 109 VAL B O   1 
ATOM 882 C CB  . VAL B 1 51 ? 39.417 13.176 12.542 1.00 30.81  ? 109 VAL B CB  1 
ATOM 883 C CG1 . VAL B 1 51 ? 40.504 12.503 11.905 1.00 30.63  ? 109 VAL B CG1 1 
ATOM 884 C CG2 . VAL B 1 51 ? 38.274 13.260 11.533 1.00 29.25  ? 109 VAL B CG2 1 
ATOM 885 N N   . GLU B 1 52 ? 40.770 12.839 15.444 1.00 34.40  ? 110 GLU B N   1 
ATOM 886 C CA  . GLU B 1 52 ? 42.024 12.512 16.113 1.00 35.88  ? 110 GLU B CA  1 
ATOM 887 C C   . GLU B 1 52 ? 41.742 11.445 17.152 1.00 39.26  ? 110 GLU B C   1 
ATOM 888 O O   . GLU B 1 52 ? 42.562 10.613 17.536 1.00 43.37  ? 110 GLU B O   1 
ATOM 889 C CB  . GLU B 1 52 ? 42.496 13.755 16.744 1.00 34.51  ? 110 GLU B CB  1 
ATOM 890 C CG  . GLU B 1 52 ? 43.675 13.702 17.662 1.00 32.46  ? 110 GLU B CG  1 
ATOM 891 C CD  . GLU B 1 52 ? 44.251 15.129 17.847 1.00 41.55  ? 110 GLU B CD  1 
ATOM 892 O OE1 . GLU B 1 52 ? 43.576 16.190 17.379 1.00 46.74  ? 110 GLU B OE1 1 
ATOM 893 O OE2 . GLU B 1 52 ? 45.424 15.219 18.342 1.00 41.36  ? 110 GLU B OE2 1 
ATOM 894 N N   . GLN B 1 53 ? 40.532 11.420 17.575 1.00 40.48  ? 111 GLN B N   1 
ATOM 895 C CA  . GLN B 1 53 ? 40.173 10.417 18.457 1.00 43.87  ? 111 GLN B CA  1 
ATOM 896 C C   . GLN B 1 53 ? 39.792 9.107  17.885 1.00 45.08  ? 111 GLN B C   1 
ATOM 897 O O   . GLN B 1 53 ? 40.007 8.090  18.505 1.00 45.87  ? 111 GLN B O   1 
ATOM 898 C CB  . GLN B 1 53 ? 39.115 10.939 19.364 1.00 43.29  ? 111 GLN B CB  1 
ATOM 899 C CG  . GLN B 1 53 ? 39.963 11.161 20.573 1.00 52.55  ? 111 GLN B CG  1 
ATOM 900 C CD  . GLN B 1 53 ? 39.158 11.533 21.567 1.00 58.67  ? 111 GLN B CD  1 
ATOM 901 O OE1 . GLN B 1 53 ? 39.542 11.601 22.708 1.00 59.71  ? 111 GLN B OE1 1 
ATOM 902 N NE2 . GLN B 1 53 ? 37.943 11.835 21.169 1.00 68.47  ? 111 GLN B NE2 1 
ATOM 903 N N   . GLU B 1 54 ? 39.145 9.133  16.750 1.00 45.55  ? 112 GLU B N   1 
ATOM 904 C CA  . GLU B 1 54 ? 39.066 7.981  15.946 1.00 45.97  ? 112 GLU B CA  1 
ATOM 905 C C   . GLU B 1 54 ? 40.416 7.444  15.561 1.00 45.45  ? 112 GLU B C   1 
ATOM 906 O O   . GLU B 1 54 ? 40.641 6.285  15.572 1.00 45.91  ? 112 GLU B O   1 
ATOM 907 C CB  . GLU B 1 54 ? 38.358 8.338  14.701 1.00 45.28  ? 112 GLU B CB  1 
ATOM 908 C CG  . GLU B 1 54 ? 36.892 8.106  14.709 1.00 50.63  ? 112 GLU B CG  1 
ATOM 909 C CD  . GLU B 1 54 ? 36.351 8.390  13.296 1.00 62.90  ? 112 GLU B CD  1 
ATOM 910 O OE1 . GLU B 1 54 ? 36.656 7.597  12.306 1.00 67.07  ? 112 GLU B OE1 1 
ATOM 911 O OE2 . GLU B 1 54 ? 35.643 9.443  13.148 1.00 63.99  ? 112 GLU B OE2 1 
ATOM 912 N N   . ILE B 1 55 ? 41.364 8.213  15.147 1.00 46.91  ? 113 ILE B N   1 
ATOM 913 C CA  . ILE B 1 55 ? 42.647 7.471  14.875 1.00 47.40  ? 113 ILE B CA  1 
ATOM 914 C C   . ILE B 1 55 ? 43.115 6.696  16.161 1.00 49.33  ? 113 ILE B C   1 
ATOM 915 O O   . ILE B 1 55 ? 43.450 5.547  16.132 1.00 51.17  ? 113 ILE B O   1 
ATOM 916 C CB  . ILE B 1 55 ? 43.717 8.377  14.250 1.00 44.52  ? 113 ILE B CB  1 
ATOM 917 C CG1 . ILE B 1 55 ? 43.786 8.137  12.776 1.00 46.55  ? 113 ILE B CG1 1 
ATOM 918 C CG2 . ILE B 1 55 ? 45.006 8.097  14.723 1.00 46.33  ? 113 ILE B CG2 1 
ATOM 919 C CD1 . ILE B 1 55 ? 42.808 8.896  12.060 1.00 49.10  ? 113 ILE B CD1 1 
ATOM 920 N N   . ARG B 1 56 ? 43.012 7.342  17.299 1.00 50.51  ? 114 ARG B N   1 
ATOM 921 C CA  . ARG B 1 56 ? 43.570 6.879  18.525 1.00 50.49  ? 114 ARG B CA  1 
ATOM 922 C C   . ARG B 1 56 ? 42.815 5.601  18.943 1.00 51.94  ? 114 ARG B C   1 
ATOM 923 O O   . ARG B 1 56 ? 43.432 4.730  19.431 1.00 52.51  ? 114 ARG B O   1 
ATOM 924 C CB  . ARG B 1 56 ? 43.338 7.993  19.569 1.00 49.12  ? 114 ARG B CB  1 
ATOM 925 C CG  . ARG B 1 56 ? 44.202 8.002  20.713 1.00 45.53  ? 114 ARG B CG  1 
ATOM 926 C CD  . ARG B 1 56 ? 43.661 8.880  21.810 1.00 42.04  ? 114 ARG B CD  1 
ATOM 927 N NE  . ARG B 1 56 ? 43.037 8.050  22.817 1.00 46.35  ? 114 ARG B NE  1 
ATOM 928 C CZ  . ARG B 1 56 ? 41.752 8.117  23.179 1.00 47.17  ? 114 ARG B CZ  1 
ATOM 929 N NH1 . ARG B 1 56 ? 40.916 9.032  22.631 1.00 49.98  ? 114 ARG B NH1 1 
ATOM 930 N NH2 . ARG B 1 56 ? 41.299 7.274  24.100 1.00 41.78  ? 114 ARG B NH2 1 
ATOM 931 N N   . THR B 1 57 ? 41.500 5.551  18.878 1.00 53.37  ? 115 THR B N   1 
ATOM 932 C CA  . THR B 1 57 ? 40.781 4.414  19.302 1.00 56.03  ? 115 THR B CA  1 
ATOM 933 C C   . THR B 1 57 ? 40.874 3.409  18.106 1.00 59.62  ? 115 THR B C   1 
ATOM 934 O O   . THR B 1 57 ? 41.738 2.564  18.116 1.00 63.72  ? 115 THR B O   1 
ATOM 935 C CB  . THR B 1 57 ? 39.355 4.749  19.861 1.00 56.33  ? 115 THR B CB  1 
ATOM 936 O OG1 . THR B 1 57 ? 38.646 5.657  19.020 1.00 58.40  ? 115 THR B OG1 1 
ATOM 937 C CG2 . THR B 1 57 ? 39.446 5.524  21.128 1.00 52.85  ? 115 THR B CG2 1 
ATOM 938 N N   . PHE B 1 58 ? 40.190 3.473  16.990 1.00 61.53  ? 116 PHE B N   1 
ATOM 939 C CA  . PHE B 1 58 ? 40.549 2.410  16.026 1.00 63.06  ? 116 PHE B CA  1 
ATOM 940 C C   . PHE B 1 58 ? 41.426 1.221  16.533 1.00 62.80  ? 116 PHE B C   1 
ATOM 941 O O   . PHE B 1 58 ? 40.914 0.086  16.580 1.00 63.05  ? 116 PHE B O   1 
ATOM 942 C CB  . PHE B 1 58 ? 41.138 2.860  14.710 1.00 63.12  ? 116 PHE B CB  1 
ATOM 943 C CG  . PHE B 1 58 ? 41.192 1.720  13.708 1.00 68.20  ? 116 PHE B CG  1 
ATOM 944 C CD1 . PHE B 1 58 ? 39.966 1.187  13.172 1.00 74.43  ? 116 PHE B CD1 1 
ATOM 945 C CD2 . PHE B 1 58 ? 42.426 1.091  13.386 1.00 72.32  ? 116 PHE B CD2 1 
ATOM 946 C CE1 . PHE B 1 58 ? 39.954 0.094  12.281 1.00 75.16  ? 116 PHE B CE1 1 
ATOM 947 C CE2 . PHE B 1 58 ? 42.447 -0.006 12.512 1.00 74.80  ? 116 PHE B CE2 1 
ATOM 948 C CZ  . PHE B 1 58 ? 41.198 -0.500 11.945 1.00 76.33  ? 116 PHE B CZ  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLN 1  59  ?   ?   ?   A . n 
A 1 2  ASN 2  60  ?   ?   ?   A . n 
A 1 3  ARG 3  61  ?   ?   ?   A . n 
A 1 4  ASN 4  62  ?   ?   ?   A . n 
A 1 5  GLY 5  63  63  GLY GLY A . n 
A 1 6  LYS 6  64  64  LYS LYS A . n 
A 1 7  TRP 7  65  65  TRP TRP A . n 
A 1 8  ARG 8  66  66  ARG ARG A . n 
A 1 9  GLU 9  67  67  GLU GLU A . n 
A 1 10 GLN 10 68  68  GLN GLN A . n 
A 1 11 LEU 11 69  69  LEU LEU A . n 
A 1 12 GLY 12 70  70  GLY GLY A . n 
A 1 13 GLN 13 71  71  GLN GLN A . n 
A 1 14 LYS 14 72  72  LYS LYS A . n 
A 1 15 PHE 15 73  73  PHE PHE A . n 
A 1 16 GLU 16 74  74  GLU GLU A . n 
A 1 17 GLU 17 75  75  GLU GLU A . n 
A 1 18 ILE 18 76  76  ILE ILE A . n 
A 1 19 ARG 19 77  77  ARG ARG A . n 
A 1 20 TRP 20 78  78  TRP TRP A . n 
A 1 21 LEU 21 79  79  LEU LEU A . n 
A 1 22 ILE 22 80  80  ILE ILE A . n 
A 1 23 GLU 23 81  81  GLU GLU A . n 
A 1 24 GLU 24 82  82  GLU GLU A . n 
A 1 25 VAL 25 83  83  VAL VAL A . n 
A 1 26 ARG 26 84  84  ARG ARG A . n 
A 1 27 HIS 27 85  85  HIS HIS A . n 
A 1 28 ARG 28 86  86  ARG ARG A . n 
A 1 29 LEU 29 87  87  LEU LEU A . n 
A 1 30 LYS 30 88  88  LYS LYS A . n 
A 1 31 ILE 31 89  89  ILE ILE A . n 
A 1 32 THR 32 90  90  THR THR A . n 
A 1 33 GLU 33 91  91  GLU GLU A . n 
A 1 34 ASN 34 92  92  ASN ASN A . n 
A 1 35 SER 35 93  93  SER SER A . n 
A 1 36 PHE 36 94  94  PHE PHE A . n 
A 1 37 GLU 37 95  95  GLU GLU A . n 
A 1 38 GLN 38 96  96  GLN GLN A . n 
A 1 39 ILE 39 97  97  ILE ILE A . n 
A 1 40 THR 40 98  98  THR THR A . n 
A 1 41 PHE 41 99  99  PHE PHE A . n 
A 1 42 MET 42 100 100 MET MET A . n 
A 1 43 GLN 43 101 101 GLN GLN A . n 
A 1 44 ALA 44 102 102 ALA ALA A . n 
A 1 45 LEU 45 103 103 LEU LEU A . n 
A 1 46 GLN 46 104 104 GLN GLN A . n 
A 1 47 LEU 47 105 105 LEU LEU A . n 
A 1 48 LEU 48 106 106 LEU LEU A . n 
A 1 49 LEU 49 107 107 LEU LEU A . n 
A 1 50 GLU 50 108 108 GLU GLU A . n 
A 1 51 VAL 51 109 109 VAL VAL A . n 
A 1 52 GLU 52 110 110 GLU GLU A . n 
A 1 53 GLN 53 111 111 GLN GLN A . n 
A 1 54 GLU 54 112 112 GLU GLU A . n 
A 1 55 ILE 55 113 113 ILE ILE A . n 
A 1 56 ARG 56 114 114 ARG ARG A . n 
A 1 57 THR 57 115 115 THR THR A . n 
A 1 58 PHE 58 116 116 PHE PHE A . n 
B 1 1  GLN 1  59  ?   ?   ?   B . n 
B 1 2  ASN 2  60  ?   ?   ?   B . n 
B 1 3  ARG 3  61  ?   ?   ?   B . n 
B 1 4  ASN 4  62  ?   ?   ?   B . n 
B 1 5  GLY 5  63  63  GLY GLY B . n 
B 1 6  LYS 6  64  64  LYS LYS B . n 
B 1 7  TRP 7  65  65  TRP TRP B . n 
B 1 8  ARG 8  66  66  ARG ARG B . n 
B 1 9  GLU 9  67  67  GLU GLU B . n 
B 1 10 GLN 10 68  68  GLN GLN B . n 
B 1 11 LEU 11 69  69  LEU LEU B . n 
B 1 12 GLY 12 70  70  GLY GLY B . n 
B 1 13 GLN 13 71  71  GLN GLN B . n 
B 1 14 LYS 14 72  72  LYS LYS B . n 
B 1 15 PHE 15 73  73  PHE PHE B . n 
B 1 16 GLU 16 74  74  GLU GLU B . n 
B 1 17 GLU 17 75  75  GLU GLU B . n 
B 1 18 ILE 18 76  76  ILE ILE B . n 
B 1 19 ARG 19 77  77  ARG ARG B . n 
B 1 20 TRP 20 78  78  TRP TRP B . n 
B 1 21 LEU 21 79  79  LEU LEU B . n 
B 1 22 ILE 22 80  80  ILE ILE B . n 
B 1 23 GLU 23 81  81  GLU GLU B . n 
B 1 24 GLU 24 82  82  GLU GLU B . n 
B 1 25 VAL 25 83  83  VAL VAL B . n 
B 1 26 ARG 26 84  84  ARG ARG B . n 
B 1 27 HIS 27 85  85  HIS HIS B . n 
B 1 28 ARG 28 86  86  ARG ARG B . n 
B 1 29 LEU 29 87  87  LEU LEU B . n 
B 1 30 LYS 30 88  88  LYS LYS B . n 
B 1 31 ILE 31 89  89  ILE ILE B . n 
B 1 32 THR 32 90  90  THR THR B . n 
B 1 33 GLU 33 91  91  GLU GLU B . n 
B 1 34 ASN 34 92  92  ASN ASN B . n 
B 1 35 SER 35 93  93  SER SER B . n 
B 1 36 PHE 36 94  94  PHE PHE B . n 
B 1 37 GLU 37 95  95  GLU GLU B . n 
B 1 38 GLN 38 96  96  GLN GLN B . n 
B 1 39 ILE 39 97  97  ILE ILE B . n 
B 1 40 THR 40 98  98  THR THR B . n 
B 1 41 PHE 41 99  99  PHE PHE B . n 
B 1 42 MET 42 100 100 MET MET B . n 
B 1 43 GLN 43 101 101 GLN GLN B . n 
B 1 44 ALA 44 102 102 ALA ALA B . n 
B 1 45 LEU 45 103 103 LEU LEU B . n 
B 1 46 GLN 46 104 104 GLN GLN B . n 
B 1 47 LEU 47 105 105 LEU LEU B . n 
B 1 48 LEU 48 106 106 LEU LEU B . n 
B 1 49 LEU 49 107 107 LEU LEU B . n 
B 1 50 GLU 50 108 108 GLU GLU B . n 
B 1 51 VAL 51 109 109 VAL VAL B . n 
B 1 52 GLU 52 110 110 GLU GLU B . n 
B 1 53 GLN 53 111 111 GLN GLN B . n 
B 1 54 GLU 54 112 112 GLU GLU B . n 
B 1 55 ILE 55 113 113 ILE ILE B . n 
B 1 56 ARG 56 114 114 ARG ARG B . n 
B 1 57 THR 57 115 115 THR THR B . n 
B 1 58 PHE 58 116 116 PHE PHE B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 author_defined_assembly   ?        monomeric 1 
3 software_defined_assembly PISA,PQS dimeric   2 
4 software_defined_assembly PISA     dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A   
2 1 B   
3 1 A,B 
4 1 A   
4 2 B   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 2540 ? 
3 MORE         -25  ? 
3 'SSA (A^2)'  6970 ? 
4 'ABSA (A^2)' 2440 ? 
4 MORE         -6   ? 
4 'SSA (A^2)'  7070 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 2_654 -y+1,x-y,z-1/3 -0.5000000000 -0.8660254038 0.0000000000 82.6910000000 0.8660254038 
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -20.3703333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-16 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 36.6153 18.4943 4.9896  0.0327 0.0280 0.0236 -0.0120 -0.0048 0.0111  0.0996  1.3060 0.6619 -0.2799 0.0405  -0.1202 
-0.0383 -0.0023 -0.0079 0.0006 0.1224 0.0721  0.0388 -0.1670 -0.0841 'X-RAY DIFFRACTION' 
2 ? refined 47.3771 20.6452 5.0394  0.0421 0.0154 0.0273 -0.0155 0.0185  -0.0053 0.0008  3.2932 0.6734 1.0704  -0.0705 0.5890  
0.0109  -0.0514 -0.0220 0.0082 0.0253 -0.0863 0.0180 0.0570  -0.0362 'X-RAY DIFFRACTION' 
3 ? refined 47.4080 20.0384 14.9174 0.0261 0.0456 0.0150 0.0200  -0.0044 -0.0171 -0.1333 1.4824 1.1298 -0.2254 -0.3547 0.4416  
-0.0725 -0.0359 0.0596  0.0724 0.1654 -0.0756 0.0693 0.1950  -0.0929 'X-RAY DIFFRACTION' 
4 ? refined 36.5085 18.8888 14.8256 0.0311 0.0176 0.0362 0.0233  0.0064  0.0072  -0.4309 0.4878 1.4857 -0.3359 0.4239  -0.0056 
0.0397  0.0376  -0.0178 0.0276 0.0429 0.0323  0.0787 -0.0980 -0.0826 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 5  63 A 29 87  ? A A 'X-RAY DIFFRACTION' ? 
2 2 A 35 93 A 58 116 ? A A 'X-RAY DIFFRACTION' ? 
3 3 B 5  63 B 29 87  ? B B 'X-RAY DIFFRACTION' ? 
4 4 B 35 93 B 58 116 ? B B 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.24    ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
SOLVE  phasing          .         ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    111 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    114 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.99 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     81 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     81 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_654 
_pdbx_validate_symm_contact.dist              2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CD A GLU 67  ? ? OE2 A GLU 67  ? ? 1.340 1.252 0.088  0.011 N 
2  1 CG A GLN 71  ? ? CD  A GLN 71  ? ? 1.716 1.506 0.210  0.023 N 
3  1 CG A ARG 86  ? ? CD  A ARG 86  ? ? 1.310 1.515 -0.205 0.025 N 
4  1 CG A GLU 91  ? ? CD  A GLU 91  ? ? 1.638 1.515 0.123  0.015 N 
5  1 CD A GLU 91  ? ? OE1 A GLU 91  ? ? 1.333 1.252 0.081  0.011 N 
6  1 CD A GLU 95  ? ? OE1 A GLU 95  ? ? 1.323 1.252 0.071  0.011 N 
7  1 CA A ILE 113 ? ? CB  A ILE 113 ? ? 1.398 1.544 -0.146 0.023 N 
8  1 CB B TRP 65  ? ? CG  B TRP 65  ? ? 1.630 1.498 0.132  0.018 N 
9  1 CD B GLU 74  ? ? OE1 B GLU 74  ? ? 1.320 1.252 0.068  0.011 N 
10 1 CD B GLU 81  ? ? OE2 B GLU 81  ? ? 1.179 1.252 -0.073 0.011 N 
11 1 CD B GLU 91  ? ? OE1 B GLU 91  ? ? 1.321 1.252 0.069  0.011 N 
12 1 CD B GLU 95  ? ? OE1 B GLU 95  ? ? 1.323 1.252 0.071  0.011 N 
13 1 CD B GLU 110 ? ? OE1 B GLU 110 ? ? 1.342 1.252 0.090  0.011 N 
14 1 CG B GLN 111 ? ? CD  B GLN 111 ? ? 1.332 1.506 -0.174 0.023 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD  A ARG 77  ? ? NE  A ARG 77  ? ? CZ  A ARG 77  ? ? 132.18 123.60 8.58   1.40 N 
2  1 NE  A ARG 77  ? ? CZ  A ARG 77  ? ? NH2 A ARG 77  ? ? 114.49 120.30 -5.81  0.50 N 
3  1 CB  A ILE 80  ? ? CG1 A ILE 80  ? ? CD1 A ILE 80  ? ? 92.67  113.90 -21.23 2.80 N 
4  1 CG1 A VAL 83  ? ? CB  A VAL 83  ? ? CG2 A VAL 83  ? ? 99.49  110.90 -11.41 1.60 N 
5  1 NE  A ARG 84  ? ? CZ  A ARG 84  ? ? NH1 A ARG 84  ? ? 123.67 120.30 3.37   0.50 N 
6  1 NE  A ARG 84  ? ? CZ  A ARG 84  ? ? NH2 A ARG 84  ? ? 116.28 120.30 -4.02  0.50 N 
7  1 OE1 A GLU 95  ? ? CD  A GLU 95  ? ? OE2 A GLU 95  ? ? 131.75 123.30 8.45   1.20 N 
8  1 CB  A LEU 105 ? ? CG  A LEU 105 ? ? CD2 A LEU 105 ? ? 98.22  111.00 -12.78 1.70 N 
9  1 NE  A ARG 114 ? ? CZ  A ARG 114 ? ? NH1 A ARG 114 ? ? 115.73 120.30 -4.57  0.50 N 
10 1 NE  A ARG 114 ? ? CZ  A ARG 114 ? ? NH2 A ARG 114 ? ? 123.34 120.30 3.04   0.50 N 
11 1 NE  B ARG 66  ? ? CZ  B ARG 66  ? ? NH1 B ARG 66  ? ? 117.13 120.30 -3.17  0.50 N 
12 1 CA  B LEU 79  ? ? CB  B LEU 79  ? ? CG  B LEU 79  ? ? 130.99 115.30 15.69  2.30 N 
13 1 CA  B GLU 81  ? ? CB  B GLU 81  ? ? CG  B GLU 81  ? ? 97.66  113.40 -15.74 2.20 N 
14 1 NE  B ARG 84  ? ? CZ  B ARG 84  ? ? NH1 B ARG 84  ? ? 124.01 120.30 3.71   0.50 N 
15 1 NE  B ARG 84  ? ? CZ  B ARG 84  ? ? NH2 B ARG 84  ? ? 114.24 120.30 -6.06  0.50 N 
16 1 OE1 B GLU 95  ? ? CD  B GLU 95  ? ? OE2 B GLU 95  ? ? 131.35 123.30 8.05   1.20 N 
17 1 CB  B LEU 105 ? ? CG  B LEU 105 ? ? CD2 B LEU 105 ? ? 100.72 111.00 -10.28 1.70 N 
18 1 CA  B GLN 111 ? ? CB  B GLN 111 ? ? CG  B GLN 111 ? ? 98.16  113.40 -15.24 2.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS B 64  ? ? -57.64 -3.91  
2 1 THR B 115 ? ? -80.74 -76.61 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLN 59 ? A GLN 1 
2 1 Y 1 A ASN 60 ? A ASN 2 
3 1 Y 1 A ARG 61 ? A ARG 3 
4 1 Y 1 A ASN 62 ? A ASN 4 
5 1 Y 1 B GLN 59 ? B GLN 1 
6 1 Y 1 B ASN 60 ? B ASN 2 
7 1 Y 1 B ARG 61 ? B ARG 3 
8 1 Y 1 B ASN 62 ? B ASN 4 
#