data_1PEW
# 
_entry.id   1PEW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PEW         
RCSB  RCSB019279   
WWPDB D_1000019279 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1CD0 
_pdbx_database_related.details        'Wild Type protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PEW 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dealwis, C.'   1 
'Gupta, V.'     2 
'Wilkerson, M.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis of light chain amyloidogenicity: comparison of the thermodynamic properties, fibrillogenic potential and tertiary structural features of four V(lambda)6 proteins
;
_citation.journal_abbrev            J.Mol.Recog. 
_citation.journal_volume            17 
_citation.page_first                323 
_citation.page_last                 331 
_citation.year                      2004 
_citation.journal_id_ASTM           JMORE4 
_citation.country                   UK 
_citation.journal_id_ISSN           0952-3499 
_citation.journal_id_CSD            0814 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15227639 
_citation.pdbx_database_id_DOI      10.1002/jmr.681 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wall, J.S.'    1 
primary 'Gupta, V.'     2 
primary 'Wilkerson, M.' 3 
primary 'Schell, M.'    4 
primary 'Loris, R.'     5 
primary 'Adams, P.'     6 
primary 'Solomon, A.'   7 
primary 'Stevens, F.'   8 
primary 'Dealwis, C.'   9 
# 
_cell.entry_id           1PEW 
_cell.length_a           73.577 
_cell.length_b           73.577 
_cell.length_c           92.298 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PEW 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.cell_setting                     tetragonal 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                91 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN' 11898.972 2   ? D29A 
'IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN' ? 
2 non-polymer syn 'CADMIUM ION'                                                       112.411   4   ? ?    ? ? 
3 water       nat water                                                               18.015    104 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'immunoglobulin lambda light chain VLJ region' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQRSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLK
TEDEADYYCQSYDARNVVFGGGTRLTVLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQRSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLK
TEDEADYYCQSYDARNVVFGGGTRLTVLG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   PHE n 
1 3   MET n 
1 4   LEU n 
1 5   ASN n 
1 6   GLN n 
1 7   PRO n 
1 8   HIS n 
1 9   SER n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  LYS n 
1 17  THR n 
1 18  VAL n 
1 19  THR n 
1 20  ILE n 
1 21  SER n 
1 22  CYS n 
1 23  THR n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLY n 
1 28  ASN n 
1 29  ILE n 
1 30  ALA n 
1 31  SER n 
1 32  ASN n 
1 33  TYR n 
1 34  VAL n 
1 35  GLN n 
1 36  TRP n 
1 37  TYR n 
1 38  GLN n 
1 39  GLN n 
1 40  ARG n 
1 41  SER n 
1 42  ALA n 
1 43  PRO n 
1 44  ILE n 
1 45  THR n 
1 46  VAL n 
1 47  ILE n 
1 48  TYR n 
1 49  GLU n 
1 50  ASP n 
1 51  ASN n 
1 52  GLN n 
1 53  ARG n 
1 54  PRO n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  PRO n 
1 59  ASP n 
1 60  ARG n 
1 61  PHE n 
1 62  ALA n 
1 63  GLY n 
1 64  SER n 
1 65  ILE n 
1 66  ASP n 
1 67  ARG n 
1 68  SER n 
1 69  SER n 
1 70  ASN n 
1 71  SER n 
1 72  ALA n 
1 73  SER n 
1 74  LEU n 
1 75  THR n 
1 76  ILE n 
1 77  SER n 
1 78  GLY n 
1 79  LEU n 
1 80  LYS n 
1 81  THR n 
1 82  GLU n 
1 83  ASP n 
1 84  GLU n 
1 85  ALA n 
1 86  ASP n 
1 87  TYR n 
1 88  TYR n 
1 89  CYS n 
1 90  GLN n 
1 91  SER n 
1 92  TYR n 
1 93  ASP n 
1 94  ALA n 
1 95  ARG n 
1 96  ASN n 
1 97  VAL n 
1 98  VAL n 
1 99  PHE n 
1 100 GLY n 
1 101 GLY n 
1 102 GLY n 
1 103 THR n 
1 104 ARG n 
1 105 LEU n 
1 106 THR n 
1 107 VAL n 
1 108 LEU n 
1 109 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Jto 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Bl21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-27b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LV6C_HUMAN 
_struct_ref.pdbx_db_accession          P06317 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PEW A 2 ? 109 ? P06317 2 ? 111 ? 2 108 
2 1 1PEW B 2 ? 109 ? P06317 2 ? 111 ? 2 108 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CD  non-polymer         . 'CADMIUM ION'   ? 'Cd 2'           112.411 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PEW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   51.2 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
;0.1M Na Acetate, 0.8M Amm. Sulfate, 100mM Cadmium chloride, 10% n-Decyl-B-D-maltoside, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   'RIGAKU AFC-5R' 
_diffrn_detector.pdbx_collection_date   2001-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1PEW 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.60 
_reflns.d_resolution_low             15. 
_reflns.number_all                   32368 
_reflns.number_obs                   31495 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   93.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.515 
_reflns_shell.meanI_over_sigI_obs    5.4 
_reflns_shell.pdbx_redundancy        11.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3339 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1PEW 
_refine.ls_number_reflns_obs                     31495 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          4. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    97.30 
_refine.ls_R_factor_obs                          0.2533 
_refine.ls_R_factor_all                          0.295 
_refine.ls_R_factor_R_work                       0.2522 
_refine.ls_R_factor_R_free                       0.27291 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1633 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.918 
_refine.correlation_coeff_Fo_to_Fc_free          0.907 
_refine.B_iso_mean                               12.751 
_refine.aniso_B[1][1]                            0.14 
_refine.aniso_B[2][2]                            0.14 
_refine.aniso_B[3][3]                            -0.28 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1CD0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.125 
_refine.pdbx_overall_ESU_R_Free                  0.114 
_refine.overall_SU_ML                            0.114 
_refine.overall_SU_B                             3.385 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1647 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               1755 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017 0.021 ? 1687 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.290 1.939 ? 2288 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.962 5.000 ? 212  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.082 0.200 ? 251  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004 0.020 ? 1318 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.228 0.200 ? 777  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.208 0.200 ? 3    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.234 0.200 ? 139  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.334 0.200 ? 58   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.352 0.200 ? 11   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.530 1.500 ? 1070 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.904 2.000 ? 1727 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.565 3.000 ? 617  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.234 4.500 ? 561  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.641 
_refine_ls_shell.number_reflns_R_work             2114 
_refine_ls_shell.R_factor_R_work                  0.356 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             109 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1PEW 
_struct.title                     
'High Resolution Crystal Structure of Jto2, a mutant of the non-amyloidogenic Lamba6 Light Chain, Jto' 
_struct.pdbx_descriptor           'Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE DOMAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PEW 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Beta Sheet, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 28 B ASN A 32 ? ASN A 27 ASN A 31 5 ? 5 
HELX_P HELX_P2 2 LYS A 80 ? GLU A 84 ? LYS A 79 GLU A 83 5 ? 5 
HELX_P HELX_P3 3 ASN B 28 B ASN B 32 ? ASN B 27 ASN B 31 5 ? 5 
HELX_P HELX_P4 4 ARG B 67 B SER B 69 ? ARG B 66 SER B 68 5 ? 3 
HELX_P HELX_P5 5 LYS B 80 ? GLU B 84 ? LYS B 79 GLU B 83 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 89 SG  ? ? A CYS 23  A CYS 88  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf2  disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 89 SG  ? ? B CYS 23  B CYS 88  1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc1  metalc ? ? C CD  .  CD ? ? ? 1_555 A ASP 86 OD1 ? ? A CD  901 A ASP 85  1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc2  metalc ? ? C CD  .  CD ? ? ? 1_555 A ASP 86 OD2 ? ? A CD  901 A ASP 85  1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc3  metalc ? ? C CD  .  CD ? ? ? 1_555 G HOH .  O   ? ? A CD  901 A HOH 903 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc4  metalc ? ? C CD  .  CD ? ? ? 1_555 G HOH .  O   ? ? A CD  901 A HOH 904 1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc5  metalc ? ? C CD  .  CD ? ? ? 1_555 G HOH .  O   ? ? A CD  901 A HOH 905 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc6  metalc ? ? D CD  .  CD ? ? ? 1_555 B GLU 49 OE1 ? ? B CD  902 B GLU 50  1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc7  metalc ? ? D CD  .  CD ? ? ? 1_555 B GLU 49 OE2 ? ? B CD  902 B GLU 50  1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc8  metalc ? ? D CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  902 B HOH 911 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc9  metalc ? ? D CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  902 B HOH 918 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc10 metalc ? ? D CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  902 B HOH 950 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc11 metalc ? ? E CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  903 B HOH 913 1_555 ? ? ? ? ? ? ? 1.785 ? 
metalc12 metalc ? ? E CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  903 B HOH 938 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc13 metalc ? ? E CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  903 B HOH 941 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc14 metalc ? ? E CD  .  CD ? ? ? 1_555 B ASP 59 OD1 ? ? B CD  903 B ASP 60  1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc15 metalc ? ? E CD  .  CD ? ? ? 1_555 B ASP 59 OD2 ? ? B CD  903 B ASP 60  1_555 ? ? ? ? ? ? ? 3.054 ? 
metalc16 metalc ? ? E CD  .  CD ? ? ? 1_555 H HOH .  O   ? ? B CD  903 B HOH 916 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc17 metalc ? ? F CD  .  CD ? ? ? 1_555 B ASP 86 OD1 ? ? B CD  904 B ASP 85  1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc18 metalc ? ? F CD  .  CD ? ? ? 1_555 B ASP 86 OD2 ? ? B CD  904 B ASP 85  1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc19 metalc ? ? D CD  .  CD ? ? ? 1_555 A ASP 59 OD1 ? ? B CD  902 A ASP 60  3_435 ? ? ? ? ? ? ? 2.233 ? 
metalc20 metalc ? ? E CD  .  CD ? ? ? 1_555 A GLU 49 OE2 ? ? B CD  903 A GLU 50  3_435 ? ? ? ? ? ? ? 2.425 ? 
metalc21 metalc ? ? E CD  .  CD ? ? ? 1_555 A GLU 49 OE1 ? ? B CD  903 A GLU 50  3_435 ? ? ? ? ? ? ? 2.378 ? 
metalc22 metalc ? ? F CD  .  CD ? ? ? 1_555 A HIS 8  NE2 ? ? B CD  904 A HIS 8   5_554 ? ? ? ? ? ? ? 3.034 ? 
metalc23 metalc ? ? F CD  .  CD ? ? ? 1_555 G HOH .  O   ? ? B CD  904 A HOH 902 5_554 ? ? ? ? ? ? ? 2.477 ? 
metalc24 metalc ? ? F CD  .  CD ? ? ? 1_555 B SER 41 N   ? ? B CD  904 B SER 42  5_554 ? ? ? ? ? ? ? 2.191 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 5 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? ASN A 5   ? LEU A 4   ASN A 5   
A 2 VAL A 18  ? ARG A 24  ? VAL A 19  ARG A 25  
A 3 SER A 71  ? ILE A 76  ? SER A 70  ILE A 75  
A 4 PHE A 61  ? ASP A 66  A PHE A 62  ASP A 66  
B 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 13  
B 2 THR A 103 ? VAL A 107 ? THR A 102 VAL A 106 
B 3 ALA A 85  ? ASP A 93  ? ALA A 84  ASP A 92  
B 4 GLN A 35  ? GLN A 39  ? GLN A 34  GLN A 38  
B 5 ILE A 44  ? ILE A 47  ? ILE A 45  ILE A 48  
C 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 13  
C 2 THR A 103 ? VAL A 107 ? THR A 102 VAL A 106 
C 3 ALA A 85  ? ASP A 93  ? ALA A 84  ASP A 92  
C 4 ASN A 96  ? PHE A 99  ? ASN A 95  PHE A 98  
D 1 LEU B 4   ? ASN B 5   ? LEU B 4   ASN B 5   
D 2 VAL B 18  ? ARG B 24  ? VAL B 19  ARG B 25  
D 3 SER B 71  ? ILE B 76  ? SER B 70  ILE B 75  
D 4 PHE B 61  ? ASP B 66  A PHE B 62  ASP B 66  
E 1 SER B 9   ? GLU B 12  ? SER B 9   GLU B 13  
E 2 THR B 103 ? VAL B 107 ? THR B 102 VAL B 106 
E 3 ASP B 86  ? TYR B 92  ? ASP B 85  TYR B 91  
E 4 GLN B 35  ? GLN B 39  ? GLN B 34  GLN B 38  
E 5 ILE B 44  ? ILE B 47  ? ILE B 45  ILE B 48  
F 1 SER B 9   ? GLU B 12  ? SER B 9   GLU B 13  
F 2 THR B 103 ? VAL B 107 ? THR B 102 VAL B 106 
F 3 ASP B 86  ? TYR B 92  ? ASP B 85  TYR B 91  
F 4 VAL B 97  ? PHE B 99  ? VAL B 96  PHE B 98  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 5   ? N ASN A 5   O THR A 23  ? O THR A 24  
A 2 3 N ILE A 20  ? N ILE A 21  O LEU A 74  ? O LEU A 73  
A 3 4 O THR A 75  ? O THR A 74  N ALA A 62  ? N ALA A 63  
B 1 2 N VAL A 10  ? N VAL A 11  O ARG A 104 ? O ARG A 103 
B 2 3 O LEU A 105 ? O LEU A 104 N ALA A 85  ? N ALA A 84  
B 3 4 O TYR A 88  ? O TYR A 87  N TYR A 37  ? N TYR A 36  
B 4 5 N TRP A 36  ? N TRP A 35  O VAL A 46  ? O VAL A 47  
C 1 2 N VAL A 10  ? N VAL A 11  O ARG A 104 ? O ARG A 103 
C 2 3 O LEU A 105 ? O LEU A 104 N ALA A 85  ? N ALA A 84  
C 3 4 N SER A 91  ? N SER A 90  O VAL A 98  ? O VAL A 97  
D 1 2 N ASN B 5   ? N ASN B 5   O THR B 23  ? O THR B 24  
D 2 3 N CYS B 22  ? N CYS B 23  O ALA B 72  ? O ALA B 71  
D 3 4 O SER B 71  ? O SER B 70  N ASP B 66  A N ASP B 66  
E 1 2 N VAL B 10  ? N VAL B 11  O ARG B 104 ? O ARG B 103 
E 2 3 O THR B 103 ? O THR B 102 N TYR B 87  ? N TYR B 86  
E 3 4 O TYR B 88  ? O TYR B 87  N TYR B 37  ? N TYR B 36  
E 4 5 N TRP B 36  ? N TRP B 35  O ILE B 47  ? O ILE B 48  
F 1 2 N VAL B 10  ? N VAL B 11  O ARG B 104 ? O ARG B 103 
F 2 3 O THR B 103 ? O THR B 102 N TYR B 87  ? N TYR B 86  
F 3 4 N SER B 91  ? N SER B 90  O VAL B 98  ? O VAL B 97  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CD A 901' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CD B 902' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CD B 903' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD B 904' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 86 ? ASP A 85  . ? 1_555 ? 
2  AC1 5 HOH G .  ? HOH A 903 . ? 1_555 ? 
3  AC1 5 HOH G .  ? HOH A 904 . ? 1_555 ? 
4  AC1 5 HOH G .  ? HOH A 905 . ? 1_555 ? 
5  AC1 5 HIS B 8  ? HIS B 8   . ? 5_554 ? 
6  AC2 5 ASP A 59 ? ASP A 60  . ? 3_435 ? 
7  AC2 5 GLU B 49 ? GLU B 50  . ? 1_555 ? 
8  AC2 5 HOH H .  ? HOH B 911 . ? 1_555 ? 
9  AC2 5 HOH H .  ? HOH B 918 . ? 1_555 ? 
10 AC2 5 HOH H .  ? HOH B 950 . ? 1_555 ? 
11 AC3 6 GLU A 49 ? GLU A 50  . ? 3_435 ? 
12 AC3 6 ASP B 59 ? ASP B 60  . ? 1_555 ? 
13 AC3 6 HOH H .  ? HOH B 913 . ? 1_555 ? 
14 AC3 6 HOH H .  ? HOH B 916 . ? 1_555 ? 
15 AC3 6 HOH H .  ? HOH B 938 . ? 1_555 ? 
16 AC3 6 HOH H .  ? HOH B 941 . ? 1_555 ? 
17 AC4 4 HIS A 8  ? HIS A 8   . ? 5_554 ? 
18 AC4 4 HOH G .  ? HOH A 902 . ? 5_554 ? 
19 AC4 4 SER B 41 ? SER B 42  . ? 5_554 ? 
20 AC4 4 ASP B 86 ? ASP B 85  . ? 1_555 ? 
# 
_atom_sites.entry_id                    1PEW 
_atom_sites.fract_transf_matrix[1][1]   0.013591 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013591 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010834 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 1   ? 22.620  -116.617 -52.664 1.00 14.21 ? 1   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 1   ? 22.250  -115.413 -53.443 1.00 14.21 ? 1   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 1   ? 21.251  -114.539 -52.688 1.00 13.52 ? 1   ASN A C   1 
ATOM   4    O  O   . ASN A 1 1   ? 21.304  -114.467 -51.455 1.00 14.16 ? 1   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 1   ? 21.699  -115.803 -54.822 1.00 14.89 ? 1   ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 1   ? 20.520  -116.770 -54.744 1.00 15.82 ? 1   ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 1   ? 20.546  -117.757 -54.005 1.00 17.18 ? 1   ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 1   ? 19.487  -116.491 -55.533 1.00 18.93 ? 1   ASN A ND2 1 
ATOM   9    N  N   . PHE A 1 2   ? 20.351  -113.894 -53.430 1.00 12.09 ? 2   PHE A N   1 
ATOM   10   C  CA  . PHE A 1 2   ? 19.300  -113.053 -52.861 1.00 11.09 ? 2   PHE A CA  1 
ATOM   11   C  C   . PHE A 1 2   ? 18.027  -113.054 -53.705 1.00 10.65 ? 2   PHE A C   1 
ATOM   12   O  O   . PHE A 1 2   ? 18.010  -113.557 -54.830 1.00 10.22 ? 2   PHE A O   1 
ATOM   13   C  CB  . PHE A 1 2   ? 19.797  -111.612 -52.660 1.00 10.44 ? 2   PHE A CB  1 
ATOM   14   C  CG  . PHE A 1 2   ? 20.225  -110.921 -53.930 1.00 10.24 ? 2   PHE A CG  1 
ATOM   15   C  CD1 . PHE A 1 2   ? 19.329  -110.115 -54.642 1.00 8.86  ? 2   PHE A CD1 1 
ATOM   16   C  CD2 . PHE A 1 2   ? 21.530  -111.056 -54.406 1.00 10.13 ? 2   PHE A CD2 1 
ATOM   17   C  CE1 . PHE A 1 2   ? 19.732  -109.460 -55.812 1.00 10.26 ? 2   PHE A CE1 1 
ATOM   18   C  CE2 . PHE A 1 2   ? 21.935  -110.406 -55.578 1.00 9.71  ? 2   PHE A CE2 1 
ATOM   19   C  CZ  . PHE A 1 2   ? 21.036  -109.615 -56.276 1.00 10.41 ? 2   PHE A CZ  1 
ATOM   20   N  N   . MET A 1 3   ? 16.953  -112.517 -53.137 1.00 10.36 ? 3   MET A N   1 
ATOM   21   C  CA  . MET A 1 3   ? 15.763  -112.215 -53.920 1.00 10.61 ? 3   MET A CA  1 
ATOM   22   C  C   . MET A 1 3   ? 15.468  -110.717 -53.869 1.00 10.49 ? 3   MET A C   1 
ATOM   23   O  O   . MET A 1 3   ? 15.964  -110.003 -52.993 1.00 9.95  ? 3   MET A O   1 
ATOM   24   C  CB  . MET A 1 3   ? 14.534  -113.047 -53.525 1.00 11.08 ? 3   MET A CB  1 
ATOM   25   C  CG  . MET A 1 3   ? 14.367  -113.342 -52.068 1.00 12.71 ? 3   MET A CG  1 
ATOM   26   S  SD  . MET A 1 3   ? 13.360  -114.816 -51.820 1.00 15.29 ? 3   MET A SD  1 
ATOM   27   C  CE  . MET A 1 3   ? 14.089  -115.413 -50.353 1.00 13.31 ? 3   MET A CE  1 
ATOM   28   N  N   . LEU A 1 4   ? 14.672  -110.264 -54.825 1.00 10.71 ? 4   LEU A N   1 
ATOM   29   C  CA  . LEU A 1 4   ? 14.190  -108.889 -54.841 1.00 10.82 ? 4   LEU A CA  1 
ATOM   30   C  C   . LEU A 1 4   ? 12.687  -108.898 -54.728 1.00 11.33 ? 4   LEU A C   1 
ATOM   31   O  O   . LEU A 1 4   ? 12.005  -109.527 -55.541 1.00 12.54 ? 4   LEU A O   1 
ATOM   32   C  CB  . LEU A 1 4   ? 14.605  -108.172 -56.126 1.00 10.96 ? 4   LEU A CB  1 
ATOM   33   C  CG  . LEU A 1 4   ? 16.101  -108.058 -56.414 1.00 10.15 ? 4   LEU A CG  1 
ATOM   34   C  CD1 . LEU A 1 4   ? 16.305  -107.619 -57.849 1.00 9.85  ? 4   LEU A CD1 1 
ATOM   35   C  CD2 . LEU A 1 4   ? 16.781  -107.090 -55.452 1.00 9.52  ? 4   LEU A CD2 1 
ATOM   36   N  N   . ASN A 1 5   ? 12.170  -108.212 -53.714 1.00 11.06 ? 5   ASN A N   1 
ATOM   37   C  CA  . ASN A 1 5   ? 10.740  -108.193 -53.465 1.00 11.04 ? 5   ASN A CA  1 
ATOM   38   C  C   . ASN A 1 5   ? 10.117  -106.834 -53.730 1.00 10.26 ? 5   ASN A C   1 
ATOM   39   O  O   . ASN A 1 5   ? 10.596  -105.801 -53.258 1.00 9.75  ? 5   ASN A O   1 
ATOM   40   C  CB  . ASN A 1 5   ? 10.413  -108.641 -52.042 1.00 11.70 ? 5   ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 5   ? 8.996   -109.149 -51.908 1.00 13.08 ? 5   ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 5   ? 8.120   -108.451 -51.392 1.00 14.72 ? 5   ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 5   ? 8.756   -110.377 -52.373 1.00 14.17 ? 5   ASN A ND2 1 
ATOM   44   N  N   . GLN A 1 6   ? 9.046   -106.856 -54.503 1.00 10.12 ? 6   GLN A N   1 
ATOM   45   C  CA  . GLN A 1 6   ? 8.254   -105.669 -54.769 1.00 10.06 ? 6   GLN A CA  1 
ATOM   46   C  C   . GLN A 1 6   ? 6.795   -105.943 -54.475 1.00 9.54  ? 6   GLN A C   1 
ATOM   47   O  O   . GLN A 1 6   ? 6.366   -107.111 -54.509 1.00 9.06  ? 6   GLN A O   1 
ATOM   48   C  CB  . GLN A 1 6   ? 8.380   -105.216 -56.227 1.00 10.82 ? 6   GLN A CB  1 
ATOM   49   C  CG  . GLN A 1 6   ? 9.026   -106.186 -57.172 1.00 12.54 ? 6   GLN A CG  1 
ATOM   50   C  CD  . GLN A 1 6   ? 9.276   -105.626 -58.577 1.00 11.36 ? 6   GLN A CD  1 
ATOM   51   O  OE1 . GLN A 1 6   ? 9.971   -106.262 -59.372 1.00 12.96 ? 6   GLN A OE1 1 
ATOM   52   N  NE2 . GLN A 1 6   ? 8.689   -104.488 -58.892 1.00 9.37  ? 6   GLN A NE2 1 
ATOM   53   N  N   . PRO A 1 7   ? 6.025   -104.885 -54.222 1.00 9.09  ? 7   PRO A N   1 
ATOM   54   C  CA  . PRO A 1 7   ? 4.572   -105.020 -54.041 1.00 9.06  ? 7   PRO A CA  1 
ATOM   55   C  C   . PRO A 1 7   ? 3.941   -105.501 -55.351 1.00 8.68  ? 7   PRO A C   1 
ATOM   56   O  O   . PRO A 1 7   ? 4.499   -105.222 -56.407 1.00 7.68  ? 7   PRO A O   1 
ATOM   57   C  CB  . PRO A 1 7   ? 4.142   -103.581 -53.742 1.00 9.61  ? 7   PRO A CB  1 
ATOM   58   C  CG  . PRO A 1 7   ? 5.184   -102.709 -54.395 1.00 9.42  ? 7   PRO A CG  1 
ATOM   59   C  CD  . PRO A 1 7   ? 6.463   -103.469 -54.174 1.00 9.64  ? 7   PRO A CD  1 
ATOM   60   N  N   . HIS A 1 8   ? 2.757   -106.075 -55.568 1.00 6.02  ? 8   HIS A N   1 
ATOM   61   C  CA  . HIS A 1 8   ? 2.377   -106.449 -56.916 1.00 7.16  ? 8   HIS A CA  1 
ATOM   62   C  C   . HIS A 1 8   ? 1.637   -105.243 -57.413 1.00 6.65  ? 8   HIS A C   1 
ATOM   63   O  O   . HIS A 1 8   ? 1.656   -104.992 -58.609 1.00 5.81  ? 8   HIS A O   1 
ATOM   64   C  CB  . HIS A 1 8   ? 1.441   -107.677 -57.095 1.00 8.97  ? 8   HIS A CB  1 
ATOM   65   C  CG  . HIS A 1 8   ? 0.737   -108.057 -55.776 1.00 12.79 ? 8   HIS A CG  1 
ATOM   66   N  ND1 . HIS A 1 8   ? 1.493   -108.503 -54.727 1.00 17.17 ? 8   HIS A ND1 1 
ATOM   67   C  CD2 . HIS A 1 8   ? -0.550  -108.068 -55.385 1.00 15.16 ? 8   HIS A CD2 1 
ATOM   68   C  CE1 . HIS A 1 8   ? 0.687   -108.783 -53.714 1.00 16.63 ? 8   HIS A CE1 1 
ATOM   69   N  NE2 . HIS A 1 8   ? -0.557  -108.518 -54.086 1.00 17.13 ? 8   HIS A NE2 1 
ATOM   70   N  N   . SER A 1 9   ? 1.137   -104.499 -56.665 1.00 9.47  ? 9   SER A N   1 
ATOM   71   C  CA  . SER A 1 9   ? 0.316   -103.441 -57.251 1.00 10.88 ? 9   SER A CA  1 
ATOM   72   C  C   . SER A 1 9   ? 0.581   -102.091 -56.607 1.00 11.19 ? 9   SER A C   1 
ATOM   73   O  O   . SER A 1 9   ? 0.802   -101.992 -55.397 1.00 12.28 ? 9   SER A O   1 
ATOM   74   C  CB  . SER A 1 9   ? -1.179  -103.761 -57.129 1.00 10.29 ? 9   SER A CB  1 
ATOM   75   O  OG  . SER A 1 9   ? -1.549  -105.064 -57.612 1.00 11.94 ? 9   SER A OG  1 
ATOM   76   N  N   . VAL A 1 10  ? 0.571   -101.050 -57.430 1.00 11.40 ? 11  VAL A N   1 
ATOM   77   C  CA  . VAL A 1 10  ? 0.536   -99.677  -56.931 1.00 11.56 ? 11  VAL A CA  1 
ATOM   78   C  C   . VAL A 1 10  ? -0.439  -98.917  -57.837 1.00 10.95 ? 11  VAL A C   1 
ATOM   79   O  O   . VAL A 1 10  ? -0.620  -99.279  -59.003 1.00 10.46 ? 11  VAL A O   1 
ATOM   80   C  CB  . VAL A 1 10  ? 1.926   -98.992  -56.902 1.00 12.00 ? 11  VAL A CB  1 
ATOM   81   C  CG1 . VAL A 1 10  ? 1.782   -97.620  -56.338 1.00 12.24 ? 11  VAL A CG1 1 
ATOM   82   C  CG2 . VAL A 1 10  ? 2.969   -99.751  -56.028 1.00 13.11 ? 11  VAL A CG2 1 
ATOM   83   N  N   . SER A 1 11  ? -1.088  -97.884  -57.304 1.00 10.64 ? 12  SER A N   1 
ATOM   84   C  CA  . SER A 1 11  ? -2.002  -97.089  -58.098 1.00 10.98 ? 12  SER A CA  1 
ATOM   85   C  C   . SER A 1 11  ? -1.895  -95.620  -57.742 1.00 10.51 ? 12  SER A C   1 
ATOM   86   O  O   . SER A 1 11  ? -1.459  -95.271  -56.644 1.00 9.74  ? 12  SER A O   1 
ATOM   87   C  CB  . SER A 1 11  ? -3.448  -97.587  -57.968 1.00 10.92 ? 12  SER A CB  1 
ATOM   88   O  OG  . SER A 1 11  ? -3.994  -97.348  -56.682 1.00 13.51 ? 12  SER A OG  1 
ATOM   89   N  N   . GLU A 1 12  ? -2.300  -94.777  -58.688 1.00 10.67 ? 13  GLU A N   1 
ATOM   90   C  CA  . GLU A 1 12  ? -2.260  -93.330  -58.539 1.00 11.09 ? 13  GLU A CA  1 
ATOM   91   C  C   . GLU A 1 12  ? -3.023  -92.703  -59.690 1.00 10.66 ? 13  GLU A C   1 
ATOM   92   O  O   . GLU A 1 12  ? -3.251  -93.346  -60.721 1.00 10.67 ? 13  GLU A O   1 
ATOM   93   C  CB  . GLU A 1 12  ? -0.804  -92.863  -58.585 1.00 12.05 ? 13  GLU A CB  1 
ATOM   94   C  CG  . GLU A 1 12  ? -0.488  -91.599  -57.832 1.00 15.09 ? 13  GLU A CG  1 
ATOM   95   C  CD  . GLU A 1 12  ? -0.629  -91.733  -56.330 1.00 18.27 ? 13  GLU A CD  1 
ATOM   96   O  OE1 . GLU A 1 12  ? -1.286  -90.852  -55.722 1.00 18.43 ? 13  GLU A OE1 1 
ATOM   97   O  OE2 . GLU A 1 12  ? -0.074  -92.710  -55.767 1.00 21.21 ? 13  GLU A OE2 1 
ATOM   98   N  N   . SER A 1 13  ? -3.407  -91.443  -59.499 1.00 10.37 ? 14  SER A N   1 
ATOM   99   C  CA  . SER A 1 13  ? -4.105  -90.645  -60.493 1.00 10.70 ? 14  SER A CA  1 
ATOM   100  C  C   . SER A 1 13  ? -3.100  -89.968  -61.429 1.00 10.44 ? 14  SER A C   1 
ATOM   101  O  O   . SER A 1 13  ? -1.954  -89.754  -61.039 1.00 10.16 ? 14  SER A O   1 
ATOM   102  C  CB  . SER A 1 13  ? -4.934  -89.583  -59.773 1.00 10.58 ? 14  SER A CB  1 
ATOM   103  O  OG  . SER A 1 13  ? -6.028  -90.159  -59.076 1.00 12.21 ? 14  SER A OG  1 
ATOM   104  N  N   . PRO A 1 14  ? -3.512  -89.624  -62.657 1.00 10.61 ? 15  PRO A N   1 
ATOM   105  C  CA  . PRO A 1 14  ? -2.628  -88.889  -63.576 1.00 10.52 ? 15  PRO A CA  1 
ATOM   106  C  C   . PRO A 1 14  ? -2.128  -87.573  -62.971 1.00 9.75  ? 15  PRO A C   1 
ATOM   107  O  O   . PRO A 1 14  ? -2.868  -86.940  -62.234 1.00 9.98  ? 15  PRO A O   1 
ATOM   108  C  CB  . PRO A 1 14  ? -3.527  -88.593  -64.780 1.00 10.34 ? 15  PRO A CB  1 
ATOM   109  C  CG  . PRO A 1 14  ? -4.611  -89.615  -64.720 1.00 11.23 ? 15  PRO A CG  1 
ATOM   110  C  CD  . PRO A 1 14  ? -4.817  -89.918  -63.271 1.00 10.89 ? 15  PRO A CD  1 
ATOM   111  N  N   . GLY A 1 15  ? -0.882  -87.213  -63.272 1.00 9.79  ? 16  GLY A N   1 
ATOM   112  C  CA  . GLY A 1 15  ? -0.253  -86.007  -62.757 1.00 9.10  ? 16  GLY A CA  1 
ATOM   113  C  C   . GLY A 1 15  ? 0.460   -86.195  -61.428 1.00 9.37  ? 16  GLY A C   1 
ATOM   114  O  O   . GLY A 1 15  ? 1.256   -85.342  -61.018 1.00 8.95  ? 16  GLY A O   1 
ATOM   115  N  N   . LYS A 1 16  ? 0.184   -87.316  -60.764 1.00 9.43  ? 17  LYS A N   1 
ATOM   116  C  CA  . LYS A 1 16  ? 0.694   -87.577  -59.424 1.00 9.73  ? 17  LYS A CA  1 
ATOM   117  C  C   . LYS A 1 16  ? 1.988   -88.363  -59.455 1.00 10.10 ? 17  LYS A C   1 
ATOM   118  O  O   . LYS A 1 16  ? 2.424   -88.788  -60.516 1.00 9.29  ? 17  LYS A O   1 
ATOM   119  C  CB  . LYS A 1 16  ? -0.379  -88.258  -58.573 1.00 9.92  ? 17  LYS A CB  1 
ATOM   120  C  CG  . LYS A 1 16  ? -1.533  -87.322  -58.203 1.00 11.87 ? 17  LYS A CG  1 
ATOM   121  C  CD  . LYS A 1 16  ? -2.451  -87.943  -57.177 1.00 14.54 ? 17  LYS A CD  1 
ATOM   122  C  CE  . LYS A 1 16  ? -3.237  -86.869  -56.437 1.00 16.70 ? 17  LYS A CE  1 
ATOM   123  N  NZ  . LYS A 1 16  ? -3.953  -87.427  -55.256 1.00 17.64 ? 17  LYS A NZ  1 
ATOM   124  N  N   . THR A 1 17  ? 2.617   -88.532  -58.297 1.00 10.55 ? 18  THR A N   1 
ATOM   125  C  CA  . THR A 1 17  ? 3.878   -89.277  -58.223 1.00 10.71 ? 18  THR A CA  1 
ATOM   126  C  C   . THR A 1 17  ? 3.663   -90.623  -57.544 1.00 10.67 ? 18  THR A C   1 
ATOM   127  O  O   . THR A 1 17  ? 2.971   -90.711  -56.528 1.00 11.10 ? 18  THR A O   1 
ATOM   128  C  CB  . THR A 1 17  ? 4.951   -88.462  -57.472 1.00 10.45 ? 18  THR A CB  1 
ATOM   129  O  OG1 . THR A 1 17  ? 5.245   -87.243  -58.175 1.00 11.42 ? 18  THR A OG1 1 
ATOM   130  C  CG2 . THR A 1 17  ? 6.290   -89.194  -57.464 1.00 12.05 ? 18  THR A CG2 1 
ATOM   131  N  N   . VAL A 1 18  ? 4.253   -91.672  -58.109 1.00 9.69  ? 19  VAL A N   1 
ATOM   132  C  CA  . VAL A 1 18  ? 4.178   -92.989  -57.503 1.00 10.26 ? 19  VAL A CA  1 
ATOM   133  C  C   . VAL A 1 18  ? 5.585   -93.619  -57.328 1.00 10.08 ? 19  VAL A C   1 
ATOM   134  O  O   . VAL A 1 18  ? 6.477   -93.366  -58.131 1.00 10.60 ? 19  VAL A O   1 
ATOM   135  C  CB  . VAL A 1 18  ? 3.260   -93.897  -58.346 1.00 11.08 ? 19  VAL A CB  1 
ATOM   136  C  CG1 . VAL A 1 18  ? 3.894   -94.215  -59.686 1.00 11.99 ? 19  VAL A CG1 1 
ATOM   137  C  CG2 . VAL A 1 18  ? 2.956   -95.140  -57.617 1.00 12.02 ? 19  VAL A CG2 1 
ATOM   138  N  N   . THR A 1 19  ? 5.762   -94.436  -56.289 1.00 9.83  ? 20  THR A N   1 
ATOM   139  C  CA  . THR A 1 19  ? 7.050   -95.089  -56.042 1.00 11.21 ? 20  THR A CA  1 
ATOM   140  C  C   . THR A 1 19  ? 6.873   -96.584  -55.931 1.00 10.59 ? 20  THR A C   1 
ATOM   141  O  O   . THR A 1 19  ? 5.985   -97.053  -55.230 1.00 11.92 ? 20  THR A O   1 
ATOM   142  C  CB  . THR A 1 19  ? 7.703   -94.549  -54.764 1.00 10.67 ? 20  THR A CB  1 
ATOM   143  O  OG1 . THR A 1 19  ? 7.861   -93.127  -54.876 1.00 13.33 ? 20  THR A OG1 1 
ATOM   144  C  CG2 . THR A 1 19  ? 9.143   -95.028  -54.642 1.00 11.37 ? 20  THR A CG2 1 
ATOM   145  N  N   . ILE A 1 20  ? 7.735   -97.319  -56.613 1.00 9.87  ? 21  ILE A N   1 
ATOM   146  C  CA  . ILE A 1 20  ? 7.729   -98.774  -56.549 1.00 10.09 ? 21  ILE A CA  1 
ATOM   147  C  C   . ILE A 1 20  ? 9.058   -99.157  -55.929 1.00 10.28 ? 21  ILE A C   1 
ATOM   148  O  O   . ILE A 1 20  ? 10.105  -98.786  -56.461 1.00 10.87 ? 21  ILE A O   1 
ATOM   149  C  CB  . ILE A 1 20  ? 7.615   -99.370  -57.960 1.00 9.54  ? 21  ILE A CB  1 
ATOM   150  C  CG1 . ILE A 1 20  ? 6.259   -99.000  -58.587 1.00 10.79 ? 21  ILE A CG1 1 
ATOM   151  C  CG2 . ILE A 1 20  ? 7.854   -100.897 -57.932 1.00 10.83 ? 21  ILE A CG2 1 
ATOM   152  C  CD1 . ILE A 1 20  ? 6.121   -99.351  -60.079 1.00 10.33 ? 21  ILE A CD1 1 
ATOM   153  N  N   . SER A 1 21  ? 9.027   -99.892  -54.823 1.00 10.57 ? 22  SER A N   1 
ATOM   154  C  CA  . SER A 1 21  ? 10.276  -100.272 -54.156 1.00 10.77 ? 22  SER A CA  1 
ATOM   155  C  C   . SER A 1 21  ? 10.615  -101.711 -54.433 1.00 10.39 ? 22  SER A C   1 
ATOM   156  O  O   . SER A 1 21  ? 9.729   -102.518 -54.683 1.00 10.89 ? 22  SER A O   1 
ATOM   157  C  CB  . SER A 1 21  ? 10.223  -100.016 -52.651 1.00 11.06 ? 22  SER A CB  1 
ATOM   158  O  OG  . SER A 1 21  ? 9.325   -100.904 -51.997 1.00 15.06 ? 22  SER A OG  1 
ATOM   159  N  N   . CYS A 1 22  ? 11.898  -102.020 -54.295 1.00 10.19 ? 23  CYS A N   1 
ATOM   160  C  CA  . CYS A 1 22  ? 12.465  -103.318 -54.591 1.00 10.57 ? 23  CYS A CA  1 
ATOM   161  C  C   . CYS A 1 22  ? 13.414  -103.603 -53.441 1.00 9.78  ? 23  CYS A C   1 
ATOM   162  O  O   . CYS A 1 22  ? 14.478  -102.996 -53.386 1.00 8.63  ? 23  CYS A O   1 
ATOM   163  C  CB  . CYS A 1 22  ? 13.254  -103.151 -55.891 1.00 10.57 ? 23  CYS A CB  1 
ATOM   164  S  SG  . CYS A 1 22  ? 14.300  -104.497 -56.480 1.00 15.76 ? 23  CYS A SG  1 
ATOM   165  N  N   . THR A 1 23  ? 13.029  -104.507 -52.531 1.00 9.45  ? 24  THR A N   1 
ATOM   166  C  CA  . THR A 1 23  ? 13.845  -104.808 -51.359 1.00 10.46 ? 24  THR A CA  1 
ATOM   167  C  C   . THR A 1 23  ? 14.713  -106.016 -51.654 1.00 10.36 ? 24  THR A C   1 
ATOM   168  O  O   . THR A 1 23  ? 14.221  -107.019 -52.141 1.00 11.91 ? 24  THR A O   1 
ATOM   169  C  CB  . THR A 1 23  ? 12.933  -105.062 -50.130 1.00 10.45 ? 24  THR A CB  1 
ATOM   170  O  OG1 . THR A 1 23  ? 12.279  -103.831 -49.794 1.00 11.77 ? 24  THR A OG1 1 
ATOM   171  C  CG2 . THR A 1 23  ? 13.736  -105.379 -48.880 1.00 10.92 ? 24  THR A CG2 1 
ATOM   172  N  N   . ARG A 1 24  ? 16.002  -105.894 -51.372 1.00 10.44 ? 25  ARG A N   1 
ATOM   173  C  CA  . ARG A 1 24  ? 16.943  -107.010 -51.480 1.00 9.87  ? 25  ARG A CA  1 
ATOM   174  C  C   . ARG A 1 24  ? 17.014  -107.775 -50.163 1.00 9.92  ? 25  ARG A C   1 
ATOM   175  O  O   . ARG A 1 24  ? 17.113  -107.181 -49.093 1.00 9.41  ? 25  ARG A O   1 
ATOM   176  C  CB  . ARG A 1 24  ? 18.315  -106.481 -51.884 1.00 9.81  ? 25  ARG A CB  1 
ATOM   177  C  CG  . ARG A 1 24  ? 19.362  -107.558 -52.116 1.00 10.43 ? 25  ARG A CG  1 
ATOM   178  C  CD  . ARG A 1 24  ? 20.650  -107.043 -52.762 1.00 8.78  ? 25  ARG A CD  1 
ATOM   179  N  NE  . ARG A 1 24  ? 21.761  -107.973 -52.536 1.00 9.17  ? 25  ARG A NE  1 
ATOM   180  C  CZ  . ARG A 1 24  ? 22.869  -108.008 -53.259 1.00 8.05  ? 25  ARG A CZ  1 
ATOM   181  N  NH1 . ARG A 1 24  ? 23.029  -107.161 -54.274 1.00 8.74  ? 25  ARG A NH1 1 
ATOM   182  N  NH2 . ARG A 1 24  ? 23.833  -108.889 -52.964 1.00 8.15  ? 25  ARG A NH2 1 
ATOM   183  N  N   . SER A 1 25  ? 16.967  -109.099 -50.249 1.00 9.58  ? 26  SER A N   1 
ATOM   184  C  CA  . SER A 1 25  ? 16.790  -109.931 -49.058 1.00 10.41 ? 26  SER A CA  1 
ATOM   185  C  C   . SER A 1 25  ? 18.069  -110.182 -48.254 1.00 10.59 ? 26  SER A C   1 
ATOM   186  O  O   . SER A 1 25  ? 18.021  -110.326 -47.028 1.00 10.64 ? 26  SER A O   1 
ATOM   187  C  CB  . SER A 1 25  ? 16.125  -111.251 -49.440 1.00 10.29 ? 26  SER A CB  1 
ATOM   188  O  OG  . SER A 1 25  ? 16.962  -112.007 -50.300 1.00 11.52 ? 26  SER A OG  1 
ATOM   189  N  N   . SER A 1 26  ? 19.202  -110.253 -48.946 1.00 11.05 ? 27  SER A N   1 
ATOM   190  C  CA  . SER A 1 26  ? 20.503  -110.489 -48.316 1.00 11.41 ? 27  SER A CA  1 
ATOM   191  C  C   . SER A 1 26  ? 21.577  -109.718 -49.075 1.00 11.63 ? 27  SER A C   1 
ATOM   192  O  O   . SER A 1 26  ? 21.362  -109.332 -50.224 1.00 11.34 ? 27  SER A O   1 
ATOM   193  C  CB  . SER A 1 26  ? 20.824  -111.987 -48.284 1.00 11.98 ? 27  SER A CB  1 
ATOM   194  O  OG  . SER A 1 26  ? 20.897  -112.510 -49.600 1.00 12.79 ? 27  SER A OG  1 
ATOM   195  N  N   . GLY A 1 27  A 22.724  -109.480 -48.439 1.00 11.62 ? 27  GLY A N   1 
ATOM   196  C  CA  . GLY A 1 27  A 23.762  -108.653 -49.038 1.00 11.92 ? 27  GLY A CA  1 
ATOM   197  C  C   . GLY A 1 27  A 23.373  -107.184 -49.113 1.00 12.45 ? 27  GLY A C   1 
ATOM   198  O  O   . GLY A 1 27  A 22.339  -106.786 -48.584 1.00 12.89 ? 27  GLY A O   1 
ATOM   199  N  N   . ASN A 1 28  B 24.203  -106.379 -49.765 1.00 12.52 ? 27  ASN A N   1 
ATOM   200  C  CA  . ASN A 1 28  B 23.960  -104.939 -49.858 1.00 12.57 ? 27  ASN A CA  1 
ATOM   201  C  C   . ASN A 1 28  B 23.421  -104.539 -51.228 1.00 12.26 ? 27  ASN A C   1 
ATOM   202  O  O   . ASN A 1 28  B 23.987  -104.911 -52.255 1.00 12.23 ? 27  ASN A O   1 
ATOM   203  C  CB  . ASN A 1 28  B 25.232  -104.149 -49.523 1.00 12.98 ? 27  ASN A CB  1 
ATOM   204  C  CG  . ASN A 1 28  B 25.794  -104.488 -48.140 1.00 14.64 ? 27  ASN A CG  1 
ATOM   205  O  OD1 . ASN A 1 28  B 26.726  -105.294 -48.008 1.00 16.30 ? 27  ASN A OD1 1 
ATOM   206  N  ND2 . ASN A 1 28  B 25.235  -103.863 -47.101 1.00 16.38 ? 27  ASN A ND2 1 
ATOM   207  N  N   . ILE A 1 29  ? 22.326  -103.781 -51.236 1.00 11.68 ? 28  ILE A N   1 
ATOM   208  C  CA  . ILE A 1 29  ? 21.734  -103.309 -52.492 1.00 11.37 ? 28  ILE A CA  1 
ATOM   209  C  C   . ILE A 1 29  ? 22.760  -102.547 -53.345 1.00 11.47 ? 28  ILE A C   1 
ATOM   210  O  O   . ILE A 1 29  ? 22.716  -102.609 -54.572 1.00 12.16 ? 28  ILE A O   1 
ATOM   211  C  CB  . ILE A 1 29  ? 20.432  -102.469 -52.226 1.00 11.23 ? 28  ILE A CB  1 
ATOM   212  C  CG1 . ILE A 1 29  ? 19.675  -102.190 -53.529 1.00 10.78 ? 28  ILE A CG1 1 
ATOM   213  C  CG2 . ILE A 1 29  ? 20.755  -101.174 -51.489 1.00 11.48 ? 28  ILE A CG2 1 
ATOM   214  C  CD1 . ILE A 1 29  ? 18.816  -103.362 -54.016 1.00 8.41  ? 28  ILE A CD1 1 
ATOM   215  N  N   . ALA A 1 30  ? 23.695  -101.868 -52.682 1.00 11.55 ? 29  ALA A N   1 
ATOM   216  C  CA  . ALA A 1 30  ? 24.744  -101.082 -53.333 1.00 11.58 ? 29  ALA A CA  1 
ATOM   217  C  C   . ALA A 1 30  ? 25.806  -101.906 -54.081 1.00 11.60 ? 29  ALA A C   1 
ATOM   218  O  O   . ALA A 1 30  ? 26.537  -101.367 -54.909 1.00 12.35 ? 29  ALA A O   1 
ATOM   219  C  CB  . ALA A 1 30  ? 25.420  -100.167 -52.305 1.00 11.83 ? 29  ALA A CB  1 
ATOM   220  N  N   . SER A 1 31  ? 25.898  -103.199 -53.784 1.00 11.62 ? 30  SER A N   1 
ATOM   221  C  CA  . SER A 1 31  ? 26.977  -104.052 -54.303 1.00 11.11 ? 30  SER A CA  1 
ATOM   222  C  C   . SER A 1 31  ? 26.844  -104.374 -55.792 1.00 10.75 ? 30  SER A C   1 
ATOM   223  O  O   . SER A 1 31  ? 27.838  -104.700 -56.462 1.00 10.56 ? 30  SER A O   1 
ATOM   224  C  CB  . SER A 1 31  ? 27.018  -105.350 -53.513 1.00 11.17 ? 30  SER A CB  1 
ATOM   225  O  OG  . SER A 1 31  ? 27.193  -105.078 -52.136 1.00 12.06 ? 30  SER A OG  1 
ATOM   226  N  N   . ASN A 1 32  ? 25.613  -104.310 -56.286 1.00 9.98  ? 31  ASN A N   1 
ATOM   227  C  CA  . ASN A 1 32  ? 25.301  -104.618 -57.678 1.00 9.71  ? 31  ASN A CA  1 
ATOM   228  C  C   . ASN A 1 32  ? 24.324  -103.625 -58.279 1.00 9.24  ? 31  ASN A C   1 
ATOM   229  O  O   . ASN A 1 32  ? 23.421  -103.137 -57.600 1.00 9.25  ? 31  ASN A O   1 
ATOM   230  C  CB  . ASN A 1 32  ? 24.744  -106.035 -57.813 1.00 9.93  ? 31  ASN A CB  1 
ATOM   231  C  CG  . ASN A 1 32  ? 25.654  -107.072 -57.197 1.00 10.31 ? 31  ASN A CG  1 
ATOM   232  O  OD1 . ASN A 1 32  ? 26.647  -107.489 -57.806 1.00 12.12 ? 31  ASN A OD1 1 
ATOM   233  N  ND2 . ASN A 1 32  ? 25.332  -107.487 -55.974 1.00 11.02 ? 31  ASN A ND2 1 
ATOM   234  N  N   . TYR A 1 33  ? 24.506  -103.337 -59.561 1.00 8.68  ? 32  TYR A N   1 
ATOM   235  C  CA  . TYR A 1 33  ? 23.634  -102.391 -60.257 1.00 8.07  ? 32  TYR A CA  1 
ATOM   236  C  C   . TYR A 1 33  ? 22.204  -102.897 -60.320 1.00 8.59  ? 32  TYR A C   1 
ATOM   237  O  O   . TYR A 1 33  ? 21.950  -104.100 -60.471 1.00 8.76  ? 32  TYR A O   1 
ATOM   238  C  CB  . TYR A 1 33  ? 24.138  -102.126 -61.682 1.00 7.59  ? 32  TYR A CB  1 
ATOM   239  C  CG  . TYR A 1 33  ? 25.307  -101.186 -61.779 1.00 7.56  ? 32  TYR A CG  1 
ATOM   240  C  CD1 . TYR A 1 33  ? 25.301  -99.944  -61.135 1.00 7.23  ? 32  TYR A CD1 1 
ATOM   241  C  CD2 . TYR A 1 33  ? 26.416  -101.531 -62.536 1.00 9.33  ? 32  TYR A CD2 1 
ATOM   242  C  CE1 . TYR A 1 33  ? 26.406  -99.064  -61.252 1.00 10.33 ? 32  TYR A CE1 1 
ATOM   243  C  CE2 . TYR A 1 33  ? 27.500  -100.684 -62.651 1.00 11.16 ? 32  TYR A CE2 1 
ATOM   244  C  CZ  . TYR A 1 33  ? 27.492  -99.458  -62.005 1.00 11.40 ? 32  TYR A CZ  1 
ATOM   245  O  OH  . TYR A 1 33  ? 28.595  -98.630  -62.136 1.00 12.75 ? 32  TYR A OH  1 
ATOM   246  N  N   . VAL A 1 34  ? 21.257  -101.966 -60.212 1.00 8.29  ? 33  VAL A N   1 
ATOM   247  C  CA  . VAL A 1 34  ? 19.844  -102.330 -60.308 1.00 9.34  ? 33  VAL A CA  1 
ATOM   248  C  C   . VAL A 1 34  ? 19.264  -101.742 -61.584 1.00 9.38  ? 33  VAL A C   1 
ATOM   249  O  O   . VAL A 1 34  ? 19.491  -100.566 -61.891 1.00 9.73  ? 33  VAL A O   1 
ATOM   250  C  CB  . VAL A 1 34  ? 19.002  -101.836 -59.097 1.00 9.44  ? 33  VAL A CB  1 
ATOM   251  C  CG1 . VAL A 1 34  ? 17.559  -102.256 -59.253 1.00 9.98  ? 33  VAL A CG1 1 
ATOM   252  C  CG2 . VAL A 1 34  ? 19.594  -102.339 -57.772 1.00 10.43 ? 33  VAL A CG2 1 
ATOM   253  N  N   . GLN A 1 35  ? 18.516  -102.579 -62.307 1.00 9.11  ? 34  GLN A N   1 
ATOM   254  C  CA  . GLN A 1 35  ? 17.835  -102.194 -63.538 1.00 9.76  ? 34  GLN A CA  1 
ATOM   255  C  C   . GLN A 1 35  ? 16.335  -102.258 -63.290 1.00 10.27 ? 34  GLN A C   1 
ATOM   256  O  O   . GLN A 1 35  ? 15.858  -103.056 -62.473 1.00 10.06 ? 34  GLN A O   1 
ATOM   257  C  CB  . GLN A 1 35  ? 18.155  -103.173 -64.685 1.00 9.02  ? 34  GLN A CB  1 
ATOM   258  C  CG  . GLN A 1 35  ? 19.546  -103.040 -65.287 1.00 10.65 ? 34  GLN A CG  1 
ATOM   259  C  CD  . GLN A 1 35  ? 20.677  -103.192 -64.270 1.00 13.37 ? 34  GLN A CD  1 
ATOM   260  O  OE1 . GLN A 1 35  ? 21.443  -102.243 -64.050 1.00 14.39 ? 34  GLN A OE1 1 
ATOM   261  N  NE2 . GLN A 1 35  ? 20.781  -104.370 -63.640 1.00 10.79 ? 34  GLN A NE2 1 
ATOM   262  N  N   . TRP A 1 36  ? 15.589  -101.439 -64.012 1.00 9.50  ? 35  TRP A N   1 
ATOM   263  C  CA  . TRP A 1 36  ? 14.136  -101.534 -63.998 1.00 9.87  ? 35  TRP A CA  1 
ATOM   264  C  C   . TRP A 1 36  ? 13.629  -101.717 -65.405 1.00 10.59 ? 35  TRP A C   1 
ATOM   265  O  O   . TRP A 1 36  ? 14.093  -101.039 -66.326 1.00 9.76  ? 35  TRP A O   1 
ATOM   266  C  CB  . TRP A 1 36  ? 13.512  -100.256 -63.421 1.00 10.82 ? 35  TRP A CB  1 
ATOM   267  C  CG  . TRP A 1 36  ? 13.764  -100.087 -61.962 1.00 10.49 ? 35  TRP A CG  1 
ATOM   268  C  CD1 . TRP A 1 36  ? 14.856  -99.479  -61.372 1.00 9.85  ? 35  TRP A CD1 1 
ATOM   269  C  CD2 . TRP A 1 36  ? 12.925  -100.532 -60.881 1.00 11.11 ? 35  TRP A CD2 1 
ATOM   270  N  NE1 . TRP A 1 36  ? 14.741  -99.538  -60.007 1.00 10.49 ? 35  TRP A NE1 1 
ATOM   271  C  CE2 . TRP A 1 36  ? 13.562  -100.163 -59.675 1.00 8.83  ? 35  TRP A CE2 1 
ATOM   272  C  CE3 . TRP A 1 36  ? 11.692  -101.208 -60.809 1.00 9.29  ? 35  TRP A CE3 1 
ATOM   273  C  CZ2 . TRP A 1 36  ? 13.006  -100.434 -58.421 1.00 8.32  ? 35  TRP A CZ2 1 
ATOM   274  C  CZ3 . TRP A 1 36  ? 11.139  -101.475 -59.559 1.00 9.20  ? 35  TRP A CZ3 1 
ATOM   275  C  CH2 . TRP A 1 36  ? 11.794  -101.088 -58.389 1.00 9.43  ? 35  TRP A CH2 1 
ATOM   276  N  N   . TYR A 1 37  ? 12.674  -102.631 -65.554 1.00 10.34 ? 36  TYR A N   1 
ATOM   277  C  CA  . TYR A 1 37  ? 12.047  -102.884 -66.841 1.00 10.54 ? 36  TYR A CA  1 
ATOM   278  C  C   . TYR A 1 37  ? 10.571  -102.621 -66.776 1.00 9.67  ? 36  TYR A C   1 
ATOM   279  O  O   . TYR A 1 37  ? 9.945   -102.839 -65.756 1.00 10.59 ? 36  TYR A O   1 
ATOM   280  C  CB  . TYR A 1 37  ? 12.282  -104.316 -67.289 1.00 10.15 ? 36  TYR A CB  1 
ATOM   281  C  CG  . TYR A 1 37  ? 13.729  -104.693 -67.264 1.00 9.32  ? 36  TYR A CG  1 
ATOM   282  C  CD1 . TYR A 1 37  ? 14.582  -104.348 -68.324 1.00 10.44 ? 36  TYR A CD1 1 
ATOM   283  C  CD2 . TYR A 1 37  ? 14.271  -105.339 -66.158 1.00 10.40 ? 36  TYR A CD2 1 
ATOM   284  C  CE1 . TYR A 1 37  ? 15.938  -104.689 -68.286 1.00 13.86 ? 36  TYR A CE1 1 
ATOM   285  C  CE2 . TYR A 1 37  ? 15.601  -105.698 -66.128 1.00 11.63 ? 36  TYR A CE2 1 
ATOM   286  C  CZ  . TYR A 1 37  ? 16.433  -105.357 -67.174 1.00 13.82 ? 36  TYR A CZ  1 
ATOM   287  O  OH  . TYR A 1 37  ? 17.765  -105.701 -67.096 1.00 17.41 ? 36  TYR A OH  1 
ATOM   288  N  N   . GLN A 1 38  ? 10.028  -102.147 -67.893 1.00 9.68  ? 37  GLN A N   1 
ATOM   289  C  CA  . GLN A 1 38  ? 8.600   -101.938 -68.052 1.00 8.95  ? 37  GLN A CA  1 
ATOM   290  C  C   . GLN A 1 38  ? 8.104   -102.970 -69.060 1.00 9.34  ? 37  GLN A C   1 
ATOM   291  O  O   . GLN A 1 38  ? 8.749   -103.206 -70.081 1.00 9.70  ? 37  GLN A O   1 
ATOM   292  C  CB  . GLN A 1 38  ? 8.372   -100.518 -68.571 1.00 9.37  ? 37  GLN A CB  1 
ATOM   293  C  CG  . GLN A 1 38  ? 6.954   -100.084 -68.758 1.00 10.49 ? 37  GLN A CG  1 
ATOM   294  C  CD  . GLN A 1 38  ? 6.904   -98.847  -69.622 1.00 12.62 ? 37  GLN A CD  1 
ATOM   295  O  OE1 . GLN A 1 38  ? 7.357   -98.879  -70.777 1.00 14.55 ? 37  GLN A OE1 1 
ATOM   296  N  NE2 . GLN A 1 38  ? 6.379   -97.760  -69.082 1.00 10.43 ? 37  GLN A NE2 1 
ATOM   297  N  N   . GLN A 1 39  ? 6.954   -103.585 -68.751 1.00 7.50  ? 38  GLN A N   1 
ATOM   298  C  CA  . GLN A 1 39  ? 6.376   -104.547 -69.702 1.00 8.96  ? 38  GLN A CA  1 
ATOM   299  C  C   . GLN A 1 39  ? 4.869   -104.342 -70.060 1.00 9.33  ? 38  GLN A C   1 
ATOM   300  O  O   . GLN A 1 39  ? 4.032   -104.177 -69.174 1.00 9.49  ? 38  GLN A O   1 
ATOM   301  C  CB  . GLN A 1 39  ? 6.615   -105.966 -69.180 1.00 7.65  ? 38  GLN A CB  1 
ATOM   302  C  CG  . GLN A 1 39  ? 6.210   -106.997 -70.208 1.00 7.25  ? 38  GLN A CG  1 
ATOM   303  C  CD  . GLN A 1 39  ? 6.501   -108.396 -69.727 1.00 6.27  ? 38  GLN A CD  1 
ATOM   304  O  OE1 . GLN A 1 39  ? 6.562   -108.647 -68.512 1.00 5.84  ? 38  GLN A OE1 1 
ATOM   305  N  NE2 . GLN A 1 39  ? 6.710   -109.459 -70.492 1.00 2.80  ? 38  GLN A NE2 1 
ATOM   306  N  N   . SER A 1 41  ? 4.614   -107.584 -75.663 1.00 13.47 ? 42  SER A N   1 
ATOM   307  C  CA  . SER A 1 41  ? 6.065   -107.608 -75.847 1.00 13.21 ? 42  SER A CA  1 
ATOM   308  C  C   . SER A 1 41  ? 6.873   -107.891 -74.604 1.00 12.46 ? 42  SER A C   1 
ATOM   309  O  O   . SER A 1 41  ? 6.345   -107.927 -73.480 1.00 12.31 ? 42  SER A O   1 
ATOM   310  C  CB  . SER A 1 41  ? 6.596   -106.382 -76.611 1.00 13.46 ? 42  SER A CB  1 
ATOM   311  O  OG  . SER A 1 41  ? 6.468   -105.206 -75.851 1.00 14.55 ? 42  SER A OG  1 
ATOM   312  N  N   . ALA A 1 42  ? 8.162   -108.119 -74.848 1.00 12.08 ? 43  ALA A N   1 
ATOM   313  C  CA  . ALA A 1 42  ? 9.141   -108.383 -73.816 1.00 11.88 ? 43  ALA A CA  1 
ATOM   314  C  C   . ALA A 1 42  ? 9.288   -107.141 -72.968 1.00 11.51 ? 43  ALA A C   1 
ATOM   315  O  O   . ALA A 1 42  ? 8.871   -106.055 -73.379 1.00 11.66 ? 43  ALA A O   1 
ATOM   316  C  CB  . ALA A 1 42  ? 10.474  -108.741 -74.452 1.00 12.36 ? 43  ALA A CB  1 
ATOM   317  N  N   . PRO A 1 43  ? 9.864   -107.281 -71.778 1.00 11.77 ? 44  PRO A N   1 
ATOM   318  C  CA  . PRO A 1 43  ? 10.186  -106.101 -70.976 1.00 11.38 ? 44  PRO A CA  1 
ATOM   319  C  C   . PRO A 1 43  ? 11.188  -105.217 -71.706 1.00 11.64 ? 44  PRO A C   1 
ATOM   320  O  O   . PRO A 1 43  ? 12.053  -105.730 -72.425 1.00 11.21 ? 44  PRO A O   1 
ATOM   321  C  CB  . PRO A 1 43  ? 10.815  -106.687 -69.715 1.00 12.05 ? 44  PRO A CB  1 
ATOM   322  C  CG  . PRO A 1 43  ? 10.344  -108.102 -69.675 1.00 12.21 ? 44  PRO A CG  1 
ATOM   323  C  CD  . PRO A 1 43  ? 10.215  -108.539 -71.089 1.00 11.59 ? 44  PRO A CD  1 
ATOM   324  N  N   . ILE A 1 44  ? 11.026  -103.902 -71.544 1.00 11.09 ? 45  ILE A N   1 
ATOM   325  C  CA  . ILE A 1 44  ? 11.964  -102.906 -72.050 1.00 12.15 ? 45  ILE A CA  1 
ATOM   326  C  C   . ILE A 1 44  ? 12.603  -102.181 -70.866 1.00 11.19 ? 45  ILE A C   1 
ATOM   327  O  O   . ILE A 1 44  ? 11.961  -101.959 -69.841 1.00 11.01 ? 45  ILE A O   1 
ATOM   328  C  CB  . ILE A 1 44  ? 11.270  -101.882 -73.024 1.00 12.86 ? 45  ILE A CB  1 
ATOM   329  C  CG1 . ILE A 1 44  ? 10.197  -101.054 -72.318 1.00 15.15 ? 45  ILE A CG1 1 
ATOM   330  C  CG2 . ILE A 1 44  ? 10.677  -102.611 -74.245 1.00 13.35 ? 45  ILE A CG2 1 
ATOM   331  C  CD1 . ILE A 1 44  ? 10.040  -99.623  -72.877 1.00 18.12 ? 45  ILE A CD1 1 
ATOM   332  N  N   . THR A 1 45  ? 13.875  -101.831 -71.022 1.00 10.76 ? 46  THR A N   1 
ATOM   333  C  CA  . THR A 1 45  ? 14.632  -101.152 -69.989 1.00 10.48 ? 46  THR A CA  1 
ATOM   334  C  C   . THR A 1 45  ? 14.118  -99.734  -69.808 1.00 9.96  ? 46  THR A C   1 
ATOM   335  O  O   . THR A 1 45  ? 14.020  -98.973  -70.791 1.00 10.43 ? 46  THR A O   1 
ATOM   336  C  CB  . THR A 1 45  ? 16.125  -101.102 -70.372 1.00 10.34 ? 46  THR A CB  1 
ATOM   337  O  OG1 . THR A 1 45  ? 16.649  -102.439 -70.448 1.00 11.88 ? 46  THR A OG1 1 
ATOM   338  C  CG2 . THR A 1 45  ? 16.939  -100.400 -69.271 1.00 10.27 ? 46  THR A CG2 1 
ATOM   339  N  N   . VAL A 1 46  ? 13.795  -99.373  -68.571 1.00 10.45 ? 47  VAL A N   1 
ATOM   340  C  CA  . VAL A 1 46  ? 13.530  -97.961  -68.269 1.00 9.21  ? 47  VAL A CA  1 
ATOM   341  C  C   . VAL A 1 46  ? 14.590  -97.300  -67.371 1.00 9.69  ? 47  VAL A C   1 
ATOM   342  O  O   . VAL A 1 46  ? 14.756  -96.073  -67.416 1.00 9.09  ? 47  VAL A O   1 
ATOM   343  C  CB  . VAL A 1 46  ? 12.099  -97.662  -67.742 1.00 10.48 ? 47  VAL A CB  1 
ATOM   344  C  CG1 . VAL A 1 46  ? 11.059  -97.894  -68.826 1.00 9.09  ? 47  VAL A CG1 1 
ATOM   345  C  CG2 . VAL A 1 46  ? 11.781  -98.424  -66.474 1.00 8.92  ? 47  VAL A CG2 1 
ATOM   346  N  N   . ILE A 1 47  ? 15.277  -98.112  -66.571 1.00 9.22  ? 48  ILE A N   1 
ATOM   347  C  CA  . ILE A 1 47  ? 16.420  -97.661  -65.773 1.00 8.97  ? 48  ILE A CA  1 
ATOM   348  C  C   . ILE A 1 47  ? 17.483  -98.725  -65.830 1.00 8.25  ? 48  ILE A C   1 
ATOM   349  O  O   . ILE A 1 47  ? 17.173  -99.923  -65.733 1.00 7.98  ? 48  ILE A O   1 
ATOM   350  C  CB  . ILE A 1 47  ? 16.039  -97.393  -64.286 1.00 9.49  ? 48  ILE A CB  1 
ATOM   351  C  CG1 . ILE A 1 47  ? 15.081  -96.199  -64.135 1.00 7.27  ? 48  ILE A CG1 1 
ATOM   352  C  CG2 . ILE A 1 47  ? 17.304  -97.239  -63.416 1.00 7.95  ? 48  ILE A CG2 1 
ATOM   353  C  CD1 . ILE A 1 47  ? 15.714  -94.808  -64.379 1.00 8.16  ? 48  ILE A CD1 1 
ATOM   354  N  N   . TYR A 1 48  ? 18.741  -98.304  -65.933 1.00 8.28  ? 49  TYR A N   1 
ATOM   355  C  CA  . TYR A 1 48  ? 19.858  -99.226  -65.746 1.00 7.57  ? 49  TYR A CA  1 
ATOM   356  C  C   . TYR A 1 48  ? 20.940  -98.602  -64.874 1.00 7.04  ? 49  TYR A C   1 
ATOM   357  O  O   . TYR A 1 48  ? 20.950  -97.376  -64.670 1.00 6.27  ? 49  TYR A O   1 
ATOM   358  C  CB  . TYR A 1 48  ? 20.431  -99.702  -67.086 1.00 7.99  ? 49  TYR A CB  1 
ATOM   359  C  CG  . TYR A 1 48  ? 21.035  -98.597  -67.921 1.00 6.98  ? 49  TYR A CG  1 
ATOM   360  C  CD1 . TYR A 1 48  ? 20.244  -97.833  -68.770 1.00 7.96  ? 49  TYR A CD1 1 
ATOM   361  C  CD2 . TYR A 1 48  ? 22.399  -98.322  -67.867 1.00 8.38  ? 49  TYR A CD2 1 
ATOM   362  C  CE1 . TYR A 1 48  ? 20.798  -96.817  -69.540 1.00 7.59  ? 49  TYR A CE1 1 
ATOM   363  C  CE2 . TYR A 1 48  ? 22.960  -97.310  -68.636 1.00 7.98  ? 49  TYR A CE2 1 
ATOM   364  C  CZ  . TYR A 1 48  ? 22.155  -96.561  -69.464 1.00 7.21  ? 49  TYR A CZ  1 
ATOM   365  O  OH  . TYR A 1 48  ? 22.739  -95.556  -70.232 1.00 5.99  ? 49  TYR A OH  1 
ATOM   366  N  N   . GLU A 1 49  ? 21.838  -99.429  -64.342 1.00 6.68  ? 50  GLU A N   1 
ATOM   367  C  CA  . GLU A 1 49  ? 22.885  -98.927  -63.456 1.00 7.33  ? 50  GLU A CA  1 
ATOM   368  C  C   . GLU A 1 49  ? 22.302  -97.990  -62.379 1.00 7.64  ? 50  GLU A C   1 
ATOM   369  O  O   . GLU A 1 49  ? 22.774  -96.863  -62.203 1.00 8.23  ? 50  GLU A O   1 
ATOM   370  C  CB  . GLU A 1 49  ? 23.976  -98.191  -64.275 1.00 7.12  ? 50  GLU A CB  1 
ATOM   371  C  CG  . GLU A 1 49  ? 24.941  -99.121  -65.015 1.00 7.79  ? 50  GLU A CG  1 
ATOM   372  C  CD  . GLU A 1 49  ? 25.818  -98.464  -66.071 1.00 10.18 ? 50  GLU A CD  1 
ATOM   373  O  OE1 . GLU A 1 49  ? 25.917  -97.221  -66.170 1.00 7.98  ? 50  GLU A OE1 1 
ATOM   374  O  OE2 . GLU A 1 49  ? 26.433  -99.218  -66.835 1.00 9.63  ? 50  GLU A OE2 1 
ATOM   375  N  N   . ASP A 1 50  ? 21.239  -98.459  -61.721 1.00 7.05  ? 51  ASP A N   1 
ATOM   376  C  CA  . ASP A 1 50  ? 20.575  -97.800  -60.584 1.00 7.26  ? 51  ASP A CA  1 
ATOM   377  C  C   . ASP A 1 50  ? 19.680  -96.645  -60.974 1.00 7.54  ? 51  ASP A C   1 
ATOM   378  O  O   . ASP A 1 50  ? 18.570  -96.514  -60.440 1.00 7.83  ? 51  ASP A O   1 
ATOM   379  C  CB  . ASP A 1 50  ? 21.566  -97.295  -59.518 1.00 7.29  ? 51  ASP A CB  1 
ATOM   380  C  CG  . ASP A 1 50  ? 22.473  -98.375  -58.991 1.00 8.89  ? 51  ASP A CG  1 
ATOM   381  O  OD1 . ASP A 1 50  ? 22.077  -99.568  -58.970 1.00 8.15  ? 51  ASP A OD1 1 
ATOM   382  O  OD2 . ASP A 1 50  ? 23.616  -98.101  -58.572 1.00 9.20  ? 51  ASP A OD2 1 
ATOM   383  N  N   . ASN A 1 51  ? 20.149  -95.781  -61.881 1.00 6.45  ? 52  ASN A N   1 
ATOM   384  C  CA  . ASN A 1 51  ? 19.421  -94.523  -62.123 1.00 6.40  ? 52  ASN A CA  1 
ATOM   385  C  C   . ASN A 1 51  ? 19.578  -93.934  -63.529 1.00 6.48  ? 52  ASN A C   1 
ATOM   386  O  O   . ASN A 1 51  ? 19.213  -92.777  -63.753 1.00 6.49  ? 52  ASN A O   1 
ATOM   387  C  CB  . ASN A 1 51  ? 19.834  -93.460  -61.081 1.00 6.35  ? 52  ASN A CB  1 
ATOM   388  C  CG  . ASN A 1 51  ? 21.337  -93.259  -61.003 1.00 6.15  ? 52  ASN A CG  1 
ATOM   389  O  OD1 . ASN A 1 51  ? 22.077  -93.662  -61.889 1.00 6.60  ? 52  ASN A OD1 1 
ATOM   390  N  ND2 . ASN A 1 51  ? 21.787  -92.607  -59.951 1.00 7.30  ? 52  ASN A ND2 1 
ATOM   391  N  N   . GLN A 1 52  ? 20.142  -94.706  -64.453 1.00 6.16  ? 53  GLN A N   1 
ATOM   392  C  CA  . GLN A 1 52  ? 20.355  -94.195  -65.814 1.00 6.48  ? 53  GLN A CA  1 
ATOM   393  C  C   . GLN A 1 52  ? 19.130  -94.485  -66.682 1.00 7.50  ? 53  GLN A C   1 
ATOM   394  O  O   . GLN A 1 52  ? 18.645  -95.610  -66.717 1.00 7.27  ? 53  GLN A O   1 
ATOM   395  C  CB  . GLN A 1 52  ? 21.591  -94.838  -66.459 1.00 5.82  ? 53  GLN A CB  1 
ATOM   396  C  CG  . GLN A 1 52  ? 22.890  -94.685  -65.660 1.00 4.31  ? 53  GLN A CG  1 
ATOM   397  C  CD  . GLN A 1 52  ? 23.262  -93.255  -65.460 1.00 5.58  ? 53  GLN A CD  1 
ATOM   398  O  OE1 . GLN A 1 52  ? 23.162  -92.708  -64.350 1.00 5.42  ? 53  GLN A OE1 1 
ATOM   399  N  NE2 . GLN A 1 52  ? 23.674  -92.630  -66.529 1.00 2.11  ? 53  GLN A NE2 1 
ATOM   400  N  N   . ARG A 1 53  ? 18.644  -93.460  -67.386 1.00 7.28  ? 54  ARG A N   1 
ATOM   401  C  CA  . ARG A 1 53  ? 17.549  -93.645  -68.332 1.00 9.21  ? 54  ARG A CA  1 
ATOM   402  C  C   . ARG A 1 53  ? 18.095  -93.882  -69.734 1.00 8.96  ? 54  ARG A C   1 
ATOM   403  O  O   . ARG A 1 53  ? 18.854  -93.033  -70.245 1.00 9.80  ? 54  ARG A O   1 
ATOM   404  C  CB  . ARG A 1 53  ? 16.677  -92.390  -68.395 1.00 9.62  ? 54  ARG A CB  1 
ATOM   405  C  CG  . ARG A 1 53  ? 15.637  -92.256  -67.272 1.00 11.04 ? 54  ARG A CG  1 
ATOM   406  C  CD  . ARG A 1 53  ? 14.901  -90.922  -67.360 1.00 10.48 ? 54  ARG A CD  1 
ATOM   407  N  NE  . ARG A 1 53  ? 15.779  -89.758  -67.240 1.00 11.93 ? 54  ARG A NE  1 
ATOM   408  C  CZ  . ARG A 1 53  ? 16.229  -89.271  -66.079 1.00 11.41 ? 54  ARG A CZ  1 
ATOM   409  N  NH1 . ARG A 1 53  ? 15.855  -89.830  -64.924 1.00 8.28  ? 54  ARG A NH1 1 
ATOM   410  N  NH2 . ARG A 1 53  ? 17.020  -88.196  -66.078 1.00 9.91  ? 54  ARG A NH2 1 
ATOM   411  N  N   . PRO A 1 54  ? 17.674  -94.958  -70.397 1.00 8.70  ? 55  PRO A N   1 
ATOM   412  C  CA  . PRO A 1 54  ? 17.973  -95.110  -71.829 1.00 9.19  ? 55  PRO A CA  1 
ATOM   413  C  C   . PRO A 1 54  ? 17.366  -93.992  -72.648 1.00 9.68  ? 55  PRO A C   1 
ATOM   414  O  O   . PRO A 1 54  ? 16.417  -93.329  -72.218 1.00 9.95  ? 55  PRO A O   1 
ATOM   415  C  CB  . PRO A 1 54  ? 17.268  -96.408  -72.227 1.00 9.47  ? 55  PRO A CB  1 
ATOM   416  C  CG  . PRO A 1 54  ? 16.997  -97.142  -70.968 1.00 9.09  ? 55  PRO A CG  1 
ATOM   417  C  CD  . PRO A 1 54  ? 16.909  -96.115  -69.869 1.00 8.45  ? 55  PRO A CD  1 
ATOM   418  N  N   . SER A 1 55  ? 17.920  -93.812  -73.835 1.00 10.33 ? 56  SER A N   1 
ATOM   419  C  CA  . SER A 1 55  ? 17.360  -92.924  -74.835 1.00 11.14 ? 56  SER A CA  1 
ATOM   420  C  C   . SER A 1 55  ? 15.872  -93.185  -75.020 1.00 10.97 ? 56  SER A C   1 
ATOM   421  O  O   . SER A 1 55  ? 15.441  -94.343  -75.103 1.00 11.31 ? 56  SER A O   1 
ATOM   422  C  CB  . SER A 1 55  ? 18.108  -93.105  -76.153 1.00 11.67 ? 56  SER A CB  1 
ATOM   423  O  OG  . SER A 1 55  ? 19.371  -92.477  -76.066 1.00 15.06 ? 56  SER A OG  1 
ATOM   424  N  N   . GLY A 1 56  ? 15.089  -92.109  -75.026 1.00 10.71 ? 57  GLY A N   1 
ATOM   425  C  CA  . GLY A 1 56  ? 13.658  -92.198  -75.261 1.00 11.32 ? 57  GLY A CA  1 
ATOM   426  C  C   . GLY A 1 56  ? 12.776  -92.364  -74.033 1.00 11.16 ? 57  GLY A C   1 
ATOM   427  O  O   . GLY A 1 56  ? 11.566  -92.134  -74.098 1.00 12.77 ? 57  GLY A O   1 
ATOM   428  N  N   . VAL A 1 57  ? 13.367  -92.761  -72.912 1.00 10.45 ? 58  VAL A N   1 
ATOM   429  C  CA  . VAL A 1 57  ? 12.621  -92.933  -71.673 1.00 10.40 ? 58  VAL A CA  1 
ATOM   430  C  C   . VAL A 1 57  ? 12.373  -91.566  -71.022 1.00 10.95 ? 58  VAL A C   1 
ATOM   431  O  O   . VAL A 1 57  ? 13.317  -90.797  -70.795 1.00 9.94  ? 58  VAL A O   1 
ATOM   432  C  CB  . VAL A 1 57  ? 13.364  -93.874  -70.724 1.00 10.50 ? 58  VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 57  ? 12.674  -93.944  -69.360 1.00 11.07 ? 58  VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 57  ? 13.478  -95.272  -71.365 1.00 10.97 ? 58  VAL A CG2 1 
ATOM   435  N  N   . PRO A 1 58  ? 11.107  -91.240  -70.760 1.00 11.29 ? 59  PRO A N   1 
ATOM   436  C  CA  . PRO A 1 58  ? 10.779  -89.928  -70.183 1.00 10.88 ? 59  PRO A CA  1 
ATOM   437  C  C   . PRO A 1 58  ? 11.524  -89.637  -68.880 1.00 10.54 ? 59  PRO A C   1 
ATOM   438  O  O   . PRO A 1 58  ? 11.757  -90.554  -68.060 1.00 9.97  ? 59  PRO A O   1 
ATOM   439  C  CB  . PRO A 1 58  ? 9.272   -89.998  -69.922 1.00 11.91 ? 59  PRO A CB  1 
ATOM   440  C  CG  . PRO A 1 58  ? 8.754   -91.141  -70.741 1.00 12.49 ? 59  PRO A CG  1 
ATOM   441  C  CD  . PRO A 1 58  ? 9.910   -92.076  -71.011 1.00 11.76 ? 59  PRO A CD  1 
ATOM   442  N  N   . ASP A 1 59  ? 11.908  -88.366  -68.721 1.00 10.86 ? 60  ASP A N   1 
ATOM   443  C  CA  . ASP A 1 59  ? 12.635  -87.908  -67.532 1.00 11.42 ? 60  ASP A CA  1 
ATOM   444  C  C   . ASP A 1 59  ? 11.832  -88.128  -66.251 1.00 11.37 ? 60  ASP A C   1 
ATOM   445  O  O   . ASP A 1 59  ? 12.399  -88.144  -65.162 1.00 11.56 ? 60  ASP A O   1 
ATOM   446  C  CB  . ASP A 1 59  ? 12.978  -86.411  -67.607 1.00 11.05 ? 60  ASP A CB  1 
ATOM   447  C  CG  . ASP A 1 59  ? 13.929  -86.044  -68.755 1.00 13.63 ? 60  ASP A CG  1 
ATOM   448  O  OD1 . ASP A 1 59  ? 14.761  -86.861  -69.199 1.00 17.51 ? 60  ASP A OD1 1 
ATOM   449  O  OD2 . ASP A 1 59  ? 13.916  -84.904  -69.268 1.00 15.79 ? 60  ASP A OD2 1 
ATOM   450  N  N   . ARG A 1 60  ? 10.516  -88.285  -66.384 1.00 11.43 ? 61  ARG A N   1 
ATOM   451  C  CA  . ARG A 1 60  ? 9.648   -88.584  -65.245 1.00 10.81 ? 61  ARG A CA  1 
ATOM   452  C  C   . ARG A 1 60  ? 9.947   -89.909  -64.537 1.00 10.93 ? 61  ARG A C   1 
ATOM   453  O  O   . ARG A 1 60  ? 9.468   -90.123  -63.432 1.00 10.91 ? 61  ARG A O   1 
ATOM   454  C  CB  . ARG A 1 60  ? 8.162   -88.454  -65.622 1.00 11.52 ? 61  ARG A CB  1 
ATOM   455  C  CG  . ARG A 1 60  ? 7.501   -89.677  -66.256 1.00 12.51 ? 61  ARG A CG  1 
ATOM   456  C  CD  . ARG A 1 60  ? 6.025   -89.461  -66.627 1.00 15.48 ? 61  ARG A CD  1 
ATOM   457  N  NE  . ARG A 1 60  ? 5.979   -88.810  -67.924 1.00 20.05 ? 61  ARG A NE  1 
ATOM   458  C  CZ  . ARG A 1 60  ? 5.758   -89.439  -69.078 1.00 19.16 ? 61  ARG A CZ  1 
ATOM   459  N  NH1 . ARG A 1 60  ? 5.496   -90.735  -69.106 1.00 19.75 ? 61  ARG A NH1 1 
ATOM   460  N  NH2 . ARG A 1 60  ? 5.761   -88.744  -70.209 1.00 19.03 ? 61  ARG A NH2 1 
ATOM   461  N  N   . PHE A 1 61  ? 10.748  -90.763  -65.171 1.00 10.50 ? 62  PHE A N   1 
ATOM   462  C  CA  . PHE A 1 61  ? 11.165  -92.034  -64.585 1.00 10.71 ? 62  PHE A CA  1 
ATOM   463  C  C   . PHE A 1 61  ? 12.511  -91.853  -63.904 1.00 10.37 ? 62  PHE A C   1 
ATOM   464  O  O   . PHE A 1 61  ? 13.486  -91.420  -64.528 1.00 11.37 ? 62  PHE A O   1 
ATOM   465  C  CB  . PHE A 1 61  ? 11.277  -93.117  -65.659 1.00 9.88  ? 62  PHE A CB  1 
ATOM   466  C  CG  . PHE A 1 61  ? 9.955   -93.588  -66.193 1.00 10.09 ? 62  PHE A CG  1 
ATOM   467  C  CD1 . PHE A 1 61  ? 9.295   -92.880  -67.190 1.00 10.08 ? 62  PHE A CD1 1 
ATOM   468  C  CD2 . PHE A 1 61  ? 9.375   -94.748  -65.704 1.00 12.44 ? 62  PHE A CD2 1 
ATOM   469  C  CE1 . PHE A 1 61  ? 8.048   -93.342  -67.689 1.00 10.31 ? 62  PHE A CE1 1 
ATOM   470  C  CE2 . PHE A 1 61  ? 8.142   -95.203  -66.192 1.00 11.86 ? 62  PHE A CE2 1 
ATOM   471  C  CZ  . PHE A 1 61  ? 7.488   -94.503  -67.183 1.00 11.14 ? 62  PHE A CZ  1 
ATOM   472  N  N   . ALA A 1 62  ? 12.543  -92.150  -62.612 1.00 10.36 ? 63  ALA A N   1 
ATOM   473  C  CA  . ALA A 1 62  ? 13.744  -91.991  -61.818 1.00 8.84  ? 63  ALA A CA  1 
ATOM   474  C  C   . ALA A 1 62  ? 14.044  -93.206  -60.962 1.00 9.99  ? 63  ALA A C   1 
ATOM   475  O  O   . ALA A 1 62  ? 13.177  -93.702  -60.223 1.00 10.16 ? 63  ALA A O   1 
ATOM   476  C  CB  . ALA A 1 62  ? 13.648  -90.741  -60.953 1.00 9.64  ? 63  ALA A CB  1 
ATOM   477  N  N   . GLY A 1 63  ? 15.292  -93.658  -61.047 1.00 8.52  ? 64  GLY A N   1 
ATOM   478  C  CA  . GLY A 1 63  ? 15.779  -94.742  -60.191 1.00 8.21  ? 64  GLY A CA  1 
ATOM   479  C  C   . GLY A 1 63  ? 16.575  -94.193  -59.025 1.00 8.72  ? 64  GLY A C   1 
ATOM   480  O  O   . GLY A 1 63  ? 17.272  -93.171  -59.144 1.00 8.00  ? 64  GLY A O   1 
ATOM   481  N  N   . SER A 1 64  ? 16.445  -94.850  -57.881 1.00 8.41  ? 65  SER A N   1 
ATOM   482  C  CA  . SER A 1 64  ? 17.198  -94.482  -56.705 1.00 9.07  ? 65  SER A CA  1 
ATOM   483  C  C   . SER A 1 64  ? 17.553  -95.742  -55.912 1.00 9.06  ? 65  SER A C   1 
ATOM   484  O  O   . SER A 1 64  ? 17.006  -96.832  -56.150 1.00 8.78  ? 65  SER A O   1 
ATOM   485  C  CB  . SER A 1 64  ? 16.426  -93.469  -55.861 1.00 9.30  ? 65  SER A CB  1 
ATOM   486  O  OG  . SER A 1 64  ? 15.274  -94.058  -55.286 1.00 10.66 ? 65  SER A OG  1 
ATOM   487  N  N   . ILE A 1 65  ? 18.525  -95.589  -55.068 1.00 9.36  ? 66  ILE A N   1 
ATOM   488  C  CA  . ILE A 1 65  ? 18.979  -96.622  -54.148 1.00 9.34  ? 66  ILE A CA  1 
ATOM   489  C  C   . ILE A 1 65  ? 18.908  -96.108  -52.703 1.00 9.49  ? 66  ILE A C   1 
ATOM   490  O  O   . ILE A 1 65  ? 19.310  -94.960  -52.487 1.00 8.97  ? 66  ILE A O   1 
ATOM   491  C  CB  . ILE A 1 65  ? 20.396  -97.107  -54.475 1.00 9.83  ? 66  ILE A CB  1 
ATOM   492  C  CG1 . ILE A 1 65  ? 20.436  -97.720  -55.875 1.00 20.00 ? 66  ILE A CG1 1 
ATOM   493  C  CG2 . ILE A 1 65  ? 20.863  -98.112  -53.431 1.00 20.00 ? 66  ILE A CG2 1 
ATOM   494  C  CD1 . ILE A 1 65  ? 19.620  -98.985  -56.015 1.00 20.00 ? 66  ILE A CD1 1 
ATOM   495  N  N   . ASP A 1 66  A 18.358  -96.899  -51.834 1.00 9.29  ? 66  ASP A N   1 
ATOM   496  C  CA  . ASP A 1 66  A 18.315  -96.574  -50.408 1.00 9.96  ? 66  ASP A CA  1 
ATOM   497  C  C   . ASP A 1 66  A 19.030  -97.689  -49.655 1.00 9.99  ? 66  ASP A C   1 
ATOM   498  O  O   . ASP A 1 66  A 18.463  -98.766  -49.427 1.00 9.94  ? 66  ASP A O   1 
ATOM   499  C  CB  . ASP A 1 66  A 16.861  -96.416  -49.938 1.00 9.94  ? 66  ASP A CB  1 
ATOM   500  C  CG  . ASP A 1 66  A 16.744  -96.042  -48.476 1.00 12.01 ? 66  ASP A CG  1 
ATOM   501  O  OD1 . ASP A 1 66  A 17.704  -95.467  -47.918 1.00 13.04 ? 66  ASP A OD1 1 
ATOM   502  O  OD2 . ASP A 1 66  A 15.721  -96.288  -47.793 1.00 13.02 ? 66  ASP A OD2 1 
ATOM   503  N  N   . ARG A 1 67  B 20.289  -97.431  -49.308 1.00 10.44 ? 66  ARG A N   1 
ATOM   504  C  CA  . ARG A 1 67  B 21.100  -98.382  -48.536 1.00 11.02 ? 66  ARG A CA  1 
ATOM   505  C  C   . ARG A 1 67  B 20.552  -98.697  -47.146 1.00 11.03 ? 66  ARG A C   1 
ATOM   506  O  O   . ARG A 1 67  B 20.762  -99.803  -46.644 1.00 11.14 ? 66  ARG A O   1 
ATOM   507  C  CB  . ARG A 1 67  B 22.549  -97.897  -48.405 1.00 11.30 ? 66  ARG A CB  1 
ATOM   508  C  CG  . ARG A 1 67  B 23.285  -97.737  -49.736 1.00 13.62 ? 66  ARG A CG  1 
ATOM   509  C  CD  . ARG A 1 67  B 24.691  -97.149  -49.590 1.00 16.18 ? 66  ARG A CD  1 
ATOM   510  N  NE  . ARG A 1 67  B 24.636  -95.764  -49.120 1.00 19.75 ? 66  ARG A NE  1 
ATOM   511  C  CZ  . ARG A 1 67  B 25.677  -95.065  -48.674 1.00 20.43 ? 66  ARG A CZ  1 
ATOM   512  N  NH1 . ARG A 1 67  B 26.890  -95.609  -48.625 1.00 21.43 ? 66  ARG A NH1 1 
ATOM   513  N  NH2 . ARG A 1 67  B 25.502  -93.811  -48.273 1.00 21.36 ? 66  ARG A NH2 1 
ATOM   514  N  N   . SER A 1 68  ? 19.881  -97.725  -46.520 1.00 10.77 ? 67  SER A N   1 
ATOM   515  C  CA  . SER A 1 68  ? 19.329  -97.890  -45.170 1.00 10.89 ? 67  SER A CA  1 
ATOM   516  C  C   . SER A 1 68  ? 18.207  -98.927  -45.086 1.00 10.35 ? 67  SER A C   1 
ATOM   517  O  O   . SER A 1 68  ? 18.082  -99.620  -44.076 1.00 10.86 ? 67  SER A O   1 
ATOM   518  C  CB  . SER A 1 68  ? 18.861  -96.545  -44.594 1.00 10.45 ? 67  SER A CB  1 
ATOM   519  O  OG  . SER A 1 68  ? 17.755  -96.022  -45.316 1.00 13.26 ? 67  SER A OG  1 
ATOM   520  N  N   . SER A 1 69  ? 17.397  -99.025  -46.139 1.00 10.01 ? 68  SER A N   1 
ATOM   521  C  CA  . SER A 1 69  ? 16.342  -100.036 -46.212 1.00 9.79  ? 68  SER A CA  1 
ATOM   522  C  C   . SER A 1 69  ? 16.713  -101.168 -47.164 1.00 9.32  ? 68  SER A C   1 
ATOM   523  O  O   . SER A 1 69  ? 15.882  -102.032 -47.465 1.00 9.37  ? 68  SER A O   1 
ATOM   524  C  CB  . SER A 1 69  ? 15.021  -99.404  -46.638 1.00 10.05 ? 68  SER A CB  1 
ATOM   525  O  OG  . SER A 1 69  ? 15.175  -98.751  -47.878 1.00 11.20 ? 68  SER A OG  1 
ATOM   526  N  N   . ASN A 1 70  ? 17.954  -101.132 -47.654 1.00 8.92  ? 69  ASN A N   1 
ATOM   527  C  CA  . ASN A 1 70  ? 18.490  -102.136 -48.570 1.00 8.51  ? 69  ASN A CA  1 
ATOM   528  C  C   . ASN A 1 70  ? 17.605  -102.350 -49.791 1.00 8.87  ? 69  ASN A C   1 
ATOM   529  O  O   . ASN A 1 70  ? 17.325  -103.474 -50.206 1.00 8.01  ? 69  ASN A O   1 
ATOM   530  C  CB  . ASN A 1 70  ? 18.769  -103.445 -47.821 1.00 8.80  ? 69  ASN A CB  1 
ATOM   531  C  CG  . ASN A 1 70  ? 19.824  -104.276 -48.496 1.00 8.97  ? 69  ASN A CG  1 
ATOM   532  O  OD1 . ASN A 1 70  ? 20.844  -103.750 -48.927 1.00 9.80  ? 69  ASN A OD1 1 
ATOM   533  N  ND2 . ASN A 1 70  ? 19.586  -105.586 -48.600 1.00 9.82  ? 69  ASN A ND2 1 
ATOM   534  N  N   . SER A 1 71  ? 17.164  -101.236 -50.362 1.00 8.50  ? 70  SER A N   1 
ATOM   535  C  CA  . SER A 1 71  ? 16.170  -101.259 -51.413 1.00 8.82  ? 70  SER A CA  1 
ATOM   536  C  C   . SER A 1 71  ? 16.539  -100.341 -52.561 1.00 8.53  ? 70  SER A C   1 
ATOM   537  O  O   . SER A 1 71  ? 17.404  -99.464  -52.444 1.00 8.42  ? 70  SER A O   1 
ATOM   538  C  CB  . SER A 1 71  ? 14.792  -100.867 -50.854 1.00 8.96  ? 70  SER A CB  1 
ATOM   539  O  OG  . SER A 1 71  ? 14.768  -99.491  -50.527 1.00 9.15  ? 70  SER A OG  1 
ATOM   540  N  N   . ALA A 1 72  ? 15.870  -100.575 -53.674 1.00 8.30  ? 71  ALA A N   1 
ATOM   541  C  CA  . ALA A 1 72  ? 15.947  -99.714  -54.843 1.00 8.27  ? 71  ALA A CA  1 
ATOM   542  C  C   . ALA A 1 72  ? 14.524  -99.259  -55.113 1.00 8.89  ? 71  ALA A C   1 
ATOM   543  O  O   . ALA A 1 72  ? 13.564  -99.956  -54.771 1.00 9.54  ? 71  ALA A O   1 
ATOM   544  C  CB  . ALA A 1 72  ? 16.491  -100.499 -56.007 1.00 8.76  ? 71  ALA A CB  1 
ATOM   545  N  N   . SER A 1 73  ? 14.378  -98.080  -55.690 1.00 8.26  ? 72  SER A N   1 
ATOM   546  C  CA  . SER A 1 73  ? 13.050  -97.577  -56.004 1.00 8.95  ? 72  SER A CA  1 
ATOM   547  C  C   . SER A 1 73  ? 12.991  -96.985  -57.392 1.00 9.25  ? 72  SER A C   1 
ATOM   548  O  O   . SER A 1 73  ? 13.965  -96.365  -57.879 1.00 9.00  ? 72  SER A O   1 
ATOM   549  C  CB  . SER A 1 73  ? 12.593  -96.529  -54.973 1.00 8.34  ? 72  SER A CB  1 
ATOM   550  O  OG  . SER A 1 73  ? 12.435  -97.110  -53.681 1.00 7.88  ? 72  SER A OG  1 
ATOM   551  N  N   . LEU A 1 74  ? 11.841  -97.196  -58.036 1.00 8.55  ? 73  LEU A N   1 
ATOM   552  C  CA  . LEU A 1 74  ? 11.480  -96.508  -59.273 1.00 10.09 ? 73  LEU A CA  1 
ATOM   553  C  C   . LEU A 1 74  ? 10.389  -95.522  -58.931 1.00 10.41 ? 73  LEU A C   1 
ATOM   554  O  O   . LEU A 1 74  ? 9.327   -95.910  -58.422 1.00 10.53 ? 73  LEU A O   1 
ATOM   555  C  CB  . LEU A 1 74  ? 10.997  -97.510  -60.333 1.00 9.78  ? 73  LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 74  ? 10.493  -96.921  -61.657 1.00 8.94  ? 73  LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 74  ? 11.582  -96.192  -62.409 1.00 13.52 ? 73  LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 74  ? 9.915   -98.025  -62.514 1.00 10.84 ? 73  LEU A CD2 1 
ATOM   559  N  N   . THR A 1 75  ? 10.659  -94.249  -59.197 1.00 10.54 ? 74  THR A N   1 
ATOM   560  C  CA  . THR A 1 75  ? 9.695   -93.199  -58.922 1.00 10.41 ? 74  THR A CA  1 
ATOM   561  C  C   . THR A 1 75  ? 9.239   -92.606  -60.232 1.00 10.51 ? 74  THR A C   1 
ATOM   562  O  O   . THR A 1 75  ? 10.057  -92.154  -61.021 1.00 11.84 ? 74  THR A O   1 
ATOM   563  C  CB  . THR A 1 75  ? 10.304  -92.101  -58.038 1.00 10.09 ? 74  THR A CB  1 
ATOM   564  O  OG1 . THR A 1 75  ? 10.833  -92.668  -56.827 1.00 12.23 ? 74  THR A OG1 1 
ATOM   565  C  CG2 . THR A 1 75  ? 9.213   -91.182  -57.537 1.00 11.01 ? 74  THR A CG2 1 
ATOM   566  N  N   . ILE A 1 76  ? 7.929   -92.608  -60.461 1.00 11.02 ? 75  ILE A N   1 
ATOM   567  C  CA  . ILE A 1 76  ? 7.386   -92.043  -61.686 1.00 10.17 ? 75  ILE A CA  1 
ATOM   568  C  C   . ILE A 1 76  ? 6.610   -90.797  -61.306 1.00 10.17 ? 75  ILE A C   1 
ATOM   569  O  O   . ILE A 1 76  ? 5.600   -90.896  -60.622 1.00 9.80  ? 75  ILE A O   1 
ATOM   570  C  CB  . ILE A 1 76  ? 6.480   -93.051  -62.419 1.00 10.58 ? 75  ILE A CB  1 
ATOM   571  C  CG1 . ILE A 1 76  ? 7.254   -94.347  -62.708 1.00 10.48 ? 75  ILE A CG1 1 
ATOM   572  C  CG2 . ILE A 1 76  ? 5.942   -92.424  -63.679 1.00 11.64 ? 75  ILE A CG2 1 
ATOM   573  C  CD1 . ILE A 1 76  ? 6.365   -95.510  -63.171 1.00 14.50 ? 75  ILE A CD1 1 
ATOM   574  N  N   . SER A 1 77  ? 7.096   -89.638  -61.713 1.00 10.58 ? 76  SER A N   1 
ATOM   575  C  CA  . SER A 1 77  ? 6.473   -88.354  -61.408 1.00 10.74 ? 76  SER A CA  1 
ATOM   576  C  C   . SER A 1 77  ? 5.574   -87.930  -62.565 1.00 11.22 ? 76  SER A C   1 
ATOM   577  O  O   . SER A 1 77  ? 5.764   -88.405  -63.678 1.00 11.79 ? 76  SER A O   1 
ATOM   578  C  CB  . SER A 1 77  ? 7.545   -87.306  -61.091 1.00 11.36 ? 76  SER A CB  1 
ATOM   579  O  OG  . SER A 1 77  ? 8.439   -87.776  -60.102 1.00 12.58 ? 76  SER A OG  1 
ATOM   580  N  N   . GLY A 1 78  ? 4.604   -87.070  -62.320 1.00 10.01 ? 77  GLY A N   1 
ATOM   581  C  CA  . GLY A 1 78  ? 3.760   -86.619  -63.395 1.00 9.23  ? 77  GLY A CA  1 
ATOM   582  C  C   . GLY A 1 78  ? 3.104   -87.733  -64.177 1.00 8.81  ? 77  GLY A C   1 
ATOM   583  O  O   . GLY A 1 78  ? 2.981   -87.669  -65.410 1.00 8.82  ? 77  GLY A O   1 
ATOM   584  N  N   . LEU A 1 79  ? 2.667   -88.739  -63.458 1.00 8.12  ? 78  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 79  ? 2.067   -89.958  -63.969 1.00 8.48  ? 78  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 79  ? 1.211   -89.741  -65.225 1.00 7.54  ? 78  LEU A C   1 
ATOM   587  O  O   . LEU A 1 79  ? 0.404   -88.825  -65.226 1.00 6.68  ? 78  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 79  ? 1.218   -90.578  -62.879 1.00 9.31  ? 78  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 79  ? 1.542   -92.035  -62.501 1.00 20.00 ? 78  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 79  ? 3.049   -92.275  -62.568 1.00 13.74 ? 78  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 79  ? 0.979   -92.369  -61.128 1.00 20.00 ? 78  LEU A CD2 1 
ATOM   592  N  N   . LYS A 1 80  ? 1.371   -90.553  -66.254 1.00 6.61  ? 79  LYS A N   1 
ATOM   593  C  CA  . LYS A 1 80  ? 0.534   -90.404  -67.435 1.00 7.31  ? 79  LYS A CA  1 
ATOM   594  C  C   . LYS A 1 80  ? -0.199  -91.735  -67.618 1.00 6.76  ? 79  LYS A C   1 
ATOM   595  O  O   . LYS A 1 80  ? 0.260   -92.791  -67.165 1.00 5.01  ? 79  LYS A O   1 
ATOM   596  C  CB  . LYS A 1 80  ? 1.365   -90.044  -68.674 1.00 7.10  ? 79  LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 80  ? 1.910   -88.614  -68.616 1.00 10.04 ? 79  LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 80  ? 2.440   -88.124  -69.961 1.00 12.71 ? 79  LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 80  ? 3.083   -86.741  -69.849 1.00 13.50 ? 79  LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 80  ? 2.116   -85.647  -70.133 1.00 16.60 ? 79  LYS A NZ  1 
ATOM   601  N  N   . THR A 1 81  ? -1.356  -91.702  -68.285 1.00 6.94  ? 80  THR A N   1 
ATOM   602  C  CA  . THR A 1 81  ? -2.149  -92.916  -68.487 1.00 7.29  ? 80  THR A CA  1 
ATOM   603  C  C   . THR A 1 81  ? -1.272  -94.024  -69.092 1.00 7.73  ? 80  THR A C   1 
ATOM   604  O  O   . THR A 1 81  ? -1.377  -95.186  -68.709 1.00 7.20  ? 80  THR A O   1 
ATOM   605  C  CB  . THR A 1 81  ? -3.390  -92.647  -69.387 1.00 7.41  ? 80  THR A CB  1 
ATOM   606  O  OG1 . THR A 1 81  ? -2.981  -92.070  -70.634 1.00 7.62  ? 80  THR A OG1 1 
ATOM   607  C  CG2 . THR A 1 81  ? -4.302  -91.557  -68.778 1.00 7.34  ? 80  THR A CG2 1 
ATOM   608  N  N   . GLU A 1 82  ? -0.369  -93.604  -69.980 1.00 8.19  ? 81  GLU A N   1 
ATOM   609  C  CA  . GLU A 1 82  ? 0.531   -94.453  -70.754 1.00 9.28  ? 81  GLU A CA  1 
ATOM   610  C  C   . GLU A 1 82  ? 1.439   -95.278  -69.862 1.00 8.98  ? 81  GLU A C   1 
ATOM   611  O  O   . GLU A 1 82  ? 1.972   -96.294  -70.293 1.00 9.36  ? 81  GLU A O   1 
ATOM   612  C  CB  . GLU A 1 82  ? 1.404   -93.582  -71.684 1.00 10.03 ? 81  GLU A CB  1 
ATOM   613  C  CG  . GLU A 1 82  ? 0.844   -92.188  -71.975 1.00 12.38 ? 81  GLU A CG  1 
ATOM   614  C  CD  . GLU A 1 82  ? 1.906   -91.159  -72.315 1.00 15.18 ? 81  GLU A CD  1 
ATOM   615  O  OE1 . GLU A 1 82  ? 1.525   -90.030  -72.694 1.00 20.86 ? 81  GLU A OE1 1 
ATOM   616  O  OE2 . GLU A 1 82  ? 3.111   -91.457  -72.221 1.00 18.59 ? 81  GLU A OE2 1 
ATOM   617  N  N   . ASP A 1 83  ? 1.628   -94.834  -68.619 1.00 7.99  ? 82  ASP A N   1 
ATOM   618  C  CA  . ASP A 1 83  ? 2.552   -95.493  -67.687 1.00 7.83  ? 82  ASP A CA  1 
ATOM   619  C  C   . ASP A 1 83  ? 2.042   -96.776  -67.030 1.00 7.39  ? 82  ASP A C   1 
ATOM   620  O  O   . ASP A 1 83  ? 2.806   -97.483  -66.340 1.00 7.25  ? 82  ASP A O   1 
ATOM   621  C  CB  . ASP A 1 83  ? 2.970   -94.528  -66.593 1.00 8.49  ? 82  ASP A CB  1 
ATOM   622  C  CG  . ASP A 1 83  ? 3.619   -93.294  -67.127 1.00 9.74  ? 82  ASP A CG  1 
ATOM   623  O  OD1 . ASP A 1 83  ? 4.232   -93.351  -68.218 1.00 10.84 ? 82  ASP A OD1 1 
ATOM   624  O  OD2 . ASP A 1 83  ? 3.548   -92.216  -66.514 1.00 9.96  ? 82  ASP A OD2 1 
ATOM   625  N  N   . GLU A 1 84  ? 0.770   -97.083  -67.240 1.00 7.08  ? 83  GLU A N   1 
ATOM   626  C  CA  . GLU A 1 84  ? 0.183   -98.320  -66.752 1.00 8.24  ? 83  GLU A CA  1 
ATOM   627  C  C   . GLU A 1 84  ? 0.922   -99.470  -67.399 1.00 8.20  ? 83  GLU A C   1 
ATOM   628  O  O   . GLU A 1 84  ? 0.989   -99.557  -68.623 1.00 9.00  ? 83  GLU A O   1 
ATOM   629  C  CB  . GLU A 1 84  ? -1.276  -98.419  -67.167 1.00 7.91  ? 83  GLU A CB  1 
ATOM   630  C  CG  . GLU A 1 84  ? -2.241  -97.822  -66.173 1.00 11.45 ? 83  GLU A CG  1 
ATOM   631  C  CD  . GLU A 1 84  ? -3.548  -98.591  -66.073 1.00 12.76 ? 83  GLU A CD  1 
ATOM   632  O  OE1 . GLU A 1 84  ? -4.360  -98.222  -65.218 1.00 14.35 ? 83  GLU A OE1 1 
ATOM   633  O  OE2 . GLU A 1 84  ? -3.777  -99.549  -66.846 1.00 16.68 ? 83  GLU A OE2 1 
ATOM   634  N  N   . ALA A 1 85  ? 1.471   -100.342 -66.569 1.00 8.48  ? 84  ALA A N   1 
ATOM   635  C  CA  . ALA A 1 85  ? 2.363   -101.398 -67.036 1.00 7.92  ? 84  ALA A CA  1 
ATOM   636  C  C   . ALA A 1 85  ? 2.836   -102.174 -65.831 1.00 8.21  ? 84  ALA A C   1 
ATOM   637  O  O   . ALA A 1 85  ? 2.624   -101.752 -64.710 1.00 8.72  ? 84  ALA A O   1 
ATOM   638  C  CB  . ALA A 1 85  ? 3.574   -100.795 -67.761 1.00 8.25  ? 84  ALA A CB  1 
ATOM   639  N  N   . ASP A 1 86  ? 3.474   -103.317 -66.068 1.00 6.22  ? 85  ASP A N   1 
ATOM   640  C  CA  . ASP A 1 86  ? 4.214   -103.994 -65.005 1.00 6.94  ? 85  ASP A CA  1 
ATOM   641  C  C   . ASP A 1 86  ? 5.631   -103.452 -64.983 1.00 7.48  ? 85  ASP A C   1 
ATOM   642  O  O   . ASP A 1 86  ? 6.225   -103.206 -66.036 1.00 8.06  ? 85  ASP A O   1 
ATOM   643  C  CB  . ASP A 1 86  ? 4.279   -105.513 -65.250 1.00 5.70  ? 85  ASP A CB  1 
ATOM   644  C  CG  . ASP A 1 86  ? 2.942   -106.263 -65.006 1.00 6.52  ? 85  ASP A CG  1 
ATOM   645  O  OD1 . ASP A 1 86  ? 2.887   -107.453 -65.376 1.00 2.65  ? 85  ASP A OD1 1 
ATOM   646  O  OD2 . ASP A 1 86  ? 1.916   -105.802 -64.458 1.00 4.62  ? 85  ASP A OD2 1 
ATOM   647  N  N   . TYR A 1 87  ? 6.172   -103.270 -63.788 1.00 8.08  ? 86  TYR A N   1 
ATOM   648  C  CA  . TYR A 1 87  ? 7.569   -102.850 -63.644 1.00 8.21  ? 86  TYR A CA  1 
ATOM   649  C  C   . TYR A 1 87  ? 8.283   -103.861 -62.797 1.00 8.26  ? 86  TYR A C   1 
ATOM   650  O  O   . TYR A 1 87  ? 7.799   -104.226 -61.701 1.00 8.71  ? 86  TYR A O   1 
ATOM   651  C  CB  . TYR A 1 87  ? 7.637   -101.481 -62.990 1.00 7.59  ? 86  TYR A CB  1 
ATOM   652  C  CG  . TYR A 1 87  ? 7.049   -100.424 -63.869 1.00 8.62  ? 86  TYR A CG  1 
ATOM   653  C  CD1 . TYR A 1 87  ? 5.681   -100.145 -63.836 1.00 7.17  ? 86  TYR A CD1 1 
ATOM   654  C  CD2 . TYR A 1 87  ? 7.851   -99.729  -64.771 1.00 8.05  ? 86  TYR A CD2 1 
ATOM   655  C  CE1 . TYR A 1 87  ? 5.126   -99.166  -64.641 1.00 8.73  ? 86  TYR A CE1 1 
ATOM   656  C  CE2 . TYR A 1 87  ? 7.312   -98.744  -65.589 1.00 7.78  ? 86  TYR A CE2 1 
ATOM   657  C  CZ  . TYR A 1 87  ? 5.958   -98.475  -65.531 1.00 7.39  ? 86  TYR A CZ  1 
ATOM   658  O  OH  . TYR A 1 87  ? 5.439   -97.538  -66.368 1.00 9.44  ? 86  TYR A OH  1 
ATOM   659  N  N   . TYR A 1 88  ? 9.418   -104.334 -63.322 1.00 7.65  ? 87  TYR A N   1 
ATOM   660  C  CA  . TYR A 1 88  ? 10.295  -105.302 -62.659 1.00 7.87  ? 87  TYR A CA  1 
ATOM   661  C  C   . TYR A 1 88  ? 11.644  -104.687 -62.319 1.00 8.30  ? 87  TYR A C   1 
ATOM   662  O  O   . TYR A 1 88  ? 12.267  -104.049 -63.167 1.00 9.42  ? 87  TYR A O   1 
ATOM   663  C  CB  . TYR A 1 88  ? 10.596  -106.463 -63.613 1.00 7.11  ? 87  TYR A CB  1 
ATOM   664  C  CG  . TYR A 1 88  ? 9.405   -107.332 -63.872 1.00 5.71  ? 87  TYR A CG  1 
ATOM   665  C  CD1 . TYR A 1 88  ? 9.146   -108.457 -63.077 1.00 8.70  ? 87  TYR A CD1 1 
ATOM   666  C  CD2 . TYR A 1 88  ? 8.532   -107.040 -64.912 1.00 9.08  ? 87  TYR A CD2 1 
ATOM   667  C  CE1 . TYR A 1 88  ? 8.018   -109.241 -63.303 1.00 6.34  ? 87  TYR A CE1 1 
ATOM   668  C  CE2 . TYR A 1 88  ? 7.422   -107.826 -65.164 1.00 8.18  ? 87  TYR A CE2 1 
ATOM   669  C  CZ  . TYR A 1 88  ? 7.164   -108.922 -64.355 1.00 7.04  ? 87  TYR A CZ  1 
ATOM   670  O  OH  . TYR A 1 88  ? 6.062   -109.687 -64.596 1.00 6.28  ? 87  TYR A OH  1 
ATOM   671  N  N   . CYS A 1 89  ? 12.125  -104.916 -61.100 1.00 8.12  ? 88  CYS A N   1 
ATOM   672  C  CA  . CYS A 1 89  ? 13.515  -104.594 -60.796 1.00 8.69  ? 88  CYS A CA  1 
ATOM   673  C  C   . CYS A 1 89  ? 14.378  -105.829 -61.029 1.00 8.48  ? 88  CYS A C   1 
ATOM   674  O  O   . CYS A 1 89  ? 13.867  -106.964 -61.047 1.00 7.89  ? 88  CYS A O   1 
ATOM   675  C  CB  . CYS A 1 89  ? 13.651  -104.091 -59.369 1.00 8.32  ? 88  CYS A CB  1 
ATOM   676  S  SG  . CYS A 1 89  ? 13.311  -105.322 -58.079 1.00 10.66 ? 88  CYS A SG  1 
ATOM   677  N  N   . GLN A 1 90  ? 15.679  -105.611 -61.205 1.00 8.41  ? 89  GLN A N   1 
ATOM   678  C  CA  . GLN A 1 90  ? 16.583  -106.702 -61.526 1.00 9.07  ? 89  GLN A CA  1 
ATOM   679  C  C   . GLN A 1 90  ? 17.972  -106.342 -61.039 1.00 8.59  ? 89  GLN A C   1 
ATOM   680  O  O   . GLN A 1 90  ? 18.387  -105.204 -61.149 1.00 9.97  ? 89  GLN A O   1 
ATOM   681  C  CB  . GLN A 1 90  ? 16.567  -106.951 -63.043 1.00 7.94  ? 89  GLN A CB  1 
ATOM   682  C  CG  . GLN A 1 90  ? 17.541  -108.006 -63.547 1.00 9.63  ? 89  GLN A CG  1 
ATOM   683  C  CD  . GLN A 1 90  ? 18.842  -107.386 -64.028 1.00 9.82  ? 89  GLN A CD  1 
ATOM   684  O  OE1 . GLN A 1 90  ? 18.829  -106.486 -64.860 1.00 11.12 ? 89  GLN A OE1 1 
ATOM   685  N  NE2 . GLN A 1 90  ? 19.961  -107.856 -63.502 1.00 11.77 ? 89  GLN A NE2 1 
ATOM   686  N  N   . SER A 1 91  ? 18.685  -107.315 -60.481 1.00 9.17  ? 90  SER A N   1 
ATOM   687  C  CA  . SER A 1 91  ? 20.090  -107.126 -60.186 1.00 10.03 ? 90  SER A CA  1 
ATOM   688  C  C   . SER A 1 91  ? 20.848  -108.431 -60.428 1.00 10.87 ? 90  SER A C   1 
ATOM   689  O  O   . SER A 1 91  ? 20.330  -109.326 -61.092 1.00 11.11 ? 90  SER A O   1 
ATOM   690  C  CB  . SER A 1 91  ? 20.281  -106.594 -58.774 1.00 10.41 ? 90  SER A CB  1 
ATOM   691  O  OG  . SER A 1 91  ? 21.590  -106.083 -58.606 1.00 10.62 ? 90  SER A OG  1 
ATOM   692  N  N   . TYR A 1 92  ? 22.066  -108.527 -59.906 1.00 12.26 ? 91  TYR A N   1 
ATOM   693  C  CA  . TYR A 1 92  ? 22.933  -109.678 -60.149 1.00 13.80 ? 91  TYR A CA  1 
ATOM   694  C  C   . TYR A 1 92  ? 23.573  -110.174 -58.863 1.00 14.15 ? 91  TYR A C   1 
ATOM   695  O  O   . TYR A 1 92  ? 23.896  -109.379 -57.979 1.00 13.53 ? 91  TYR A O   1 
ATOM   696  C  CB  . TYR A 1 92  ? 24.063  -109.328 -61.121 1.00 14.35 ? 91  TYR A CB  1 
ATOM   697  C  CG  . TYR A 1 92  ? 23.650  -108.623 -62.392 1.00 17.46 ? 91  TYR A CG  1 
ATOM   698  C  CD1 . TYR A 1 92  ? 23.306  -109.355 -63.537 1.00 19.73 ? 91  TYR A CD1 1 
ATOM   699  C  CD2 . TYR A 1 92  ? 23.645  -107.229 -62.470 1.00 18.83 ? 91  TYR A CD2 1 
ATOM   700  C  CE1 . TYR A 1 92  ? 22.944  -108.712 -64.723 1.00 21.38 ? 91  TYR A CE1 1 
ATOM   701  C  CE2 . TYR A 1 92  ? 23.284  -106.569 -63.662 1.00 21.70 ? 91  TYR A CE2 1 
ATOM   702  C  CZ  . TYR A 1 92  ? 22.933  -107.328 -64.781 1.00 22.11 ? 91  TYR A CZ  1 
ATOM   703  O  OH  . TYR A 1 92  ? 22.564  -106.710 -65.959 1.00 24.43 ? 91  TYR A OH  1 
ATOM   704  N  N   . ASP A 1 93  ? 23.760  -111.492 -58.783 1.00 15.25 ? 92  ASP A N   1 
ATOM   705  C  CA  . ASP A 1 93  ? 24.553  -112.120 -57.738 1.00 16.74 ? 92  ASP A CA  1 
ATOM   706  C  C   . ASP A 1 93  ? 25.735  -112.807 -58.413 1.00 16.94 ? 92  ASP A C   1 
ATOM   707  O  O   . ASP A 1 93  ? 25.788  -114.037 -58.476 1.00 17.54 ? 92  ASP A O   1 
ATOM   708  C  CB  . ASP A 1 93  ? 23.711  -113.144 -56.956 1.00 16.94 ? 92  ASP A CB  1 
ATOM   709  C  CG  . ASP A 1 93  ? 24.455  -113.747 -55.779 1.00 18.27 ? 92  ASP A CG  1 
ATOM   710  O  OD1 . ASP A 1 93  ? 24.641  -113.043 -54.764 1.00 20.61 ? 92  ASP A OD1 1 
ATOM   711  O  OD2 . ASP A 1 93  ? 24.876  -114.928 -55.769 1.00 19.61 ? 92  ASP A OD2 1 
ATOM   712  N  N   . ALA A 1 94  ? 26.668  -112.017 -58.961 1.00 17.49 ? 93  ALA A N   1 
ATOM   713  C  CA  . ALA A 1 94  ? 27.908  -112.457 -59.579 1.00 17.86 ? 93  ALA A CA  1 
ATOM   714  C  C   . ALA A 1 94  ? 27.646  -113.475 -60.680 1.00 18.24 ? 93  ALA A C   1 
ATOM   715  O  O   . ALA A 1 94  ? 28.137  -114.629 -60.627 1.00 18.01 ? 93  ALA A O   1 
ATOM   716  C  CB  . ALA A 1 94  ? 28.845  -113.036 -58.533 1.00 17.93 ? 93  ALA A CB  1 
ATOM   717  N  N   . ARG A 1 95  ? 26.924  -113.079 -61.738 1.00 18.80 ? 94  ARG A N   1 
ATOM   718  C  CA  . ARG A 1 95  ? 26.562  -113.977 -62.825 1.00 19.07 ? 94  ARG A CA  1 
ATOM   719  C  C   . ARG A 1 95  ? 25.053  -114.055 -63.006 1.00 18.99 ? 94  ARG A C   1 
ATOM   720  O  O   . ARG A 1 95  ? 24.485  -113.341 -63.844 1.00 19.12 ? 94  ARG A O   1 
ATOM   721  C  CB  . ARG A 1 95  ? 27.116  -115.378 -62.578 1.00 20.00 ? 94  ARG A CB  1 
ATOM   722  C  CG  . ARG A 1 95  ? 28.475  -115.635 -63.202 1.00 20.00 ? 94  ARG A CG  1 
ATOM   723  C  CD  . ARG A 1 95  ? 28.386  -115.614 -64.718 1.00 20.00 ? 94  ARG A CD  1 
ATOM   724  N  NE  . ARG A 1 95  ? 28.216  -114.263 -65.241 1.00 20.00 ? 94  ARG A NE  1 
ATOM   725  C  CZ  . ARG A 1 95  ? 28.118  -113.974 -66.533 1.00 20.00 ? 94  ARG A CZ  1 
ATOM   726  N  NH1 . ARG A 1 95  ? 28.173  -114.946 -67.435 1.00 20.00 ? 94  ARG A NH1 1 
ATOM   727  N  NH2 . ARG A 1 95  ? 27.963  -112.716 -66.922 1.00 20.00 ? 94  ARG A NH2 1 
ATOM   728  N  N   . ASN A 1 96  ? 24.404  -114.924 -62.225 1.00 18.94 ? 95  ASN A N   1 
ATOM   729  C  CA  . ASN A 1 96  ? 22.958  -115.157 -62.309 1.00 18.48 ? 95  ASN A CA  1 
ATOM   730  C  C   . ASN A 1 96  ? 22.088  -113.931 -62.050 1.00 18.07 ? 95  ASN A C   1 
ATOM   731  O  O   . ASN A 1 96  ? 22.260  -113.223 -61.048 1.00 18.01 ? 95  ASN A O   1 
ATOM   732  C  CB  . ASN A 1 96  ? 22.517  -116.313 -61.397 1.00 18.91 ? 95  ASN A CB  1 
ATOM   733  C  CG  . ASN A 1 96  ? 22.996  -116.152 -59.957 1.00 19.55 ? 95  ASN A CG  1 
ATOM   734  O  OD1 . ASN A 1 96  ? 22.586  -115.228 -59.243 1.00 19.31 ? 95  ASN A OD1 1 
ATOM   735  N  ND2 . ASN A 1 96  ? 23.865  -117.058 -59.524 1.00 19.47 ? 95  ASN A ND2 1 
ATOM   736  N  N   . VAL A 1 97  ? 21.150  -113.702 -62.965 1.00 17.56 ? 96  VAL A N   1 
ATOM   737  C  CA  . VAL A 1 97  ? 20.217  -112.586 -62.871 1.00 16.54 ? 96  VAL A CA  1 
ATOM   738  C  C   . VAL A 1 97  ? 19.147  -112.853 -61.814 1.00 15.53 ? 96  VAL A C   1 
ATOM   739  O  O   . VAL A 1 97  ? 18.625  -113.969 -61.709 1.00 15.11 ? 96  VAL A O   1 
ATOM   740  C  CB  . VAL A 1 97  ? 19.545  -112.258 -64.244 1.00 17.02 ? 96  VAL A CB  1 
ATOM   741  C  CG1 . VAL A 1 97  ? 20.604  -111.873 -65.293 1.00 18.21 ? 96  VAL A CG1 1 
ATOM   742  C  CG2 . VAL A 1 97  ? 18.681  -113.432 -64.742 1.00 16.95 ? 96  VAL A CG2 1 
ATOM   743  N  N   . VAL A 1 98  ? 18.854  -111.830 -61.018 1.00 14.23 ? 97  VAL A N   1 
ATOM   744  C  CA  . VAL A 1 98  ? 17.772  -111.875 -60.041 1.00 13.48 ? 97  VAL A CA  1 
ATOM   745  C  C   . VAL A 1 98  ? 16.691  -110.865 -60.440 1.00 12.66 ? 97  VAL A C   1 
ATOM   746  O  O   . VAL A 1 98  ? 16.996  -109.709 -60.750 1.00 12.38 ? 97  VAL A O   1 
ATOM   747  C  CB  . VAL A 1 98  ? 18.286  -111.582 -58.605 1.00 13.30 ? 97  VAL A CB  1 
ATOM   748  C  CG1 . VAL A 1 98  ? 17.159  -111.667 -57.592 1.00 14.51 ? 97  VAL A CG1 1 
ATOM   749  C  CG2 . VAL A 1 98  ? 19.427  -112.541 -58.223 1.00 14.12 ? 97  VAL A CG2 1 
ATOM   750  N  N   . PHE A 1 99  ? 15.441  -111.317 -60.434 1.00 12.47 ? 98  PHE A N   1 
ATOM   751  C  CA  . PHE A 1 99  ? 14.293  -110.500 -60.801 1.00 12.55 ? 98  PHE A CA  1 
ATOM   752  C  C   . PHE A 1 99  ? 13.308  -110.408 -59.666 1.00 11.86 ? 98  PHE A C   1 
ATOM   753  O  O   . PHE A 1 99  ? 13.022  -111.403 -59.002 1.00 11.26 ? 98  PHE A O   1 
ATOM   754  C  CB  . PHE A 1 99  ? 13.537  -111.122 -61.974 1.00 13.70 ? 98  PHE A CB  1 
ATOM   755  C  CG  . PHE A 1 99  ? 14.142  -110.842 -63.312 1.00 15.28 ? 98  PHE A CG  1 
ATOM   756  C  CD1 . PHE A 1 99  ? 13.945  -109.621 -63.944 1.00 17.37 ? 98  PHE A CD1 1 
ATOM   757  C  CD2 . PHE A 1 99  ? 14.891  -111.817 -63.950 1.00 15.43 ? 98  PHE A CD2 1 
ATOM   758  C  CE1 . PHE A 1 99  ? 14.507  -109.370 -65.207 1.00 18.43 ? 98  PHE A CE1 1 
ATOM   759  C  CE2 . PHE A 1 99  ? 15.463  -111.574 -65.210 1.00 18.50 ? 98  PHE A CE2 1 
ATOM   760  C  CZ  . PHE A 1 99  ? 15.268  -110.347 -65.829 1.00 18.03 ? 98  PHE A CZ  1 
ATOM   761  N  N   . GLY A 1 100 ? 12.758  -109.217 -59.479 1.00 11.11 ? 99  GLY A N   1 
ATOM   762  C  CA  . GLY A 1 100 ? 11.630  -109.035 -58.595 1.00 10.11 ? 99  GLY A CA  1 
ATOM   763  C  C   . GLY A 1 100 ? 10.394  -109.664 -59.199 1.00 9.62  ? 99  GLY A C   1 
ATOM   764  O  O   . GLY A 1 100 ? 10.395  -110.067 -60.365 1.00 8.55  ? 99  GLY A O   1 
ATOM   765  N  N   . GLY A 1 101 ? 9.336   -109.747 -58.394 1.00 9.22  ? 100 GLY A N   1 
ATOM   766  C  CA  . GLY A 1 101 ? 8.086   -110.341 -58.825 1.00 9.85  ? 100 GLY A CA  1 
ATOM   767  C  C   . GLY A 1 101 ? 7.257   -109.459 -59.737 1.00 9.94  ? 100 GLY A C   1 
ATOM   768  O  O   . GLY A 1 101 ? 6.267   -109.926 -60.314 1.00 10.72 ? 100 GLY A O   1 
ATOM   769  N  N   . GLY A 1 102 ? 7.673   -108.194 -59.885 1.00 9.61  ? 101 GLY A N   1 
ATOM   770  C  CA  . GLY A 1 102 ? 6.961   -107.223 -60.714 1.00 9.91  ? 101 GLY A CA  1 
ATOM   771  C  C   . GLY A 1 102 ? 5.784   -106.549 -60.032 1.00 9.99  ? 101 GLY A C   1 
ATOM   772  O  O   . GLY A 1 102 ? 5.090   -107.158 -59.215 1.00 11.16 ? 101 GLY A O   1 
ATOM   773  N  N   . THR A 1 103 ? 5.565   -105.290 -60.380 1.00 9.68  ? 102 THR A N   1 
ATOM   774  C  CA  . THR A 1 103 ? 4.507   -104.466 -59.802 1.00 8.80  ? 102 THR A CA  1 
ATOM   775  C  C   . THR A 1 103 ? 3.662   -103.887 -60.925 1.00 8.77  ? 102 THR A C   1 
ATOM   776  O  O   . THR A 1 103 ? 4.191   -103.224 -61.842 1.00 8.70  ? 102 THR A O   1 
ATOM   777  C  CB  . THR A 1 103 ? 5.134   -103.293 -59.038 1.00 8.52  ? 102 THR A CB  1 
ATOM   778  O  OG1 . THR A 1 103 ? 5.941   -103.771 -57.948 1.00 9.04  ? 102 THR A OG1 1 
ATOM   779  C  CG2 . THR A 1 103 ? 4.048   -102.422 -58.390 1.00 6.24  ? 102 THR A CG2 1 
ATOM   780  N  N   . ARG A 1 104 ? 2.352   -104.084 -60.843 1.00 8.54  ? 103 ARG A N   1 
ATOM   781  C  CA  . ARG A 1 104 ? 1.455   -103.432 -61.785 1.00 8.59  ? 103 ARG A CA  1 
ATOM   782  C  C   . ARG A 1 104 ? 1.106   -102.051 -61.293 1.00 8.59  ? 103 ARG A C   1 
ATOM   783  O  O   . ARG A 1 104 ? 0.593   -101.883 -60.194 1.00 7.76  ? 103 ARG A O   1 
ATOM   784  C  CB  . ARG A 1 104 ? 0.200   -104.277 -62.066 1.00 9.04  ? 103 ARG A CB  1 
ATOM   785  C  CG  . ARG A 1 104 ? -0.859  -103.565 -62.931 1.00 11.41 ? 103 ARG A CG  1 
ATOM   786  C  CD  . ARG A 1 104 ? -0.540  -103.568 -64.427 1.00 14.74 ? 103 ARG A CD  1 
ATOM   787  N  NE  . ARG A 1 104 ? -1.654  -103.044 -65.216 1.00 18.89 ? 103 ARG A NE  1 
ATOM   788  C  CZ  . ARG A 1 104 ? -1.755  -103.128 -66.540 1.00 20.06 ? 103 ARG A CZ  1 
ATOM   789  N  NH1 . ARG A 1 104 ? -0.804  -103.718 -67.266 1.00 22.28 ? 103 ARG A NH1 1 
ATOM   790  N  NH2 . ARG A 1 104 ? -2.809  -102.610 -67.139 1.00 19.82 ? 103 ARG A NH2 1 
ATOM   791  N  N   . LEU A 1 105 ? 1.433   -101.067 -62.127 1.00 8.31  ? 104 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 105 ? 1.039   -99.694  -61.930 1.00 9.29  ? 104 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 105 ? -0.296  -99.519  -62.631 1.00 9.24  ? 104 LEU A C   1 
ATOM   794  O  O   . LEU A 1 105 ? -0.365  -99.633  -63.853 1.00 9.11  ? 104 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 105 ? 2.079   -98.746  -62.545 1.00 9.06  ? 104 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 105 ? 1.672   -97.248  -62.633 1.00 10.72 ? 104 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 105 ? 1.117   -96.641  -61.325 1.00 12.36 ? 104 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 105 ? 2.812   -96.410  -63.157 1.00 14.49 ? 104 LEU A CD2 1 
ATOM   799  N  N   . THR A 1 106 ? -1.351  -99.289  -61.849 1.00 9.46  ? 105 THR A N   1 
ATOM   800  C  CA  . THR A 1 106 ? -2.662  -98.904  -62.381 1.00 10.00 ? 105 THR A CA  1 
ATOM   801  C  C   . THR A 1 106 ? -2.787  -97.394  -62.265 1.00 10.25 ? 105 THR A C   1 
ATOM   802  O  O   . THR A 1 106 ? -2.560  -96.825  -61.195 1.00 10.17 ? 105 THR A O   1 
ATOM   803  C  CB  . THR A 1 106 ? -3.805  -99.588  -61.602 1.00 9.79  ? 105 THR A CB  1 
ATOM   804  O  OG1 . THR A 1 106 ? -3.818  -100.991 -61.900 1.00 10.87 ? 105 THR A OG1 1 
ATOM   805  C  CG2 . THR A 1 106 ? -5.177  -99.116  -62.090 1.00 9.76  ? 105 THR A CG2 1 
ATOM   806  N  N   . VAL A 1 107 ? -3.121  -96.753  -63.378 1.00 10.84 ? 106 VAL A N   1 
ATOM   807  C  CA  . VAL A 1 107 ? -3.333  -95.309  -63.401 1.00 12.05 ? 106 VAL A CA  1 
ATOM   808  C  C   . VAL A 1 107 ? -4.828  -95.068  -63.371 1.00 12.54 ? 106 VAL A C   1 
ATOM   809  O  O   . VAL A 1 107 ? -5.561  -95.474  -64.278 1.00 12.74 ? 106 VAL A O   1 
ATOM   810  C  CB  . VAL A 1 107 ? -2.680  -94.628  -64.641 1.00 11.91 ? 106 VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 107 ? -3.066  -93.144  -64.722 1.00 12.31 ? 106 VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 107 ? -1.166  -94.801  -64.637 1.00 12.90 ? 106 VAL A CG2 1 
ATOM   813  N  N   . LEU A 1 108 ? -5.272  -94.414  -62.306 1.00 13.32 ? 107 LEU A N   1 
ATOM   814  C  CA  . LEU A 1 108 ? -6.680  -94.171  -62.042 1.00 14.46 ? 107 LEU A CA  1 
ATOM   815  C  C   . LEU A 1 108 ? -7.264  -93.182  -63.056 1.00 14.88 ? 107 LEU A C   1 
ATOM   816  O  O   . LEU A 1 108 ? -6.523  -92.485  -63.751 1.00 15.24 ? 107 LEU A O   1 
ATOM   817  C  CB  . LEU A 1 108 ? -6.824  -93.632  -60.612 1.00 14.55 ? 107 LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 108 ? -6.854  -94.565  -59.386 1.00 15.15 ? 107 LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 108 ? -6.156  -95.901  -59.568 1.00 16.13 ? 107 LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 108 ? -6.267  -93.853  -58.172 1.00 16.20 ? 107 LEU A CD2 1 
ATOM   821  N  N   . GLY A 1 109 ? -8.589  -93.134  -63.156 1.00 15.53 ? 108 GLY A N   1 
ATOM   822  C  CA  . GLY A 1 109 ? -9.247  -92.155  -64.009 1.00 16.36 ? 108 GLY A CA  1 
ATOM   823  C  C   . GLY A 1 109 ? -10.109 -92.751  -65.109 1.00 16.72 ? 108 GLY A C   1 
ATOM   824  O  O   . GLY A 1 109 ? -10.986 -92.078  -65.657 1.00 16.65 ? 108 GLY A O   1 
ATOM   825  O  OXT . GLY A 1 109 ? -9.946  -93.914  -65.482 1.00 17.56 ? 108 GLY A OXT 1 
ATOM   826  N  N   . ASN B 1 1   ? -8.753  -129.035 -35.772 1.00 11.97 ? 1   ASN B N   1 
ATOM   827  C  CA  . ASN B 1 1   ? -7.429  -128.434 -36.076 1.00 12.03 ? 1   ASN B CA  1 
ATOM   828  C  C   . ASN B 1 1   ? -6.798  -127.745 -34.860 1.00 11.82 ? 1   ASN B C   1 
ATOM   829  O  O   . ASN B 1 1   ? -6.896  -128.252 -33.743 1.00 12.14 ? 1   ASN B O   1 
ATOM   830  C  CB  . ASN B 1 1   ? -7.515  -127.504 -37.304 1.00 12.29 ? 1   ASN B CB  1 
ATOM   831  C  CG  . ASN B 1 1   ? -8.424  -126.298 -37.079 1.00 12.15 ? 1   ASN B CG  1 
ATOM   832  O  OD1 . ASN B 1 1   ? -9.287  -126.303 -36.195 1.00 13.85 ? 1   ASN B OD1 1 
ATOM   833  N  ND2 . ASN B 1 1   ? -8.227  -125.256 -37.887 1.00 11.34 ? 1   ASN B ND2 1 
ATOM   834  N  N   . PHE B 1 2   ? -6.128  -126.617 -35.087 1.00 11.15 ? 2   PHE B N   1 
ATOM   835  C  CA  . PHE B 1 2   ? -5.587  -125.806 -34.005 1.00 10.39 ? 2   PHE B CA  1 
ATOM   836  C  C   . PHE B 1 2   ? -5.477  -124.346 -34.416 1.00 10.77 ? 2   PHE B C   1 
ATOM   837  O  O   . PHE B 1 2   ? -5.820  -123.967 -35.546 1.00 10.79 ? 2   PHE B O   1 
ATOM   838  C  CB  . PHE B 1 2   ? -4.221  -126.332 -33.575 1.00 9.92  ? 2   PHE B CB  1 
ATOM   839  C  CG  . PHE B 1 2   ? -3.245  -126.479 -34.708 1.00 9.34  ? 2   PHE B CG  1 
ATOM   840  C  CD1 . PHE B 1 2   ? -2.357  -125.452 -35.017 1.00 9.51  ? 2   PHE B CD1 1 
ATOM   841  C  CD2 . PHE B 1 2   ? -3.211  -127.649 -35.460 1.00 9.50  ? 2   PHE B CD2 1 
ATOM   842  C  CE1 . PHE B 1 2   ? -1.445  -125.590 -36.061 1.00 10.02 ? 2   PHE B CE1 1 
ATOM   843  C  CE2 . PHE B 1 2   ? -2.300  -127.797 -36.506 1.00 10.85 ? 2   PHE B CE2 1 
ATOM   844  C  CZ  . PHE B 1 2   ? -1.417  -126.767 -36.806 1.00 10.60 ? 2   PHE B CZ  1 
ATOM   845  N  N   . MET B 1 3   ? -5.018  -123.526 -33.481 1.00 10.74 ? 3   MET B N   1 
ATOM   846  C  CA  . MET B 1 3   ? -4.662  -122.146 -33.771 1.00 11.48 ? 3   MET B CA  1 
ATOM   847  C  C   . MET B 1 3   ? -3.218  -121.883 -33.343 1.00 10.94 ? 3   MET B C   1 
ATOM   848  O  O   . MET B 1 3   ? -2.714  -122.500 -32.398 1.00 10.89 ? 3   MET B O   1 
ATOM   849  C  CB  . MET B 1 3   ? -5.630  -121.162 -33.099 1.00 11.98 ? 3   MET B CB  1 
ATOM   850  C  CG  . MET B 1 3   ? -6.378  -121.720 -31.906 1.00 14.48 ? 3   MET B CG  1 
ATOM   851  S  SD  . MET B 1 3   ? -7.057  -120.440 -30.853 1.00 18.90 ? 3   MET B SD  1 
ATOM   852  C  CE  . MET B 1 3   ? -8.622  -121.194 -30.366 1.00 17.20 ? 3   MET B CE  1 
ATOM   853  N  N   . LEU B 1 4   ? -2.549  -120.991 -34.070 1.00 10.54 ? 4   LEU B N   1 
ATOM   854  C  CA  . LEU B 1 4   ? -1.214  -120.557 -33.700 1.00 10.13 ? 4   LEU B CA  1 
ATOM   855  C  C   . LEU B 1 4   ? -1.259  -119.147 -33.097 1.00 11.00 ? 4   LEU B C   1 
ATOM   856  O  O   . LEU B 1 4   ? -1.958  -118.274 -33.609 1.00 10.85 ? 4   LEU B O   1 
ATOM   857  C  CB  . LEU B 1 4   ? -0.281  -120.640 -34.919 1.00 9.37  ? 4   LEU B CB  1 
ATOM   858  C  CG  . LEU B 1 4   ? -0.048  -122.029 -35.549 1.00 9.24  ? 4   LEU B CG  1 
ATOM   859  C  CD1 . LEU B 1 4   ? 0.625   -121.927 -36.930 1.00 9.32  ? 4   LEU B CD1 1 
ATOM   860  C  CD2 . LEU B 1 4   ? 0.778   -122.966 -34.653 1.00 9.51  ? 4   LEU B CD2 1 
ATOM   861  N  N   . ASN B 1 5   ? -0.518  -118.925 -32.013 1.00 11.67 ? 5   ASN B N   1 
ATOM   862  C  CA  . ASN B 1 5   ? -0.559  -117.645 -31.297 1.00 12.21 ? 5   ASN B CA  1 
ATOM   863  C  C   . ASN B 1 5   ? 0.786   -116.949 -31.156 1.00 12.03 ? 5   ASN B C   1 
ATOM   864  O  O   . ASN B 1 5   ? 1.706   -117.490 -30.527 1.00 12.18 ? 5   ASN B O   1 
ATOM   865  C  CB  . ASN B 1 5   ? -1.131  -117.829 -29.886 1.00 12.88 ? 5   ASN B CB  1 
ATOM   866  C  CG  . ASN B 1 5   ? -2.628  -118.000 -29.879 1.00 14.97 ? 5   ASN B CG  1 
ATOM   867  O  OD1 . ASN B 1 5   ? -3.370  -117.191 -30.453 1.00 19.55 ? 5   ASN B OD1 1 
ATOM   868  N  ND2 . ASN B 1 5   ? -3.095  -119.053 -29.204 1.00 20.17 ? 5   ASN B ND2 1 
ATOM   869  N  N   . GLN B 1 6   ? 0.877   -115.739 -31.710 1.00 11.40 ? 6   GLN B N   1 
ATOM   870  C  CA  . GLN B 1 6   ? 2.060   -114.891 -31.544 1.00 10.63 ? 6   GLN B CA  1 
ATOM   871  C  C   . GLN B 1 6   ? 1.653   -113.512 -31.013 1.00 9.95  ? 6   GLN B C   1 
ATOM   872  O  O   . GLN B 1 6   ? 0.552   -113.048 -31.297 1.00 9.07  ? 6   GLN B O   1 
ATOM   873  C  CB  . GLN B 1 6   ? 2.811   -114.759 -32.872 1.00 10.59 ? 6   GLN B CB  1 
ATOM   874  C  CG  . GLN B 1 6   ? 1.955   -115.049 -34.089 1.00 10.65 ? 6   GLN B CG  1 
ATOM   875  C  CD  . GLN B 1 6   ? 2.706   -114.950 -35.403 1.00 9.38  ? 6   GLN B CD  1 
ATOM   876  O  OE1 . GLN B 1 6   ? 2.272   -115.525 -36.396 1.00 8.97  ? 6   GLN B OE1 1 
ATOM   877  N  NE2 . GLN B 1 6   ? 3.830   -114.223 -35.417 1.00 9.58  ? 6   GLN B NE2 1 
ATOM   878  N  N   . PRO B 1 7   ? 2.532   -112.855 -30.247 1.00 9.68  ? 7   PRO B N   1 
ATOM   879  C  CA  . PRO B 1 7   ? 2.228   -111.522 -29.711 1.00 9.23  ? 7   PRO B CA  1 
ATOM   880  C  C   . PRO B 1 7   ? 2.017   -110.563 -30.877 1.00 8.62  ? 7   PRO B C   1 
ATOM   881  O  O   . PRO B 1 7   ? 2.596   -110.770 -31.930 1.00 7.14  ? 7   PRO B O   1 
ATOM   882  C  CB  . PRO B 1 7   ? 3.496   -111.153 -28.934 1.00 9.55  ? 7   PRO B CB  1 
ATOM   883  C  CG  . PRO B 1 7   ? 4.580   -112.018 -29.540 1.00 10.05 ? 7   PRO B CG  1 
ATOM   884  C  CD  . PRO B 1 7   ? 3.880   -113.317 -29.851 1.00 9.82  ? 7   PRO B CD  1 
ATOM   885  N  N   . HIS B 1 8   ? 1.165   -109.555 -30.714 1.00 7.74  ? 8   HIS B N   1 
ATOM   886  C  CA  . HIS B 1 8   ? 0.939   -108.627 -31.816 1.00 8.39  ? 8   HIS B CA  1 
ATOM   887  C  C   . HIS B 1 8   ? 2.219   -107.907 -32.266 1.00 8.76  ? 8   HIS B C   1 
ATOM   888  O  O   . HIS B 1 8   ? 2.464   -107.736 -33.483 1.00 8.55  ? 8   HIS B O   1 
ATOM   889  C  CB  . HIS B 1 8   ? -0.138  -107.578 -31.486 1.00 7.62  ? 8   HIS B CB  1 
ATOM   890  C  CG  . HIS B 1 8   ? -1.409  -108.148 -30.914 1.00 7.77  ? 8   HIS B CG  1 
ATOM   891  N  ND1 . HIS B 1 8   ? -2.548  -108.594 -31.884 1.00 6.78  ? 8   HIS B ND1 1 
ATOM   892  C  CD2 . HIS B 1 8   ? -1.807  -108.335 -29.406 1.00 5.74  ? 8   HIS B CD2 1 
ATOM   893  C  CE1 . HIS B 1 8   ? -3.542  -109.017 -31.044 1.00 4.86  ? 8   HIS B CE1 1 
ATOM   894  N  NE2 . HIS B 1 8   ? -3.109  -108.870 -29.530 1.00 7.63  ? 8   HIS B NE2 1 
ATOM   895  N  N   . SER B 1 9   ? 3.016   -107.466 -31.284 1.00 10.06 ? 9   SER B N   1 
ATOM   896  C  CA  . SER B 1 9   ? 4.116   -106.553 -31.563 1.00 11.13 ? 9   SER B CA  1 
ATOM   897  C  C   . SER B 1 9   ? 5.340   -106.875 -30.747 1.00 11.82 ? 9   SER B C   1 
ATOM   898  O  O   . SER B 1 9   ? 5.244   -107.237 -29.572 1.00 11.91 ? 9   SER B O   1 
ATOM   899  C  CB  . SER B 1 9   ? 3.702   -105.110 -31.270 1.00 10.71 ? 9   SER B CB  1 
ATOM   900  O  OG  . SER B 1 9   ? 3.100   -104.535 -32.406 1.00 11.66 ? 9   SER B OG  1 
ATOM   901  N  N   . VAL B 1 10  ? 6.494   -106.737 -31.389 1.00 12.82 ? 11  VAL B N   1 
ATOM   902  C  CA  . VAL B 1 10  ? 7.765   -106.815 -30.697 1.00 13.63 ? 11  VAL B CA  1 
ATOM   903  C  C   . VAL B 1 10  ? 8.573   -105.569 -31.061 1.00 13.57 ? 11  VAL B C   1 
ATOM   904  O  O   . VAL B 1 10  ? 8.644   -105.176 -32.224 1.00 13.43 ? 11  VAL B O   1 
ATOM   905  C  CB  . VAL B 1 10  ? 8.514   -108.137 -31.014 1.00 14.25 ? 11  VAL B CB  1 
ATOM   906  C  CG1 . VAL B 1 10  ? 9.870   -108.163 -30.345 1.00 15.63 ? 11  VAL B CG1 1 
ATOM   907  C  CG2 . VAL B 1 10  ? 7.701   -109.351 -30.548 1.00 13.91 ? 11  VAL B CG2 1 
ATOM   908  N  N   . SER B 1 11  ? 9.134   -104.923 -30.047 1.00 13.65 ? 12  SER B N   1 
ATOM   909  C  CA  . SER B 1 11  ? 10.025  -103.794 -30.261 1.00 13.76 ? 12  SER B CA  1 
ATOM   910  C  C   . SER B 1 11  ? 11.452  -104.216 -29.923 1.00 13.55 ? 12  SER B C   1 
ATOM   911  O  O   . SER B 1 11  ? 11.674  -104.952 -28.958 1.00 13.59 ? 12  SER B O   1 
ATOM   912  C  CB  . SER B 1 11  ? 9.577   -102.588 -29.426 1.00 13.92 ? 12  SER B CB  1 
ATOM   913  O  OG  . SER B 1 11  ? 10.634  -102.080 -28.609 1.00 14.39 ? 12  SER B OG  1 
ATOM   914  N  N   . GLU B 1 12  ? 12.409  -103.771 -30.733 1.00 13.10 ? 13  GLU B N   1 
ATOM   915  C  CA  . GLU B 1 12  ? 13.825  -103.977 -30.442 1.00 12.63 ? 13  GLU B CA  1 
ATOM   916  C  C   . GLU B 1 12  ? 14.704  -103.006 -31.223 1.00 12.21 ? 13  GLU B C   1 
ATOM   917  O  O   . GLU B 1 12  ? 14.401  -102.655 -32.362 1.00 11.93 ? 13  GLU B O   1 
ATOM   918  C  CB  . GLU B 1 12  ? 14.238  -105.431 -30.704 1.00 12.67 ? 13  GLU B CB  1 
ATOM   919  C  CG  . GLU B 1 12  ? 15.404  -105.936 -29.858 1.00 13.34 ? 13  GLU B CG  1 
ATOM   920  C  CD  . GLU B 1 12  ? 15.238  -105.695 -28.363 1.00 13.90 ? 13  GLU B CD  1 
ATOM   921  O  OE1 . GLU B 1 12  ? 16.205  -105.222 -27.725 1.00 14.52 ? 13  GLU B OE1 1 
ATOM   922  O  OE2 . GLU B 1 12  ? 14.152  -105.984 -27.818 1.00 14.83 ? 13  GLU B OE2 1 
ATOM   923  N  N   . SER B 1 13  ? 15.783  -102.569 -30.583 1.00 11.75 ? 14  SER B N   1 
ATOM   924  C  CA  . SER B 1 13  ? 16.766  -101.682 -31.194 1.00 11.45 ? 14  SER B CA  1 
ATOM   925  C  C   . SER B 1 13  ? 17.659  -102.455 -32.176 1.00 11.31 ? 14  SER B C   1 
ATOM   926  O  O   . SER B 1 13  ? 17.914  -103.645 -31.963 1.00 11.03 ? 14  SER B O   1 
ATOM   927  C  CB  . SER B 1 13  ? 17.618  -101.032 -30.101 1.00 11.43 ? 14  SER B CB  1 
ATOM   928  O  OG  . SER B 1 13  ? 16.905  -100.007 -29.435 1.00 11.31 ? 14  SER B OG  1 
ATOM   929  N  N   . PRO B 1 14  ? 18.125  -101.794 -33.244 1.00 11.18 ? 15  PRO B N   1 
ATOM   930  C  CA  . PRO B 1 14  ? 19.045  -102.424 -34.205 1.00 11.09 ? 15  PRO B CA  1 
ATOM   931  C  C   . PRO B 1 14  ? 20.232  -103.130 -33.540 1.00 11.11 ? 15  PRO B C   1 
ATOM   932  O  O   . PRO B 1 14  ? 20.725  -102.671 -32.505 1.00 10.71 ? 15  PRO B O   1 
ATOM   933  C  CB  . PRO B 1 14  ? 19.559  -101.247 -35.047 1.00 11.18 ? 15  PRO B CB  1 
ATOM   934  C  CG  . PRO B 1 14  ? 18.564  -100.145 -34.879 1.00 11.21 ? 15  PRO B CG  1 
ATOM   935  C  CD  . PRO B 1 14  ? 17.786  -100.410 -33.626 1.00 11.25 ? 15  PRO B CD  1 
ATOM   936  N  N   . GLY B 1 15  ? 20.671  -104.242 -34.132 1.00 10.95 ? 16  GLY B N   1 
ATOM   937  C  CA  . GLY B 1 15  ? 21.851  -104.950 -33.667 1.00 11.23 ? 16  GLY B CA  1 
ATOM   938  C  C   . GLY B 1 15  ? 21.599  -105.935 -32.538 1.00 11.44 ? 16  GLY B C   1 
ATOM   939  O  O   . GLY B 1 15  ? 22.508  -106.661 -32.128 1.00 11.56 ? 16  GLY B O   1 
ATOM   940  N  N   . LYS B 1 16  ? 20.368  -105.959 -32.036 1.00 11.56 ? 17  LYS B N   1 
ATOM   941  C  CA  . LYS B 1 16  ? 19.999  -106.843 -30.940 1.00 11.38 ? 17  LYS B CA  1 
ATOM   942  C  C   . LYS B 1 16  ? 19.193  -108.025 -31.446 1.00 11.47 ? 17  LYS B C   1 
ATOM   943  O  O   . LYS B 1 16  ? 18.789  -108.060 -32.614 1.00 11.22 ? 17  LYS B O   1 
ATOM   944  C  CB  . LYS B 1 16  ? 19.224  -106.079 -29.862 1.00 11.61 ? 17  LYS B CB  1 
ATOM   945  C  CG  . LYS B 1 16  ? 20.091  -105.122 -29.042 1.00 11.12 ? 17  LYS B CG  1 
ATOM   946  C  CD  . LYS B 1 16  ? 19.279  -103.961 -28.512 1.00 11.47 ? 17  LYS B CD  1 
ATOM   947  C  CE  . LYS B 1 16  ? 19.421  -103.832 -27.002 1.00 11.42 ? 17  LYS B CE  1 
ATOM   948  N  NZ  . LYS B 1 16  ? 18.797  -102.569 -26.507 1.00 12.29 ? 17  LYS B NZ  1 
ATOM   949  N  N   . THR B 1 17  ? 18.962  -108.982 -30.549 1.00 11.49 ? 18  THR B N   1 
ATOM   950  C  CA  . THR B 1 17  ? 18.288  -110.229 -30.870 1.00 11.45 ? 18  THR B CA  1 
ATOM   951  C  C   . THR B 1 17  ? 16.809  -110.165 -30.506 1.00 11.54 ? 18  THR B C   1 
ATOM   952  O  O   . THR B 1 17  ? 16.450  -109.919 -29.347 1.00 11.39 ? 18  THR B O   1 
ATOM   953  C  CB  . THR B 1 17  ? 18.974  -111.393 -30.128 1.00 11.44 ? 18  THR B CB  1 
ATOM   954  O  OG1 . THR B 1 17  ? 20.283  -111.597 -30.669 1.00 11.92 ? 18  THR B OG1 1 
ATOM   955  C  CG2 . THR B 1 17  ? 18.272  -112.711 -30.410 1.00 11.17 ? 18  THR B CG2 1 
ATOM   956  N  N   . VAL B 1 18  ? 15.954  -110.389 -31.499 1.00 11.57 ? 19  VAL B N   1 
ATOM   957  C  CA  . VAL B 1 18  ? 14.520  -110.490 -31.249 1.00 11.94 ? 19  VAL B CA  1 
ATOM   958  C  C   . VAL B 1 18  ? 14.015  -111.925 -31.418 1.00 12.00 ? 19  VAL B C   1 
ATOM   959  O  O   . VAL B 1 18  ? 14.432  -112.627 -32.331 1.00 11.35 ? 19  VAL B O   1 
ATOM   960  C  CB  . VAL B 1 18  ? 13.707  -109.494 -32.121 1.00 12.15 ? 19  VAL B CB  1 
ATOM   961  C  CG1 . VAL B 1 18  ? 13.655  -109.912 -33.577 1.00 12.45 ? 19  VAL B CG1 1 
ATOM   962  C  CG2 . VAL B 1 18  ? 12.316  -109.319 -31.566 1.00 12.86 ? 19  VAL B CG2 1 
ATOM   963  N  N   . THR B 1 19  ? 13.123  -112.344 -30.522 1.00 12.12 ? 20  THR B N   1 
ATOM   964  C  CA  . THR B 1 19  ? 12.463  -113.643 -30.643 1.00 12.38 ? 20  THR B CA  1 
ATOM   965  C  C   . THR B 1 19  ? 10.948  -113.465 -30.741 1.00 11.76 ? 20  THR B C   1 
ATOM   966  O  O   . THR B 1 19  ? 10.329  -112.807 -29.903 1.00 11.82 ? 20  THR B O   1 
ATOM   967  C  CB  . THR B 1 19  ? 12.847  -114.578 -29.473 1.00 12.33 ? 20  THR B CB  1 
ATOM   968  O  OG1 . THR B 1 19  ? 14.241  -114.903 -29.552 1.00 13.07 ? 20  THR B OG1 1 
ATOM   969  C  CG2 . THR B 1 19  ? 12.157  -115.943 -29.601 1.00 14.01 ? 20  THR B CG2 1 
ATOM   970  N  N   . ILE B 1 20  ? 10.372  -114.061 -31.777 1.00 11.42 ? 21  ILE B N   1 
ATOM   971  C  CA  . ILE B 1 20  ? 8.941   -114.081 -32.008 1.00 11.30 ? 21  ILE B CA  1 
ATOM   972  C  C   . ILE B 1 20  ? 8.470   -115.522 -31.883 1.00 11.66 ? 21  ILE B C   1 
ATOM   973  O  O   . ILE B 1 20  ? 8.910   -116.393 -32.631 1.00 11.23 ? 21  ILE B O   1 
ATOM   974  C  CB  . ILE B 1 20  ? 8.614   -113.526 -33.409 1.00 11.40 ? 21  ILE B CB  1 
ATOM   975  C  CG1 . ILE B 1 20  ? 8.997   -112.039 -33.492 1.00 12.04 ? 21  ILE B CG1 1 
ATOM   976  C  CG2 . ILE B 1 20  ? 7.127   -113.734 -33.732 1.00 12.00 ? 21  ILE B CG2 1 
ATOM   977  C  CD1 . ILE B 1 20  ? 9.285   -111.538 -34.889 1.00 10.84 ? 21  ILE B CD1 1 
ATOM   978  N  N   . SER B 1 21  ? 7.574   -115.775 -30.934 1.00 11.94 ? 22  SER B N   1 
ATOM   979  C  CA  . SER B 1 21  ? 7.129   -117.147 -30.713 1.00 12.70 ? 22  SER B CA  1 
ATOM   980  C  C   . SER B 1 21  ? 5.677   -117.389 -31.128 1.00 12.22 ? 22  SER B C   1 
ATOM   981  O  O   . SER B 1 21  ? 4.834   -116.493 -31.059 1.00 13.66 ? 22  SER B O   1 
ATOM   982  C  CB  . SER B 1 21  ? 7.392   -117.590 -29.266 1.00 12.03 ? 22  SER B CB  1 
ATOM   983  O  OG  . SER B 1 21  ? 6.390   -117.105 -28.385 1.00 15.70 ? 22  SER B OG  1 
ATOM   984  N  N   . CYS B 1 22  ? 5.425   -118.625 -31.548 1.00 11.78 ? 23  CYS B N   1 
ATOM   985  C  CA  . CYS B 1 22  ? 4.179   -119.109 -32.121 1.00 12.01 ? 23  CYS B CA  1 
ATOM   986  C  C   . CYS B 1 22  ? 3.777   -120.380 -31.363 1.00 11.58 ? 23  CYS B C   1 
ATOM   987  O  O   . CYS B 1 22  ? 4.468   -121.410 -31.447 1.00 11.63 ? 23  CYS B O   1 
ATOM   988  C  CB  . CYS B 1 22  ? 4.455   -119.439 -33.592 1.00 13.00 ? 23  CYS B CB  1 
ATOM   989  S  SG  . CYS B 1 22  ? 3.178   -120.259 -34.570 1.00 17.74 ? 23  CYS B SG  1 
ATOM   990  N  N   . THR B 1 23  ? 2.669   -120.307 -30.628 1.00 10.69 ? 24  THR B N   1 
ATOM   991  C  CA  . THR B 1 23  ? 2.205   -121.430 -29.813 1.00 10.24 ? 24  THR B CA  1 
ATOM   992  C  C   . THR B 1 23  ? 1.064   -122.156 -30.486 1.00 9.02  ? 24  THR B C   1 
ATOM   993  O  O   . THR B 1 23  ? 0.123   -121.542 -30.949 1.00 8.67  ? 24  THR B O   1 
ATOM   994  C  CB  . THR B 1 23  ? 1.778   -120.952 -28.402 1.00 9.98  ? 24  THR B CB  1 
ATOM   995  O  OG1 . THR B 1 23  ? 2.939   -120.510 -27.690 1.00 11.67 ? 24  THR B OG1 1 
ATOM   996  C  CG2 . THR B 1 23  ? 1.292   -122.123 -27.538 1.00 11.88 ? 24  THR B CG2 1 
ATOM   997  N  N   . ARG B 1 24  ? 1.162   -123.480 -30.512 1.00 8.53  ? 25  ARG B N   1 
ATOM   998  C  CA  . ARG B 1 24  ? 0.100   -124.320 -31.039 1.00 7.86  ? 25  ARG B CA  1 
ATOM   999  C  C   . ARG B 1 24  ? -0.872  -124.704 -29.919 1.00 7.42  ? 25  ARG B C   1 
ATOM   1000 O  O   . ARG B 1 24  ? -0.467  -125.114 -28.822 1.00 6.98  ? 25  ARG B O   1 
ATOM   1001 C  CB  . ARG B 1 24  ? 0.716   -125.538 -31.734 1.00 8.12  ? 25  ARG B CB  1 
ATOM   1002 C  CG  . ARG B 1 24  ? -0.259  -126.547 -32.266 1.00 8.37  ? 25  ARG B CG  1 
ATOM   1003 C  CD  . ARG B 1 24  ? 0.417   -127.619 -33.126 1.00 9.50  ? 25  ARG B CD  1 
ATOM   1004 N  NE  . ARG B 1 24  ? -0.507  -128.701 -33.448 1.00 8.93  ? 25  ARG B NE  1 
ATOM   1005 C  CZ  . ARG B 1 24  ? -0.352  -129.574 -34.436 1.00 9.34  ? 25  ARG B CZ  1 
ATOM   1006 N  NH1 . ARG B 1 24  ? 0.703   -129.517 -35.247 1.00 8.24  ? 25  ARG B NH1 1 
ATOM   1007 N  NH2 . ARG B 1 24  ? -1.269  -130.505 -34.629 1.00 9.53  ? 25  ARG B NH2 1 
ATOM   1008 N  N   . SER B 1 25  ? -2.162  -124.557 -30.202 1.00 6.41  ? 26  SER B N   1 
ATOM   1009 C  CA  . SER B 1 25  ? -3.200  -124.638 -29.173 1.00 6.02  ? 26  SER B CA  1 
ATOM   1010 C  C   . SER B 1 25  ? -3.640  -126.058 -28.845 1.00 6.57  ? 26  SER B C   1 
ATOM   1011 O  O   . SER B 1 25  ? -4.253  -126.298 -27.793 1.00 6.50  ? 26  SER B O   1 
ATOM   1012 C  CB  . SER B 1 25  ? -4.412  -123.823 -29.612 1.00 5.45  ? 26  SER B CB  1 
ATOM   1013 O  OG  . SER B 1 25  ? -5.071  -124.469 -30.688 1.00 4.83  ? 26  SER B OG  1 
ATOM   1014 N  N   . SER B 1 26  ? -3.360  -126.991 -29.754 1.00 7.11  ? 27  SER B N   1 
ATOM   1015 C  CA  . SER B 1 26  ? -3.780  -128.388 -29.617 1.00 8.13  ? 27  SER B CA  1 
ATOM   1016 C  C   . SER B 1 26  ? -3.016  -129.238 -30.610 1.00 8.78  ? 27  SER B C   1 
ATOM   1017 O  O   . SER B 1 26  ? -2.720  -128.792 -31.719 1.00 8.42  ? 27  SER B O   1 
ATOM   1018 C  CB  . SER B 1 26  ? -5.287  -128.551 -29.852 1.00 8.16  ? 27  SER B CB  1 
ATOM   1019 O  OG  . SER B 1 26  ? -5.639  -128.011 -31.110 1.00 9.41  ? 27  SER B OG  1 
ATOM   1020 N  N   . GLY B 1 27  A -2.702  -130.462 -30.201 1.00 9.65  ? 27  GLY B N   1 
ATOM   1021 C  CA  . GLY B 1 27  A -1.789  -131.306 -30.941 1.00 10.60 ? 27  GLY B CA  1 
ATOM   1022 C  C   . GLY B 1 27  A -0.353  -130.901 -30.673 1.00 11.34 ? 27  GLY B C   1 
ATOM   1023 O  O   . GLY B 1 27  A -0.093  -129.831 -30.110 1.00 11.57 ? 27  GLY B O   1 
ATOM   1024 N  N   . ASN B 1 28  B 0.573   -131.761 -31.096 1.00 11.83 ? 27  ASN B N   1 
ATOM   1025 C  CA  . ASN B 1 28  B 2.010   -131.551 -30.944 1.00 12.50 ? 27  ASN B CA  1 
ATOM   1026 C  C   . ASN B 1 28  B 2.575   -130.580 -31.977 1.00 12.29 ? 27  ASN B C   1 
ATOM   1027 O  O   . ASN B 1 28  B 2.359   -130.752 -33.178 1.00 12.44 ? 27  ASN B O   1 
ATOM   1028 C  CB  . ASN B 1 28  B 2.742   -132.888 -31.094 1.00 13.08 ? 27  ASN B CB  1 
ATOM   1029 C  CG  . ASN B 1 28  B 2.496   -133.838 -29.935 1.00 15.08 ? 27  ASN B CG  1 
ATOM   1030 O  OD1 . ASN B 1 28  B 1.512   -134.584 -29.911 1.00 17.69 ? 27  ASN B OD1 1 
ATOM   1031 N  ND2 . ASN B 1 28  B 3.414   -133.836 -28.976 1.00 18.67 ? 27  ASN B ND2 1 
ATOM   1032 N  N   . ILE B 1 29  ? 3.305   -129.565 -31.517 1.00 11.79 ? 28  ILE B N   1 
ATOM   1033 C  CA  . ILE B 1 29  ? 4.033   -128.676 -32.420 1.00 11.17 ? 28  ILE B CA  1 
ATOM   1034 C  C   . ILE B 1 29  ? 5.011   -129.460 -33.325 1.00 11.70 ? 28  ILE B C   1 
ATOM   1035 O  O   . ILE B 1 29  ? 5.220   -129.093 -34.480 1.00 11.54 ? 28  ILE B O   1 
ATOM   1036 C  CB  . ILE B 1 29  ? 4.749   -127.507 -31.642 1.00 11.10 ? 28  ILE B CB  1 
ATOM   1037 C  CG1 . ILE B 1 29  ? 5.348   -126.474 -32.600 1.00 8.46  ? 28  ILE B CG1 1 
ATOM   1038 C  CG2 . ILE B 1 29  ? 5.822   -128.035 -30.694 1.00 10.24 ? 28  ILE B CG2 1 
ATOM   1039 C  CD1 . ILE B 1 29  ? 4.323   -125.476 -33.198 1.00 6.18  ? 28  ILE B CD1 1 
ATOM   1040 N  N   . ALA B 1 30  ? 5.573   -130.546 -32.796 1.00 11.98 ? 29  ALA B N   1 
ATOM   1041 C  CA  . ALA B 1 30  ? 6.540   -131.355 -33.534 1.00 13.04 ? 29  ALA B CA  1 
ATOM   1042 C  C   . ALA B 1 30  ? 5.897   -132.214 -34.618 1.00 13.28 ? 29  ALA B C   1 
ATOM   1043 O  O   . ALA B 1 30  ? 6.571   -132.635 -35.559 1.00 13.90 ? 29  ALA B O   1 
ATOM   1044 C  CB  . ALA B 1 30  ? 7.339   -132.230 -32.576 1.00 12.79 ? 29  ALA B CB  1 
ATOM   1045 N  N   . SER B 1 31  ? 4.597   -132.462 -34.485 1.00 13.50 ? 30  SER B N   1 
ATOM   1046 C  CA  . SER B 1 31  ? 3.885   -133.398 -35.356 1.00 13.70 ? 30  SER B CA  1 
ATOM   1047 C  C   . SER B 1 31  ? 3.879   -132.975 -36.832 1.00 13.52 ? 30  SER B C   1 
ATOM   1048 O  O   . SER B 1 31  ? 3.744   -133.819 -37.725 1.00 13.49 ? 30  SER B O   1 
ATOM   1049 C  CB  . SER B 1 31  ? 2.451   -133.596 -34.856 1.00 13.67 ? 30  SER B CB  1 
ATOM   1050 O  OG  . SER B 1 31  ? 2.377   -134.648 -33.901 1.00 15.07 ? 30  SER B OG  1 
ATOM   1051 N  N   . ASN B 1 32  ? 4.028   -131.672 -37.075 1.00 12.97 ? 31  ASN B N   1 
ATOM   1052 C  CA  . ASN B 1 32  ? 3.975   -131.106 -38.414 1.00 12.86 ? 31  ASN B CA  1 
ATOM   1053 C  C   . ASN B 1 32  ? 4.953   -129.959 -38.560 1.00 12.88 ? 31  ASN B C   1 
ATOM   1054 O  O   . ASN B 1 32  ? 5.227   -129.228 -37.604 1.00 12.83 ? 31  ASN B O   1 
ATOM   1055 C  CB  . ASN B 1 32  ? 2.559   -130.616 -38.753 1.00 12.90 ? 31  ASN B CB  1 
ATOM   1056 C  CG  . ASN B 1 32  ? 1.490   -131.677 -38.521 1.00 13.29 ? 31  ASN B CG  1 
ATOM   1057 O  OD1 . ASN B 1 32  ? 1.192   -132.478 -39.403 1.00 13.88 ? 31  ASN B OD1 1 
ATOM   1058 N  ND2 . ASN B 1 32  ? 0.906   -131.674 -37.336 1.00 12.28 ? 31  ASN B ND2 1 
ATOM   1059 N  N   . TYR B 1 33  ? 5.470   -129.797 -39.769 1.00 12.68 ? 32  TYR B N   1 
ATOM   1060 C  CA  . TYR B 1 33  ? 6.471   -128.782 -40.044 1.00 12.54 ? 32  TYR B CA  1 
ATOM   1061 C  C   . TYR B 1 33  ? 5.933   -127.374 -39.855 1.00 12.04 ? 32  TYR B C   1 
ATOM   1062 O  O   . TYR B 1 33  ? 4.794   -127.069 -40.204 1.00 12.04 ? 32  TYR B O   1 
ATOM   1063 C  CB  . TYR B 1 33  ? 7.030   -128.939 -41.461 1.00 12.86 ? 32  TYR B CB  1 
ATOM   1064 C  CG  . TYR B 1 33  ? 7.993   -130.101 -41.629 1.00 14.14 ? 32  TYR B CG  1 
ATOM   1065 C  CD1 . TYR B 1 33  ? 9.151   -130.205 -40.853 1.00 15.31 ? 32  TYR B CD1 1 
ATOM   1066 C  CD2 . TYR B 1 33  ? 7.743   -131.096 -42.574 1.00 15.64 ? 32  TYR B CD2 1 
ATOM   1067 C  CE1 . TYR B 1 33  ? 10.040  -131.276 -41.014 1.00 17.28 ? 32  TYR B CE1 1 
ATOM   1068 C  CE2 . TYR B 1 33  ? 8.623   -132.164 -42.744 1.00 16.77 ? 32  TYR B CE2 1 
ATOM   1069 C  CZ  . TYR B 1 33  ? 9.761   -132.251 -41.963 1.00 17.30 ? 32  TYR B CZ  1 
ATOM   1070 O  OH  . TYR B 1 33  ? 10.617  -133.312 -42.143 1.00 17.28 ? 32  TYR B OH  1 
ATOM   1071 N  N   . VAL B 1 34  ? 6.769   -126.523 -39.276 1.00 11.80 ? 33  VAL B N   1 
ATOM   1072 C  CA  . VAL B 1 34  ? 6.451   -125.116 -39.148 1.00 10.86 ? 33  VAL B CA  1 
ATOM   1073 C  C   . VAL B 1 34  ? 7.204   -124.277 -40.160 1.00 11.47 ? 33  VAL B C   1 
ATOM   1074 O  O   . VAL B 1 34  ? 8.441   -124.338 -40.269 1.00 11.85 ? 33  VAL B O   1 
ATOM   1075 C  CB  . VAL B 1 34  ? 6.725   -124.585 -37.723 1.00 11.06 ? 33  VAL B CB  1 
ATOM   1076 C  CG1 . VAL B 1 34  ? 6.407   -123.088 -37.667 1.00 8.88  ? 33  VAL B CG1 1 
ATOM   1077 C  CG2 . VAL B 1 34  ? 5.909   -125.352 -36.709 1.00 9.82  ? 33  VAL B CG2 1 
ATOM   1078 N  N   . GLN B 1 35  ? 6.440   -123.488 -40.905 1.00 11.61 ? 34  GLN B N   1 
ATOM   1079 C  CA  . GLN B 1 35  ? 6.990   -122.508 -41.819 1.00 11.64 ? 34  GLN B CA  1 
ATOM   1080 C  C   . GLN B 1 35  ? 6.810   -121.100 -41.247 1.00 11.53 ? 34  GLN B C   1 
ATOM   1081 O  O   . GLN B 1 35  ? 5.849   -120.830 -40.512 1.00 10.99 ? 34  GLN B O   1 
ATOM   1082 C  CB  . GLN B 1 35  ? 6.313   -122.627 -43.202 1.00 11.70 ? 34  GLN B CB  1 
ATOM   1083 C  CG  . GLN B 1 35  ? 6.760   -123.833 -44.059 1.00 13.37 ? 34  GLN B CG  1 
ATOM   1084 C  CD  . GLN B 1 35  ? 6.503   -125.197 -43.409 1.00 15.85 ? 34  GLN B CD  1 
ATOM   1085 O  OE1 . GLN B 1 35  ? 7.436   -125.974 -43.182 1.00 14.04 ? 34  GLN B OE1 1 
ATOM   1086 N  NE2 . GLN B 1 35  ? 5.245   -125.490 -43.126 1.00 16.30 ? 34  GLN B NE2 1 
ATOM   1087 N  N   . TRP B 1 36  ? 7.751   -120.217 -41.560 1.00 10.60 ? 35  TRP B N   1 
ATOM   1088 C  CA  . TRP B 1 36  ? 7.627   -118.790 -41.261 1.00 9.66  ? 35  TRP B CA  1 
ATOM   1089 C  C   . TRP B 1 36  ? 7.635   -117.970 -42.553 1.00 8.99  ? 35  TRP B C   1 
ATOM   1090 O  O   . TRP B 1 36  ? 8.436   -118.238 -43.448 1.00 8.28  ? 35  TRP B O   1 
ATOM   1091 C  CB  . TRP B 1 36  ? 8.759   -118.325 -40.350 1.00 9.34  ? 35  TRP B CB  1 
ATOM   1092 C  CG  . TRP B 1 36  ? 8.657   -118.833 -38.942 1.00 9.37  ? 35  TRP B CG  1 
ATOM   1093 C  CD1 . TRP B 1 36  ? 9.225   -119.979 -38.434 1.00 9.24  ? 35  TRP B CD1 1 
ATOM   1094 C  CD2 . TRP B 1 36  ? 7.951   -118.225 -37.851 1.00 8.74  ? 35  TRP B CD2 1 
ATOM   1095 N  NE1 . TRP B 1 36  ? 8.913   -120.119 -37.098 1.00 8.81  ? 35  TRP B NE1 1 
ATOM   1096 C  CE2 . TRP B 1 36  ? 8.144   -119.051 -36.708 1.00 9.20  ? 35  TRP B CE2 1 
ATOM   1097 C  CE3 . TRP B 1 36  ? 7.184   -117.054 -37.708 1.00 8.39  ? 35  TRP B CE3 1 
ATOM   1098 C  CZ2 . TRP B 1 36  ? 7.581   -118.748 -35.459 1.00 8.01  ? 35  TRP B CZ2 1 
ATOM   1099 C  CZ3 . TRP B 1 36  ? 6.629   -116.752 -36.457 1.00 9.34  ? 35  TRP B CZ3 1 
ATOM   1100 C  CH2 . TRP B 1 36  ? 6.838   -117.611 -35.346 1.00 9.02  ? 35  TRP B CH2 1 
ATOM   1101 N  N   . TYR B 1 37  ? 6.727   -116.988 -42.656 1.00 8.76  ? 36  TYR B N   1 
ATOM   1102 C  CA  . TYR B 1 37  ? 6.645   -116.103 -43.823 1.00 9.17  ? 36  TYR B CA  1 
ATOM   1103 C  C   . TYR B 1 37  ? 6.855   -114.641 -43.442 1.00 9.52  ? 36  TYR B C   1 
ATOM   1104 O  O   . TYR B 1 37  ? 6.419   -114.197 -42.378 1.00 9.65  ? 36  TYR B O   1 
ATOM   1105 C  CB  . TYR B 1 37  ? 5.276   -116.234 -44.518 1.00 8.66  ? 36  TYR B CB  1 
ATOM   1106 C  CG  . TYR B 1 37  ? 4.961   -117.643 -44.922 1.00 10.00 ? 36  TYR B CG  1 
ATOM   1107 C  CD1 . TYR B 1 37  ? 5.566   -118.189 -46.081 1.00 10.67 ? 36  TYR B CD1 1 
ATOM   1108 C  CD2 . TYR B 1 37  ? 4.082   -118.447 -44.128 1.00 9.57  ? 36  TYR B CD2 1 
ATOM   1109 C  CE1 . TYR B 1 37  ? 5.311   -119.494 -46.444 1.00 11.25 ? 36  TYR B CE1 1 
ATOM   1110 C  CE2 . TYR B 1 37  ? 3.832   -119.766 -44.475 1.00 11.11 ? 36  TYR B CE2 1 
ATOM   1111 C  CZ  . TYR B 1 37  ? 4.446   -120.277 -45.642 1.00 10.58 ? 36  TYR B CZ  1 
ATOM   1112 O  OH  . TYR B 1 37  ? 4.204   -121.570 -46.012 1.00 12.76 ? 36  TYR B OH  1 
ATOM   1113 N  N   . GLN B 1 38  ? 7.492   -113.884 -44.339 1.00 10.08 ? 37  GLN B N   1 
ATOM   1114 C  CA  . GLN B 1 38  ? 7.697   -112.455 -44.132 1.00 10.35 ? 37  GLN B CA  1 
ATOM   1115 C  C   . GLN B 1 38  ? 6.884   -111.675 -45.180 1.00 10.73 ? 37  GLN B C   1 
ATOM   1116 O  O   . GLN B 1 38  ? 6.882   -112.027 -46.374 1.00 10.02 ? 37  GLN B O   1 
ATOM   1117 C  CB  . GLN B 1 38  ? 9.194   -112.124 -44.209 1.00 10.59 ? 37  GLN B CB  1 
ATOM   1118 C  CG  . GLN B 1 38  ? 9.552   -110.648 -43.817 1.00 12.25 ? 37  GLN B CG  1 
ATOM   1119 C  CD  . GLN B 1 38  ? 10.864  -110.218 -44.493 1.00 12.13 ? 37  GLN B CD  1 
ATOM   1120 O  OE1 . GLN B 1 38  ? 10.986  -110.560 -45.767 1.00 14.05 ? 37  GLN B OE1 1 
ATOM   1121 N  NE2 . GLN B 1 38  ? 11.860  -109.492 -43.644 1.00 13.70 ? 37  GLN B NE2 1 
ATOM   1122 N  N   . GLN B 1 39  ? 6.178   -110.614 -44.738 1.00 11.43 ? 38  GLN B N   1 
ATOM   1123 C  CA  . GLN B 1 39  ? 5.298   -109.915 -45.672 1.00 12.59 ? 38  GLN B CA  1 
ATOM   1124 C  C   . GLN B 1 39  ? 5.426   -108.375 -45.594 1.00 12.74 ? 38  GLN B C   1 
ATOM   1125 O  O   . GLN B 1 39  ? 5.048   -107.664 -44.342 1.00 14.24 ? 38  GLN B O   1 
ATOM   1126 C  CB  . GLN B 1 39  ? 3.847   -110.374 -45.467 1.00 12.21 ? 38  GLN B CB  1 
ATOM   1127 C  CG  . GLN B 1 39  ? 3.034   -110.529 -46.793 1.00 13.17 ? 38  GLN B CG  1 
ATOM   1128 C  CD  . GLN B 1 39  ? 1.599   -110.142 -46.555 1.00 12.94 ? 38  GLN B CD  1 
ATOM   1129 O  OE1 . GLN B 1 39  ? 1.080   -110.349 -45.444 1.00 13.63 ? 38  GLN B OE1 1 
ATOM   1130 N  NE2 . GLN B 1 39  ? 0.946   -109.566 -47.571 1.00 13.56 ? 38  GLN B NE2 1 
ATOM   1131 N  N   . SER B 1 41  ? 2.299   -107.072 -51.160 1.00 12.23 ? 42  SER B N   1 
ATOM   1132 C  CA  . SER B 1 41  ? 3.037   -108.282 -51.688 1.00 13.13 ? 42  SER B CA  1 
ATOM   1133 C  C   . SER B 1 41  ? 2.746   -109.616 -50.969 1.00 13.34 ? 42  SER B C   1 
ATOM   1134 O  O   . SER B 1 41  ? 2.434   -109.653 -49.758 1.00 13.20 ? 42  SER B O   1 
ATOM   1135 C  CB  . SER B 1 41  ? 4.552   -108.019 -51.783 1.00 13.27 ? 42  SER B CB  1 
ATOM   1136 O  OG  . SER B 1 41  ? 5.180   -108.037 -50.501 1.00 13.84 ? 42  SER B OG  1 
ATOM   1137 N  N   . ALA B 1 42  ? 2.857   -110.714 -51.726 1.00 13.40 ? 43  ALA B N   1 
ATOM   1138 C  CA  . ALA B 1 42  ? 2.612   -112.072 -51.203 1.00 13.94 ? 43  ALA B CA  1 
ATOM   1139 C  C   . ALA B 1 42  ? 3.617   -112.468 -50.143 1.00 13.91 ? 43  ALA B C   1 
ATOM   1140 O  O   . ALA B 1 42  ? 4.748   -111.980 -50.171 1.00 14.74 ? 43  ALA B O   1 
ATOM   1141 C  CB  . ALA B 1 42  ? 2.646   -113.092 -52.347 1.00 14.39 ? 43  ALA B CB  1 
ATOM   1142 N  N   . PRO B 1 43  ? 3.209   -113.350 -49.219 1.00 13.45 ? 44  PRO B N   1 
ATOM   1143 C  CA  . PRO B 1 43  ? 4.135   -113.993 -48.275 1.00 13.22 ? 44  PRO B CA  1 
ATOM   1144 C  C   . PRO B 1 43  ? 5.265   -114.708 -48.993 1.00 13.13 ? 44  PRO B C   1 
ATOM   1145 O  O   . PRO B 1 43  ? 5.037   -115.344 -50.031 1.00 13.53 ? 44  PRO B O   1 
ATOM   1146 C  CB  . PRO B 1 43  ? 3.260   -115.043 -47.589 1.00 13.28 ? 44  PRO B CB  1 
ATOM   1147 C  CG  . PRO B 1 43  ? 1.898   -114.527 -47.682 1.00 12.79 ? 44  PRO B CG  1 
ATOM   1148 C  CD  . PRO B 1 43  ? 1.819   -113.787 -48.986 1.00 13.40 ? 44  PRO B CD  1 
ATOM   1149 N  N   . ILE B 1 44  ? 6.470   -114.566 -48.453 1.00 12.73 ? 45  ILE B N   1 
ATOM   1150 C  CA  . ILE B 1 44  ? 7.640   -115.290 -48.928 1.00 12.33 ? 45  ILE B CA  1 
ATOM   1151 C  C   . ILE B 1 44  ? 8.209   -116.092 -47.768 1.00 11.87 ? 45  ILE B C   1 
ATOM   1152 O  O   . ILE B 1 44  ? 8.226   -115.625 -46.623 1.00 12.03 ? 45  ILE B O   1 
ATOM   1153 C  CB  . ILE B 1 44  ? 8.717   -114.336 -49.494 1.00 12.44 ? 45  ILE B CB  1 
ATOM   1154 C  CG1 . ILE B 1 44  ? 9.290   -113.435 -48.393 1.00 12.57 ? 45  ILE B CG1 1 
ATOM   1155 C  CG2 . ILE B 1 44  ? 8.180   -113.521 -50.677 1.00 12.55 ? 45  ILE B CG2 1 
ATOM   1156 C  CD1 . ILE B 1 44  ? 10.805  -113.476 -48.317 1.00 12.75 ? 45  ILE B CD1 1 
ATOM   1157 N  N   . THR B 1 45  ? 8.671   -117.299 -48.066 1.00 11.45 ? 46  THR B N   1 
ATOM   1158 C  CA  . THR B 1 45  ? 9.157   -118.201 -47.039 1.00 10.86 ? 46  THR B CA  1 
ATOM   1159 C  C   . THR B 1 45  ? 10.508  -117.700 -46.501 1.00 10.52 ? 46  THR B C   1 
ATOM   1160 O  O   . THR B 1 45  ? 11.426  -117.447 -47.288 1.00 9.99  ? 46  THR B O   1 
ATOM   1161 C  CB  . THR B 1 45  ? 9.275   -119.626 -47.629 1.00 11.14 ? 46  THR B CB  1 
ATOM   1162 O  OG1 . THR B 1 45  ? 8.020   -120.010 -48.223 1.00 11.74 ? 46  THR B OG1 1 
ATOM   1163 C  CG2 . THR B 1 45  ? 9.549   -120.671 -46.524 1.00 12.58 ? 46  THR B CG2 1 
ATOM   1164 N  N   . VAL B 1 46  ? 10.609  -117.516 -45.177 1.00 10.88 ? 47  VAL B N   1 
ATOM   1165 C  CA  . VAL B 1 46  ? 11.910  -117.217 -44.531 1.00 10.38 ? 47  VAL B CA  1 
ATOM   1166 C  C   . VAL B 1 46  ? 12.448  -118.358 -43.685 1.00 10.24 ? 47  VAL B C   1 
ATOM   1167 O  O   . VAL B 1 46  ? 13.663  -118.465 -43.461 1.00 9.05  ? 47  VAL B O   1 
ATOM   1168 C  CB  . VAL B 1 46  ? 11.916  -115.920 -43.696 1.00 10.17 ? 47  VAL B CB  1 
ATOM   1169 C  CG1 . VAL B 1 46  ? 11.614  -114.721 -44.581 1.00 10.60 ? 47  VAL B CG1 1 
ATOM   1170 C  CG2 . VAL B 1 46  ? 10.950  -116.011 -42.469 1.00 10.51 ? 47  VAL B CG2 1 
ATOM   1171 N  N   . ILE B 1 47  ? 11.537  -119.184 -43.195 1.00 9.57  ? 48  ILE B N   1 
ATOM   1172 C  CA  . ILE B 1 47  ? 11.883  -120.467 -42.634 1.00 9.77  ? 48  ILE B CA  1 
ATOM   1173 C  C   . ILE B 1 47  ? 10.900  -121.498 -43.154 1.00 9.55  ? 48  ILE B C   1 
ATOM   1174 O  O   . ILE B 1 47  ? 9.701   -121.220 -43.259 1.00 9.73  ? 48  ILE B O   1 
ATOM   1175 C  CB  . ILE B 1 47  ? 11.903  -120.420 -41.081 1.00 9.14  ? 48  ILE B CB  1 
ATOM   1176 C  CG1 . ILE B 1 47  ? 13.045  -119.522 -40.570 1.00 9.71  ? 48  ILE B CG1 1 
ATOM   1177 C  CG2 . ILE B 1 47  ? 11.976  -121.832 -40.487 1.00 8.84  ? 48  ILE B CG2 1 
ATOM   1178 C  CD1 . ILE B 1 47  ? 14.484  -120.106 -40.704 1.00 8.70  ? 48  ILE B CD1 1 
ATOM   1179 N  N   . TYR B 1 48  ? 11.420  -122.669 -43.521 1.00 9.62  ? 49  TYR B N   1 
ATOM   1180 C  CA  . TYR B 1 48  ? 10.565  -123.813 -43.777 1.00 9.05  ? 49  TYR B CA  1 
ATOM   1181 C  C   . TYR B 1 48  ? 11.095  -125.056 -43.074 1.00 9.26  ? 49  TYR B C   1 
ATOM   1182 O  O   . TYR B 1 48  ? 12.281  -125.137 -42.716 1.00 8.66  ? 49  TYR B O   1 
ATOM   1183 C  CB  . TYR B 1 48  ? 10.369  -124.033 -45.285 1.00 8.99  ? 49  TYR B CB  1 
ATOM   1184 C  CG  . TYR B 1 48  ? 11.625  -124.433 -46.010 1.00 8.31  ? 49  TYR B CG  1 
ATOM   1185 C  CD1 . TYR B 1 48  ? 12.542  -123.475 -46.432 1.00 9.01  ? 49  TYR B CD1 1 
ATOM   1186 C  CD2 . TYR B 1 48  ? 11.893  -125.769 -46.267 1.00 8.68  ? 49  TYR B CD2 1 
ATOM   1187 C  CE1 . TYR B 1 48  ? 13.707  -123.846 -47.108 1.00 8.92  ? 49  TYR B CE1 1 
ATOM   1188 C  CE2 . TYR B 1 48  ? 13.046  -126.149 -46.927 1.00 8.29  ? 49  TYR B CE2 1 
ATOM   1189 C  CZ  . TYR B 1 48  ? 13.944  -125.186 -47.345 1.00 9.35  ? 49  TYR B CZ  1 
ATOM   1190 O  OH  . TYR B 1 48  ? 15.085  -125.586 -47.994 1.00 8.15  ? 49  TYR B OH  1 
ATOM   1191 N  N   . GLU B 1 49  ? 10.192  -126.008 -42.849 1.00 8.85  ? 50  GLU B N   1 
ATOM   1192 C  CA  . GLU B 1 49  ? 10.521  -127.252 -42.177 1.00 8.59  ? 50  GLU B CA  1 
ATOM   1193 C  C   . GLU B 1 49  ? 11.200  -126.957 -40.840 1.00 8.79  ? 50  GLU B C   1 
ATOM   1194 O  O   . GLU B 1 49  ? 12.270  -127.479 -40.543 1.00 9.01  ? 50  GLU B O   1 
ATOM   1195 C  CB  . GLU B 1 49  ? 11.382  -128.143 -43.071 1.00 8.02  ? 50  GLU B CB  1 
ATOM   1196 C  CG  . GLU B 1 49  ? 10.656  -128.700 -44.289 1.00 7.47  ? 50  GLU B CG  1 
ATOM   1197 C  CD  . GLU B 1 49  ? 11.598  -129.228 -45.355 1.00 7.06  ? 50  GLU B CD  1 
ATOM   1198 O  OE1 . GLU B 1 49  ? 12.838  -129.110 -45.185 1.00 7.19  ? 50  GLU B OE1 1 
ATOM   1199 O  OE2 . GLU B 1 49  ? 11.105  -129.763 -46.370 1.00 3.86  ? 50  GLU B OE2 1 
ATOM   1200 N  N   . ASP B 1 50  ? 10.555  -126.082 -40.072 1.00 9.19  ? 51  ASP B N   1 
ATOM   1201 C  CA  . ASP B 1 50  ? 10.986  -125.673 -38.733 1.00 9.10  ? 51  ASP B CA  1 
ATOM   1202 C  C   . ASP B 1 50  ? 12.181  -124.724 -38.682 1.00 9.34  ? 51  ASP B C   1 
ATOM   1203 O  O   . ASP B 1 50  ? 12.152  -123.757 -37.920 1.00 8.33  ? 51  ASP B O   1 
ATOM   1204 C  CB  . ASP B 1 50  ? 11.270  -126.867 -37.811 1.00 9.29  ? 51  ASP B CB  1 
ATOM   1205 C  CG  . ASP B 1 50  ? 10.143  -127.888 -37.777 1.00 10.00 ? 51  ASP B CG  1 
ATOM   1206 O  OD1 . ASP B 1 50  ? 8.934   -127.510 -37.835 1.00 10.27 ? 51  ASP B OD1 1 
ATOM   1207 O  OD2 . ASP B 1 50  ? 10.400  -129.109 -37.654 1.00 11.81 ? 51  ASP B OD2 1 
ATOM   1208 N  N   . ASN B 1 51  ? 13.239  -125.009 -39.441 1.00 8.43  ? 52  ASN B N   1 
ATOM   1209 C  CA  . ASN B 1 51  ? 14.492  -124.279 -39.241 1.00 7.55  ? 52  ASN B CA  1 
ATOM   1210 C  C   . ASN B 1 51  ? 15.345  -124.107 -40.506 1.00 7.75  ? 52  ASN B C   1 
ATOM   1211 O  O   . ASN B 1 51  ? 16.512  -123.760 -40.393 1.00 8.68  ? 52  ASN B O   1 
ATOM   1212 C  CB  . ASN B 1 51  ? 15.326  -124.935 -38.119 1.00 7.70  ? 52  ASN B CB  1 
ATOM   1213 C  CG  . ASN B 1 51  ? 15.544  -126.426 -38.331 1.00 5.64  ? 52  ASN B CG  1 
ATOM   1214 O  OD1 . ASN B 1 51  ? 15.355  -126.951 -39.441 1.00 7.82  ? 52  ASN B OD1 1 
ATOM   1215 N  ND2 . ASN B 1 51  ? 15.927  -127.117 -37.270 1.00 7.47  ? 52  ASN B ND2 1 
ATOM   1216 N  N   . GLN B 1 52  ? 14.769  -124.361 -41.688 1.00 7.80  ? 53  GLN B N   1 
ATOM   1217 C  CA  . GLN B 1 52  ? 15.526  -124.240 -42.938 1.00 8.31  ? 53  GLN B CA  1 
ATOM   1218 C  C   . GLN B 1 52  ? 15.352  -122.842 -43.505 1.00 8.65  ? 53  GLN B C   1 
ATOM   1219 O  O   . GLN B 1 52  ? 14.224  -122.395 -43.693 1.00 9.12  ? 53  GLN B O   1 
ATOM   1220 C  CB  . GLN B 1 52  ? 15.082  -125.264 -44.013 1.00 7.79  ? 53  GLN B CB  1 
ATOM   1221 C  CG  . GLN B 1 52  ? 15.090  -126.739 -43.602 1.00 9.02  ? 53  GLN B CG  1 
ATOM   1222 C  CD  . GLN B 1 52  ? 16.464  -127.231 -43.220 1.00 5.65  ? 53  GLN B CD  1 
ATOM   1223 O  OE1 . GLN B 1 52  ? 16.749  -127.429 -42.029 1.00 9.11  ? 53  GLN B OE1 1 
ATOM   1224 N  NE2 . GLN B 1 52  ? 17.323  -127.398 -44.194 1.00 4.14  ? 53  GLN B NE2 1 
ATOM   1225 N  N   . ARG B 1 53  ? 16.458  -122.161 -43.792 1.00 9.17  ? 54  ARG B N   1 
ATOM   1226 C  CA  . ARG B 1 53  ? 16.448  -120.903 -44.544 1.00 9.58  ? 54  ARG B CA  1 
ATOM   1227 C  C   . ARG B 1 53  ? 16.475  -121.201 -46.040 1.00 9.88  ? 54  ARG B C   1 
ATOM   1228 O  O   . ARG B 1 53  ? 17.398  -121.854 -46.495 1.00 10.09 ? 54  ARG B O   1 
ATOM   1229 C  CB  . ARG B 1 53  ? 17.702  -120.082 -44.215 1.00 9.48  ? 54  ARG B CB  1 
ATOM   1230 C  CG  . ARG B 1 53  ? 17.726  -119.434 -42.838 1.00 9.16  ? 54  ARG B CG  1 
ATOM   1231 C  CD  . ARG B 1 53  ? 18.979  -118.621 -42.574 1.00 8.67  ? 54  ARG B CD  1 
ATOM   1232 N  NE  . ARG B 1 53  ? 20.130  -119.495 -42.363 1.00 8.47  ? 54  ARG B NE  1 
ATOM   1233 C  CZ  . ARG B 1 53  ? 20.327  -120.222 -41.264 1.00 10.57 ? 54  ARG B CZ  1 
ATOM   1234 N  NH1 . ARG B 1 53  ? 19.460  -120.176 -40.236 1.00 9.46  ? 54  ARG B NH1 1 
ATOM   1235 N  NH2 . ARG B 1 53  ? 21.398  -121.000 -41.186 1.00 8.56  ? 54  ARG B NH2 1 
ATOM   1236 N  N   . PRO B 1 54  ? 15.496  -120.727 -46.816 1.00 9.99  ? 55  PRO B N   1 
ATOM   1237 C  CA  . PRO B 1 54  ? 15.612  -120.770 -48.282 1.00 10.65 ? 55  PRO B CA  1 
ATOM   1238 C  C   . PRO B 1 54  ? 16.770  -119.893 -48.777 1.00 11.26 ? 55  PRO B C   1 
ATOM   1239 O  O   . PRO B 1 54  ? 17.295  -119.074 -48.010 1.00 11.18 ? 55  PRO B O   1 
ATOM   1240 C  CB  . PRO B 1 54  ? 14.256  -120.230 -48.780 1.00 10.45 ? 55  PRO B CB  1 
ATOM   1241 C  CG  . PRO B 1 54  ? 13.602  -119.642 -47.615 1.00 10.68 ? 55  PRO B CG  1 
ATOM   1242 C  CD  . PRO B 1 54  ? 14.212  -120.161 -46.367 1.00 10.06 ? 55  PRO B CD  1 
ATOM   1243 N  N   . SER B 1 55  ? 17.183  -120.102 -50.025 1.00 11.99 ? 56  SER B N   1 
ATOM   1244 C  CA  . SER B 1 55  ? 18.243  -119.295 -50.645 1.00 12.54 ? 56  SER B CA  1 
ATOM   1245 C  C   . SER B 1 55  ? 17.797  -117.841 -50.598 1.00 12.12 ? 56  SER B C   1 
ATOM   1246 O  O   . SER B 1 55  ? 16.630  -117.551 -50.815 1.00 12.46 ? 56  SER B O   1 
ATOM   1247 C  CB  . SER B 1 55  ? 18.489  -119.703 -52.101 1.00 13.34 ? 56  SER B CB  1 
ATOM   1248 O  OG  . SER B 1 55  ? 18.432  -121.104 -52.265 1.00 15.62 ? 56  SER B OG  1 
ATOM   1249 N  N   . GLY B 1 56  ? 18.715  -116.946 -50.268 1.00 11.63 ? 57  GLY B N   1 
ATOM   1250 C  CA  . GLY B 1 56  ? 18.393  -115.535 -50.217 1.00 10.97 ? 57  GLY B CA  1 
ATOM   1251 C  C   . GLY B 1 56  ? 18.073  -115.029 -48.826 1.00 10.26 ? 57  GLY B C   1 
ATOM   1252 O  O   . GLY B 1 56  ? 18.042  -113.830 -48.600 1.00 10.42 ? 57  GLY B O   1 
ATOM   1253 N  N   . VAL B 1 57  ? 17.839  -115.933 -47.880 1.00 9.26  ? 58  VAL B N   1 
ATOM   1254 C  CA  . VAL B 1 57  ? 17.471  -115.523 -46.536 1.00 8.80  ? 58  VAL B CA  1 
ATOM   1255 C  C   . VAL B 1 57  ? 18.703  -115.488 -45.636 1.00 9.31  ? 58  VAL B C   1 
ATOM   1256 O  O   . VAL B 1 57  ? 19.410  -116.493 -45.532 1.00 9.35  ? 58  VAL B O   1 
ATOM   1257 C  CB  . VAL B 1 57  ? 16.353  -116.430 -45.977 1.00 8.83  ? 58  VAL B CB  1 
ATOM   1258 C  CG1 . VAL B 1 57  ? 16.007  -116.073 -44.514 1.00 8.92  ? 58  VAL B CG1 1 
ATOM   1259 C  CG2 . VAL B 1 57  ? 15.108  -116.319 -46.884 1.00 6.92  ? 58  VAL B CG2 1 
ATOM   1260 N  N   . PRO B 1 58  ? 18.982  -114.338 -45.018 1.00 8.95  ? 59  PRO B N   1 
ATOM   1261 C  CA  . PRO B 1 58  ? 20.207  -114.177 -44.213 1.00 9.12  ? 59  PRO B CA  1 
ATOM   1262 C  C   . PRO B 1 58  ? 20.279  -115.076 -42.970 1.00 8.73  ? 59  PRO B C   1 
ATOM   1263 O  O   . PRO B 1 58  ? 19.253  -115.411 -42.369 1.00 7.59  ? 59  PRO B O   1 
ATOM   1264 C  CB  . PRO B 1 58  ? 20.206  -112.696 -43.821 1.00 9.65  ? 59  PRO B CB  1 
ATOM   1265 C  CG  . PRO B 1 58  ? 18.825  -112.199 -44.095 1.00 10.64 ? 59  PRO B CG  1 
ATOM   1266 C  CD  . PRO B 1 58  ? 18.168  -113.108 -45.067 1.00 9.51  ? 59  PRO B CD  1 
ATOM   1267 N  N   . ASP B 1 59  ? 21.508  -115.439 -42.604 1.00 9.34  ? 60  ASP B N   1 
ATOM   1268 C  CA  . ASP B 1 59  ? 21.786  -116.366 -41.505 1.00 9.51  ? 60  ASP B CA  1 
ATOM   1269 C  C   . ASP B 1 59  ? 21.304  -115.873 -40.149 1.00 9.75  ? 60  ASP B C   1 
ATOM   1270 O  O   . ASP B 1 59  ? 21.070  -116.668 -39.241 1.00 9.61  ? 60  ASP B O   1 
ATOM   1271 C  CB  . ASP B 1 59  ? 23.281  -116.649 -41.425 1.00 9.89  ? 60  ASP B CB  1 
ATOM   1272 C  CG  . ASP B 1 59  ? 23.786  -117.436 -42.608 1.00 9.98  ? 60  ASP B CG  1 
ATOM   1273 O  OD1 . ASP B 1 59  ? 22.973  -118.138 -43.264 1.00 9.07  ? 60  ASP B OD1 1 
ATOM   1274 O  OD2 . ASP B 1 59  ? 24.986  -117.401 -42.960 1.00 11.98 ? 60  ASP B OD2 1 
ATOM   1275 N  N   . ARG B 1 60  ? 21.166  -114.554 -40.010 1.00 9.84  ? 61  ARG B N   1 
ATOM   1276 C  CA  . ARG B 1 60  ? 20.624  -113.971 -38.785 1.00 10.13 ? 61  ARG B CA  1 
ATOM   1277 C  C   . ARG B 1 60  ? 19.181  -114.410 -38.485 1.00 9.67  ? 61  ARG B C   1 
ATOM   1278 O  O   . ARG B 1 60  ? 18.697  -114.242 -37.351 1.00 9.42  ? 61  ARG B O   1 
ATOM   1279 C  CB  . ARG B 1 60  ? 20.755  -112.443 -38.821 1.00 10.46 ? 61  ARG B CB  1 
ATOM   1280 C  CG  . ARG B 1 60  ? 19.699  -111.719 -39.632 1.00 12.50 ? 61  ARG B CG  1 
ATOM   1281 C  CD  . ARG B 1 60  ? 19.828  -110.199 -39.584 1.00 15.89 ? 61  ARG B CD  1 
ATOM   1282 N  NE  . ARG B 1 60  ? 20.488  -109.677 -40.770 1.00 17.74 ? 61  ARG B NE  1 
ATOM   1283 C  CZ  . ARG B 1 60  ? 19.853  -109.176 -41.823 1.00 18.73 ? 61  ARG B CZ  1 
ATOM   1284 N  NH1 . ARG B 1 60  ? 18.524  -109.132 -41.852 1.00 19.12 ? 61  ARG B NH1 1 
ATOM   1285 N  NH2 . ARG B 1 60  ? 20.550  -108.724 -42.857 1.00 20.05 ? 61  ARG B NH2 1 
ATOM   1286 N  N   . PHE B 1 61  ? 18.495  -114.986 -39.477 1.00 9.49  ? 62  PHE B N   1 
ATOM   1287 C  CA  . PHE B 1 61  ? 17.164  -115.577 -39.244 1.00 9.76  ? 62  PHE B CA  1 
ATOM   1288 C  C   . PHE B 1 61  ? 17.246  -117.051 -38.838 1.00 10.05 ? 62  PHE B C   1 
ATOM   1289 O  O   . PHE B 1 61  ? 17.859  -117.875 -39.530 1.00 10.13 ? 62  PHE B O   1 
ATOM   1290 C  CB  . PHE B 1 61  ? 16.275  -115.455 -40.487 1.00 10.00 ? 62  PHE B CB  1 
ATOM   1291 C  CG  . PHE B 1 61  ? 15.823  -114.056 -40.782 1.00 9.59  ? 62  PHE B CG  1 
ATOM   1292 C  CD1 . PHE B 1 61  ? 16.718  -113.113 -41.280 1.00 10.54 ? 62  PHE B CD1 1 
ATOM   1293 C  CD2 . PHE B 1 61  ? 14.497  -113.689 -40.583 1.00 10.71 ? 62  PHE B CD2 1 
ATOM   1294 C  CE1 . PHE B 1 61  ? 16.303  -111.815 -41.565 1.00 10.91 ? 62  PHE B CE1 1 
ATOM   1295 C  CE2 . PHE B 1 61  ? 14.071  -112.385 -40.865 1.00 10.77 ? 62  PHE B CE2 1 
ATOM   1296 C  CZ  . PHE B 1 61  ? 14.978  -111.452 -41.349 1.00 11.90 ? 62  PHE B CZ  1 
ATOM   1297 N  N   . ALA B 1 62  ? 16.586  -117.394 -37.741 1.00 10.00 ? 63  ALA B N   1 
ATOM   1298 C  CA  . ALA B 1 62  ? 16.700  -118.758 -37.239 1.00 10.13 ? 63  ALA B CA  1 
ATOM   1299 C  C   . ALA B 1 62  ? 15.361  -119.253 -36.734 1.00 10.61 ? 63  ALA B C   1 
ATOM   1300 O  O   . ALA B 1 62  ? 14.724  -118.590 -35.932 1.00 10.68 ? 63  ALA B O   1 
ATOM   1301 C  CB  . ALA B 1 62  ? 17.744  -118.830 -36.146 1.00 9.97  ? 63  ALA B CB  1 
ATOM   1302 N  N   . GLY B 1 63  ? 14.963  -120.438 -37.192 1.00 11.15 ? 64  GLY B N   1 
ATOM   1303 C  CA  . GLY B 1 63  ? 13.746  -121.074 -36.736 1.00 9.89  ? 64  GLY B CA  1 
ATOM   1304 C  C   . GLY B 1 63  ? 14.060  -122.153 -35.719 1.00 9.89  ? 64  GLY B C   1 
ATOM   1305 O  O   . GLY B 1 63  ? 15.078  -122.870 -35.823 1.00 10.49 ? 64  GLY B O   1 
ATOM   1306 N  N   . SER B 1 64  ? 13.186  -122.270 -34.734 1.00 9.70  ? 65  SER B N   1 
ATOM   1307 C  CA  . SER B 1 64  ? 13.332  -123.278 -33.689 1.00 9.70  ? 65  SER B CA  1 
ATOM   1308 C  C   . SER B 1 64  ? 11.980  -123.798 -33.205 1.00 9.87  ? 65  SER B C   1 
ATOM   1309 O  O   . SER B 1 64  ? 10.950  -123.169 -33.442 1.00 9.57  ? 65  SER B O   1 
ATOM   1310 C  CB  . SER B 1 64  ? 14.156  -122.710 -32.524 1.00 9.68  ? 65  SER B CB  1 
ATOM   1311 O  OG  . SER B 1 64  ? 13.424  -121.697 -31.847 1.00 11.31 ? 65  SER B OG  1 
ATOM   1312 N  N   . ILE B 1 65  ? 12.005  -124.988 -32.619 1.00 9.22  ? 66  ILE B N   1 
ATOM   1313 C  CA  . ILE B 1 65  ? 10.852  -125.605 -31.976 1.00 9.32  ? 66  ILE B CA  1 
ATOM   1314 C  C   . ILE B 1 65  ? 11.130  -125.889 -30.504 1.00 9.11  ? 66  ILE B C   1 
ATOM   1315 O  O   . ILE B 1 65  ? 12.193  -126.429 -30.184 1.00 8.59  ? 66  ILE B O   1 
ATOM   1316 C  CB  . ILE B 1 65  ? 10.458  -126.892 -32.703 1.00 9.31  ? 66  ILE B CB  1 
ATOM   1317 N  N   . ASP B 1 66  A 10.192  -125.523 -29.666 1.00 9.10  ? 66  ASP B N   1 
ATOM   1318 C  CA  . ASP B 1 66  A 10.279  -125.832 -28.246 1.00 9.86  ? 66  ASP B CA  1 
ATOM   1319 C  C   . ASP B 1 66  A 9.142   -126.767 -27.834 1.00 10.65 ? 66  ASP B C   1 
ATOM   1320 O  O   . ASP B 1 66  A 8.031   -126.316 -27.545 1.00 9.86  ? 66  ASP B O   1 
ATOM   1321 C  CB  . ASP B 1 66  A 10.204  -124.529 -27.449 1.00 10.51 ? 66  ASP B CB  1 
ATOM   1322 C  CG  . ASP B 1 66  A 10.359  -124.741 -25.965 1.00 11.18 ? 66  ASP B CG  1 
ATOM   1323 O  OD1 . ASP B 1 66  A 10.605  -125.894 -25.554 1.00 11.04 ? 66  ASP B OD1 1 
ATOM   1324 O  OD2 . ASP B 1 66  A 10.234  -123.824 -25.127 1.00 13.09 ? 66  ASP B OD2 1 
ATOM   1325 N  N   . ARG B 1 67  B 9.413   -128.067 -27.776 1.00 10.67 ? 66  ARG B N   1 
ATOM   1326 C  CA  . ARG B 1 67  B 8.340   -128.999 -27.433 1.00 11.15 ? 66  ARG B CA  1 
ATOM   1327 C  C   . ARG B 1 67  B 7.778   -128.711 -26.034 1.00 11.20 ? 66  ARG B C   1 
ATOM   1328 O  O   . ARG B 1 67  B 6.590   -128.914 -25.782 1.00 11.90 ? 66  ARG B O   1 
ATOM   1329 C  CB  . ARG B 1 67  B 8.817   -130.443 -27.556 1.00 11.55 ? 66  ARG B CB  1 
ATOM   1330 C  CG  . ARG B 1 67  B 9.183   -130.828 -28.982 1.00 12.93 ? 66  ARG B CG  1 
ATOM   1331 C  CD  . ARG B 1 67  B 9.739   -132.235 -29.124 1.00 17.32 ? 66  ARG B CD  1 
ATOM   1332 N  NE  . ARG B 1 67  B 11.143  -132.320 -28.709 1.00 20.93 ? 66  ARG B NE  1 
ATOM   1333 C  CZ  . ARG B 1 67  B 11.882  -133.418 -28.796 1.00 21.13 ? 66  ARG B CZ  1 
ATOM   1334 N  NH1 . ARG B 1 67  B 11.361  -134.541 -29.278 1.00 23.15 ? 66  ARG B NH1 1 
ATOM   1335 N  NH2 . ARG B 1 67  B 13.151  -133.402 -28.395 1.00 23.11 ? 66  ARG B NH2 1 
ATOM   1336 N  N   . SER B 1 68  ? 8.622   -128.179 -25.152 1.00 10.68 ? 67  SER B N   1 
ATOM   1337 C  CA  . SER B 1 68  ? 8.255   -127.981 -23.755 1.00 10.26 ? 67  SER B CA  1 
ATOM   1338 C  C   . SER B 1 68  ? 7.238   -126.868 -23.576 1.00 10.28 ? 67  SER B C   1 
ATOM   1339 O  O   . SER B 1 68  ? 6.602   -126.770 -22.529 1.00 10.24 ? 67  SER B O   1 
ATOM   1340 C  CB  . SER B 1 68  ? 9.498   -127.735 -22.882 1.00 10.24 ? 67  SER B CB  1 
ATOM   1341 O  OG  . SER B 1 68  ? 9.885   -126.371 -22.884 1.00 10.13 ? 67  SER B OG  1 
ATOM   1342 N  N   . SER B 1 69  ? 7.092   -126.036 -24.608 1.00 10.07 ? 68  SER B N   1 
ATOM   1343 C  CA  . SER B 1 69  ? 6.078   -124.994 -24.606 1.00 10.45 ? 68  SER B CA  1 
ATOM   1344 C  C   . SER B 1 69  ? 5.114   -125.139 -25.787 1.00 9.42  ? 68  SER B C   1 
ATOM   1345 O  O   . SER B 1 69  ? 4.262   -124.288 -26.009 1.00 9.50  ? 68  SER B O   1 
ATOM   1346 C  CB  . SER B 1 69  ? 6.723   -123.603 -24.545 1.00 9.88  ? 68  SER B CB  1 
ATOM   1347 O  OG  . SER B 1 69  ? 7.521   -123.319 -25.680 1.00 13.40 ? 68  SER B OG  1 
ATOM   1348 N  N   . ASN B 1 70  ? 5.236   -126.253 -26.508 1.00 9.16  ? 69  ASN B N   1 
ATOM   1349 C  CA  . ASN B 1 70  ? 4.434   -126.524 -27.707 1.00 9.15  ? 69  ASN B CA  1 
ATOM   1350 C  C   . ASN B 1 70  ? 4.461   -125.359 -28.668 1.00 8.76  ? 69  ASN B C   1 
ATOM   1351 O  O   . ASN B 1 70  ? 3.428   -124.949 -29.198 1.00 8.52  ? 69  ASN B O   1 
ATOM   1352 C  CB  . ASN B 1 70  ? 2.987   -126.887 -27.346 1.00 8.89  ? 69  ASN B CB  1 
ATOM   1353 C  CG  . ASN B 1 70  ? 2.378   -127.882 -28.312 1.00 9.39  ? 69  ASN B CG  1 
ATOM   1354 O  OD1 . ASN B 1 70  ? 3.028   -128.850 -28.708 1.00 9.80  ? 69  ASN B OD1 1 
ATOM   1355 N  ND2 . ASN B 1 70  ? 1.125   -127.648 -28.701 1.00 7.15  ? 69  ASN B ND2 1 
ATOM   1356 N  N   . SER B 1 71  ? 5.653   -124.825 -28.885 1.00 8.75  ? 70  SER B N   1 
ATOM   1357 C  CA  . SER B 1 71  ? 5.780   -123.596 -29.655 1.00 9.39  ? 70  SER B CA  1 
ATOM   1358 C  C   . SER B 1 71  ? 6.890   -123.669 -30.683 1.00 9.89  ? 70  SER B C   1 
ATOM   1359 O  O   . SER B 1 71  ? 7.817   -124.476 -30.576 1.00 8.82  ? 70  SER B O   1 
ATOM   1360 C  CB  . SER B 1 71  ? 6.016   -122.416 -28.715 1.00 10.04 ? 70  SER B CB  1 
ATOM   1361 O  OG  . SER B 1 71  ? 7.348   -122.424 -28.245 1.00 11.06 ? 70  SER B OG  1 
ATOM   1362 N  N   . ALA B 1 72  ? 6.767   -122.817 -31.691 1.00 9.46  ? 71  ALA B N   1 
ATOM   1363 C  CA  . ALA B 1 72  ? 7.832   -122.566 -32.651 1.00 9.88  ? 71  ALA B CA  1 
ATOM   1364 C  C   . ALA B 1 72  ? 8.262   -121.112 -32.481 1.00 9.68  ? 71  ALA B C   1 
ATOM   1365 O  O   . ALA B 1 72  ? 7.473   -120.279 -32.037 1.00 9.40  ? 71  ALA B O   1 
ATOM   1366 C  CB  . ALA B 1 72  ? 7.322   -122.806 -34.060 1.00 9.42  ? 71  ALA B CB  1 
ATOM   1367 N  N   . SER B 1 73  ? 9.528   -120.830 -32.775 1.00 9.66  ? 72  SER B N   1 
ATOM   1368 C  CA  . SER B 1 73  ? 10.087  -119.483 -32.629 1.00 9.95  ? 72  SER B CA  1 
ATOM   1369 C  C   . SER B 1 73  ? 10.910  -119.076 -33.852 1.00 9.91  ? 72  SER B C   1 
ATOM   1370 O  O   . SER B 1 73  ? 11.639  -119.886 -34.443 1.00 9.44  ? 72  SER B O   1 
ATOM   1371 C  CB  . SER B 1 73  ? 10.954  -119.370 -31.354 1.00 10.19 ? 72  SER B CB  1 
ATOM   1372 O  OG  . SER B 1 73  ? 10.176  -119.361 -30.162 1.00 10.75 ? 72  SER B OG  1 
ATOM   1373 N  N   . LEU B 1 74  ? 10.782  -117.813 -34.232 1.00 10.10 ? 73  LEU B N   1 
ATOM   1374 C  CA  . LEU B 1 74  ? 11.660  -117.214 -35.213 1.00 10.03 ? 73  LEU B CA  1 
ATOM   1375 C  C   . LEU B 1 74  ? 12.536  -116.218 -34.451 1.00 10.18 ? 73  LEU B C   1 
ATOM   1376 O  O   . LEU B 1 74  ? 12.029  -115.335 -33.754 1.00 9.71  ? 73  LEU B O   1 
ATOM   1377 C  CB  . LEU B 1 74  ? 10.832  -116.522 -36.307 1.00 10.24 ? 73  LEU B CB  1 
ATOM   1378 C  CG  . LEU B 1 74  ? 11.547  -115.770 -37.430 1.00 8.66  ? 73  LEU B CG  1 
ATOM   1379 C  CD1 . LEU B 1 74  ? 12.409  -116.706 -38.267 1.00 9.57  ? 73  LEU B CD1 1 
ATOM   1380 C  CD2 . LEU B 1 74  ? 10.527  -115.053 -38.300 1.00 9.66  ? 73  LEU B CD2 1 
ATOM   1381 N  N   . THR B 1 75  ? 13.848  -116.387 -34.562 1.00 9.79  ? 74  THR B N   1 
ATOM   1382 C  CA  . THR B 1 75  ? 14.801  -115.566 -33.829 1.00 10.19 ? 74  THR B CA  1 
ATOM   1383 C  C   . THR B 1 75  ? 15.684  -114.793 -34.808 1.00 10.05 ? 74  THR B C   1 
ATOM   1384 O  O   . THR B 1 75  ? 16.333  -115.385 -35.670 1.00 9.88  ? 74  THR B O   1 
ATOM   1385 C  CB  . THR B 1 75  ? 15.665  -116.448 -32.905 1.00 10.34 ? 74  THR B CB  1 
ATOM   1386 O  OG1 . THR B 1 75  ? 14.824  -117.111 -31.949 1.00 10.22 ? 74  THR B OG1 1 
ATOM   1387 C  CG2 . THR B 1 75  ? 16.578  -115.607 -32.039 1.00 11.42 ? 74  THR B CG2 1 
ATOM   1388 N  N   . ILE B 1 76  ? 15.703  -113.468 -34.675 1.00 10.15 ? 75  ILE B N   1 
ATOM   1389 C  CA  . ILE B 1 76  ? 16.527  -112.630 -35.554 1.00 10.73 ? 75  ILE B CA  1 
ATOM   1390 C  C   . ILE B 1 76  ? 17.656  -111.968 -34.766 1.00 10.73 ? 75  ILE B C   1 
ATOM   1391 O  O   . ILE B 1 76  ? 17.406  -111.168 -33.873 1.00 10.71 ? 75  ILE B O   1 
ATOM   1392 C  CB  . ILE B 1 76  ? 15.672  -111.575 -36.299 1.00 10.70 ? 75  ILE B CB  1 
ATOM   1393 C  CG1 . ILE B 1 76  ? 14.330  -112.168 -36.743 1.00 11.14 ? 75  ILE B CG1 1 
ATOM   1394 C  CG2 . ILE B 1 76  ? 16.438  -111.020 -37.505 1.00 10.58 ? 75  ILE B CG2 1 
ATOM   1395 C  CD1 . ILE B 1 76  ? 13.372  -111.156 -37.381 1.00 12.92 ? 75  ILE B CD1 1 
ATOM   1396 N  N   . SER B 1 77  ? 18.896  -112.340 -35.082 1.00 11.26 ? 76  SER B N   1 
ATOM   1397 C  CA  . SER B 1 77  ? 20.070  -111.735 -34.463 1.00 11.83 ? 76  SER B CA  1 
ATOM   1398 C  C   . SER B 1 77  ? 20.447  -110.478 -35.243 1.00 11.79 ? 76  SER B C   1 
ATOM   1399 O  O   . SER B 1 77  ? 20.146  -110.379 -36.430 1.00 11.80 ? 76  SER B O   1 
ATOM   1400 C  CB  . SER B 1 77  ? 21.236  -112.727 -34.449 1.00 12.08 ? 76  SER B CB  1 
ATOM   1401 O  OG  . SER B 1 77  ? 20.880  -113.918 -33.766 1.00 13.22 ? 76  SER B OG  1 
ATOM   1402 N  N   . GLY B 1 78  ? 21.083  -109.518 -34.571 1.00 11.98 ? 77  GLY B N   1 
ATOM   1403 C  CA  . GLY B 1 78  ? 21.528  -108.284 -35.206 1.00 12.20 ? 77  GLY B CA  1 
ATOM   1404 C  C   . GLY B 1 78  ? 20.509  -107.608 -36.114 1.00 12.46 ? 77  GLY B C   1 
ATOM   1405 O  O   . GLY B 1 78  ? 20.737  -107.492 -37.324 1.00 12.59 ? 77  GLY B O   1 
ATOM   1406 N  N   . LEU B 1 79  ? 19.403  -107.146 -35.528 1.00 12.48 ? 78  LEU B N   1 
ATOM   1407 C  CA  . LEU B 1 79  ? 18.268  -106.590 -36.278 1.00 12.54 ? 78  LEU B CA  1 
ATOM   1408 C  C   . LEU B 1 79  ? 18.608  -105.520 -37.314 1.00 12.41 ? 78  LEU B C   1 
ATOM   1409 O  O   . LEU B 1 79  ? 19.555  -104.760 -37.141 1.00 12.68 ? 78  LEU B O   1 
ATOM   1410 C  CB  . LEU B 1 79  ? 17.220  -106.037 -35.316 1.00 12.70 ? 78  LEU B CB  1 
ATOM   1411 C  CG  . LEU B 1 79  ? 16.179  -107.052 -34.858 1.00 12.95 ? 78  LEU B CG  1 
ATOM   1412 C  CD1 . LEU B 1 79  ? 15.163  -106.393 -33.958 1.00 14.49 ? 78  LEU B CD1 1 
ATOM   1413 C  CD2 . LEU B 1 79  ? 15.494  -107.715 -36.035 1.00 14.62 ? 78  LEU B CD2 1 
ATOM   1414 N  N   . LYS B 1 80  ? 17.812  -105.469 -38.382 1.00 12.35 ? 79  LYS B N   1 
ATOM   1415 C  CA  . LYS B 1 80  ? 17.961  -104.472 -39.443 1.00 12.17 ? 79  LYS B CA  1 
ATOM   1416 C  C   . LYS B 1 80  ? 16.609  -103.864 -39.817 1.00 12.09 ? 79  LYS B C   1 
ATOM   1417 O  O   . LYS B 1 80  ? 15.584  -104.536 -39.725 1.00 11.01 ? 79  LYS B O   1 
ATOM   1418 C  CB  . LYS B 1 80  ? 18.629  -105.099 -40.670 1.00 12.21 ? 79  LYS B CB  1 
ATOM   1419 C  CG  . LYS B 1 80  ? 20.099  -105.401 -40.458 1.00 12.58 ? 79  LYS B CG  1 
ATOM   1420 C  CD  . LYS B 1 80  ? 20.838  -105.626 -41.764 1.00 13.36 ? 79  LYS B CD  1 
ATOM   1421 C  CE  . LYS B 1 80  ? 22.275  -106.044 -41.496 1.00 13.40 ? 79  LYS B CE  1 
ATOM   1422 N  NZ  . LYS B 1 80  ? 23.119  -104.874 -41.111 1.00 13.56 ? 79  LYS B NZ  1 
ATOM   1423 N  N   . THR B 1 81  ? 16.607  -102.596 -40.246 1.00 11.79 ? 80  THR B N   1 
ATOM   1424 C  CA  . THR B 1 81  ? 15.352  -101.884 -40.542 1.00 12.34 ? 80  THR B CA  1 
ATOM   1425 C  C   . THR B 1 81  ? 14.534  -102.510 -41.677 1.00 12.49 ? 80  THR B C   1 
ATOM   1426 O  O   . THR B 1 81  ? 13.306  -102.408 -41.693 1.00 12.80 ? 80  THR B O   1 
ATOM   1427 C  CB  . THR B 1 81  ? 15.586  -100.364 -40.824 1.00 12.34 ? 80  THR B CB  1 
ATOM   1428 O  OG1 . THR B 1 81  ? 16.467  -100.194 -41.941 1.00 12.99 ? 80  THR B OG1 1 
ATOM   1429 C  CG2 . THR B 1 81  ? 16.325  -99.694  -39.672 1.00 12.52 ? 80  THR B CG2 1 
ATOM   1430 N  N   . GLU B 1 82  ? 15.221  -103.138 -42.630 1.00 12.71 ? 81  GLU B N   1 
ATOM   1431 C  CA  . GLU B 1 82  ? 14.571  -103.899 -43.699 1.00 13.05 ? 81  GLU B CA  1 
ATOM   1432 C  C   . GLU B 1 82  ? 13.724  -105.066 -43.142 1.00 13.05 ? 81  GLU B C   1 
ATOM   1433 O  O   . GLU B 1 82  ? 12.741  -105.489 -43.779 1.00 13.37 ? 81  GLU B O   1 
ATOM   1434 C  CB  . GLU B 1 82  ? 15.620  -104.420 -44.689 1.00 13.00 ? 81  GLU B CB  1 
ATOM   1435 C  CG  . GLU B 1 82  ? 16.804  -105.120 -44.006 1.00 14.20 ? 81  GLU B CG  1 
ATOM   1436 C  CD  . GLU B 1 82  ? 17.895  -105.540 -44.976 1.00 15.56 ? 81  GLU B CD  1 
ATOM   1437 O  OE1 . GLU B 1 82  ? 18.922  -104.836 -45.053 1.00 15.40 ? 81  GLU B OE1 1 
ATOM   1438 O  OE2 . GLU B 1 82  ? 17.738  -106.587 -45.642 1.00 16.87 ? 81  GLU B OE2 1 
ATOM   1439 N  N   . ASP B 1 83  ? 14.096  -105.554 -41.949 1.00 13.05 ? 82  ASP B N   1 
ATOM   1440 C  CA  . ASP B 1 83  ? 13.372  -106.639 -41.258 1.00 12.81 ? 82  ASP B CA  1 
ATOM   1441 C  C   . ASP B 1 83  ? 11.979  -106.222 -40.761 1.00 12.79 ? 82  ASP B C   1 
ATOM   1442 O  O   . ASP B 1 83  ? 11.192  -107.064 -40.306 1.00 13.21 ? 82  ASP B O   1 
ATOM   1443 C  CB  . ASP B 1 83  ? 14.186  -107.197 -40.075 1.00 12.82 ? 82  ASP B CB  1 
ATOM   1444 C  CG  . ASP B 1 83  ? 15.623  -107.591 -40.474 1.00 12.68 ? 82  ASP B CG  1 
ATOM   1445 O  OD1 . ASP B 1 83  ? 15.817  -108.100 -41.605 1.00 13.55 ? 82  ASP B OD1 1 
ATOM   1446 O  OD2 . ASP B 1 83  ? 16.629  -107.429 -39.706 1.00 12.52 ? 82  ASP B OD2 1 
ATOM   1447 N  N   . GLU B 1 84  ? 11.686  -104.921 -40.822 1.00 12.72 ? 83  GLU B N   1 
ATOM   1448 C  CA  . GLU B 1 84  ? 10.363  -104.417 -40.472 1.00 12.61 ? 83  GLU B CA  1 
ATOM   1449 C  C   . GLU B 1 84  ? 9.305   -104.976 -41.424 1.00 12.35 ? 83  GLU B C   1 
ATOM   1450 O  O   . GLU B 1 84  ? 9.316   -104.679 -42.629 1.00 11.82 ? 83  GLU B O   1 
ATOM   1451 C  CB  . GLU B 1 84  ? 10.336  -102.885 -40.486 1.00 12.80 ? 83  GLU B CB  1 
ATOM   1452 C  CG  . GLU B 1 84  ? 10.684  -102.247 -39.148 1.00 13.82 ? 83  GLU B CG  1 
ATOM   1453 C  CD  . GLU B 1 84  ? 9.921   -100.964 -38.880 1.00 15.33 ? 83  GLU B CD  1 
ATOM   1454 O  OE1 . GLU B 1 84  ? 10.548  -99.994  -38.402 1.00 16.24 ? 83  GLU B OE1 1 
ATOM   1455 O  OE2 . GLU B 1 84  ? 8.695   -100.917 -39.138 1.00 16.53 ? 83  GLU B OE2 1 
ATOM   1456 N  N   . ALA B 1 85  ? 8.390   -105.785 -40.863 1.00 12.08 ? 84  ALA B N   1 
ATOM   1457 C  CA  . ALA B 1 85  ? 7.374   -106.498 -41.641 1.00 12.27 ? 84  ALA B CA  1 
ATOM   1458 C  C   . ALA B 1 85  ? 6.297   -107.142 -40.755 1.00 11.88 ? 84  ALA B C   1 
ATOM   1459 O  O   . ALA B 1 85  ? 6.282   -106.966 -39.459 1.00 12.03 ? 84  ALA B O   1 
ATOM   1460 C  CB  . ALA B 1 85  ? 8.046   -107.586 -42.523 1.00 12.51 ? 84  ALA B CB  1 
ATOM   1461 N  N   . ASP B 1 86  ? 5.399   -107.894 -41.472 1.00 11.75 ? 85  ASP B N   1 
ATOM   1462 C  CA  . ASP B 1 86  ? 4.502   -108.845 -40.818 1.00 11.51 ? 85  ASP B CA  1 
ATOM   1463 C  C   . ASP B 1 86  ? 5.201   -110.206 -40.862 1.00 11.48 ? 85  ASP B C   1 
ATOM   1464 O  O   . ASP B 1 86  ? 5.658   -110.635 -41.929 1.00 11.09 ? 85  ASP B O   1 
ATOM   1465 C  CB  . ASP B 1 86  ? 3.152   -108.924 -41.561 1.00 11.45 ? 85  ASP B CB  1 
ATOM   1466 C  CG  . ASP B 1 86  ? 2.226   -107.748 -41.254 1.00 11.64 ? 85  ASP B CG  1 
ATOM   1467 O  OD1 . ASP B 1 86  ? 1.407   -107.381 -42.141 1.00 10.95 ? 85  ASP B OD1 1 
ATOM   1468 O  OD2 . ASP B 1 86  ? 2.211   -107.123 -40.166 1.00 10.69 ? 85  ASP B OD2 1 
ATOM   1469 N  N   . TYR B 1 87  ? 5.313   -110.873 -39.707 1.00 11.20 ? 86  TYR B N   1 
ATOM   1470 C  CA  . TYR B 1 87  ? 5.868   -112.231 -39.641 1.00 11.63 ? 86  TYR B CA  1 
ATOM   1471 C  C   . TYR B 1 87  ? 4.761   -113.191 -39.250 1.00 11.72 ? 86  TYR B C   1 
ATOM   1472 O  O   . TYR B 1 87  ? 4.090   -112.984 -38.240 1.00 12.38 ? 86  TYR B O   1 
ATOM   1473 C  CB  . TYR B 1 87  ? 7.031   -112.319 -38.643 1.00 11.68 ? 86  TYR B CB  1 
ATOM   1474 C  CG  . TYR B 1 87  ? 8.264   -111.572 -39.103 1.00 10.13 ? 86  TYR B CG  1 
ATOM   1475 C  CD1 . TYR B 1 87  ? 8.438   -110.220 -38.797 1.00 9.04  ? 86  TYR B CD1 1 
ATOM   1476 C  CD2 . TYR B 1 87  ? 9.251   -112.212 -39.856 1.00 9.76  ? 86  TYR B CD2 1 
ATOM   1477 C  CE1 . TYR B 1 87  ? 9.569   -109.524 -39.232 1.00 8.47  ? 86  TYR B CE1 1 
ATOM   1478 C  CE2 . TYR B 1 87  ? 10.384  -111.529 -40.291 1.00 8.50  ? 86  TYR B CE2 1 
ATOM   1479 C  CZ  . TYR B 1 87  ? 10.544  -110.191 -39.973 1.00 10.35 ? 86  TYR B CZ  1 
ATOM   1480 O  OH  . TYR B 1 87  ? 11.663  -109.504 -40.417 1.00 9.21  ? 86  TYR B OH  1 
ATOM   1481 N  N   . TYR B 1 88  ? 4.550   -114.217 -40.073 1.00 11.87 ? 87  TYR B N   1 
ATOM   1482 C  CA  . TYR B 1 88  ? 3.530   -115.237 -39.816 1.00 11.34 ? 87  TYR B CA  1 
ATOM   1483 C  C   . TYR B 1 88  ? 4.125   -116.633 -39.737 1.00 10.86 ? 87  TYR B C   1 
ATOM   1484 O  O   . TYR B 1 88  ? 4.987   -116.979 -40.544 1.00 10.47 ? 87  TYR B O   1 
ATOM   1485 C  CB  . TYR B 1 88  ? 2.495   -115.215 -40.937 1.00 11.80 ? 87  TYR B CB  1 
ATOM   1486 C  CG  . TYR B 1 88  ? 1.888   -113.855 -41.161 1.00 13.06 ? 87  TYR B CG  1 
ATOM   1487 C  CD1 . TYR B 1 88  ? 1.257   -113.172 -40.120 1.00 14.03 ? 87  TYR B CD1 1 
ATOM   1488 C  CD2 . TYR B 1 88  ? 1.939   -113.249 -42.405 1.00 13.71 ? 87  TYR B CD2 1 
ATOM   1489 C  CE1 . TYR B 1 88  ? 0.702   -111.922 -40.306 1.00 14.65 ? 87  TYR B CE1 1 
ATOM   1490 C  CE2 . TYR B 1 88  ? 1.378   -111.993 -42.608 1.00 14.86 ? 87  TYR B CE2 1 
ATOM   1491 C  CZ  . TYR B 1 88  ? 0.758   -111.337 -41.552 1.00 15.51 ? 87  TYR B CZ  1 
ATOM   1492 O  OH  . TYR B 1 88  ? 0.204   -110.096 -41.731 1.00 16.74 ? 87  TYR B OH  1 
ATOM   1493 N  N   . CYS B 1 89  ? 3.656   -117.431 -38.772 1.00 10.05 ? 88  CYS B N   1 
ATOM   1494 C  CA  . CYS B 1 89  ? 3.975   -118.854 -38.741 1.00 10.01 ? 88  CYS B CA  1 
ATOM   1495 C  C   . CYS B 1 89  ? 2.851   -119.640 -39.393 1.00 9.37  ? 88  CYS B C   1 
ATOM   1496 O  O   . CYS B 1 89  ? 1.727   -119.129 -39.545 1.00 9.69  ? 88  CYS B O   1 
ATOM   1497 C  CB  . CYS B 1 89  ? 4.204   -119.325 -37.303 1.00 9.92  ? 88  CYS B CB  1 
ATOM   1498 S  SG  . CYS B 1 89  ? 2.790   -119.117 -36.199 1.00 10.49 ? 88  CYS B SG  1 
ATOM   1499 N  N   . GLN B 1 90  ? 3.135   -120.882 -39.765 1.00 9.44  ? 89  GLN B N   1 
ATOM   1500 C  CA  . GLN B 1 90  ? 2.146   -121.712 -40.441 1.00 10.38 ? 89  GLN B CA  1 
ATOM   1501 C  C   . GLN B 1 90  ? 2.509   -123.187 -40.300 1.00 10.84 ? 89  GLN B C   1 
ATOM   1502 O  O   . GLN B 1 90  ? 3.670   -123.547 -40.379 1.00 11.38 ? 89  GLN B O   1 
ATOM   1503 C  CB  . GLN B 1 90  ? 2.044   -121.295 -41.918 1.00 10.44 ? 89  GLN B CB  1 
ATOM   1504 C  CG  . GLN B 1 90  ? 1.216   -122.206 -42.796 1.00 10.03 ? 89  GLN B CG  1 
ATOM   1505 C  CD  . GLN B 1 90  ? 2.048   -123.270 -43.477 1.00 8.85  ? 89  GLN B CD  1 
ATOM   1506 O  OE1 . GLN B 1 90  ? 3.070   -122.971 -44.103 1.00 9.43  ? 89  GLN B OE1 1 
ATOM   1507 N  NE2 . GLN B 1 90  ? 1.603   -124.510 -43.385 1.00 7.24  ? 89  GLN B NE2 1 
ATOM   1508 N  N   . SER B 1 91  ? 1.513   -124.037 -40.069 1.00 10.56 ? 90  SER B N   1 
ATOM   1509 C  CA  . SER B 1 91  ? 1.736   -125.480 -40.021 1.00 11.23 ? 90  SER B CA  1 
ATOM   1510 C  C   . SER B 1 91  ? 0.523   -126.210 -40.598 1.00 11.86 ? 90  SER B C   1 
ATOM   1511 O  O   . SER B 1 91  ? -0.380  -125.561 -41.125 1.00 12.71 ? 90  SER B O   1 
ATOM   1512 C  CB  . SER B 1 91  ? 2.080   -125.927 -38.592 1.00 11.14 ? 90  SER B CB  1 
ATOM   1513 O  OG  . SER B 1 91  ? 2.502   -127.270 -38.567 1.00 10.58 ? 90  SER B OG  1 
ATOM   1514 N  N   . TYR B 1 92  ? 0.521   -127.544 -40.550 1.00 12.71 ? 91  TYR B N   1 
ATOM   1515 C  CA  . TYR B 1 92  ? -0.563  -128.340 -41.128 1.00 13.88 ? 91  TYR B CA  1 
ATOM   1516 C  C   . TYR B 1 92  ? -1.284  -129.151 -40.071 1.00 14.20 ? 91  TYR B C   1 
ATOM   1517 O  O   . TYR B 1 92  ? -0.715  -129.476 -39.018 1.00 14.49 ? 91  TYR B O   1 
ATOM   1518 C  CB  . TYR B 1 92  ? -0.077  -129.296 -42.236 1.00 13.92 ? 91  TYR B CB  1 
ATOM   1519 C  CG  . TYR B 1 92  ? 1.184   -128.884 -42.969 1.00 15.37 ? 91  TYR B CG  1 
ATOM   1520 C  CD1 . TYR B 1 92  ? 1.223   -127.713 -43.718 1.00 17.17 ? 91  TYR B CD1 1 
ATOM   1521 C  CD2 . TYR B 1 92  ? 2.325   -129.682 -42.936 1.00 16.17 ? 91  TYR B CD2 1 
ATOM   1522 C  CE1 . TYR B 1 92  ? 2.357   -127.334 -44.398 1.00 17.10 ? 91  TYR B CE1 1 
ATOM   1523 C  CE2 . TYR B 1 92  ? 3.489   -129.305 -43.618 1.00 17.51 ? 91  TYR B CE2 1 
ATOM   1524 C  CZ  . TYR B 1 92  ? 3.488   -128.125 -44.351 1.00 17.77 ? 91  TYR B CZ  1 
ATOM   1525 O  OH  . TYR B 1 92  ? 4.605   -127.719 -45.041 1.00 17.65 ? 91  TYR B OH  1 
ATOM   1526 N  N   . ASP B 1 93  ? -2.537  -129.465 -40.386 1.00 14.54 ? 92  ASP B N   1 
ATOM   1527 C  CA  . ASP B 1 93  ? -3.395  -130.308 -39.580 1.00 15.01 ? 92  ASP B CA  1 
ATOM   1528 C  C   . ASP B 1 93  ? -4.062  -131.343 -40.486 1.00 15.03 ? 92  ASP B C   1 
ATOM   1529 O  O   . ASP B 1 93  ? -5.221  -131.167 -40.906 1.00 15.37 ? 92  ASP B O   1 
ATOM   1530 C  CB  . ASP B 1 93  ? -4.450  -129.445 -38.884 1.00 15.18 ? 92  ASP B CB  1 
ATOM   1531 C  CG  . ASP B 1 93  ? -5.362  -130.248 -38.000 1.00 15.40 ? 92  ASP B CG  1 
ATOM   1532 O  OD1 . ASP B 1 93  ? -4.991  -130.487 -36.833 1.00 16.10 ? 92  ASP B OD1 1 
ATOM   1533 O  OD2 . ASP B 1 93  ? -6.475  -130.672 -38.382 1.00 16.61 ? 92  ASP B OD2 1 
ATOM   1534 N  N   . ALA B 1 94  ? -3.326  -132.410 -40.798 1.00 15.27 ? 93  ALA B N   1 
ATOM   1535 C  CA  . ALA B 1 94  ? -3.810  -133.478 -41.688 1.00 15.42 ? 93  ALA B CA  1 
ATOM   1536 C  C   . ALA B 1 94  ? -4.640  -132.949 -42.871 1.00 15.70 ? 93  ALA B C   1 
ATOM   1537 O  O   . ALA B 1 94  ? -5.857  -133.148 -42.932 1.00 15.33 ? 93  ALA B O   1 
ATOM   1538 C  CB  . ALA B 1 94  ? -4.599  -134.531 -40.892 1.00 15.27 ? 93  ALA B CB  1 
ATOM   1539 N  N   . ARG B 1 95  ? -3.969  -132.277 -43.804 1.00 16.01 ? 94  ARG B N   1 
ATOM   1540 C  CA  . ARG B 1 95  ? -4.637  -131.625 -44.921 1.00 15.86 ? 94  ARG B CA  1 
ATOM   1541 C  C   . ARG B 1 95  ? -4.532  -130.109 -44.826 1.00 15.89 ? 94  ARG B C   1 
ATOM   1542 O  O   . ARG B 1 95  ? -3.479  -129.539 -45.156 1.00 16.16 ? 94  ARG B O   1 
ATOM   1543 C  CB  . ARG B 1 95  ? -6.109  -132.028 -44.983 1.00 20.00 ? 94  ARG B CB  1 
ATOM   1544 C  CG  . ARG B 1 95  ? -6.345  -133.515 -45.167 1.00 20.00 ? 94  ARG B CG  1 
ATOM   1545 C  CD  . ARG B 1 95  ? -7.810  -133.798 -45.450 1.00 20.00 ? 94  ARG B CD  1 
ATOM   1546 N  NE  . ARG B 1 95  ? -8.069  -135.220 -45.642 1.00 20.00 ? 94  ARG B NE  1 
ATOM   1547 C  CZ  . ARG B 1 95  ? -9.269  -135.728 -45.896 1.00 20.00 ? 94  ARG B CZ  1 
ATOM   1548 N  NH1 . ARG B 1 95  ? -10.322 -134.927 -45.989 1.00 20.00 ? 94  ARG B NH1 1 
ATOM   1549 N  NH2 . ARG B 1 95  ? -9.415  -137.036 -46.058 1.00 20.00 ? 94  ARG B NH2 1 
ATOM   1550 N  N   . ASN B 1 96  ? -5.597  -129.488 -44.321 1.00 15.59 ? 95  ASN B N   1 
ATOM   1551 C  CA  . ASN B 1 96  ? -5.677  -128.033 -44.102 1.00 15.42 ? 95  ASN B CA  1 
ATOM   1552 C  C   . ASN B 1 96  ? -4.504  -127.393 -43.341 1.00 14.97 ? 95  ASN B C   1 
ATOM   1553 O  O   . ASN B 1 96  ? -3.673  -128.095 -42.755 1.00 15.32 ? 95  ASN B O   1 
ATOM   1554 C  CB  . ASN B 1 96  ? -7.004  -127.666 -43.418 1.00 15.27 ? 95  ASN B CB  1 
ATOM   1555 C  CG  . ASN B 1 96  ? -7.228  -128.421 -42.114 1.00 15.48 ? 95  ASN B CG  1 
ATOM   1556 O  OD1 . ASN B 1 96  ? -6.452  -128.294 -41.164 1.00 14.78 ? 95  ASN B OD1 1 
ATOM   1557 N  ND2 . ASN B 1 96  ? -8.300  -129.205 -42.062 1.00 15.08 ? 95  ASN B ND2 1 
ATOM   1558 N  N   . VAL B 1 97  ? -4.449  -126.058 -43.353 1.00 14.33 ? 96  VAL B N   1 
ATOM   1559 C  CA  . VAL B 1 97  ? -3.318  -125.320 -42.768 1.00 13.30 ? 96  VAL B CA  1 
ATOM   1560 C  C   . VAL B 1 97  ? -3.768  -124.166 -41.865 1.00 12.66 ? 96  VAL B C   1 
ATOM   1561 O  O   . VAL B 1 97  ? -4.933  -123.760 -41.906 1.00 12.02 ? 96  VAL B O   1 
ATOM   1562 C  CB  . VAL B 1 97  ? -2.310  -124.806 -43.848 1.00 13.75 ? 96  VAL B CB  1 
ATOM   1563 C  CG1 . VAL B 1 97  ? -1.856  -125.934 -44.763 1.00 13.73 ? 96  VAL B CG1 1 
ATOM   1564 C  CG2 . VAL B 1 97  ? -2.889  -123.666 -44.659 1.00 13.76 ? 96  VAL B CG2 1 
ATOM   1565 N  N   . VAL B 1 98  ? -2.835  -123.646 -41.064 1.00 11.40 ? 97  VAL B N   1 
ATOM   1566 C  CA  . VAL B 1 98  ? -3.121  -122.641 -40.041 1.00 11.03 ? 97  VAL B CA  1 
ATOM   1567 C  C   . VAL B 1 98  ? -2.036  -121.562 -39.983 1.00 10.70 ? 97  VAL B C   1 
ATOM   1568 O  O   . VAL B 1 98  ? -0.844  -121.868 -40.091 1.00 9.93  ? 97  VAL B O   1 
ATOM   1569 C  CB  . VAL B 1 98  ? -3.260  -123.313 -38.632 1.00 11.11 ? 97  VAL B CB  1 
ATOM   1570 C  CG1 . VAL B 1 98  ? -3.405  -122.276 -37.509 1.00 11.48 ? 97  VAL B CG1 1 
ATOM   1571 C  CG2 . VAL B 1 98  ? -4.425  -124.291 -38.607 1.00 10.95 ? 97  VAL B CG2 1 
ATOM   1572 N  N   . PHE B 1 99  ? -2.454  -120.313 -39.779 1.00 10.37 ? 98  PHE B N   1 
ATOM   1573 C  CA  . PHE B 1 99  ? -1.537  -119.181 -39.649 1.00 10.49 ? 98  PHE B CA  1 
ATOM   1574 C  C   . PHE B 1 99  ? -1.602  -118.489 -38.288 1.00 10.07 ? 98  PHE B C   1 
ATOM   1575 O  O   . PHE B 1 99  ? -2.671  -118.371 -37.693 1.00 9.67  ? 98  PHE B O   1 
ATOM   1576 C  CB  . PHE B 1 99  ? -1.836  -118.148 -40.741 1.00 10.75 ? 98  PHE B CB  1 
ATOM   1577 C  CG  . PHE B 1 99  ? -1.313  -118.538 -42.095 1.00 11.79 ? 98  PHE B CG  1 
ATOM   1578 C  CD1 . PHE B 1 99  ? -0.036  -118.165 -42.497 1.00 12.01 ? 98  PHE B CD1 1 
ATOM   1579 C  CD2 . PHE B 1 99  ? -2.100  -119.288 -42.969 1.00 13.56 ? 98  PHE B CD2 1 
ATOM   1580 C  CE1 . PHE B 1 99  ? 0.454   -118.534 -43.748 1.00 13.31 ? 98  PHE B CE1 1 
ATOM   1581 C  CE2 . PHE B 1 99  ? -1.618  -119.664 -44.220 1.00 13.14 ? 98  PHE B CE2 1 
ATOM   1582 C  CZ  . PHE B 1 99  ? -0.341  -119.286 -44.609 1.00 13.46 ? 98  PHE B CZ  1 
ATOM   1583 N  N   . GLY B 1 100 ? -0.450  -118.031 -37.802 1.00 9.65  ? 99  GLY B N   1 
ATOM   1584 C  CA  . GLY B 1 100 ? -0.433  -117.146 -36.649 1.00 8.73  ? 99  GLY B CA  1 
ATOM   1585 C  C   . GLY B 1 100 ? -0.982  -115.765 -36.989 1.00 8.90  ? 99  GLY B C   1 
ATOM   1586 O  O   . GLY B 1 100 ? -1.007  -115.348 -38.155 1.00 8.30  ? 99  GLY B O   1 
ATOM   1587 N  N   . GLY B 1 101 ? -1.417  -115.053 -35.953 1.00 8.13  ? 100 GLY B N   1 
ATOM   1588 C  CA  . GLY B 1 101 ? -1.948  -113.710 -36.085 1.00 8.33  ? 100 GLY B CA  1 
ATOM   1589 C  C   . GLY B 1 101 ? -0.941  -112.670 -36.558 1.00 7.81  ? 100 GLY B C   1 
ATOM   1590 O  O   . GLY B 1 101 ? -1.343  -111.552 -36.907 1.00 8.85  ? 100 GLY B O   1 
ATOM   1591 N  N   . GLY B 1 102 ? 0.346   -113.024 -36.538 1.00 7.76  ? 101 GLY B N   1 
ATOM   1592 C  CA  . GLY B 1 102 ? 1.428   -112.176 -37.025 1.00 7.45  ? 101 GLY B CA  1 
ATOM   1593 C  C   . GLY B 1 102 ? 2.013   -111.299 -35.942 1.00 7.67  ? 101 GLY B C   1 
ATOM   1594 O  O   . GLY B 1 102 ? 1.366   -111.031 -34.914 1.00 7.53  ? 101 GLY B O   1 
ATOM   1595 N  N   . THR B 1 103 ? 3.245   -110.835 -36.180 1.00 7.87  ? 102 THR B N   1 
ATOM   1596 C  CA  . THR B 1 103 ? 3.921   -109.992 -35.209 1.00 8.74  ? 102 THR B CA  1 
ATOM   1597 C  C   . THR B 1 103 ? 4.641   -108.873 -35.925 1.00 8.53  ? 102 THR B C   1 
ATOM   1598 O  O   . THR B 1 103 ? 5.430   -109.138 -36.837 1.00 9.05  ? 102 THR B O   1 
ATOM   1599 C  CB  . THR B 1 103 ? 4.941   -110.820 -34.433 1.00 8.10  ? 102 THR B CB  1 
ATOM   1600 O  OG1 . THR B 1 103 ? 4.291   -111.934 -33.802 1.00 9.89  ? 102 THR B OG1 1 
ATOM   1601 C  CG2 . THR B 1 103 ? 5.520   -110.025 -33.281 1.00 9.57  ? 102 THR B CG2 1 
ATOM   1602 N  N   . ARG B 1 104 ? 4.373   -107.631 -35.533 1.00 8.58  ? 103 ARG B N   1 
ATOM   1603 C  CA  . ARG B 1 104 ? 5.123   -106.508 -36.082 1.00 8.73  ? 103 ARG B CA  1 
ATOM   1604 C  C   . ARG B 1 104 ? 6.388   -106.289 -35.297 1.00 8.88  ? 103 ARG B C   1 
ATOM   1605 O  O   . ARG B 1 104 ? 6.366   -105.955 -34.107 1.00 8.89  ? 103 ARG B O   1 
ATOM   1606 C  CB  . ARG B 1 104 ? 4.301   -105.209 -36.142 1.00 8.19  ? 103 ARG B CB  1 
ATOM   1607 C  CG  . ARG B 1 104 ? 4.869   -104.161 -37.099 1.00 9.99  ? 103 ARG B CG  1 
ATOM   1608 C  CD  . ARG B 1 104 ? 3.813   -103.226 -37.700 1.00 12.14 ? 103 ARG B CD  1 
ATOM   1609 N  NE  . ARG B 1 104 ? 4.374   -102.288 -38.672 1.00 16.10 ? 103 ARG B NE  1 
ATOM   1610 C  CZ  . ARG B 1 104 ? 4.528   -102.536 -39.973 1.00 16.42 ? 103 ARG B CZ  1 
ATOM   1611 N  NH1 . ARG B 1 104 ? 4.175   -103.712 -40.485 1.00 17.25 ? 103 ARG B NH1 1 
ATOM   1612 N  NH2 . ARG B 1 104 ? 5.048   -101.609 -40.762 1.00 15.50 ? 103 ARG B NH2 1 
ATOM   1613 N  N   . LEU B 1 105 ? 7.498   -106.489 -35.988 1.00 9.21  ? 104 LEU B N   1 
ATOM   1614 C  CA  . LEU B 1 105 ? 8.778   -106.096 -35.461 1.00 9.57  ? 104 LEU B CA  1 
ATOM   1615 C  C   . LEU B 1 105 ? 9.037   -104.650 -35.868 1.00 9.72  ? 104 LEU B C   1 
ATOM   1616 O  O   . LEU B 1 105 ? 9.103   -104.329 -37.056 1.00 9.40  ? 104 LEU B O   1 
ATOM   1617 C  CB  . LEU B 1 105 ? 9.862   -107.038 -35.983 1.00 9.58  ? 104 LEU B CB  1 
ATOM   1618 C  CG  . LEU B 1 105 ? 11.310  -106.752 -35.599 1.00 10.06 ? 104 LEU B CG  1 
ATOM   1619 C  CD1 . LEU B 1 105 ? 11.510  -106.847 -34.093 1.00 9.63  ? 104 LEU B CD1 1 
ATOM   1620 C  CD2 . LEU B 1 105 ? 12.190  -107.726 -36.326 1.00 9.54  ? 104 LEU B CD2 1 
ATOM   1621 N  N   . THR B 1 106 ? 9.147   -103.775 -34.875 1.00 10.20 ? 105 THR B N   1 
ATOM   1622 C  CA  . THR B 1 106 ? 9.577   -102.407 -35.127 1.00 10.91 ? 105 THR B CA  1 
ATOM   1623 C  C   . THR B 1 106 ? 11.015  -102.271 -34.660 1.00 11.24 ? 105 THR B C   1 
ATOM   1624 O  O   . THR B 1 106 ? 11.391  -102.762 -33.593 1.00 11.00 ? 105 THR B O   1 
ATOM   1625 C  CB  . THR B 1 106 ? 8.656   -101.370 -34.429 1.00 10.79 ? 105 THR B CB  1 
ATOM   1626 O  OG1 . THR B 1 106 ? 7.286   -101.673 -34.712 1.00 11.40 ? 105 THR B OG1 1 
ATOM   1627 C  CG2 . THR B 1 106 ? 8.828   -99.988  -35.052 1.00 10.92 ? 105 THR B CG2 1 
ATOM   1628 N  N   . VAL B 1 107 ? 11.820  -101.616 -35.482 1.00 11.88 ? 106 VAL B N   1 
ATOM   1629 C  CA  . VAL B 1 107 ? 13.213  -101.380 -35.150 1.00 12.58 ? 106 VAL B CA  1 
ATOM   1630 C  C   . VAL B 1 107 ? 13.363  -99.937  -34.671 1.00 12.78 ? 106 VAL B C   1 
ATOM   1631 O  O   . VAL B 1 107 ? 13.119  -98.987  -35.416 1.00 12.99 ? 106 VAL B O   1 
ATOM   1632 C  CB  . VAL B 1 107 ? 14.150  -101.718 -36.334 1.00 12.41 ? 106 VAL B CB  1 
ATOM   1633 C  CG1 . VAL B 1 107 ? 15.566  -101.917 -35.837 1.00 12.59 ? 106 VAL B CG1 1 
ATOM   1634 C  CG2 . VAL B 1 107 ? 13.677  -102.995 -37.036 1.00 13.17 ? 106 VAL B CG2 1 
ATOM   1635 N  N   . LEU B 1 108 ? 13.752  -99.796  -33.406 1.00 13.15 ? 107 LEU B N   1 
ATOM   1636 C  CA  . LEU B 1 108 ? 13.732  -98.515  -32.700 1.00 13.13 ? 107 LEU B CA  1 
ATOM   1637 C  C   . LEU B 1 108 ? 14.896  -97.592  -33.051 1.00 13.32 ? 107 LEU B C   1 
ATOM   1638 O  O   . LEU B 1 108 ? 15.812  -97.983  -33.769 1.00 13.54 ? 107 LEU B O   1 
ATOM   1639 C  CB  . LEU B 1 108 ? 13.710  -98.768  -31.189 1.00 13.08 ? 107 LEU B CB  1 
ATOM   1640 C  CG  . LEU B 1 108 ? 12.338  -98.803  -30.507 1.00 13.42 ? 107 LEU B CG  1 
ATOM   1641 C  CD1 . LEU B 1 108 ? 11.509  -99.994  -30.976 1.00 12.57 ? 107 LEU B CD1 1 
ATOM   1642 C  CD2 . LEU B 1 108 ? 12.495  -98.820  -28.992 1.00 13.55 ? 107 LEU B CD2 1 
ATOM   1643 N  N   . GLY B 1 109 ? 14.842  -96.360  -32.543 1.00 13.51 ? 108 GLY B N   1 
ATOM   1644 C  CA  . GLY B 1 109 ? 15.920  -95.399  -32.710 1.00 13.64 ? 108 GLY B CA  1 
ATOM   1645 C  C   . GLY B 1 109 ? 15.809  -94.544  -33.959 1.00 13.76 ? 108 GLY B C   1 
ATOM   1646 O  O   . GLY B 1 109 ? 16.239  -93.392  -33.984 1.00 13.60 ? 108 GLY B O   1 
ATOM   1647 O  OXT . GLY B 1 109 ? 15.297  -94.970  -34.997 1.00 14.01 ? 108 GLY B OXT 1 
HETATM 1648 CD CD  . CD  C 2 .   ? 0.670   -107.745 -64.615 1.00 29.85 ? 901 CD  A CD  1 
HETATM 1649 CD CD  . CD  D 2 .   ? 13.019  -130.514 -47.301 1.00 31.40 ? 902 CD  B CD  1 
HETATM 1650 CD CD  . CD  E 2 .   ? 23.772  -119.546 -44.763 1.00 32.23 ? 903 CD  B CD  1 
HETATM 1651 CD CD  . CD  F 2 .   ? -0.268  -106.635 -40.443 1.00 29.13 ? 904 CD  B CD  1 
HETATM 1652 O  O   . HOH G 3 .   ? -0.012  -104.644 -53.302 1.00 14.70 ? 902 HOH A O   1 
HETATM 1653 O  O   . HOH G 3 .   ? 0.312   -110.131 -64.892 1.00 17.56 ? 903 HOH A O   1 
HETATM 1654 O  O   . HOH G 3 .   ? -1.735  -106.855 -64.211 1.00 19.11 ? 904 HOH A O   1 
HETATM 1655 O  O   . HOH G 3 .   ? -0.195  -106.505 -67.061 1.00 29.26 ? 905 HOH A O   1 
HETATM 1656 O  O   . HOH G 3 .   ? 13.409  -93.376  -57.283 1.00 20.21 ? 906 HOH A O   1 
HETATM 1657 O  O   . HOH G 3 .   ? 4.556   -108.883 -66.679 1.00 23.75 ? 907 HOH A O   1 
HETATM 1658 O  O   . HOH G 3 .   ? 16.950  -91.766  -62.567 1.00 18.22 ? 908 HOH A O   1 
HETATM 1659 O  O   . HOH G 3 .   ? 16.988  -98.098  -58.692 1.00 16.44 ? 909 HOH A O   1 
HETATM 1660 O  O   . HOH G 3 .   ? -2.428  -102.060 -60.207 1.00 25.20 ? 910 HOH A O   1 
HETATM 1661 O  O   . HOH G 3 .   ? 20.167  -93.117  -55.571 1.00 29.33 ? 911 HOH A O   1 
HETATM 1662 O  O   . HOH G 3 .   ? 10.505  -89.299  -60.643 1.00 23.55 ? 912 HOH A O   1 
HETATM 1663 O  O   . HOH G 3 .   ? 24.670  -94.576  -61.489 1.00 25.54 ? 913 HOH A O   1 
HETATM 1664 O  O   . HOH G 3 .   ? 6.946   -109.544 -49.385 1.00 29.82 ? 914 HOH A O   1 
HETATM 1665 O  O   . HOH G 3 .   ? 8.522   -109.329 -55.657 1.00 23.63 ? 915 HOH A O   1 
HETATM 1666 O  O   . HOH G 3 .   ? 9.705   -103.674 -51.435 1.00 24.78 ? 916 HOH A O   1 
HETATM 1667 O  O   . HOH G 3 .   ? 3.965   -96.802  -71.434 1.00 36.97 ? 917 HOH A O   1 
HETATM 1668 O  O   . HOH G 3 .   ? 14.579  -97.524  -52.359 1.00 27.53 ? 918 HOH A O   1 
HETATM 1669 O  O   . HOH G 3 .   ? 3.509   -85.788  -59.441 1.00 29.33 ? 919 HOH A O   1 
HETATM 1670 O  O   . HOH G 3 .   ? 23.263  -100.497 -56.539 1.00 29.01 ? 920 HOH A O   1 
HETATM 1671 O  O   . HOH G 3 .   ? 14.577  -98.696  -73.446 1.00 29.60 ? 921 HOH A O   1 
HETATM 1672 O  O   . HOH G 3 .   ? 5.573   -95.128  -70.352 1.00 30.54 ? 922 HOH A O   1 
HETATM 1673 O  O   . HOH G 3 .   ? 21.450  -105.114 -55.667 1.00 23.21 ? 923 HOH A O   1 
HETATM 1674 O  O   . HOH G 3 .   ? 24.430  -93.935  -68.879 1.00 23.83 ? 924 HOH A O   1 
HETATM 1675 O  O   . HOH G 3 .   ? 12.128  -87.758  -62.480 1.00 29.14 ? 925 HOH A O   1 
HETATM 1676 O  O   . HOH G 3 .   ? 3.758   -101.348 -70.927 1.00 42.56 ? 926 HOH A O   1 
HETATM 1677 O  O   . HOH G 3 .   ? 26.626  -104.891 -61.131 1.00 31.78 ? 927 HOH A O   1 
HETATM 1678 O  O   . HOH G 3 .   ? 11.663  -86.374  -70.754 1.00 28.69 ? 928 HOH A O   1 
HETATM 1679 O  O   . HOH G 3 .   ? 14.923  -114.349 -60.070 1.00 30.00 ? 929 HOH A O   1 
HETATM 1680 O  O   . HOH G 3 .   ? 1.503   -110.288 -53.569 1.00 35.14 ? 930 HOH A O   1 
HETATM 1681 O  O   . HOH G 3 .   ? 3.616   -108.976 -72.365 1.00 25.72 ? 931 HOH A O   1 
HETATM 1682 O  O   . HOH G 3 .   ? 19.631  -91.937  -58.036 1.00 26.51 ? 932 HOH A O   1 
HETATM 1683 O  O   . HOH G 3 .   ? 16.726  -96.953  -75.822 1.00 37.04 ? 933 HOH A O   1 
HETATM 1684 O  O   . HOH G 3 .   ? 8.214   -96.644  -72.532 1.00 38.51 ? 934 HOH A O   1 
HETATM 1685 O  O   . HOH G 3 .   ? 16.639  -105.096 -47.581 1.00 44.45 ? 935 HOH A O   1 
HETATM 1686 O  O   . HOH G 3 .   ? 8.218   -86.179  -57.751 1.00 44.56 ? 936 HOH A O   1 
HETATM 1687 O  O   . HOH G 3 .   ? 10.735  -96.876  -50.972 1.00 40.81 ? 937 HOH A O   1 
HETATM 1688 O  O   . HOH G 3 .   ? 1.777   -105.768 -68.738 1.00 29.67 ? 938 HOH A O   1 
HETATM 1689 O  O   . HOH G 3 .   ? 5.633   -108.742 -56.759 1.00 33.52 ? 939 HOH A O   1 
HETATM 1690 O  O   . HOH G 3 .   ? 28.060  -95.802  -61.563 1.00 35.61 ? 940 HOH A O   1 
HETATM 1691 O  O   . HOH G 3 .   ? 15.878  -90.617  -71.634 1.00 31.90 ? 941 HOH A O   1 
HETATM 1692 O  O   . HOH G 3 .   ? 13.405  -112.044 -56.363 1.00 28.35 ? 942 HOH A O   1 
HETATM 1693 O  O   . HOH G 3 .   ? 7.660   -105.430 -50.970 1.00 34.63 ? 943 HOH A O   1 
HETATM 1694 O  O   . HOH G 3 .   ? 14.819  -102.096 -73.522 1.00 36.29 ? 944 HOH A O   1 
HETATM 1695 O  O   . HOH G 3 .   ? -5.959  -96.604  -66.653 1.00 35.32 ? 945 HOH A O   1 
HETATM 1696 O  O   . HOH G 3 .   ? 8.630   -99.918  -49.303 1.00 33.79 ? 946 HOH A O   1 
HETATM 1697 O  O   . HOH G 3 .   ? 6.700   -86.234  -68.607 1.00 33.82 ? 947 HOH A O   1 
HETATM 1698 O  O   . HOH G 3 .   ? 24.701  -92.144  -59.516 1.00 30.46 ? 948 HOH A O   1 
HETATM 1699 O  O   . HOH G 3 .   ? 12.796  -101.968 -47.908 1.00 31.09 ? 949 HOH A O   1 
HETATM 1700 O  O   . HOH G 3 .   ? -1.007  -89.450  -72.553 1.00 39.36 ? 950 HOH A O   1 
HETATM 1701 O  O   . HOH H 3 .   ? 10.086  -122.632 -36.250 1.00 20.55 ? 905 HOH B O   1 
HETATM 1702 O  O   . HOH H 3 .   ? 17.047  -121.691 -38.584 1.00 21.73 ? 906 HOH B O   1 
HETATM 1703 O  O   . HOH H 3 .   ? 4.014   -106.040 -39.429 1.00 30.06 ? 907 HOH B O   1 
HETATM 1704 O  O   . HOH H 3 .   ? 0.769   -108.482 -34.296 1.00 37.33 ? 908 HOH B O   1 
HETATM 1705 O  O   . HOH H 3 .   ? 9.683   -121.848 -29.556 1.00 22.74 ? 909 HOH B O   1 
HETATM 1706 O  O   . HOH H 3 .   ? 16.582  -130.026 -37.262 1.00 24.29 ? 910 HOH B O   1 
HETATM 1707 O  O   . HOH H 3 .   ? 11.312  -131.617 -47.901 1.00 28.28 ? 911 HOH B O   1 
HETATM 1708 O  O   . HOH H 3 .   ? 14.221  -119.467 -33.038 1.00 22.78 ? 912 HOH B O   1 
HETATM 1709 O  O   . HOH H 3 .   ? 25.358  -118.728 -44.797 1.00 29.43 ? 913 HOH B O   1 
HETATM 1710 O  O   . HOH H 3 .   ? 14.678  -129.583 -39.950 1.00 22.96 ? 914 HOH B O   1 
HETATM 1711 O  O   . HOH H 3 .   ? 1.793   -105.123 -49.068 1.00 31.09 ? 915 HOH B O   1 
HETATM 1712 O  O   . HOH H 3 .   ? 21.275  -120.134 -44.946 1.00 28.82 ? 916 HOH B O   1 
HETATM 1713 O  O   . HOH H 3 .   ? 4.860   -109.886 -48.847 1.00 41.67 ? 917 HOH B O   1 
HETATM 1714 O  O   . HOH H 3 .   ? 15.193  -130.459 -46.743 1.00 21.33 ? 918 HOH B O   1 
HETATM 1715 O  O   . HOH H 3 .   ? -1.286  -114.433 -32.828 1.00 29.29 ? 919 HOH B O   1 
HETATM 1716 O  O   . HOH H 3 .   ? 2.879   -107.137 -37.622 1.00 42.16 ? 920 HOH B O   1 
HETATM 1717 O  O   . HOH H 3 .   ? -0.489  -111.670 -33.079 1.00 31.67 ? 921 HOH B O   1 
HETATM 1718 O  O   . HOH H 3 .   ? 3.660   -107.047 -47.915 1.00 31.71 ? 922 HOH B O   1 
HETATM 1719 O  O   . HOH H 3 .   ? -4.034  -119.093 -30.681 1.00 37.62 ? 923 HOH B O   1 
HETATM 1720 O  O   . HOH H 3 .   ? 5.351   -131.467 -29.917 1.00 32.96 ? 924 HOH B O   1 
HETATM 1721 O  O   . HOH H 3 .   ? 19.695  -102.441 -44.218 1.00 40.98 ? 925 HOH B O   1 
HETATM 1722 O  O   . HOH H 3 .   ? -2.056  -133.040 -46.659 1.00 42.67 ? 926 HOH B O   1 
HETATM 1723 O  O   . HOH H 3 .   ? 21.518  -117.973 -49.769 1.00 35.72 ? 927 HOH B O   1 
HETATM 1724 O  O   . HOH H 3 .   ? 5.766   -106.269 -48.870 1.00 39.04 ? 928 HOH B O   1 
HETATM 1725 O  O   . HOH H 3 .   ? 6.599   -111.806 -48.572 1.00 38.86 ? 929 HOH B O   1 
HETATM 1726 O  O   . HOH H 3 .   ? -5.700  -121.597 -41.573 1.00 35.29 ? 930 HOH B O   1 
HETATM 1727 O  O   . HOH H 3 .   ? -8.460  -128.758 -45.627 1.00 41.35 ? 931 HOH B O   1 
HETATM 1728 O  O   . HOH H 3 .   ? 7.122   -126.625 -45.682 1.00 31.50 ? 932 HOH B O   1 
HETATM 1729 O  O   . HOH H 3 .   ? -1.081  -132.462 -36.483 1.00 36.60 ? 933 HOH B O   1 
HETATM 1730 O  O   . HOH H 3 .   ? 2.250   -107.979 -45.330 1.00 28.54 ? 934 HOH B O   1 
HETATM 1731 O  O   . HOH H 3 .   ? 16.455  -127.792 -46.831 1.00 24.24 ? 935 HOH B O   1 
HETATM 1732 O  O   . HOH H 3 .   ? 11.713  -117.693 -50.051 1.00 30.17 ? 936 HOH B O   1 
HETATM 1733 O  O   . HOH H 3 .   ? 4.584   -130.031 -27.042 1.00 32.45 ? 937 HOH B O   1 
HETATM 1734 O  O   . HOH H 3 .   ? 23.005  -118.129 -46.361 1.00 28.07 ? 938 HOH B O   1 
HETATM 1735 O  O   . HOH H 3 .   ? -4.107  -118.921 -35.428 1.00 30.23 ? 939 HOH B O   1 
HETATM 1736 O  O   . HOH H 3 .   ? 2.964   -127.953 -35.746 1.00 28.24 ? 940 HOH B O   1 
HETATM 1737 O  O   . HOH H 3 .   ? 24.201  -120.688 -46.674 1.00 29.49 ? 941 HOH B O   1 
HETATM 1738 O  O   . HOH H 3 .   ? 18.880  -115.897 -35.013 1.00 31.36 ? 942 HOH B O   1 
HETATM 1739 O  O   . HOH H 3 .   ? 6.048   -122.030 -47.944 1.00 41.44 ? 943 HOH B O   1 
HETATM 1740 O  O   . HOH H 3 .   ? 8.629   -118.685 -50.696 1.00 33.39 ? 944 HOH B O   1 
HETATM 1741 O  O   . HOH H 3 .   ? 19.212  -101.899 -41.677 1.00 42.15 ? 945 HOH B O   1 
HETATM 1742 O  O   . HOH H 3 .   ? 9.072   -98.352  -40.997 1.00 44.65 ? 946 HOH B O   1 
HETATM 1743 O  O   . HOH H 3 .   ? -4.697  -116.066 -36.245 1.00 36.53 ? 947 HOH B O   1 
HETATM 1744 O  O   . HOH H 3 .   ? 5.566   -116.726 -52.322 1.00 29.47 ? 948 HOH B O   1 
HETATM 1745 O  O   . HOH H 3 .   ? -5.438  -112.874 -37.796 1.00 37.37 ? 949 HOH B O   1 
HETATM 1746 O  O   . HOH H 3 .   ? 13.735  -132.006 -48.950 1.00 35.90 ? 950 HOH B O   1 
HETATM 1747 O  O   . HOH H 3 .   ? 7.467   -129.108 -36.034 1.00 29.32 ? 951 HOH B O   1 
HETATM 1748 O  O   . HOH H 3 .   ? 18.168  -98.134  -41.845 1.00 43.45 ? 952 HOH B O   1 
HETATM 1749 O  O   . HOH H 3 .   ? 20.005  -100.042 -32.015 1.00 44.72 ? 953 HOH B O   1 
HETATM 1750 O  O   . HOH H 3 .   ? 11.693  -123.494 -23.051 1.00 31.48 ? 954 HOH B O   1 
HETATM 1751 O  O   . HOH H 3 .   ? 23.582  -114.394 -44.508 1.00 31.78 ? 955 HOH B O   1 
HETATM 1752 O  O   . HOH H 3 .   ? 13.291  -100.805 -44.077 1.00 39.51 ? 956 HOH B O   1 
HETATM 1753 O  O   . HOH H 3 .   ? -2.106  -120.900 -29.760 1.00 37.90 ? 957 HOH B O   1 
HETATM 1754 O  O   . HOH H 3 .   ? 11.789  -110.613 -28.586 1.00 37.80 ? 958 HOH B O   1 
HETATM 1755 O  O   . HOH H 3 .   ? -8.016  -131.507 -35.077 1.00 44.59 ? 959 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   1   1   ASN ASN A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  VAL 10  11  11  VAL VAL A . n 
A 1 11  SER 11  12  12  SER SER A . n 
A 1 12  GLU 12  13  13  GLU GLU A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  LYS 16  17  17  LYS LYS A . n 
A 1 17  THR 17  18  18  THR THR A . n 
A 1 18  VAL 18  19  19  VAL VAL A . n 
A 1 19  THR 19  20  20  THR THR A . n 
A 1 20  ILE 20  21  21  ILE ILE A . n 
A 1 21  SER 21  22  22  SER SER A . n 
A 1 22  CYS 22  23  23  CYS CYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  ARG 24  25  25  ARG ARG A . n 
A 1 25  SER 25  26  26  SER SER A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  GLY 27  27  27  GLY GLY A A n 
A 1 28  ASN 28  27  27  ASN ASN A B n 
A 1 29  ILE 29  28  28  ILE ILE A . n 
A 1 30  ALA 30  29  29  ALA ALA A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  VAL 34  33  33  VAL VAL A . n 
A 1 35  GLN 35  34  34  GLN GLN A . n 
A 1 36  TRP 36  35  35  TRP TRP A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  GLN 39  38  38  GLN GLN A . n 
A 1 40  ARG 40  41  ?   ?   ?   A . n 
A 1 41  SER 41  42  42  SER SER A . n 
A 1 42  ALA 42  43  43  ALA ALA A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ILE 44  45  45  ILE ILE A . n 
A 1 45  THR 45  46  46  THR THR A . n 
A 1 46  VAL 46  47  47  VAL VAL A . n 
A 1 47  ILE 47  48  48  ILE ILE A . n 
A 1 48  TYR 48  49  49  TYR TYR A . n 
A 1 49  GLU 49  50  50  GLU GLU A . n 
A 1 50  ASP 50  51  51  ASP ASP A . n 
A 1 51  ASN 51  52  52  ASN ASN A . n 
A 1 52  GLN 52  53  53  GLN GLN A . n 
A 1 53  ARG 53  54  54  ARG ARG A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  SER 55  56  56  SER SER A . n 
A 1 56  GLY 56  57  57  GLY GLY A . n 
A 1 57  VAL 57  58  58  VAL VAL A . n 
A 1 58  PRO 58  59  59  PRO PRO A . n 
A 1 59  ASP 59  60  60  ASP ASP A . n 
A 1 60  ARG 60  61  61  ARG ARG A . n 
A 1 61  PHE 61  62  62  PHE PHE A . n 
A 1 62  ALA 62  63  63  ALA ALA A . n 
A 1 63  GLY 63  64  64  GLY GLY A . n 
A 1 64  SER 64  65  65  SER SER A . n 
A 1 65  ILE 65  66  66  ILE ILE A . n 
A 1 66  ASP 66  66  66  ASP ASP A A n 
A 1 67  ARG 67  66  66  ARG ARG A B n 
A 1 68  SER 68  67  67  SER SER A . n 
A 1 69  SER 69  68  68  SER SER A . n 
A 1 70  ASN 70  69  69  ASN ASN A . n 
A 1 71  SER 71  70  70  SER SER A . n 
A 1 72  ALA 72  71  71  ALA ALA A . n 
A 1 73  SER 73  72  72  SER SER A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  THR 75  74  74  THR THR A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  SER 77  76  76  SER SER A . n 
A 1 78  GLY 78  77  77  GLY GLY A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  THR 81  80  80  THR THR A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  ASP 83  82  82  ASP ASP A . n 
A 1 84  GLU 84  83  83  GLU GLU A . n 
A 1 85  ALA 85  84  84  ALA ALA A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  TYR 87  86  86  TYR TYR A . n 
A 1 88  TYR 88  87  87  TYR TYR A . n 
A 1 89  CYS 89  88  88  CYS CYS A . n 
A 1 90  GLN 90  89  89  GLN GLN A . n 
A 1 91  SER 91  90  90  SER SER A . n 
A 1 92  TYR 92  91  91  TYR TYR A . n 
A 1 93  ASP 93  92  92  ASP ASP A . n 
A 1 94  ALA 94  93  93  ALA ALA A . n 
A 1 95  ARG 95  94  94  ARG ARG A . n 
A 1 96  ASN 96  95  95  ASN ASN A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  PHE 99  98  98  PHE PHE A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 GLY 101 100 100 GLY GLY A . n 
A 1 102 GLY 102 101 101 GLY GLY A . n 
A 1 103 THR 103 102 102 THR THR A . n 
A 1 104 ARG 104 103 103 ARG ARG A . n 
A 1 105 LEU 105 104 104 LEU LEU A . n 
A 1 106 THR 106 105 105 THR THR A . n 
A 1 107 VAL 107 106 106 VAL VAL A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 GLY 109 108 108 GLY GLY A . n 
B 1 1   ASN 1   1   1   ASN ASN B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   MET 3   3   3   MET MET B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   ASN 5   5   5   ASN ASN B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   HIS 8   8   8   HIS HIS B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  VAL 10  11  11  VAL VAL B . n 
B 1 11  SER 11  12  12  SER SER B . n 
B 1 12  GLU 12  13  13  GLU GLU B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  LYS 16  17  17  LYS LYS B . n 
B 1 17  THR 17  18  18  THR THR B . n 
B 1 18  VAL 18  19  19  VAL VAL B . n 
B 1 19  THR 19  20  20  THR THR B . n 
B 1 20  ILE 20  21  21  ILE ILE B . n 
B 1 21  SER 21  22  22  SER SER B . n 
B 1 22  CYS 22  23  23  CYS CYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  ARG 24  25  25  ARG ARG B . n 
B 1 25  SER 25  26  26  SER SER B . n 
B 1 26  SER 26  27  27  SER SER B . n 
B 1 27  GLY 27  27  27  GLY GLY B A n 
B 1 28  ASN 28  27  27  ASN ASN B B n 
B 1 29  ILE 29  28  28  ILE ILE B . n 
B 1 30  ALA 30  29  29  ALA ALA B . n 
B 1 31  SER 31  30  30  SER SER B . n 
B 1 32  ASN 32  31  31  ASN ASN B . n 
B 1 33  TYR 33  32  32  TYR TYR B . n 
B 1 34  VAL 34  33  33  VAL VAL B . n 
B 1 35  GLN 35  34  34  GLN GLN B . n 
B 1 36  TRP 36  35  35  TRP TRP B . n 
B 1 37  TYR 37  36  36  TYR TYR B . n 
B 1 38  GLN 38  37  37  GLN GLN B . n 
B 1 39  GLN 39  38  38  GLN GLN B . n 
B 1 40  ARG 40  41  ?   ?   ?   B . n 
B 1 41  SER 41  42  42  SER SER B . n 
B 1 42  ALA 42  43  43  ALA ALA B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ILE 44  45  45  ILE ILE B . n 
B 1 45  THR 45  46  46  THR THR B . n 
B 1 46  VAL 46  47  47  VAL VAL B . n 
B 1 47  ILE 47  48  48  ILE ILE B . n 
B 1 48  TYR 48  49  49  TYR TYR B . n 
B 1 49  GLU 49  50  50  GLU GLU B . n 
B 1 50  ASP 50  51  51  ASP ASP B . n 
B 1 51  ASN 51  52  52  ASN ASN B . n 
B 1 52  GLN 52  53  53  GLN GLN B . n 
B 1 53  ARG 53  54  54  ARG ARG B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  SER 55  56  56  SER SER B . n 
B 1 56  GLY 56  57  57  GLY GLY B . n 
B 1 57  VAL 57  58  58  VAL VAL B . n 
B 1 58  PRO 58  59  59  PRO PRO B . n 
B 1 59  ASP 59  60  60  ASP ASP B . n 
B 1 60  ARG 60  61  61  ARG ARG B . n 
B 1 61  PHE 61  62  62  PHE PHE B . n 
B 1 62  ALA 62  63  63  ALA ALA B . n 
B 1 63  GLY 63  64  64  GLY GLY B . n 
B 1 64  SER 64  65  65  SER SER B . n 
B 1 65  ILE 65  66  66  ILE ILE B . n 
B 1 66  ASP 66  66  66  ASP ASP B A n 
B 1 67  ARG 67  66  66  ARG ARG B B n 
B 1 68  SER 68  67  67  SER SER B . n 
B 1 69  SER 69  68  68  SER SER B . n 
B 1 70  ASN 70  69  69  ASN ASN B . n 
B 1 71  SER 71  70  70  SER SER B . n 
B 1 72  ALA 72  71  71  ALA ALA B . n 
B 1 73  SER 73  72  72  SER SER B . n 
B 1 74  LEU 74  73  73  LEU LEU B . n 
B 1 75  THR 75  74  74  THR THR B . n 
B 1 76  ILE 76  75  75  ILE ILE B . n 
B 1 77  SER 77  76  76  SER SER B . n 
B 1 78  GLY 78  77  77  GLY GLY B . n 
B 1 79  LEU 79  78  78  LEU LEU B . n 
B 1 80  LYS 80  79  79  LYS LYS B . n 
B 1 81  THR 81  80  80  THR THR B . n 
B 1 82  GLU 82  81  81  GLU GLU B . n 
B 1 83  ASP 83  82  82  ASP ASP B . n 
B 1 84  GLU 84  83  83  GLU GLU B . n 
B 1 85  ALA 85  84  84  ALA ALA B . n 
B 1 86  ASP 86  85  85  ASP ASP B . n 
B 1 87  TYR 87  86  86  TYR TYR B . n 
B 1 88  TYR 88  87  87  TYR TYR B . n 
B 1 89  CYS 89  88  88  CYS CYS B . n 
B 1 90  GLN 90  89  89  GLN GLN B . n 
B 1 91  SER 91  90  90  SER SER B . n 
B 1 92  TYR 92  91  91  TYR TYR B . n 
B 1 93  ASP 93  92  92  ASP ASP B . n 
B 1 94  ALA 94  93  93  ALA ALA B . n 
B 1 95  ARG 95  94  94  ARG ARG B . n 
B 1 96  ASN 96  95  95  ASN ASN B . n 
B 1 97  VAL 97  96  96  VAL VAL B . n 
B 1 98  VAL 98  97  97  VAL VAL B . n 
B 1 99  PHE 99  98  98  PHE PHE B . n 
B 1 100 GLY 100 99  99  GLY GLY B . n 
B 1 101 GLY 101 100 100 GLY GLY B . n 
B 1 102 GLY 102 101 101 GLY GLY B . n 
B 1 103 THR 103 102 102 THR THR B . n 
B 1 104 ARG 104 103 103 ARG ARG B . n 
B 1 105 LEU 105 104 104 LEU LEU B . n 
B 1 106 THR 106 105 105 THR THR B . n 
B 1 107 VAL 107 106 106 VAL VAL B . n 
B 1 108 LEU 108 107 107 LEU LEU B . n 
B 1 109 GLY 109 108 108 GLY GLY B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        dimeric    2 
2 software_defined_assembly PISA,PQS tetrameric 4 
3 software_defined_assembly PISA     tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
3 1,3 B,D,E,F,H       
3 4,2 A,C,G           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 5200  ? 
2 MORE         -72   ? 
2 'SSA (A^2)'  19390 ? 
3 'ABSA (A^2)' 3780  ? 
3 MORE         -59   ? 
3 'SSA (A^2)'  20810 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_554 -x,y,-z-1     -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 -1.0000000000 -92.2980000000 
3 'crystal symmetry operation' 6_524 x,-y-3,-z-1/2 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 -220.7310000000 0.0000000000 0.0000000000 -1.0000000000 -46.1490000000 
4 'crystal symmetry operation' 2_525 -x,-y-3,z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 -220.7310000000 0.0000000000 0.0000000000 1.0000000000  46.1490000000  
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 OD2 ? A ASP 86 ? A ASP 85  ? 1_555 54.0  ? 
2  OD1 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 102.9 ? 
3  OD2 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 155.8 ? 
4  OD1 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 151.3 ? 
5  OD2 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 101.6 ? 
6  O   ? G HOH .  ? A HOH 903 ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 102.6 ? 
7  OD1 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 905 ? 1_555 87.4  ? 
8  OD2 ? A ASP 86 ? A ASP 85  ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 905 ? 1_555 81.8  ? 
9  O   ? G HOH .  ? A HOH 903 ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 905 ? 1_555 106.4 ? 
10 O   ? G HOH .  ? A HOH 904 ? 1_555 CD ? C CD . ? A CD 901 ? 1_555 O   ? G HOH .  ? A HOH 905 ? 1_555 72.9  ? 
11 OE1 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OE2 ? B GLU 49 ? B GLU 50  ? 1_555 54.1  ? 
12 OE1 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 911 ? 1_555 117.7 ? 
13 OE2 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 911 ? 1_555 66.9  ? 
14 OE1 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 918 ? 1_555 81.3  ? 
15 OE2 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 918 ? 1_555 135.3 ? 
16 O   ? H HOH .  ? B HOH 911 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 918 ? 1_555 149.7 ? 
17 OE1 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 950 ? 1_555 163.9 ? 
18 OE2 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 950 ? 1_555 139.8 ? 
19 O   ? H HOH .  ? B HOH 911 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 950 ? 1_555 73.4  ? 
20 O   ? H HOH .  ? B HOH 918 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 O   ? H HOH .  ? B HOH 950 ? 1_555 83.9  ? 
21 OE1 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OD1 ? A ASP 59 ? A ASP 60  ? 3_435 92.0  ? 
22 OE2 ? B GLU 49 ? B GLU 50  ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OD1 ? A ASP 59 ? A ASP 60  ? 3_435 99.4  ? 
23 O   ? H HOH .  ? B HOH 911 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OD1 ? A ASP 59 ? A ASP 60  ? 3_435 78.9  ? 
24 O   ? H HOH .  ? B HOH 918 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OD1 ? A ASP 59 ? A ASP 60  ? 3_435 77.0  ? 
25 O   ? H HOH .  ? B HOH 950 ? 1_555 CD ? D CD . ? B CD 902 ? 1_555 OD1 ? A ASP 59 ? A ASP 60  ? 3_435 78.4  ? 
26 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 938 ? 1_555 90.0  ? 
27 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 941 ? 1_555 92.7  ? 
28 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 941 ? 1_555 77.6  ? 
29 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 92.4  ? 
30 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 87.6  ? 
31 O   ? H HOH .  ? B HOH 941 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 164.3 ? 
32 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 48.4  ? 
33 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 96.4  ? 
34 O   ? H HOH .  ? B HOH 941 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 140.9 ? 
35 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 45.1  ? 
36 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 916 ? 1_555 165.1 ? 
37 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 916 ? 1_555 76.4  ? 
38 O   ? H HOH .  ? B HOH 941 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 916 ? 1_555 90.5  ? 
39 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 916 ? 1_555 80.9  ? 
40 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 O   ? H HOH .  ? B HOH 916 ? 1_555 126.1 ? 
41 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 62.9  ? 
42 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 148.7 ? 
43 O   ? H HOH .  ? B HOH 941 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 87.6  ? 
44 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 107.9 ? 
45 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 77.9  ? 
46 O   ? H HOH .  ? B HOH 916 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 131.8 ? 
47 O   ? H HOH .  ? B HOH 913 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 112.8 ? 
48 O   ? H HOH .  ? B HOH 938 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 156.9 ? 
49 O   ? H HOH .  ? B HOH 941 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 104.1 ? 
50 OD1 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 87.6  ? 
51 OD2 ? B ASP 59 ? B ASP 60  ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 96.1  ? 
52 O   ? H HOH .  ? B HOH 916 ? 1_555 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 80.5  ? 
53 OE2 ? A GLU 49 ? A GLU 50  ? 3_435 CD ? E CD . ? B CD 903 ? 1_555 OE1 ? A GLU 49 ? A GLU 50  ? 3_435 53.6  ? 
54 OD1 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 OD2 ? B ASP 86 ? B ASP 85  ? 1_555 50.4  ? 
55 OD1 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 NE2 ? A HIS 8  ? A HIS 8   ? 5_554 97.6  ? 
56 OD2 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 NE2 ? A HIS 8  ? A HIS 8   ? 5_554 62.3  ? 
57 OD1 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 5_554 124.1 ? 
58 OD2 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 5_554 88.9  ? 
59 NE2 ? A HIS 8  ? A HIS 8   ? 5_554 CD ? F CD . ? B CD 904 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 5_554 92.2  ? 
60 OD1 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 N   ? B SER 41 ? B SER 42  ? 5_554 110.3 ? 
61 OD2 ? B ASP 86 ? B ASP 85  ? 1_555 CD ? F CD . ? B CD 904 ? 1_555 N   ? B SER 41 ? B SER 42  ? 5_554 154.2 ? 
62 NE2 ? A HIS 8  ? A HIS 8   ? 5_554 CD ? F CD . ? B CD 904 ? 1_555 N   ? B SER 41 ? B SER 42  ? 5_554 111.2 ? 
63 O   ? G HOH .  ? A HOH 902 ? 5_554 CD ? F CD . ? B CD 904 ? 1_555 N   ? B SER 41 ? B SER 42  ? 5_554 116.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Refinement description'    
5 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 11.9083 -100.4335 -60.9006 0.1128 0.0011 0.0781 -0.0018 0.0169 0.0085 4.4054 3.3052 3.7139 0.0468  
-0.2215 0.6353  -0.1720 -0.0474 0.2194  -0.2481 -0.2559 0.0979 0.0664 0.1194  0.0404  
'X-RAY DIFFRACTION' 2 ? refined 8.0555  -117.2196 -37.5231 0.2495 0.2627 0.1686 0.1953  0.1179 0.1544 8.3907 2.8506 6.3737 -0.0137 
-4.7509 -0.9283 0.8133  -0.0972 -0.7161 0.8094  0.7787  0.2009 0.2501 -0.9510 -0.8149 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1 A 108 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 1 B 108 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .      ? 1 
SCALEPACK 'data scaling'   .      ? 2 
AMoRE     phasing          .      ? 3 
REFMAC    refinement       5.1.24 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CE1 A HIS 8   ? ? O A HOH 930 ? ? 1.72 
2 1 ND2 B ASN 5   ? ? O B HOH 923 ? ? 1.75 
3 1 CG  B ASN 5   ? ? O B HOH 923 ? ? 1.95 
4 1 O   B HIS 8   ? ? O B HOH 908 ? ? 2.02 
5 1 OD1 B ASN 5   ? ? O B HOH 923 ? ? 2.03 
6 1 ND1 A HIS 8   ? ? O A HOH 930 ? ? 2.13 
7 1 ND2 B ASN 5   ? ? O B HOH 957 ? ? 2.17 
8 1 O   A HOH 914 ? ? O B HOH 917 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OD2 A ASP 60 ? ? 1_555 NH1 B ARG 94  ? ? 7_743 1.97 
2 1 CD2 B HIS 8  ? ? 1_555 CD  A CD  901 ? ? 5_554 2.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C   A HIS 8  ? ? N   A SER 9  ? ? 1.167 1.336 -0.169 0.023 Y 
2 1 CG  B HIS 8  ? ? CD2 B HIS 8  ? ? 1.571 1.354 0.217  0.009 N 
3 1 CG  B HIS 8  ? ? ND1 B HIS 8  ? ? 1.561 1.383 0.178  0.022 N 
4 1 CE1 B HIS 8  ? ? NE2 B HIS 8  ? ? 1.582 1.333 0.249  0.019 N 
5 1 CD  B GLN 37 ? ? NE2 B GLN 37 ? ? 1.497 1.324 0.173  0.025 N 
6 1 C   B GLN 38 ? ? O   B GLN 38 ? ? 1.489 1.229 0.260  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A PRO 7  ? ? C  A PRO 7  ? ? N   A HIS 8  ? ? 111.21 122.70 -11.49 1.60 Y 
2 1 CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 126.66 118.30 8.36   0.90 N 
3 1 CB B ASP 85 ? ? CG B ASP 85 ? ? OD2 B ASP 85 ? ? 124.39 118.30 6.09   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 51 ? ? 77.33   -44.11 
2  1 ASN A 52 ? ? -152.15 11.50  
3  1 LEU A 78 ? ? -35.04  133.02 
4  1 ALA A 84 ? ? 178.24  168.80 
5  1 ASP A 92 ? ? -117.10 68.96  
6  1 ARG A 94 ? ? 121.96  -84.63 
7  1 ASP B 51 ? ? 74.48   -46.20 
8  1 ASN B 52 ? ? -149.36 14.06  
9  1 ALA B 93 ? ? 38.53   70.09  
10 1 ARG B 94 ? ? 112.27  -98.65 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   HIS 
_pdbx_validate_polymer_linkage.auth_seq_id_1    8 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   SER 
_pdbx_validate_polymer_linkage.auth_seq_id_2    9 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.17 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B ILE 66 ? CG1 ? B ILE 65 CG1 
2 1 Y 1 B ILE 66 ? CG2 ? B ILE 65 CG2 
3 1 Y 1 B ILE 66 ? CD1 ? B ILE 65 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ARG 41 ? A ARG 40 
2 1 Y 1 B ARG 41 ? B ARG 40 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CADMIUM ION' CD  
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CD  1  901 901 CD  CD  A . 
D 2 CD  1  902 902 CD  CD  B . 
E 2 CD  1  903 903 CD  CD  B . 
F 2 CD  1  904 904 CD  CD  B . 
G 3 HOH 1  902 2   HOH HOH A . 
G 3 HOH 2  903 3   HOH HOH A . 
G 3 HOH 3  904 4   HOH HOH A . 
G 3 HOH 4  905 5   HOH HOH A . 
G 3 HOH 5  906 7   HOH HOH A . 
G 3 HOH 6  907 9   HOH HOH A . 
G 3 HOH 7  908 13  HOH HOH A . 
G 3 HOH 8  909 14  HOH HOH A . 
G 3 HOH 9  910 17  HOH HOH A . 
G 3 HOH 10 911 18  HOH HOH A . 
G 3 HOH 11 912 19  HOH HOH A . 
G 3 HOH 12 913 21  HOH HOH A . 
G 3 HOH 13 914 25  HOH HOH A . 
G 3 HOH 14 915 28  HOH HOH A . 
G 3 HOH 15 916 29  HOH HOH A . 
G 3 HOH 16 917 30  HOH HOH A . 
G 3 HOH 17 918 33  HOH HOH A . 
G 3 HOH 18 919 36  HOH HOH A . 
G 3 HOH 19 920 37  HOH HOH A . 
G 3 HOH 20 921 38  HOH HOH A . 
G 3 HOH 21 922 39  HOH HOH A . 
G 3 HOH 22 923 40  HOH HOH A . 
G 3 HOH 23 924 41  HOH HOH A . 
G 3 HOH 24 925 45  HOH HOH A . 
G 3 HOH 25 926 47  HOH HOH A . 
G 3 HOH 26 927 48  HOH HOH A . 
G 3 HOH 27 928 52  HOH HOH A . 
G 3 HOH 28 929 58  HOH HOH A . 
G 3 HOH 29 930 59  HOH HOH A . 
G 3 HOH 30 931 60  HOH HOH A . 
G 3 HOH 31 932 68  HOH HOH A . 
G 3 HOH 32 933 69  HOH HOH A . 
G 3 HOH 33 934 70  HOH HOH A . 
G 3 HOH 34 935 71  HOH HOH A . 
G 3 HOH 35 936 74  HOH HOH A . 
G 3 HOH 36 937 75  HOH HOH A . 
G 3 HOH 37 938 77  HOH HOH A . 
G 3 HOH 38 939 78  HOH HOH A . 
G 3 HOH 39 940 81  HOH HOH A . 
G 3 HOH 40 941 83  HOH HOH A . 
G 3 HOH 41 942 89  HOH HOH A . 
G 3 HOH 42 943 90  HOH HOH A . 
G 3 HOH 43 944 93  HOH HOH A . 
G 3 HOH 44 945 95  HOH HOH A . 
G 3 HOH 45 946 97  HOH HOH A . 
G 3 HOH 46 947 99  HOH HOH A . 
G 3 HOH 47 948 100 HOH HOH A . 
G 3 HOH 48 949 102 HOH HOH A . 
G 3 HOH 49 950 104 HOH HOH A . 
H 3 HOH 1  905 8   HOH HOH B . 
H 3 HOH 2  906 10  HOH HOH B . 
H 3 HOH 3  907 11  HOH HOH B . 
H 3 HOH 4  908 12  HOH HOH B . 
H 3 HOH 5  909 15  HOH HOH B . 
H 3 HOH 6  910 16  HOH HOH B . 
H 3 HOH 7  911 20  HOH HOH B . 
H 3 HOH 8  912 22  HOH HOH B . 
H 3 HOH 9  913 24  HOH HOH B . 
H 3 HOH 10 914 26  HOH HOH B . 
H 3 HOH 11 915 27  HOH HOH B . 
H 3 HOH 12 916 32  HOH HOH B . 
H 3 HOH 13 917 34  HOH HOH B . 
H 3 HOH 14 918 35  HOH HOH B . 
H 3 HOH 15 919 42  HOH HOH B . 
H 3 HOH 16 920 43  HOH HOH B . 
H 3 HOH 17 921 44  HOH HOH B . 
H 3 HOH 18 922 46  HOH HOH B . 
H 3 HOH 19 923 49  HOH HOH B . 
H 3 HOH 20 924 50  HOH HOH B . 
H 3 HOH 21 925 51  HOH HOH B . 
H 3 HOH 22 926 53  HOH HOH B . 
H 3 HOH 23 927 54  HOH HOH B . 
H 3 HOH 24 928 55  HOH HOH B . 
H 3 HOH 25 929 56  HOH HOH B . 
H 3 HOH 26 930 57  HOH HOH B . 
H 3 HOH 27 931 61  HOH HOH B . 
H 3 HOH 28 932 62  HOH HOH B . 
H 3 HOH 29 933 63  HOH HOH B . 
H 3 HOH 30 934 64  HOH HOH B . 
H 3 HOH 31 935 65  HOH HOH B . 
H 3 HOH 32 936 66  HOH HOH B . 
H 3 HOH 33 937 67  HOH HOH B . 
H 3 HOH 34 938 72  HOH HOH B . 
H 3 HOH 35 939 73  HOH HOH B . 
H 3 HOH 36 940 76  HOH HOH B . 
H 3 HOH 37 941 79  HOH HOH B . 
H 3 HOH 38 942 80  HOH HOH B . 
H 3 HOH 39 943 82  HOH HOH B . 
H 3 HOH 40 944 84  HOH HOH B . 
H 3 HOH 41 945 85  HOH HOH B . 
H 3 HOH 42 946 86  HOH HOH B . 
H 3 HOH 43 947 87  HOH HOH B . 
H 3 HOH 44 948 88  HOH HOH B . 
H 3 HOH 45 949 91  HOH HOH B . 
H 3 HOH 46 950 92  HOH HOH B . 
H 3 HOH 47 951 94  HOH HOH B . 
H 3 HOH 48 952 96  HOH HOH B . 
H 3 HOH 49 953 98  HOH HOH B . 
H 3 HOH 50 954 101 HOH HOH B . 
H 3 HOH 51 955 103 HOH HOH B . 
H 3 HOH 52 956 105 HOH HOH B . 
H 3 HOH 53 957 106 HOH HOH B . 
H 3 HOH 54 958 107 HOH HOH B . 
H 3 HOH 55 959 108 HOH HOH B . 
#