data_1PFI
# 
_entry.id   1PFI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PFI         
WWPDB D_1000175641 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PFI 
_pdbx_database_status.recvd_initial_deposition_date   1994-04-06 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, D.J.' 1 
'Day, L.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Pf1 virus structure: helical coat protein and DNA with paraxial phosphates.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            265 
_citation.page_first                671 
_citation.page_last                 674 
_citation.year                      1994 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8036516 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, D.J.' 1 
primary 'Day, L.A.' 2 
# 
_cell.entry_id           1PFI 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PFI 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'MAJOR COAT PROTEIN OF PF1 VIRUS' 4612.393 2 ? ? ? ? 
2 polymer man 
;DNA (5'-D(P*C)-3')
;
307.197  2 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA A,B 
? 
2 polydeoxyribonucleotide no no '(DC)'                                         C                                              C,D 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  VAL n 
1 3  ILE n 
1 4  ASP n 
1 5  THR n 
1 6  SER n 
1 7  ALA n 
1 8  VAL n 
1 9  GLU n 
1 10 SER n 
1 11 ALA n 
1 12 ILE n 
1 13 THR n 
1 14 ASP n 
1 15 GLY n 
1 16 GLN n 
1 17 GLY n 
1 18 ASP n 
1 19 MET n 
1 20 LYS n 
1 21 ALA n 
1 22 ILE n 
1 23 GLY n 
1 24 GLY n 
1 25 TYR n 
1 26 ILE n 
1 27 VAL n 
1 28 GLY n 
1 29 ALA n 
1 30 LEU n 
1 31 VAL n 
1 32 ILE n 
1 33 LEU n 
1 34 ALA n 
1 35 VAL n 
1 36 ALA n 
1 37 GLY n 
1 38 LEU n 
1 39 ILE n 
1 40 TYR n 
1 41 SER n 
1 42 MET n 
1 43 LEU n 
1 44 ARG n 
1 45 LYS n 
1 46 ALA n 
2 1  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Inovirus ? ? G8P ? ? ? ? 'Pseudomonas phage Pf1' 10871 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? 
2 1 sample ? ? ? ? Inovirus ? ? G8P ? ? ? ? 'Pseudomonas phage Pf1' 10871 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP COATB_BPPF1 1 P03621 1 
;MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLR
KA
;
? 
2 PDB 1PFI        2 1PFI   1 C                                                                                     ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PFI A 1 ? 46 ? P03621 37 ? 82 ? 1 46 
2 1 1PFI B 1 ? 46 ? P03621 37 ? 82 ? 1 46 
3 2 1PFI C 1 ? 1  ? 1PFI   1  ? 1  ? 1 1  
4 2 1PFI D 1 ? 1  ? 1PFI   1  ? 1  ? 1 1  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PFI 
_exptl.method            'FIBER DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1PFI 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             . 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'DATA ARE BASED ON, BUT NOT LIMITED TO, FIBER DIFFRACTION.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'FIBER DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'FIBER DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        644 
_refine_hist.pdbx_number_atoms_nucleic_acid   38 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               682 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1PFI 
_struct.title                     'PF1 VIRUS STRUCTURE: HELICAL COAT PROTEIN AND DNA WITH PARAXIAL PHOSPHATES' 
_struct.pdbx_descriptor           
;MAJOR COAT PROTEIN OF PF1 VIRUS (MODEL FOR PF1 VIRUS) COMPLEXED WITH CIRCULAR SINGLE-STRANDED DNA OF PF1 VIRUS G8P (FIBER DIFFRACTION)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PFI 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'COMPLEX(VIRAL COAT PROTEIN-DNA), Helical virus, Virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 2  ? GLN A 16 ? VAL A 2  GLN A 16 1 ? 15 
HELX_P HELX_P2 2 GLN A 16 ? ALA A 46 ? GLN A 16 ALA A 46 1 ? 31 
HELX_P HELX_P3 3 VAL B 2  ? GLN B 16 ? VAL B 2  GLN B 16 1 ? 15 
HELX_P HELX_P4 4 GLN B 16 ? ALA B 46 ? GLN B 16 ALA B 46 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE DC C 1' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE DC D 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ARG A 44 ? ARG A 44 . ? 1_555 ? 
2 AC1 4 SER B 41 ? SER B 41 . ? 1_555 ? 
3 AC1 4 MET B 42 ? MET B 42 . ? 1_555 ? 
4 AC1 4 LYS B 45 ? LYS B 45 . ? 1_555 ? 
5 AC2 2 LYS A 45 ? LYS A 45 . ? 1_555 ? 
6 AC2 2 LYS B 45 ? LYS B 45 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PFI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PFI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N      . GLY A 1 1  ? 18.241 -21.181 59.388 1.00 0.00 ? 1  GLY A N      1 
ATOM 2    C CA     . GLY A 1 1  ? 17.758 -21.270 58.012 1.00 0.00 ? 1  GLY A CA     1 
ATOM 3    C C      . GLY A 1 1  ? 18.395 -20.211 57.145 1.00 0.00 ? 1  GLY A C      1 
ATOM 4    O O      . GLY A 1 1  ? 17.834 -19.761 56.151 1.00 0.00 ? 1  GLY A O      1 
ATOM 5    H H1     . GLY A 1 1  ? 17.901 -21.858 60.157 1.00 0.00 ? 1  GLY A H1     1 
ATOM 6    H H2     . GLY A 1 1  ? 18.960 -20.438 59.694 1.00 0.00 ? 1  GLY A H2     1 
ATOM 7    H HA2    . GLY A 1 1  ? 17.979 -22.267 57.591 1.00 0.00 ? 1  GLY A HA2    1 
ATOM 8    H HA3    . GLY A 1 1  ? 16.657 -21.151 57.986 1.00 0.00 ? 1  GLY A HA3    1 
ATOM 9    N N      . VAL A 1 2  ? 19.735 -19.747 57.568 1.00 0.00 ? 2  VAL A N      1 
ATOM 10   C CA     . VAL A 1 2  ? 20.467 -18.726 56.827 1.00 0.00 ? 2  VAL A CA     1 
ATOM 11   C C      . VAL A 1 2  ? 21.727 -19.298 56.221 1.00 0.00 ? 2  VAL A C      1 
ATOM 12   O O      . VAL A 1 2  ? 22.105 -18.988 55.084 1.00 0.00 ? 2  VAL A O      1 
ATOM 13   C CB     . VAL A 1 2  ? 20.805 -17.509 57.778 1.00 0.00 ? 2  VAL A CB     1 
ATOM 14   C CG1    . VAL A 1 2  ? 21.748 -16.419 57.199 1.00 0.00 ? 2  VAL A CG1    1 
ATOM 15   C CG2    . VAL A 1 2  ? 19.560 -16.746 58.289 1.00 0.00 ? 2  VAL A CG2    1 
ATOM 16   H H      . VAL A 1 2  ? 20.136 -20.207 58.459 1.00 0.00 ? 2  VAL A H      1 
ATOM 17   H HA     . VAL A 1 2  ? 19.837 -18.369 55.990 1.00 0.00 ? 2  VAL A HA     1 
ATOM 18   H HB     . VAL A 1 2  ? 21.322 -17.927 58.671 1.00 0.00 ? 2  VAL A HB     1 
ATOM 19   H HG11   . VAL A 1 2  ? 21.338 -15.949 56.285 1.00 0.00 ? 2  VAL A HG11   1 
ATOM 20   H HG12   . VAL A 1 2  ? 21.948 -15.608 57.924 1.00 0.00 ? 2  VAL A HG12   1 
ATOM 21   H HG13   . VAL A 1 2  ? 22.745 -16.817 56.935 1.00 0.00 ? 2  VAL A HG13   1 
ATOM 22   H HG21   . VAL A 1 2  ? 19.019 -16.235 57.471 1.00 0.00 ? 2  VAL A HG21   1 
ATOM 23   H HG22   . VAL A 1 2  ? 18.839 -17.421 58.790 1.00 0.00 ? 2  VAL A HG22   1 
ATOM 24   H HG23   . VAL A 1 2  ? 19.829 -15.975 59.036 1.00 0.00 ? 2  VAL A HG23   1 
ATOM 25   N N      . ILE A 1 3  ? 22.478 -20.254 57.061 1.00 0.00 ? 3  ILE A N      1 
ATOM 26   C CA     . ILE A 1 3  ? 23.710 -20.884 56.604 1.00 0.00 ? 3  ILE A CA     1 
ATOM 27   C C      . ILE A 1 3  ? 23.449 -21.790 55.427 1.00 0.00 ? 3  ILE A C      1 
ATOM 28   O O      . ILE A 1 3  ? 23.485 -21.379 54.259 1.00 0.00 ? 3  ILE A O      1 
ATOM 29   C CB     . ILE A 1 3  ? 24.440 -21.645 57.785 1.00 0.00 ? 3  ILE A CB     1 
ATOM 30   C CG1    . ILE A 1 3  ? 24.942 -20.729 58.944 1.00 0.00 ? 3  ILE A CG1    1 
ATOM 31   C CG2    . ILE A 1 3  ? 25.644 -22.510 57.293 1.00 0.00 ? 3  ILE A CG2    1 
ATOM 32   C CD1    . ILE A 1 3  ? 25.943 -19.625 58.543 1.00 0.00 ? 3  ILE A CD1    1 
ATOM 33   H H      . ILE A 1 3  ? 22.061 -20.452 58.037 1.00 0.00 ? 3  ILE A H      1 
ATOM 34   H HA     . ILE A 1 3  ? 24.381 -20.085 56.242 1.00 0.00 ? 3  ILE A HA     1 
ATOM 35   H HB     . ILE A 1 3  ? 23.691 -22.342 58.226 1.00 0.00 ? 3  ILE A HB     1 
ATOM 36   H HG12   . ILE A 1 3  ? 24.082 -20.287 59.482 1.00 0.00 ? 3  ILE A HG12   1 
ATOM 37   H HG13   . ILE A 1 3  ? 25.460 -21.344 59.702 1.00 0.00 ? 3  ILE A HG13   1 
ATOM 38   H HG21   . ILE A 1 3  ? 25.359 -23.277 56.552 1.00 0.00 ? 3  ILE A HG21   1 
ATOM 39   H HG22   . ILE A 1 3  ? 26.441 -21.891 56.837 1.00 0.00 ? 3  ILE A HG22   1 
ATOM 40   H HG23   . ILE A 1 3  ? 26.112 -23.086 58.115 1.00 0.00 ? 3  ILE A HG23   1 
ATOM 41   H HD11   . ILE A 1 3  ? 26.302 -19.072 59.429 1.00 0.00 ? 3  ILE A HD11   1 
ATOM 42   H HD12   . ILE A 1 3  ? 26.836 -20.042 58.038 1.00 0.00 ? 3  ILE A HD12   1 
ATOM 43   H HD13   . ILE A 1 3  ? 25.497 -18.875 57.862 1.00 0.00 ? 3  ILE A HD13   1 
ATOM 44   N N      . ASP A 1 4  ? 23.147 -23.202 55.749 1.00 0.00 ? 4  ASP A N      1 
ATOM 45   C CA     . ASP A 1 4  ? 22.874 -24.192 54.712 1.00 0.00 ? 4  ASP A CA     1 
ATOM 46   C C      . ASP A 1 4  ? 21.600 -23.862 53.969 1.00 0.00 ? 4  ASP A C      1 
ATOM 47   O O      . ASP A 1 4  ? 21.353 -24.329 52.814 1.00 0.00 ? 4  ASP A O      1 
ATOM 48   C CB     . ASP A 1 4  ? 22.836 -25.618 55.326 1.00 0.00 ? 4  ASP A CB     1 
ATOM 49   C CG     . ASP A 1 4  ? 22.736 -26.791 54.338 1.00 0.00 ? 4  ASP A CG     1 
ATOM 50   O OD1    . ASP A 1 4  ? 22.041 -27.774 54.540 1.00 0.00 ? 4  ASP A OD1    1 
ATOM 51   O OD2    . ASP A 1 4  ? 23.481 -26.597 53.210 1.00 0.00 ? 4  ASP A OD2    1 
ATOM 52   H H      . ASP A 1 4  ? 23.142 -23.459 56.798 1.00 0.00 ? 4  ASP A H      1 
ATOM 53   H HA     . ASP A 1 4  ? 23.696 -24.118 53.976 1.00 0.00 ? 4  ASP A HA     1 
ATOM 54   H HB2    . ASP A 1 4  ? 23.717 -25.797 55.964 1.00 0.00 ? 4  ASP A HB2    1 
ATOM 55   H HB3    . ASP A 1 4  ? 21.970 -25.695 56.015 1.00 0.00 ? 4  ASP A HB3    1 
ATOM 56   H HD2    . ASP A 1 4  ? 23.946 -25.765 53.238 1.00 0.00 ? 4  ASP A HD2    1 
ATOM 57   N N      . THR A 1 5  ? 20.655 -22.964 54.673 1.00 0.00 ? 5  THR A N      1 
ATOM 58   C CA     . THR A 1 5  ? 19.388 -22.558 54.078 1.00 0.00 ? 5  THR A CA     1 
ATOM 59   C C      . THR A 1 5  ? 19.611 -21.717 52.843 1.00 0.00 ? 5  THR A C      1 
ATOM 60   O O      . THR A 1 5  ? 18.925 -21.842 51.847 1.00 0.00 ? 5  THR A O      1 
ATOM 61   C CB     . THR A 1 5  ? 18.511 -21.786 55.122 1.00 0.00 ? 5  THR A CB     1 
ATOM 62   O OG1    . THR A 1 5  ? 17.736 -22.698 55.890 1.00 0.00 ? 5  THR A OG1    1 
ATOM 63   C CG2    . THR A 1 5  ? 17.482 -20.791 54.550 1.00 0.00 ? 5  THR A CG2    1 
ATOM 64   H H      . THR A 1 5  ? 20.964 -22.625 55.650 1.00 0.00 ? 5  THR A H      1 
ATOM 65   H HA     . THR A 1 5  ? 18.846 -23.469 53.761 1.00 0.00 ? 5  THR A HA     1 
ATOM 66   H HB     . THR A 1 5  ? 19.190 -21.232 55.805 1.00 0.00 ? 5  THR A HB     1 
ATOM 67   H HG1    . THR A 1 5  ? 17.281 -22.167 56.553 1.00 0.00 ? 5  THR A HG1    1 
ATOM 68   H HG21   . THR A 1 5  ? 17.958 -19.966 53.984 1.00 0.00 ? 5  THR A HG21   1 
ATOM 69   H HG22   . THR A 1 5  ? 16.769 -21.283 53.861 1.00 0.00 ? 5  THR A HG22   1 
ATOM 70   H HG23   . THR A 1 5  ? 16.888 -20.303 55.342 1.00 0.00 ? 5  THR A HG23   1 
ATOM 71   N N      . SER A 1 6  ? 20.715 -20.735 52.918 1.00 0.00 ? 6  SER A N      1 
ATOM 72   C CA     . SER A 1 6  ? 21.043 -19.859 51.802 1.00 0.00 ? 6  SER A CA     1 
ATOM 73   C C      . SER A 1 6  ? 21.540 -20.651 50.617 1.00 0.00 ? 6  SER A C      1 
ATOM 74   O O      . SER A 1 6  ? 21.218 -20.365 49.461 1.00 0.00 ? 6  SER A O      1 
ATOM 75   C CB     . SER A 1 6  ? 22.071 -18.780 52.232 1.00 0.00 ? 6  SER A CB     1 
ATOM 76   O OG     . SER A 1 6  ? 23.367 -19.321 52.496 1.00 0.00 ? 6  SER A OG     1 
ATOM 77   H H      . SER A 1 6  ? 21.261 -20.710 53.847 1.00 0.00 ? 6  SER A H      1 
ATOM 78   H HA     . SER A 1 6  ? 20.116 -19.348 51.483 1.00 0.00 ? 6  SER A HA     1 
ATOM 79   H HB2    . SER A 1 6  ? 22.167 -18.015 51.438 1.00 0.00 ? 6  SER A HB2    1 
ATOM 80   H HB3    . SER A 1 6  ? 21.714 -18.223 53.121 1.00 0.00 ? 6  SER A HB3    1 
ATOM 81   H HG     . SER A 1 6  ? 23.283 -19.925 53.240 1.00 0.00 ? 6  SER A HG     1 
ATOM 82   N N      . ALA A 1 7  ? 22.433 -21.787 50.925 1.00 0.00 ? 7  ALA A N      1 
ATOM 83   C CA     . ALA A 1 7  ? 22.987 -22.641 49.877 1.00 0.00 ? 7  ALA A CA     1 
ATOM 84   C C      . ALA A 1 7  ? 21.894 -23.410 49.169 1.00 0.00 ? 7  ALA A C      1 
ATOM 85   O O      . ALA A 1 7  ? 21.910 -23.594 47.947 1.00 0.00 ? 7  ALA A O      1 
ATOM 86   C CB     . ALA A 1 7  ? 24.033 -23.561 50.531 1.00 0.00 ? 7  ALA A CB     1 
ATOM 87   H H      . ALA A 1 7  ? 22.652 -21.948 51.970 1.00 0.00 ? 7  ALA A H      1 
ATOM 88   H HA     . ALA A 1 7  ? 23.480 -22.001 49.122 1.00 0.00 ? 7  ALA A HA     1 
ATOM 89   H HB1    . ALA A 1 7  ? 24.512 -24.230 49.792 1.00 0.00 ? 7  ALA A HB1    1 
ATOM 90   H HB2    . ALA A 1 7  ? 24.845 -22.985 51.011 1.00 0.00 ? 7  ALA A HB2    1 
ATOM 91   H HB3    . ALA A 1 7  ? 23.587 -24.207 51.314 1.00 0.00 ? 7  ALA A HB3    1 
ATOM 92   N N      . VAL A 1 8  ? 20.813 -23.933 50.027 1.00 0.00 ? 8  VAL A N      1 
ATOM 93   C CA     . VAL A 1 8  ? 19.689 -24.693 49.480 1.00 0.00 ? 8  VAL A CA     1 
ATOM 94   C C      . VAL A 1 8  ? 18.848 -23.830 48.567 1.00 0.00 ? 8  VAL A C      1 
ATOM 95   O O      . VAL A 1 8  ? 18.377 -24.267 47.509 1.00 0.00 ? 8  VAL A O      1 
ATOM 96   C CB     . VAL A 1 8  ? 18.815 -25.283 50.657 1.00 0.00 ? 8  VAL A CB     1 
ATOM 97   C CG1    . VAL A 1 8  ? 19.102 -24.720 52.076 1.00 0.00 ? 8  VAL A CG1    1 
ATOM 98   C CG2    . VAL A 1 8  ? 17.290 -25.112 50.452 1.00 0.00 ? 8  VAL A CG2    1 
ATOM 99   H H      . VAL A 1 8  ? 20.897 -23.723 51.084 1.00 0.00 ? 8  VAL A H      1 
ATOM 100  H HA     . VAL A 1 8  ? 20.087 -25.524 48.868 1.00 0.00 ? 8  VAL A HA     1 
ATOM 101  H HB     . VAL A 1 8  ? 19.020 -26.375 50.703 1.00 0.00 ? 8  VAL A HB     1 
ATOM 102  H HG11   . VAL A 1 8  ? 18.949 -23.626 52.136 1.00 0.00 ? 8  VAL A HG11   1 
ATOM 103  H HG12   . VAL A 1 8  ? 18.461 -25.183 52.850 1.00 0.00 ? 8  VAL A HG12   1 
ATOM 104  H HG13   . VAL A 1 8  ? 20.139 -24.922 52.409 1.00 0.00 ? 8  VAL A HG13   1 
ATOM 105  H HG21   . VAL A 1 8  ? 16.982 -24.049 50.462 1.00 0.00 ? 8  VAL A HG21   1 
ATOM 106  H HG22   . VAL A 1 8  ? 16.954 -25.540 49.491 1.00 0.00 ? 8  VAL A HG22   1 
ATOM 107  H HG23   . VAL A 1 8  ? 16.709 -25.631 51.238 1.00 0.00 ? 8  VAL A HG23   1 
ATOM 108  N N      . GLU A 1 9  ? 18.624 -22.440 49.011 1.00 0.00 ? 9  GLU A N      1 
ATOM 109  C CA     . GLU A 1 9  ? 17.830 -21.496 48.230 1.00 0.00 ? 9  GLU A CA     1 
ATOM 110  C C      . GLU A 1 9  ? 18.496 -21.200 46.905 1.00 0.00 ? 9  GLU A C      1 
ATOM 111  O O      . GLU A 1 9  ? 17.848 -21.088 45.864 1.00 0.00 ? 9  GLU A O      1 
ATOM 112  C CB     . GLU A 1 9  ? 17.638 -20.201 49.067 1.00 0.00 ? 9  GLU A CB     1 
ATOM 113  C CG     . GLU A 1 9  ? 16.768 -19.063 48.439 1.00 0.00 ? 9  GLU A CG     1 
ATOM 114  C CD     . GLU A 1 9  ? 16.613 -17.754 49.216 1.00 0.00 ? 9  GLU A CD     1 
ATOM 115  O OE1    . GLU A 1 9  ? 15.985 -16.795 48.787 1.00 0.00 ? 9  GLU A OE1    1 
ATOM 116  O OE2    . GLU A 1 9  ? 17.237 -17.758 50.427 1.00 0.00 ? 9  GLU A OE2    1 
ATOM 117  H H      . GLU A 1 9  ? 19.031 -22.196 49.846 1.00 0.00 ? 9  GLU A H      1 
ATOM 118  H HA     . GLU A 1 9  ? 16.847 -21.953 48.019 1.00 0.00 ? 9  GLU A HA     1 
ATOM 119  H HB2    . GLU A 1 9  ? 17.197 -20.474 50.047 1.00 0.00 ? 9  GLU A HB2    1 
ATOM 120  H HB3    . GLU A 1 9  ? 18.635 -19.793 49.325 1.00 0.00 ? 9  GLU A HB3    1 
ATOM 121  H HG2    . GLU A 1 9  ? 17.170 -18.795 47.444 1.00 0.00 ? 9  GLU A HG2    1 
ATOM 122  H HG3    . GLU A 1 9  ? 15.748 -19.434 48.231 1.00 0.00 ? 9  GLU A HG3    1 
ATOM 123  H HE2    . GLU A 1 9  ? 17.100 -16.899 50.828 1.00 0.00 ? 9  GLU A HE2    1 
ATOM 124  N N      . SER A 1 10 ? 19.966 -21.047 46.937 1.00 0.00 ? 10 SER A N      1 
ATOM 125  C CA     . SER A 1 10 ? 20.738 -20.757 45.735 1.00 0.00 ? 10 SER A CA     1 
ATOM 126  C C      . SER A 1 10 ? 20.657 -21.899 44.752 1.00 0.00 ? 10 SER A C      1 
ATOM 127  O O      . SER A 1 10 ? 20.554 -21.712 43.540 1.00 0.00 ? 10 SER A O      1 
ATOM 128  C CB     . SER A 1 10 ? 22.209 -20.417 46.091 1.00 0.00 ? 10 SER A CB     1 
ATOM 129  O OG     . SER A 1 10 ? 22.942 -21.546 46.575 1.00 0.00 ? 10 SER A OG     1 
ATOM 130  H H      . SER A 1 10 ? 20.431 -21.163 47.905 1.00 0.00 ? 10 SER A H      1 
ATOM 131  H HA     . SER A 1 10 ? 20.288 -19.878 45.240 1.00 0.00 ? 10 SER A HA     1 
ATOM 132  H HB2    . SER A 1 10 ? 22.727 -20.023 45.197 1.00 0.00 ? 10 SER A HB2    1 
ATOM 133  H HB3    . SER A 1 10 ? 22.258 -19.599 46.836 1.00 0.00 ? 10 SER A HB3    1 
ATOM 134  H HG     . SER A 1 10 ? 22.521 -21.833 47.392 1.00 0.00 ? 10 SER A HG     1 
ATOM 135  N N      . ALA A 1 11 ? 20.712 -23.261 45.330 1.00 0.00 ? 11 ALA A N      1 
ATOM 136  C CA     . ALA A 1 11 ? 20.645 -24.459 44.500 1.00 0.00 ? 11 ALA A CA     1 
ATOM 137  C C      . ALA A 1 11 ? 19.303 -24.568 43.814 1.00 0.00 ? 11 ALA A C      1 
ATOM 138  O O      . ALA A 1 11 ? 19.193 -24.962 42.645 1.00 0.00 ? 11 ALA A O      1 
ATOM 139  C CB     . ALA A 1 11 ? 20.954 -25.667 45.400 1.00 0.00 ? 11 ALA A CB     1 
ATOM 140  H H      . ALA A 1 11 ? 20.801 -23.312 46.406 1.00 0.00 ? 11 ALA A H      1 
ATOM 141  H HA     . ALA A 1 11 ? 21.412 -24.383 43.707 1.00 0.00 ? 11 ALA A HA     1 
ATOM 142  H HB1    . ALA A 1 11 ? 20.942 -26.619 44.834 1.00 0.00 ? 11 ALA A HB1    1 
ATOM 143  H HB2    . ALA A 1 11 ? 21.956 -25.590 45.865 1.00 0.00 ? 11 ALA A HB2    1 
ATOM 144  H HB3    . ALA A 1 11 ? 20.223 -25.769 46.228 1.00 0.00 ? 11 ALA A HB3    1 
ATOM 145  N N      . ILE A 1 12 ? 18.126 -24.190 44.630 1.00 0.00 ? 12 ILE A N      1 
ATOM 146  C CA     . ILE A 1 12 ? 16.767 -24.249 44.097 1.00 0.00 ? 12 ILE A CA     1 
ATOM 147  C C      . ILE A 1 12 ? 16.587 -23.255 42.974 1.00 0.00 ? 12 ILE A C      1 
ATOM 148  O O      . ILE A 1 12 ? 15.935 -23.529 41.956 1.00 0.00 ? 12 ILE A O      1 
ATOM 149  C CB     . ILE A 1 12 ? 15.692 -24.050 45.241 1.00 0.00 ? 12 ILE A CB     1 
ATOM 150  C CG1    . ILE A 1 12 ? 15.091 -22.608 45.328 1.00 0.00 ? 12 ILE A CG1    1 
ATOM 151  C CG2    . ILE A 1 12 ? 16.230 -24.436 46.653 1.00 0.00 ? 12 ILE A CG2    1 
ATOM 152  C CD1    . ILE A 1 12 ? 13.551 -22.522 45.347 1.00 0.00 ? 12 ILE A CD1    1 
ATOM 153  H H      . ILE A 1 12 ? 18.332 -23.872 45.639 1.00 0.00 ? 12 ILE A H      1 
ATOM 154  H HA     . ILE A 1 12 ? 16.624 -25.250 43.655 1.00 0.00 ? 12 ILE A HA     1 
ATOM 155  H HB     . ILE A 1 12 ? 14.845 -24.734 45.004 1.00 0.00 ? 12 ILE A HB     1 
ATOM 156  H HG12   . ILE A 1 12 ? 15.514 -22.070 46.197 1.00 0.00 ? 12 ILE A HG12   1 
ATOM 157  H HG13   . ILE A 1 12 ? 15.417 -22.019 44.451 1.00 0.00 ? 12 ILE A HG13   1 
ATOM 158  H HG21   . ILE A 1 12 ? 16.565 -25.486 46.714 1.00 0.00 ? 12 ILE A HG21   1 
ATOM 159  H HG22   . ILE A 1 12 ? 17.076 -23.799 46.962 1.00 0.00 ? 12 ILE A HG22   1 
ATOM 160  H HG23   . ILE A 1 12 ? 15.454 -24.349 47.434 1.00 0.00 ? 12 ILE A HG23   1 
ATOM 161  H HD11   . ILE A 1 12 ? 13.211 -21.468 45.336 1.00 0.00 ? 12 ILE A HD11   1 
ATOM 162  H HD12   . ILE A 1 12 ? 13.103 -23.018 44.465 1.00 0.00 ? 12 ILE A HD12   1 
ATOM 163  H HD13   . ILE A 1 12 ? 13.113 -22.985 46.247 1.00 0.00 ? 12 ILE A HD13   1 
ATOM 164  N N      . THR A 1 13 ? 17.198 -21.916 43.094 1.00 0.00 ? 13 THR A N      1 
ATOM 165  C CA     . THR A 1 13 ? 17.065 -20.905 42.048 1.00 0.00 ? 13 THR A CA     1 
ATOM 166  C C      . THR A 1 13 ? 17.750 -21.348 40.779 1.00 0.00 ? 13 THR A C      1 
ATOM 167  O O      . THR A 1 13 ? 17.266 -21.149 39.681 1.00 0.00 ? 13 THR A O      1 
ATOM 168  C CB     . THR A 1 13 ? 17.634 -19.529 42.535 1.00 0.00 ? 13 THR A CB     1 
ATOM 169  O OG1    . THR A 1 13 ? 16.910 -19.062 43.667 1.00 0.00 ? 13 THR A OG1    1 
ATOM 170  C CG2    . THR A 1 13 ? 17.568 -18.365 41.525 1.00 0.00 ? 13 THR A CG2    1 
ATOM 171  H H      . THR A 1 13 ? 17.758 -21.730 44.001 1.00 0.00 ? 13 THR A H      1 
ATOM 172  H HA     . THR A 1 13 ? 15.992 -20.783 41.818 1.00 0.00 ? 13 THR A HA     1 
ATOM 173  H HB     . THR A 1 13 ? 18.695 -19.675 42.828 1.00 0.00 ? 13 THR A HB     1 
ATOM 174  H HG1    . THR A 1 13 ? 17.352 -18.259 43.953 1.00 0.00 ? 13 THR A HG1    1 
ATOM 175  H HG21   . THR A 1 13 ? 18.163 -18.560 40.615 1.00 0.00 ? 13 THR A HG21   1 
ATOM 176  H HG22   . THR A 1 13 ? 16.527 -18.164 41.198 1.00 0.00 ? 13 THR A HG22   1 
ATOM 177  H HG23   . THR A 1 13 ? 17.965 -17.424 41.947 1.00 0.00 ? 13 THR A HG23   1 
ATOM 178  N N      . ASP A 1 14 ? 19.048 -22.037 40.947 1.00 0.00 ? 14 ASP A N      1 
ATOM 179  C CA     . ASP A 1 14 ? 19.823 -22.520 39.808 1.00 0.00 ? 14 ASP A CA     1 
ATOM 180  C C      . ASP A 1 14 ? 19.084 -23.618 39.081 1.00 0.00 ? 14 ASP A C      1 
ATOM 181  O O      . ASP A 1 14 ? 19.074 -23.694 37.812 1.00 0.00 ? 14 ASP A O      1 
ATOM 182  C CB     . ASP A 1 14 ? 21.229 -22.975 40.269 1.00 0.00 ? 14 ASP A CB     1 
ATOM 183  C CG     . ASP A 1 14 ? 22.328 -21.900 40.296 1.00 0.00 ? 14 ASP A CG     1 
ATOM 184  O OD1    . ASP A 1 14 ? 23.478 -22.112 39.946 1.00 0.00 ? 14 ASP A OD1    1 
ATOM 185  O OD2    . ASP A 1 14 ? 21.870 -20.688 40.735 1.00 0.00 ? 14 ASP A OD2    1 
ATOM 186  H H      . ASP A 1 14 ? 19.390 -22.163 41.963 1.00 0.00 ? 14 ASP A H      1 
ATOM 187  H HA     . ASP A 1 14 ? 19.909 -21.670 39.101 1.00 0.00 ? 14 ASP A HA     1 
ATOM 188  H HB2    . ASP A 1 14 ? 21.191 -23.432 41.273 1.00 0.00 ? 14 ASP A HB2    1 
ATOM 189  H HB3    . ASP A 1 14 ? 21.589 -23.789 39.608 1.00 0.00 ? 14 ASP A HB3    1 
ATOM 190  H HD2    . ASP A 1 14 ? 20.941 -20.727 40.954 1.00 0.00 ? 14 ASP A HD2    1 
ATOM 191  N N      . GLY A 1 15 ? 18.371 -24.597 39.930 1.00 0.00 ? 15 GLY A N      1 
ATOM 192  C CA     . GLY A 1 15 ? 17.618 -25.712 39.363 1.00 0.00 ? 15 GLY A CA     1 
ATOM 193  C C      . GLY A 1 15 ? 16.309 -25.235 38.774 1.00 0.00 ? 15 GLY A C      1 
ATOM 194  O O      . GLY A 1 15 ? 15.871 -25.682 37.723 1.00 0.00 ? 15 GLY A O      1 
ATOM 195  H H      . GLY A 1 15 ? 18.445 -24.437 40.996 1.00 0.00 ? 15 GLY A H      1 
ATOM 196  H HA2    . GLY A 1 15 ? 18.209 -26.209 38.576 1.00 0.00 ? 15 GLY A HA2    1 
ATOM 197  H HA3    . GLY A 1 15 ? 17.412 -26.468 40.143 1.00 0.00 ? 15 GLY A HA3    1 
ATOM 198  N N      . GLN A 1 16 ? 15.593 -24.199 39.548 1.00 0.00 ? 16 GLN A N      1 
ATOM 199  C CA     . GLN A 1 16 ? 14.318 -23.644 39.102 1.00 0.00 ? 16 GLN A CA     1 
ATOM 200  C C      . GLN A 1 16 ? 14.519 -22.682 37.956 1.00 0.00 ? 16 GLN A C      1 
ATOM 201  O O      . GLN A 1 16 ? 13.572 -22.163 37.366 1.00 0.00 ? 16 GLN A O      1 
ATOM 202  C CB     . GLN A 1 16 ? 13.634 -22.947 40.299 1.00 0.00 ? 16 GLN A CB     1 
ATOM 203  C CG     . GLN A 1 16 ? 12.223 -22.328 40.024 1.00 0.00 ? 16 GLN A CG     1 
ATOM 204  C CD     . GLN A 1 16 ? 11.509 -21.565 41.145 1.00 0.00 ? 16 GLN A CD     1 
ATOM 205  O OE1    . GLN A 1 16 ? 10.426 -21.034 40.957 1.00 0.00 ? 16 GLN A OE1    1 
ATOM 206  N NE2    . GLN A 1 16 ? 12.072 -21.454 42.321 1.00 0.00 ? 16 GLN A NE2    1 
ATOM 207  H H      . GLN A 1 16 ? 16.015 -23.908 40.360 1.00 0.00 ? 16 GLN A H      1 
ATOM 208  H HA     . GLN A 1 16 ? 13.681 -24.469 38.736 1.00 0.00 ? 16 GLN A HA     1 
ATOM 209  H HB2    . GLN A 1 16 ? 13.542 -23.671 41.129 1.00 0.00 ? 16 GLN A HB2    1 
ATOM 210  H HB3    . GLN A 1 16 ? 14.309 -22.148 40.675 1.00 0.00 ? 16 GLN A HB3    1 
ATOM 211  H HG2    . GLN A 1 16 ? 12.279 -21.602 39.191 1.00 0.00 ? 16 GLN A HG2    1 
ATOM 212  H HG3    . GLN A 1 16 ? 11.528 -23.109 39.658 1.00 0.00 ? 16 GLN A HG3    1 
ATOM 213  H HE21   . GLN A 1 16 ? 13.006 -21.860 42.394 1.00 0.00 ? 16 GLN A HE21   1 
ATOM 214  H HE22   . GLN A 1 16 ? 11.561 -20.880 42.992 1.00 0.00 ? 16 GLN A HE22   1 
ATOM 215  N N      . GLY A 1 17 ? 15.920 -22.396 37.587 1.00 0.00 ? 17 GLY A N      1 
ATOM 216  C CA     . GLY A 1 17 ? 16.267 -21.486 36.499 1.00 0.00 ? 17 GLY A CA     1 
ATOM 217  C C      . GLY A 1 17 ? 15.907 -22.083 35.157 1.00 0.00 ? 17 GLY A C      1 
ATOM 218  O O      . GLY A 1 17 ? 15.768 -21.390 34.153 1.00 0.00 ? 17 GLY A O      1 
ATOM 219  H H      . GLY A 1 17 ? 16.676 -22.902 38.168 1.00 0.00 ? 17 GLY A H      1 
ATOM 220  H HA2    . GLY A 1 17 ? 15.731 -20.525 36.621 1.00 0.00 ? 17 GLY A HA2    1 
ATOM 221  H HA3    . GLY A 1 17 ? 17.345 -21.258 36.518 1.00 0.00 ? 17 GLY A HA3    1 
ATOM 222  N N      . ASP A 1 18 ? 15.735 -23.551 35.129 1.00 0.00 ? 18 ASP A N      1 
ATOM 223  C CA     . ASP A 1 18 ? 15.388 -24.266 33.903 1.00 0.00 ? 18 ASP A CA     1 
ATOM 224  C C      . ASP A 1 18 ? 14.011 -23.875 33.423 1.00 0.00 ? 18 ASP A C      1 
ATOM 225  O O      . ASP A 1 18 ? 13.752 -23.703 32.189 1.00 0.00 ? 18 ASP A O      1 
ATOM 226  C CB     . ASP A 1 18 ? 15.513 -25.794 34.118 1.00 0.00 ? 18 ASP A CB     1 
ATOM 227  C CG     . ASP A 1 18 ? 15.880 -26.264 35.535 1.00 0.00 ? 18 ASP A CG     1 
ATOM 228  O OD1    . ASP A 1 18 ? 17.025 -26.249 35.965 1.00 0.00 ? 18 ASP A OD1    1 
ATOM 229  O OD2    . ASP A 1 18 ? 14.795 -26.679 36.253 1.00 0.00 ? 18 ASP A OD2    1 
ATOM 230  H H      . ASP A 1 18 ? 15.882 -24.066 36.068 1.00 0.00 ? 18 ASP A H      1 
ATOM 231  H HA     . ASP A 1 18 ? 16.104 -23.930 33.129 1.00 0.00 ? 18 ASP A HA     1 
ATOM 232  H HB2    . ASP A 1 18 ? 14.584 -26.314 33.829 1.00 0.00 ? 18 ASP A HB2    1 
ATOM 233  H HB3    . ASP A 1 18 ? 16.283 -26.200 33.428 1.00 0.00 ? 18 ASP A HB3    1 
ATOM 234  H HD2    . ASP A 1 18 ? 14.718 -26.197 37.074 1.00 0.00 ? 18 ASP A HD2    1 
ATOM 235  N N      . MET A 1 19 ? 12.984 -23.702 34.471 1.00 0.00 ? 19 MET A N      1 
ATOM 236  C CA     . MET A 1 19 ? 11.609 -23.325 34.151 1.00 0.00 ? 19 MET A CA     1 
ATOM 237  C C      . MET A 1 19 ? 11.554 -21.936 33.560 1.00 0.00 ? 19 MET A C      1 
ATOM 238  O O      . MET A 1 19 ? 10.798 -21.656 32.615 1.00 0.00 ? 19 MET A O      1 
ATOM 239  C CB     . MET A 1 19 ? 10.725 -23.422 35.423 1.00 0.00 ? 19 MET A CB     1 
ATOM 240  C CG     . MET A 1 19 ? 10.172 -22.084 35.961 1.00 0.00 ? 19 MET A CG     1 
ATOM 241  S SD     . MET A 1 19 ? 8.449  -22.289 36.444 1.00 0.00 ? 19 MET A SD     1 
ATOM 242  C CE     . MET A 1 19 ? 8.375  -24.085 36.412 1.00 0.00 ? 19 MET A CE     1 
ATOM 243  H H      . MET A 1 19 ? 13.308 -23.869 35.486 1.00 0.00 ? 19 MET A H      1 
ATOM 244  H HA     . MET A 1 19 ? 11.222 -24.022 33.383 1.00 0.00 ? 19 MET A HA     1 
ATOM 245  H HB2    . MET A 1 19 ? 9.872  -24.110 35.238 1.00 0.00 ? 19 MET A HB2    1 
ATOM 246  H HB3    . MET A 1 19 ? 11.303 -23.902 36.237 1.00 0.00 ? 19 MET A HB3    1 
ATOM 247  H HG2    . MET A 1 19 ? 10.752 -21.725 36.828 1.00 0.00 ? 19 MET A HG2    1 
ATOM 248  H HG3    . MET A 1 19 ? 10.243 -21.303 35.182 1.00 0.00 ? 19 MET A HG3    1 
ATOM 249  H HE1    . MET A 1 19 ? 8.269  -24.460 35.378 1.00 0.00 ? 19 MET A HE1    1 
ATOM 250  H HE2    . MET A 1 19 ? 9.298  -24.515 36.845 1.00 0.00 ? 19 MET A HE2    1 
ATOM 251  H HE3    . MET A 1 19 ? 7.518  -24.449 37.005 1.00 0.00 ? 19 MET A HE3    1 
ATOM 252  N N      . LYS A 1 20 ? 12.421 -20.880 34.123 1.00 0.00 ? 20 LYS A N      1 
ATOM 253  C CA     . LYS A 1 20 ? 12.420 -19.517 33.600 1.00 0.00 ? 20 LYS A CA     1 
ATOM 254  C C      . LYS A 1 20 ? 12.926 -19.482 32.179 1.00 0.00 ? 20 LYS A C      1 
ATOM 255  O O      . LYS A 1 20 ? 12.408 -18.755 31.314 1.00 0.00 ? 20 LYS A O      1 
ATOM 256  C CB     . LYS A 1 20 ? 13.283 -18.610 34.519 1.00 0.00 ? 20 LYS A CB     1 
ATOM 257  C CG     . LYS A 1 20 ? 13.166 -18.963 36.021 1.00 0.00 ? 20 LYS A CG     1 
ATOM 258  C CD     . LYS A 1 20 ? 13.124 -17.758 36.967 1.00 0.00 ? 20 LYS A CD     1 
ATOM 259  C CE     . LYS A 1 20 ? 12.836 -18.241 38.393 1.00 0.00 ? 20 LYS A CE     1 
ATOM 260  N NZ     . LYS A 1 20 ? 12.964 -17.113 39.329 1.00 0.00 ? 20 LYS A NZ     1 
ATOM 261  H H      . LYS A 1 20 ? 13.057 -21.178 34.944 1.00 0.00 ? 20 LYS A H      1 
ATOM 262  H HA     . LYS A 1 20 ? 11.376 -19.149 33.593 1.00 0.00 ? 20 LYS A HA     1 
ATOM 263  H HB2    . LYS A 1 20 ? 14.348 -18.677 34.212 1.00 0.00 ? 20 LYS A HB2    1 
ATOM 264  H HB3    . LYS A 1 20 ? 13.006 -17.545 34.357 1.00 0.00 ? 20 LYS A HB3    1 
ATOM 265  H HG2    . LYS A 1 20 ? 12.238 -19.537 36.210 1.00 0.00 ? 20 LYS A HG2    1 
ATOM 266  H HG3    . LYS A 1 20 ? 13.995 -19.640 36.309 1.00 0.00 ? 20 LYS A HG3    1 
ATOM 267  H HD2    . LYS A 1 20 ? 14.083 -17.207 36.911 1.00 0.00 ? 20 LYS A HD2    1 
ATOM 268  H HD3    . LYS A 1 20 ? 12.339 -17.049 36.635 1.00 0.00 ? 20 LYS A HD3    1 
ATOM 269  H HE2    . LYS A 1 20 ? 11.817 -18.682 38.454 1.00 0.00 ? 20 LYS A HE2    1 
ATOM 270  H HE3    . LYS A 1 20 ? 13.532 -19.052 38.688 1.00 0.00 ? 20 LYS A HE3    1 
ATOM 271  H HZ1    . LYS A 1 20 ? 12.613 -16.246 38.904 1.00 0.00 ? 20 LYS A HZ1    1 
ATOM 272  H HZ3    . LYS A 1 20 ? 12.403 -17.265 40.175 1.00 0.00 ? 20 LYS A HZ3    1 
ATOM 273  N N      . ALA A 1 21 ? 14.073 -20.364 31.876 1.00 0.00 ? 21 ALA A N      1 
ATOM 274  C CA     . ALA A 1 21 ? 14.665 -20.432 30.540 1.00 0.00 ? 21 ALA A CA     1 
ATOM 275  C C      . ALA A 1 21 ? 13.685 -20.997 29.543 1.00 0.00 ? 21 ALA A C      1 
ATOM 276  O O      . ALA A 1 21 ? 13.590 -20.551 28.395 1.00 0.00 ? 21 ALA A O      1 
ATOM 277  C CB     . ALA A 1 21 ? 15.954 -21.267 30.650 1.00 0.00 ? 21 ALA A CB     1 
ATOM 278  H H      . ALA A 1 21 ? 14.445 -20.956 32.700 1.00 0.00 ? 21 ALA A H      1 
ATOM 279  H HA     . ALA A 1 21 ? 14.918 -19.408 30.215 1.00 0.00 ? 21 ALA A HA     1 
ATOM 280  H HB1    . ALA A 1 21 ? 16.473 -21.352 29.676 1.00 0.00 ? 21 ALA A HB1    1 
ATOM 281  H HB2    . ALA A 1 21 ? 16.678 -20.820 31.360 1.00 0.00 ? 21 ALA A HB2    1 
ATOM 282  H HB3    . ALA A 1 21 ? 15.755 -22.300 31.000 1.00 0.00 ? 21 ALA A HB3    1 
ATOM 283  N N      . ILE A 1 22 ? 12.851 -22.124 30.013 1.00 0.00 ? 22 ILE A N      1 
ATOM 284  C CA     . ILE A 1 22 ? 11.863 -22.767 29.157 1.00 0.00 ? 22 ILE A CA     1 
ATOM 285  C C      . ILE A 1 22 ? 10.753 -21.810 28.800 1.00 0.00 ? 22 ILE A C      1 
ATOM 286  O O      . ILE A 1 22 ? 10.259 -21.770 27.661 1.00 0.00 ? 22 ILE A O      1 
ATOM 287  C CB     . ILE A 1 22 ? 11.303 -24.092 29.816 1.00 0.00 ? 22 ILE A CB     1 
ATOM 288  C CG1    . ILE A 1 22 ? 9.769  -24.068 30.130 1.00 0.00 ? 22 ILE A CG1    1 
ATOM 289  C CG2    . ILE A 1 22 ? 12.055 -24.486 31.125 1.00 0.00 ? 22 ILE A CG2    1 
ATOM 290  C CD1    . ILE A 1 22 ? 9.042  -22.743 29.820 1.00 0.00 ? 22 ILE A CD1    1 
ATOM 291  H H      . ILE A 1 22 ? 13.021 -22.445 31.033 1.00 0.00 ? 22 ILE A H      1 
ATOM 292  H HA     . ILE A 1 22 ? 12.365 -23.036 28.209 1.00 0.00 ? 22 ILE A HA     1 
ATOM 293  H HB     . ILE A 1 22 ? 11.464 -24.910 29.080 1.00 0.00 ? 22 ILE A HB     1 
ATOM 294  H HG12   . ILE A 1 22 ? 9.262  -24.910 29.629 1.00 0.00 ? 22 ILE A HG12   1 
ATOM 295  H HG13   . ILE A 1 22 ? 9.613  -24.253 31.212 1.00 0.00 ? 22 ILE A HG13   1 
ATOM 296  H HG21   . ILE A 1 22 ? 12.727 -23.685 31.478 1.00 0.00 ? 22 ILE A HG21   1 
ATOM 297  H HG22   . ILE A 1 22 ? 11.367 -24.719 31.955 1.00 0.00 ? 22 ILE A HG22   1 
ATOM 298  H HG23   . ILE A 1 22 ? 12.668 -25.401 31.015 1.00 0.00 ? 22 ILE A HG23   1 
ATOM 299  H HD11   . ILE A 1 22 ? 9.735  -21.942 29.505 1.00 0.00 ? 22 ILE A HD11   1 
ATOM 300  H HD12   . ILE A 1 22 ? 8.313  -22.870 29.001 1.00 0.00 ? 22 ILE A HD12   1 
ATOM 301  H HD13   . ILE A 1 22 ? 8.480  -22.368 30.697 1.00 0.00 ? 22 ILE A HD13   1 
ATOM 302  N N      . GLY A 1 23 ? 10.289 -20.918 29.882 1.00 0.00 ? 23 GLY A N      1 
ATOM 303  C CA     . GLY A 1 23 ? 9.223  -19.943 29.681 1.00 0.00 ? 23 GLY A CA     1 
ATOM 304  C C      . GLY A 1 23 ? 9.592  -18.954 28.606 1.00 0.00 ? 23 GLY A C      1 
ATOM 305  O O      . GLY A 1 23 ? 8.746  -18.281 28.021 1.00 0.00 ? 23 GLY A O      1 
ATOM 306  H H      . GLY A 1 23 ? 10.788 -21.034 30.834 1.00 0.00 ? 23 GLY A H      1 
ATOM 307  H HA2    . GLY A 1 23 ? 8.284  -20.454 29.399 1.00 0.00 ? 23 GLY A HA2    1 
ATOM 308  H HA3    . GLY A 1 23 ? 9.017  -19.397 30.621 1.00 0.00 ? 23 GLY A HA3    1 
ATOM 309  N N      . GLY A 1 24 ? 11.033 -18.837 28.297 1.00 0.00 ? 24 GLY A N      1 
ATOM 310  C CA     . GLY A 1 24 ? 11.536 -17.920 27.278 1.00 0.00 ? 24 GLY A CA     1 
ATOM 311  C C      . GLY A 1 24 ? 10.954 -18.244 25.924 1.00 0.00 ? 24 GLY A C      1 
ATOM 312  O O      . GLY A 1 24 ? 10.938 -17.424 25.011 1.00 0.00 ? 24 GLY A O      1 
ATOM 313  H H      . GLY A 1 24 ? 11.692 -19.473 28.870 1.00 0.00 ? 24 GLY A H      1 
ATOM 314  H HA2    . GLY A 1 24 ? 11.283 -16.877 27.544 1.00 0.00 ? 24 GLY A HA2    1 
ATOM 315  H HA3    . GLY A 1 24 ? 12.642 -17.978 27.224 1.00 0.00 ? 24 GLY A HA3    1 
ATOM 316  N N      . TYR A 1 25 ? 10.406 -19.606 25.762 1.00 0.00 ? 25 TYR A N      1 
ATOM 317  C CA     . TYR A 1 25 ? 9.811  -20.058 24.507 1.00 0.00 ? 25 TYR A CA     1 
ATOM 318  C C      . TYR A 1 25 ? 8.554  -19.278 24.194 1.00 0.00 ? 25 TYR A C      1 
ATOM 319  O O      . TYR A 1 25 ? 8.288  -18.910 23.048 1.00 0.00 ? 25 TYR A O      1 
ATOM 320  C CB     . TYR A 1 25 ? 9.430  -21.564 24.585 1.00 0.00 ? 25 TYR A CB     1 
ATOM 321  C CG     . TYR A 1 25 ? 9.032  -22.248 23.271 1.00 0.00 ? 25 TYR A CG     1 
ATOM 322  C CD1    . TYR A 1 25 ? 9.173  -21.581 22.052 1.00 0.00 ? 25 TYR A CD1    1 
ATOM 323  C CD2    . TYR A 1 25 ? 8.528  -23.551 23.292 1.00 0.00 ? 25 TYR A CD2    1 
ATOM 324  C CE1    . TYR A 1 25 ? 8.819  -22.216 20.864 1.00 0.00 ? 25 TYR A CE1    1 
ATOM 325  C CE2    . TYR A 1 25 ? 8.177  -24.186 22.104 1.00 0.00 ? 25 TYR A CE2    1 
ATOM 326  C CZ     . TYR A 1 25 ? 8.325  -23.518 20.890 1.00 0.00 ? 25 TYR A CZ     1 
ATOM 327  O OH     . TYR A 1 25 ? 7.984  -24.141 19.723 1.00 0.00 ? 25 TYR A OH     1 
ATOM 328  H H      . TYR A 1 25 ? 10.470 -20.249 26.627 1.00 0.00 ? 25 TYR A H      1 
ATOM 329  H HA     . TYR A 1 25 ? 10.531 -19.891 23.685 1.00 0.00 ? 25 TYR A HA     1 
ATOM 330  H HB2    . TYR A 1 25 ? 10.260 -22.129 25.058 1.00 0.00 ? 25 TYR A HB2    1 
ATOM 331  H HB3    . TYR A 1 25 ? 8.590  -21.703 25.297 1.00 0.00 ? 25 TYR A HB3    1 
ATOM 332  H HD1    . TYR A 1 25 ? 9.564  -20.573 22.020 1.00 0.00 ? 25 TYR A HD1    1 
ATOM 333  H HD2    . TYR A 1 25 ? 8.421  -24.080 24.232 1.00 0.00 ? 25 TYR A HD2    1 
ATOM 334  H HE1    . TYR A 1 25 ? 8.938  -21.707 19.918 1.00 0.00 ? 25 TYR A HE1    1 
ATOM 335  H HE2    . TYR A 1 25 ? 7.797  -25.195 22.132 1.00 0.00 ? 25 TYR A HE2    1 
ATOM 336  H HH     . TYR A 1 25 ? 7.667  -25.022 19.931 1.00 0.00 ? 25 TYR A HH     1 
ATOM 337  N N      . ILE A 1 26 ? 7.670  -18.980 25.340 1.00 0.00 ? 26 ILE A N      1 
ATOM 338  C CA     . ILE A 1 26 ? 6.425  -18.235 25.183 1.00 0.00 ? 26 ILE A CA     1 
ATOM 339  C C      . ILE A 1 26 ? 6.694  -16.816 24.739 1.00 0.00 ? 26 ILE A C      1 
ATOM 340  O O      . ILE A 1 26 ? 5.986  -16.246 23.899 1.00 0.00 ? 26 ILE A O      1 
ATOM 341  C CB     . ILE A 1 26 ? 5.554  -18.284 26.504 1.00 0.00 ? 26 ILE A CB     1 
ATOM 342  C CG1    . ILE A 1 26 ? 5.580  -16.971 27.349 1.00 0.00 ? 26 ILE A CG1    1 
ATOM 343  C CG2    . ILE A 1 26 ? 5.939  -19.469 27.440 1.00 0.00 ? 26 ILE A CG2    1 
ATOM 344  C CD1    . ILE A 1 26 ? 4.265  -16.164 27.382 1.00 0.00 ? 26 ILE A CD1    1 
ATOM 345  H H      . ILE A 1 26 ? 7.998  -19.347 26.300 1.00 0.00 ? 26 ILE A H      1 
ATOM 346  H HA     . ILE A 1 26 ? 5.850  -18.713 24.370 1.00 0.00 ? 26 ILE A HA     1 
ATOM 347  H HB     . ILE A 1 26 ? 4.500  -18.435 26.183 1.00 0.00 ? 26 ILE A HB     1 
ATOM 348  H HG12   . ILE A 1 26 ? 5.920  -17.184 28.380 1.00 0.00 ? 26 ILE A HG12   1 
ATOM 349  H HG13   . ILE A 1 26 ? 6.345  -16.284 26.942 1.00 0.00 ? 26 ILE A HG13   1 
ATOM 350  H HG21   . ILE A 1 26 ? 5.833  -20.457 26.955 1.00 0.00 ? 26 ILE A HG21   1 
ATOM 351  H HG22   . ILE A 1 26 ? 6.978  -19.394 27.805 1.00 0.00 ? 26 ILE A HG22   1 
ATOM 352  H HG23   . ILE A 1 26 ? 5.289  -19.529 28.333 1.00 0.00 ? 26 ILE A HG23   1 
ATOM 353  H HD11   . ILE A 1 26 ? 4.461  -15.079 27.298 1.00 0.00 ? 26 ILE A HD11   1 
ATOM 354  H HD12   . ILE A 1 26 ? 3.597  -16.439 26.543 1.00 0.00 ? 26 ILE A HD12   1 
ATOM 355  H HD13   . ILE A 1 26 ? 3.700  -16.312 28.320 1.00 0.00 ? 26 ILE A HD13   1 
ATOM 356  N N      . VAL A 1 27 ? 7.856  -16.150 25.369 1.00 0.00 ? 27 VAL A N      1 
ATOM 357  C CA     . VAL A 1 27 ? 8.237  -14.779 25.038 1.00 0.00 ? 27 VAL A CA     1 
ATOM 358  C C      . VAL A 1 27 ? 8.681  -14.678 23.597 1.00 0.00 ? 27 VAL A C      1 
ATOM 359  O O      . VAL A 1 27 ? 8.374  -13.713 22.886 1.00 0.00 ? 27 VAL A O      1 
ATOM 360  C CB     . VAL A 1 27 ? 9.376  -14.289 26.015 1.00 0.00 ? 27 VAL A CB     1 
ATOM 361  C CG1    . VAL A 1 27 ? 10.275 -13.133 25.500 1.00 0.00 ? 27 VAL A CG1    1 
ATOM 362  C CG2    . VAL A 1 27 ? 8.862  -13.819 27.399 1.00 0.00 ? 27 VAL A CG2    1 
ATOM 363  H H      . VAL A 1 27 ? 8.405  -16.737 26.091 1.00 0.00 ? 27 VAL A H      1 
ATOM 364  H HA     . VAL A 1 27 ? 7.353  -14.128 25.152 1.00 0.00 ? 27 VAL A HA     1 
ATOM 365  H HB     . VAL A 1 27 ? 10.049 -15.155 26.195 1.00 0.00 ? 27 VAL A HB     1 
ATOM 366  H HG11   . VAL A 1 27 ? 9.697  -12.216 25.268 1.00 0.00 ? 27 VAL A HG11   1 
ATOM 367  H HG12   . VAL A 1 27 ? 11.056 -12.851 26.231 1.00 0.00 ? 27 VAL A HG12   1 
ATOM 368  H HG13   . VAL A 1 27 ? 10.830 -13.404 24.583 1.00 0.00 ? 27 VAL A HG13   1 
ATOM 369  H HG21   . VAL A 1 27 ? 8.230  -12.913 27.323 1.00 0.00 ? 27 VAL A HG21   1 
ATOM 370  H HG22   . VAL A 1 27 ? 8.254  -14.597 27.896 1.00 0.00 ? 27 VAL A HG22   1 
ATOM 371  H HG23   . VAL A 1 27 ? 9.691  -13.590 28.091 1.00 0.00 ? 27 VAL A HG23   1 
ATOM 372  N N      . GLY A 1 28 ? 9.503  -15.796 23.091 1.00 0.00 ? 28 GLY A N      1 
ATOM 373  C CA     . GLY A 1 28 ? 10.003 -15.827 21.721 1.00 0.00 ? 28 GLY A CA     1 
ATOM 374  C C      . GLY A 1 28 ? 8.898  -16.169 20.750 1.00 0.00 ? 28 GLY A C      1 
ATOM 375  O O      . GLY A 1 28 ? 9.074  -16.161 19.536 1.00 0.00 ? 28 GLY A O      1 
ATOM 376  H H      . GLY A 1 28 ? 9.714  -16.586 23.796 1.00 0.00 ? 28 GLY A H      1 
ATOM 377  H HA2    . GLY A 1 28 ? 10.439 -14.850 21.447 1.00 0.00 ? 28 GLY A HA2    1 
ATOM 378  H HA3    . GLY A 1 28 ? 10.812 -16.578 21.626 1.00 0.00 ? 28 GLY A HA3    1 
ATOM 379  N N      . ALA A 1 29 ? 7.589  -16.513 21.350 1.00 0.00 ? 29 ALA A N      1 
ATOM 380  C CA     . ALA A 1 29 ? 6.433  -16.861 20.534 1.00 0.00 ? 29 ALA A CA     1 
ATOM 381  C C      . ALA A 1 29 ? 5.986  -15.686 19.696 1.00 0.00 ? 29 ALA A C      1 
ATOM 382  O O      . ALA A 1 29 ? 5.602  -15.822 18.528 1.00 0.00 ? 29 ALA A O      1 
ATOM 383  C CB     . ALA A 1 29 ? 5.331  -17.371 21.477 1.00 0.00 ? 29 ALA A CB     1 
ATOM 384  H H      . ALA A 1 29 ? 7.543  -16.488 22.427 1.00 0.00 ? 29 ALA A H      1 
ATOM 385  H HA     . ALA A 1 29 ? 6.721  -17.670 19.836 1.00 0.00 ? 29 ALA A HA     1 
ATOM 386  H HB1    . ALA A 1 29 ? 4.423  -17.678 20.927 1.00 0.00 ? 29 ALA A HB1    1 
ATOM 387  H HB2    . ALA A 1 29 ? 5.664  -18.254 22.056 1.00 0.00 ? 29 ALA A HB2    1 
ATOM 388  H HB3    . ALA A 1 29 ? 5.024  -16.603 22.213 1.00 0.00 ? 29 ALA A HB3    1 
ATOM 389  N N      . LEU A 1 30 ? 6.023  -14.366 20.361 1.00 0.00 ? 30 LEU A N      1 
ATOM 390  C CA     . LEU A 1 30 ? 5.621  -13.142 19.675 1.00 0.00 ? 30 LEU A CA     1 
ATOM 391  C C      . LEU A 1 30 ? 6.550  -12.835 18.523 1.00 0.00 ? 30 LEU A C      1 
ATOM 392  O O      . LEU A 1 30 ? 6.130  -12.401 17.440 1.00 0.00 ? 30 LEU A O      1 
ATOM 393  C CB     . LEU A 1 30 ? 5.559  -11.953 20.674 1.00 0.00 ? 30 LEU A CB     1 
ATOM 394  C CG     . LEU A 1 30 ? 4.623  -12.078 21.903 1.00 0.00 ? 30 LEU A CG     1 
ATOM 395  C CD1    . LEU A 1 30 ? 4.615  -10.767 22.702 1.00 0.00 ? 30 LEU A CD1    1 
ATOM 396  C CD2    . LEU A 1 30 ? 3.181  -12.457 21.521 1.00 0.00 ? 30 LEU A CD2    1 
ATOM 397  H H      . LEU A 1 30 ? 6.349  -14.360 21.332 1.00 0.00 ? 30 LEU A H      1 
ATOM 398  H HA     . LEU A 1 30 ? 4.620  -13.303 19.230 1.00 0.00 ? 30 LEU A HA     1 
ATOM 399  H HB2    . LEU A 1 30 ? 6.583  -11.740 21.040 1.00 0.00 ? 30 LEU A HB2    1 
ATOM 400  H HB3    . LEU A 1 30 ? 5.274  -11.037 20.114 1.00 0.00 ? 30 LEU A HB3    1 
ATOM 401  H HG     . LEU A 1 30 ? 5.027  -12.875 22.565 1.00 0.00 ? 30 LEU A HG     1 
ATOM 402  H HD11   . LEU A 1 30 ? 5.634  -10.482 23.031 1.00 0.00 ? 30 LEU A HD11   1 
ATOM 403  H HD12   . LEU A 1 30 ? 4.216  -9.921  22.112 1.00 0.00 ? 30 LEU A HD12   1 
ATOM 404  H HD13   . LEU A 1 30 ? 3.998  -10.848 23.615 1.00 0.00 ? 30 LEU A HD13   1 
ATOM 405  H HD21   . LEU A 1 30 ? 2.516  -12.501 22.403 1.00 0.00 ? 30 LEU A HD21   1 
ATOM 406  H HD22   . LEU A 1 30 ? 2.738  -11.744 20.803 1.00 0.00 ? 30 LEU A HD22   1 
ATOM 407  H HD23   . LEU A 1 30 ? 3.142  -13.461 21.058 1.00 0.00 ? 30 LEU A HD23   1 
ATOM 408  N N      . VAL A 1 31 ? 7.987  -13.080 18.770 1.00 0.00 ? 31 VAL A N      1 
ATOM 409  C CA     . VAL A 1 31 ? 8.999  -12.827 17.750 1.00 0.00 ? 31 VAL A CA     1 
ATOM 410  C C      . VAL A 1 31 ? 8.821  -13.750 16.568 1.00 0.00 ? 31 VAL A C      1 
ATOM 411  O O      . VAL A 1 31 ? 8.967  -13.360 15.403 1.00 0.00 ? 31 VAL A O      1 
ATOM 412  C CB     . VAL A 1 31 ? 10.443 -12.992 18.374 1.00 0.00 ? 31 VAL A CB     1 
ATOM 413  C CG1    . VAL A 1 31 ? 11.547 -12.051 17.817 1.00 0.00 ? 31 VAL A CG1    1 
ATOM 414  C CG2    . VAL A 1 31 ? 10.485 -12.807 19.912 1.00 0.00 ? 31 VAL A CG2    1 
ATOM 415  H H      . VAL A 1 31 ? 8.242  -13.458 19.751 1.00 0.00 ? 31 VAL A H      1 
ATOM 416  H HA     . VAL A 1 31 ? 8.880  -11.795 17.377 1.00 0.00 ? 31 VAL A HA     1 
ATOM 417  H HB     . VAL A 1 31 ? 10.775 -14.031 18.162 1.00 0.00 ? 31 VAL A HB     1 
ATOM 418  H HG11   . VAL A 1 31 ? 11.302 -10.982 17.960 1.00 0.00 ? 31 VAL A HG11   1 
ATOM 419  H HG12   . VAL A 1 31 ? 12.529 -12.231 18.292 1.00 0.00 ? 31 VAL A HG12   1 
ATOM 420  H HG13   . VAL A 1 31 ? 11.724 -12.203 16.734 1.00 0.00 ? 31 VAL A HG13   1 
ATOM 421  H HG21   . VAL A 1 31 ? 10.234 -11.773 20.213 1.00 0.00 ? 31 VAL A HG21   1 
ATOM 422  H HG22   . VAL A 1 31 ? 9.779  -13.480 20.427 1.00 0.00 ? 31 VAL A HG22   1 
ATOM 423  H HG23   . VAL A 1 31 ? 11.485 -13.034 20.326 1.00 0.00 ? 31 VAL A HG23   1 
ATOM 424  N N      . ILE A 1 32 ? 8.455  -15.147 16.885 1.00 0.00 ? 32 ILE A N      1 
ATOM 425  C CA     . ILE A 1 32 ? 8.248  -16.150 15.843 1.00 0.00 ? 32 ILE A CA     1 
ATOM 426  C C      . ILE A 1 32 ? 7.059  -15.801 14.987 1.00 0.00 ? 32 ILE A C      1 
ATOM 427  O O      . ILE A 1 32 ? 7.063  -15.962 13.756 1.00 0.00 ? 32 ILE A O      1 
ATOM 428  C CB     . ILE A 1 32 ? 8.124  -17.604 16.458 1.00 0.00 ? 32 ILE A CB     1 
ATOM 429  C CG1    . ILE A 1 32 ? 9.293  -18.004 17.420 1.00 0.00 ? 32 ILE A CG1    1 
ATOM 430  C CG2    . ILE A 1 32 ? 7.994  -18.712 15.368 1.00 0.00 ? 32 ILE A CG2    1 
ATOM 431  C CD1    . ILE A 1 32 ? 9.052  -19.263 18.279 1.00 0.00 ? 32 ILE A CD1    1 
ATOM 432  H H      . ILE A 1 32 ? 8.352  -15.383 17.934 1.00 0.00 ? 32 ILE A H      1 
ATOM 433  H HA     . ILE A 1 32 ? 9.131  -16.127 15.180 1.00 0.00 ? 32 ILE A HA     1 
ATOM 434  H HB     . ILE A 1 32 ? 7.194  -17.615 17.062 1.00 0.00 ? 32 ILE A HB     1 
ATOM 435  H HG12   . ILE A 1 32 ? 10.239 -18.105 16.854 1.00 0.00 ? 32 ILE A HG12   1 
ATOM 436  H HG13   . ILE A 1 32 ? 9.478  -17.182 18.136 1.00 0.00 ? 32 ILE A HG13   1 
ATOM 437  H HG21   . ILE A 1 32 ? 7.117  -18.572 14.711 1.00 0.00 ? 32 ILE A HG21   1 
ATOM 438  H HG22   . ILE A 1 32 ? 8.887  -18.765 14.718 1.00 0.00 ? 32 ILE A HG22   1 
ATOM 439  H HG23   . ILE A 1 32 ? 7.852  -19.718 15.805 1.00 0.00 ? 32 ILE A HG23   1 
ATOM 440  H HD11   . ILE A 1 32 ? 9.889  -19.435 18.981 1.00 0.00 ? 32 ILE A HD11   1 
ATOM 441  H HD12   . ILE A 1 32 ? 8.130  -19.174 18.889 1.00 0.00 ? 32 ILE A HD12   1 
ATOM 442  H HD13   . ILE A 1 32 ? 8.957  -20.181 17.670 1.00 0.00 ? 32 ILE A HD13   1 
ATOM 443  N N      . LEU A 1 33 ? 5.881  -15.253 15.700 1.00 0.00 ? 33 LEU A N      1 
ATOM 444  C CA     . LEU A 1 33 ? 4.659  -14.872 14.999 1.00 0.00 ? 33 LEU A CA     1 
ATOM 445  C C      . LEU A 1 33 ? 4.910  -13.708 14.070 1.00 0.00 ? 33 LEU A C      1 
ATOM 446  O O      . LEU A 1 33 ? 4.399  -13.644 12.943 1.00 0.00 ? 33 LEU A O      1 
ATOM 447  C CB     . LEU A 1 33 ? 3.530  -14.536 16.014 1.00 0.00 ? 33 LEU A CB     1 
ATOM 448  C CG     . LEU A 1 33 ? 3.042  -13.065 16.102 1.00 0.00 ? 33 LEU A CG     1 
ATOM 449  C CD1    . LEU A 1 33 ? 2.000  -12.787 15.010 1.00 0.00 ? 33 LEU A CD1    1 
ATOM 450  C CD2    . LEU A 1 33 ? 2.454  -12.717 17.481 1.00 0.00 ? 33 LEU A CD2    1 
ATOM 451  H H      . LEU A 1 33 ? 5.976  -15.160 16.717 1.00 0.00 ? 33 LEU A H      1 
ATOM 452  H HA     . LEU A 1 33 ? 4.344  -15.715 14.361 1.00 0.00 ? 33 LEU A HA     1 
ATOM 453  H HB2    . LEU A 1 33 ? 2.650  -15.177 15.791 1.00 0.00 ? 33 LEU A HB2    1 
ATOM 454  H HB3    . LEU A 1 33 ? 3.857  -14.853 17.022 1.00 0.00 ? 33 LEU A HB3    1 
ATOM 455  H HG     . LEU A 1 33 ? 3.909  -12.400 15.920 1.00 0.00 ? 33 LEU A HG     1 
ATOM 456  H HD11   . LEU A 1 33 ? 2.402  -12.984 13.998 1.00 0.00 ? 33 LEU A HD11   1 
ATOM 457  H HD12   . LEU A 1 33 ? 1.091  -13.410 15.128 1.00 0.00 ? 33 LEU A HD12   1 
ATOM 458  H HD13   . LEU A 1 33 ? 1.673  -11.732 15.018 1.00 0.00 ? 33 LEU A HD13   1 
ATOM 459  H HD21   . LEU A 1 33 ? 1.346  -12.712 17.475 1.00 0.00 ? 33 LEU A HD21   1 
ATOM 460  H HD22   . LEU A 1 33 ? 2.773  -13.444 18.250 1.00 0.00 ? 33 LEU A HD22   1 
ATOM 461  H HD23   . LEU A 1 33 ? 2.790  -11.727 17.837 1.00 0.00 ? 33 LEU A HD23   1 
ATOM 462  N N      . ALA A 1 34 ? 5.807  -12.648 14.583 1.00 0.00 ? 34 ALA A N      1 
ATOM 463  C CA     . ALA A 1 34 ? 6.139  -11.464 13.795 1.00 0.00 ? 34 ALA A CA     1 
ATOM 464  C C      . ALA A 1 34 ? 6.930  -11.843 12.563 1.00 0.00 ? 34 ALA A C      1 
ATOM 465  O O      . ALA A 1 34 ? 6.742  -11.295 11.471 1.00 0.00 ? 34 ALA A O      1 
ATOM 466  C CB     . ALA A 1 34 ? 6.894  -10.489 14.712 1.00 0.00 ? 34 ALA A CB     1 
ATOM 467  H H      . ALA A 1 34 ? 6.200  -12.801 15.579 1.00 0.00 ? 34 ALA A H      1 
ATOM 468  H HA     . ALA A 1 34 ? 5.199  -10.993 13.449 1.00 0.00 ? 34 ALA A HA     1 
ATOM 469  H HB1    . ALA A 1 34 ? 7.166  -9.557  14.185 1.00 0.00 ? 34 ALA A HB1    1 
ATOM 470  H HB2    . ALA A 1 34 ? 6.285  -10.195 15.588 1.00 0.00 ? 34 ALA A HB2    1 
ATOM 471  H HB3    . ALA A 1 34 ? 7.834  -10.928 15.104 1.00 0.00 ? 34 ALA A HB3    1 
ATOM 472  N N      . VAL A 1 35 ? 7.952  -12.895 12.746 1.00 0.00 ? 35 VAL A N      1 
ATOM 473  C CA     . VAL A 1 35 ? 8.789  -13.360 11.644 1.00 0.00 ? 35 VAL A CA     1 
ATOM 474  C C      . VAL A 1 35 ? 7.959  -14.042 10.584 1.00 0.00 ? 35 VAL A C      1 
ATOM 475  O O      . VAL A 1 35 ? 8.177  -13.881 9.376  1.00 0.00 ? 35 VAL A O      1 
ATOM 476  C CB     . VAL A 1 35 ? 9.910  -14.331 12.195 1.00 0.00 ? 35 VAL A CB     1 
ATOM 477  C CG1    . VAL A 1 35 ? 10.703 -13.831 13.433 1.00 0.00 ? 35 VAL A CG1    1 
ATOM 478  C CG2    . VAL A 1 35 ? 9.389  -15.733 12.583 1.00 0.00 ? 35 VAL A CG2    1 
ATOM 479  H H      . VAL A 1 35 ? 8.041  -13.300 13.744 1.00 0.00 ? 35 VAL A H      1 
ATOM 480  H HA     . VAL A 1 35 ? 9.269  -12.484 11.169 1.00 0.00 ? 35 VAL A HA     1 
ATOM 481  H HB     . VAL A 1 35 ? 10.651 -14.468 11.381 1.00 0.00 ? 35 VAL A HB     1 
ATOM 482  H HG11   . VAL A 1 35 ? 10.519 -12.760 13.650 1.00 0.00 ? 35 VAL A HG11   1 
ATOM 483  H HG12   . VAL A 1 35 ? 10.460 -14.393 14.349 1.00 0.00 ? 35 VAL A HG12   1 
ATOM 484  H HG13   . VAL A 1 35 ? 11.801 -13.902 13.288 1.00 0.00 ? 35 VAL A HG13   1 
ATOM 485  H HG21   . VAL A 1 35 ? 9.171  -15.818 13.663 1.00 0.00 ? 35 VAL A HG21   1 
ATOM 486  H HG22   . VAL A 1 35 ? 8.464  -15.996 12.042 1.00 0.00 ? 35 VAL A HG22   1 
ATOM 487  H HG23   . VAL A 1 35 ? 10.122 -16.527 12.335 1.00 0.00 ? 35 VAL A HG23   1 
ATOM 488  N N      . ALA A 1 36 ? 6.870  -14.913 11.075 1.00 0.00 ? 36 ALA A N      1 
ATOM 489  C CA     . ALA A 1 36 ? 5.987  -15.635 10.163 1.00 0.00 ? 36 ALA A CA     1 
ATOM 490  C C      . ALA A 1 36 ? 5.151  -14.679 9.346  1.00 0.00 ? 36 ALA A C      1 
ATOM 491  O O      . ALA A 1 36 ? 4.911  -14.876 8.149  1.00 0.00 ? 36 ALA A O      1 
ATOM 492  C CB     . ALA A 1 36 ? 5.136  -16.598 11.005 1.00 0.00 ? 36 ALA A CB     1 
ATOM 493  H H      . ALA A 1 36 ? 6.764  -14.981 12.148 1.00 0.00 ? 36 ALA A H      1 
ATOM 494  H HA     . ALA A 1 36 ? 6.610  -16.215 9.454  1.00 0.00 ? 36 ALA A HA     1 
ATOM 495  H HB1    . ALA A 1 36 ? 4.451  -17.200 10.380 1.00 0.00 ? 36 ALA A HB1    1 
ATOM 496  H HB2    . ALA A 1 36 ? 5.763  -17.317 11.566 1.00 0.00 ? 36 ALA A HB2    1 
ATOM 497  H HB3    . ALA A 1 36 ? 4.511  -16.065 11.749 1.00 0.00 ? 36 ALA A HB3    1 
ATOM 498  N N      . GLY A 1 37 ? 4.629  -13.496 10.066 1.00 0.00 ? 37 GLY A N      1 
ATOM 499  C CA     . GLY A 1 37 ? 3.805  -12.489 9.403  1.00 0.00 ? 37 GLY A CA     1 
ATOM 500  C C      . GLY A 1 37 ? 4.593  -11.765 8.338  1.00 0.00 ? 37 GLY A C      1 
ATOM 501  O O      . GLY A 1 37 ? 4.099  -11.469 7.252  1.00 0.00 ? 37 GLY A O      1 
ATOM 502  H H      . GLY A 1 37 ? 4.890  -13.425 11.112 1.00 0.00 ? 37 GLY A H      1 
ATOM 503  H HA2    . GLY A 1 37 ? 2.918  -12.961 8.944  1.00 0.00 ? 37 GLY A HA2    1 
ATOM 504  H HA3    . GLY A 1 37 ? 3.432  -11.754 10.142 1.00 0.00 ? 37 GLY A HA3    1 
ATOM 505  N N      . LEU A 1 38 ? 5.996  -11.439 8.675  1.00 0.00 ? 38 LEU A N      1 
ATOM 506  C CA     . LEU A 1 38 ? 6.873  -10.740 7.741  1.00 0.00 ? 38 LEU A CA     1 
ATOM 507  C C      . LEU A 1 38 ? 7.133  -11.581 6.512  1.00 0.00 ? 38 LEU A C      1 
ATOM 508  O O      . LEU A 1 38 ? 7.170  -11.088 5.376  1.00 0.00 ? 38 LEU A O      1 
ATOM 509  C CB     . LEU A 1 38 ? 8.210  -10.345 8.436  1.00 0.00 ? 38 LEU A CB     1 
ATOM 510  C CG     . LEU A 1 38 ? 8.161  -9.254  9.538  1.00 0.00 ? 38 LEU A CG     1 
ATOM 511  C CD1    . LEU A 1 38 ? 8.718  -7.931  8.994  1.00 0.00 ? 38 LEU A CD1    1 
ATOM 512  C CD2    . LEU A 1 38 ? 6.744  -9.029  10.090 1.00 0.00 ? 38 LEU A CD2    1 
ATOM 513  H H      . LEU A 1 38 ? 6.313  -11.728 9.606  1.00 0.00 ? 38 LEU A H      1 
ATOM 514  H HA     . LEU A 1 38 ? 6.358  -9.830  7.389  1.00 0.00 ? 38 LEU A HA     1 
ATOM 515  H HB2    . LEU A 1 38 ? 8.663  -11.258 8.875  1.00 0.00 ? 38 LEU A HB2    1 
ATOM 516  H HB3    . LEU A 1 38 ? 8.929  -10.025 7.659  1.00 0.00 ? 38 LEU A HB3    1 
ATOM 517  H HG     . LEU A 1 38 ? 8.814  -9.578  10.376 1.00 0.00 ? 38 LEU A HG     1 
ATOM 518  H HD11   . LEU A 1 38 ? 9.757  -8.044  8.625  1.00 0.00 ? 38 LEU A HD11   1 
ATOM 519  H HD12   . LEU A 1 38 ? 8.116  -7.535  8.154  1.00 0.00 ? 38 LEU A HD12   1 
ATOM 520  H HD13   . LEU A 1 38 ? 8.747  -7.149  9.775  1.00 0.00 ? 38 LEU A HD13   1 
ATOM 521  H HD21   . LEU A 1 38 ? 6.717  -8.217  10.840 1.00 0.00 ? 38 LEU A HD21   1 
ATOM 522  H HD22   . LEU A 1 38 ? 6.021  -8.777  9.295  1.00 0.00 ? 38 LEU A HD22   1 
ATOM 523  H HD23   . LEU A 1 38 ? 6.365  -9.933  10.604 1.00 0.00 ? 38 LEU A HD23   1 
ATOM 524  N N      . ILE A 1 39 ? 7.337  -13.027 6.748  1.00 0.00 ? 39 ILE A N      1 
ATOM 525  C CA     . ILE A 1 39 ? 7.600  -13.961 5.655  1.00 0.00 ? 39 ILE A CA     1 
ATOM 526  C C      . ILE A 1 39 ? 6.411  -14.055 4.730  1.00 0.00 ? 39 ILE A C      1 
ATOM 527  O O      . ILE A 1 39 ? 6.540  -14.124 3.499  1.00 0.00 ? 39 ILE A O      1 
ATOM 528  C CB     . ILE A 1 39 ? 8.038  -15.379 6.201  1.00 0.00 ? 39 ILE A CB     1 
ATOM 529  C CG1    . ILE A 1 39 ? 9.280  -15.360 7.145  1.00 0.00 ? 39 ILE A CG1    1 
ATOM 530  C CG2    . ILE A 1 39 ? 8.310  -16.408 5.062  1.00 0.00 ? 39 ILE A CG2    1 
ATOM 531  C CD1    . ILE A 1 39 ? 9.903  -13.977 7.414  1.00 0.00 ? 39 ILE A CD1    1 
ATOM 532  H H      . ILE A 1 39 ? 7.283  -13.353 7.775  1.00 0.00 ? 39 ILE A H      1 
ATOM 533  H HA     . ILE A 1 39 ? 8.430  -13.546 5.055  1.00 0.00 ? 39 ILE A HA     1 
ATOM 534  H HB     . ILE A 1 39 ? 7.186  -15.765 6.803  1.00 0.00 ? 39 ILE A HB     1 
ATOM 535  H HG12   . ILE A 1 39 ? 9.044  -15.865 8.101  1.00 0.00 ? 39 ILE A HG12   1 
ATOM 536  H HG13   . ILE A 1 39 ? 10.090 -15.975 6.703  1.00 0.00 ? 39 ILE A HG13   1 
ATOM 537  H HG21   . ILE A 1 39 ? 7.438  -16.579 4.408  1.00 0.00 ? 39 ILE A HG21   1 
ATOM 538  H HG22   . ILE A 1 39 ? 9.150  -16.098 4.410  1.00 0.00 ? 39 ILE A HG22   1 
ATOM 539  H HG23   . ILE A 1 39 ? 8.561  -17.412 5.450  1.00 0.00 ? 39 ILE A HG23   1 
ATOM 540  H HD11   . ILE A 1 39 ? 10.953 -14.066 7.743  1.00 0.00 ? 39 ILE A HD11   1 
ATOM 541  H HD12   . ILE A 1 39 ? 9.899  -13.340 6.509  1.00 0.00 ? 39 ILE A HD12   1 
ATOM 542  H HD13   . ILE A 1 39 ? 9.369  -13.421 8.208  1.00 0.00 ? 39 ILE A HD13   1 
ATOM 543  N N      . TYR A 1 40 ? 5.082  -14.063 5.379  1.00 0.00 ? 40 TYR A N      1 
ATOM 544  C CA     . TYR A 1 40 ? 3.843  -14.151 4.610  1.00 0.00 ? 40 TYR A CA     1 
ATOM 545  C C      . TYR A 1 40 ? 3.655  -12.927 3.744  1.00 0.00 ? 40 TYR A C      1 
ATOM 546  O O      . TYR A 1 40 ? 3.217  -13.001 2.596  1.00 0.00 ? 40 TYR A O      1 
ATOM 547  C CB     . TYR A 1 40 ? 2.611  -14.269 5.552  1.00 0.00 ? 40 TYR A CB     1 
ATOM 548  C CG     . TYR A 1 40 ? 1.858  -12.934 5.580  1.00 0.00 ? 40 TYR A CG     1 
ATOM 549  C CD1    . TYR A 1 40 ? 1.398  -12.349 4.396  1.00 0.00 ? 40 TYR A CD1    1 
ATOM 550  C CD2    . TYR A 1 40 ? 1.620  -12.299 6.803  1.00 0.00 ? 40 TYR A CD2    1 
ATOM 551  C CE1    . TYR A 1 40 ? 0.700  -11.143 4.437  1.00 0.00 ? 40 TYR A CE1    1 
ATOM 552  C CE2    . TYR A 1 40 ? 0.925  -11.093 6.841  1.00 0.00 ? 40 TYR A CE2    1 
ATOM 553  C CZ     . TYR A 1 40 ? 0.465  -10.517 5.659  1.00 0.00 ? 40 TYR A CZ     1 
ATOM 554  O OH     . TYR A 1 40 ? -0.219 -9.338  5.695  1.00 0.00 ? 40 TYR A OH     1 
ATOM 555  H H      . TYR A 1 40 ? 5.082  -13.999 6.457  1.00 0.00 ? 40 TYR A H      1 
ATOM 556  H HA     . TYR A 1 40 ? 3.898  -15.031 3.943  1.00 0.00 ? 40 TYR A HA     1 
ATOM 557  H HB2    . TYR A 1 40 ? 1.895  -15.089 5.334  1.00 0.00 ? 40 TYR A HB2    1 
ATOM 558  H HB3    . TYR A 1 40 ? 2.991  -14.371 6.587  1.00 0.00 ? 40 TYR A HB3    1 
ATOM 559  H HD1    . TYR A 1 40 ? 1.571  -12.832 3.445  1.00 0.00 ? 40 TYR A HD1    1 
ATOM 560  H HD2    . TYR A 1 40 ? 1.961  -12.746 7.726  1.00 0.00 ? 40 TYR A HD2    1 
ATOM 561  H HE1    . TYR A 1 40 ? 0.339  -10.695 3.526  1.00 0.00 ? 40 TYR A HE1    1 
ATOM 562  H HE2    . TYR A 1 40 ? 0.742  -10.615 7.791  1.00 0.00 ? 40 TYR A HE2    1 
ATOM 563  H HH     . TYR A 1 40 ? -0.291 -9.056  6.610  1.00 0.00 ? 40 TYR A HH     1 
ATOM 564  N N      . SER A 1 41 ? 4.028  -11.635 4.361  1.00 0.00 ? 41 SER A N      1 
ATOM 565  C CA     . SER A 1 41 ? 3.899  -10.370 3.644  1.00 0.00 ? 41 SER A CA     1 
ATOM 566  C C      . SER A 1 41 ? 4.831  -10.323 2.457  1.00 0.00 ? 41 SER A C      1 
ATOM 567  O O      . SER A 1 41 ? 4.492  -9.839  1.377  1.00 0.00 ? 41 SER A O      1 
ATOM 568  C CB     . SER A 1 41 ? 4.126  -9.171  4.596  1.00 0.00 ? 41 SER A CB     1 
ATOM 569  O OG     . SER A 1 41 ? 5.484  -9.053  5.031  1.00 0.00 ? 41 SER A OG     1 
ATOM 570  H H      . SER A 1 41 ? 4.401  -11.684 5.373  1.00 0.00 ? 41 SER A H      1 
ATOM 571  H HA     . SER A 1 41 ? 2.869  -10.313 3.245  1.00 0.00 ? 41 SER A HA     1 
ATOM 572  H HB2    . SER A 1 41 ? 3.842  -8.230  4.086  1.00 0.00 ? 41 SER A HB2    1 
ATOM 573  H HB3    . SER A 1 41 ? 3.459  -9.228  5.480  1.00 0.00 ? 41 SER A HB3    1 
ATOM 574  H HG     . SER A 1 41 ? 5.694  -9.846  5.537  1.00 0.00 ? 41 SER A HG     1 
ATOM 575  N N      . MET A 1 42 ? 6.180  -10.894 2.669  1.00 0.00 ? 42 MET A N      1 
ATOM 576  C CA     . MET A 1 42 ? 7.184  -10.916 1.611  1.00 0.00 ? 42 MET A CA     1 
ATOM 577  C C      . MET A 1 42 ? 6.746  -11.803 0.469  1.00 0.00 ? 42 MET A C      1 
ATOM 578  O O      . MET A 1 42 ? 6.947  -11.493 -0.714 1.00 0.00 ? 42 MET A O      1 
ATOM 579  C CB     . MET A 1 42 ? 8.546  -11.386 2.188  1.00 0.00 ? 42 MET A CB     1 
ATOM 580  C CG     . MET A 1 42 ? 8.758  -12.915 2.256  1.00 0.00 ? 42 MET A CG     1 
ATOM 581  S SD     . MET A 1 42 ? 10.490 -13.305 1.954  1.00 0.00 ? 42 MET A SD     1 
ATOM 582  C CE     . MET A 1 42 ? 10.314 -15.069 1.649  1.00 0.00 ? 42 MET A CE     1 
ATOM 583  H H      . MET A 1 42 ? 6.375  -11.292 3.654  1.00 0.00 ? 42 MET A H      1 
ATOM 584  H HA     . MET A 1 42 ? 7.293  -9.891  1.205  1.00 0.00 ? 42 MET A HA     1 
ATOM 585  H HB2    . MET A 1 42 ? 9.378  -10.938 1.608  1.00 0.00 ? 42 MET A HB2    1 
ATOM 586  H HB3    . MET A 1 42 ? 8.670  -10.987 3.214  1.00 0.00 ? 42 MET A HB3    1 
ATOM 587  H HG2    . MET A 1 42 ? 8.458  -13.324 3.239  1.00 0.00 ? 42 MET A HG2    1 
ATOM 588  H HG3    . MET A 1 42 ? 8.130  -13.420 1.497  1.00 0.00 ? 42 MET A HG3    1 
ATOM 589  H HE1    . MET A 1 42 ? 11.141 -15.635 2.117  1.00 0.00 ? 42 MET A HE1    1 
ATOM 590  H HE2    . MET A 1 42 ? 9.358  -15.435 2.062  1.00 0.00 ? 42 MET A HE2    1 
ATOM 591  H HE3    . MET A 1 42 ? 10.322 -15.274 0.564  1.00 0.00 ? 42 MET A HE3    1 
ATOM 592  N N      . LEU A 1 43 ? 6.075  -13.063 0.848  1.00 0.00 ? 43 LEU A N      1 
ATOM 593  C CA     . LEU A 1 43 ? 5.600  -14.018 -0.150 1.00 0.00 ? 43 LEU A CA     1 
ATOM 594  C C      . LEU A 1 43 ? 4.489  -13.419 -0.984 1.00 0.00 ? 43 LEU A C      1 
ATOM 595  O O      . LEU A 1 43 ? 4.411  -13.613 -2.206 1.00 0.00 ? 43 LEU A O      1 
ATOM 596  C CB     . LEU A 1 43 ? 5.130  -15.333 0.532  1.00 0.00 ? 43 LEU A CB     1 
ATOM 597  C CG     . LEU A 1 43 ? 4.614  -16.484 -0.377 1.00 0.00 ? 43 LEU A CG     1 
ATOM 598  C CD1    . LEU A 1 43 ? 3.135  -16.258 -0.723 1.00 0.00 ? 43 LEU A CD1    1 
ATOM 599  C CD2    . LEU A 1 43 ? 5.431  -16.632 -1.668 1.00 0.00 ? 43 LEU A CD2    1 
ATOM 600  H H      . LEU A 1 43 ? 5.960  -13.228 1.854  1.00 0.00 ? 43 LEU A H      1 
ATOM 601  H HA     . LEU A 1 43 ? 6.428  -14.235 -0.845 1.00 0.00 ? 43 LEU A HA     1 
ATOM 602  H HB2    . LEU A 1 43 ? 5.963  -15.730 1.150  1.00 0.00 ? 43 LEU A HB2    1 
ATOM 603  H HB3    . LEU A 1 43 ? 4.335  -15.086 1.262  1.00 0.00 ? 43 LEU A HB3    1 
ATOM 604  H HG     . LEU A 1 43 ? 4.687  -17.433 0.193  1.00 0.00 ? 43 LEU A HG     1 
ATOM 605  H HD11   . LEU A 1 43 ? 2.506  -16.188 0.186  1.00 0.00 ? 43 LEU A HD11   1 
ATOM 606  H HD12   . LEU A 1 43 ? 2.977  -15.329 -1.301 1.00 0.00 ? 43 LEU A HD12   1 
ATOM 607  H HD13   . LEU A 1 43 ? 2.726  -17.093 -1.325 1.00 0.00 ? 43 LEU A HD13   1 
ATOM 608  H HD21   . LEU A 1 43 ? 5.026  -17.424 -2.326 1.00 0.00 ? 43 LEU A HD21   1 
ATOM 609  H HD22   . LEU A 1 43 ? 5.466  -15.695 -2.254 1.00 0.00 ? 43 LEU A HD22   1 
ATOM 610  H HD23   . LEU A 1 43 ? 6.478  -16.921 -1.450 1.00 0.00 ? 43 LEU A HD23   1 
ATOM 611  N N      . ARG A 1 44 ? 3.505  -12.591 -0.256 1.00 0.00 ? 44 ARG A N      1 
ATOM 612  C CA     . ARG A 1 44 ? 2.380  -11.952 -0.934 1.00 0.00 ? 44 ARG A CA     1 
ATOM 613  C C      . ARG A 1 44 ? 2.861  -10.908 -1.915 1.00 0.00 ? 44 ARG A C      1 
ATOM 614  O O      . ARG A 1 44 ? 2.325  -10.747 -3.008 1.00 0.00 ? 44 ARG A O      1 
ATOM 615  C CB     . ARG A 1 44 ? 1.435  -11.333 0.132  1.00 0.00 ? 44 ARG A CB     1 
ATOM 616  C CG     . ARG A 1 44 ? 0.811  -9.968  -0.261 1.00 0.00 ? 44 ARG A CG     1 
ATOM 617  C CD     . ARG A 1 44 ? -0.054 -9.373  0.858  1.00 0.00 ? 44 ARG A CD     1 
ATOM 618  N NE     . ARG A 1 44 ? -0.659 -8.113  0.360  1.00 0.00 ? 44 ARG A NE     1 
ATOM 619  C CZ     . ARG A 1 44 ? -0.706 -6.965  1.029  1.00 0.00 ? 44 ARG A CZ     1 
ATOM 620  N NH1    . ARG A 1 44 ? -0.220 -6.790  2.222  1.00 0.00 ? 44 ARG A NH1    1 
ATOM 621  N NH2    . ARG A 1 44 ? -1.272 -5.966  0.450  1.00 0.00 ? 44 ARG A NH2    1 
ATOM 622  H H      . ARG A 1 44 ? 3.650  -12.499 0.689  1.00 0.00 ? 44 ARG A H      1 
ATOM 623  H HA     . ARG A 1 44 ? 1.840  -12.728 -1.508 1.00 0.00 ? 44 ARG A HA     1 
ATOM 624  H HB2    . ARG A 1 44 ? 0.608  -12.040 0.350  1.00 0.00 ? 44 ARG A HB2    1 
ATOM 625  H HB3    . ARG A 1 44 ? 1.977  -11.234 1.094  1.00 0.00 ? 44 ARG A HB3    1 
ATOM 626  H HG2    . ARG A 1 44 ? 1.602  -9.231  -0.517 1.00 0.00 ? 44 ARG A HG2    1 
ATOM 627  H HG3    . ARG A 1 44 ? 0.203  -10.075 -1.182 1.00 0.00 ? 44 ARG A HG3    1 
ATOM 628  H HD2    . ARG A 1 44 ? -0.845 -10.091 1.153  1.00 0.00 ? 44 ARG A HD2    1 
ATOM 629  H HD3    . ARG A 1 44 ? 0.565  -9.175  1.760  1.00 0.00 ? 44 ARG A HD3    1 
ATOM 630  H HH11   . ARG A 1 44 ? 0.212  -7.632  2.604  1.00 0.00 ? 44 ARG A HH11   1 
ATOM 631  H HH12   . ARG A 1 44 ? -0.319 -5.863  2.629  1.00 0.00 ? 44 ARG A HH12   1 
ATOM 632  H HH21   . ARG A 1 44 ? -1.313 -5.083  0.956  1.00 0.00 ? 44 ARG A HH21   1 
ATOM 633  H HH22   . ARG A 1 44 ? -1.623 -6.209  -0.478 1.00 0.00 ? 44 ARG A HH22   1 
ATOM 634  N N      . LYS A 1 45 ? 4.000  -10.077 -1.470 1.00 0.00 ? 45 LYS A N      1 
ATOM 635  C CA     . LYS A 1 45 ? 4.570  -9.029  -2.311 1.00 0.00 ? 45 LYS A CA     1 
ATOM 636  C C      . LYS A 1 45 ? 5.202  -9.617  -3.552 1.00 0.00 ? 45 LYS A C      1 
ATOM 637  O O      . LYS A 1 45 ? 5.096  -9.076  -4.663 1.00 0.00 ? 45 LYS A O      1 
ATOM 638  C CB     . LYS A 1 45 ? 5.604  -8.211  -1.493 1.00 0.00 ? 45 LYS A CB     1 
ATOM 639  C CG     . LYS A 1 45 ? 5.060  -6.848  -0.997 1.00 0.00 ? 45 LYS A CG     1 
ATOM 640  C CD     . LYS A 1 45 ? 4.473  -5.952  -2.089 1.00 0.00 ? 45 LYS A CD     1 
ATOM 641  C CE     . LYS A 1 45 ? 3.912  -4.674  -1.451 1.00 0.00 ? 45 LYS A CE     1 
ATOM 642  N NZ     . LYS A 1 45 ? 3.504  -3.735  -2.511 1.00 0.00 ? 45 LYS A NZ     1 
ATOM 643  H H      . LYS A 1 45 ? 4.383  -10.287 -0.483 1.00 0.00 ? 45 LYS A H      1 
ATOM 644  H HA     . LYS A 1 45 ? 3.750  -8.363  -2.641 1.00 0.00 ? 45 LYS A HA     1 
ATOM 645  H HB2    . LYS A 1 45 ? 5.946  -8.805  -0.624 1.00 0.00 ? 45 LYS A HB2    1 
ATOM 646  H HB3    . LYS A 1 45 ? 6.517  -8.050  -2.104 1.00 0.00 ? 45 LYS A HB3    1 
ATOM 647  H HG2    . LYS A 1 45 ? 4.254  -7.004  -0.257 1.00 0.00 ? 45 LYS A HG2    1 
ATOM 648  H HG3    . LYS A 1 45 ? 5.859  -6.306  -0.452 1.00 0.00 ? 45 LYS A HG3    1 
ATOM 649  H HD2    . LYS A 1 45 ? 5.251  -5.718  -2.844 1.00 0.00 ? 45 LYS A HD2    1 
ATOM 650  H HD3    . LYS A 1 45 ? 3.670  -6.494  -2.630 1.00 0.00 ? 45 LYS A HD3    1 
ATOM 651  H HE2    . LYS A 1 45 ? 3.053  -4.915  -0.793 1.00 0.00 ? 45 LYS A HE2    1 
ATOM 652  H HE3    . LYS A 1 45 ? 4.668  -4.190  -0.796 1.00 0.00 ? 45 LYS A HE3    1 
ATOM 653  H HZ1    . LYS A 1 45 ? 4.306  -3.484  -3.100 1.00 0.00 ? 45 LYS A HZ1    1 
ATOM 654  H HZ3    . LYS A 1 45 ? 2.814  -4.162  -3.138 1.00 0.00 ? 45 LYS A HZ3    1 
ATOM 655  N N      . ALA A 1 46 ? 5.955  -10.873 -3.360 1.00 0.00 ? 46 ALA A N      1 
ATOM 656  C CA     . ALA A 1 46 ? 6.620  -11.556 -4.468 1.00 0.00 ? 46 ALA A CA     1 
ATOM 657  C C      . ALA A 1 46 ? 5.613  -12.058 -5.475 1.00 0.00 ? 46 ALA A C      1 
ATOM 658  O O      . ALA A 1 46 ? 4.397  -11.876 -5.334 1.00 0.00 ? 46 ALA A O      1 
ATOM 659  C CB     . ALA A 1 46 ? 7.479  -12.682 -3.871 1.00 0.00 ? 46 ALA A CB     1 
ATOM 660  O OXT    . ALA A 1 46 ? 6.078  -12.766 -6.626 1.00 0.00 ? 46 ALA A OXT    1 
ATOM 661  H H      . ALA A 1 46 ? 5.987  -11.259 -2.350 1.00 0.00 ? 46 ALA A H      1 
ATOM 662  H HA     . ALA A 1 46 ? 7.273  -10.830 -4.988 1.00 0.00 ? 46 ALA A HA     1 
ATOM 663  H HB1    . ALA A 1 46 ? 8.237  -12.295 -3.165 1.00 0.00 ? 46 ALA A HB1    1 
ATOM 664  H HB2    . ALA A 1 46 ? 6.871  -13.425 -3.318 1.00 0.00 ? 46 ALA A HB2    1 
ATOM 665  H HB3    . ALA A 1 46 ? 8.030  -13.238 -4.656 1.00 0.00 ? 46 ALA A HB3    1 
ATOM 666  H HXT    . ALA A 1 46 ? 6.043  -12.689 -7.586 1.00 0.00 ? 46 ALA A HXT    1 
ATOM 667  N N      . GLY B 1 1  ? 26.780 8.012   62.438 1.00 0.00 ? 1  GLY B N      1 
ATOM 668  C CA     . GLY B 1 1  ? 26.664 7.534   61.062 1.00 0.00 ? 1  GLY B CA     1 
ATOM 669  C C      . GLY B 1 1  ? 25.958 8.548   60.195 1.00 0.00 ? 1  GLY B C      1 
ATOM 670  O O      . GLY B 1 1  ? 25.318 8.219   59.201 1.00 0.00 ? 1  GLY B O      1 
ATOM 671  H H1     . GLY B 1 1  ? 27.260 7.425   63.207 1.00 0.00 ? 1  GLY B H1     1 
ATOM 672  H H2     . GLY B 1 1  ? 26.395 8.971   62.744 1.00 0.00 ? 1  GLY B H2     1 
ATOM 673  H HA2    . GLY B 1 1  ? 27.665 7.329   60.641 1.00 0.00 ? 1  GLY B HA2    1 
ATOM 674  H HA3    . GLY B 1 1  ? 26.107 6.578   61.036 1.00 0.00 ? 1  GLY B HA3    1 
ATOM 675  N N      . VAL B 1 2  ? 26.081 9.961   60.618 1.00 0.00 ? 2  VAL B N      1 
ATOM 676  C CA     . VAL B 1 2  ? 25.447 11.045  59.877 1.00 0.00 ? 2  VAL B CA     1 
ATOM 677  C C      . VAL B 1 2  ? 26.484 11.962  59.271 1.00 0.00 ? 2  VAL B C      1 
ATOM 678  O O      . VAL B 1 2  ? 26.355 12.434  58.134 1.00 0.00 ? 2  VAL B O      1 
ATOM 679  C CB     . VAL B 1 2  ? 24.474 11.851  60.828 1.00 0.00 ? 2  VAL B CB     1 
ATOM 680  C CG1    . VAL B 1 2  ? 23.864 13.156  60.249 1.00 0.00 ? 2  VAL B CG1    1 
ATOM 681  C CG2    . VAL B 1 2  ? 23.269 11.025  61.339 1.00 0.00 ? 2  VAL B CG2    1 
ATOM 682  H H      . VAL B 1 2  ? 26.664 10.139  61.509 1.00 0.00 ? 2  VAL B H      1 
ATOM 683  H HA     . VAL B 1 2  ? 24.864 10.616  59.040 1.00 0.00 ? 2  VAL B HA     1 
ATOM 684  H HB     . VAL B 1 2  ? 25.067 12.152  61.721 1.00 0.00 ? 2  VAL B HB     1 
ATOM 685  H HG11   . VAL B 1 2  ? 23.267 12.974  59.335 1.00 0.00 ? 2  VAL B HG11   1 
ATOM 686  H HG12   . VAL B 1 2  ? 23.205 13.670  60.974 1.00 0.00 ? 2  VAL B HG12   1 
ATOM 687  H HG13   . VAL B 1 2  ? 24.634 13.904  59.985 1.00 0.00 ? 2  VAL B HG13   1 
ATOM 688  H HG21   . VAL B 1 2  ? 22.582 10.740  60.521 1.00 0.00 ? 2  VAL B HG21   1 
ATOM 689  H HG22   . VAL B 1 2  ? 23.592 10.092  61.840 1.00 0.00 ? 2  VAL B HG22   1 
ATOM 690  H HG23   . VAL B 1 2  ? 22.675 11.585  62.086 1.00 0.00 ? 2  VAL B HG23   1 
ATOM 691  N N      . ILE B 1 3  ? 27.663 12.258  60.111 1.00 0.00 ? 3  ILE B N      1 
ATOM 692  C CA     . ILE B 1 3  ? 28.741 13.126  59.654 1.00 0.00 ? 3  ILE B CA     1 
ATOM 693  C C      . ILE B 1 3  ? 29.461 12.518  58.477 1.00 0.00 ? 3  ILE B C      1 
ATOM 694  O O      . ILE B 1 3  ? 29.101 12.718  57.309 1.00 0.00 ? 3  ILE B O      1 
ATOM 695  C CB     . ILE B 1 3  ? 29.733 13.482  60.835 1.00 0.00 ? 3  ILE B CB     1 
ATOM 696  C CG1    . ILE B 1 3  ? 29.102 14.314  61.994 1.00 0.00 ? 3  ILE B CG1    1 
ATOM 697  C CG2    . ILE B 1 3  ? 31.014 14.228  60.343 1.00 0.00 ? 3  ILE B CG2    1 
ATOM 698  C CD1    . ILE B 1 3  ? 28.502 15.678  61.593 1.00 0.00 ? 3  ILE B CD1    1 
ATOM 699  H H      . ILE B 1 3  ? 27.673 11.797  61.087 1.00 0.00 ? 3  ILE B H      1 
ATOM 700  H HA     . ILE B 1 3  ? 28.285 14.064  59.292 1.00 0.00 ? 3  ILE B HA     1 
ATOM 701  H HB     . ILE B 1 3  ? 30.064 12.514  61.276 1.00 0.00 ? 3  ILE B HB     1 
ATOM 702  H HG12   . ILE B 1 3  ? 28.347 13.709  62.532 1.00 0.00 ? 3  ILE B HG12   1 
ATOM 703  H HG13   . ILE B 1 3  ? 29.875 14.536  62.752 1.00 0.00 ? 3  ILE B HG13   1 
ATOM 704  H HG21   . ILE B 1 3  ? 31.598 13.655  59.602 1.00 0.00 ? 3  ILE B HG21   1 
ATOM 705  H HG22   . ILE B 1 3  ? 30.774 15.208  59.887 1.00 0.00 ? 3  ILE B HG22   1 
ATOM 706  H HG23   . ILE B 1 3  ? 31.731 14.420  61.165 1.00 0.00 ? 3  ILE B HG23   1 
ATOM 707  H HD11   . ILE B 1 3  ? 28.144 16.232  62.479 1.00 0.00 ? 3  ILE B HD11   1 
ATOM 708  H HD12   . ILE B 1 3  ? 29.247 16.323  61.088 1.00 0.00 ? 3  ILE B HD12   1 
ATOM 709  H HD13   . ILE B 1 3  ? 27.636 15.577  60.912 1.00 0.00 ? 3  ILE B HD13   1 
ATOM 710  N N      . ASP B 1 4  ? 30.627 11.666  58.799 1.00 0.00 ? 4  ASP B N      1 
ATOM 711  C CA     . ASP B 1 4  ? 31.420 11.013  57.762 1.00 0.00 ? 4  ASP B CA     1 
ATOM 712  C C      . ASP B 1 4  ? 30.599 9.984   57.019 1.00 0.00 ? 4  ASP B C      1 
ATOM 713  O O      . ASP B 1 4  ? 30.924 9.568   55.864 1.00 0.00 ? 4  ASP B O      1 
ATOM 714  C CB     . ASP B 1 4  ? 32.706 10.396  58.376 1.00 0.00 ? 4  ASP B CB     1 
ATOM 715  C CG     . ASP B 1 4  ? 33.736 9.826   57.388 1.00 0.00 ? 4  ASP B CG     1 
ATOM 716  O OD1    . ASP B 1 4  ? 34.350 8.791   57.590 1.00 0.00 ? 4  ASP B OD1    1 
ATOM 717  O OD2    . ASP B 1 4  ? 33.863 10.586  56.260 1.00 0.00 ? 4  ASP B OD2    1 
ATOM 718  H H      . ASP B 1 4  ? 30.860 11.557  59.848 1.00 0.00 ? 4  ASP B H      1 
ATOM 719  H HA     . ASP B 1 4  ? 31.687 11.793  57.026 1.00 0.00 ? 4  ASP B HA     1 
ATOM 720  H HB2    . ASP B 1 4  ? 33.229 11.128  59.014 1.00 0.00 ? 4  ASP B HB2    1 
ATOM 721  H HB3    . ASP B 1 4  ? 32.423 9.574   59.065 1.00 0.00 ? 4  ASP B HB3    1 
ATOM 722  H HD2    . ASP B 1 4  ? 33.293 11.350  56.288 1.00 0.00 ? 4  ASP B HD2    1 
ATOM 723  N N      . THR B 1 5  ? 29.393 9.488   57.723 1.00 0.00 ? 5  THR B N      1 
ATOM 724  C CA     . THR B 1 5  ? 28.505 8.497   57.128 1.00 0.00 ? 5  THR B CA     1 
ATOM 725  C C      . THR B 1 5  ? 27.829 9.044   55.893 1.00 0.00 ? 5  THR B C      1 
ATOM 726  O O      . THR B 1 5  ? 27.663 8.366   54.897 1.00 0.00 ? 5  THR B O      1 
ATOM 727  C CB     . THR B 1 5  ? 27.443 8.011   58.172 1.00 0.00 ? 5  THR B CB     1 
ATOM 728  O OG1    . THR B 1 5  ? 27.959 6.932   58.940 1.00 0.00 ? 5  THR B OG1    1 
ATOM 729  C CG2    . THR B 1 5  ? 26.115 7.478   57.600 1.00 0.00 ? 5  THR B CG2    1 
ATOM 730  H H      . THR B 1 5  ? 29.210 9.908   58.700 1.00 0.00 ? 5  THR B H      1 
ATOM 731  H HA     . THR B 1 5  ? 29.116 7.630   56.811 1.00 0.00 ? 5  THR B HA     1 
ATOM 732  H HB     . THR B 1 5  ? 27.214 8.857   58.855 1.00 0.00 ? 5  THR B HB     1 
ATOM 733  H HG1    . THR B 1 5  ? 27.289 6.733   59.603 1.00 0.00 ? 5  THR B HG1    1 
ATOM 734  H HG21   . THR B 1 5  ? 25.556 8.249   57.034 1.00 0.00 ? 5  THR B HG21   1 
ATOM 735  H HG22   . THR B 1 5  ? 26.273 6.626   56.911 1.00 0.00 ? 5  THR B HG22   1 
ATOM 736  H HG23   . THR B 1 5  ? 25.427 7.134   58.392 1.00 0.00 ? 5  THR B HG23   1 
ATOM 737  N N      . SER B 1 6  ? 27.383 10.452  55.968 1.00 0.00 ? 6  SER B N      1 
ATOM 738  C CA     . SER B 1 6  ? 26.717 11.109  54.852 1.00 0.00 ? 6  SER B CA     1 
ATOM 739  C C      . SER B 1 6  ? 27.642 11.240  53.667 1.00 0.00 ? 6  SER B C      1 
ATOM 740  O O      . SER B 1 6  ? 27.250 11.062  52.511 1.00 0.00 ? 6  SER B O      1 
ATOM 741  C CB     . SER B 1 6  ? 26.151 12.488  55.282 1.00 0.00 ? 6  SER B CB     1 
ATOM 742  O OG     . SER B 1 6  ? 27.174 13.450  55.546 1.00 0.00 ? 6  SER B OG     1 
ATOM 743  H H      . SER B 1 6  ? 27.582 10.961  56.897 1.00 0.00 ? 6  SER B H      1 
ATOM 744  H HA     . SER B 1 6  ? 25.872 10.471  54.533 1.00 0.00 ? 6  SER B HA     1 
ATOM 745  H HB2    . SER B 1 6  ? 25.492 12.888  54.488 1.00 0.00 ? 6  SER B HB2    1 
ATOM 746  H HB3    . SER B 1 6  ? 25.497 12.389  56.171 1.00 0.00 ? 6  SER B HB3    1 
ATOM 747  H HG     . SER B 1 6  ? 27.691 13.127  56.290 1.00 0.00 ? 6  SER B HG     1 
ATOM 748  N N      . ALA B 1 7  ? 29.044 11.591  53.975 1.00 0.00 ? 7  ALA B N      1 
ATOM 749  C CA     . ALA B 1 7  ? 30.050 11.749  52.927 1.00 0.00 ? 7  ALA B CA     1 
ATOM 750  C C      . ALA B 1 7  ? 30.306 10.437  52.219 1.00 0.00 ? 7  ALA B C      1 
ATOM 751  O O      . ALA B 1 7  ? 30.480 10.377  50.997 1.00 0.00 ? 7  ALA B O      1 
ATOM 752  C CB     . ALA B 1 7  ? 31.316 12.328  53.581 1.00 0.00 ? 7  ALA B CB     1 
ATOM 753  H H      . ALA B 1 7  ? 29.280 11.726  55.020 1.00 0.00 ? 7  ALA B H      1 
ATOM 754  H HA     . ALA B 1 7  ? 29.667 12.460  52.172 1.00 0.00 ? 7  ALA B HA     1 
ATOM 755  H HB1    . ALA B 1 7  ? 32.123 12.493  52.842 1.00 0.00 ? 7  ALA B HB1    1 
ATOM 756  H HB2    . ALA B 1 7  ? 31.122 13.305  54.061 1.00 0.00 ? 7  ALA B HB2    1 
ATOM 757  H HB3    . ALA B 1 7  ? 31.724 11.658  54.364 1.00 0.00 ? 7  ALA B HB3    1 
ATOM 758  N N      . VAL B 1 8  ? 30.342 9.237   53.077 1.00 0.00 ? 8  VAL B N      1 
ATOM 759  C CA     . VAL B 1 8  ? 30.577 7.901   52.530 1.00 0.00 ? 8  VAL B CA     1 
ATOM 760  C C      . VAL B 1 8  ? 29.446 7.485   51.617 1.00 0.00 ? 8  VAL B C      1 
ATOM 761  O O      . VAL B 1 8  ? 29.653 6.877   50.559 1.00 0.00 ? 8  VAL B O      1 
ATOM 762  C CB     . VAL B 1 8  ? 30.760 6.862   53.707 1.00 0.00 ? 8  VAL B CB     1 
ATOM 763  C CG1    . VAL B 1 8  ? 30.363 7.354   55.126 1.00 0.00 ? 8  VAL B CG1    1 
ATOM 764  C CG2    . VAL B 1 8  ? 29.981 5.539   53.502 1.00 0.00 ? 8  VAL B CG2    1 
ATOM 765  H H      . VAL B 1 8  ? 30.185 9.399   54.134 1.00 0.00 ? 8  VAL B H      1 
ATOM 766  H HA     . VAL B 1 8  ? 31.499 7.925   51.918 1.00 0.00 ? 8  VAL B HA     1 
ATOM 767  H HB     . VAL B 1 8  ? 31.840 6.604   53.753 1.00 0.00 ? 8  VAL B HB     1 
ATOM 768  H HG11   . VAL B 1 8  ? 29.301 7.660   55.186 1.00 0.00 ? 8  VAL B HG11   1 
ATOM 769  H HG12   . VAL B 1 8  ? 30.524 6.580   55.900 1.00 0.00 ? 8  VAL B HG12   1 
ATOM 770  H HG13   . VAL B 1 8  ? 30.970 8.218   55.459 1.00 0.00 ? 8  VAL B HG13   1 
ATOM 771  H HG21   . VAL B 1 8  ? 28.885 5.692   53.512 1.00 0.00 ? 8  VAL B HG21   1 
ATOM 772  H HG22   . VAL B 1 8  ? 30.235 5.058   52.541 1.00 0.00 ? 8  VAL B HG22   1 
ATOM 773  H HG23   . VAL B 1 8  ? 30.218 4.797   54.288 1.00 0.00 ? 8  VAL B HG23   1 
ATOM 774  N N      . GLU B 1 9  ? 28.086 7.847   52.061 1.00 0.00 ? 9  GLU B N      1 
ATOM 775  C CA     . GLU B 1 9  ? 26.900 7.508   51.280 1.00 0.00 ? 9  GLU B CA     1 
ATOM 776  C C      . GLU B 1 9  ? 26.902 8.237   49.955 1.00 0.00 ? 9  GLU B C      1 
ATOM 777  O O      . GLU B 1 9  ? 26.535 7.691   48.914 1.00 0.00 ? 9  GLU B O      1 
ATOM 778  C CB     . GLU B 1 9  ? 25.640 7.861   52.117 1.00 0.00 ? 9  GLU B CB     1 
ATOM 779  C CG     . GLU B 1 9  ? 24.246 7.531   51.489 1.00 0.00 ? 9  GLU B CG     1 
ATOM 780  C CD     . GLU B 1 9  ? 22.987 7.923   52.266 1.00 0.00 ? 9  GLU B CD     1 
ATOM 781  O OE1    . GLU B 1 9  ? 21.856 7.741   51.837 1.00 0.00 ? 9  GLU B OE1    1 
ATOM 782  O OE2    . GLU B 1 9  ? 23.246 8.492   53.477 1.00 0.00 ? 9  GLU B OE2    1 
ATOM 783  H H      . GLU B 1 9  ? 28.029 8.319   52.896 1.00 0.00 ? 9  GLU B H      1 
ATOM 784  H HA     . GLU B 1 9  ? 26.916 6.424   51.069 1.00 0.00 ? 9  GLU B HA     1 
ATOM 785  H HB2    . GLU B 1 9  ? 25.709 7.347   53.097 1.00 0.00 ? 9  GLU B HB2    1 
ATOM 786  H HB3    . GLU B 1 9  ? 25.674 8.938   52.375 1.00 0.00 ? 9  GLU B HB3    1 
ATOM 787  H HG2    . GLU B 1 9  ? 24.165 8.007   50.494 1.00 0.00 ? 9  GLU B HG2    1 
ATOM 788  H HG3    . GLU B 1 9  ? 24.168 6.448   51.281 1.00 0.00 ? 9  GLU B HG3    1 
ATOM 789  H HE2    . GLU B 1 9  ? 22.405 8.717   53.878 1.00 0.00 ? 9  GLU B HE2    1 
ATOM 790  N N      . SER B 1 10 ? 27.362 9.641   49.987 1.00 0.00 ? 10 SER B N      1 
ATOM 791  C CA     . SER B 1 10 ? 27.412 10.464  48.785 1.00 0.00 ? 10 SER B CA     1 
ATOM 792  C C      . SER B 1 10 ? 28.422 9.924   47.802 1.00 0.00 ? 10 SER B C      1 
ATOM 793  O O      . SER B 1 10 ? 28.209 9.907   46.590 1.00 0.00 ? 10 SER B O      1 
ATOM 794  C CB     . SER B 1 10 ? 27.702 11.946  49.141 1.00 0.00 ? 10 SER B CB     1 
ATOM 795  O OG     . SER B 1 10 ? 29.032 12.154  49.625 1.00 0.00 ? 10 SER B OG     1 
ATOM 796  H H      . SER B 1 10 ? 27.657 10.018  50.955 1.00 0.00 ? 10 SER B H      1 
ATOM 797  H HA     . SER B 1 10 ? 26.426 10.412  48.290 1.00 0.00 ? 10 SER B HA     1 
ATOM 798  H HB2    . SER B 1 10 ? 27.553 12.580  48.247 1.00 0.00 ? 10 SER B HB2    1 
ATOM 799  H HB3    . SER B 1 10 ? 26.975 12.324  49.886 1.00 0.00 ? 10 SER B HB3    1 
ATOM 800  H HG     . SER B 1 10 ? 29.122 11.653  50.442 1.00 0.00 ? 10 SER B HG     1 
ATOM 801  N N      . ALA B 1 11 ? 29.688 9.419   48.380 1.00 0.00 ? 11 ALA B N      1 
ATOM 802  C CA     . ALA B 1 11 ? 30.754 8.869   47.550 1.00 0.00 ? 11 ALA B CA     1 
ATOM 803  C C      . ALA B 1 11 ? 30.306 7.599   46.864 1.00 0.00 ? 11 ALA B C      1 
ATOM 804  O O      . ALA B 1 11 ? 30.621 7.338   45.695 1.00 0.00 ? 11 ALA B O      1 
ATOM 805  C CB     . ALA B 1 11 ? 31.983 8.658   48.450 1.00 0.00 ? 11 ALA B CB     1 
ATOM 806  H H      . ALA B 1 11 ? 29.770 9.479   49.456 1.00 0.00 ? 11 ALA B H      1 
ATOM 807  H HA     . ALA B 1 11 ? 30.997 9.600   46.757 1.00 0.00 ? 11 ALA B HA     1 
ATOM 808  H HB1    . ALA B 1 11 ? 32.847 8.259   47.884 1.00 0.00 ? 11 ALA B HB1    1 
ATOM 809  H HB2    . ALA B 1 11 ? 32.321 9.604   48.915 1.00 0.00 ? 11 ALA B HB2    1 
ATOM 810  H HB3    . ALA B 1 11 ? 31.778 7.949   49.278 1.00 0.00 ? 11 ALA B HB3    1 
ATOM 811  N N      . ILE B 1 12 ? 29.481 6.679   47.680 1.00 0.00 ? 12 ILE B N      1 
ATOM 812  C CA     . ILE B 1 12 ? 28.980 5.414   47.147 1.00 0.00 ? 12 ILE B CA     1 
ATOM 813  C C      . ILE B 1 12 ? 27.999 5.655   46.024 1.00 0.00 ? 12 ILE B C      1 
ATOM 814  O O      . ILE B 1 12 ? 27.983 4.948   45.006 1.00 0.00 ? 12 ILE B O      1 
ATOM 815  C CB     . ILE B 1 12 ? 28.360 4.514   48.291 1.00 0.00 ? 12 ILE B CB     1 
ATOM 816  C CG1    . ILE B 1 12 ? 26.798 4.553   48.378 1.00 0.00 ? 12 ILE B CG1    1 
ATOM 817  C CG2    . ILE B 1 12 ? 28.932 4.847   49.703 1.00 0.00 ? 12 ILE B CG2    1 
ATOM 818  C CD1    . ILE B 1 12 ? 26.091 3.183   48.397 1.00 0.00 ? 12 ILE B CD1    1 
ATOM 819  H H      . ILE B 1 12 ? 29.274 6.997   48.689 1.00 0.00 ? 12 ILE B H      1 
ATOM 820  H HA     . ILE B 1 12 ? 29.835 4.875   46.705 1.00 0.00 ? 12 ILE B HA     1 
ATOM 821  H HB     . ILE B 1 12 ? 28.639 3.461   48.054 1.00 0.00 ? 12 ILE B HB     1 
ATOM 822  H HG12   . ILE B 1 12 ? 26.479 5.159   49.247 1.00 0.00 ? 12 ILE B HG12   1 
ATOM 823  H HG13   . ILE B 1 12 ? 26.393 5.091   47.501 1.00 0.00 ? 12 ILE B HG13   1 
ATOM 824  H HG21   . ILE B 1 12 ? 30.027 4.725   49.764 1.00 0.00 ? 12 ILE B HG21   1 
ATOM 825  H HG22   . ILE B 1 12 ? 28.695 5.880   50.012 1.00 0.00 ? 12 ILE B HG22   1 
ATOM 826  H HG23   . ILE B 1 12 ? 28.535 4.174   50.484 1.00 0.00 ? 12 ILE B HG23   1 
ATOM 827  H HD11   . ILE B 1 12 ? 24.990 3.302   48.386 1.00 0.00 ? 12 ILE B HD11   1 
ATOM 828  H HD12   . ILE B 1 12 ? 26.361 2.571   47.515 1.00 0.00 ? 12 ILE B HD12   1 
ATOM 829  H HD13   . ILE B 1 12 ? 26.335 2.594   49.297 1.00 0.00 ? 12 ILE B HD13   1 
ATOM 830  N N      . THR B 1 13 ? 27.026 6.759   46.144 1.00 0.00 ? 13 THR B N      1 
ATOM 831  C CA     . THR B 1 13 ? 26.049 7.050   45.098 1.00 0.00 ? 13 THR B CA     1 
ATOM 832  C C      . THR B 1 13 ? 26.732 7.495   43.829 1.00 0.00 ? 13 THR B C      1 
ATOM 833  O O      . THR B 1 13 ? 26.353 7.134   42.731 1.00 0.00 ? 13 THR B O      1 
ATOM 834  C CB     . THR B 1 13 ? 25.024 8.131   45.585 1.00 0.00 ? 13 THR B CB     1 
ATOM 835  O OG1    . THR B 1 13 ? 24.303 7.661   46.717 1.00 0.00 ? 13 THR B OG1    1 
ATOM 836  C CG2    . THR B 1 13 ? 23.935 8.546   44.575 1.00 0.00 ? 13 THR B CG2    1 
ATOM 837  H H      . THR B 1 13 ? 27.084 7.347   47.051 1.00 0.00 ? 13 THR B H      1 
ATOM 838  H HA     . THR B 1 13 ? 25.499 6.121   44.868 1.00 0.00 ? 13 THR B HA     1 
ATOM 839  H HB     . THR B 1 13 ? 25.591 9.040   45.878 1.00 0.00 ? 13 THR B HB     1 
ATOM 840  H HG1    . THR B 1 13 ? 23.750 8.392   47.003 1.00 0.00 ? 13 THR B HG1    1 
ATOM 841  H HG21   . THR B 1 13 ? 24.356 9.010   43.665 1.00 0.00 ? 13 THR B HG21   1 
ATOM 842  H HG22   . THR B 1 13 ? 23.327 7.678   44.248 1.00 0.00 ? 13 THR B HG22   1 
ATOM 843  H HG23   . THR B 1 13 ? 23.238 9.292   44.997 1.00 0.00 ? 13 THR B HG23   1 
ATOM 844  N N      . ASP B 1 14 ? 27.891 8.399   43.997 1.00 0.00 ? 14 ASP B N      1 
ATOM 845  C CA     . ASP B 1 14 ? 28.648 8.910   42.858 1.00 0.00 ? 14 ASP B CA     1 
ATOM 846  C C      . ASP B 1 14 ? 29.349 7.787   42.131 1.00 0.00 ? 14 ASP B C      1 
ATOM 847  O O      . ASP B 1 14 ? 29.414 7.747   40.862 1.00 0.00 ? 14 ASP B O      1 
ATOM 848  C CB     . ASP B 1 14 ? 29.637 10.008  43.319 1.00 0.00 ? 14 ASP B CB     1 
ATOM 849  C CG     . ASP B 1 14 ? 29.104 11.449  43.346 1.00 0.00 ? 14 ASP B CG     1 
ATOM 850  O OD1    . ASP B 1 14 ? 29.767 12.413  42.996 1.00 0.00 ? 14 ASP B OD1    1 
ATOM 851  O OD2    . ASP B 1 14 ? 27.811 11.526  43.785 1.00 0.00 ? 14 ASP B OD2    1 
ATOM 852  H H      . ASP B 1 14 ? 28.146 8.660   45.013 1.00 0.00 ? 14 ASP B H      1 
ATOM 853  H HA     . ASP B 1 14 ? 27.907 9.335   42.151 1.00 0.00 ? 14 ASP B HA     1 
ATOM 854  H HB2    . ASP B 1 14 ? 30.039 9.786   44.323 1.00 0.00 ? 14 ASP B HB2    1 
ATOM 855  H HB3    . ASP B 1 14 ? 30.527 10.004  42.658 1.00 0.00 ? 14 ASP B HB3    1 
ATOM 856  H HD2    . ASP B 1 14 ? 27.467 10.662  44.004 1.00 0.00 ? 14 ASP B HD2    1 
ATOM 857  N N      . GLY B 1 15 ? 29.952 6.736   42.980 1.00 0.00 ? 15 GLY B N      1 
ATOM 858  C CA     . GLY B 1 15 ? 30.663 5.594   42.413 1.00 0.00 ? 15 GLY B CA     1 
ATOM 859  C C      . GLY B 1 15 ? 29.693 4.594   41.824 1.00 0.00 ? 15 GLY B C      1 
ATOM 860  O O      . GLY B 1 15 ? 29.923 4.011   40.773 1.00 0.00 ? 15 GLY B O      1 
ATOM 861  H H      . GLY B 1 15 ? 29.836 6.869   44.046 1.00 0.00 ? 15 GLY B H      1 
ATOM 862  H HA2    . GLY B 1 15 ? 31.358 5.931   41.626 1.00 0.00 ? 15 GLY B HA2    1 
ATOM 863  H HA3    . GLY B 1 15 ? 31.269 5.097   43.193 1.00 0.00 ? 15 GLY B HA3    1 
ATOM 864  N N      . GLN B 1 16 ? 28.455 4.363   42.598 1.00 0.00 ? 16 GLN B N      1 
ATOM 865  C CA     . GLN B 1 16 ? 27.428 3.425   42.152 1.00 0.00 ? 16 GLN B CA     1 
ATOM 866  C C      . GLN B 1 16 ? 26.632 4.001   41.006 1.00 0.00 ? 16 GLN B C      1 
ATOM 867  O O      . GLN B 1 16 ? 25.772 3.348   40.416 1.00 0.00 ? 16 GLN B O      1 
ATOM 868  C CB     . GLN B 1 16 ? 26.513 3.085   43.349 1.00 0.00 ? 16 GLN B CB     1 
ATOM 869  C CG     . GLN B 1 16 ? 25.372 2.049   43.074 1.00 0.00 ? 16 GLN B CG     1 
ATOM 870  C CD     . GLN B 1 16 ? 24.384 1.709   44.195 1.00 0.00 ? 16 GLN B CD     1 
ATOM 871  O OE1    . GLN B 1 16 ? 23.457 0.937   44.007 1.00 0.00 ? 16 GLN B OE1    1 
ATOM 872  N NE2    . GLN B 1 16 ? 24.513 2.268   45.371 1.00 0.00 ? 16 GLN B NE2    1 
ATOM 873  H H      . GLN B 1 16 ? 28.362 4.867   43.410 1.00 0.00 ? 16 GLN B H      1 
ATOM 874  H HA     . GLN B 1 16 ? 27.922 2.507   41.786 1.00 0.00 ? 16 GLN B HA     1 
ATOM 875  H HB2    . GLN B 1 16 ? 27.136 2.705   44.179 1.00 0.00 ? 16 GLN B HB2    1 
ATOM 876  H HB3    . GLN B 1 16 ? 26.059 4.027   43.725 1.00 0.00 ? 16 GLN B HB3    1 
ATOM 877  H HG2    . GLN B 1 16 ? 24.732 2.397   42.241 1.00 0.00 ? 16 GLN B HG2    1 
ATOM 878  H HG3    . GLN B 1 16 ? 25.802 1.096   42.708 1.00 0.00 ? 16 GLN B HG3    1 
ATOM 879  H HE21   . GLN B 1 16 ? 25.264 2.955   45.444 1.00 0.00 ? 16 GLN B HE21   1 
ATOM 880  H HE22   . GLN B 1 16 ? 23.780 2.036   46.042 1.00 0.00 ? 16 GLN B HE22   1 
ATOM 881  N N      . GLY B 1 17 ? 26.943 5.397   40.637 1.00 0.00 ? 17 GLY B N      1 
ATOM 882  C CA     . GLY B 1 17 ? 26.253 6.085   39.549 1.00 0.00 ? 17 GLY B CA     1 
ATOM 883  C C      . GLY B 1 17 ? 26.652 5.513   38.207 1.00 0.00 ? 17 GLY B C      1 
ATOM 884  O O      . GLY B 1 17 ? 25.962 5.668   37.203 1.00 0.00 ? 17 GLY B O      1 
ATOM 885  H H      . GLY B 1 17 ? 27.713 5.881   41.218 1.00 0.00 ? 17 GLY B H      1 
ATOM 886  H HA2    . GLY B 1 17 ? 25.157 5.988   39.671 1.00 0.00 ? 17 GLY B HA2    1 
ATOM 887  H HA3    . GLY B 1 17 ? 26.485 7.162   39.568 1.00 0.00 ? 17 GLY B HA3    1 
ATOM 888  N N      . ASP B 1 18 ? 27.922 4.757   38.179 1.00 0.00 ? 18 ASP B N      1 
ATOM 889  C CA     . ASP B 1 18 ? 28.433 4.148   36.953 1.00 0.00 ? 18 ASP B CA     1 
ATOM 890  C C      . ASP B 1 18 ? 27.514 3.050   36.473 1.00 0.00 ? 18 ASP B C      1 
ATOM 891  O O      . ASP B 1 18 ? 27.251 2.884   35.239 1.00 0.00 ? 18 ASP B O      1 
ATOM 892  C CB     . ASP B 1 18 ? 29.879 3.639   37.168 1.00 0.00 ? 18 ASP B CB     1 
ATOM 893  C CG     . ASP B 1 18 ? 30.458 3.782   38.585 1.00 0.00 ? 18 ASP B CG     1 
ATOM 894  O OD1    . ASP B 1 18 ? 30.911 4.834   39.015 1.00 0.00 ? 18 ASP B OD1    1 
ATOM 895  O OD2    . ASP B 1 18 ? 30.394 2.622   39.303 1.00 0.00 ? 18 ASP B OD2    1 
ATOM 896  H H      . ASP B 1 18 ? 28.452 4.681   39.118 1.00 0.00 ? 18 ASP B H      1 
ATOM 897  H HA     . ASP B 1 18 ? 28.418 4.939   36.179 1.00 0.00 ? 18 ASP B HA     1 
ATOM 898  H HB2    . ASP B 1 18 ? 29.975 2.578   36.879 1.00 0.00 ? 18 ASP B HB2    1 
ATOM 899  H HB3    . ASP B 1 18 ? 30.564 4.176   36.478 1.00 0.00 ? 18 ASP B HB3    1 
ATOM 900  H HD2    . ASP B 1 18 ? 29.922 2.749   40.124 1.00 0.00 ? 18 ASP B HD2    1 
ATOM 901  N N      . MET B 1 19 ? 26.937 2.183   37.521 1.00 0.00 ? 19 MET B N      1 
ATOM 902  C CA     . MET B 1 19 ? 26.032 1.082   37.201 1.00 0.00 ? 19 MET B CA     1 
ATOM 903  C C      . MET B 1 19 ? 24.741 1.598   36.610 1.00 0.00 ? 19 MET B C      1 
ATOM 904  O O      . MET B 1 19 ? 24.177 1.022   35.665 1.00 0.00 ? 19 MET B O      1 
ATOM 905  C CB     . MET B 1 19 ? 25.760 0.235   38.473 1.00 0.00 ? 19 MET B CB     1 
ATOM 906  C CG     . MET B 1 19 ? 24.312 0.276   39.011 1.00 0.00 ? 19 MET B CG     1 
ATOM 907  S SD     . MET B 1 19 ? 23.797 -1.380  39.494 1.00 0.00 ? 19 MET B SD     1 
ATOM 908  C CE     . MET B 1 19 ? 25.406 -2.181  39.462 1.00 0.00 ? 19 MET B CE     1 
ATOM 909  H H      . MET B 1 19 ? 27.222 2.411   38.536 1.00 0.00 ? 19 MET B H      1 
ATOM 910  H HA     . MET B 1 19 ? 26.510 0.444   36.433 1.00 0.00 ? 19 MET B HA     1 
ATOM 911  H HB2    . MET B 1 19 ? 26.040 -0.824  38.288 1.00 0.00 ? 19 MET B HB2    1 
ATOM 912  H HB3    . MET B 1 19 ? 26.434 0.567   39.287 1.00 0.00 ? 19 MET B HB3    1 
ATOM 913  H HG2    . MET B 1 19 ? 24.221 0.952   39.878 1.00 0.00 ? 19 MET B HG2    1 
ATOM 914  H HG3    . MET B 1 19 ? 23.628 0.660   38.232 1.00 0.00 ? 19 MET B HG3    1 
ATOM 915  H HE1    . MET B 1 19 ? 25.705 -2.431  38.428 1.00 0.00 ? 19 MET B HE1    1 
ATOM 916  H HE2    . MET B 1 19 ? 26.175 -1.514  39.895 1.00 0.00 ? 19 MET B HE2    1 
ATOM 917  H HE3    . MET B 1 19 ? 25.389 -3.112  40.055 1.00 0.00 ? 19 MET B HE3    1 
ATOM 918  N N      . LYS B 1 20 ? 24.131 2.821   37.173 1.00 0.00 ? 20 LYS B N      1 
ATOM 919  C CA     . LYS B 1 20 ? 22.886 3.376   36.650 1.00 0.00 ? 20 LYS B CA     1 
ATOM 920  C C      . LYS B 1 20 ? 23.061 3.852   35.229 1.00 0.00 ? 20 LYS B C      1 
ATOM 921  O O      . LYS B 1 20 ? 22.185 3.676   34.364 1.00 0.00 ? 20 LYS B O      1 
ATOM 922  C CB     . LYS B 1 20 ? 22.410 4.534   37.569 1.00 0.00 ? 20 LYS B CB     1 
ATOM 923  C CG     . LYS B 1 20 ? 22.685 4.283   39.071 1.00 0.00 ? 20 LYS B CG     1 
ATOM 924  C CD     . LYS B 1 20 ? 21.567 4.736   40.017 1.00 0.00 ? 20 LYS B CD     1 
ATOM 925  C CE     . LYS B 1 20 ? 21.891 4.276   41.443 1.00 0.00 ? 20 LYS B CE     1 
ATOM 926  N NZ     . LYS B 1 20 ? 20.913 4.854   42.379 1.00 0.00 ? 20 LYS B NZ     1 
ATOM 927  H H      . LYS B 1 20 ? 24.662 3.280   37.994 1.00 0.00 ? 20 LYS B H      1 
ATOM 928  H HA     . LYS B 1 20 ? 22.124 2.573   36.643 1.00 0.00 ? 20 LYS B HA     1 
ATOM 929  H HB2    . LYS B 1 20 ? 22.906 5.479   37.262 1.00 0.00 ? 20 LYS B HB2    1 
ATOM 930  H HB3    . LYS B 1 20 ? 21.325 4.716   37.407 1.00 0.00 ? 20 LYS B HB3    1 
ATOM 931  H HG2    . LYS B 1 20 ? 22.830 3.202   39.260 1.00 0.00 ? 20 LYS B HG2    1 
ATOM 932  H HG3    . LYS B 1 20 ? 23.641 4.764   39.359 1.00 0.00 ? 20 LYS B HG3    1 
ATOM 933  H HD2    . LYS B 1 20 ? 21.456 5.837   39.961 1.00 0.00 ? 20 LYS B HD2    1 
ATOM 934  H HD3    . LYS B 1 20 ? 20.600 4.309   39.685 1.00 0.00 ? 20 LYS B HD3    1 
ATOM 935  H HE2    . LYS B 1 20 ? 21.878 3.166   41.504 1.00 0.00 ? 20 LYS B HE2    1 
ATOM 936  H HE3    . LYS B 1 20 ? 22.915 4.581   41.738 1.00 0.00 ? 20 LYS B HE3    1 
ATOM 937  H HZ1    . LYS B 1 20 ? 19.978 4.887   41.954 1.00 0.00 ? 20 LYS B HZ1    1 
ATOM 938  H HZ3    . LYS B 1 20 ? 20.823 4.279   43.225 1.00 0.00 ? 20 LYS B HZ3    1 
ATOM 939  N N      . ALA B 1 21 ? 24.334 4.540   34.926 1.00 0.00 ? 21 ALA B N      1 
ATOM 940  C CA     . ALA B 1 21 ? 24.637 5.052   33.590 1.00 0.00 ? 21 ALA B CA     1 
ATOM 941  C C      . ALA B 1 21 ? 24.753 3.927   32.593 1.00 0.00 ? 21 ALA B C      1 
ATOM 942  O O      . ALA B 1 21 ? 24.307 4.022   31.445 1.00 0.00 ? 21 ALA B O      1 
ATOM 943  C CB     . ALA B 1 21 ? 25.926 5.888   33.700 1.00 0.00 ? 21 ALA B CB     1 
ATOM 944  H H      . ALA B 1 21 ? 25.026 4.638   35.750 1.00 0.00 ? 21 ALA B H      1 
ATOM 945  H HA     . ALA B 1 21 ? 23.806 5.701   33.265 1.00 0.00 ? 21 ALA B HA     1 
ATOM 946  H HB1    . ALA B 1 21 ? 26.215 6.328   32.726 1.00 0.00 ? 21 ALA B HB1    1 
ATOM 947  H HB2    . ALA B 1 21 ? 25.813 6.732   34.410 1.00 0.00 ? 21 ALA B HB2    1 
ATOM 948  H HB3    . ALA B 1 21 ? 26.788 5.285   34.050 1.00 0.00 ? 21 ALA B HB3    1 
ATOM 949  N N      . ILE B 1 22 ? 25.442 2.706   33.063 1.00 0.00 ? 22 ILE B N      1 
ATOM 950  C CA     . ILE B 1 22 ? 25.626 1.541   32.207 1.00 0.00 ? 22 ILE B CA     1 
ATOM 951  C C      . ILE B 1 22 ? 24.299 0.918   31.850 1.00 0.00 ? 22 ILE B C      1 
ATOM 952  O O      . ILE B 1 22 ? 24.061 0.484   30.711 1.00 0.00 ? 22 ILE B O      1 
ATOM 953  C CB     . ILE B 1 22 ? 26.607 0.490   32.866 1.00 0.00 ? 22 ILE B CB     1 
ATOM 954  C CG1    . ILE B 1 22 ? 25.959 -0.901  33.180 1.00 0.00 ? 22 ILE B CG1    1 
ATOM 955  C CG2    . ILE B 1 22 ? 27.274 1.015   34.175 1.00 0.00 ? 22 ILE B CG2    1 
ATOM 956  C CD1    . ILE B 1 22 ? 24.453 -1.024  32.870 1.00 0.00 ? 22 ILE B CD1    1 
ATOM 957  H H      . ILE B 1 22 ? 25.804 2.730   34.083 1.00 0.00 ? 22 ILE B H      1 
ATOM 958  H HA     . ILE B 1 22 ? 26.076 1.890   31.259 1.00 0.00 ? 22 ILE B HA     1 
ATOM 959  H HB     . ILE B 1 22 ? 27.420 0.303   32.130 1.00 0.00 ? 22 ILE B HB     1 
ATOM 960  H HG12   . ILE B 1 22 ? 26.521 -1.708  32.679 1.00 0.00 ? 22 ILE B HG12   1 
ATOM 961  H HG13   . ILE B 1 22 ? 26.065 -1.119  34.262 1.00 0.00 ? 22 ILE B HG13   1 
ATOM 962  H HG21   . ILE B 1 22 ? 26.817 1.956   34.528 1.00 0.00 ? 22 ILE B HG21   1 
ATOM 963  H HG22   . ILE B 1 22 ? 27.206 0.292   35.005 1.00 0.00 ? 22 ILE B HG22   1 
ATOM 964  H HG23   . ILE B 1 22 ? 28.359 1.202   34.065 1.00 0.00 ? 22 ILE B HG23   1 
ATOM 965  H HD11   . ILE B 1 22 ? 24.005 -0.065  32.555 1.00 0.00 ? 22 ILE B HD11   1 
ATOM 966  H HD12   . ILE B 1 22 ? 24.272 -1.742  32.051 1.00 0.00 ? 22 ILE B HD12   1 
ATOM 967  H HD13   . ILE B 1 22 ? 23.881 -1.384  33.747 1.00 0.00 ? 22 ILE B HD13   1 
ATOM 968  N N      . GLY B 1 23 ? 23.296 0.859   32.932 1.00 0.00 ? 23 GLY B N      1 
ATOM 969  C CA     . GLY B 1 23 ? 21.971 0.283   32.731 1.00 0.00 ? 23 GLY B CA     1 
ATOM 970  C C      . GLY B 1 23 ? 21.218 1.024   31.656 1.00 0.00 ? 23 GLY B C      1 
ATOM 971  O O      . GLY B 1 23 ? 20.259 0.526   31.071 1.00 0.00 ? 23 GLY B O      1 
ATOM 972  H H      . GLY B 1 23 ? 23.605 1.267   33.884 1.00 0.00 ? 23 GLY B H      1 
ATOM 973  H HA2    . GLY B 1 23 ? 22.054 -0.782  32.449 1.00 0.00 ? 23 GLY B HA2    1 
ATOM 974  H HA3    . GLY B 1 23 ? 21.388 0.318   33.671 1.00 0.00 ? 23 GLY B HA3    1 
ATOM 975  N N      . GLY B 1 24 ? 21.699 2.387   31.347 1.00 0.00 ? 24 GLY B N      1 
ATOM 976  C CA     . GLY B 1 24 ? 21.067 3.221   30.328 1.00 0.00 ? 24 GLY B CA     1 
ATOM 977  C C      . GLY B 1 24 ? 21.126 2.557   28.974 1.00 0.00 ? 24 GLY B C      1 
ATOM 978  O O      . GLY B 1 24 ? 20.371 2.877   28.061 1.00 0.00 ? 24 GLY B O      1 
ATOM 979  H H      . GLY B 1 24 ? 22.549 2.729   31.920 1.00 0.00 ? 24 GLY B H      1 
ATOM 980  H HA2    . GLY B 1 24 ? 20.012 3.415   30.594 1.00 0.00 ? 24 GLY B HA2    1 
ATOM 981  H HA3    . GLY B 1 24 ? 21.572 4.207   30.274 1.00 0.00 ? 24 GLY B HA3    1 
ATOM 982  N N      . TYR B 1 25 ? 22.146 1.501   28.812 1.00 0.00 ? 25 TYR B N      1 
ATOM 983  C CA     . TYR B 1 25 ? 22.315 0.773   27.557 1.00 0.00 ? 25 TYR B CA     1 
ATOM 984  C C      . TYR B 1 25 ? 21.091 -0.056  27.244 1.00 0.00 ? 25 TYR B C      1 
ATOM 985  O O      . TYR B 1 25 ? 20.646 -0.149  26.098 1.00 0.00 ? 25 TYR B O      1 
ATOM 986  C CB     . TYR B 1 25 ? 23.535 -0.189  27.635 1.00 0.00 ? 25 TYR B CB     1 
ATOM 987  C CG     . TYR B 1 25 ? 23.997 -0.831  26.321 1.00 0.00 ? 25 TYR B CG     1 
ATOM 988  C CD1    . TYR B 1 25 ? 23.446 -0.431  25.102 1.00 0.00 ? 25 TYR B CD1    1 
ATOM 989  C CD2    . TYR B 1 25 ? 24.981 -1.823  26.342 1.00 0.00 ? 25 TYR B CD2    1 
ATOM 990  C CE1    . TYR B 1 25 ? 23.881 -1.013  23.914 1.00 0.00 ? 25 TYR B CE1    1 
ATOM 991  C CE2    . TYR B 1 25 ? 25.418 -2.403  25.154 1.00 0.00 ? 25 TYR B CE2    1 
ATOM 992  C CZ     . TYR B 1 25 ? 24.868 -1.995  23.940 1.00 0.00 ? 25 TYR B CZ     1 
ATOM 993  O OH     . TYR B 1 25 ? 25.298 -2.561  22.773 1.00 0.00 ? 25 TYR B OH     1 
ATOM 994  H H      . TYR B 1 25 ? 22.759 1.297   29.677 1.00 0.00 ? 25 TYR B H      1 
ATOM 995  H HA     . TYR B 1 25 ? 22.457 1.499   26.735 1.00 0.00 ? 25 TYR B HA     1 
ATOM 996  H HB2    . TYR B 1 25 ? 24.389 0.338   28.108 1.00 0.00 ? 25 TYR B HB2    1 
ATOM 997  H HB3    . TYR B 1 25 ? 23.319 -1.013  28.347 1.00 0.00 ? 25 TYR B HB3    1 
ATOM 998  H HD1    . TYR B 1 25 ? 22.685 0.338   25.070 1.00 0.00 ? 25 TYR B HD1    1 
ATOM 999  H HD2    . TYR B 1 25 ? 25.420 -2.137  27.282 1.00 0.00 ? 25 TYR B HD2    1 
ATOM 1000 H HE1    . TYR B 1 25 ? 23.465 -0.697  22.968 1.00 0.00 ? 25 TYR B HE1    1 
ATOM 1001 H HE2    . TYR B 1 25 ? 26.184 -3.161  25.182 1.00 0.00 ? 25 TYR B HE2    1 
ATOM 1002 H HH     . TYR B 1 25 ? 25.973 -3.209  22.981 1.00 0.00 ? 25 TYR B HH     1 
ATOM 1003 N N      . ILE B 1 26 ? 20.458 -0.742  28.390 1.00 0.00 ? 26 ILE B N      1 
ATOM 1004 C CA     . ILE B 1 26 ? 19.270 -1.574  28.233 1.00 0.00 ? 26 ILE B CA     1 
ATOM 1005 C C      . ILE B 1 26 ? 18.084 -0.750  27.789 1.00 0.00 ? 26 ILE B C      1 
ATOM 1006 O O      . ILE B 1 26 ? 17.275 -1.163  26.949 1.00 0.00 ? 26 ILE B O      1 
ATOM 1007 C CB     . ILE B 1 26 ? 18.959 -2.389  29.554 1.00 0.00 ? 26 ILE B CB     1 
ATOM 1008 C CG1    . ILE B 1 26 ? 17.771 -1.830  30.399 1.00 0.00 ? 26 ILE B CG1    1 
ATOM 1009 C CG2    . ILE B 1 26 ? 20.198 -2.521  30.490 1.00 0.00 ? 26 ILE B CG2    1 
ATOM 1010 C CD1    . ILE B 1 26 ? 16.498 -2.701  30.432 1.00 0.00 ? 26 ILE B CD1    1 
ATOM 1011 H H      . ILE B 1 26 ? 20.927 -0.592  29.350 1.00 0.00 ? 26 ILE B H      1 
ATOM 1012 H HA     . ILE B 1 26 ? 19.471 -2.294  27.420 1.00 0.00 ? 26 ILE B HA     1 
ATOM 1013 H HB     . ILE B 1 26 ? 18.667 -3.413  29.233 1.00 0.00 ? 26 ILE B HB     1 
ATOM 1014 H HG12   . ILE B 1 26 ? 18.104 -1.606  31.430 1.00 0.00 ? 26 ILE B HG12   1 
ATOM 1015 H HG13   . ILE B 1 26 ? 17.456 -0.851  29.992 1.00 0.00 ? 26 ILE B HG13   1 
ATOM 1016 H HG21   . ILE B 1 26 ? 21.057 -3.021  30.005 1.00 0.00 ? 26 ILE B HG21   1 
ATOM 1017 H HG22   . ILE B 1 26 ? 20.553 -1.542  30.855 1.00 0.00 ? 26 ILE B HG22   1 
ATOM 1018 H HG23   . ILE B 1 26 ? 19.988 -3.139  31.383 1.00 0.00 ? 26 ILE B HG23   1 
ATOM 1019 H HD11   . ILE B 1 26 ? 15.587 -2.080  30.348 1.00 0.00 ? 26 ILE B HD11   1 
ATOM 1020 H HD12   . ILE B 1 26 ? 16.476 -3.423  29.593 1.00 0.00 ? 26 ILE B HD12   1 
ATOM 1021 H HD13   . ILE B 1 26 ? 16.402 -3.277  31.370 1.00 0.00 ? 26 ILE B HD13   1 
ATOM 1022 N N      . VAL B 1 27 ? 17.950 0.583   28.419 1.00 0.00 ? 27 VAL B N      1 
ATOM 1023 C CA     . VAL B 1 27 ? 16.854 1.490   28.088 1.00 0.00 ? 27 VAL B CA     1 
ATOM 1024 C C      . VAL B 1 27 ? 16.943 1.937   26.647 1.00 0.00 ? 27 VAL B C      1 
ATOM 1025 O O      . VAL B 1 27 ? 15.936 2.050   25.936 1.00 0.00 ? 27 VAL B O      1 
ATOM 1026 C CB     . VAL B 1 27 ? 16.871 2.730   29.065 1.00 0.00 ? 27 VAL B CB     1 
ATOM 1027 C CG1    . VAL B 1 27 ? 16.182 4.022   28.550 1.00 0.00 ? 27 VAL B CG1    1 
ATOM 1028 C CG2    . VAL B 1 27 ? 16.232 2.452   30.449 1.00 0.00 ? 27 VAL B CG2    1 
ATOM 1029 H H      . VAL B 1 27 ? 18.710 0.845   29.141 1.00 0.00 ? 27 VAL B H      1 
ATOM 1030 H HA     . VAL B 1 27 ? 15.899 0.949   28.202 1.00 0.00 ? 27 VAL B HA     1 
ATOM 1031 H HB     . VAL B 1 27 ? 17.936 2.991   29.245 1.00 0.00 ? 27 VAL B HB     1 
ATOM 1032 H HG11   . VAL B 1 27 ? 15.109 3.869   28.318 1.00 0.00 ? 27 VAL B HG11   1 
ATOM 1033 H HG12   . VAL B 1 27 ? 16.244 4.851   29.281 1.00 0.00 ? 27 VAL B HG12   1 
ATOM 1034 H HG13   . VAL B 1 27 ? 16.656 4.419   27.633 1.00 0.00 ? 27 VAL B HG13   1 
ATOM 1035 H HG21   . VAL B 1 27 ? 15.147 2.245   30.373 1.00 0.00 ? 27 VAL B HG21   1 
ATOM 1036 H HG22   . VAL B 1 27 ? 16.694 1.580   30.946 1.00 0.00 ? 27 VAL B HG22   1 
ATOM 1037 H HG23   . VAL B 1 27 ? 16.361 3.303   31.141 1.00 0.00 ? 27 VAL B HG23   1 
ATOM 1038 N N      . GLY B 1 28 ? 18.299 2.231   26.141 1.00 0.00 ? 28 GLY B N      1 
ATOM 1039 C CA     . GLY B 1 28 ? 18.531 2.675   24.771 1.00 0.00 ? 28 GLY B CA     1 
ATOM 1040 C C      . GLY B 1 28 ? 18.392 1.527   23.800 1.00 0.00 ? 28 GLY B C      1 
ATOM 1041 O O      . GLY B 1 28 ? 18.457 1.690   22.586 1.00 0.00 ? 28 GLY B O      1 
ATOM 1042 H H      . GLY B 1 28 ? 19.106 2.101   26.846 1.00 0.00 ? 28 GLY B H      1 
ATOM 1043 H HA2    . GLY B 1 28 ? 17.817 3.472   24.497 1.00 0.00 ? 28 GLY B HA2    1 
ATOM 1044 H HA3    . GLY B 1 28 ? 19.547 3.107   24.676 1.00 0.00 ? 28 GLY B HA3    1 
ATOM 1045 N N      . ALA B 1 29 ? 18.172 0.191   24.400 1.00 0.00 ? 29 ALA B N      1 
ATOM 1046 C CA     . ALA B 1 29 ? 18.018 -1.006  23.584 1.00 0.00 ? 29 ALA B CA     1 
ATOM 1047 C C      . ALA B 1 29 ? 16.763 -0.935  22.746 1.00 0.00 ? 29 ALA B C      1 
ATOM 1048 O O      . ALA B 1 29 ? 16.731 -1.341  21.578 1.00 0.00 ? 29 ALA B O      1 
ATOM 1049 C CB     . ALA B 1 29 ? 18.034 -2.220  24.527 1.00 0.00 ? 29 ALA B CB     1 
ATOM 1050 H H      . ALA B 1 29 ? 18.131 0.159   25.477 1.00 0.00 ? 29 ALA B H      1 
ATOM 1051 H HA     . ALA B 1 29 ? 18.875 -1.073  22.886 1.00 0.00 ? 29 ALA B HA     1 
ATOM 1052 H HB1    . ALA B 1 29 ? 17.944 -3.175  23.977 1.00 0.00 ? 29 ALA B HB1    1 
ATOM 1053 H HB2    . ALA B 1 29 ? 18.976 -2.277  25.106 1.00 0.00 ? 29 ALA B HB2    1 
ATOM 1054 H HB3    . ALA B 1 29 ? 17.208 -2.187  25.263 1.00 0.00 ? 29 ALA B HB3    1 
ATOM 1055 N N      . LEU B 1 30 ? 15.573 -0.363  23.411 1.00 0.00 ? 30 LEU B N      1 
ATOM 1056 C CA     . LEU B 1 30 ? 14.292 -0.230  22.725 1.00 0.00 ? 30 LEU B CA     1 
ATOM 1057 C C      . LEU B 1 30 ? 14.391 0.743   21.573 1.00 0.00 ? 30 LEU B C      1 
ATOM 1058 O O      . LEU B 1 30 ? 13.823 0.537   20.490 1.00 0.00 ? 30 LEU B O      1 
ATOM 1059 C CB     . LEU B 1 30 ? 13.181 0.198   23.724 1.00 0.00 ? 30 LEU B CB     1 
ATOM 1060 C CG     . LEU B 1 30 ? 12.913 -0.707  24.953 1.00 0.00 ? 30 LEU B CG     1 
ATOM 1061 C CD1    . LEU B 1 30 ? 11.713 -0.180  25.752 1.00 0.00 ? 30 LEU B CD1    1 
ATOM 1062 C CD2    . LEU B 1 30 ? 12.671 -2.178  24.571 1.00 0.00 ? 30 LEU B CD2    1 
ATOM 1063 H H      . LEU B 1 30 ? 15.701 -0.063  24.382 1.00 0.00 ? 30 LEU B H      1 
ATOM 1064 H HA     . LEU B 1 30 ? 14.030 -1.210  22.280 1.00 0.00 ? 30 LEU B HA     1 
ATOM 1065 H HB2    . LEU B 1 30 ? 13.404 1.220   24.090 1.00 0.00 ? 30 LEU B HB2    1 
ATOM 1066 H HB3    . LEU B 1 30 ? 12.228 0.312   23.164 1.00 0.00 ? 30 LEU B HB3    1 
ATOM 1067 H HG     . LEU B 1 30 ? 13.806 -0.664  25.615 1.00 0.00 ? 30 LEU B HG     1 
ATOM 1068 H HD11   . LEU B 1 30 ? 11.869 0.867   26.081 1.00 0.00 ? 30 LEU B HD11   1 
ATOM 1069 H HD12   . LEU B 1 30 ? 10.778 -0.199  25.162 1.00 0.00 ? 30 LEU B HD12   1 
ATOM 1070 H HD13   . LEU B 1 30 ? 11.535 -0.776  26.665 1.00 0.00 ? 30 LEU B HD13   1 
ATOM 1071 H HD21   . LEU B 1 30 ? 12.440 -2.804  25.453 1.00 0.00 ? 30 LEU B HD21   1 
ATOM 1072 H HD22   . LEU B 1 30 ? 11.839 -2.292  23.853 1.00 0.00 ? 30 LEU B HD22   1 
ATOM 1073 H HD23   . LEU B 1 30 ? 13.572 -2.624  24.108 1.00 0.00 ? 30 LEU B HD23   1 
ATOM 1074 N N      . VAL B 1 31 ? 15.201 1.955   21.820 1.00 0.00 ? 31 VAL B N      1 
ATOM 1075 C CA     . VAL B 1 31 ? 15.382 2.982   20.800 1.00 0.00 ? 31 VAL B CA     1 
ATOM 1076 C C      . VAL B 1 31 ? 16.153 2.443   19.618 1.00 0.00 ? 31 VAL B C      1 
ATOM 1077 O O      . VAL B 1 31 ? 15.856 2.736   18.453 1.00 0.00 ? 31 VAL B O      1 
ATOM 1078 C CB     . VAL B 1 31 ? 16.122 4.233   21.424 1.00 0.00 ? 31 VAL B CB     1 
ATOM 1079 C CG1    . VAL B 1 31 ? 15.714 5.625   20.867 1.00 0.00 ? 31 VAL B CG1    1 
ATOM 1080 C CG2    . VAL B 1 31 ? 15.971 4.347   22.962 1.00 0.00 ? 31 VAL B CG2    1 
ATOM 1081 H H      . VAL B 1 31 ? 15.650 2.034   22.801 1.00 0.00 ? 31 VAL B H      1 
ATOM 1082 H HA     . VAL B 1 31 ? 14.392 3.295   20.427 1.00 0.00 ? 31 VAL B HA     1 
ATOM 1083 H HB     . VAL B 1 31 ? 17.206 4.113   21.212 1.00 0.00 ? 31 VAL B HB     1 
ATOM 1084 H HG11   . VAL B 1 31 ? 14.638 5.838   21.010 1.00 0.00 ? 31 VAL B HG11   1 
ATOM 1085 H HG12   . VAL B 1 31 ? 16.279 6.448   21.342 1.00 0.00 ? 31 VAL B HG12   1 
ATOM 1086 H HG13   . VAL B 1 31 ? 15.925 5.725   19.784 1.00 0.00 ? 31 VAL B HG13   1 
ATOM 1087 H HG21   . VAL B 1 31 ? 14.924 4.540   23.263 1.00 0.00 ? 31 VAL B HG21   1 
ATOM 1088 H HG22   . VAL B 1 31 ? 16.297 3.428   23.477 1.00 0.00 ? 31 VAL B HG22   1 
ATOM 1089 H HG23   . VAL B 1 31 ? 16.586 5.168   23.376 1.00 0.00 ? 31 VAL B HG23   1 
ATOM 1090 N N      . ILE B 1 32 ? 17.279 1.539   19.935 1.00 0.00 ? 32 ILE B N      1 
ATOM 1091 C CA     . ILE B 1 32 ? 18.110 0.941   18.893 1.00 0.00 ? 32 ILE B CA     1 
ATOM 1092 C C      . ILE B 1 32 ? 17.306 -0.002  18.037 1.00 0.00 ? 32 ILE B C      1 
ATOM 1093 O O      . ILE B 1 32 ? 17.455 -0.064  16.806 1.00 0.00 ? 32 ILE B O      1 
ATOM 1094 C CB     . ILE B 1 32 ? 19.387 0.234   19.508 1.00 0.00 ? 32 ILE B CB     1 
ATOM 1095 C CG1    . ILE B 1 32 ? 20.229 1.138   20.470 1.00 0.00 ? 32 ILE B CG1    1 
ATOM 1096 C CG2    . ILE B 1 32 ? 20.345 -0.336  18.418 1.00 0.00 ? 32 ILE B CG2    1 
ATOM 1097 C CD1    . ILE B 1 32 ? 21.280 0.405   21.329 1.00 0.00 ? 32 ILE B CD1    1 
ATOM 1098 H H      . ILE B 1 32 ? 17.452 1.349   20.984 1.00 0.00 ? 32 ILE B H      1 
ATOM 1099 H HA     . ILE B 1 32 ? 18.449 1.756   18.230 1.00 0.00 ? 32 ILE B HA     1 
ATOM 1100 H HB     . ILE B 1 32 ? 19.017 -0.619  20.112 1.00 0.00 ? 32 ILE B HB     1 
ATOM 1101 H HG12   . ILE B 1 32 ? 20.707 1.961   19.904 1.00 0.00 ? 32 ILE B HG12   1 
ATOM 1102 H HG13   . ILE B 1 32 ? 19.554 1.643   21.186 1.00 0.00 ? 32 ILE B HG13   1 
ATOM 1103 H HG21   . ILE B 1 32 ? 19.860 -1.080  17.761 1.00 0.00 ? 32 ILE B HG21   1 
ATOM 1104 H HG22   . ILE B 1 32 ? 20.758 0.457   17.768 1.00 0.00 ? 32 ILE B HG22   1 
ATOM 1105 H HG23   . ILE B 1 32 ? 21.206 -0.876  18.855 1.00 0.00 ? 32 ILE B HG23   1 
ATOM 1106 H HD11   . ILE B 1 32 ? 21.779 1.099   22.031 1.00 0.00 ? 32 ILE B HD11   1 
ATOM 1107 H HD12   . ILE B 1 32 ? 20.823 -0.401  21.939 1.00 0.00 ? 32 ILE B HD12   1 
ATOM 1108 H HD13   . ILE B 1 32 ? 22.079 -0.057  20.720 1.00 0.00 ? 32 ILE B HD13   1 
ATOM 1109 N N      . LEU B 1 33 ? 16.325 -0.854  18.750 1.00 0.00 ? 33 LEU B N      1 
ATOM 1110 C CA     . LEU B 1 33 ? 15.479 -1.814  18.049 1.00 0.00 ? 33 LEU B CA     1 
ATOM 1111 C C      . LEU B 1 33 ? 14.518 -1.110  17.120 1.00 0.00 ? 33 LEU B C      1 
ATOM 1112 O O      . LEU B 1 33 ? 14.252 -1.551  15.993 1.00 0.00 ? 33 LEU B O      1 
ATOM 1113 C CB     . LEU B 1 33 ? 14.711 -2.708  19.064 1.00 0.00 ? 33 LEU B CB     1 
ATOM 1114 C CG     . LEU B 1 33 ? 13.169 -2.553  19.152 1.00 0.00 ? 33 LEU B CG     1 
ATOM 1115 C CD1    . LEU B 1 33 ? 12.490 -3.391  18.060 1.00 0.00 ? 33 LEU B CD1    1 
ATOM 1116 C CD2    . LEU B 1 33 ? 12.612 -2.948  20.531 1.00 0.00 ? 33 LEU B CD2    1 
ATOM 1117 H H      . LEU B 1 33 ? 16.279 -0.730  19.767 1.00 0.00 ? 33 LEU B H      1 
ATOM 1118 H HA     . LEU B 1 33 ? 16.120 -2.446  17.411 1.00 0.00 ? 33 LEU B HA     1 
ATOM 1119 H HB2    . LEU B 1 33 ? 14.937 -3.773  18.841 1.00 0.00 ? 33 LEU B HB2    1 
ATOM 1120 H HB3    . LEU B 1 33 ? 15.134 -2.539  20.072 1.00 0.00 ? 33 LEU B HB3    1 
ATOM 1121 H HG     . LEU B 1 33 ? 12.916 -1.491  18.970 1.00 0.00 ? 33 LEU B HG     1 
ATOM 1122 H HD11   . LEU B 1 33 ? 12.834 -3.105  17.048 1.00 0.00 ? 33 LEU B HD11   1 
ATOM 1123 H HD12   . LEU B 1 33 ? 12.688 -4.475  18.178 1.00 0.00 ? 33 LEU B HD12   1 
ATOM 1124 H HD13   . LEU B 1 33 ? 11.394 -3.259  18.068 1.00 0.00 ? 33 LEU B HD13   1 
ATOM 1125 H HD21   . LEU B 1 33 ? 12.155 -3.958  20.525 1.00 0.00 ? 33 LEU B HD21   1 
ATOM 1126 H HD22   . LEU B 1 33 ? 13.405 -2.954  21.300 1.00 0.00 ? 33 LEU B HD22   1 
ATOM 1127 H HD23   . LEU B 1 33 ? 11.845 -2.238  20.887 1.00 0.00 ? 33 LEU B HD23   1 
ATOM 1128 N N      . ALA B 1 34 ? 13.917 0.141   17.633 1.00 0.00 ? 34 ALA B N      1 
ATOM 1129 C CA     . ALA B 1 34 ? 12.971 0.927   16.845 1.00 0.00 ? 34 ALA B CA     1 
ATOM 1130 C C      . ALA B 1 34 ? 13.640 1.495   15.613 1.00 0.00 ? 34 ALA B C      1 
ATOM 1131 O O      . ALA B 1 34 ? 13.063 1.547   14.521 1.00 0.00 ? 34 ALA B O      1 
ATOM 1132 C CB     . ALA B 1 34 ? 12.389 2.014   17.762 1.00 0.00 ? 34 ALA B CB     1 
ATOM 1133 H H      . ALA B 1 34 ? 14.217 0.437   18.629 1.00 0.00 ? 34 ALA B H      1 
ATOM 1134 H HA     . ALA B 1 34 ? 12.158 0.261   16.499 1.00 0.00 ? 34 ALA B HA     1 
ATOM 1135 H HB1    . ALA B 1 34 ? 11.649 2.643   17.235 1.00 0.00 ? 34 ALA B HB1    1 
ATOM 1136 H HB2    . ALA B 1 34 ? 11.872 1.578   18.638 1.00 0.00 ? 34 ALA B HB2    1 
ATOM 1137 H HB3    . ALA B 1 34 ? 13.173 2.694   18.154 1.00 0.00 ? 34 ALA B HB3    1 
ATOM 1138 N N      . VAL B 1 35 ? 15.017 1.999   15.796 1.00 0.00 ? 35 VAL B N      1 
ATOM 1139 C CA     . VAL B 1 35 ? 15.783 2.573   14.694 1.00 0.00 ? 35 VAL B CA     1 
ATOM 1140 C C      . VAL B 1 35 ? 16.067 1.537   13.634 1.00 0.00 ? 35 VAL B C      1 
ATOM 1141 O O      . VAL B 1 35 ? 16.009 1.802   12.426 1.00 0.00 ? 35 VAL B O      1 
ATOM 1142 C CB     . VAL B 1 35 ? 17.127 3.200   15.245 1.00 0.00 ? 35 VAL B CB     1 
ATOM 1143 C CG1    . VAL B 1 35 ? 16.994 4.128   16.483 1.00 0.00 ? 35 VAL B CG1    1 
ATOM 1144 C CG2    . VAL B 1 35 ? 18.195 2.153   15.633 1.00 0.00 ? 35 VAL B CG2    1 
ATOM 1145 H H      . VAL B 1 35 ? 15.423 1.915   16.794 1.00 0.00 ? 35 VAL B H      1 
ATOM 1146 H HA     . VAL B 1 35 ? 15.179 3.369   14.219 1.00 0.00 ? 35 VAL B HA     1 
ATOM 1147 H HB     . VAL B 1 35 ? 17.555 3.821   14.431 1.00 0.00 ? 35 VAL B HB     1 
ATOM 1148 H HG11   . VAL B 1 35 ? 15.941 4.397   16.700 1.00 0.00 ? 35 VAL B HG11   1 
ATOM 1149 H HG12   . VAL B 1 35 ? 17.408 3.677   17.399 1.00 0.00 ? 35 VAL B HG12   1 
ATOM 1150 H HG13   . VAL B 1 35 ? 17.507 5.102   16.338 1.00 0.00 ? 35 VAL B HG13   1 
ATOM 1151 H HG21   . VAL B 1 35 ? 18.183 1.919   16.713 1.00 0.00 ? 35 VAL B HG21   1 
ATOM 1152 H HG22   . VAL B 1 35 ? 18.057 1.201   15.092 1.00 0.00 ? 35 VAL B HG22   1 
ATOM 1153 H HG23   . VAL B 1 35 ? 19.219 2.498   15.385 1.00 0.00 ? 35 VAL B HG23   1 
ATOM 1154 N N      . ALA B 1 36 ? 16.418 0.187   14.125 1.00 0.00 ? 36 ALA B N      1 
ATOM 1155 C CA     . ALA B 1 36 ? 16.717 -0.913  13.213 1.00 0.00 ? 36 ALA B CA     1 
ATOM 1156 C C      . ALA B 1 36 ? 15.503 -1.286  12.396 1.00 0.00 ? 36 ALA B C      1 
ATOM 1157 O O      . ALA B 1 36 ? 15.585 -1.586  11.199 1.00 0.00 ? 36 ALA B O      1 
ATOM 1158 C CB     . ALA B 1 36 ? 17.249 -2.083  14.055 1.00 0.00 ? 36 ALA B CB     1 
ATOM 1159 H H      . ALA B 1 36 ? 16.437 0.063   15.198 1.00 0.00 ? 36 ALA B H      1 
ATOM 1160 H HA     . ALA B 1 36 ? 17.501 -0.581  12.504 1.00 0.00 ? 36 ALA B HA     1 
ATOM 1161 H HB1    . ALA B 1 36 ? 17.519 -2.954  13.430 1.00 0.00 ? 36 ALA B HB1    1 
ATOM 1162 H HB2    . ALA B 1 36 ? 18.161 -1.804  14.616 1.00 0.00 ? 36 ALA B HB2    1 
ATOM 1163 H HB3    . ALA B 1 36 ? 16.508 -2.436  14.799 1.00 0.00 ? 36 ALA B HB3    1 
ATOM 1164 N N      . GLY B 1 37 ? 14.210 -1.280  13.116 1.00 0.00 ? 37 GLY B N      1 
ATOM 1165 C CA     . GLY B 1 37 ? 12.955 -1.622  12.453 1.00 0.00 ? 37 GLY B CA     1 
ATOM 1166 C C      . GLY B 1 37 ? 12.615 -0.607  11.388 1.00 0.00 ? 37 GLY B C      1 
ATOM 1167 O O      . GLY B 1 37 ? 12.143 -0.937  10.302 1.00 0.00 ? 37 GLY B O      1 
ATOM 1168 H H      . GLY B 1 37 ? 14.252 -1.013  14.162 1.00 0.00 ? 37 GLY B H      1 
ATOM 1169 H HA2    . GLY B 1 37 ? 13.024 -2.624  11.994 1.00 0.00 ? 37 GLY B HA2    1 
ATOM 1170 H HA3    . GLY B 1 37 ? 12.131 -1.662  13.192 1.00 0.00 ? 37 GLY B HA3    1 
ATOM 1171 N N      . LEU B 1 38 ? 12.890 0.807   11.725 1.00 0.00 ? 38 LEU B N      1 
ATOM 1172 C CA     . LEU B 1 38 ? 12.610 1.893   10.791 1.00 0.00 ? 38 LEU B CA     1 
ATOM 1173 C C      . LEU B 1 38 ? 13.484 1.787   9.562  1.00 0.00 ? 38 LEU B C      1 
ATOM 1174 O O      . LEU B 1 38 ? 13.049 2.022   8.426  1.00 0.00 ? 38 LEU B O      1 
ATOM 1175 C CB     . LEU B 1 38 ? 12.795 3.275   11.486 1.00 0.00 ? 38 LEU B CB     1 
ATOM 1176 C CG     . LEU B 1 38 ? 11.778 3.675   12.588 1.00 0.00 ? 38 LEU B CG     1 
ATOM 1177 C CD1    . LEU B 1 38 ? 10.798 4.723   12.044 1.00 0.00 ? 38 LEU B CD1    1 
ATOM 1178 C CD2    . LEU B 1 38 ? 10.995 2.473   13.140 1.00 0.00 ? 38 LEU B CD2    1 
ATOM 1179 H H      . LEU B 1 38 ? 13.283 0.978   12.656 1.00 0.00 ? 38 LEU B H      1 
ATOM 1180 H HA     . LEU B 1 38 ? 11.569 1.794   10.439 1.00 0.00 ? 38 LEU B HA     1 
ATOM 1181 H HB2    . LEU B 1 38 ? 13.813 3.316   11.925 1.00 0.00 ? 38 LEU B HB2    1 
ATOM 1182 H HB3    . LEU B 1 38 ? 12.796 4.062   10.709 1.00 0.00 ? 38 LEU B HB3    1 
ATOM 1183 H HG     . LEU B 1 38 ? 12.341 4.139   13.426 1.00 0.00 ? 38 LEU B HG     1 
ATOM 1184 H HD11   . LEU B 1 38 ? 11.325 5.626   11.675 1.00 0.00 ? 38 LEU B HD11   1 
ATOM 1185 H HD12   . LEU B 1 38 ? 10.191 4.335   11.204 1.00 0.00 ? 38 LEU B HD12   1 
ATOM 1186 H HD13   . LEU B 1 38 ? 10.096 5.069   12.825 1.00 0.00 ? 38 LEU B HD13   1 
ATOM 1187 H HD21   . LEU B 1 38 ? 10.243 2.780   13.890 1.00 0.00 ? 38 LEU B HD21   1 
ATOM 1188 H HD22   . LEU B 1 38 ? 10.470 1.916   12.345 1.00 0.00 ? 38 LEU B HD22   1 
ATOM 1189 H HD23   . LEU B 1 38 ? 11.666 1.758   13.654 1.00 0.00 ? 38 LEU B HD23   1 
ATOM 1190 N N      . ILE B 1 39 ? 14.887 1.383   9.798  1.00 0.00 ? 39 ILE B N      1 
ATOM 1191 C CA     . ILE B 1 39 ? 15.847 1.242   8.705  1.00 0.00 ? 39 ILE B CA     1 
ATOM 1192 C C      . ILE B 1 39 ? 15.448 0.118   7.780  1.00 0.00 ? 39 ILE B C      1 
ATOM 1193 O O      . ILE B 1 39 ? 15.563 0.208   6.549  1.00 0.00 ? 39 ILE B O      1 
ATOM 1194 C CB     . ILE B 1 39 ? 17.320 1.064   9.251  1.00 0.00 ? 39 ILE B CB     1 
ATOM 1195 C CG1    . ILE B 1 39 ? 17.810 2.205   10.195 1.00 0.00 ? 39 ILE B CG1    1 
ATOM 1196 C CG2    . ILE B 1 39 ? 18.371 0.892   8.112  1.00 0.00 ? 39 ILE B CG2    1 
ATOM 1197 C CD1    . ILE B 1 39 ? 16.801 3.338   10.464 1.00 0.00 ? 39 ILE B CD1    1 
ATOM 1198 H H      . ILE B 1 39 ? 15.163 1.201   10.825 1.00 0.00 ? 39 ILE B H      1 
ATOM 1199 H HA     . ILE B 1 39 ? 15.807 2.169   8.105  1.00 0.00 ? 39 ILE B HA     1 
ATOM 1200 H HB     . ILE B 1 39 ? 17.325 0.128   9.853  1.00 0.00 ? 39 ILE B HB     1 
ATOM 1201 H HG12   . ILE B 1 39 ? 18.174 1.784   11.151 1.00 0.00 ? 39 ILE B HG12   1 
ATOM 1202 H HG13   . ILE B 1 39 ? 18.702 2.694   9.753  1.00 0.00 ? 39 ILE B HG13   1 
ATOM 1203 H HG21   . ILE B 1 39 ? 18.171 0.026   7.458  1.00 0.00 ? 39 ILE B HG21   1 
ATOM 1204 H HG22   . ILE B 1 39 ? 18.430 1.786   7.460  1.00 0.00 ? 39 ILE B HG22   1 
ATOM 1205 H HG23   . ILE B 1 39 ? 19.390 0.712   8.500  1.00 0.00 ? 39 ILE B HG23   1 
ATOM 1206 H HD11   . ILE B 1 39 ? 17.311 4.261   10.793 1.00 0.00 ? 39 ILE B HD11   1 
ATOM 1207 H HD12   . ILE B 1 39 ? 16.218 3.595   9.559  1.00 0.00 ? 39 ILE B HD12   1 
ATOM 1208 H HD13   . ILE B 1 39 ? 16.076 3.078   11.258 1.00 0.00 ? 39 ILE B HD13   1 
ATOM 1209 N N      . TYR B 1 40 ? 14.913 -1.098  8.429  1.00 0.00 ? 40 TYR B N      1 
ATOM 1210 C CA     . TYR B 1 40 ? 14.488 -2.265  7.660  1.00 0.00 ? 40 TYR B CA     1 
ATOM 1211 C C      . TYR B 1 40 ? 13.293 -1.937  6.794  1.00 0.00 ? 40 TYR B C      1 
ATOM 1212 O O      . TYR B 1 40 ? 13.182 -2.368  5.646  1.00 0.00 ? 40 TYR B O      1 
ATOM 1213 C CB     . TYR B 1 40 ? 14.093 -3.438  8.602  1.00 0.00 ? 40 TYR B CB     1 
ATOM 1214 C CG     . TYR B 1 40 ? 12.567 -3.581  8.630  1.00 0.00 ? 40 TYR B CG     1 
ATOM 1215 C CD1    . TYR B 1 40 ? 11.845 -3.762  7.446  1.00 0.00 ? 40 TYR B CD1    1 
ATOM 1216 C CD2    . TYR B 1 40 ? 11.890 -3.539  9.853  1.00 0.00 ? 40 TYR B CD2    1 
ATOM 1217 C CE1    . TYR B 1 40 ? 10.459 -3.907  7.487  1.00 0.00 ? 40 TYR B CE1    1 
ATOM 1218 C CE2    . TYR B 1 40 ? 10.505 -3.682  9.891  1.00 0.00 ? 40 TYR B CE2    1 
ATOM 1219 C CZ     . TYR B 1 40 ? 9.792  -3.867  8.709  1.00 0.00 ? 40 TYR B CZ     1 
ATOM 1220 O OH     . TYR B 1 40 ? 8.436  -4.010  8.745  1.00 0.00 ? 40 TYR B OH     1 
ATOM 1221 H H      . TYR B 1 40 ? 14.854 -1.072  9.507  1.00 0.00 ? 40 TYR B H      1 
ATOM 1222 H HA     . TYR B 1 40 ? 15.313 -2.574  6.993  1.00 0.00 ? 40 TYR B HA     1 
ATOM 1223 H HB2    . TYR B 1 40 ? 14.549 -4.426  8.384  1.00 0.00 ? 40 TYR B HB2    1 
ATOM 1224 H HB3    . TYR B 1 40 ? 14.341 -3.133  9.637  1.00 0.00 ? 40 TYR B HB3    1 
ATOM 1225 H HD1    . TYR B 1 40 ? 12.356 -3.801  6.495  1.00 0.00 ? 40 TYR B HD1    1 
ATOM 1226 H HD2    . TYR B 1 40 ? 12.437 -3.410  10.776 1.00 0.00 ? 40 TYR B HD2    1 
ATOM 1227 H HE1    . TYR B 1 40 ? 9.903  -4.054  6.576  1.00 0.00 ? 40 TYR B HE1    1 
ATOM 1228 H HE2    . TYR B 1 40 ? 9.994  -3.654  10.841 1.00 0.00 ? 40 TYR B HE2    1 
ATOM 1229 H HH     . TYR B 1 40 ? 8.149  -3.961  9.660  1.00 0.00 ? 40 TYR B HH     1 
ATOM 1230 N N      . SER B 1 41 ? 12.266 -1.070  7.411  1.00 0.00 ? 41 SER B N      1 
ATOM 1231 C CA     . SER B 1 41 ? 11.058 -0.671  6.694  1.00 0.00 ? 41 SER B CA     1 
ATOM 1232 C C      . SER B 1 41 ? 11.396 0.199   5.507  1.00 0.00 ? 41 SER B C      1 
ATOM 1233 O O      . SER B 1 41 ? 10.816 0.087   4.427  1.00 0.00 ? 41 SER B O      1 
ATOM 1234 C CB     . SER B 1 41 ? 10.056 0.025   7.646  1.00 0.00 ? 41 SER B CB     1 
ATOM 1235 O OG     . SER B 1 41 ? 10.503 1.313   8.081  1.00 0.00 ? 41 SER B OG     1 
ATOM 1236 H H      . SER B 1 41 ? 12.463 -0.749  8.423  1.00 0.00 ? 41 SER B H      1 
ATOM 1237 H HA     . SER B 1 41 ? 10.586 -1.588  6.295  1.00 0.00 ? 41 SER B HA     1 
ATOM 1238 H HB2    . SER B 1 41 ? 9.081  0.150   7.136  1.00 0.00 ? 41 SER B HB2    1 
ATOM 1239 H HB3    . SER B 1 41 ? 9.836  -0.607  8.530  1.00 0.00 ? 41 SER B HB3    1 
ATOM 1240 H HG     . SER B 1 41 ? 11.312 1.181   8.587  1.00 0.00 ? 41 SER B HG     1 
ATOM 1241 N N      . MET B 1 42 ? 12.467 1.197   5.719  1.00 0.00 ? 42 MET B N      1 
ATOM 1242 C CA     . MET B 1 42 ? 12.897 2.105   4.661  1.00 0.00 ? 42 MET B CA     1 
ATOM 1243 C C      . MET B 1 42 ? 13.528 1.343   3.519  1.00 0.00 ? 42 MET B C      1 
ATOM 1244 O O      . MET B 1 42 ? 13.327 1.653   2.336  1.00 0.00 ? 42 MET B O      1 
ATOM 1245 C CB     . MET B 1 42 ? 13.882 3.157   5.238  1.00 0.00 ? 42 MET B CB     1 
ATOM 1246 C CG     . MET B 1 42 ? 15.364 2.726   5.306  1.00 0.00 ? 42 MET B CG     1 
ATOM 1247 S SD     . MET B 1 42 ? 16.427 4.149   5.004  1.00 0.00 ? 42 MET B SD     1 
ATOM 1248 C CE     . MET B 1 42 ? 17.966 3.268   4.699  1.00 0.00 ? 42 MET B CE     1 
ATOM 1249 H H      . MET B 1 42 ? 12.910 1.213   6.704  1.00 0.00 ? 42 MET B H      1 
ATOM 1250 H HA     . MET B 1 42 ? 12.006 2.623   4.255  1.00 0.00 ? 42 MET B HA     1 
ATOM 1251 H HB2    . MET B 1 42 ? 13.812 4.099   4.658  1.00 0.00 ? 42 MET B HB2    1 
ATOM 1252 H HB3    . MET B 1 42 ? 13.568 3.433   6.264  1.00 0.00 ? 42 MET B HB3    1 
ATOM 1253 H HG2    . MET B 1 42 ? 15.615 2.286   6.289  1.00 0.00 ? 42 MET B HG2    1 
ATOM 1254 H HG3    . MET B 1 42 ? 15.569 1.947   4.547  1.00 0.00 ? 42 MET B HG3    1 
ATOM 1255 H HE1    . MET B 1 42 ? 18.820 3.792   5.167  1.00 0.00 ? 42 MET B HE1    1 
ATOM 1256 H HE2    . MET B 1 42 ? 17.910 2.246   5.112  1.00 0.00 ? 42 MET B HE2    1 
ATOM 1257 H HE3    . MET B 1 42 ? 18.156 3.192   3.614  1.00 0.00 ? 42 MET B HE3    1 
ATOM 1258 N N      . LEU B 1 43 ? 14.405 0.216   3.898  1.00 0.00 ? 43 LEU B N      1 
ATOM 1259 C CA     . LEU B 1 43 ? 15.083 -0.607  2.900  1.00 0.00 ? 43 LEU B CA     1 
ATOM 1260 C C      . LEU B 1 43 ? 14.083 -1.377  2.066  1.00 0.00 ? 43 LEU B C      1 
ATOM 1261 O O      . LEU B 1 43 ? 14.228 -1.527  0.844  1.00 0.00 ? 43 LEU B O      1 
ATOM 1262 C CB     . LEU B 1 43 ? 16.092 -1.572  3.582  1.00 0.00 ? 43 LEU B CB     1 
ATOM 1263 C CG     . LEU B 1 43 ? 16.932 -2.513  2.673  1.00 0.00 ? 43 LEU B CG     1 
ATOM 1264 C CD1    . LEU B 1 43 ? 16.122 -3.771  2.327  1.00 0.00 ? 43 LEU B CD1    1 
ATOM 1265 C CD2    . LEU B 1 43 ? 17.401 -1.828  1.382  1.00 0.00 ? 43 LEU B CD2    1 
ATOM 1266 H H      . LEU B 1 43 ? 14.509 0.044   4.904  1.00 0.00 ? 43 LEU B H      1 
ATOM 1267 H HA     . LEU B 1 43 ? 15.619 0.061   2.205  1.00 0.00 ? 43 LEU B HA     1 
ATOM 1268 H HB2    . LEU B 1 43 ? 16.794 -0.974  4.200  1.00 0.00 ? 43 LEU B HB2    1 
ATOM 1269 H HB3    . LEU B 1 43 ? 15.542 -2.198  4.312  1.00 0.00 ? 43 LEU B HB3    1 
ATOM 1270 H HG     . LEU B 1 43 ? 17.828 -2.834  3.243  1.00 0.00 ? 43 LEU B HG     1 
ATOM 1271 H HD11   . LEU B 1 43 ? 15.802 -4.317  3.236  1.00 0.00 ? 43 LEU B HD11   1 
ATOM 1272 H HD12   . LEU B 1 43 ? 15.210 -3.536  1.749  1.00 0.00 ? 43 LEU B HD12   1 
ATOM 1273 H HD13   . LEU B 1 43 ? 16.718 -4.485  1.725  1.00 0.00 ? 43 LEU B HD13   1 
ATOM 1274 H HD21   . LEU B 1 43 ? 17.958 -2.521  0.724  1.00 0.00 ? 43 LEU B HD21   1 
ATOM 1275 H HD22   . LEU B 1 43 ? 16.559 -1.413  0.796  1.00 0.00 ? 43 LEU B HD22   1 
ATOM 1276 H HD23   . LEU B 1 43 ? 18.092 -0.990  1.600  1.00 0.00 ? 43 LEU B HD23   1 
ATOM 1277 N N      . ARG B 1 44 ? 12.925 -1.937  2.794  1.00 0.00 ? 44 ARG B N      1 
ATOM 1278 C CA     . ARG B 1 44 ? 11.883 -2.704  2.116  1.00 0.00 ? 44 ARG B CA     1 
ATOM 1279 C C      . ARG B 1 44 ? 11.126 -1.839  1.135  1.00 0.00 ? 44 ARG B C      1 
ATOM 1280 O O      . ARG B 1 44 ? 10.760 -2.262  0.042  1.00 0.00 ? 44 ARG B O      1 
ATOM 1281 C CB     . ARG B 1 44 ? 10.932 -3.314  3.182  1.00 0.00 ? 44 ARG B CB     1 
ATOM 1282 C CG     . ARG B 1 44 ? 9.431  -3.327  2.789  1.00 0.00 ? 44 ARG B CG     1 
ATOM 1283 C CD     . ARG B 1 44 ? 8.535  -3.874  3.908  1.00 0.00 ? 44 ARG B CD     1 
ATOM 1284 N NE     . ARG B 1 44 ? 7.138  -3.912  3.410  1.00 0.00 ? 44 ARG B NE     1 
ATOM 1285 C CZ     . ARG B 1 44 ? 6.071  -3.486  4.079  1.00 0.00 ? 44 ARG B CZ     1 
ATOM 1286 N NH1    . ARG B 1 44 ? 6.109  -2.971  5.272  1.00 0.00 ? 44 ARG B NH1    1 
ATOM 1287 N NH2    . ARG B 1 44 ? 4.928  -3.596  3.500  1.00 0.00 ? 44 ARG B NH2    1 
ATOM 1288 H H      . ARG B 1 44 ? 12.901 -1.767  3.739  1.00 0.00 ? 44 ARG B H      1 
ATOM 1289 H HA     . ARG B 1 44 ? 12.371 -3.513  1.542  1.00 0.00 ? 44 ARG B HA     1 
ATOM 1290 H HB2    . ARG B 1 44 ? 11.240 -4.357  3.400  1.00 0.00 ? 44 ARG B HB2    1 
ATOM 1291 H HB3    . ARG B 1 44 ? 11.063 -2.779  4.144  1.00 0.00 ? 44 ARG B HB3    1 
ATOM 1292 H HG2    . ARG B 1 44 ? 9.081  -2.304  2.533  1.00 0.00 ? 44 ARG B HG2    1 
ATOM 1293 H HG3    . ARG B 1 44 ? 9.281  -3.925  1.868  1.00 0.00 ? 44 ARG B HG3    1 
ATOM 1294 H HD2    . ARG B 1 44 ? 8.868  -4.889  4.203  1.00 0.00 ? 44 ARG B HD2    1 
ATOM 1295 H HD3    . ARG B 1 44 ? 8.607  -3.228  4.810  1.00 0.00 ? 44 ARG B HD3    1 
ATOM 1296 H HH11   . ARG B 1 44 ? 7.054  -2.920  5.654  1.00 0.00 ? 44 ARG B HH11   1 
ATOM 1297 H HH12   . ARG B 1 44 ? 5.223  -2.683  5.679  1.00 0.00 ? 44 ARG B HH12   1 
ATOM 1298 H HH21   . ARG B 1 44 ? 4.105  -3.273  4.006  1.00 0.00 ? 44 ARG B HH21   1 
ATOM 1299 H HH22   . ARG B 1 44 ? 5.006  -4.015  2.572  1.00 0.00 ? 44 ARG B HH22   1 
ATOM 1300 N N      . LYS B 1 45 ? 10.832 -0.460  1.580  1.00 0.00 ? 45 LYS B N      1 
ATOM 1301 C CA     . LYS B 1 45 ? 10.108 0.488   0.739  1.00 0.00 ? 45 LYS B CA     1 
ATOM 1302 C C      . LYS B 1 45 ? 10.903 0.825   -0.502 1.00 0.00 ? 45 LYS B C      1 
ATOM 1303 O O      . LYS B 1 45 ? 10.365 0.949   -1.613 1.00 0.00 ? 45 LYS B O      1 
ATOM 1304 C CB     . LYS B 1 45 ? 9.783  1.766   1.557  1.00 0.00 ? 45 LYS B CB     1 
ATOM 1305 C CG     . LYS B 1 45 ? 8.317  1.826   2.053  1.00 0.00 ? 45 LYS B CG     1 
ATOM 1306 C CD     . LYS B 1 45 ? 7.259  1.655   0.961  1.00 0.00 ? 45 LYS B CD     1 
ATOM 1307 C CE     . LYS B 1 45 ? 5.863  1.665   1.599  1.00 0.00 ? 45 LYS B CE     1 
ATOM 1308 N NZ     . LYS B 1 45 ? 4.840  1.675   0.539  1.00 0.00 ? 45 LYS B NZ     1 
ATOM 1309 H H      . LYS B 1 45 ? 11.180 -0.196  2.567  1.00 0.00 ? 45 LYS B H      1 
ATOM 1310 H HA     . LYS B 1 45 ? 9.165  0.011   0.409  1.00 0.00 ? 45 LYS B HA     1 
ATOM 1311 H HB2    . LYS B 1 45 ? 10.465 1.836   2.426  1.00 0.00 ? 45 LYS B HB2    1 
ATOM 1312 H HB3    . LYS B 1 45 ? 10.008 2.665   0.946  1.00 0.00 ? 45 LYS B HB3    1 
ATOM 1313 H HG2    . LYS B 1 45 ? 8.130  1.026   2.793  1.00 0.00 ? 45 LYS B HG2    1 
ATOM 1314 H HG3    . LYS B 1 45 ? 8.148  2.776   2.598  1.00 0.00 ? 45 LYS B HG3    1 
ATOM 1315 H HD2    . LYS B 1 45 ? 7.363  2.461   0.206  1.00 0.00 ? 45 LYS B HD2    1 
ATOM 1316 H HD3    . LYS B 1 45 ? 7.426  0.701   0.420  1.00 0.00 ? 45 LYS B HD3    1 
ATOM 1317 H HE2    . LYS B 1 45 ? 5.733  0.782   2.257  1.00 0.00 ? 45 LYS B HE2    1 
ATOM 1318 H HE3    . LYS B 1 45 ? 5.730  2.552   2.254  1.00 0.00 ? 45 LYS B HE3    1 
ATOM 1319 H HZ1    . LYS B 1 45 ? 4.938  2.510   -0.050 1.00 0.00 ? 45 LYS B HZ1    1 
ATOM 1320 H HZ3    . LYS B 1 45 ? 4.948  0.871   -0.088 1.00 0.00 ? 45 LYS B HZ3    1 
ATOM 1321 N N      . ALA B 1 46 ? 12.357 1.000   -0.310 1.00 0.00 ? 46 ALA B N      1 
ATOM 1322 C CA     . ALA B 1 46 ? 13.251 1.329   -1.418 1.00 0.00 ? 46 ALA B CA     1 
ATOM 1323 C C      . ALA B 1 46 ? 13.299 0.205   -2.425 1.00 0.00 ? 46 ALA B C      1 
ATOM 1324 O O      . ALA B 1 46 ? 12.637 -0.831  -2.284 1.00 0.00 ? 46 ALA B O      1 
ATOM 1325 C CB     . ALA B 1 46 ? 14.630 1.654   -0.821 1.00 0.00 ? 46 ALA B CB     1 
ATOM 1326 O OXT    . ALA B 1 46 ? 14.135 0.340   -3.576 1.00 0.00 ? 46 ALA B OXT    1 
ATOM 1327 H H      . ALA B 1 46 ? 12.722 0.872   0.700  1.00 0.00 ? 46 ALA B H      1 
ATOM 1328 H HA     . ALA B 1 46 ? 12.855 2.221   -1.938 1.00 0.00 ? 46 ALA B HA     1 
ATOM 1329 H HB1    . ALA B 1 46 ? 14.586 2.504   -0.115 1.00 0.00 ? 46 ALA B HB1    1 
ATOM 1330 H HB2    . ALA B 1 46 ? 15.060 0.796   -0.268 1.00 0.00 ? 46 ALA B HB2    1 
ATOM 1331 H HB3    . ALA B 1 46 ? 15.362 1.930   -1.606 1.00 0.00 ? 46 ALA B HB3    1 
ATOM 1332 H HXT    . ALA B 1 46 ? 14.050 0.340   -4.536 1.00 0.00 ? 46 ALA B HXT    1 
ATOM 1333 P P      . DC  C 2 1  ? 1.360  -2.098  1.525  1.00 0.00 ? 1  DC  C P      1 
ATOM 1334 O OP1    . DC  C 2 1  ? 2.665  -1.917  0.734  1.00 0.00 ? 1  DC  C OP1    1 
ATOM 1335 O OP2    . DC  C 2 1  ? 1.330  -3.582  1.922  1.00 0.00 ? 1  DC  C OP2    1 
ATOM 1336 O "O5'"  . DC  C 2 1  ? 1.371  -1.167  2.883  1.00 0.00 ? 1  DC  C "O5'"  1 
ATOM 1337 C "C5'"  . DC  C 2 1  ? 2.527  -0.457  3.404  1.00 0.00 ? 1  DC  C "C5'"  1 
ATOM 1338 C "C4'"  . DC  C 2 1  ? 2.414  -0.084  4.919  1.00 0.00 ? 1  DC  C "C4'"  1 
ATOM 1339 O "O4'"  . DC  C 2 1  ? 3.764  -0.062  5.466  1.00 0.00 ? 1  DC  C "O4'"  1 
ATOM 1340 C "C3'"  . DC  C 2 1  ? 1.788  1.283   5.329  1.00 0.00 ? 1  DC  C "C3'"  1 
ATOM 1341 O "O3'"  . DC  C 2 1  ? 1.254  1.204   6.689  1.00 0.00 ? 1  DC  C "O3'"  1 
ATOM 1342 C "C2'"  . DC  C 2 1  ? 3.034  2.175   5.310  1.00 0.00 ? 1  DC  C "C2'"  1 
ATOM 1343 C "C1'"  . DC  C 2 1  ? 4.093  1.263   5.943  1.00 0.00 ? 1  DC  C "C1'"  1 
ATOM 1344 N N1     . DC  C 2 1  ? 5.494  1.633   5.579  1.00 0.00 ? 1  DC  C N1     1 
ATOM 1345 C C2     . DC  C 2 1  ? 6.328  2.362   6.402  1.00 0.00 ? 1  DC  C C2     1 
ATOM 1346 O O2     . DC  C 2 1  ? 5.980  2.863   7.468  1.00 0.00 ? 1  DC  C O2     1 
ATOM 1347 N N3     . DC  C 2 1  ? 7.760  2.569   5.969  1.00 0.00 ? 1  DC  C N3     1 
ATOM 1348 C C4     . DC  C 2 1  ? 8.172  2.124   4.829  1.00 0.00 ? 1  DC  C C4     1 
ATOM 1349 N N4     . DC  C 2 1  ? 9.564  2.374   4.496  1.00 0.00 ? 1  DC  C N4     1 
ATOM 1350 C C5     . DC  C 2 1  ? 7.374  1.442   3.953  1.00 0.00 ? 1  DC  C C5     1 
ATOM 1351 C C6     . DC  C 2 1  ? 6.070  1.182   4.245  1.00 0.00 ? 1  DC  C C6     1 
ATOM 1352 H "H5'"  . DC  C 2 1  ? 2.729  0.438   2.785  1.00 0.00 ? 1  DC  C "H5'"  1 
ATOM 1353 H "H5''" . DC  C 2 1  ? 3.411  -1.106  3.267  1.00 0.00 ? 1  DC  C "H5''" 1 
ATOM 1354 H "H4'"  . DC  C 2 1  ? 1.843  -0.892  5.402  1.00 0.00 ? 1  DC  C "H4'"  1 
ATOM 1355 H "H3'"  . DC  C 2 1  ? 0.995  1.606   4.625  1.00 0.00 ? 1  DC  C "H3'"  1 
ATOM 1356 H "H2'"  . DC  C 2 1  ? 3.289  2.439   4.268  1.00 0.00 ? 1  DC  C "H2'"  1 
ATOM 1357 H "H2''" . DC  C 2 1  ? 2.897  3.114   5.870  1.00 0.00 ? 1  DC  C "H2''" 1 
ATOM 1358 H "H1'"  . DC  C 2 1  ? 3.955  1.267   7.048  1.00 0.00 ? 1  DC  C "H1'"  1 
ATOM 1359 H H41    . DC  C 2 1  ? 9.794  2.253   3.509  1.00 0.00 ? 1  DC  C H41    1 
ATOM 1360 H H42    . DC  C 2 1  ? 10.130 2.649   5.300  1.00 0.00 ? 1  DC  C H42    1 
ATOM 1361 H H5     . DC  C 2 1  ? 7.760  1.093   2.996  1.00 0.00 ? 1  DC  C H5     1 
ATOM 1362 H H6     . DC  C 2 1  ? 5.433  0.646   3.534  1.00 0.00 ? 1  DC  C H6     1 
ATOM 1363 P P      . DC  D 2 1  ? 1.360  2.098   -1.525 1.00 0.00 ? 1  DC  D P      1 
ATOM 1364 O OP1    . DC  D 2 1  ? 2.665  1.917   -0.734 1.00 0.00 ? 1  DC  D OP1    1 
ATOM 1365 O OP2    . DC  D 2 1  ? 1.330  3.582   -1.922 1.00 0.00 ? 1  DC  D OP2    1 
ATOM 1366 O "O5'"  . DC  D 2 1  ? 1.371  1.167   -2.883 1.00 0.00 ? 1  DC  D "O5'"  1 
ATOM 1367 C "C5'"  . DC  D 2 1  ? 2.527  0.457   -3.404 1.00 0.00 ? 1  DC  D "C5'"  1 
ATOM 1368 C "C4'"  . DC  D 2 1  ? 2.414  0.084   -4.919 1.00 0.00 ? 1  DC  D "C4'"  1 
ATOM 1369 O "O4'"  . DC  D 2 1  ? 3.764  0.062   -5.466 1.00 0.00 ? 1  DC  D "O4'"  1 
ATOM 1370 C "C3'"  . DC  D 2 1  ? 1.788  -1.283  -5.329 1.00 0.00 ? 1  DC  D "C3'"  1 
ATOM 1371 O "O3'"  . DC  D 2 1  ? 1.254  -1.204  -6.689 1.00 0.00 ? 1  DC  D "O3'"  1 
ATOM 1372 C "C2'"  . DC  D 2 1  ? 3.034  -2.175  -5.310 1.00 0.00 ? 1  DC  D "C2'"  1 
ATOM 1373 C "C1'"  . DC  D 2 1  ? 4.093  -1.263  -5.943 1.00 0.00 ? 1  DC  D "C1'"  1 
ATOM 1374 N N1     . DC  D 2 1  ? 5.494  -1.633  -5.579 1.00 0.00 ? 1  DC  D N1     1 
ATOM 1375 C C2     . DC  D 2 1  ? 6.328  -2.362  -6.402 1.00 0.00 ? 1  DC  D C2     1 
ATOM 1376 O O2     . DC  D 2 1  ? 5.980  -2.863  -7.468 1.00 0.00 ? 1  DC  D O2     1 
ATOM 1377 N N3     . DC  D 2 1  ? 7.760  -2.569  -5.969 1.00 0.00 ? 1  DC  D N3     1 
ATOM 1378 C C4     . DC  D 2 1  ? 8.172  -2.124  -4.829 1.00 0.00 ? 1  DC  D C4     1 
ATOM 1379 N N4     . DC  D 2 1  ? 9.564  -2.374  -4.496 1.00 0.00 ? 1  DC  D N4     1 
ATOM 1380 C C5     . DC  D 2 1  ? 7.374  -1.442  -3.953 1.00 0.00 ? 1  DC  D C5     1 
ATOM 1381 C C6     . DC  D 2 1  ? 6.070  -1.182  -4.245 1.00 0.00 ? 1  DC  D C6     1 
ATOM 1382 H "H5'"  . DC  D 2 1  ? 2.729  -0.438  -2.785 1.00 0.00 ? 1  DC  D "H5'"  1 
ATOM 1383 H "H5''" . DC  D 2 1  ? 3.411  1.106   -3.267 1.00 0.00 ? 1  DC  D "H5''" 1 
ATOM 1384 H "H4'"  . DC  D 2 1  ? 1.843  0.892   -5.402 1.00 0.00 ? 1  DC  D "H4'"  1 
ATOM 1385 H "H3'"  . DC  D 2 1  ? 0.995  -1.606  -4.625 1.00 0.00 ? 1  DC  D "H3'"  1 
ATOM 1386 H "H2'"  . DC  D 2 1  ? 3.289  -2.439  -4.268 1.00 0.00 ? 1  DC  D "H2'"  1 
ATOM 1387 H "H2''" . DC  D 2 1  ? 2.897  -3.114  -5.870 1.00 0.00 ? 1  DC  D "H2''" 1 
ATOM 1388 H "H1'"  . DC  D 2 1  ? 3.955  -1.267  -7.048 1.00 0.00 ? 1  DC  D "H1'"  1 
ATOM 1389 H H41    . DC  D 2 1  ? 9.794  -2.253  -3.509 1.00 0.00 ? 1  DC  D H41    1 
ATOM 1390 H H42    . DC  D 2 1  ? 10.130 -2.649  -5.300 1.00 0.00 ? 1  DC  D H42    1 
ATOM 1391 H H5     . DC  D 2 1  ? 7.760  -1.093  -2.996 1.00 0.00 ? 1  DC  D H5     1 
ATOM 1392 H H6     . DC  D 2 1  ? 5.433  -0.646  -3.534 1.00 0.00 ? 1  DC  D H6     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  VAL 2  2  2  VAL VAL A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  THR 5  5  5  THR THR A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLY 15 15 15 GLY GLY A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 MET 19 19 19 MET MET A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 TYR 25 25 25 TYR TYR A . n 
A 1 26 ILE 26 26 26 ILE ILE A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 ALA 29 29 29 ALA ALA A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 VAL 31 31 31 VAL VAL A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ALA 34 34 34 ALA ALA A . n 
A 1 35 VAL 35 35 35 VAL VAL A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ILE 39 39 39 ILE ILE A . n 
A 1 40 TYR 40 40 40 TYR TYR A . n 
A 1 41 SER 41 41 41 SER SER A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
B 1 1  GLY 1  1  1  GLY GLY B . n 
B 1 2  VAL 2  2  2  VAL VAL B . n 
B 1 3  ILE 3  3  3  ILE ILE B . n 
B 1 4  ASP 4  4  4  ASP ASP B . n 
B 1 5  THR 5  5  5  THR THR B . n 
B 1 6  SER 6  6  6  SER SER B . n 
B 1 7  ALA 7  7  7  ALA ALA B . n 
B 1 8  VAL 8  8  8  VAL VAL B . n 
B 1 9  GLU 9  9  9  GLU GLU B . n 
B 1 10 SER 10 10 10 SER SER B . n 
B 1 11 ALA 11 11 11 ALA ALA B . n 
B 1 12 ILE 12 12 12 ILE ILE B . n 
B 1 13 THR 13 13 13 THR THR B . n 
B 1 14 ASP 14 14 14 ASP ASP B . n 
B 1 15 GLY 15 15 15 GLY GLY B . n 
B 1 16 GLN 16 16 16 GLN GLN B . n 
B 1 17 GLY 17 17 17 GLY GLY B . n 
B 1 18 ASP 18 18 18 ASP ASP B . n 
B 1 19 MET 19 19 19 MET MET B . n 
B 1 20 LYS 20 20 20 LYS LYS B . n 
B 1 21 ALA 21 21 21 ALA ALA B . n 
B 1 22 ILE 22 22 22 ILE ILE B . n 
B 1 23 GLY 23 23 23 GLY GLY B . n 
B 1 24 GLY 24 24 24 GLY GLY B . n 
B 1 25 TYR 25 25 25 TYR TYR B . n 
B 1 26 ILE 26 26 26 ILE ILE B . n 
B 1 27 VAL 27 27 27 VAL VAL B . n 
B 1 28 GLY 28 28 28 GLY GLY B . n 
B 1 29 ALA 29 29 29 ALA ALA B . n 
B 1 30 LEU 30 30 30 LEU LEU B . n 
B 1 31 VAL 31 31 31 VAL VAL B . n 
B 1 32 ILE 32 32 32 ILE ILE B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 ALA 34 34 34 ALA ALA B . n 
B 1 35 VAL 35 35 35 VAL VAL B . n 
B 1 36 ALA 36 36 36 ALA ALA B . n 
B 1 37 GLY 37 37 37 GLY GLY B . n 
B 1 38 LEU 38 38 38 LEU LEU B . n 
B 1 39 ILE 39 39 39 ILE ILE B . n 
B 1 40 TYR 40 40 40 TYR TYR B . n 
B 1 41 SER 41 41 41 SER SER B . n 
B 1 42 MET 42 42 42 MET MET B . n 
B 1 43 LEU 43 43 43 LEU LEU B . n 
B 1 44 ARG 44 44 44 ARG ARG B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 ALA 46 46 46 ALA ALA B . n 
C 2 1  DC  1  1  1  DC  DC  C . n 
D 2 1  DC  1  1  1  DC  DC  D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'representative helical assembly'            ? helical    140 
2 'helical asymmetric unit'                    ? tetrameric 4   
3 'helical asymmetric unit, std helical frame' ? tetrameric 4   
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-35)' A,B,C,D 
2 18       A,B,C,D 
3 H        A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
H  'transform to helical frame' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000    
1  'helical symmetry operation' ? ? 0.15160586  0.98844103  0.00000000 0.00000 -0.98844103 0.15160586  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -103.70000 
2  'helical symmetry operation' ? ? 0.63526983  -0.77229026 0.00000000 0.00000 0.77229026  0.63526983  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -97.60000  
3  'helical symmetry operation' ? ? -0.99912283 0.04187565  0.00000000 0.00000 -0.04187565 -0.99912283 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -91.50000  
4  'helical symmetry operation' ? ? 0.69766543  0.71642372  0.00000000 0.00000 -0.71642372 0.69766543  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -85.40000  
5  'helical symmetry operation' ? ? 0.06836354  -0.99766048 0.00000000 0.00000 0.99766048  0.06836354  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -79.30000  
6  'helical symmetry operation' ? ? -0.78886961 0.61456060  0.00000000 0.00000 -0.61456060 -0.78886961 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -73.20000  
7  'helical symmetry operation' ? ? 0.98407174  0.17777180  0.00000000 0.00000 -0.17777180 0.98407174  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -67.10000  
8  'helical symmetry operation' ? ? -0.52398591 -0.85172693 0.00000000 0.00000 0.85172693  -0.52398591 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -61.00000  
9  'helical symmetry operation' ? ? -0.28501926 0.95852179  0.00000000 0.00000 -0.95852179 -0.28501926 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -54.90000  
10 'helical symmetry operation' ? ? 0.90423167  -0.42704225 0.00000000 0.00000 0.42704225  0.90423167  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -48.80000  
11 'helical symmetry operation' ? ? -0.92132118 -0.38880237 0.00000000 0.00000 0.38880237  -0.92132118 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -42.70000  
12 'helical symmetry operation' ? ? 0.32490798  0.94574563  0.00000000 0.00000 -0.94574563 0.32490798  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -36.60000  
13 'helical symmetry operation' ? ? 0.48785966  -0.87292208 0.00000000 0.00000 0.87292208  0.48785966  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -30.50000  
14 'helical symmetry operation' ? ? -0.97576423 0.21882451  0.00000000 0.00000 -0.21882451 -0.97576423 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -24.40000  
15 'helical symmetry operation' ? ? 0.81391277  0.58098710  0.00000000 0.00000 -0.58098710 0.81391277  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -18.30000  
16 'helical symmetry operation' ? ? -0.11008126 -0.99392259 0.00000000 0.00000 0.99392259  -0.11008126 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -12.20000  
17 'helical symmetry operation' ? ? -0.66705275 0.74501049  0.00000000 0.00000 -0.74501049 -0.66705275 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -6.10000   
18 'helical symmetry operation' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000    
19 'helical symmetry operation' ? ? -0.66705275 -0.74501049 0.00000000 0.00000 0.74501049  -0.66705275 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 6.10000    
20 'helical symmetry operation' ? ? -0.11008126 0.99392259  0.00000000 0.00000 -0.99392259 -0.11008126 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 12.20000   
21 'helical symmetry operation' ? ? 0.81391277  -0.58098710 0.00000000 0.00000 0.58098710  0.81391277  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 18.30000   
22 'helical symmetry operation' ? ? -0.97576423 -0.21882451 0.00000000 0.00000 0.21882451  -0.97576423 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 24.40000   
23 'helical symmetry operation' ? ? 0.48785966  0.87292208  0.00000000 0.00000 -0.87292208 0.48785966  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 30.50000   
24 'helical symmetry operation' ? ? 0.32490798  -0.94574563 0.00000000 0.00000 0.94574563  0.32490798  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 36.60000   
25 'helical symmetry operation' ? ? -0.92132118 0.38880237  0.00000000 0.00000 -0.38880237 -0.92132118 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 42.70000   
26 'helical symmetry operation' ? ? 0.90423167  0.42704225  0.00000000 0.00000 -0.42704225 0.90423167  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 48.80000   
27 'helical symmetry operation' ? ? -0.28501926 -0.95852179 0.00000000 0.00000 0.95852179  -0.28501926 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 54.90000   
28 'helical symmetry operation' ? ? -0.52398591 0.85172693  0.00000000 0.00000 -0.85172693 -0.52398591 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 61.00000   
29 'helical symmetry operation' ? ? 0.98407174  -0.17777180 0.00000000 0.00000 0.17777180  0.98407174  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 67.10000   
30 'helical symmetry operation' ? ? -0.78886961 -0.61456060 0.00000000 0.00000 0.61456060  -0.78886961 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 73.20000   
31 'helical symmetry operation' ? ? 0.06836354  0.99766048  0.00000000 0.00000 -0.99766048 0.06836354  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 79.30000   
32 'helical symmetry operation' ? ? 0.69766543  -0.71642372 0.00000000 0.00000 0.71642372  0.69766543  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 85.40000   
33 'helical symmetry operation' ? ? -0.99912283 -0.04187565 0.00000000 0.00000 0.04187565  -0.99912283 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 91.50000   
34 'helical symmetry operation' ? ? 0.63526983  0.77229026  0.00000000 0.00000 -0.77229026 0.63526983  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 97.60000   
35 'helical symmetry operation' ? ? 0.15160586  -0.98844103 0.00000000 0.00000 0.98844103  0.15160586  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 103.70000  
# 
_pdbx_helical_symmetry.entry_id                  1PFI 
_pdbx_helical_symmetry.number_of_operations      35 
_pdbx_helical_symmetry.rotation_per_n_subunits   131.840000 
_pdbx_helical_symmetry.rise_per_n_subunits       6.100000 
_pdbx_helical_symmetry.n_subunits_divisor        1 
_pdbx_helical_symmetry.dyad_axis                 no 
_pdbx_helical_symmetry.circular_symmetry         1 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-03-21 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HG2  B LYS 45 ? ? H5   C DC  1  ? ? 0.43 
2  1 HD11 A ILE 22 ? ? N    A GLY 23 ? ? 1.22 
3  1 HD11 B ILE 22 ? ? N    B GLY 23 ? ? 1.22 
4  1 O    B ASP 18 ? ? HG21 B ILE 22 ? ? 1.25 
5  1 O    A ASP 18 ? ? HG21 A ILE 22 ? ? 1.25 
6  1 HA2  B GLY 1  ? ? HG1  B THR 5  ? ? 1.25 
7  1 HA2  A GLY 1  ? ? HG1  A THR 5  ? ? 1.25 
8  1 CG   B LYS 45 ? ? H5   C DC  1  ? ? 1.32 
9  1 HE2  B LYS 45 ? ? H6   C DC  1  ? ? 1.32 
10 1 HB2  B LYS 45 ? ? H41  C DC  1  ? ? 1.34 
11 1 O    A GLY 1  ? ? HG23 A THR 5  ? ? 1.36 
12 1 O    B GLY 1  ? ? HG23 B THR 5  ? ? 1.36 
13 1 O    B ASP 4  ? ? HG13 B VAL 8  ? ? 1.41 
14 1 O    A ASP 4  ? ? HG13 A VAL 8  ? ? 1.41 
15 1 O    B GLY 15 ? ? HD2  B ASP 18 ? ? 1.42 
16 1 O    A GLY 15 ? ? HD2  A ASP 18 ? ? 1.42 
17 1 HG2  B LYS 45 ? ? C5   C DC  1  ? ? 1.45 
18 1 O    A VAL 8  ? ? HG22 A ILE 12 ? ? 1.49 
19 1 O    B VAL 8  ? ? HG22 B ILE 12 ? ? 1.49 
20 1 O    B GLY 1  ? ? CG2  B THR 5  ? ? 1.94 
21 1 O    A GLY 1  ? ? CG2  A THR 5  ? ? 1.94 
22 1 O    B GLY 15 ? ? OD2  B ASP 18 ? ? 2.08 
23 1 O    A GLY 15 ? ? OD2  A ASP 18 ? ? 2.08 
24 1 O    A ASP 18 ? ? CG2  A ILE 22 ? ? 2.15 
25 1 O    B ASP 18 ? ? CG2  B ILE 22 ? ? 2.15 
26 1 CG   B LYS 45 ? ? C5   C DC  1  ? ? 2.16 
27 1 O    A GLY 15 ? ? OD1  A ASP 18 ? ? 2.18 
28 1 O    B GLY 15 ? ? OD1  B ASP 18 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1   1 C     A GLY 1  ? ? N     A VAL 2  ? ? 1.480 1.336 0.144  0.023 Y 
2   1 C     A VAL 2  ? ? N     A ILE 3  ? ? 1.478 1.336 0.142  0.023 Y 
3   1 C     A ILE 3  ? ? N     A ASP 4  ? ? 1.479 1.336 0.143  0.023 Y 
4   1 C     A ASP 4  ? ? N     A THR 5  ? ? 1.482 1.336 0.146  0.023 Y 
5   1 C     A THR 5  ? ? N     A SER 6  ? ? 1.479 1.336 0.143  0.023 Y 
6   1 C     A SER 6  ? ? N     A ALA 7  ? ? 1.477 1.336 0.141  0.023 Y 
7   1 C     A ALA 7  ? ? N     A VAL 8  ? ? 1.476 1.336 0.140  0.023 Y 
8   1 C     A VAL 8  ? ? N     A GLU 9  ? ? 1.476 1.336 0.140  0.023 Y 
9   1 CD    A GLU 9  ? ? OE2   A GLU 9  ? ? 1.362 1.252 0.110  0.011 N 
10  1 C     A GLU 9  ? ? N     A SER 10 ? ? 1.478 1.336 0.142  0.023 Y 
11  1 C     A SER 10 ? ? N     A ALA 11 ? ? 1.481 1.336 0.145  0.023 Y 
12  1 C     A ALA 11 ? ? N     A ILE 12 ? ? 1.481 1.336 0.145  0.023 Y 
13  1 C     A ILE 12 ? ? N     A THR 13 ? ? 1.477 1.336 0.141  0.023 Y 
14  1 C     A THR 13 ? ? N     A ASP 14 ? ? 1.479 1.336 0.143  0.023 Y 
15  1 C     A ASP 14 ? ? N     A GLY 15 ? ? 1.479 1.336 0.143  0.023 Y 
16  1 C     A GLY 15 ? ? N     A GLN 16 ? ? 1.478 1.336 0.142  0.023 Y 
17  1 C     A GLN 16 ? ? N     A GLY 17 ? ? 1.477 1.336 0.141  0.023 Y 
18  1 C     A GLY 17 ? ? N     A ASP 18 ? ? 1.478 1.336 0.142  0.023 Y 
19  1 C     A ASP 18 ? ? N     A MET 19 ? ? 1.477 1.336 0.141  0.023 Y 
20  1 C     A MET 19 ? ? N     A LYS 20 ? ? 1.478 1.336 0.142  0.023 Y 
21  1 C     A LYS 20 ? ? N     A ALA 21 ? ? 1.478 1.336 0.142  0.023 Y 
22  1 C     A ALA 21 ? ? N     A ILE 22 ? ? 1.479 1.336 0.143  0.023 Y 
23  1 C     A ILE 22 ? ? N     A GLY 23 ? ? 1.477 1.336 0.141  0.023 Y 
24  1 C     A GLY 23 ? ? N     A GLY 24 ? ? 1.478 1.336 0.142  0.023 Y 
25  1 C     A GLY 24 ? ? N     A TYR 25 ? ? 1.477 1.336 0.141  0.023 Y 
26  1 C     A TYR 25 ? ? N     A ILE 26 ? ? 1.478 1.336 0.142  0.023 Y 
27  1 C     A ILE 26 ? ? N     A VAL 27 ? ? 1.480 1.336 0.144  0.023 Y 
28  1 C     A VAL 27 ? ? N     A GLY 28 ? ? 1.477 1.336 0.141  0.023 Y 
29  1 C     A GLY 28 ? ? N     A ALA 29 ? ? 1.480 1.336 0.144  0.023 Y 
30  1 C     A ALA 29 ? ? N     A LEU 30 ? ? 1.479 1.336 0.143  0.023 Y 
31  1 C     A LEU 30 ? ? N     A VAL 31 ? ? 1.479 1.336 0.143  0.023 Y 
32  1 C     A VAL 31 ? ? N     A ILE 32 ? ? 1.479 1.336 0.143  0.023 Y 
33  1 C     A ILE 32 ? ? N     A LEU 33 ? ? 1.482 1.336 0.146  0.023 Y 
34  1 C     A LEU 33 ? ? N     A ALA 34 ? ? 1.480 1.336 0.144  0.023 Y 
35  1 C     A ALA 34 ? ? N     A VAL 35 ? ? 1.478 1.336 0.142  0.023 Y 
36  1 C     A VAL 35 ? ? N     A ALA 36 ? ? 1.478 1.336 0.142  0.023 Y 
37  1 C     A ALA 36 ? ? N     A GLY 37 ? ? 1.480 1.336 0.144  0.023 Y 
38  1 C     A GLY 37 ? ? N     A LEU 38 ? ? 1.479 1.336 0.143  0.023 Y 
39  1 C     A LEU 38 ? ? N     A ILE 39 ? ? 1.479 1.336 0.143  0.023 Y 
40  1 C     A ILE 39 ? ? N     A TYR 40 ? ? 1.479 1.336 0.143  0.023 Y 
41  1 C     A TYR 40 ? ? N     A SER 41 ? ? 1.480 1.336 0.144  0.023 Y 
42  1 C     A SER 41 ? ? N     A MET 42 ? ? 1.480 1.336 0.144  0.023 Y 
43  1 C     A MET 42 ? ? N     A LEU 43 ? ? 1.477 1.336 0.141  0.023 Y 
44  1 C     A LEU 43 ? ? N     A ARG 44 ? ? 1.478 1.336 0.142  0.023 Y 
45  1 C     A ARG 44 ? ? N     A LYS 45 ? ? 1.478 1.336 0.142  0.023 Y 
46  1 C     A LYS 45 ? ? N     A ALA 46 ? ? 1.477 1.336 0.141  0.023 Y 
47  1 C     A ALA 46 ? ? OXT   A ALA 46 ? ? 1.429 1.229 0.200  0.019 N 
48  1 C     B GLY 1  ? ? N     B VAL 2  ? ? 1.480 1.336 0.144  0.023 Y 
49  1 C     B VAL 2  ? ? N     B ILE 3  ? ? 1.478 1.336 0.142  0.023 Y 
50  1 C     B ILE 3  ? ? N     B ASP 4  ? ? 1.480 1.336 0.144  0.023 Y 
51  1 C     B ASP 4  ? ? N     B THR 5  ? ? 1.482 1.336 0.146  0.023 Y 
52  1 C     B THR 5  ? ? N     B SER 6  ? ? 1.479 1.336 0.143  0.023 Y 
53  1 C     B SER 6  ? ? N     B ALA 7  ? ? 1.478 1.336 0.142  0.023 Y 
54  1 C     B ALA 7  ? ? N     B VAL 8  ? ? 1.476 1.336 0.140  0.023 Y 
55  1 C     B VAL 8  ? ? N     B GLU 9  ? ? 1.476 1.336 0.140  0.023 Y 
56  1 CD    B GLU 9  ? ? OE2   B GLU 9  ? ? 1.363 1.252 0.111  0.011 N 
57  1 C     B GLU 9  ? ? N     B SER 10 ? ? 1.478 1.336 0.142  0.023 Y 
58  1 C     B SER 10 ? ? N     B ALA 11 ? ? 1.480 1.336 0.144  0.023 Y 
59  1 C     B ALA 11 ? ? N     B ILE 12 ? ? 1.481 1.336 0.145  0.023 Y 
60  1 C     B ILE 12 ? ? N     B THR 13 ? ? 1.476 1.336 0.140  0.023 Y 
61  1 C     B THR 13 ? ? N     B ASP 14 ? ? 1.479 1.336 0.143  0.023 Y 
62  1 C     B ASP 14 ? ? N     B GLY 15 ? ? 1.480 1.336 0.144  0.023 Y 
63  1 C     B GLY 15 ? ? N     B GLN 16 ? ? 1.478 1.336 0.142  0.023 Y 
64  1 C     B GLN 16 ? ? N     B GLY 17 ? ? 1.477 1.336 0.141  0.023 Y 
65  1 C     B GLY 17 ? ? N     B ASP 18 ? ? 1.478 1.336 0.142  0.023 Y 
66  1 C     B ASP 18 ? ? N     B MET 19 ? ? 1.477 1.336 0.141  0.023 Y 
67  1 C     B MET 19 ? ? N     B LYS 20 ? ? 1.478 1.336 0.142  0.023 Y 
68  1 C     B LYS 20 ? ? N     B ALA 21 ? ? 1.478 1.336 0.142  0.023 Y 
69  1 C     B ALA 21 ? ? N     B ILE 22 ? ? 1.479 1.336 0.143  0.023 Y 
70  1 C     B ILE 22 ? ? N     B GLY 23 ? ? 1.477 1.336 0.141  0.023 Y 
71  1 C     B GLY 23 ? ? N     B GLY 24 ? ? 1.478 1.336 0.142  0.023 Y 
72  1 C     B GLY 24 ? ? N     B TYR 25 ? ? 1.477 1.336 0.141  0.023 Y 
73  1 C     B TYR 25 ? ? N     B ILE 26 ? ? 1.478 1.336 0.142  0.023 Y 
74  1 C     B ILE 26 ? ? N     B VAL 27 ? ? 1.480 1.336 0.144  0.023 Y 
75  1 C     B VAL 27 ? ? N     B GLY 28 ? ? 1.477 1.336 0.141  0.023 Y 
76  1 C     B GLY 28 ? ? N     B ALA 29 ? ? 1.481 1.336 0.145  0.023 Y 
77  1 C     B ALA 29 ? ? N     B LEU 30 ? ? 1.478 1.336 0.142  0.023 Y 
78  1 C     B LEU 30 ? ? N     B VAL 31 ? ? 1.479 1.336 0.143  0.023 Y 
79  1 C     B VAL 31 ? ? N     B ILE 32 ? ? 1.478 1.336 0.142  0.023 Y 
80  1 C     B ILE 32 ? ? N     B LEU 33 ? ? 1.482 1.336 0.146  0.023 Y 
81  1 C     B LEU 33 ? ? N     B ALA 34 ? ? 1.480 1.336 0.144  0.023 Y 
82  1 C     B ALA 34 ? ? N     B VAL 35 ? ? 1.478 1.336 0.142  0.023 Y 
83  1 C     B VAL 35 ? ? N     B ALA 36 ? ? 1.479 1.336 0.143  0.023 Y 
84  1 C     B ALA 36 ? ? N     B GLY 37 ? ? 1.480 1.336 0.144  0.023 Y 
85  1 C     B GLY 37 ? ? N     B LEU 38 ? ? 1.479 1.336 0.143  0.023 Y 
86  1 C     B LEU 38 ? ? N     B ILE 39 ? ? 1.479 1.336 0.143  0.023 Y 
87  1 C     B ILE 39 ? ? N     B TYR 40 ? ? 1.479 1.336 0.143  0.023 Y 
88  1 C     B TYR 40 ? ? N     B SER 41 ? ? 1.479 1.336 0.143  0.023 Y 
89  1 C     B SER 41 ? ? N     B MET 42 ? ? 1.479 1.336 0.143  0.023 Y 
90  1 C     B MET 42 ? ? N     B LEU 43 ? ? 1.477 1.336 0.141  0.023 Y 
91  1 C     B LEU 43 ? ? N     B ARG 44 ? ? 1.478 1.336 0.142  0.023 Y 
92  1 C     B ARG 44 ? ? N     B LYS 45 ? ? 1.479 1.336 0.143  0.023 Y 
93  1 C     B LYS 45 ? ? N     B ALA 46 ? ? 1.477 1.336 0.141  0.023 Y 
94  1 C     B ALA 46 ? ? OXT   B ALA 46 ? ? 1.429 1.229 0.200  0.019 N 
95  1 "C5'" C DC  1  ? ? "C4'" C DC  1  ? ? 1.564 1.512 0.052  0.007 N 
96  1 C4    C DC  1  ? ? N4    C DC  1  ? ? 1.453 1.335 0.118  0.009 N 
97  1 N1    C DC  1  ? ? C6    C DC  1  ? ? 1.521 1.367 0.154  0.006 N 
98  1 C2    C DC  1  ? ? N3    C DC  1  ? ? 1.510 1.353 0.157  0.008 N 
99  1 N3    C DC  1  ? ? C4    C DC  1  ? ? 1.291 1.335 -0.044 0.007 N 
100 1 C4    C DC  1  ? ? C5    C DC  1  ? ? 1.367 1.425 -0.058 0.008 N 
101 1 "C5'" D DC  1  ? ? "C4'" D DC  1  ? ? 1.564 1.512 0.052  0.007 N 
102 1 C4    D DC  1  ? ? N4    D DC  1  ? ? 1.453 1.335 0.118  0.009 N 
103 1 N1    D DC  1  ? ? C6    D DC  1  ? ? 1.521 1.367 0.154  0.006 N 
104 1 C2    D DC  1  ? ? N3    D DC  1  ? ? 1.510 1.353 0.157  0.008 N 
105 1 N3    D DC  1  ? ? C4    D DC  1  ? ? 1.291 1.335 -0.044 0.007 N 
106 1 C4    D DC  1  ? ? C5    D DC  1  ? ? 1.367 1.425 -0.058 0.008 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB    A ASP 4  ? ? CG    A ASP 4  ? ? OD2 A ASP 4  ? ? 112.77 118.30 -5.53  0.90 N 
2  1 CB    A ASP 14 ? ? CG    A ASP 14 ? ? OD2 A ASP 14 ? ? 112.69 118.30 -5.61  0.90 N 
3  1 CB    A ASP 18 ? ? CG    A ASP 18 ? ? OD2 A ASP 18 ? ? 112.82 118.30 -5.48  0.90 N 
4  1 NE    A ARG 44 ? ? CZ    A ARG 44 ? ? NH1 A ARG 44 ? ? 124.39 120.30 4.09   0.50 N 
5  1 CB    B ASP 4  ? ? CG    B ASP 4  ? ? OD2 B ASP 4  ? ? 112.76 118.30 -5.54  0.90 N 
6  1 CB    B ASP 14 ? ? CG    B ASP 14 ? ? OD2 B ASP 14 ? ? 112.73 118.30 -5.57  0.90 N 
7  1 CB    B ASP 18 ? ? CG    B ASP 18 ? ? OD2 B ASP 18 ? ? 112.82 118.30 -5.48  0.90 N 
8  1 NE    B ARG 44 ? ? CZ    B ARG 44 ? ? NH1 B ARG 44 ? ? 124.42 120.30 4.12   0.50 N 
9  1 OP1   C DC  1  ? ? P     C DC  1  ? ? OP2 C DC  1  ? ? 105.27 119.60 -14.33 1.50 N 
10 1 "O4'" C DC  1  ? ? "C1'" C DC  1  ? ? N1  C DC  1  ? ? 111.09 108.30 2.79   0.30 N 
11 1 C6    C DC  1  ? ? N1    C DC  1  ? ? C2  C DC  1  ? ? 116.79 120.30 -3.51  0.40 N 
12 1 C4    C DC  1  ? ? C5    C DC  1  ? ? C6  C DC  1  ? ? 121.13 117.40 3.73   0.50 N 
13 1 N1    C DC  1  ? ? C2    C DC  1  ? ? O2  C DC  1  ? ? 124.19 118.90 5.29   0.60 N 
14 1 N3    C DC  1  ? ? C2    C DC  1  ? ? O2  C DC  1  ? ? 117.49 121.90 -4.41  0.70 N 
15 1 OP1   D DC  1  ? ? P     D DC  1  ? ? OP2 D DC  1  ? ? 105.27 119.60 -14.33 1.50 N 
16 1 "O4'" D DC  1  ? ? "C1'" D DC  1  ? ? N1  D DC  1  ? ? 111.09 108.30 2.79   0.30 N 
17 1 C6    D DC  1  ? ? N1    D DC  1  ? ? C2  D DC  1  ? ? 116.79 120.30 -3.51  0.40 N 
18 1 C4    D DC  1  ? ? C5    D DC  1  ? ? C6  D DC  1  ? ? 121.13 117.40 3.73   0.50 N 
19 1 N1    D DC  1  ? ? C2    D DC  1  ? ? O2  D DC  1  ? ? 124.19 118.90 5.29   0.60 N 
20 1 N3    D DC  1  ? ? C2    D DC  1  ? ? O2  D DC  1  ? ? 117.49 121.90 -4.41  0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 3 ? ? -65.09 -91.00 
2 1 ILE B 3 ? ? -65.06 -91.01 
#