data_1PG3
# 
_entry.id   1PG3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1PG3         pdb_00001pg3 10.2210/pdb1pg3/pdb 
RCSB  RCSB019303   ?            ?                   
WWPDB D_1000019303 ?            ?                   
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1PG3 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1NNN 
_pdbx_database_PDB_obs_spr.date             2003-06-03 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PG4 
_pdbx_database_related.details        'Acetyl CoA Synthetase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PG3 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gulick, A.M.'             1 
'Starai, V.J.'             2 
'Horswill, A.R.'           3 
'Homick, K.M.'             4 
'Escalante-Semerena, J.C.' 5 
# 
_citation.id                        primary 
_citation.title                     
;The 1.75 A Crystal Structure of Acetyl-CoA Synthetase Bound 
to Adenosine-5'-propylphosphate and Coenzyme A
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                2866 
_citation.page_last                 2873 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12627952 
_citation.pdbx_database_id_DOI      10.1021/bi0271603 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gulick, A.M.'             1 ? 
primary 'Starai, V.J.'             2 ? 
primary 'Horswill, A.R.'           3 ? 
primary 'Homick, K.M.'             4 ? 
primary 'Escalante-Semerena, J.C.' 5 ? 
# 
_cell.entry_id           1PG3 
_cell.length_a           59.981 
_cell.length_b           143.160 
_cell.length_c           71.934 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.57 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PG3 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.cell_setting                     monoclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'acetyl-CoA synthetase'                   72182.422 2   6.2.1.1 R174C ? ? 
2 non-polymer syn 'MAGNESIUM ION'                           24.305    2   ?       ?     ? ? 
3 non-polymer syn 'COENZYME A'                              767.534   2   ?       ?     ? ? 
4 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                            62.068    6   ?       ?     ? ? 
6 water       nat water                                     18.015    377 ?       ?     ? ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.6.2.1.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 CYS n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 ACS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella enterica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     28901 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PG3 A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 1PG3 B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PG3 CYS A 174 ? UNP Q8ZKF6 ARG 174 'engineered mutation' 174 1 
2 1PG3 CYS B 174 ? UNP Q8ZKF6 ARG 174 'engineered mutation' 174 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'                              ?                              'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'        121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                            'ETHYLENE GLYCOL'              'C2 H6 O2'            62.068  
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ?                              'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'          115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P'     389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          1PG3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   41.6 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, ethylene glycol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-06-06 
_diffrn_detector.details                'Osmic Max-Flux confocal focusing mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1PG3 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.29 
_reflns.d_resolution_low             24.21 
_reflns.number_all                   53761 
_reflns.number_obs                   51511 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.101 
_reflns.pdbx_netI_over_sigmaI        7.9 
_reflns.B_iso_Wilson_estimate        24.0 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.29 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   78.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.384 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4037 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PG3 
_refine.ls_d_res_high                            2.30 
_refine.ls_d_res_low                             24.22 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     53547 
_refine.ls_number_reflns_obs                     51411 
_refine.ls_number_reflns_R_free                  2608 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      1NNM 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'random, same as 1NNM r-free set' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               23.06 
_refine.aniso_B[1][1]                            0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -2.24 
_refine.aniso_B[2][2]                            -1.42 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            1.37 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PG3 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.23 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9835 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         174 
_refine_hist.number_atoms_solvent             377 
_refine_hist.number_atoms_total               10386 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        24.22 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d  0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d 1.18  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
8 2.3  2.4   . 0.246 80.7 0.286 0.017 . 271 5407 . . 'X-RAY DIFFRACTION' . 
8 2.4  2.53  . 0.23  95.3 0.287 0.016 . 317 6368 . . 'X-RAY DIFFRACTION' . 
8 2.53 2.69  . 0.213 96.1 0.282 0.016 . 298 6463 . . 'X-RAY DIFFRACTION' . 
8 2.69 2.90  . 0.216 97.3 0.286 0.016 . 319 6519 . . 'X-RAY DIFFRACTION' . 
8 2.90 3.19  . 0.202 98.1 0.248 0.013 . 351 6599 . . 'X-RAY DIFFRACTION' . 
8 3.19 3.65  . 0.198 99.2 0.226 0.012 . 361 6672 . . 'X-RAY DIFFRACTION' . 
8 3.65 4.59  . 0.163 99.7 0.198 0.011 . 347 6709 . . 'X-RAY DIFFRACTION' . 
8 4.59 24.22 . 0.193 99.7 0.215 0.011 . 353 6774 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1PG3 
_struct.title                     'Acetyl CoA Synthetase, Acetylated on Lys609' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PG3 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'AMP-forming; Adenylate-forming; thioester-forming; Lysine acetylation, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? ASP A 15  ? PRO A 10  ASP A 15  1 ? 6  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? GLY A 128 ? TYR A 110 GLY A 128 1 ? 19 
HELX_P HELX_P8  8  VAL A 142 ? ILE A 155 ? VAL A 142 ILE A 155 1 ? 14 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 LEU A 198 ? ASN A 208 ? LEU A 198 ASN A 208 1 ? 11 
HELX_P HELX_P11 11 TRP A 237 ? GLU A 242 ? TRP A 237 GLU A 242 1 ? 6  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? LEU A 316 ? TRP A 309 LEU A 316 1 ? 8  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? HIS A 349 ? ALA A 340 HIS A 349 1 ? 10 
HELX_P HELX_P16 16 ALA A 357 ? ALA A 366 ? ALA A 357 ALA A 366 1 ? 10 
HELX_P HELX_P17 17 GLU A 367 ? ILE A 372 ? GLU A 367 ILE A 372 5 ? 6  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? ALA A 538 ? THR A 529 ALA A 538 1 ? 10 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? GLY A 621 ? MET A 611 GLY A 621 1 ? 11 
HELX_P HELX_P25 25 PRO A 635 ? ALA A 647 ? PRO A 635 ALA A 647 1 ? 13 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? GLY B 128 ? TYR B 110 GLY B 128 1 ? 19 
HELX_P HELX_P33 33 VAL B 142 ? ILE B 155 ? VAL B 142 ILE B 155 1 ? 14 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 LEU B 198 ? LYS B 207 ? LEU B 198 LYS B 207 1 ? 10 
HELX_P HELX_P36 36 TRP B 237 ? GLU B 242 ? TRP B 237 GLU B 242 1 ? 6  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? LEU B 316 ? TRP B 309 LEU B 316 1 ? 8  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? HIS B 349 ? ALA B 340 HIS B 349 1 ? 10 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? ALA B 538 ? THR B 529 ALA B 538 1 ? 10 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 GLY B 636 ? GLN B 646 ? GLY B 636 GLN B 646 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A VAL 537 O  ? ? ? 1_555 C MG  . MG ? ? A VAL 537 A MG  902  1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc2  metalc ? ? A HIS 539 O  ? ? ? 1_555 C MG  . MG ? ? A HIS 539 A MG  902  1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc3  metalc ? ? A ILE 542 O  ? ? ? 1_555 C MG  . MG ? ? A ILE 542 A MG  902  1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc4  metalc ? ? C MG  .   MG ? ? ? 1_555 O HOH . O  ? ? A MG  902 A HOH 1097 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc5  metalc ? ? C MG  .   MG ? ? ? 1_555 O HOH . O  ? ? A MG  902 A HOH 1198 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc6  metalc ? ? C MG  .   MG ? ? ? 1_555 O HOH . O  ? ? A MG  902 A HOH 1200 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc7  metalc ? ? B VAL 537 O  ? ? ? 1_555 I MG  . MG ? ? B VAL 537 B MG  901  1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc8  metalc ? ? B HIS 539 O  ? ? ? 1_555 I MG  . MG ? ? B HIS 539 B MG  901  1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc9  metalc ? ? B ILE 542 O  ? ? ? 1_555 I MG  . MG ? ? B ILE 542 B MG  901  1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc10 metalc ? ? I MG  .   MG ? ? ? 1_555 P HOH . O  ? ? B MG  901 B HOH 1137 1_555 ? ? ? ? ? ? ? 2.634 ? ? 
metalc11 metalc ? ? I MG  .   MG ? ? ? 1_555 P HOH . O  ? ? B MG  901 B HOH 1148 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 -0.06 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 0.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 5 ? 
E ? 2 ? 
F ? 3 ? 
G ? 4 ? 
H ? 2 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 7 ? 
M ? 5 ? 
N ? 2 ? 
O ? 3 ? 
P ? 5 ? 
Q ? 2 ? 
R ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 2 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 5 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
E 1 GLU A 188 ? ARG A 191 ? GLU A 188 ARG A 191 
E 2 ARG A 194 ? PRO A 197 ? ARG A 194 PRO A 197 
F 1 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
F 2 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
F 3 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
G 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
G 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
G 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
G 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
H 1 VAL A 519 ? ASN A 521 ? VAL A 519 ASN A 521 
H 2 ARG A 526 ? GLY A 528 ? ARG A 526 GLY A 528 
I 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
I 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
I 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
J 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
J 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
K 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
K 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
L 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
L 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
L 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
L 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
L 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
L 6 ILE B 382 ? SER B 385 ? ILE B 382 SER B 385 
L 7 VAL B 409 ? ASP B 411 ? VAL B 409 ASP B 411 
M 1 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
M 2 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
M 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
M 4 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
M 5 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
N 1 GLU B 188 ? ARG B 191 ? GLU B 188 ARG B 191 
N 2 ARG B 194 ? PRO B 197 ? ARG B 194 PRO B 197 
O 1 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
O 2 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
O 3 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
P 1 PRO B 455 ? GLN B 456 ? PRO B 455 GLN B 456 
P 2 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
P 3 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
P 4 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
P 5 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
Q 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
Q 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
R 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
R 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
R 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 59  ? N SER A 59  O SER A 66  ? O SER A 66  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O THR A 326 ? O THR A 326 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O ILE A 353 ? O ILE A 353 
C 5 6 N LEU A 354 ? N LEU A 354 O GLY A 384 ? O GLY A 384 
C 6 7 N LEU A 383 ? N LEU A 383 O VAL A 410 ? O VAL A 410 
D 1 2 O SER A 160 ? O SER A 160 N VAL A 135 ? N VAL A 135 
D 2 3 N TYR A 138 ? N TYR A 138 O ILE A 184 ? O ILE A 184 
D 3 4 N THR A 185 ? N THR A 185 O ILE A 218 ? O ILE A 218 
D 4 5 N VAL A 219 ? N VAL A 219 O LEU A 235 ? O LEU A 235 
E 1 2 N GLY A 189 ? N GLY A 189 O ILE A 196 ? O ILE A 196 
F 1 2 N THR A 264 ? N THR A 264 O LYS A 272 ? O LYS A 272 
F 2 3 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
G 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
G 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
G 3 4 N ARG A 503 ? N ARG A 503 O TRP A 511 ? O TRP A 511 
H 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
I 1 2 N ALA A 546 ? N ALA A 546 O TYR A 562 ? O TYR A 562 
I 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
J 1 2 N SER B 59  ? N SER B 59  O SER B 66  ? O SER B 66  
K 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
L 1 2 O LYS B 106 ? O LYS B 106 N TRP B 97  ? N TRP B 97  
L 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
L 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
L 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
L 5 6 N THR B 356 ? N THR B 356 O GLY B 384 ? O GLY B 384 
L 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
M 1 2 O SER B 160 ? O SER B 160 N VAL B 135 ? N VAL B 135 
M 2 3 N ALA B 136 ? N ALA B 136 O LEU B 182 ? O LEU B 182 
M 3 4 N THR B 185 ? N THR B 185 O ILE B 218 ? O ILE B 218 
M 4 5 N VAL B 219 ? N VAL B 219 O LEU B 235 ? O LEU B 235 
N 1 2 N GLY B 189 ? N GLY B 189 O ILE B 196 ? O ILE B 196 
O 1 2 N THR B 264 ? N THR B 264 O LYS B 272 ? O LYS B 272 
O 2 3 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
P 1 2 O GLN B 456 ? O GLN B 456 N LEU B 448 ? N LEU B 448 
P 2 3 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
P 3 4 N THR B 460 ? N THR B 460 O ARG B 504 ? O ARG B 504 
P 4 5 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
Q 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
R 1 2 N GLU B 544 ? N GLU B 544 O THR B 564 ? O THR B 564 
R 2 3 N ALA B 561 ? N ALA B 561 O VAL B 595 ? O VAL B 595 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  901 ? 5  'BINDING SITE FOR RESIDUE MG B 901'  
AC2 Software A MG  902 ? 6  'BINDING SITE FOR RESIDUE MG A 902'  
AC3 Software A COA 990 ? 12 'BINDING SITE FOR RESIDUE COA A 990' 
AC4 Software B COA 991 ? 9  'BINDING SITE FOR RESIDUE COA B 991' 
AC5 Software A PRX 999 ? 14 'BINDING SITE FOR RESIDUE PRX A 999' 
AC6 Software B PRX 998 ? 15 'BINDING SITE FOR RESIDUE PRX B 998' 
AC7 Software B EDO 800 ? 7  'BINDING SITE FOR RESIDUE EDO B 800' 
AC8 Software A EDO 801 ? 7  'BINDING SITE FOR RESIDUE EDO A 801' 
AC9 Software A EDO 802 ? 4  'BINDING SITE FOR RESIDUE EDO A 802' 
BC1 Software A EDO 803 ? 8  'BINDING SITE FOR RESIDUE EDO A 803' 
BC2 Software B EDO 804 ? 4  'BINDING SITE FOR RESIDUE EDO B 804' 
BC3 Software B EDO 805 ? 8  'BINDING SITE FOR RESIDUE EDO B 805' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  VAL B 537 ? VAL B 537  . ? 1_555 ? 
2  AC1 5  HIS B 539 ? HIS B 539  . ? 1_555 ? 
3  AC1 5  ILE B 542 ? ILE B 542  . ? 1_555 ? 
4  AC1 5  HOH P .   ? HOH B 1137 . ? 1_555 ? 
5  AC1 5  HOH P .   ? HOH B 1148 . ? 1_555 ? 
6  AC2 6  VAL A 537 ? VAL A 537  . ? 1_555 ? 
7  AC2 6  HIS A 539 ? HIS A 539  . ? 1_555 ? 
8  AC2 6  ILE A 542 ? ILE A 542  . ? 1_555 ? 
9  AC2 6  HOH O .   ? HOH A 1097 . ? 1_555 ? 
10 AC2 6  HOH O .   ? HOH A 1198 . ? 1_555 ? 
11 AC2 6  HOH O .   ? HOH A 1200 . ? 1_555 ? 
12 AC3 12 PHE A 163 ? PHE A 163  . ? 1_555 ? 
13 AC3 12 GLY A 164 ? GLY A 164  . ? 1_555 ? 
14 AC3 12 GLY A 165 ? GLY A 165  . ? 1_555 ? 
15 AC3 12 ARG A 191 ? ARG A 191  . ? 1_555 ? 
16 AC3 12 ARG A 194 ? ARG A 194  . ? 1_555 ? 
17 AC3 12 ILE A 196 ? ILE A 196  . ? 1_555 ? 
18 AC3 12 SER A 523 ? SER A 523  . ? 1_555 ? 
19 AC3 12 HIS A 525 ? HIS A 525  . ? 1_555 ? 
20 AC3 12 ARG A 584 ? ARG A 584  . ? 1_555 ? 
21 AC3 12 PRO A 589 ? PRO A 589  . ? 1_555 ? 
22 AC3 12 HOH O .   ? HOH A 1034 . ? 1_555 ? 
23 AC3 12 HOH O .   ? HOH A 1181 . ? 1_555 ? 
24 AC4 9  PHE B 163 ? PHE B 163  . ? 1_555 ? 
25 AC4 9  GLY B 164 ? GLY B 164  . ? 1_555 ? 
26 AC4 9  GLY B 165 ? GLY B 165  . ? 1_555 ? 
27 AC4 9  ARG B 191 ? ARG B 191  . ? 1_555 ? 
28 AC4 9  ARG B 194 ? ARG B 194  . ? 1_555 ? 
29 AC4 9  ILE B 196 ? ILE B 196  . ? 1_555 ? 
30 AC4 9  ARG B 584 ? ARG B 584  . ? 1_555 ? 
31 AC4 9  PRO B 589 ? PRO B 589  . ? 1_555 ? 
32 AC4 9  HOH P .   ? HOH B 1172 . ? 1_555 ? 
33 AC5 14 THR A 311 ? THR A 311  . ? 1_555 ? 
34 AC5 14 GLY A 387 ? GLY A 387  . ? 1_555 ? 
35 AC5 14 GLU A 388 ? GLU A 388  . ? 1_555 ? 
36 AC5 14 PRO A 389 ? PRO A 389  . ? 1_555 ? 
37 AC5 14 ASP A 411 ? ASP A 411  . ? 1_555 ? 
38 AC5 14 THR A 412 ? THR A 412  . ? 1_555 ? 
39 AC5 14 TRP A 413 ? TRP A 413  . ? 1_555 ? 
40 AC5 14 TRP A 414 ? TRP A 414  . ? 1_555 ? 
41 AC5 14 GLN A 415 ? GLN A 415  . ? 1_555 ? 
42 AC5 14 THR A 416 ? THR A 416  . ? 1_555 ? 
43 AC5 14 ASP A 500 ? ASP A 500  . ? 1_555 ? 
44 AC5 14 ARG A 515 ? ARG A 515  . ? 1_555 ? 
45 AC5 14 ARG A 526 ? ARG A 526  . ? 1_555 ? 
46 AC5 14 HOH O .   ? HOH A 1156 . ? 1_555 ? 
47 AC6 15 THR B 311 ? THR B 311  . ? 1_555 ? 
48 AC6 15 GLY B 387 ? GLY B 387  . ? 1_555 ? 
49 AC6 15 GLU B 388 ? GLU B 388  . ? 1_555 ? 
50 AC6 15 PRO B 389 ? PRO B 389  . ? 1_555 ? 
51 AC6 15 ASP B 411 ? ASP B 411  . ? 1_555 ? 
52 AC6 15 THR B 412 ? THR B 412  . ? 1_555 ? 
53 AC6 15 TRP B 413 ? TRP B 413  . ? 1_555 ? 
54 AC6 15 TRP B 414 ? TRP B 414  . ? 1_555 ? 
55 AC6 15 GLN B 415 ? GLN B 415  . ? 1_555 ? 
56 AC6 15 THR B 416 ? THR B 416  . ? 1_555 ? 
57 AC6 15 ASP B 500 ? ASP B 500  . ? 1_555 ? 
58 AC6 15 ILE B 512 ? ILE B 512  . ? 1_555 ? 
59 AC6 15 ARG B 515 ? ARG B 515  . ? 1_555 ? 
60 AC6 15 ARG B 526 ? ARG B 526  . ? 1_555 ? 
61 AC6 15 HOH P .   ? HOH B 1168 . ? 1_555 ? 
62 AC7 7  VAL B 161 ? VAL B 161  . ? 1_555 ? 
63 AC7 7  ILE B 162 ? ILE B 162  . ? 1_555 ? 
64 AC7 7  PHE B 163 ? PHE B 163  . ? 1_555 ? 
65 AC7 7  PHE B 166 ? PHE B 166  . ? 1_555 ? 
66 AC7 7  TYR B 263 ? TYR B 263  . ? 1_555 ? 
67 AC7 7  GLY B 308 ? GLY B 308  . ? 1_555 ? 
68 AC7 7  HOH P .   ? HOH B 1038 . ? 1_555 ? 
69 AC8 7  VAL A 161 ? VAL A 161  . ? 1_555 ? 
70 AC8 7  ILE A 162 ? ILE A 162  . ? 1_555 ? 
71 AC8 7  PHE A 163 ? PHE A 163  . ? 1_555 ? 
72 AC8 7  PHE A 166 ? PHE A 166  . ? 1_555 ? 
73 AC8 7  TYR A 263 ? TYR A 263  . ? 1_555 ? 
74 AC8 7  GLY A 308 ? GLY A 308  . ? 1_555 ? 
75 AC8 7  HOH O .   ? HOH A 1037 . ? 1_555 ? 
76 AC9 4  GLU A 41  ? GLU A 41   . ? 1_555 ? 
77 AC9 4  GLN A 42  ? GLN A 42   . ? 1_555 ? 
78 AC9 4  ILE A 45  ? ILE A 45   . ? 1_555 ? 
79 AC9 4  HOH O .   ? HOH A 1009 . ? 1_555 ? 
80 BC1 8  GLY A 164 ? GLY A 164  . ? 1_555 ? 
81 BC1 8  GLY A 165 ? GLY A 165  . ? 1_555 ? 
82 BC1 8  PHE A 166 ? PHE A 166  . ? 1_555 ? 
83 BC1 8  SER A 167 ? SER A 167  . ? 1_555 ? 
84 BC1 8  ILE A 196 ? ILE A 196  . ? 1_555 ? 
85 BC1 8  ASN A 201 ? ASN A 201  . ? 1_555 ? 
86 BC1 8  ARG A 584 ? ARG A 584  . ? 1_555 ? 
87 BC1 8  PRO A 589 ? PRO A 589  . ? 1_555 ? 
88 BC2 4  VAL B 190 ? VAL B 190  . ? 1_555 ? 
89 BC2 4  GLY B 193 ? GLY B 193  . ? 1_555 ? 
90 BC2 4  ARG B 194 ? ARG B 194  . ? 1_555 ? 
91 BC2 4  SER B 195 ? SER B 195  . ? 1_555 ? 
92 BC3 8  GLY B 164 ? GLY B 164  . ? 1_555 ? 
93 BC3 8  GLY B 165 ? GLY B 165  . ? 1_555 ? 
94 BC3 8  PHE B 166 ? PHE B 166  . ? 1_555 ? 
95 BC3 8  SER B 167 ? SER B 167  . ? 1_555 ? 
96 BC3 8  ILE B 196 ? ILE B 196  . ? 1_555 ? 
97 BC3 8  ASN B 201 ? ASN B 201  . ? 1_555 ? 
98 BC3 8  ARG B 584 ? ARG B 584  . ? 1_555 ? 
99 BC3 8  HOH P .   ? HOH B 1104 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1PG3 
_atom_sites.fract_transf_matrix[1][1]   0.016672 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000457 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006985 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013907 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1 5   ? 17.821  146.580 43.831  1.00 41.13 ? 5    HIS A N     1 
ATOM   2     C  CA    . HIS A 1 5   ? 17.660  147.348 42.559  1.00 39.85 ? 5    HIS A CA    1 
ATOM   3     C  C     . HIS A 1 5   ? 18.764  147.020 41.560  1.00 37.82 ? 5    HIS A C     1 
ATOM   4     O  O     . HIS A 1 5   ? 19.953  147.025 41.892  1.00 36.20 ? 5    HIS A O     1 
ATOM   5     C  CB    . HIS A 1 5   ? 17.673  148.854 42.827  1.00 42.27 ? 5    HIS A CB    1 
ATOM   6     C  CG    . HIS A 1 5   ? 17.482  149.688 41.594  1.00 45.42 ? 5    HIS A CG    1 
ATOM   7     N  ND1   . HIS A 1 5   ? 17.910  150.995 41.508  1.00 47.29 ? 5    HIS A ND1   1 
ATOM   8     C  CD2   . HIS A 1 5   ? 16.902  149.404 40.402  1.00 47.02 ? 5    HIS A CD2   1 
ATOM   9     C  CE1   . HIS A 1 5   ? 17.604  151.481 40.316  1.00 47.08 ? 5    HIS A CE1   1 
ATOM   10    N  NE2   . HIS A 1 5   ? 16.992  150.535 39.626  1.00 47.20 ? 5    HIS A NE2   1 
ATOM   11    N  N     . LYS A 1 6   ? 18.354  146.742 40.328  1.00 35.33 ? 6    LYS A N     1 
ATOM   12    C  CA    . LYS A 1 6   ? 19.277  146.416 39.256  1.00 32.00 ? 6    LYS A CA    1 
ATOM   13    C  C     . LYS A 1 6   ? 19.166  147.483 38.165  1.00 31.24 ? 6    LYS A C     1 
ATOM   14    O  O     . LYS A 1 6   ? 18.134  147.595 37.503  1.00 31.69 ? 6    LYS A O     1 
ATOM   15    C  CB    . LYS A 1 6   ? 18.929  145.039 38.681  1.00 32.28 ? 6    LYS A CB    1 
ATOM   16    C  CG    . LYS A 1 6   ? 20.113  144.104 38.502  1.00 31.95 ? 6    LYS A CG    1 
ATOM   17    C  CD    . LYS A 1 6   ? 19.673  142.719 38.012  1.00 30.63 ? 6    LYS A CD    1 
ATOM   18    C  CE    . LYS A 1 6   ? 20.873  141.806 37.799  1.00 29.00 ? 6    LYS A CE    1 
ATOM   19    N  NZ    . LYS A 1 6   ? 20.495  140.468 37.282  1.00 28.74 ? 6    LYS A NZ    1 
ATOM   20    N  N     . HIS A 1 7   ? 20.218  148.277 37.992  1.00 28.82 ? 7    HIS A N     1 
ATOM   21    C  CA    . HIS A 1 7   ? 20.218  149.318 36.972  1.00 26.90 ? 7    HIS A CA    1 
ATOM   22    C  C     . HIS A 1 7   ? 20.261  148.702 35.577  1.00 27.25 ? 7    HIS A C     1 
ATOM   23    O  O     . HIS A 1 7   ? 21.071  147.810 35.302  1.00 26.67 ? 7    HIS A O     1 
ATOM   24    C  CB    . HIS A 1 7   ? 21.417  150.248 37.161  1.00 27.03 ? 7    HIS A CB    1 
ATOM   25    C  CG    . HIS A 1 7   ? 21.244  151.231 38.274  1.00 27.32 ? 7    HIS A CG    1 
ATOM   26    N  ND1   . HIS A 1 7   ? 20.706  152.486 38.080  1.00 26.05 ? 7    HIS A ND1   1 
ATOM   27    C  CD2   . HIS A 1 7   ? 21.491  151.127 39.601  1.00 26.03 ? 7    HIS A CD2   1 
ATOM   28    C  CE1   . HIS A 1 7   ? 20.629  153.111 39.240  1.00 26.64 ? 7    HIS A CE1   1 
ATOM   29    N  NE2   . HIS A 1 7   ? 21.099  152.308 40.179  1.00 25.84 ? 7    HIS A NE2   1 
ATOM   30    N  N     . ALA A 1 8   ? 19.379  149.182 34.704  1.00 24.85 ? 8    ALA A N     1 
ATOM   31    C  CA    . ALA A 1 8   ? 19.305  148.690 33.337  1.00 24.87 ? 8    ALA A CA    1 
ATOM   32    C  C     . ALA A 1 8   ? 20.315  149.401 32.442  1.00 25.04 ? 8    ALA A C     1 
ATOM   33    O  O     . ALA A 1 8   ? 20.747  150.518 32.736  1.00 25.89 ? 8    ALA A O     1 
ATOM   34    C  CB    . ALA A 1 8   ? 17.896  148.891 32.785  1.00 24.11 ? 8    ALA A CB    1 
ATOM   35    N  N     . ILE A 1 9   ? 20.674  148.743 31.344  1.00 23.05 ? 9    ILE A N     1 
ATOM   36    C  CA    . ILE A 1 9   ? 21.613  149.290 30.377  1.00 22.51 ? 9    ILE A CA    1 
ATOM   37    C  C     . ILE A 1 9   ? 20.892  150.344 29.536  1.00 22.50 ? 9    ILE A C     1 
ATOM   38    O  O     . ILE A 1 9   ? 19.906  150.045 28.865  1.00 23.82 ? 9    ILE A O     1 
ATOM   39    C  CB    . ILE A 1 9   ? 22.143  148.182 29.444  1.00 22.73 ? 9    ILE A CB    1 
ATOM   40    C  CG1   . ILE A 1 9   ? 22.846  147.102 30.268  1.00 22.70 ? 9    ILE A CG1   1 
ATOM   41    C  CG2   . ILE A 1 9   ? 23.106  148.765 28.428  1.00 24.54 ? 9    ILE A CG2   1 
ATOM   42    C  CD1   . ILE A 1 9   ? 23.122  145.827 29.494  1.00 19.18 ? 9    ILE A CD1   1 
ATOM   43    N  N     . PRO A 1 10  ? 21.379  151.594 29.564  1.00 23.71 ? 10   PRO A N     1 
ATOM   44    C  CA    . PRO A 1 10  ? 20.774  152.694 28.800  1.00 21.66 ? 10   PRO A CA    1 
ATOM   45    C  C     . PRO A 1 10  ? 20.746  152.413 27.295  1.00 22.10 ? 10   PRO A C     1 
ATOM   46    O  O     . PRO A 1 10  ? 21.612  151.707 26.774  1.00 21.22 ? 10   PRO A O     1 
ATOM   47    C  CB    . PRO A 1 10  ? 21.668  153.886 29.142  1.00 23.06 ? 10   PRO A CB    1 
ATOM   48    C  CG    . PRO A 1 10  ? 22.196  153.543 30.513  1.00 23.62 ? 10   PRO A CG    1 
ATOM   49    C  CD    . PRO A 1 10  ? 22.516  152.078 30.372  1.00 22.40 ? 10   PRO A CD    1 
ATOM   50    N  N     . ALA A 1 11  ? 19.759  152.982 26.602  1.00 21.46 ? 11   ALA A N     1 
ATOM   51    C  CA    . ALA A 1 11  ? 19.615  152.786 25.162  1.00 20.42 ? 11   ALA A CA    1 
ATOM   52    C  C     . ALA A 1 11  ? 20.762  153.398 24.360  1.00 21.15 ? 11   ALA A C     1 
ATOM   53    O  O     . ALA A 1 11  ? 21.165  152.843 23.334  1.00 20.29 ? 11   ALA A O     1 
ATOM   54    C  CB    . ALA A 1 11  ? 18.284  153.360 24.677  1.00 18.30 ? 11   ALA A CB    1 
ATOM   55    N  N     . ASN A 1 12  ? 21.288  154.536 24.817  1.00 20.48 ? 12   ASN A N     1 
ATOM   56    C  CA    . ASN A 1 12  ? 22.387  155.184 24.098  1.00 19.10 ? 12   ASN A CA    1 
ATOM   57    C  C     . ASN A 1 12  ? 23.647  154.321 24.155  1.00 18.48 ? 12   ASN A C     1 
ATOM   58    O  O     . ASN A 1 12  ? 24.403  154.252 23.187  1.00 17.32 ? 12   ASN A O     1 
ATOM   59    C  CB    . ASN A 1 12  ? 22.665  156.600 24.650  1.00 16.98 ? 12   ASN A CB    1 
ATOM   60    C  CG    . ASN A 1 12  ? 23.179  156.600 26.086  1.00 18.22 ? 12   ASN A CG    1 
ATOM   61    O  OD1   . ASN A 1 12  ? 22.550  156.039 26.991  1.00 16.30 ? 12   ASN A OD1   1 
ATOM   62    N  ND2   . ASN A 1 12  ? 24.324  157.251 26.301  1.00 14.78 ? 12   ASN A ND2   1 
ATOM   63    N  N     . ILE A 1 13  ? 23.861  153.648 25.280  1.00 18.82 ? 13   ILE A N     1 
ATOM   64    C  CA    . ILE A 1 13  ? 25.025  152.784 25.419  1.00 19.36 ? 13   ILE A CA    1 
ATOM   65    C  C     . ILE A 1 13  ? 24.787  151.470 24.680  1.00 20.54 ? 13   ILE A C     1 
ATOM   66    O  O     . ILE A 1 13  ? 25.725  150.863 24.160  1.00 19.57 ? 13   ILE A O     1 
ATOM   67    C  CB    . ILE A 1 13  ? 25.336  152.477 26.906  1.00 19.76 ? 13   ILE A CB    1 
ATOM   68    C  CG1   . ILE A 1 13  ? 25.751  153.763 27.630  1.00 18.25 ? 13   ILE A CG1   1 
ATOM   69    C  CG2   . ILE A 1 13  ? 26.432  151.410 27.003  1.00 18.27 ? 13   ILE A CG2   1 
ATOM   70    C  CD1   . ILE A 1 13  ? 26.935  154.479 27.008  1.00 17.18 ? 13   ILE A CD1   1 
ATOM   71    N  N     . ALA A 1 14  ? 23.529  151.042 24.619  1.00 21.61 ? 14   ALA A N     1 
ATOM   72    C  CA    . ALA A 1 14  ? 23.177  149.795 23.942  1.00 21.73 ? 14   ALA A CA    1 
ATOM   73    C  C     . ALA A 1 14  ? 23.258  149.906 22.417  1.00 21.88 ? 14   ALA A C     1 
ATOM   74    O  O     . ALA A 1 14  ? 23.457  148.909 21.725  1.00 22.37 ? 14   ALA A O     1 
ATOM   75    C  CB    . ALA A 1 14  ? 21.777  149.352 24.364  1.00 22.08 ? 14   ALA A CB    1 
ATOM   76    N  N     . ASP A 1 15  ? 23.116  151.120 21.899  1.00 22.31 ? 15   ASP A N     1 
ATOM   77    C  CA    . ASP A 1 15  ? 23.172  151.360 20.460  1.00 23.69 ? 15   ASP A CA    1 
ATOM   78    C  C     . ASP A 1 15  ? 24.583  151.438 19.873  1.00 23.72 ? 15   ASP A C     1 
ATOM   79    O  O     . ASP A 1 15  ? 24.753  151.384 18.656  1.00 23.38 ? 15   ASP A O     1 
ATOM   80    C  CB    . ASP A 1 15  ? 22.433  152.654 20.114  1.00 23.26 ? 15   ASP A CB    1 
ATOM   81    C  CG    . ASP A 1 15  ? 20.931  152.516 20.229  1.00 27.42 ? 15   ASP A CG    1 
ATOM   82    O  OD1   . ASP A 1 15  ? 20.438  151.368 20.337  1.00 31.01 ? 15   ASP A OD1   1 
ATOM   83    O  OD2   . ASP A 1 15  ? 20.240  153.556 20.197  1.00 29.56 ? 15   ASP A OD2   1 
ATOM   84    N  N     . ARG A 1 16  ? 25.590  151.569 20.728  1.00 23.32 ? 16   ARG A N     1 
ATOM   85    C  CA    . ARG A 1 16  ? 26.960  151.678 20.248  1.00 24.70 ? 16   ARG A CA    1 
ATOM   86    C  C     . ARG A 1 16  ? 27.970  150.788 20.963  1.00 22.55 ? 16   ARG A C     1 
ATOM   87    O  O     . ARG A 1 16  ? 29.126  150.701 20.546  1.00 23.42 ? 16   ARG A O     1 
ATOM   88    C  CB    . ARG A 1 16  ? 27.412  153.139 20.341  1.00 26.76 ? 16   ARG A CB    1 
ATOM   89    C  CG    . ARG A 1 16  ? 26.943  153.838 21.610  1.00 33.25 ? 16   ARG A CG    1 
ATOM   90    C  CD    . ARG A 1 16  ? 27.364  155.307 21.639  1.00 36.86 ? 16   ARG A CD    1 
ATOM   91    N  NE    . ARG A 1 16  ? 28.771  155.465 21.993  1.00 38.95 ? 16   ARG A NE    1 
ATOM   92    C  CZ    . ARG A 1 16  ? 29.507  156.528 21.680  1.00 41.30 ? 16   ARG A CZ    1 
ATOM   93    N  NH1   . ARG A 1 16  ? 28.967  157.535 20.995  1.00 40.38 ? 16   ARG A NH1   1 
ATOM   94    N  NH2   . ARG A 1 16  ? 30.781  156.588 22.064  1.00 40.28 ? 16   ARG A NH2   1 
ATOM   95    N  N     . CYS A 1 17  ? 27.535  150.118 22.026  1.00 20.52 ? 17   CYS A N     1 
ATOM   96    C  CA    . CYS A 1 17  ? 28.426  149.263 22.798  1.00 19.26 ? 17   CYS A CA    1 
ATOM   97    C  C     . CYS A 1 17  ? 29.182  148.234 21.957  1.00 18.65 ? 17   CYS A C     1 
ATOM   98    O  O     . CYS A 1 17  ? 28.635  147.638 21.019  1.00 17.68 ? 17   CYS A O     1 
ATOM   99    C  CB    . CYS A 1 17  ? 27.655  148.554 23.923  1.00 19.06 ? 17   CYS A CB    1 
ATOM   100   S  SG    . CYS A 1 17  ? 26.524  147.232 23.415  1.00 18.53 ? 17   CYS A SG    1 
ATOM   101   N  N     . LEU A 1 18  ? 30.448  148.033 22.306  1.00 17.59 ? 18   LEU A N     1 
ATOM   102   C  CA    . LEU A 1 18  ? 31.290  147.075 21.609  1.00 19.18 ? 18   LEU A CA    1 
ATOM   103   C  C     . LEU A 1 18  ? 30.870  145.658 22.005  1.00 19.71 ? 18   LEU A C     1 
ATOM   104   O  O     . LEU A 1 18  ? 31.015  144.714 21.231  1.00 20.34 ? 18   LEU A O     1 
ATOM   105   C  CB    . LEU A 1 18  ? 32.768  147.297 21.967  1.00 20.19 ? 18   LEU A CB    1 
ATOM   106   C  CG    . LEU A 1 18  ? 33.380  148.692 21.777  1.00 20.75 ? 18   LEU A CG    1 
ATOM   107   C  CD1   . LEU A 1 18  ? 34.870  148.655 22.135  1.00 18.94 ? 18   LEU A CD1   1 
ATOM   108   C  CD2   . LEU A 1 18  ? 33.197  149.153 20.340  1.00 19.82 ? 18   LEU A CD2   1 
ATOM   109   N  N     . ILE A 1 19  ? 30.334  145.515 23.210  1.00 20.10 ? 19   ILE A N     1 
ATOM   110   C  CA    . ILE A 1 19  ? 29.913  144.206 23.696  1.00 20.00 ? 19   ILE A CA    1 
ATOM   111   C  C     . ILE A 1 19  ? 28.552  144.225 24.380  1.00 20.50 ? 19   ILE A C     1 
ATOM   112   O  O     . ILE A 1 19  ? 28.355  144.923 25.378  1.00 19.44 ? 19   ILE A O     1 
ATOM   113   C  CB    . ILE A 1 19  ? 30.967  143.631 24.669  1.00 19.84 ? 19   ILE A CB    1 
ATOM   114   C  CG1   . ILE A 1 19  ? 32.217  143.223 23.876  1.00 19.27 ? 19   ILE A CG1   1 
ATOM   115   C  CG2   . ILE A 1 19  ? 30.388  142.459 25.451  1.00 17.25 ? 19   ILE A CG2   1 
ATOM   116   C  CD1   . ILE A 1 19  ? 33.305  142.612 24.718  1.00 19.75 ? 19   ILE A CD1   1 
ATOM   117   N  N     . ASN A 1 20  ? 27.611  143.455 23.836  1.00 19.36 ? 20   ASN A N     1 
ATOM   118   C  CA    . ASN A 1 20  ? 26.279  143.387 24.419  1.00 21.48 ? 20   ASN A CA    1 
ATOM   119   C  C     . ASN A 1 20  ? 26.203  142.174 25.352  1.00 21.88 ? 20   ASN A C     1 
ATOM   120   O  O     . ASN A 1 20  ? 27.157  141.401 25.452  1.00 22.10 ? 20   ASN A O     1 
ATOM   121   C  CB    . ASN A 1 20  ? 25.198  143.315 23.316  1.00 18.48 ? 20   ASN A CB    1 
ATOM   122   C  CG    . ASN A 1 20  ? 25.370  142.125 22.388  1.00 17.64 ? 20   ASN A CG    1 
ATOM   123   O  OD1   . ASN A 1 20  ? 25.631  141.008 22.830  1.00 17.45 ? 20   ASN A OD1   1 
ATOM   124   N  ND2   . ASN A 1 20  ? 25.201  142.359 21.092  1.00 14.91 ? 20   ASN A ND2   1 
ATOM   125   N  N     . PRO A 1 21  ? 25.077  142.007 26.065  1.00 22.81 ? 21   PRO A N     1 
ATOM   126   C  CA    . PRO A 1 21  ? 24.895  140.879 26.992  1.00 22.94 ? 21   PRO A CA    1 
ATOM   127   C  C     . PRO A 1 21  ? 25.157  139.505 26.375  1.00 23.07 ? 21   PRO A C     1 
ATOM   128   O  O     . PRO A 1 21  ? 25.823  138.667 26.982  1.00 22.48 ? 21   PRO A O     1 
ATOM   129   C  CB    . PRO A 1 21  ? 23.450  141.039 27.445  1.00 23.44 ? 21   PRO A CB    1 
ATOM   130   C  CG    . PRO A 1 21  ? 23.289  142.532 27.459  1.00 24.28 ? 21   PRO A CG    1 
ATOM   131   C  CD    . PRO A 1 21  ? 23.939  142.942 26.154  1.00 22.75 ? 21   PRO A CD    1 
ATOM   132   N  N     . GLU A 1 22  ? 24.632  139.279 25.171  1.00 24.85 ? 22   GLU A N     1 
ATOM   133   C  CA    . GLU A 1 22  ? 24.807  138.001 24.480  1.00 25.50 ? 22   GLU A CA    1 
ATOM   134   C  C     . GLU A 1 22  ? 26.275  137.749 24.171  1.00 24.32 ? 22   GLU A C     1 
ATOM   135   O  O     . GLU A 1 22  ? 26.778  136.646 24.366  1.00 23.49 ? 22   GLU A O     1 
ATOM   136   C  CB    . GLU A 1 22  ? 24.021  137.969 23.161  1.00 30.10 ? 22   GLU A CB    1 
ATOM   137   C  CG    . GLU A 1 22  ? 22.513  138.203 23.264  1.00 35.72 ? 22   GLU A CG    1 
ATOM   138   C  CD    . GLU A 1 22  ? 22.131  139.675 23.080  1.00 41.26 ? 22   GLU A CD    1 
ATOM   139   O  OE1   . GLU A 1 22  ? 22.178  140.440 24.078  1.00 42.10 ? 22   GLU A OE1   1 
ATOM   140   O  OE2   . GLU A 1 22  ? 21.798  140.064 21.927  1.00 41.92 ? 22   GLU A OE2   1 
ATOM   141   N  N     . GLN A 1 23  ? 26.959  138.777 23.679  1.00 24.53 ? 23   GLN A N     1 
ATOM   142   C  CA    . GLN A 1 23  ? 28.371  138.656 23.340  1.00 24.86 ? 23   GLN A CA    1 
ATOM   143   C  C     . GLN A 1 23  ? 29.251  138.443 24.572  1.00 24.18 ? 23   GLN A C     1 
ATOM   144   O  O     . GLN A 1 23  ? 30.265  137.750 24.487  1.00 23.74 ? 23   GLN A O     1 
ATOM   145   C  CB    . GLN A 1 23  ? 28.832  139.894 22.570  1.00 25.21 ? 23   GLN A CB    1 
ATOM   146   C  CG    . GLN A 1 23  ? 28.081  140.110 21.275  1.00 28.07 ? 23   GLN A CG    1 
ATOM   147   C  CD    . GLN A 1 23  ? 28.431  141.433 20.602  1.00 31.24 ? 23   GLN A CD    1 
ATOM   148   O  OE1   . GLN A 1 23  ? 28.248  142.513 21.177  1.00 31.03 ? 23   GLN A OE1   1 
ATOM   149   N  NE2   . GLN A 1 23  ? 28.934  141.352 19.376  1.00 32.10 ? 23   GLN A NE2   1 
ATOM   150   N  N     . TYR A 1 24  ? 28.875  139.027 25.711  1.00 22.02 ? 24   TYR A N     1 
ATOM   151   C  CA    . TYR A 1 24  ? 29.665  138.842 26.926  1.00 23.42 ? 24   TYR A CA    1 
ATOM   152   C  C     . TYR A 1 24  ? 29.669  137.365 27.291  1.00 24.00 ? 24   TYR A C     1 
ATOM   153   O  O     . TYR A 1 24  ? 30.724  136.757 27.467  1.00 24.68 ? 24   TYR A O     1 
ATOM   154   C  CB    . TYR A 1 24  ? 29.087  139.630 28.107  1.00 23.19 ? 24   TYR A CB    1 
ATOM   155   C  CG    . TYR A 1 24  ? 29.677  139.203 29.442  1.00 22.36 ? 24   TYR A CG    1 
ATOM   156   C  CD1   . TYR A 1 24  ? 30.927  139.665 29.859  1.00 18.84 ? 24   TYR A CD1   1 
ATOM   157   C  CD2   . TYR A 1 24  ? 29.004  138.282 30.259  1.00 22.80 ? 24   TYR A CD2   1 
ATOM   158   C  CE1   . TYR A 1 24  ? 31.492  139.217 31.055  1.00 22.25 ? 24   TYR A CE1   1 
ATOM   159   C  CE2   . TYR A 1 24  ? 29.559  137.825 31.455  1.00 21.58 ? 24   TYR A CE2   1 
ATOM   160   C  CZ    . TYR A 1 24  ? 30.804  138.295 31.848  1.00 23.02 ? 24   TYR A CZ    1 
ATOM   161   O  OH    . TYR A 1 24  ? 31.370  137.841 33.023  1.00 24.18 ? 24   TYR A OH    1 
ATOM   162   N  N     . GLU A 1 25  ? 28.472  136.803 27.414  1.00 25.23 ? 25   GLU A N     1 
ATOM   163   C  CA    . GLU A 1 25  ? 28.304  135.400 27.755  1.00 25.14 ? 25   GLU A CA    1 
ATOM   164   C  C     . GLU A 1 25  ? 29.128  134.484 26.847  1.00 23.81 ? 25   GLU A C     1 
ATOM   165   O  O     . GLU A 1 25  ? 29.867  133.628 27.324  1.00 23.53 ? 25   GLU A O     1 
ATOM   166   C  CB    . GLU A 1 25  ? 26.823  135.016 27.660  1.00 26.30 ? 25   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 25  ? 25.957  135.573 28.767  1.00 32.77 ? 25   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 25  ? 26.312  134.993 30.124  1.00 37.92 ? 25   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 25  ? 26.329  133.746 30.238  1.00 41.45 ? 25   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 25  ? 26.567  135.773 31.073  1.00 39.95 ? 25   GLU A OE2   1 
ATOM   171   N  N     . THR A 1 26  ? 29.003  134.676 25.538  1.00 23.37 ? 26   THR A N     1 
ATOM   172   C  CA    . THR A 1 26  ? 29.717  133.848 24.575  1.00 23.23 ? 26   THR A CA    1 
ATOM   173   C  C     . THR A 1 26  ? 31.233  133.981 24.679  1.00 24.35 ? 26   THR A C     1 
ATOM   174   O  O     . THR A 1 26  ? 31.934  132.996 24.924  1.00 24.87 ? 26   THR A O     1 
ATOM   175   C  CB    . THR A 1 26  ? 29.275  134.170 23.134  1.00 22.79 ? 26   THR A CB    1 
ATOM   176   O  OG1   . THR A 1 26  ? 27.871  133.919 23.002  1.00 22.07 ? 26   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1 26  ? 30.033  133.304 22.131  1.00 20.39 ? 26   THR A CG2   1 
ATOM   178   N  N     . LYS A 1 27  ? 31.746  135.192 24.493  1.00 24.61 ? 27   LYS A N     1 
ATOM   179   C  CA    . LYS A 1 27  ? 33.184  135.410 24.577  1.00 23.32 ? 27   LYS A CA    1 
ATOM   180   C  C     . LYS A 1 27  ? 33.745  134.906 25.908  1.00 22.74 ? 27   LYS A C     1 
ATOM   181   O  O     . LYS A 1 27  ? 34.817  134.297 25.945  1.00 21.94 ? 27   LYS A O     1 
ATOM   182   C  CB    . LYS A 1 27  ? 33.508  136.895 24.395  1.00 25.65 ? 27   LYS A CB    1 
ATOM   183   C  CG    . LYS A 1 27  ? 33.195  137.434 23.006  1.00 28.36 ? 27   LYS A CG    1 
ATOM   184   C  CD    . LYS A 1 27  ? 33.424  138.933 22.936  1.00 31.58 ? 27   LYS A CD    1 
ATOM   185   C  CE    . LYS A 1 27  ? 33.414  139.444 21.501  1.00 33.58 ? 27   LYS A CE    1 
ATOM   186   N  NZ    . LYS A 1 27  ? 34.760  139.947 21.086  1.00 35.61 ? 27   LYS A NZ    1 
ATOM   187   N  N     . TYR A 1 28  ? 33.023  135.152 26.999  1.00 20.64 ? 28   TYR A N     1 
ATOM   188   C  CA    . TYR A 1 28  ? 33.488  134.703 28.307  1.00 21.30 ? 28   TYR A CA    1 
ATOM   189   C  C     . TYR A 1 28  ? 33.640  133.186 28.329  1.00 20.79 ? 28   TYR A C     1 
ATOM   190   O  O     . TYR A 1 28  ? 34.647  132.651 28.789  1.00 19.59 ? 28   TYR A O     1 
ATOM   191   C  CB    . TYR A 1 28  ? 32.518  135.112 29.423  1.00 20.98 ? 28   TYR A CB    1 
ATOM   192   C  CG    . TYR A 1 28  ? 32.992  134.621 30.772  1.00 22.03 ? 28   TYR A CG    1 
ATOM   193   C  CD1   . TYR A 1 28  ? 33.978  135.314 31.477  1.00 21.27 ? 28   TYR A CD1   1 
ATOM   194   C  CD2   . TYR A 1 28  ? 32.543  133.402 31.288  1.00 22.29 ? 28   TYR A CD2   1 
ATOM   195   C  CE1   . TYR A 1 28  ? 34.512  134.802 32.656  1.00 19.49 ? 28   TYR A CE1   1 
ATOM   196   C  CE2   . TYR A 1 28  ? 33.071  132.881 32.466  1.00 21.29 ? 28   TYR A CE2   1 
ATOM   197   C  CZ    . TYR A 1 28  ? 34.056  133.584 33.143  1.00 21.14 ? 28   TYR A CZ    1 
ATOM   198   O  OH    . TYR A 1 28  ? 34.593  133.054 34.297  1.00 20.88 ? 28   TYR A OH    1 
ATOM   199   N  N     . LYS A 1 29  ? 32.621  132.500 27.831  1.00 21.04 ? 29   LYS A N     1 
ATOM   200   C  CA    . LYS A 1 29  ? 32.629  131.051 27.791  1.00 21.42 ? 29   LYS A CA    1 
ATOM   201   C  C     . LYS A 1 29  ? 33.829  130.518 27.001  1.00 20.50 ? 29   LYS A C     1 
ATOM   202   O  O     . LYS A 1 29  ? 34.478  129.567 27.426  1.00 21.38 ? 29   LYS A O     1 
ATOM   203   C  CB    . LYS A 1 29  ? 31.320  130.539 27.179  1.00 22.89 ? 29   LYS A CB    1 
ATOM   204   C  CG    . LYS A 1 29  ? 31.139  129.041 27.306  1.00 27.64 ? 29   LYS A CG    1 
ATOM   205   C  CD    . LYS A 1 29  ? 29.842  128.555 26.678  1.00 28.65 ? 29   LYS A CD    1 
ATOM   206   C  CE    . LYS A 1 29  ? 29.619  127.071 26.965  1.00 30.38 ? 29   LYS A CE    1 
ATOM   207   N  NZ    . LYS A 1 29  ? 28.405  126.536 26.276  1.00 31.25 ? 29   LYS A NZ    1 
ATOM   208   N  N     . GLN A 1 30  ? 34.132  131.129 25.860  1.00 19.56 ? 30   GLN A N     1 
ATOM   209   C  CA    . GLN A 1 30  ? 35.258  130.679 25.047  1.00 20.86 ? 30   GLN A CA    1 
ATOM   210   C  C     . GLN A 1 30  ? 36.604  131.007 25.697  1.00 21.32 ? 30   GLN A C     1 
ATOM   211   O  O     . GLN A 1 30  ? 37.563  130.243 25.568  1.00 22.82 ? 30   GLN A O     1 
ATOM   212   C  CB    . GLN A 1 30  ? 35.212  131.312 23.652  1.00 22.95 ? 30   GLN A CB    1 
ATOM   213   C  CG    . GLN A 1 30  ? 36.396  130.910 22.768  1.00 24.07 ? 30   GLN A CG    1 
ATOM   214   C  CD    . GLN A 1 30  ? 36.469  131.689 21.472  1.00 26.43 ? 30   GLN A CD    1 
ATOM   215   O  OE1   . GLN A 1 30  ? 36.430  132.918 21.468  1.00 28.33 ? 30   GLN A OE1   1 
ATOM   216   N  NE2   . GLN A 1 30  ? 36.590  130.975 20.362  1.00 28.80 ? 30   GLN A NE2   1 
ATOM   217   N  N     . SER A 1 31  ? 36.682  132.146 26.379  1.00 19.54 ? 31   SER A N     1 
ATOM   218   C  CA    . SER A 1 31  ? 37.920  132.553 27.033  1.00 19.87 ? 31   SER A CA    1 
ATOM   219   C  C     . SER A 1 31  ? 38.248  131.591 28.168  1.00 21.37 ? 31   SER A C     1 
ATOM   220   O  O     . SER A 1 31  ? 39.400  131.480 28.580  1.00 22.46 ? 31   SER A O     1 
ATOM   221   C  CB    . SER A 1 31  ? 37.795  133.972 27.596  1.00 15.83 ? 31   SER A CB    1 
ATOM   222   O  OG    . SER A 1 31  ? 37.010  133.997 28.779  1.00 12.37 ? 31   SER A OG    1 
ATOM   223   N  N     . ILE A 1 32  ? 37.231  130.895 28.670  1.00 21.94 ? 32   ILE A N     1 
ATOM   224   C  CA    . ILE A 1 32  ? 37.426  129.944 29.755  1.00 23.77 ? 32   ILE A CA    1 
ATOM   225   C  C     . ILE A 1 32  ? 37.657  128.524 29.232  1.00 24.60 ? 32   ILE A C     1 
ATOM   226   O  O     . ILE A 1 32  ? 38.571  127.831 29.675  1.00 25.10 ? 32   ILE A O     1 
ATOM   227   C  CB    . ILE A 1 32  ? 36.205  129.916 30.705  1.00 24.35 ? 32   ILE A CB    1 
ATOM   228   C  CG1   . ILE A 1 32  ? 35.938  131.313 31.274  1.00 25.61 ? 32   ILE A CG1   1 
ATOM   229   C  CG2   . ILE A 1 32  ? 36.444  128.921 31.826  1.00 26.21 ? 32   ILE A CG2   1 
ATOM   230   C  CD1   . ILE A 1 32  ? 37.108  131.936 32.002  1.00 23.63 ? 32   ILE A CD1   1 
ATOM   231   N  N     . ASN A 1 33  ? 36.836  128.094 28.282  1.00 24.59 ? 33   ASN A N     1 
ATOM   232   C  CA    . ASN A 1 33  ? 36.963  126.748 27.745  1.00 25.31 ? 33   ASN A CA    1 
ATOM   233   C  C     . ASN A 1 33  ? 38.113  126.598 26.757  1.00 25.63 ? 33   ASN A C     1 
ATOM   234   O  O     . ASN A 1 33  ? 38.737  125.545 26.684  1.00 25.18 ? 33   ASN A O     1 
ATOM   235   C  CB    . ASN A 1 33  ? 35.653  126.322 27.081  1.00 27.52 ? 33   ASN A CB    1 
ATOM   236   C  CG    . ASN A 1 33  ? 34.445  126.521 27.988  1.00 30.51 ? 33   ASN A CG    1 
ATOM   237   O  OD1   . ASN A 1 33  ? 34.533  126.358 29.208  1.00 30.71 ? 33   ASN A OD1   1 
ATOM   238   N  ND2   . ASN A 1 33  ? 33.305  126.860 27.390  1.00 31.33 ? 33   ASN A ND2   1 
ATOM   239   N  N     . ASP A 1 34  ? 38.399  127.652 26.000  1.00 26.00 ? 34   ASP A N     1 
ATOM   240   C  CA    . ASP A 1 34  ? 39.473  127.598 25.016  1.00 24.54 ? 34   ASP A CA    1 
ATOM   241   C  C     . ASP A 1 34  ? 40.263  128.913 24.969  1.00 23.59 ? 34   ASP A C     1 
ATOM   242   O  O     . ASP A 1 34  ? 40.257  129.622 23.958  1.00 23.57 ? 34   ASP A O     1 
ATOM   243   C  CB    . ASP A 1 34  ? 38.876  127.280 23.643  1.00 23.55 ? 34   ASP A CB    1 
ATOM   244   C  CG    . ASP A 1 34  ? 39.931  127.087 22.572  1.00 25.75 ? 34   ASP A CG    1 
ATOM   245   O  OD1   . ASP A 1 34  ? 41.140  127.146 22.890  1.00 27.47 ? 34   ASP A OD1   1 
ATOM   246   O  OD2   . ASP A 1 34  ? 39.546  126.874 21.406  1.00 25.63 ? 34   ASP A OD2   1 
ATOM   247   N  N     . PRO A 1 35  ? 40.970  129.242 26.064  1.00 23.63 ? 35   PRO A N     1 
ATOM   248   C  CA    . PRO A 1 35  ? 41.763  130.474 26.149  1.00 23.27 ? 35   PRO A CA    1 
ATOM   249   C  C     . PRO A 1 35  ? 42.813  130.669 25.054  1.00 23.82 ? 35   PRO A C     1 
ATOM   250   O  O     . PRO A 1 35  ? 43.158  131.804 24.724  1.00 25.21 ? 35   PRO A O     1 
ATOM   251   C  CB    . PRO A 1 35  ? 42.370  130.402 27.549  1.00 23.11 ? 35   PRO A CB    1 
ATOM   252   C  CG    . PRO A 1 35  ? 42.473  128.929 27.798  1.00 23.73 ? 35   PRO A CG    1 
ATOM   253   C  CD    . PRO A 1 35  ? 41.156  128.418 27.274  1.00 23.29 ? 35   PRO A CD    1 
ATOM   254   N  N     . ASP A 1 36  ? 43.319  129.578 24.487  1.00 23.97 ? 36   ASP A N     1 
ATOM   255   C  CA    . ASP A 1 36  ? 44.318  129.697 23.426  1.00 25.13 ? 36   ASP A CA    1 
ATOM   256   C  C     . ASP A 1 36  ? 43.711  130.302 22.164  1.00 24.02 ? 36   ASP A C     1 
ATOM   257   O  O     . ASP A 1 36  ? 44.352  131.089 21.469  1.00 23.15 ? 36   ASP A O     1 
ATOM   258   C  CB    . ASP A 1 36  ? 44.941  128.334 23.103  1.00 27.32 ? 36   ASP A CB    1 
ATOM   259   C  CG    . ASP A 1 36  ? 46.024  127.942 24.090  1.00 30.74 ? 36   ASP A CG    1 
ATOM   260   O  OD1   . ASP A 1 36  ? 46.995  128.712 24.255  1.00 32.14 ? 36   ASP A OD1   1 
ATOM   261   O  OD2   . ASP A 1 36  ? 45.905  126.863 24.701  1.00 34.14 ? 36   ASP A OD2   1 
ATOM   262   N  N     . THR A 1 37  ? 42.475  129.926 21.862  1.00 22.73 ? 37   THR A N     1 
ATOM   263   C  CA    . THR A 1 37  ? 41.804  130.468 20.693  1.00 21.84 ? 37   THR A CA    1 
ATOM   264   C  C     . THR A 1 37  ? 41.375  131.898 21.004  1.00 18.77 ? 37   THR A C     1 
ATOM   265   O  O     . THR A 1 37  ? 41.618  132.816 20.224  1.00 19.20 ? 37   THR A O     1 
ATOM   266   C  CB    . THR A 1 37  ? 40.559  129.632 20.318  1.00 22.30 ? 37   THR A CB    1 
ATOM   267   O  OG1   . THR A 1 37  ? 40.965  128.297 19.990  1.00 23.02 ? 37   THR A OG1   1 
ATOM   268   C  CG2   . THR A 1 37  ? 39.847  130.240 19.120  1.00 20.99 ? 37   THR A CG2   1 
ATOM   269   N  N     . PHE A 1 38  ? 40.751  132.084 22.160  1.00 18.54 ? 38   PHE A N     1 
ATOM   270   C  CA    . PHE A 1 38  ? 40.282  133.405 22.563  1.00 19.15 ? 38   PHE A CA    1 
ATOM   271   C  C     . PHE A 1 38  ? 41.414  134.424 22.627  1.00 20.04 ? 38   PHE A C     1 
ATOM   272   O  O     . PHE A 1 38  ? 41.407  135.426 21.907  1.00 21.99 ? 38   PHE A O     1 
ATOM   273   C  CB    . PHE A 1 38  ? 39.593  133.349 23.928  1.00 15.86 ? 38   PHE A CB    1 
ATOM   274   C  CG    . PHE A 1 38  ? 39.019  134.672 24.363  1.00 17.86 ? 38   PHE A CG    1 
ATOM   275   C  CD1   . PHE A 1 38  ? 37.804  135.123 23.853  1.00 18.24 ? 38   PHE A CD1   1 
ATOM   276   C  CD2   . PHE A 1 38  ? 39.722  135.493 25.241  1.00 17.76 ? 38   PHE A CD2   1 
ATOM   277   C  CE1   . PHE A 1 38  ? 37.296  136.374 24.208  1.00 16.27 ? 38   PHE A CE1   1 
ATOM   278   C  CE2   . PHE A 1 38  ? 39.224  136.746 25.603  1.00 18.00 ? 38   PHE A CE2   1 
ATOM   279   C  CZ    . PHE A 1 38  ? 38.007  137.186 25.083  1.00 17.79 ? 38   PHE A CZ    1 
ATOM   280   N  N     . TRP A 1 39  ? 42.390  134.169 23.491  1.00 18.69 ? 39   TRP A N     1 
ATOM   281   C  CA    . TRP A 1 39  ? 43.508  135.083 23.643  1.00 19.52 ? 39   TRP A CA    1 
ATOM   282   C  C     . TRP A 1 39  ? 44.414  135.134 22.425  1.00 19.04 ? 39   TRP A C     1 
ATOM   283   O  O     . TRP A 1 39  ? 45.124  136.119 22.210  1.00 16.25 ? 39   TRP A O     1 
ATOM   284   C  CB    . TRP A 1 39  ? 44.293  134.730 24.902  1.00 18.64 ? 39   TRP A CB    1 
ATOM   285   C  CG    . TRP A 1 39  ? 43.522  135.097 26.126  1.00 18.48 ? 39   TRP A CG    1 
ATOM   286   C  CD1   . TRP A 1 39  ? 43.023  134.250 27.073  1.00 17.13 ? 39   TRP A CD1   1 
ATOM   287   C  CD2   . TRP A 1 39  ? 43.103  136.415 26.505  1.00 17.40 ? 39   TRP A CD2   1 
ATOM   288   N  NE1   . TRP A 1 39  ? 42.321  134.958 28.014  1.00 17.36 ? 39   TRP A NE1   1 
ATOM   289   C  CE2   . TRP A 1 39  ? 42.352  136.289 27.690  1.00 17.17 ? 39   TRP A CE2   1 
ATOM   290   C  CE3   . TRP A 1 39  ? 43.287  137.691 25.953  1.00 17.80 ? 39   TRP A CE3   1 
ATOM   291   C  CZ2   . TRP A 1 39  ? 41.783  137.390 28.338  1.00 18.10 ? 39   TRP A CZ2   1 
ATOM   292   C  CZ3   . TRP A 1 39  ? 42.721  138.791 26.598  1.00 18.16 ? 39   TRP A CZ3   1 
ATOM   293   C  CH2   . TRP A 1 39  ? 41.979  138.630 27.778  1.00 17.66 ? 39   TRP A CH2   1 
ATOM   294   N  N     . GLY A 1 40  ? 44.386  134.075 21.623  1.00 19.20 ? 40   GLY A N     1 
ATOM   295   C  CA    . GLY A 1 40  ? 45.195  134.048 20.423  1.00 18.26 ? 40   GLY A CA    1 
ATOM   296   C  C     . GLY A 1 40  ? 44.669  135.092 19.456  1.00 18.58 ? 40   GLY A C     1 
ATOM   297   O  O     . GLY A 1 40  ? 45.440  135.799 18.810  1.00 18.73 ? 40   GLY A O     1 
ATOM   298   N  N     . GLU A 1 41  ? 43.348  135.193 19.362  1.00 17.74 ? 41   GLU A N     1 
ATOM   299   C  CA    . GLU A 1 41  ? 42.712  136.155 18.470  1.00 19.51 ? 41   GLU A CA    1 
ATOM   300   C  C     . GLU A 1 41  ? 42.708  137.565 19.056  1.00 18.22 ? 41   GLU A C     1 
ATOM   301   O  O     . GLU A 1 41  ? 42.952  138.545 18.344  1.00 19.37 ? 41   GLU A O     1 
ATOM   302   C  CB    . GLU A 1 41  ? 41.271  135.723 18.174  1.00 19.27 ? 41   GLU A CB    1 
ATOM   303   C  CG    . GLU A 1 41  ? 41.166  134.384 17.450  1.00 25.24 ? 41   GLU A CG    1 
ATOM   304   C  CD    . GLU A 1 41  ? 39.724  133.927 17.251  1.00 27.70 ? 41   GLU A CD    1 
ATOM   305   O  OE1   . GLU A 1 41  ? 39.517  132.881 16.597  1.00 30.04 ? 41   GLU A OE1   1 
ATOM   306   O  OE2   . GLU A 1 41  ? 38.798  134.609 17.748  1.00 28.11 ? 41   GLU A OE2   1 
ATOM   307   N  N     . GLN A 1 42  ? 42.440  137.662 20.354  1.00 15.99 ? 42   GLN A N     1 
ATOM   308   C  CA    . GLN A 1 42  ? 42.378  138.948 21.033  1.00 15.82 ? 42   GLN A CA    1 
ATOM   309   C  C     . GLN A 1 42  ? 43.736  139.636 21.212  1.00 14.74 ? 42   GLN A C     1 
ATOM   310   O  O     . GLN A 1 42  ? 43.799  140.852 21.368  1.00 14.92 ? 42   GLN A O     1 
ATOM   311   C  CB    . GLN A 1 42  ? 41.685  138.782 22.391  1.00 16.87 ? 42   GLN A CB    1 
ATOM   312   C  CG    . GLN A 1 42  ? 41.521  140.083 23.146  1.00 17.12 ? 42   GLN A CG    1 
ATOM   313   C  CD    . GLN A 1 42  ? 40.733  141.110 22.356  1.00 18.85 ? 42   GLN A CD    1 
ATOM   314   O  OE1   . GLN A 1 42  ? 41.100  142.283 22.306  1.00 22.22 ? 42   GLN A OE1   1 
ATOM   315   N  NE2   . GLN A 1 42  ? 39.641  140.674 21.740  1.00 17.66 ? 42   GLN A NE2   1 
ATOM   316   N  N     . GLY A 1 43  ? 44.821  138.865 21.184  1.00 14.53 ? 43   GLY A N     1 
ATOM   317   C  CA    . GLY A 1 43  ? 46.147  139.444 21.340  1.00 14.55 ? 43   GLY A CA    1 
ATOM   318   C  C     . GLY A 1 43  ? 46.573  140.254 20.126  1.00 16.27 ? 43   GLY A C     1 
ATOM   319   O  O     . GLY A 1 43  ? 47.606  140.928 20.140  1.00 13.92 ? 43   GLY A O     1 
ATOM   320   N  N     . LYS A 1 44  ? 45.766  140.185 19.071  1.00 16.80 ? 44   LYS A N     1 
ATOM   321   C  CA    . LYS A 1 44  ? 46.032  140.904 17.836  1.00 17.35 ? 44   LYS A CA    1 
ATOM   322   C  C     . LYS A 1 44  ? 45.624  142.370 17.983  1.00 16.66 ? 44   LYS A C     1 
ATOM   323   O  O     . LYS A 1 44  ? 45.744  143.160 17.039  1.00 16.41 ? 44   LYS A O     1 
ATOM   324   C  CB    . LYS A 1 44  ? 45.261  140.253 16.680  1.00 19.73 ? 44   LYS A CB    1 
ATOM   325   C  CG    . LYS A 1 44  ? 45.679  138.819 16.381  1.00 20.68 ? 44   LYS A CG    1 
ATOM   326   C  CD    . LYS A 1 44  ? 46.929  138.788 15.516  1.00 24.17 ? 44   LYS A CD    1 
ATOM   327   C  CE    . LYS A 1 44  ? 47.350  137.364 15.171  1.00 24.69 ? 44   LYS A CE    1 
ATOM   328   N  NZ    . LYS A 1 44  ? 48.137  136.741 16.276  1.00 27.74 ? 44   LYS A NZ    1 
ATOM   329   N  N     . ILE A 1 45  ? 45.132  142.735 19.163  1.00 14.80 ? 45   ILE A N     1 
ATOM   330   C  CA    . ILE A 1 45  ? 44.744  144.118 19.402  1.00 13.98 ? 45   ILE A CA    1 
ATOM   331   C  C     . ILE A 1 45  ? 46.024  144.949 19.445  1.00 14.47 ? 45   ILE A C     1 
ATOM   332   O  O     . ILE A 1 45  ? 45.996  146.170 19.304  1.00 14.58 ? 45   ILE A O     1 
ATOM   333   C  CB    . ILE A 1 45  ? 43.973  144.289 20.726  1.00 13.74 ? 45   ILE A CB    1 
ATOM   334   C  CG1   . ILE A 1 45  ? 43.475  145.736 20.833  1.00 12.53 ? 45   ILE A CG1   1 
ATOM   335   C  CG2   . ILE A 1 45  ? 44.864  143.924 21.917  1.00 11.70 ? 45   ILE A CG2   1 
ATOM   336   C  CD1   . ILE A 1 45  ? 42.531  145.985 21.976  1.00 13.59 ? 45   ILE A CD1   1 
ATOM   337   N  N     . LEU A 1 46  ? 47.149  144.266 19.636  1.00 14.56 ? 46   LEU A N     1 
ATOM   338   C  CA    . LEU A 1 46  ? 48.452  144.916 19.659  1.00 15.47 ? 46   LEU A CA    1 
ATOM   339   C  C     . LEU A 1 46  ? 49.183  144.561 18.381  1.00 15.99 ? 46   LEU A C     1 
ATOM   340   O  O     . LEU A 1 46  ? 48.858  143.563 17.735  1.00 17.76 ? 46   LEU A O     1 
ATOM   341   C  CB    . LEU A 1 46  ? 49.301  144.421 20.826  1.00 17.19 ? 46   LEU A CB    1 
ATOM   342   C  CG    . LEU A 1 46  ? 48.768  144.566 22.249  1.00 19.03 ? 46   LEU A CG    1 
ATOM   343   C  CD1   . LEU A 1 46  ? 49.859  144.106 23.226  1.00 15.78 ? 46   LEU A CD1   1 
ATOM   344   C  CD2   . LEU A 1 46  ? 48.375  146.018 22.514  1.00 16.92 ? 46   LEU A CD2   1 
ATOM   345   N  N     . ASP A 1 47  ? 50.159  145.385 18.014  1.00 15.49 ? 47   ASP A N     1 
ATOM   346   C  CA    . ASP A 1 47  ? 50.969  145.117 16.832  1.00 15.70 ? 47   ASP A CA    1 
ATOM   347   C  C     . ASP A 1 47  ? 52.131  144.255 17.301  1.00 16.32 ? 47   ASP A C     1 
ATOM   348   O  O     . ASP A 1 47  ? 52.797  144.584 18.278  1.00 14.26 ? 47   ASP A O     1 
ATOM   349   C  CB    . ASP A 1 47  ? 51.546  146.405 16.234  1.00 18.20 ? 47   ASP A CB    1 
ATOM   350   C  CG    . ASP A 1 47  ? 50.557  147.154 15.366  1.00 20.15 ? 47   ASP A CG    1 
ATOM   351   O  OD1   . ASP A 1 47  ? 50.973  148.142 14.717  1.00 24.95 ? 47   ASP A OD1   1 
ATOM   352   O  OD2   . ASP A 1 47  ? 49.372  146.761 15.332  1.00 21.63 ? 47   ASP A OD2   1 
ATOM   353   N  N     . TRP A 1 48  ? 52.377  143.153 16.608  1.00 15.51 ? 48   TRP A N     1 
ATOM   354   C  CA    . TRP A 1 48  ? 53.482  142.298 16.985  1.00 15.75 ? 48   TRP A CA    1 
ATOM   355   C  C     . TRP A 1 48  ? 54.569  142.341 15.920  1.00 16.80 ? 48   TRP A C     1 
ATOM   356   O  O     . TRP A 1 48  ? 54.287  142.208 14.736  1.00 19.11 ? 48   TRP A O     1 
ATOM   357   C  CB    . TRP A 1 48  ? 52.997  140.860 17.199  1.00 14.14 ? 48   TRP A CB    1 
ATOM   358   C  CG    . TRP A 1 48  ? 52.100  140.699 18.394  1.00 12.35 ? 48   TRP A CG    1 
ATOM   359   C  CD1   . TRP A 1 48  ? 50.764  140.989 18.467  1.00 13.36 ? 48   TRP A CD1   1 
ATOM   360   C  CD2   . TRP A 1 48  ? 52.486  140.256 19.699  1.00 11.36 ? 48   TRP A CD2   1 
ATOM   361   N  NE1   . TRP A 1 48  ? 50.299  140.755 19.743  1.00 13.52 ? 48   TRP A NE1   1 
ATOM   362   C  CE2   . TRP A 1 48  ? 51.334  140.305 20.518  1.00 11.89 ? 48   TRP A CE2   1 
ATOM   363   C  CE3   . TRP A 1 48  ? 53.694  139.823 20.259  1.00 12.15 ? 48   TRP A CE3   1 
ATOM   364   C  CZ2   . TRP A 1 48  ? 51.355  139.936 21.868  1.00 11.36 ? 48   TRP A CZ2   1 
ATOM   365   C  CZ3   . TRP A 1 48  ? 53.717  139.459 21.599  1.00 11.89 ? 48   TRP A CZ3   1 
ATOM   366   C  CH2   . TRP A 1 48  ? 52.552  139.518 22.390  1.00 11.59 ? 48   TRP A CH2   1 
ATOM   367   N  N     . ILE A 1 49  ? 55.810  142.552 16.345  1.00 17.32 ? 49   ILE A N     1 
ATOM   368   C  CA    . ILE A 1 49  ? 56.927  142.594 15.411  1.00 17.23 ? 49   ILE A CA    1 
ATOM   369   C  C     . ILE A 1 49  ? 57.138  141.193 14.821  1.00 17.44 ? 49   ILE A C     1 
ATOM   370   O  O     . ILE A 1 49  ? 57.448  141.045 13.647  1.00 19.83 ? 49   ILE A O     1 
ATOM   371   C  CB    . ILE A 1 49  ? 58.185  143.133 16.111  1.00 15.02 ? 49   ILE A CB    1 
ATOM   372   C  CG1   . ILE A 1 49  ? 57.926  144.595 16.507  1.00 13.73 ? 49   ILE A CG1   1 
ATOM   373   C  CG2   . ILE A 1 49  ? 59.398  143.019 15.196  1.00 12.94 ? 49   ILE A CG2   1 
ATOM   374   C  CD1   . ILE A 1 49  ? 58.923  145.176 17.485  1.00 13.58 ? 49   ILE A CD1   1 
ATOM   375   N  N     . THR A 1 50  ? 56.961  140.170 15.642  1.00 18.73 ? 50   THR A N     1 
ATOM   376   C  CA    . THR A 1 50  ? 57.042  138.789 15.187  1.00 20.17 ? 50   THR A CA    1 
ATOM   377   C  C     . THR A 1 50  ? 55.861  138.128 15.883  1.00 20.86 ? 50   THR A C     1 
ATOM   378   O  O     . THR A 1 50  ? 55.692  138.260 17.094  1.00 19.72 ? 50   THR A O     1 
ATOM   379   C  CB    . THR A 1 50  ? 58.348  138.064 15.610  1.00 21.17 ? 50   THR A CB    1 
ATOM   380   O  OG1   . THR A 1 50  ? 58.440  138.019 17.038  1.00 21.43 ? 50   THR A OG1   1 
ATOM   381   C  CG2   . THR A 1 50  ? 59.559  138.761 15.030  1.00 21.06 ? 50   THR A CG2   1 
ATOM   382   N  N     . PRO A 1 51  ? 55.020  137.416 15.122  1.00 22.15 ? 51   PRO A N     1 
ATOM   383   C  CA    . PRO A 1 51  ? 53.848  136.751 15.697  1.00 22.75 ? 51   PRO A CA    1 
ATOM   384   C  C     . PRO A 1 51  ? 54.195  135.686 16.717  1.00 22.92 ? 51   PRO A C     1 
ATOM   385   O  O     . PRO A 1 51  ? 55.293  135.135 16.705  1.00 25.05 ? 51   PRO A O     1 
ATOM   386   C  CB    . PRO A 1 51  ? 53.146  136.176 14.472  1.00 21.52 ? 51   PRO A CB    1 
ATOM   387   C  CG    . PRO A 1 51  ? 54.286  135.849 13.571  1.00 21.63 ? 51   PRO A CG    1 
ATOM   388   C  CD    . PRO A 1 51  ? 55.171  137.071 13.698  1.00 22.86 ? 51   PRO A CD    1 
ATOM   389   N  N     . TYR A 1 52  ? 53.254  135.407 17.606  1.00 22.63 ? 52   TYR A N     1 
ATOM   390   C  CA    . TYR A 1 52  ? 53.453  134.380 18.611  1.00 23.28 ? 52   TYR A CA    1 
ATOM   391   C  C     . TYR A 1 52  ? 52.907  133.065 18.082  1.00 23.91 ? 52   TYR A C     1 
ATOM   392   O  O     . TYR A 1 52  ? 52.191  133.033 17.081  1.00 23.15 ? 52   TYR A O     1 
ATOM   393   C  CB    . TYR A 1 52  ? 52.745  134.757 19.919  1.00 20.16 ? 52   TYR A CB    1 
ATOM   394   C  CG    . TYR A 1 52  ? 51.372  135.381 19.758  1.00 18.47 ? 52   TYR A CG    1 
ATOM   395   C  CD1   . TYR A 1 52  ? 50.257  134.610 19.417  1.00 16.33 ? 52   TYR A CD1   1 
ATOM   396   C  CD2   . TYR A 1 52  ? 51.187  136.750 19.971  1.00 17.80 ? 52   TYR A CD2   1 
ATOM   397   C  CE1   . TYR A 1 52  ? 48.990  135.192 19.294  1.00 14.47 ? 52   TYR A CE1   1 
ATOM   398   C  CE2   . TYR A 1 52  ? 49.936  137.336 19.854  1.00 15.85 ? 52   TYR A CE2   1 
ATOM   399   C  CZ    . TYR A 1 52  ? 48.840  136.555 19.514  1.00 16.22 ? 52   TYR A CZ    1 
ATOM   400   O  OH    . TYR A 1 52  ? 47.606  137.160 19.387  1.00 13.58 ? 52   TYR A OH    1 
ATOM   401   N  N     . GLN A 1 53  ? 53.255  131.979 18.754  1.00 26.24 ? 53   GLN A N     1 
ATOM   402   C  CA    . GLN A 1 53  ? 52.796  130.655 18.365  1.00 28.92 ? 53   GLN A CA    1 
ATOM   403   C  C     . GLN A 1 53  ? 51.963  130.189 19.551  1.00 26.91 ? 53   GLN A C     1 
ATOM   404   O  O     . GLN A 1 53  ? 50.736  130.111 19.483  1.00 28.02 ? 53   GLN A O     1 
ATOM   405   C  CB    . GLN A 1 53  ? 53.997  129.730 18.168  1.00 33.39 ? 53   GLN A CB    1 
ATOM   406   C  CG    . GLN A 1 53  ? 53.754  128.553 17.242  1.00 39.69 ? 53   GLN A CG    1 
ATOM   407   C  CD    . GLN A 1 53  ? 53.852  128.934 15.773  1.00 43.06 ? 53   GLN A CD    1 
ATOM   408   O  OE1   . GLN A 1 53  ? 53.902  128.065 14.898  1.00 44.69 ? 53   GLN A OE1   1 
ATOM   409   N  NE2   . GLN A 1 53  ? 53.875  130.239 15.495  1.00 44.67 ? 53   GLN A NE2   1 
ATOM   410   N  N     . LYS A 1 54  ? 52.654  129.909 20.648  1.00 24.49 ? 54   LYS A N     1 
ATOM   411   C  CA    . LYS A 1 54  ? 52.005  129.474 21.868  1.00 22.76 ? 54   LYS A CA    1 
ATOM   412   C  C     . LYS A 1 54  ? 51.300  130.670 22.502  1.00 21.45 ? 54   LYS A C     1 
ATOM   413   O  O     . LYS A 1 54  ? 51.779  131.800 22.427  1.00 20.02 ? 54   LYS A O     1 
ATOM   414   C  CB    . LYS A 1 54  ? 53.039  128.906 22.825  1.00 24.38 ? 54   LYS A CB    1 
ATOM   415   N  N     . VAL A 1 55  ? 50.153  130.414 23.115  1.00 20.19 ? 55   VAL A N     1 
ATOM   416   C  CA    . VAL A 1 55  ? 49.402  131.471 23.767  1.00 18.58 ? 55   VAL A CA    1 
ATOM   417   C  C     . VAL A 1 55  ? 49.501  131.296 25.276  1.00 18.25 ? 55   VAL A C     1 
ATOM   418   O  O     . VAL A 1 55  ? 50.232  132.024 25.941  1.00 19.53 ? 55   VAL A O     1 
ATOM   419   C  CB    . VAL A 1 55  ? 47.915  131.451 23.332  1.00 17.70 ? 55   VAL A CB    1 
ATOM   420   C  CG1   . VAL A 1 55  ? 47.137  132.555 24.041  1.00 15.46 ? 55   VAL A CG1   1 
ATOM   421   C  CG2   . VAL A 1 55  ? 47.827  131.630 21.826  1.00 13.85 ? 55   VAL A CG2   1 
ATOM   422   N  N     . LYS A 1 56  ? 48.782  130.317 25.812  1.00 16.75 ? 56   LYS A N     1 
ATOM   423   C  CA    . LYS A 1 56  ? 48.801  130.079 27.249  1.00 15.30 ? 56   LYS A CA    1 
ATOM   424   C  C     . LYS A 1 56  ? 49.749  128.951 27.632  1.00 14.71 ? 56   LYS A C     1 
ATOM   425   O  O     . LYS A 1 56  ? 49.639  127.838 27.126  1.00 15.31 ? 56   LYS A O     1 
ATOM   426   C  CB    . LYS A 1 56  ? 47.382  129.765 27.750  1.00 13.72 ? 56   LYS A CB    1 
ATOM   427   C  CG    . LYS A 1 56  ? 47.279  129.516 29.255  1.00 16.89 ? 56   LYS A CG    1 
ATOM   428   C  CD    . LYS A 1 56  ? 45.832  129.273 29.692  1.00 16.01 ? 56   LYS A CD    1 
ATOM   429   C  CE    . LYS A 1 56  ? 45.711  129.037 31.196  1.00 19.26 ? 56   LYS A CE    1 
ATOM   430   N  NZ    . LYS A 1 56  ? 46.402  127.777 31.658  1.00 22.23 ? 56   LYS A NZ    1 
ATOM   431   N  N     . ASN A 1 57  ? 50.692  129.260 28.517  1.00 14.36 ? 57   ASN A N     1 
ATOM   432   C  CA    . ASN A 1 57  ? 51.657  128.281 29.012  1.00 14.45 ? 57   ASN A CA    1 
ATOM   433   C  C     . ASN A 1 57  ? 51.910  128.639 30.472  1.00 14.21 ? 57   ASN A C     1 
ATOM   434   O  O     . ASN A 1 57  ? 52.934  129.226 30.810  1.00 15.64 ? 57   ASN A O     1 
ATOM   435   C  CB    . ASN A 1 57  ? 52.962  128.344 28.215  1.00 13.43 ? 57   ASN A CB    1 
ATOM   436   C  CG    . ASN A 1 57  ? 53.969  127.289 28.661  1.00 15.28 ? 57   ASN A CG    1 
ATOM   437   O  OD1   . ASN A 1 57  ? 53.623  126.355 29.385  1.00 17.51 ? 57   ASN A OD1   1 
ATOM   438   N  ND2   . ASN A 1 57  ? 55.216  127.429 28.221  1.00 10.59 ? 57   ASN A ND2   1 
ATOM   439   N  N     . THR A 1 58  ? 50.960  128.272 31.326  1.00 13.61 ? 58   THR A N     1 
ATOM   440   C  CA    . THR A 1 58  ? 51.027  128.593 32.739  1.00 13.77 ? 58   THR A CA    1 
ATOM   441   C  C     . THR A 1 58  ? 50.815  127.406 33.683  1.00 16.58 ? 58   THR A C     1 
ATOM   442   O  O     . THR A 1 58  ? 50.288  126.365 33.297  1.00 18.40 ? 58   THR A O     1 
ATOM   443   C  CB    . THR A 1 58  ? 49.978  129.667 33.087  1.00 12.88 ? 58   THR A CB    1 
ATOM   444   O  OG1   . THR A 1 58  ? 48.662  129.111 32.944  1.00 7.39  ? 58   THR A OG1   1 
ATOM   445   C  CG2   . THR A 1 58  ? 50.113  130.877 32.167  1.00 10.65 ? 58   THR A CG2   1 
ATOM   446   N  N     . SER A 1 59  ? 51.208  127.607 34.937  1.00 16.71 ? 59   SER A N     1 
ATOM   447   C  CA    . SER A 1 59  ? 51.068  126.598 35.979  1.00 16.48 ? 59   SER A CA    1 
ATOM   448   C  C     . SER A 1 59  ? 51.065  127.265 37.361  1.00 17.03 ? 59   SER A C     1 
ATOM   449   O  O     . SER A 1 59  ? 51.888  128.146 37.637  1.00 17.53 ? 59   SER A O     1 
ATOM   450   C  CB    . SER A 1 59  ? 52.223  125.595 35.902  1.00 16.92 ? 59   SER A CB    1 
ATOM   451   O  OG    . SER A 1 59  ? 52.226  124.734 37.031  1.00 13.03 ? 59   SER A OG    1 
ATOM   452   N  N     . PHE A 1 60  ? 50.150  126.835 38.227  1.00 16.13 ? 60   PHE A N     1 
ATOM   453   C  CA    . PHE A 1 60  ? 50.054  127.369 39.582  1.00 16.73 ? 60   PHE A CA    1 
ATOM   454   C  C     . PHE A 1 60  ? 50.518  126.296 40.579  1.00 18.08 ? 60   PHE A C     1 
ATOM   455   O  O     . PHE A 1 60  ? 50.201  126.366 41.766  1.00 17.59 ? 60   PHE A O     1 
ATOM   456   C  CB    . PHE A 1 60  ? 48.604  127.777 39.911  1.00 15.80 ? 60   PHE A CB    1 
ATOM   457   C  CG    . PHE A 1 60  ? 48.151  129.076 39.270  1.00 14.74 ? 60   PHE A CG    1 
ATOM   458   C  CD1   . PHE A 1 60  ? 46.824  129.492 39.397  1.00 12.73 ? 60   PHE A CD1   1 
ATOM   459   C  CD2   . PHE A 1 60  ? 49.039  129.893 38.564  1.00 12.03 ? 60   PHE A CD2   1 
ATOM   460   C  CE1   . PHE A 1 60  ? 46.388  130.705 38.834  1.00 13.30 ? 60   PHE A CE1   1 
ATOM   461   C  CE2   . PHE A 1 60  ? 48.615  131.103 37.998  1.00 11.63 ? 60   PHE A CE2   1 
ATOM   462   C  CZ    . PHE A 1 60  ? 47.288  131.509 38.134  1.00 10.69 ? 60   PHE A CZ    1 
ATOM   463   N  N     . ALA A 1 61  ? 51.260  125.306 40.091  1.00 17.09 ? 61   ALA A N     1 
ATOM   464   C  CA    . ALA A 1 61  ? 51.745  124.222 40.945  1.00 19.05 ? 61   ALA A CA    1 
ATOM   465   C  C     . ALA A 1 61  ? 52.519  124.755 42.159  1.00 18.28 ? 61   ALA A C     1 
ATOM   466   O  O     . ALA A 1 61  ? 53.320  125.688 42.039  1.00 20.29 ? 61   ALA A O     1 
ATOM   467   C  CB    . ALA A 1 61  ? 52.624  123.264 40.128  1.00 17.60 ? 61   ALA A CB    1 
ATOM   468   N  N     . PRO A 1 62  ? 52.289  124.158 43.343  1.00 18.27 ? 62   PRO A N     1 
ATOM   469   C  CA    . PRO A 1 62  ? 52.939  124.547 44.599  1.00 19.33 ? 62   PRO A CA    1 
ATOM   470   C  C     . PRO A 1 62  ? 54.456  124.627 44.462  1.00 21.16 ? 62   PRO A C     1 
ATOM   471   O  O     . PRO A 1 62  ? 55.089  123.697 43.961  1.00 21.65 ? 62   PRO A O     1 
ATOM   472   C  CB    . PRO A 1 62  ? 52.516  123.442 45.567  1.00 19.13 ? 62   PRO A CB    1 
ATOM   473   C  CG    . PRO A 1 62  ? 51.214  122.958 45.004  1.00 18.89 ? 62   PRO A CG    1 
ATOM   474   C  CD    . PRO A 1 62  ? 51.491  122.932 43.531  1.00 18.53 ? 62   PRO A CD    1 
ATOM   475   N  N     . GLY A 1 63  ? 55.037  125.736 44.903  1.00 21.17 ? 63   GLY A N     1 
ATOM   476   C  CA    . GLY A 1 63  ? 56.478  125.891 44.808  1.00 23.18 ? 63   GLY A CA    1 
ATOM   477   C  C     . GLY A 1 63  ? 57.008  125.768 43.391  1.00 24.23 ? 63   GLY A C     1 
ATOM   478   O  O     . GLY A 1 63  ? 58.217  125.644 43.184  1.00 25.59 ? 63   GLY A O     1 
ATOM   479   N  N     . ASN A 1 64  ? 56.111  125.805 42.411  1.00 23.06 ? 64   ASN A N     1 
ATOM   480   C  CA    . ASN A 1 64  ? 56.515  125.711 41.014  1.00 22.04 ? 64   ASN A CA    1 
ATOM   481   C  C     . ASN A 1 64  ? 55.594  126.492 40.074  1.00 21.17 ? 64   ASN A C     1 
ATOM   482   O  O     . ASN A 1 64  ? 55.068  125.941 39.105  1.00 21.42 ? 64   ASN A O     1 
ATOM   483   C  CB    . ASN A 1 64  ? 56.578  124.241 40.597  1.00 19.04 ? 64   ASN A CB    1 
ATOM   484   C  CG    . ASN A 1 64  ? 57.768  123.518 41.199  1.00 18.86 ? 64   ASN A CG    1 
ATOM   485   O  OD1   . ASN A 1 64  ? 58.911  123.752 40.808  1.00 18.62 ? 64   ASN A OD1   1 
ATOM   486   N  ND2   . ASN A 1 64  ? 57.507  122.638 42.161  1.00 19.47 ? 64   ASN A ND2   1 
ATOM   487   N  N     . VAL A 1 65  ? 55.413  127.778 40.367  1.00 20.79 ? 65   VAL A N     1 
ATOM   488   C  CA    . VAL A 1 65  ? 54.566  128.645 39.553  1.00 21.03 ? 65   VAL A CA    1 
ATOM   489   C  C     . VAL A 1 65  ? 55.297  129.147 38.314  1.00 20.87 ? 65   VAL A C     1 
ATOM   490   O  O     . VAL A 1 65  ? 56.437  129.602 38.393  1.00 21.66 ? 65   VAL A O     1 
ATOM   491   C  CB    . VAL A 1 65  ? 54.083  129.877 40.349  1.00 21.11 ? 65   VAL A CB    1 
ATOM   492   C  CG1   . VAL A 1 65  ? 53.256  130.800 39.448  1.00 18.48 ? 65   VAL A CG1   1 
ATOM   493   C  CG2   . VAL A 1 65  ? 53.267  129.423 41.542  1.00 21.94 ? 65   VAL A CG2   1 
ATOM   494   N  N     . SER A 1 66  ? 54.633  129.065 37.169  1.00 19.96 ? 66   SER A N     1 
ATOM   495   C  CA    . SER A 1 66  ? 55.210  129.517 35.914  1.00 18.67 ? 66   SER A CA    1 
ATOM   496   C  C     . SER A 1 66  ? 54.100  130.156 35.092  1.00 17.94 ? 66   SER A C     1 
ATOM   497   O  O     . SER A 1 66  ? 53.075  129.521 34.827  1.00 19.13 ? 66   SER A O     1 
ATOM   498   C  CB    . SER A 1 66  ? 55.816  128.336 35.154  1.00 18.35 ? 66   SER A CB    1 
ATOM   499   O  OG    . SER A 1 66  ? 56.724  128.782 34.159  1.00 20.77 ? 66   SER A OG    1 
ATOM   500   N  N     . ILE A 1 67  ? 54.301  131.410 34.694  1.00 16.78 ? 67   ILE A N     1 
ATOM   501   C  CA    . ILE A 1 67  ? 53.296  132.120 33.907  1.00 15.16 ? 67   ILE A CA    1 
ATOM   502   C  C     . ILE A 1 67  ? 53.897  132.773 32.673  1.00 15.60 ? 67   ILE A C     1 
ATOM   503   O  O     . ILE A 1 67  ? 54.686  133.707 32.776  1.00 16.32 ? 67   ILE A O     1 
ATOM   504   C  CB    . ILE A 1 67  ? 52.619  133.207 34.748  1.00 14.69 ? 67   ILE A CB    1 
ATOM   505   C  CG1   . ILE A 1 67  ? 52.046  132.581 36.019  1.00 13.57 ? 67   ILE A CG1   1 
ATOM   506   C  CG2   . ILE A 1 67  ? 51.526  133.889 33.937  1.00 13.59 ? 67   ILE A CG2   1 
ATOM   507   C  CD1   . ILE A 1 67  ? 51.760  133.565 37.108  1.00 15.66 ? 67   ILE A CD1   1 
ATOM   508   N  N     . LYS A 1 68  ? 53.510  132.263 31.509  1.00 16.13 ? 68   LYS A N     1 
ATOM   509   C  CA    . LYS A 1 68  ? 53.991  132.782 30.238  1.00 15.29 ? 68   LYS A CA    1 
ATOM   510   C  C     . LYS A 1 68  ? 52.824  132.897 29.255  1.00 15.64 ? 68   LYS A C     1 
ATOM   511   O  O     . LYS A 1 68  ? 51.945  132.035 29.218  1.00 15.13 ? 68   LYS A O     1 
ATOM   512   C  CB    . LYS A 1 68  ? 55.056  131.849 29.665  1.00 15.71 ? 68   LYS A CB    1 
ATOM   513   C  CG    . LYS A 1 68  ? 56.246  131.614 30.583  1.00 15.55 ? 68   LYS A CG    1 
ATOM   514   C  CD    . LYS A 1 68  ? 57.170  130.556 29.994  1.00 18.08 ? 68   LYS A CD    1 
ATOM   515   C  CE    . LYS A 1 68  ? 58.363  130.281 30.896  1.00 18.14 ? 68   LYS A CE    1 
ATOM   516   N  NZ    . LYS A 1 68  ? 59.242  129.201 30.348  1.00 18.31 ? 68   LYS A NZ    1 
ATOM   517   N  N     . TRP A 1 69  ? 52.816  133.974 28.475  1.00 14.91 ? 69   TRP A N     1 
ATOM   518   C  CA    . TRP A 1 69  ? 51.784  134.198 27.469  1.00 15.32 ? 69   TRP A CA    1 
ATOM   519   C  C     . TRP A 1 69  ? 52.436  134.754 26.214  1.00 15.13 ? 69   TRP A C     1 
ATOM   520   O  O     . TRP A 1 69  ? 53.277  135.646 26.304  1.00 16.34 ? 69   TRP A O     1 
ATOM   521   C  CB    . TRP A 1 69  ? 50.731  135.193 27.960  1.00 15.09 ? 69   TRP A CB    1 
ATOM   522   C  CG    . TRP A 1 69  ? 49.825  134.665 29.029  1.00 17.65 ? 69   TRP A CG    1 
ATOM   523   C  CD1   . TRP A 1 69  ? 50.080  134.614 30.367  1.00 17.35 ? 69   TRP A CD1   1 
ATOM   524   C  CD2   . TRP A 1 69  ? 48.508  134.121 28.848  1.00 17.11 ? 69   TRP A CD2   1 
ATOM   525   N  NE1   . TRP A 1 69  ? 49.003  134.077 31.031  1.00 18.14 ? 69   TRP A NE1   1 
ATOM   526   C  CE2   . TRP A 1 69  ? 48.026  133.767 30.122  1.00 17.64 ? 69   TRP A CE2   1 
ATOM   527   C  CE3   . TRP A 1 69  ? 47.689  133.901 27.728  1.00 17.51 ? 69   TRP A CE3   1 
ATOM   528   C  CZ2   . TRP A 1 69  ? 46.761  133.204 30.314  1.00 19.02 ? 69   TRP A CZ2   1 
ATOM   529   C  CZ3   . TRP A 1 69  ? 46.434  133.343 27.917  1.00 15.67 ? 69   TRP A CZ3   1 
ATOM   530   C  CH2   . TRP A 1 69  ? 45.981  133.001 29.201  1.00 18.22 ? 69   TRP A CH2   1 
ATOM   531   N  N     . TYR A 1 70  ? 52.050  134.229 25.051  1.00 14.72 ? 70   TYR A N     1 
ATOM   532   C  CA    . TYR A 1 70  ? 52.601  134.697 23.781  1.00 13.41 ? 70   TYR A CA    1 
ATOM   533   C  C     . TYR A 1 70  ? 54.124  134.719 23.865  1.00 13.96 ? 70   TYR A C     1 
ATOM   534   O  O     . TYR A 1 70  ? 54.774  135.541 23.222  1.00 14.32 ? 70   TYR A O     1 
ATOM   535   C  CB    . TYR A 1 70  ? 52.116  136.121 23.505  1.00 12.59 ? 70   TYR A CB    1 
ATOM   536   C  CG    . TYR A 1 70  ? 50.641  136.372 23.741  1.00 10.71 ? 70   TYR A CG    1 
ATOM   537   C  CD1   . TYR A 1 70  ? 50.212  137.152 24.815  1.00 10.40 ? 70   TYR A CD1   1 
ATOM   538   C  CD2   . TYR A 1 70  ? 49.682  135.900 22.848  1.00 11.11 ? 70   TYR A CD2   1 
ATOM   539   C  CE1   . TYR A 1 70  ? 48.866  137.467 24.988  1.00 7.74  ? 70   TYR A CE1   1 
ATOM   540   C  CE2   . TYR A 1 70  ? 48.335  136.207 23.008  1.00 9.44  ? 70   TYR A CE2   1 
ATOM   541   C  CZ    . TYR A 1 70  ? 47.933  136.996 24.079  1.00 10.97 ? 70   TYR A CZ    1 
ATOM   542   O  OH    . TYR A 1 70  ? 46.606  137.344 24.224  1.00 10.58 ? 70   TYR A OH    1 
ATOM   543   N  N     . GLU A 1 71  ? 54.686  133.807 24.649  1.00 14.39 ? 71   GLU A N     1 
ATOM   544   C  CA    . GLU A 1 71  ? 56.121  133.779 24.891  1.00 16.32 ? 71   GLU A CA    1 
ATOM   545   C  C     . GLU A 1 71  ? 57.071  133.923 23.719  1.00 17.36 ? 71   GLU A C     1 
ATOM   546   O  O     . GLU A 1 71  ? 58.158  134.454 23.893  1.00 18.83 ? 71   GLU A O     1 
ATOM   547   C  CB    . GLU A 1 71  ? 56.482  132.534 25.698  1.00 16.73 ? 71   GLU A CB    1 
ATOM   548   C  CG    . GLU A 1 71  ? 56.211  131.226 24.992  1.00 18.09 ? 71   GLU A CG    1 
ATOM   549   C  CD    . GLU A 1 71  ? 56.378  130.046 25.915  1.00 20.50 ? 71   GLU A CD    1 
ATOM   550   O  OE1   . GLU A 1 71  ? 55.401  129.691 26.607  1.00 19.67 ? 71   GLU A OE1   1 
ATOM   551   O  OE2   . GLU A 1 71  ? 57.494  129.485 25.962  1.00 24.83 ? 71   GLU A OE2   1 
ATOM   552   N  N     . ASP A 1 72  ? 56.682  133.471 22.533  1.00 19.93 ? 72   ASP A N     1 
ATOM   553   C  CA    . ASP A 1 72  ? 57.579  133.575 21.386  1.00 22.72 ? 72   ASP A CA    1 
ATOM   554   C  C     . ASP A 1 72  ? 57.346  134.787 20.481  1.00 22.60 ? 72   ASP A C     1 
ATOM   555   O  O     . ASP A 1 72  ? 58.072  134.991 19.508  1.00 23.41 ? 72   ASP A O     1 
ATOM   556   C  CB    . ASP A 1 72  ? 57.538  132.285 20.555  1.00 28.31 ? 72   ASP A CB    1 
ATOM   557   C  CG    . ASP A 1 72  ? 56.167  131.631 20.550  1.00 34.22 ? 72   ASP A CG    1 
ATOM   558   O  OD1   . ASP A 1 72  ? 55.154  132.353 20.391  1.00 36.38 ? 72   ASP A OD1   1 
ATOM   559   O  OD2   . ASP A 1 72  ? 56.109  130.390 20.699  1.00 36.89 ? 72   ASP A OD2   1 
ATOM   560   N  N     . GLY A 1 73  ? 56.336  135.588 20.793  1.00 20.84 ? 73   GLY A N     1 
ATOM   561   C  CA    . GLY A 1 73  ? 56.082  136.765 19.988  1.00 20.68 ? 73   GLY A CA    1 
ATOM   562   C  C     . GLY A 1 73  ? 56.916  137.915 20.520  1.00 19.50 ? 73   GLY A C     1 
ATOM   563   O  O     . GLY A 1 73  ? 57.171  137.994 21.720  1.00 21.12 ? 73   GLY A O     1 
ATOM   564   N  N     . THR A 1 74  ? 57.366  138.794 19.633  1.00 17.34 ? 74   THR A N     1 
ATOM   565   C  CA    . THR A 1 74  ? 58.159  139.941 20.060  1.00 16.03 ? 74   THR A CA    1 
ATOM   566   C  C     . THR A 1 74  ? 57.404  141.207 19.660  1.00 15.74 ? 74   THR A C     1 
ATOM   567   O  O     . THR A 1 74  ? 56.722  141.231 18.631  1.00 15.55 ? 74   THR A O     1 
ATOM   568   C  CB    . THR A 1 74  ? 59.552  139.957 19.394  1.00 14.48 ? 74   THR A CB    1 
ATOM   569   O  OG1   . THR A 1 74  ? 59.413  140.292 18.008  1.00 14.45 ? 74   THR A OG1   1 
ATOM   570   C  CG2   . THR A 1 74  ? 60.229  138.588 19.523  1.00 11.97 ? 74   THR A CG2   1 
ATOM   571   N  N     . LEU A 1 75  ? 57.526  142.251 20.471  1.00 13.72 ? 75   LEU A N     1 
ATOM   572   C  CA    . LEU A 1 75  ? 56.845  143.507 20.200  1.00 15.04 ? 75   LEU A CA    1 
ATOM   573   C  C     . LEU A 1 75  ? 57.486  144.637 20.990  1.00 15.85 ? 75   LEU A C     1 
ATOM   574   O  O     . LEU A 1 75  ? 58.479  144.438 21.694  1.00 17.84 ? 75   LEU A O     1 
ATOM   575   C  CB    . LEU A 1 75  ? 55.376  143.408 20.601  1.00 15.43 ? 75   LEU A CB    1 
ATOM   576   C  CG    . LEU A 1 75  ? 55.106  143.540 22.106  1.00 16.16 ? 75   LEU A CG    1 
ATOM   577   C  CD1   . LEU A 1 75  ? 53.610  143.562 22.353  1.00 16.05 ? 75   LEU A CD1   1 
ATOM   578   C  CD2   . LEU A 1 75  ? 55.763  142.406 22.871  1.00 13.96 ? 75   LEU A CD2   1 
ATOM   579   N  N     . ASN A 1 76  ? 56.906  145.824 20.875  1.00 15.35 ? 76   ASN A N     1 
ATOM   580   C  CA    . ASN A 1 76  ? 57.406  146.979 21.607  1.00 15.76 ? 76   ASN A CA    1 
ATOM   581   C  C     . ASN A 1 76  ? 56.229  147.792 22.130  1.00 14.53 ? 76   ASN A C     1 
ATOM   582   O  O     . ASN A 1 76  ? 55.412  148.281 21.350  1.00 16.56 ? 76   ASN A O     1 
ATOM   583   C  CB    . ASN A 1 76  ? 58.269  147.858 20.707  1.00 15.41 ? 76   ASN A CB    1 
ATOM   584   C  CG    . ASN A 1 76  ? 58.954  148.972 21.475  1.00 15.74 ? 76   ASN A CG    1 
ATOM   585   O  OD1   . ASN A 1 76  ? 60.131  148.870 21.823  1.00 15.73 ? 76   ASN A OD1   1 
ATOM   586   N  ND2   . ASN A 1 76  ? 58.211  150.035 21.760  1.00 15.36 ? 76   ASN A ND2   1 
ATOM   587   N  N     . LEU A 1 77  ? 56.146  147.937 23.447  1.00 14.61 ? 77   LEU A N     1 
ATOM   588   C  CA    . LEU A 1 77  ? 55.057  148.690 24.063  1.00 11.98 ? 77   LEU A CA    1 
ATOM   589   C  C     . LEU A 1 77  ? 54.976  150.145 23.595  1.00 11.31 ? 77   LEU A C     1 
ATOM   590   O  O     . LEU A 1 77  ? 53.882  150.662 23.375  1.00 11.53 ? 77   LEU A O     1 
ATOM   591   C  CB    . LEU A 1 77  ? 55.188  148.644 25.590  1.00 10.52 ? 77   LEU A CB    1 
ATOM   592   C  CG    . LEU A 1 77  ? 54.191  149.457 26.421  1.00 13.20 ? 77   LEU A CG    1 
ATOM   593   C  CD1   . LEU A 1 77  ? 54.030  148.792 27.784  1.00 11.55 ? 77   LEU A CD1   1 
ATOM   594   C  CD2   . LEU A 1 77  ? 54.670  150.921 26.565  1.00 10.48 ? 77   LEU A CD2   1 
ATOM   595   N  N     . ALA A 1 78  ? 56.122  150.804 23.440  1.00 10.77 ? 78   ALA A N     1 
ATOM   596   C  CA    . ALA A 1 78  ? 56.124  152.200 23.004  1.00 11.72 ? 78   ALA A CA    1 
ATOM   597   C  C     . ALA A 1 78  ? 55.552  152.332 21.597  1.00 12.26 ? 78   ALA A C     1 
ATOM   598   O  O     . ALA A 1 78  ? 54.784  153.253 21.312  1.00 11.16 ? 78   ALA A O     1 
ATOM   599   C  CB    . ALA A 1 78  ? 57.542  152.779 23.059  1.00 10.93 ? 78   ALA A CB    1 
ATOM   600   N  N     . ALA A 1 79  ? 55.922  151.405 20.719  1.00 13.01 ? 79   ALA A N     1 
ATOM   601   C  CA    . ALA A 1 79  ? 55.432  151.421 19.345  1.00 13.84 ? 79   ALA A CA    1 
ATOM   602   C  C     . ALA A 1 79  ? 53.925  151.189 19.304  1.00 13.28 ? 79   ALA A C     1 
ATOM   603   O  O     . ALA A 1 79  ? 53.220  151.718 18.444  1.00 13.98 ? 79   ALA A O     1 
ATOM   604   C  CB    . ALA A 1 79  ? 56.136  150.349 18.526  1.00 14.39 ? 79   ALA A CB    1 
ATOM   605   N  N     . ASN A 1 80  ? 53.435  150.388 20.236  1.00 11.51 ? 80   ASN A N     1 
ATOM   606   C  CA    . ASN A 1 80  ? 52.013  150.093 20.284  1.00 13.62 ? 80   ASN A CA    1 
ATOM   607   C  C     . ASN A 1 80  ? 51.215  151.260 20.836  1.00 15.48 ? 80   ASN A C     1 
ATOM   608   O  O     . ASN A 1 80  ? 50.046  151.461 20.478  1.00 15.19 ? 80   ASN A O     1 
ATOM   609   C  CB    . ASN A 1 80  ? 51.775  148.848 21.138  1.00 11.92 ? 80   ASN A CB    1 
ATOM   610   C  CG    . ASN A 1 80  ? 51.579  147.601 20.300  1.00 13.96 ? 80   ASN A CG    1 
ATOM   611   O  OD1   . ASN A 1 80  ? 50.543  147.440 19.643  1.00 12.10 ? 80   ASN A OD1   1 
ATOM   612   N  ND2   . ASN A 1 80  ? 52.577  146.717 20.302  1.00 13.77 ? 80   ASN A ND2   1 
ATOM   613   N  N     . CYS A 1 81  ? 51.857  152.043 21.697  1.00 13.66 ? 81   CYS A N     1 
ATOM   614   C  CA    . CYS A 1 81  ? 51.193  153.167 22.326  1.00 14.21 ? 81   CYS A CA    1 
ATOM   615   C  C     . CYS A 1 81  ? 51.424  154.480 21.587  1.00 13.38 ? 81   CYS A C     1 
ATOM   616   O  O     . CYS A 1 81  ? 50.741  155.470 21.857  1.00 13.19 ? 81   CYS A O     1 
ATOM   617   C  CB    . CYS A 1 81  ? 51.672  153.324 23.776  1.00 14.41 ? 81   CYS A CB    1 
ATOM   618   S  SG    . CYS A 1 81  ? 51.480  151.906 24.857  1.00 14.89 ? 81   CYS A SG    1 
ATOM   619   N  N     . LEU A 1 82  ? 52.367  154.493 20.647  1.00 13.04 ? 82   LEU A N     1 
ATOM   620   C  CA    . LEU A 1 82  ? 52.671  155.725 19.925  1.00 12.58 ? 82   LEU A CA    1 
ATOM   621   C  C     . LEU A 1 82  ? 52.804  155.598 18.416  1.00 12.94 ? 82   LEU A C     1 
ATOM   622   O  O     . LEU A 1 82  ? 51.917  156.006 17.661  1.00 12.17 ? 82   LEU A O     1 
ATOM   623   C  CB    . LEU A 1 82  ? 53.965  156.328 20.472  1.00 13.38 ? 82   LEU A CB    1 
ATOM   624   C  CG    . LEU A 1 82  ? 53.991  156.584 21.976  1.00 14.15 ? 82   LEU A CG    1 
ATOM   625   C  CD1   . LEU A 1 82  ? 55.418  156.794 22.427  1.00 13.85 ? 82   LEU A CD1   1 
ATOM   626   C  CD2   . LEU A 1 82  ? 53.117  157.799 22.302  1.00 12.42 ? 82   LEU A CD2   1 
ATOM   627   N  N     . ASP A 1 83  ? 53.934  155.044 17.993  1.00 13.11 ? 83   ASP A N     1 
ATOM   628   C  CA    . ASP A 1 83  ? 54.262  154.865 16.582  1.00 14.73 ? 83   ASP A CA    1 
ATOM   629   C  C     . ASP A 1 83  ? 53.145  154.403 15.652  1.00 13.44 ? 83   ASP A C     1 
ATOM   630   O  O     . ASP A 1 83  ? 52.917  155.018 14.610  1.00 13.57 ? 83   ASP A O     1 
ATOM   631   C  CB    . ASP A 1 83  ? 55.452  153.913 16.448  1.00 15.12 ? 83   ASP A CB    1 
ATOM   632   C  CG    . ASP A 1 83  ? 56.619  154.324 17.318  1.00 20.66 ? 83   ASP A CG    1 
ATOM   633   O  OD1   . ASP A 1 83  ? 57.767  154.270 16.827  1.00 24.16 ? 83   ASP A OD1   1 
ATOM   634   O  OD2   . ASP A 1 83  ? 56.392  154.695 18.495  1.00 20.70 ? 83   ASP A OD2   1 
ATOM   635   N  N     . ARG A 1 84  ? 52.447  153.335 16.019  1.00 12.77 ? 84   ARG A N     1 
ATOM   636   C  CA    . ARG A 1 84  ? 51.390  152.816 15.167  1.00 14.68 ? 84   ARG A CA    1 
ATOM   637   C  C     . ARG A 1 84  ? 50.170  153.723 15.073  1.00 16.36 ? 84   ARG A C     1 
ATOM   638   O  O     . ARG A 1 84  ? 49.226  153.405 14.357  1.00 18.12 ? 84   ARG A O     1 
ATOM   639   C  CB    . ARG A 1 84  ? 50.958  151.424 15.636  1.00 14.43 ? 84   ARG A CB    1 
ATOM   640   C  CG    . ARG A 1 84  ? 50.224  151.389 16.962  1.00 13.31 ? 84   ARG A CG    1 
ATOM   641   C  CD    . ARG A 1 84  ? 49.573  150.026 17.140  1.00 13.85 ? 84   ARG A CD    1 
ATOM   642   N  NE    . ARG A 1 84  ? 48.834  149.896 18.391  1.00 13.65 ? 84   ARG A NE    1 
ATOM   643   C  CZ    . ARG A 1 84  ? 48.057  148.855 18.688  1.00 14.53 ? 84   ARG A CZ    1 
ATOM   644   N  NH1   . ARG A 1 84  ? 47.922  147.861 17.810  1.00 13.86 ? 84   ARG A NH1   1 
ATOM   645   N  NH2   . ARG A 1 84  ? 47.424  148.801 19.858  1.00 9.08  ? 84   ARG A NH2   1 
ATOM   646   N  N     . HIS A 1 85  ? 50.182  154.847 15.785  1.00 18.32 ? 85   HIS A N     1 
ATOM   647   C  CA    . HIS A 1 85  ? 49.049  155.771 15.747  1.00 18.54 ? 85   HIS A CA    1 
ATOM   648   C  C     . HIS A 1 85  ? 49.377  157.052 14.981  1.00 19.70 ? 85   HIS A C     1 
ATOM   649   O  O     . HIS A 1 85  ? 48.487  157.848 14.689  1.00 19.13 ? 85   HIS A O     1 
ATOM   650   C  CB    . HIS A 1 85  ? 48.608  156.152 17.168  1.00 16.36 ? 85   HIS A CB    1 
ATOM   651   C  CG    . HIS A 1 85  ? 48.199  154.988 18.015  1.00 18.92 ? 85   HIS A CG    1 
ATOM   652   N  ND1   . HIS A 1 85  ? 47.218  154.095 17.638  1.00 18.19 ? 85   HIS A ND1   1 
ATOM   653   C  CD2   . HIS A 1 85  ? 48.625  154.585 19.235  1.00 18.96 ? 85   HIS A CD2   1 
ATOM   654   C  CE1   . HIS A 1 85  ? 47.057  153.193 18.591  1.00 17.45 ? 85   HIS A CE1   1 
ATOM   655   N  NE2   . HIS A 1 85  ? 47.899  153.468 19.572  1.00 18.63 ? 85   HIS A NE2   1 
ATOM   656   N  N     . LEU A 1 86  ? 50.650  157.243 14.648  1.00 20.43 ? 86   LEU A N     1 
ATOM   657   C  CA    . LEU A 1 86  ? 51.081  158.446 13.944  1.00 22.86 ? 86   LEU A CA    1 
ATOM   658   C  C     . LEU A 1 86  ? 50.503  158.670 12.550  1.00 23.27 ? 86   LEU A C     1 
ATOM   659   O  O     . LEU A 1 86  ? 49.960  159.734 12.257  1.00 23.19 ? 86   LEU A O     1 
ATOM   660   C  CB    . LEU A 1 86  ? 52.612  158.485 13.867  1.00 23.38 ? 86   LEU A CB    1 
ATOM   661   C  CG    . LEU A 1 86  ? 53.333  158.581 15.214  1.00 23.78 ? 86   LEU A CG    1 
ATOM   662   C  CD1   . LEU A 1 86  ? 54.738  159.124 14.999  1.00 24.57 ? 86   LEU A CD1   1 
ATOM   663   C  CD2   . LEU A 1 86  ? 52.557  159.507 16.143  1.00 23.83 ? 86   LEU A CD2   1 
ATOM   664   N  N     . GLN A 1 87  ? 50.619  157.666 11.695  1.00 25.34 ? 87   GLN A N     1 
ATOM   665   C  CA    . GLN A 1 87  ? 50.138  157.765 10.323  1.00 27.10 ? 87   GLN A CA    1 
ATOM   666   C  C     . GLN A 1 87  ? 48.691  158.256 10.168  1.00 27.79 ? 87   GLN A C     1 
ATOM   667   O  O     . GLN A 1 87  ? 48.407  159.098 9.317   1.00 27.74 ? 87   GLN A O     1 
ATOM   668   C  CB    . GLN A 1 87  ? 50.317  156.414 9.628   1.00 27.72 ? 87   GLN A CB    1 
ATOM   669   C  CG    . GLN A 1 87  ? 49.978  156.428 8.150   1.00 33.61 ? 87   GLN A CG    1 
ATOM   670   C  CD    . GLN A 1 87  ? 50.507  155.202 7.428   1.00 35.59 ? 87   GLN A CD    1 
ATOM   671   O  OE1   . GLN A 1 87  ? 51.695  155.125 7.086   1.00 38.47 ? 87   GLN A OE1   1 
ATOM   672   N  NE2   . GLN A 1 87  ? 49.631  154.225 7.208   1.00 35.97 ? 87   GLN A NE2   1 
ATOM   673   N  N     . GLU A 1 88  ? 47.778  157.739 10.984  1.00 27.04 ? 88   GLU A N     1 
ATOM   674   C  CA    . GLU A 1 88  ? 46.382  158.152 10.895  1.00 27.43 ? 88   GLU A CA    1 
ATOM   675   C  C     . GLU A 1 88  ? 45.917  159.060 12.031  1.00 27.19 ? 88   GLU A C     1 
ATOM   676   O  O     . GLU A 1 88  ? 44.892  159.725 11.905  1.00 26.88 ? 88   GLU A O     1 
ATOM   677   C  CB    . GLU A 1 88  ? 45.460  156.931 10.844  1.00 29.70 ? 88   GLU A CB    1 
ATOM   678   C  CG    . GLU A 1 88  ? 45.302  156.287 9.467   1.00 35.23 ? 88   GLU A CG    1 
ATOM   679   C  CD    . GLU A 1 88  ? 46.011  154.952 9.363   1.00 37.79 ? 88   GLU A CD    1 
ATOM   680   O  OE1   . GLU A 1 88  ? 47.247  154.941 9.169   1.00 39.39 ? 88   GLU A OE1   1 
ATOM   681   O  OE2   . GLU A 1 88  ? 45.326  153.912 9.493   1.00 41.94 ? 88   GLU A OE2   1 
ATOM   682   N  N     . ASN A 1 89  ? 46.651  159.096 13.141  1.00 25.48 ? 89   ASN A N     1 
ATOM   683   C  CA    . ASN A 1 89  ? 46.222  159.924 14.263  1.00 24.15 ? 89   ASN A CA    1 
ATOM   684   C  C     . ASN A 1 89  ? 47.325  160.708 14.962  1.00 21.69 ? 89   ASN A C     1 
ATOM   685   O  O     . ASN A 1 89  ? 47.228  160.989 16.158  1.00 19.29 ? 89   ASN A O     1 
ATOM   686   C  CB    . ASN A 1 89  ? 45.478  159.062 15.291  1.00 24.68 ? 89   ASN A CB    1 
ATOM   687   C  CG    . ASN A 1 89  ? 44.251  158.385 14.706  1.00 27.62 ? 89   ASN A CG    1 
ATOM   688   O  OD1   . ASN A 1 89  ? 44.335  157.296 14.128  1.00 29.36 ? 89   ASN A OD1   1 
ATOM   689   N  ND2   . ASN A 1 89  ? 43.103  159.037 14.839  1.00 27.64 ? 89   ASN A ND2   1 
ATOM   690   N  N     . GLY A 1 90  ? 48.362  161.067 14.209  1.00 20.31 ? 90   GLY A N     1 
ATOM   691   C  CA    . GLY A 1 90  ? 49.469  161.816 14.776  1.00 19.11 ? 90   GLY A CA    1 
ATOM   692   C  C     . GLY A 1 90  ? 49.057  163.165 15.338  1.00 19.52 ? 90   GLY A C     1 
ATOM   693   O  O     . GLY A 1 90  ? 49.642  163.641 16.316  1.00 17.05 ? 90   GLY A O     1 
ATOM   694   N  N     . ASP A 1 91  ? 48.056  163.781 14.714  1.00 19.98 ? 91   ASP A N     1 
ATOM   695   C  CA    . ASP A 1 91  ? 47.555  165.080 15.148  1.00 21.22 ? 91   ASP A CA    1 
ATOM   696   C  C     . ASP A 1 91  ? 46.570  164.964 16.300  1.00 20.26 ? 91   ASP A C     1 
ATOM   697   O  O     . ASP A 1 91  ? 46.284  165.944 16.987  1.00 22.20 ? 91   ASP A O     1 
ATOM   698   C  CB    . ASP A 1 91  ? 46.887  165.804 13.979  1.00 24.85 ? 91   ASP A CB    1 
ATOM   699   C  CG    . ASP A 1 91  ? 47.831  166.027 12.816  1.00 28.48 ? 91   ASP A CG    1 
ATOM   700   O  OD1   . ASP A 1 91  ? 49.063  165.909 13.010  1.00 30.99 ? 91   ASP A OD1   1 
ATOM   701   O  OD2   . ASP A 1 91  ? 47.341  166.331 11.706  1.00 33.71 ? 91   ASP A OD2   1 
ATOM   702   N  N     . ARG A 1 92  ? 46.042  163.767 16.507  1.00 20.03 ? 92   ARG A N     1 
ATOM   703   C  CA    . ARG A 1 92  ? 45.100  163.552 17.597  1.00 21.86 ? 92   ARG A CA    1 
ATOM   704   C  C     . ARG A 1 92  ? 45.808  163.737 18.941  1.00 20.72 ? 92   ARG A C     1 
ATOM   705   O  O     . ARG A 1 92  ? 46.957  163.341 19.108  1.00 21.80 ? 92   ARG A O     1 
ATOM   706   C  CB    . ARG A 1 92  ? 44.511  162.146 17.509  1.00 24.22 ? 92   ARG A CB    1 
ATOM   707   C  CG    . ARG A 1 92  ? 43.604  161.764 18.668  1.00 29.74 ? 92   ARG A CG    1 
ATOM   708   C  CD    . ARG A 1 92  ? 42.852  160.467 18.367  1.00 32.37 ? 92   ARG A CD    1 
ATOM   709   N  NE    . ARG A 1 92  ? 41.951  160.626 17.227  1.00 37.17 ? 92   ARG A NE    1 
ATOM   710   C  CZ    . ARG A 1 92  ? 41.222  159.647 16.703  1.00 38.49 ? 92   ARG A CZ    1 
ATOM   711   N  NH1   . ARG A 1 92  ? 41.287  158.424 17.218  1.00 41.25 ? 92   ARG A NH1   1 
ATOM   712   N  NH2   . ARG A 1 92  ? 40.428  159.893 15.666  1.00 38.71 ? 92   ARG A NH2   1 
ATOM   713   N  N     . THR A 1 93  ? 45.122  164.350 19.893  1.00 18.08 ? 93   THR A N     1 
ATOM   714   C  CA    . THR A 1 93  ? 45.696  164.568 21.209  1.00 16.91 ? 93   THR A CA    1 
ATOM   715   C  C     . THR A 1 93  ? 45.868  163.235 21.941  1.00 16.99 ? 93   THR A C     1 
ATOM   716   O  O     . THR A 1 93  ? 44.927  162.444 22.049  1.00 16.18 ? 93   THR A O     1 
ATOM   717   C  CB    . THR A 1 93  ? 44.800  165.486 22.059  1.00 16.86 ? 93   THR A CB    1 
ATOM   718   O  OG1   . THR A 1 93  ? 44.611  166.733 21.380  1.00 17.27 ? 93   THR A OG1   1 
ATOM   719   C  CG2   . THR A 1 93  ? 45.442  165.742 23.412  1.00 17.20 ? 93   THR A CG2   1 
ATOM   720   N  N     . ALA A 1 94  ? 47.070  162.990 22.443  1.00 15.15 ? 94   ALA A N     1 
ATOM   721   C  CA    . ALA A 1 94  ? 47.347  161.753 23.160  1.00 15.24 ? 94   ALA A CA    1 
ATOM   722   C  C     . ALA A 1 94  ? 47.108  161.984 24.642  1.00 14.63 ? 94   ALA A C     1 
ATOM   723   O  O     . ALA A 1 94  ? 46.432  161.199 25.312  1.00 12.56 ? 94   ALA A O     1 
ATOM   724   C  CB    . ALA A 1 94  ? 48.791  161.318 22.919  1.00 13.15 ? 94   ALA A CB    1 
ATOM   725   N  N     . ILE A 1 95  ? 47.667  163.078 25.147  1.00 14.74 ? 95   ILE A N     1 
ATOM   726   C  CA    . ILE A 1 95  ? 47.521  163.415 26.552  1.00 16.46 ? 95   ILE A CA    1 
ATOM   727   C  C     . ILE A 1 95  ? 47.053  164.839 26.795  1.00 16.69 ? 95   ILE A C     1 
ATOM   728   O  O     . ILE A 1 95  ? 47.624  165.793 26.272  1.00 17.00 ? 95   ILE A O     1 
ATOM   729   C  CB    . ILE A 1 95  ? 48.854  163.232 27.321  1.00 16.20 ? 95   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1 95  ? 49.166  161.746 27.482  1.00 16.67 ? 95   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1 95  ? 48.773  163.926 28.672  1.00 14.94 ? 95   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1 95  ? 50.476  161.482 28.197  1.00 18.03 ? 95   ILE A CD1   1 
ATOM   733   N  N     . ILE A 1 96  ? 46.007  164.973 27.599  1.00 15.84 ? 96   ILE A N     1 
ATOM   734   C  CA    . ILE A 1 96  ? 45.501  166.280 27.967  1.00 15.61 ? 96   ILE A CA    1 
ATOM   735   C  C     . ILE A 1 96  ? 46.022  166.493 29.383  1.00 17.01 ? 96   ILE A C     1 
ATOM   736   O  O     . ILE A 1 96  ? 45.703  165.721 30.293  1.00 18.47 ? 96   ILE A O     1 
ATOM   737   C  CB    . ILE A 1 96  ? 43.958  166.319 27.982  1.00 14.67 ? 96   ILE A CB    1 
ATOM   738   C  CG1   . ILE A 1 96  ? 43.427  166.211 26.544  1.00 11.64 ? 96   ILE A CG1   1 
ATOM   739   C  CG2   . ILE A 1 96  ? 43.467  167.610 28.668  1.00 14.22 ? 96   ILE A CG2   1 
ATOM   740   C  CD1   . ILE A 1 96  ? 41.926  166.315 26.430  1.00 11.42 ? 96   ILE A CD1   1 
ATOM   741   N  N     . TRP A 1 97  ? 46.847  167.515 29.571  1.00 17.13 ? 97   TRP A N     1 
ATOM   742   C  CA    . TRP A 1 97  ? 47.380  167.774 30.901  1.00 17.81 ? 97   TRP A CA    1 
ATOM   743   C  C     . TRP A 1 97  ? 46.697  168.970 31.534  1.00 17.39 ? 97   TRP A C     1 
ATOM   744   O  O     . TRP A 1 97  ? 46.701  170.066 30.984  1.00 18.94 ? 97   TRP A O     1 
ATOM   745   C  CB    . TRP A 1 97  ? 48.888  168.016 30.848  1.00 17.52 ? 97   TRP A CB    1 
ATOM   746   C  CG    . TRP A 1 97  ? 49.487  168.204 32.206  1.00 17.34 ? 97   TRP A CG    1 
ATOM   747   C  CD1   . TRP A 1 97  ? 49.650  167.250 33.170  1.00 15.99 ? 97   TRP A CD1   1 
ATOM   748   C  CD2   . TRP A 1 97  ? 49.950  169.432 32.773  1.00 17.04 ? 97   TRP A CD2   1 
ATOM   749   N  NE1   . TRP A 1 97  ? 50.184  167.809 34.305  1.00 15.28 ? 97   TRP A NE1   1 
ATOM   750   C  CE2   . TRP A 1 97  ? 50.379  169.148 34.090  1.00 16.15 ? 97   TRP A CE2   1 
ATOM   751   C  CE3   . TRP A 1 97  ? 50.044  170.749 32.296  1.00 16.22 ? 97   TRP A CE3   1 
ATOM   752   C  CZ2   . TRP A 1 97  ? 50.894  170.134 34.940  1.00 15.19 ? 97   TRP A CZ2   1 
ATOM   753   C  CZ3   . TRP A 1 97  ? 50.559  171.731 33.144  1.00 15.65 ? 97   TRP A CZ3   1 
ATOM   754   C  CH2   . TRP A 1 97  ? 50.977  171.414 34.451  1.00 12.55 ? 97   TRP A CH2   1 
ATOM   755   N  N     . GLU A 1 98  ? 46.099  168.751 32.695  1.00 17.38 ? 98   GLU A N     1 
ATOM   756   C  CA    . GLU A 1 98  ? 45.409  169.814 33.418  1.00 15.94 ? 98   GLU A CA    1 
ATOM   757   C  C     . GLU A 1 98  ? 46.217  170.115 34.676  1.00 15.74 ? 98   GLU A C     1 
ATOM   758   O  O     . GLU A 1 98  ? 46.289  169.283 35.586  1.00 14.05 ? 98   GLU A O     1 
ATOM   759   C  CB    . GLU A 1 98  ? 43.997  169.353 33.788  1.00 14.43 ? 98   GLU A CB    1 
ATOM   760   C  CG    . GLU A 1 98  ? 43.224  170.294 34.696  1.00 15.61 ? 98   GLU A CG    1 
ATOM   761   C  CD    . GLU A 1 98  ? 42.777  171.584 34.012  1.00 15.90 ? 98   GLU A CD    1 
ATOM   762   O  OE1   . GLU A 1 98  ? 42.857  171.687 32.767  1.00 15.74 ? 98   GLU A OE1   1 
ATOM   763   O  OE2   . GLU A 1 98  ? 42.322  172.495 34.735  1.00 17.31 ? 98   GLU A OE2   1 
ATOM   764   N  N     . GLY A 1 99  ? 46.832  171.295 34.720  1.00 15.56 ? 99   GLY A N     1 
ATOM   765   C  CA    . GLY A 1 99  ? 47.640  171.674 35.866  1.00 16.09 ? 99   GLY A CA    1 
ATOM   766   C  C     . GLY A 1 99  ? 46.868  171.800 37.169  1.00 15.89 ? 99   GLY A C     1 
ATOM   767   O  O     . GLY A 1 99  ? 45.642  171.814 37.170  1.00 15.08 ? 99   GLY A O     1 
ATOM   768   N  N     . ASP A 1 100 ? 47.595  171.870 38.281  1.00 17.24 ? 100  ASP A N     1 
ATOM   769   C  CA    . ASP A 1 100 ? 46.992  172.015 39.608  1.00 18.66 ? 100  ASP A CA    1 
ATOM   770   C  C     . ASP A 1 100 ? 46.199  173.318 39.608  1.00 18.89 ? 100  ASP A C     1 
ATOM   771   O  O     . ASP A 1 100 ? 45.165  173.443 40.265  1.00 17.91 ? 100  ASP A O     1 
ATOM   772   C  CB    . ASP A 1 100 ? 48.088  172.060 40.686  1.00 16.81 ? 100  ASP A CB    1 
ATOM   773   C  CG    . ASP A 1 100 ? 47.522  172.107 42.104  1.00 19.04 ? 100  ASP A CG    1 
ATOM   774   O  OD1   . ASP A 1 100 ? 46.831  171.143 42.501  1.00 19.52 ? 100  ASP A OD1   1 
ATOM   775   O  OD2   . ASP A 1 100 ? 47.772  173.107 42.821  1.00 16.20 ? 100  ASP A OD2   1 
ATOM   776   N  N     . ASP A 1 101 ? 46.710  174.280 38.849  1.00 20.35 ? 101  ASP A N     1 
ATOM   777   C  CA    . ASP A 1 101 ? 46.099  175.587 38.691  1.00 23.86 ? 101  ASP A CA    1 
ATOM   778   C  C     . ASP A 1 101 ? 45.460  175.566 37.305  1.00 24.98 ? 101  ASP A C     1 
ATOM   779   O  O     . ASP A 1 101 ? 46.157  175.412 36.297  1.00 25.05 ? 101  ASP A O     1 
ATOM   780   C  CB    . ASP A 1 101 ? 47.180  176.666 38.769  1.00 27.83 ? 101  ASP A CB    1 
ATOM   781   C  CG    . ASP A 1 101 ? 46.622  178.068 38.609  1.00 33.60 ? 101  ASP A CG    1 
ATOM   782   O  OD1   . ASP A 1 101 ? 45.929  178.327 37.596  1.00 35.48 ? 101  ASP A OD1   1 
ATOM   783   O  OD2   . ASP A 1 101 ? 46.884  178.915 39.494  1.00 37.77 ? 101  ASP A OD2   1 
ATOM   784   N  N     . THR A 1 102 ? 44.142  175.731 37.246  1.00 25.92 ? 102  THR A N     1 
ATOM   785   C  CA    . THR A 1 102 ? 43.426  175.679 35.967  1.00 27.68 ? 102  THR A CA    1 
ATOM   786   C  C     . THR A 1 102 ? 43.952  176.553 34.828  1.00 27.88 ? 102  THR A C     1 
ATOM   787   O  O     . THR A 1 102 ? 43.710  176.254 33.657  1.00 27.02 ? 102  THR A O     1 
ATOM   788   C  CB    . THR A 1 102 ? 41.926  175.985 36.144  1.00 29.00 ? 102  THR A CB    1 
ATOM   789   O  OG1   . THR A 1 102 ? 41.221  175.566 34.967  1.00 30.99 ? 102  THR A OG1   1 
ATOM   790   C  CG2   . THR A 1 102 ? 41.703  177.480 36.370  1.00 28.52 ? 102  THR A CG2   1 
ATOM   791   N  N     . SER A 1 103 ? 44.667  177.628 35.149  1.00 28.19 ? 103  SER A N     1 
ATOM   792   C  CA    . SER A 1 103 ? 45.197  178.490 34.098  1.00 27.94 ? 103  SER A CA    1 
ATOM   793   C  C     . SER A 1 103 ? 46.311  177.772 33.340  1.00 27.66 ? 103  SER A C     1 
ATOM   794   O  O     . SER A 1 103 ? 46.804  178.275 32.334  1.00 28.65 ? 103  SER A O     1 
ATOM   795   C  CB    . SER A 1 103 ? 45.743  179.791 34.689  1.00 26.86 ? 103  SER A CB    1 
ATOM   796   O  OG    . SER A 1 103 ? 46.917  179.554 35.441  1.00 28.24 ? 103  SER A OG    1 
ATOM   797   N  N     . GLN A 1 104 ? 46.702  176.598 33.828  1.00 26.56 ? 104  GLN A N     1 
ATOM   798   C  CA    . GLN A 1 104 ? 47.770  175.826 33.202  1.00 28.02 ? 104  GLN A CA    1 
ATOM   799   C  C     . GLN A 1 104 ? 47.276  174.512 32.581  1.00 28.17 ? 104  GLN A C     1 
ATOM   800   O  O     . GLN A 1 104 ? 46.680  173.676 33.266  1.00 28.79 ? 104  GLN A O     1 
ATOM   801   C  CB    . GLN A 1 104 ? 48.857  175.513 34.235  1.00 29.64 ? 104  GLN A CB    1 
ATOM   802   C  CG    . GLN A 1 104 ? 49.458  176.722 34.939  1.00 30.55 ? 104  GLN A CG    1 
ATOM   803   C  CD    . GLN A 1 104 ? 50.073  177.717 33.969  1.00 32.74 ? 104  GLN A CD    1 
ATOM   804   O  OE1   . GLN A 1 104 ? 50.844  177.343 33.079  1.00 31.38 ? 104  GLN A OE1   1 
ATOM   805   N  NE2   . GLN A 1 104 ? 49.739  178.995 34.140  1.00 33.31 ? 104  GLN A NE2   1 
ATOM   806   N  N     . SER A 1 105 ? 47.524  174.327 31.288  1.00 27.19 ? 105  SER A N     1 
ATOM   807   C  CA    . SER A 1 105 ? 47.110  173.100 30.606  1.00 27.29 ? 105  SER A CA    1 
ATOM   808   C  C     . SER A 1 105 ? 47.923  172.865 29.340  1.00 26.27 ? 105  SER A C     1 
ATOM   809   O  O     . SER A 1 105 ? 48.602  173.762 28.848  1.00 26.42 ? 105  SER A O     1 
ATOM   810   C  CB    . SER A 1 105 ? 45.616  173.142 30.246  1.00 28.97 ? 105  SER A CB    1 
ATOM   811   O  OG    . SER A 1 105 ? 45.360  174.040 29.177  1.00 31.24 ? 105  SER A OG    1 
ATOM   812   N  N     . LYS A 1 106 ? 47.849  171.645 28.821  1.00 25.47 ? 106  LYS A N     1 
ATOM   813   C  CA    . LYS A 1 106 ? 48.572  171.265 27.611  1.00 23.64 ? 106  LYS A CA    1 
ATOM   814   C  C     . LYS A 1 106 ? 47.822  170.199 26.839  1.00 22.90 ? 106  LYS A C     1 
ATOM   815   O  O     . LYS A 1 106 ? 47.098  169.389 27.417  1.00 21.76 ? 106  LYS A O     1 
ATOM   816   C  CB    . LYS A 1 106 ? 49.953  170.693 27.945  1.00 22.82 ? 106  LYS A CB    1 
ATOM   817   C  CG    . LYS A 1 106 ? 51.031  171.691 28.294  1.00 24.57 ? 106  LYS A CG    1 
ATOM   818   C  CD    . LYS A 1 106 ? 52.335  170.963 28.619  1.00 24.96 ? 106  LYS A CD    1 
ATOM   819   C  CE    . LYS A 1 106 ? 53.444  171.941 28.967  1.00 28.52 ? 106  LYS A CE    1 
ATOM   820   N  NZ    . LYS A 1 106 ? 54.704  171.238 29.321  1.00 28.64 ? 106  LYS A NZ    1 
ATOM   821   N  N     . HIS A 1 107 ? 48.015  170.206 25.528  1.00 22.72 ? 107  HIS A N     1 
ATOM   822   C  CA    . HIS A 1 107 ? 47.423  169.215 24.645  1.00 23.76 ? 107  HIS A CA    1 
ATOM   823   C  C     . HIS A 1 107 ? 48.581  168.629 23.839  1.00 23.47 ? 107  HIS A C     1 
ATOM   824   O  O     . HIS A 1 107 ? 49.042  169.221 22.860  1.00 22.84 ? 107  HIS A O     1 
ATOM   825   C  CB    . HIS A 1 107 ? 46.398  169.848 23.703  1.00 22.74 ? 107  HIS A CB    1 
ATOM   826   C  CG    . HIS A 1 107 ? 45.065  170.095 24.338  1.00 25.98 ? 107  HIS A CG    1 
ATOM   827   N  ND1   . HIS A 1 107 ? 44.863  171.063 25.301  1.00 25.85 ? 107  HIS A ND1   1 
ATOM   828   C  CD2   . HIS A 1 107 ? 43.866  169.489 24.158  1.00 24.85 ? 107  HIS A CD2   1 
ATOM   829   C  CE1   . HIS A 1 107 ? 43.599  171.042 25.686  1.00 24.27 ? 107  HIS A CE1   1 
ATOM   830   N  NE2   . HIS A 1 107 ? 42.973  170.096 25.009  1.00 24.32 ? 107  HIS A NE2   1 
ATOM   831   N  N     . ILE A 1 108 ? 49.068  167.472 24.270  1.00 22.95 ? 108  ILE A N     1 
ATOM   832   C  CA    . ILE A 1 108 ? 50.178  166.818 23.595  1.00 19.64 ? 108  ILE A CA    1 
ATOM   833   C  C     . ILE A 1 108 ? 49.641  165.788 22.612  1.00 19.62 ? 108  ILE A C     1 
ATOM   834   O  O     . ILE A 1 108 ? 48.962  164.830 22.999  1.00 18.24 ? 108  ILE A O     1 
ATOM   835   C  CB    . ILE A 1 108 ? 51.114  166.150 24.623  1.00 19.71 ? 108  ILE A CB    1 
ATOM   836   C  CG1   . ILE A 1 108 ? 51.631  167.210 25.599  1.00 16.63 ? 108  ILE A CG1   1 
ATOM   837   C  CG2   . ILE A 1 108 ? 52.285  165.468 23.921  1.00 19.30 ? 108  ILE A CG2   1 
ATOM   838   C  CD1   . ILE A 1 108 ? 52.434  166.651 26.740  1.00 17.17 ? 108  ILE A CD1   1 
ATOM   839   N  N     . SER A 1 109 ? 49.936  166.006 21.333  1.00 19.60 ? 109  SER A N     1 
ATOM   840   C  CA    . SER A 1 109 ? 49.486  165.115 20.265  1.00 18.14 ? 109  SER A CA    1 
ATOM   841   C  C     . SER A 1 109 ? 50.325  163.851 20.252  1.00 17.67 ? 109  SER A C     1 
ATOM   842   O  O     . SER A 1 109 ? 51.414  163.819 20.821  1.00 20.80 ? 109  SER A O     1 
ATOM   843   C  CB    . SER A 1 109 ? 49.623  165.801 18.909  1.00 15.67 ? 109  SER A CB    1 
ATOM   844   O  OG    . SER A 1 109 ? 50.989  165.921 18.553  1.00 14.46 ? 109  SER A OG    1 
ATOM   845   N  N     . TYR A 1 110 ? 49.823  162.810 19.602  1.00 16.79 ? 110  TYR A N     1 
ATOM   846   C  CA    . TYR A 1 110 ? 50.576  161.571 19.531  1.00 16.63 ? 110  TYR A CA    1 
ATOM   847   C  C     . TYR A 1 110 ? 51.926  161.812 18.872  1.00 17.53 ? 110  TYR A C     1 
ATOM   848   O  O     . TYR A 1 110 ? 52.945  161.283 19.320  1.00 15.42 ? 110  TYR A O     1 
ATOM   849   C  CB    . TYR A 1 110 ? 49.797  160.500 18.765  1.00 15.35 ? 110  TYR A CB    1 
ATOM   850   C  CG    . TYR A 1 110 ? 48.936  159.646 19.672  1.00 12.87 ? 110  TYR A CG    1 
ATOM   851   C  CD1   . TYR A 1 110 ? 47.589  159.964 19.907  1.00 12.27 ? 110  TYR A CD1   1 
ATOM   852   C  CD2   . TYR A 1 110 ? 49.477  158.546 20.335  1.00 11.19 ? 110  TYR A CD2   1 
ATOM   853   C  CE1   . TYR A 1 110 ? 46.803  159.201 20.785  1.00 10.22 ? 110  TYR A CE1   1 
ATOM   854   C  CE2   . TYR A 1 110 ? 48.704  157.777 21.214  1.00 9.79  ? 110  TYR A CE2   1 
ATOM   855   C  CZ    . TYR A 1 110 ? 47.372  158.107 21.433  1.00 10.27 ? 110  TYR A CZ    1 
ATOM   856   O  OH    . TYR A 1 110 ? 46.612  157.332 22.281  1.00 9.65  ? 110  TYR A OH    1 
ATOM   857   N  N     . ARG A 1 111 ? 51.935  162.626 17.821  1.00 19.14 ? 111  ARG A N     1 
ATOM   858   C  CA    . ARG A 1 111 ? 53.173  162.924 17.119  1.00 20.59 ? 111  ARG A CA    1 
ATOM   859   C  C     . ARG A 1 111 ? 54.158  163.607 18.059  1.00 20.33 ? 111  ARG A C     1 
ATOM   860   O  O     . ARG A 1 111 ? 55.356  163.307 18.038  1.00 18.65 ? 111  ARG A O     1 
ATOM   861   C  CB    . ARG A 1 111 ? 52.894  163.802 15.899  1.00 22.91 ? 111  ARG A CB    1 
ATOM   862   C  CG    . ARG A 1 111 ? 54.118  164.084 15.046  1.00 26.29 ? 111  ARG A CG    1 
ATOM   863   C  CD    . ARG A 1 111 ? 53.727  164.238 13.584  1.00 31.40 ? 111  ARG A CD    1 
ATOM   864   N  NE    . ARG A 1 111 ? 53.299  162.967 13.003  1.00 35.96 ? 111  ARG A NE    1 
ATOM   865   C  CZ    . ARG A 1 111 ? 52.212  162.814 12.248  1.00 40.45 ? 111  ARG A CZ    1 
ATOM   866   N  NH1   . ARG A 1 111 ? 51.425  163.855 11.979  1.00 41.84 ? 111  ARG A NH1   1 
ATOM   867   N  NH2   . ARG A 1 111 ? 51.911  161.619 11.753  1.00 41.51 ? 111  ARG A NH2   1 
ATOM   868   N  N     . GLU A 1 112 ? 53.656  164.512 18.894  1.00 20.88 ? 112  GLU A N     1 
ATOM   869   C  CA    . GLU A 1 112 ? 54.517  165.206 19.850  1.00 20.72 ? 112  GLU A CA    1 
ATOM   870   C  C     . GLU A 1 112 ? 55.022  164.253 20.935  1.00 19.75 ? 112  GLU A C     1 
ATOM   871   O  O     . GLU A 1 112 ? 56.226  164.185 21.200  1.00 19.90 ? 112  GLU A O     1 
ATOM   872   C  CB    . GLU A 1 112 ? 53.772  166.373 20.507  1.00 22.68 ? 112  GLU A CB    1 
ATOM   873   C  CG    . GLU A 1 112 ? 53.483  167.527 19.575  1.00 28.49 ? 112  GLU A CG    1 
ATOM   874   C  CD    . GLU A 1 112 ? 52.654  168.628 20.240  1.00 31.75 ? 112  GLU A CD    1 
ATOM   875   O  OE1   . GLU A 1 112 ? 51.486  168.356 20.621  1.00 29.50 ? 112  GLU A OE1   1 
ATOM   876   O  OE2   . GLU A 1 112 ? 53.178  169.761 20.383  1.00 32.52 ? 112  GLU A OE2   1 
ATOM   877   N  N     . LEU A 1 113 ? 54.107  163.514 21.557  1.00 17.11 ? 113  LEU A N     1 
ATOM   878   C  CA    . LEU A 1 113 ? 54.492  162.584 22.613  1.00 15.93 ? 113  LEU A CA    1 
ATOM   879   C  C     . LEU A 1 113 ? 55.549  161.616 22.089  1.00 15.88 ? 113  LEU A C     1 
ATOM   880   O  O     . LEU A 1 113 ? 56.543  161.327 22.763  1.00 14.32 ? 113  LEU A O     1 
ATOM   881   C  CB    . LEU A 1 113 ? 53.270  161.801 23.103  1.00 15.03 ? 113  LEU A CB    1 
ATOM   882   C  CG    . LEU A 1 113 ? 53.488  160.873 24.302  1.00 14.36 ? 113  LEU A CG    1 
ATOM   883   C  CD1   . LEU A 1 113 ? 53.996  161.671 25.498  1.00 11.45 ? 113  LEU A CD1   1 
ATOM   884   C  CD2   . LEU A 1 113 ? 52.185  160.183 24.645  1.00 14.31 ? 113  LEU A CD2   1 
ATOM   885   N  N     . HIS A 1 114 ? 55.319  161.124 20.876  1.00 16.25 ? 114  HIS A N     1 
ATOM   886   C  CA    . HIS A 1 114 ? 56.230  160.192 20.234  1.00 15.21 ? 114  HIS A CA    1 
ATOM   887   C  C     . HIS A 1 114 ? 57.594  160.842 20.062  1.00 16.35 ? 114  HIS A C     1 
ATOM   888   O  O     . HIS A 1 114 ? 58.617  160.244 20.394  1.00 13.92 ? 114  HIS A O     1 
ATOM   889   C  CB    . HIS A 1 114 ? 55.656  159.756 18.882  1.00 15.76 ? 114  HIS A CB    1 
ATOM   890   C  CG    . HIS A 1 114 ? 56.631  159.022 18.015  1.00 16.10 ? 114  HIS A CG    1 
ATOM   891   N  ND1   . HIS A 1 114 ? 57.476  159.665 17.137  1.00 18.19 ? 114  HIS A ND1   1 
ATOM   892   C  CD2   . HIS A 1 114 ? 56.902  157.701 17.899  1.00 14.70 ? 114  HIS A CD2   1 
ATOM   893   C  CE1   . HIS A 1 114 ? 58.224  158.772 16.515  1.00 15.18 ? 114  HIS A CE1   1 
ATOM   894   N  NE2   . HIS A 1 114 ? 57.895  157.572 16.960  1.00 16.99 ? 114  HIS A NE2   1 
ATOM   895   N  N     . ARG A 1 115 ? 57.609  162.075 19.561  1.00 16.09 ? 115  ARG A N     1 
ATOM   896   C  CA    . ARG A 1 115 ? 58.874  162.767 19.372  1.00 17.24 ? 115  ARG A CA    1 
ATOM   897   C  C     . ARG A 1 115 ? 59.644  162.874 20.692  1.00 17.37 ? 115  ARG A C     1 
ATOM   898   O  O     . ARG A 1 115 ? 60.836  162.583 20.738  1.00 16.12 ? 115  ARG A O     1 
ATOM   899   C  CB    . ARG A 1 115 ? 58.652  164.164 18.790  1.00 20.83 ? 115  ARG A CB    1 
ATOM   900   C  CG    . ARG A 1 115 ? 59.944  164.852 18.372  1.00 23.43 ? 115  ARG A CG    1 
ATOM   901   C  CD    . ARG A 1 115 ? 59.703  166.269 17.868  1.00 29.68 ? 115  ARG A CD    1 
ATOM   902   N  NE    . ARG A 1 115 ? 60.895  166.811 17.211  1.00 34.93 ? 115  ARG A NE    1 
ATOM   903   C  CZ    . ARG A 1 115 ? 61.296  166.473 15.985  1.00 36.67 ? 115  ARG A CZ    1 
ATOM   904   N  NH1   . ARG A 1 115 ? 60.596  165.597 15.272  1.00 37.28 ? 115  ARG A NH1   1 
ATOM   905   N  NH2   . ARG A 1 115 ? 62.402  167.005 15.475  1.00 37.33 ? 115  ARG A NH2   1 
ATOM   906   N  N     . ASP A 1 116 ? 58.970  163.288 21.763  1.00 16.70 ? 116  ASP A N     1 
ATOM   907   C  CA    . ASP A 1 116 ? 59.643  163.401 23.052  1.00 17.81 ? 116  ASP A CA    1 
ATOM   908   C  C     . ASP A 1 116 ? 60.088  162.060 23.628  1.00 16.66 ? 116  ASP A C     1 
ATOM   909   O  O     . ASP A 1 116 ? 61.138  161.977 24.260  1.00 17.56 ? 116  ASP A O     1 
ATOM   910   C  CB    . ASP A 1 116 ? 58.769  164.124 24.082  1.00 20.67 ? 116  ASP A CB    1 
ATOM   911   C  CG    . ASP A 1 116 ? 58.791  165.637 23.909  1.00 25.30 ? 116  ASP A CG    1 
ATOM   912   O  OD1   . ASP A 1 116 ? 59.847  166.181 23.495  1.00 24.23 ? 116  ASP A OD1   1 
ATOM   913   O  OD2   . ASP A 1 116 ? 57.757  166.283 24.203  1.00 28.52 ? 116  ASP A OD2   1 
ATOM   914   N  N     . VAL A 1 117 ? 59.293  161.016 23.417  1.00 15.71 ? 117  VAL A N     1 
ATOM   915   C  CA    . VAL A 1 117 ? 59.658  159.699 23.922  1.00 12.68 ? 117  VAL A CA    1 
ATOM   916   C  C     . VAL A 1 117 ? 60.912  159.228 23.193  1.00 12.82 ? 117  VAL A C     1 
ATOM   917   O  O     . VAL A 1 117 ? 61.802  158.634 23.802  1.00 12.72 ? 117  VAL A O     1 
ATOM   918   C  CB    . VAL A 1 117 ? 58.506  158.676 23.741  1.00 10.74 ? 117  VAL A CB    1 
ATOM   919   C  CG1   . VAL A 1 117 ? 59.008  157.252 24.003  1.00 9.62  ? 117  VAL A CG1   1 
ATOM   920   C  CG2   . VAL A 1 117 ? 57.392  158.990 24.737  1.00 10.49 ? 117  VAL A CG2   1 
ATOM   921   N  N     . CYS A 1 118 ? 60.979  159.511 21.894  1.00 13.37 ? 118  CYS A N     1 
ATOM   922   C  CA    . CYS A 1 118 ? 62.142  159.135 21.097  1.00 13.94 ? 118  CYS A CA    1 
ATOM   923   C  C     . CYS A 1 118 ? 63.382  159.868 21.601  1.00 14.76 ? 118  CYS A C     1 
ATOM   924   O  O     . CYS A 1 118 ? 64.421  159.253 21.818  1.00 16.89 ? 118  CYS A O     1 
ATOM   925   C  CB    . CYS A 1 118 ? 61.918  159.447 19.614  1.00 13.96 ? 118  CYS A CB    1 
ATOM   926   S  SG    . CYS A 1 118 ? 60.881  158.243 18.762  1.00 15.05 ? 118  CYS A SG    1 
ATOM   927   N  N     . ARG A 1 119 ? 63.262  161.175 21.806  1.00 15.61 ? 119  ARG A N     1 
ATOM   928   C  CA    . ARG A 1 119 ? 64.388  161.955 22.307  1.00 17.38 ? 119  ARG A CA    1 
ATOM   929   C  C     . ARG A 1 119 ? 64.828  161.491 23.681  1.00 17.55 ? 119  ARG A C     1 
ATOM   930   O  O     . ARG A 1 119 ? 66.021  161.407 23.957  1.00 19.24 ? 119  ARG A O     1 
ATOM   931   C  CB    . ARG A 1 119 ? 64.052  163.446 22.373  1.00 18.79 ? 119  ARG A CB    1 
ATOM   932   C  CG    . ARG A 1 119 ? 64.088  164.135 21.031  1.00 22.47 ? 119  ARG A CG    1 
ATOM   933   C  CD    . ARG A 1 119 ? 64.302  165.626 21.201  1.00 26.54 ? 119  ARG A CD    1 
ATOM   934   N  NE    . ARG A 1 119 ? 63.185  166.267 21.878  1.00 29.13 ? 119  ARG A NE    1 
ATOM   935   C  CZ    . ARG A 1 119 ? 63.208  167.518 22.330  1.00 32.21 ? 119  ARG A CZ    1 
ATOM   936   N  NH1   . ARG A 1 119 ? 64.300  168.260 22.176  1.00 31.77 ? 119  ARG A NH1   1 
ATOM   937   N  NH2   . ARG A 1 119 ? 62.139  168.032 22.934  1.00 31.55 ? 119  ARG A NH2   1 
ATOM   938   N  N     . PHE A 1 120 ? 63.873  161.185 24.552  1.00 17.08 ? 120  PHE A N     1 
ATOM   939   C  CA    . PHE A 1 120 ? 64.245  160.739 25.887  1.00 16.05 ? 120  PHE A CA    1 
ATOM   940   C  C     . PHE A 1 120 ? 64.837  159.331 25.856  1.00 14.88 ? 120  PHE A C     1 
ATOM   941   O  O     . PHE A 1 120 ? 65.709  158.998 26.661  1.00 13.25 ? 120  PHE A O     1 
ATOM   942   C  CB    . PHE A 1 120 ? 63.051  160.782 26.842  1.00 15.98 ? 120  PHE A CB    1 
ATOM   943   C  CG    . PHE A 1 120 ? 63.454  160.824 28.285  1.00 16.54 ? 120  PHE A CG    1 
ATOM   944   C  CD1   . PHE A 1 120 ? 64.131  161.932 28.795  1.00 15.37 ? 120  PHE A CD1   1 
ATOM   945   C  CD2   . PHE A 1 120 ? 63.207  159.741 29.123  1.00 14.11 ? 120  PHE A CD2   1 
ATOM   946   C  CE1   . PHE A 1 120 ? 64.557  161.958 30.120  1.00 17.30 ? 120  PHE A CE1   1 
ATOM   947   C  CE2   . PHE A 1 120 ? 63.626  159.753 30.441  1.00 17.45 ? 120  PHE A CE2   1 
ATOM   948   C  CZ    . PHE A 1 120 ? 64.304  160.865 30.946  1.00 16.87 ? 120  PHE A CZ    1 
ATOM   949   N  N     . ALA A 1 121 ? 64.368  158.506 24.926  1.00 13.73 ? 121  ALA A N     1 
ATOM   950   C  CA    . ALA A 1 121 ? 64.906  157.155 24.805  1.00 12.70 ? 121  ALA A CA    1 
ATOM   951   C  C     . ALA A 1 121 ? 66.393  157.281 24.460  1.00 12.83 ? 121  ALA A C     1 
ATOM   952   O  O     . ALA A 1 121 ? 67.243  156.600 25.052  1.00 10.81 ? 121  ALA A O     1 
ATOM   953   C  CB    . ALA A 1 121 ? 64.169  156.381 23.709  1.00 7.67  ? 121  ALA A CB    1 
ATOM   954   N  N     . ASN A 1 122 ? 66.714  158.158 23.508  1.00 13.41 ? 122  ASN A N     1 
ATOM   955   C  CA    . ASN A 1 122 ? 68.114  158.351 23.126  1.00 14.36 ? 122  ASN A CA    1 
ATOM   956   C  C     . ASN A 1 122 ? 68.894  158.925 24.296  1.00 13.63 ? 122  ASN A C     1 
ATOM   957   O  O     . ASN A 1 122 ? 70.077  158.626 24.459  1.00 13.78 ? 122  ASN A O     1 
ATOM   958   C  CB    . ASN A 1 122 ? 68.248  159.266 21.900  1.00 13.60 ? 122  ASN A CB    1 
ATOM   959   C  CG    . ASN A 1 122 ? 67.814  158.579 20.603  1.00 17.52 ? 122  ASN A CG    1 
ATOM   960   O  OD1   . ASN A 1 122 ? 68.119  157.404 20.373  1.00 19.89 ? 122  ASN A OD1   1 
ATOM   961   N  ND2   . ASN A 1 122 ? 67.111  159.314 19.748  1.00 17.57 ? 122  ASN A ND2   1 
ATOM   962   N  N     . THR A 1 123 ? 68.226  159.737 25.115  1.00 12.56 ? 123  THR A N     1 
ATOM   963   C  CA    . THR A 1 123 ? 68.876  160.330 26.277  1.00 13.90 ? 123  THR A CA    1 
ATOM   964   C  C     . THR A 1 123 ? 69.343  159.241 27.245  1.00 14.10 ? 123  THR A C     1 
ATOM   965   O  O     . THR A 1 123 ? 70.482  159.266 27.716  1.00 15.18 ? 123  THR A O     1 
ATOM   966   C  CB    . THR A 1 123 ? 67.928  161.281 27.039  1.00 13.49 ? 123  THR A CB    1 
ATOM   967   O  OG1   . THR A 1 123 ? 67.778  162.499 26.302  1.00 15.17 ? 123  THR A OG1   1 
ATOM   968   C  CG2   . THR A 1 123 ? 68.491  161.602 28.425  1.00 11.71 ? 123  THR A CG2   1 
ATOM   969   N  N     . LEU A 1 124 ? 68.457  158.295 27.536  1.00 13.73 ? 124  LEU A N     1 
ATOM   970   C  CA    . LEU A 1 124 ? 68.768  157.198 28.446  1.00 15.34 ? 124  LEU A CA    1 
ATOM   971   C  C     . LEU A 1 124 ? 69.938  156.382 27.909  1.00 16.44 ? 124  LEU A C     1 
ATOM   972   O  O     . LEU A 1 124 ? 70.900  156.093 28.629  1.00 16.70 ? 124  LEU A O     1 
ATOM   973   C  CB    . LEU A 1 124 ? 67.544  156.294 28.619  1.00 14.33 ? 124  LEU A CB    1 
ATOM   974   C  CG    . LEU A 1 124 ? 66.275  156.972 29.147  1.00 15.52 ? 124  LEU A CG    1 
ATOM   975   C  CD1   . LEU A 1 124 ? 65.106  155.993 29.102  1.00 15.60 ? 124  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A 1 124 ? 66.508  157.470 30.561  1.00 13.02 ? 124  LEU A CD2   1 
ATOM   977   N  N     . LEU A 1 125 ? 69.854  156.028 26.632  1.00 16.67 ? 125  LEU A N     1 
ATOM   978   C  CA    . LEU A 1 125 ? 70.892  155.244 25.989  1.00 17.83 ? 125  LEU A CA    1 
ATOM   979   C  C     . LEU A 1 125 ? 72.236  155.971 26.015  1.00 18.38 ? 125  LEU A C     1 
ATOM   980   O  O     . LEU A 1 125 ? 73.260  155.380 26.373  1.00 18.85 ? 125  LEU A O     1 
ATOM   981   C  CB    . LEU A 1 125 ? 70.483  154.910 24.547  1.00 17.98 ? 125  LEU A CB    1 
ATOM   982   C  CG    . LEU A 1 125 ? 69.261  153.989 24.364  1.00 19.52 ? 125  LEU A CG    1 
ATOM   983   C  CD1   . LEU A 1 125 ? 68.857  153.931 22.906  1.00 17.23 ? 125  LEU A CD1   1 
ATOM   984   C  CD2   . LEU A 1 125 ? 69.581  152.597 24.872  1.00 18.83 ? 125  LEU A CD2   1 
ATOM   985   N  N     . ASP A 1 126 ? 72.247  157.250 25.653  1.00 18.53 ? 126  ASP A N     1 
ATOM   986   C  CA    . ASP A 1 126 ? 73.500  157.995 25.665  1.00 20.31 ? 126  ASP A CA    1 
ATOM   987   C  C     . ASP A 1 126 ? 74.055  158.087 27.081  1.00 21.17 ? 126  ASP A C     1 
ATOM   988   O  O     . ASP A 1 126 ? 75.258  158.257 27.272  1.00 24.32 ? 126  ASP A O     1 
ATOM   989   C  CB    . ASP A 1 126 ? 73.321  159.410 25.105  1.00 19.80 ? 126  ASP A CB    1 
ATOM   990   C  CG    . ASP A 1 126 ? 72.828  159.413 23.679  1.00 24.21 ? 126  ASP A CG    1 
ATOM   991   O  OD1   . ASP A 1 126 ? 73.219  158.512 22.908  1.00 26.43 ? 126  ASP A OD1   1 
ATOM   992   O  OD2   . ASP A 1 126 ? 72.053  160.324 23.322  1.00 26.44 ? 126  ASP A OD2   1 
ATOM   993   N  N     . LEU A 1 127 ? 73.188  157.966 28.077  1.00 21.63 ? 127  LEU A N     1 
ATOM   994   C  CA    . LEU A 1 127 ? 73.642  158.051 29.458  1.00 22.73 ? 127  LEU A CA    1 
ATOM   995   C  C     . LEU A 1 127 ? 74.201  156.715 29.931  1.00 22.26 ? 127  LEU A C     1 
ATOM   996   O  O     . LEU A 1 127 ? 74.896  156.649 30.948  1.00 23.39 ? 127  LEU A O     1 
ATOM   997   C  CB    . LEU A 1 127 ? 72.494  158.489 30.367  1.00 23.90 ? 127  LEU A CB    1 
ATOM   998   C  CG    . LEU A 1 127 ? 72.924  159.223 31.636  1.00 25.40 ? 127  LEU A CG    1 
ATOM   999   C  CD1   . LEU A 1 127 ? 73.677  160.488 31.242  1.00 24.97 ? 127  LEU A CD1   1 
ATOM   1000  C  CD2   . LEU A 1 127 ? 71.706  159.580 32.476  1.00 25.89 ? 127  LEU A CD2   1 
ATOM   1001  N  N     . GLY A 1 128 ? 73.886  155.650 29.195  1.00 21.00 ? 128  GLY A N     1 
ATOM   1002  C  CA    . GLY A 1 128 ? 74.383  154.330 29.549  1.00 16.96 ? 128  GLY A CA    1 
ATOM   1003  C  C     . GLY A 1 128 ? 73.325  153.313 29.935  1.00 18.24 ? 128  GLY A C     1 
ATOM   1004  O  O     . GLY A 1 128 ? 73.659  152.184 30.289  1.00 16.98 ? 128  GLY A O     1 
ATOM   1005  N  N     . ILE A 1 129 ? 72.054  153.707 29.873  1.00 17.42 ? 129  ILE A N     1 
ATOM   1006  C  CA    . ILE A 1 129 ? 70.964  152.808 30.219  1.00 16.14 ? 129  ILE A CA    1 
ATOM   1007  C  C     . ILE A 1 129 ? 70.794  151.781 29.106  1.00 17.59 ? 129  ILE A C     1 
ATOM   1008  O  O     . ILE A 1 129 ? 70.744  152.136 27.926  1.00 18.84 ? 129  ILE A O     1 
ATOM   1009  C  CB    . ILE A 1 129 ? 69.624  153.569 30.386  1.00 16.67 ? 129  ILE A CB    1 
ATOM   1010  C  CG1   . ILE A 1 129 ? 69.775  154.689 31.418  1.00 16.32 ? 129  ILE A CG1   1 
ATOM   1011  C  CG2   . ILE A 1 129 ? 68.523  152.598 30.823  1.00 14.66 ? 129  ILE A CG2   1 
ATOM   1012  C  CD1   . ILE A 1 129 ? 70.129  154.212 32.809  1.00 17.31 ? 129  ILE A CD1   1 
ATOM   1013  N  N     . LYS A 1 130 ? 70.706  150.509 29.483  1.00 16.97 ? 130  LYS A N     1 
ATOM   1014  C  CA    . LYS A 1 130 ? 70.537  149.434 28.512  1.00 18.45 ? 130  LYS A CA    1 
ATOM   1015  C  C     . LYS A 1 130 ? 69.327  148.570 28.868  1.00 17.83 ? 130  LYS A C     1 
ATOM   1016  O  O     . LYS A 1 130 ? 68.799  148.645 29.979  1.00 16.11 ? 130  LYS A O     1 
ATOM   1017  C  CB    . LYS A 1 130 ? 71.790  148.546 28.461  1.00 21.37 ? 130  LYS A CB    1 
ATOM   1018  C  CG    . LYS A 1 130 ? 73.017  149.201 27.845  1.00 25.23 ? 130  LYS A CG    1 
ATOM   1019  C  CD    . LYS A 1 130 ? 74.218  148.273 27.896  1.00 26.80 ? 130  LYS A CD    1 
ATOM   1020  C  CE    . LYS A 1 130 ? 74.121  147.133 26.884  1.00 29.89 ? 130  LYS A CE    1 
ATOM   1021  N  NZ    . LYS A 1 130 ? 74.351  147.589 25.466  1.00 31.03 ? 130  LYS A NZ    1 
ATOM   1022  N  N     . LYS A 1 131 ? 68.901  147.749 27.914  1.00 17.32 ? 131  LYS A N     1 
ATOM   1023  C  CA    . LYS A 1 131 ? 67.774  146.854 28.116  1.00 16.83 ? 131  LYS A CA    1 
ATOM   1024  C  C     . LYS A 1 131 ? 68.041  146.013 29.353  1.00 17.49 ? 131  LYS A C     1 
ATOM   1025  O  O     . LYS A 1 131 ? 69.117  145.434 29.487  1.00 19.14 ? 131  LYS A O     1 
ATOM   1026  C  CB    . LYS A 1 131 ? 67.608  145.942 26.900  1.00 17.58 ? 131  LYS A CB    1 
ATOM   1027  C  CG    . LYS A 1 131 ? 66.568  144.834 27.079  1.00 18.43 ? 131  LYS A CG    1 
ATOM   1028  C  CD    . LYS A 1 131 ? 66.418  144.017 25.819  1.00 15.95 ? 131  LYS A CD    1 
ATOM   1029  C  CE    . LYS A 1 131 ? 65.367  142.944 25.984  1.00 16.51 ? 131  LYS A CE    1 
ATOM   1030  N  NZ    . LYS A 1 131 ? 65.052  142.297 24.681  1.00 20.39 ? 131  LYS A NZ    1 
ATOM   1031  N  N     . GLY A 1 132 ? 67.071  145.952 30.259  1.00 17.56 ? 132  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1 132 ? 67.248  145.166 31.465  1.00 17.09 ? 132  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1 132 ? 67.570  145.993 32.696  1.00 18.19 ? 132  GLY A C     1 
ATOM   1034  O  O     . GLY A 1 132 ? 67.356  145.539 33.814  1.00 17.82 ? 132  GLY A O     1 
ATOM   1035  N  N     . ASP A 1 133 ? 68.099  147.198 32.514  1.00 17.86 ? 133  ASP A N     1 
ATOM   1036  C  CA    . ASP A 1 133 ? 68.405  148.025 33.673  1.00 18.48 ? 133  ASP A CA    1 
ATOM   1037  C  C     . ASP A 1 133 ? 67.112  148.525 34.307  1.00 18.22 ? 133  ASP A C     1 
ATOM   1038  O  O     . ASP A 1 133 ? 66.087  148.645 33.634  1.00 18.97 ? 133  ASP A O     1 
ATOM   1039  C  CB    . ASP A 1 133 ? 69.281  149.222 33.288  1.00 18.71 ? 133  ASP A CB    1 
ATOM   1040  C  CG    . ASP A 1 133 ? 70.708  148.820 32.938  1.00 20.07 ? 133  ASP A CG    1 
ATOM   1041  O  OD1   . ASP A 1 133 ? 71.139  147.715 33.342  1.00 19.35 ? 133  ASP A OD1   1 
ATOM   1042  O  OD2   . ASP A 1 133 ? 71.403  149.619 32.270  1.00 18.15 ? 133  ASP A OD2   1 
ATOM   1043  N  N     . VAL A 1 134 ? 67.170  148.793 35.607  1.00 17.53 ? 134  VAL A N     1 
ATOM   1044  C  CA    . VAL A 1 134 ? 66.023  149.295 36.350  1.00 17.19 ? 134  VAL A CA    1 
ATOM   1045  C  C     . VAL A 1 134 ? 66.192  150.800 36.565  1.00 17.24 ? 134  VAL A C     1 
ATOM   1046  O  O     . VAL A 1 134 ? 67.219  151.258 37.063  1.00 18.84 ? 134  VAL A O     1 
ATOM   1047  C  CB    . VAL A 1 134 ? 65.905  148.583 37.709  1.00 17.48 ? 134  VAL A CB    1 
ATOM   1048  C  CG1   . VAL A 1 134 ? 64.672  149.074 38.460  1.00 17.77 ? 134  VAL A CG1   1 
ATOM   1049  C  CG2   . VAL A 1 134 ? 65.831  147.087 37.489  1.00 15.74 ? 134  VAL A CG2   1 
ATOM   1050  N  N     . VAL A 1 135 ? 65.178  151.560 36.178  1.00 16.37 ? 135  VAL A N     1 
ATOM   1051  C  CA    . VAL A 1 135 ? 65.195  153.014 36.293  1.00 15.21 ? 135  VAL A CA    1 
ATOM   1052  C  C     . VAL A 1 135 ? 64.113  153.480 37.267  1.00 15.29 ? 135  VAL A C     1 
ATOM   1053  O  O     . VAL A 1 135 ? 62.919  153.323 36.999  1.00 15.31 ? 135  VAL A O     1 
ATOM   1054  C  CB    . VAL A 1 135 ? 64.928  153.657 34.912  1.00 14.61 ? 135  VAL A CB    1 
ATOM   1055  C  CG1   . VAL A 1 135 ? 64.922  155.166 35.024  1.00 14.72 ? 135  VAL A CG1   1 
ATOM   1056  C  CG2   . VAL A 1 135 ? 65.970  153.195 33.920  1.00 13.66 ? 135  VAL A CG2   1 
ATOM   1057  N  N     . ALA A 1 136 ? 64.523  154.053 38.393  1.00 13.40 ? 136  ALA A N     1 
ATOM   1058  C  CA    . ALA A 1 136 ? 63.556  154.521 39.374  1.00 12.27 ? 136  ALA A CA    1 
ATOM   1059  C  C     . ALA A 1 136 ? 62.939  155.836 38.918  1.00 12.90 ? 136  ALA A C     1 
ATOM   1060  O  O     . ALA A 1 136 ? 63.636  156.745 38.458  1.00 10.58 ? 136  ALA A O     1 
ATOM   1061  C  CB    . ALA A 1 136 ? 64.221  154.692 40.741  1.00 14.29 ? 136  ALA A CB    1 
ATOM   1062  N  N     . ILE A 1 137 ? 61.618  155.926 39.039  1.00 13.86 ? 137  ILE A N     1 
ATOM   1063  C  CA    . ILE A 1 137 ? 60.896  157.120 38.638  1.00 12.89 ? 137  ILE A CA    1 
ATOM   1064  C  C     . ILE A 1 137 ? 60.095  157.649 39.821  1.00 14.70 ? 137  ILE A C     1 
ATOM   1065  O  O     . ILE A 1 137 ? 59.133  157.024 40.276  1.00 14.69 ? 137  ILE A O     1 
ATOM   1066  C  CB    . ILE A 1 137 ? 59.960  156.823 37.448  1.00 13.26 ? 137  ILE A CB    1 
ATOM   1067  C  CG1   . ILE A 1 137 ? 60.770  156.192 36.306  1.00 12.79 ? 137  ILE A CG1   1 
ATOM   1068  C  CG2   . ILE A 1 137 ? 59.311  158.119 36.958  1.00 9.64  ? 137  ILE A CG2   1 
ATOM   1069  C  CD1   . ILE A 1 137 ? 59.943  155.792 35.100  1.00 13.56 ? 137  ILE A CD1   1 
ATOM   1070  N  N     . TYR A 1 138 ? 60.529  158.803 40.317  1.00 13.53 ? 138  TYR A N     1 
ATOM   1071  C  CA    . TYR A 1 138 ? 59.919  159.475 41.462  1.00 14.01 ? 138  TYR A CA    1 
ATOM   1072  C  C     . TYR A 1 138 ? 59.434  160.799 40.884  1.00 15.19 ? 138  TYR A C     1 
ATOM   1073  O  O     . TYR A 1 138 ? 60.084  161.834 41.041  1.00 14.32 ? 138  TYR A O     1 
ATOM   1074  C  CB    . TYR A 1 138 ? 61.001  159.701 42.523  1.00 12.97 ? 138  TYR A CB    1 
ATOM   1075  C  CG    . TYR A 1 138 ? 60.530  160.168 43.883  1.00 13.37 ? 138  TYR A CG    1 
ATOM   1076  C  CD1   . TYR A 1 138 ? 59.549  159.463 44.593  1.00 11.20 ? 138  TYR A CD1   1 
ATOM   1077  C  CD2   . TYR A 1 138 ? 61.137  161.262 44.504  1.00 11.46 ? 138  TYR A CD2   1 
ATOM   1078  C  CE1   . TYR A 1 138 ? 59.195  159.831 45.886  1.00 10.58 ? 138  TYR A CE1   1 
ATOM   1079  C  CE2   . TYR A 1 138 ? 60.791  161.638 45.793  1.00 13.57 ? 138  TYR A CE2   1 
ATOM   1080  C  CZ    . TYR A 1 138 ? 59.822  160.921 46.482  1.00 12.65 ? 138  TYR A CZ    1 
ATOM   1081  O  OH    . TYR A 1 138 ? 59.495  161.300 47.765  1.00 13.03 ? 138  TYR A OH    1 
ATOM   1082  N  N     . MET A 1 139 ? 58.287  160.743 40.211  1.00 16.27 ? 139  MET A N     1 
ATOM   1083  C  CA    . MET A 1 139 ? 57.713  161.898 39.529  1.00 16.04 ? 139  MET A CA    1 
ATOM   1084  C  C     . MET A 1 139 ? 56.278  162.259 39.902  1.00 17.19 ? 139  MET A C     1 
ATOM   1085  O  O     . MET A 1 139 ? 55.489  161.405 40.298  1.00 17.18 ? 139  MET A O     1 
ATOM   1086  C  CB    . MET A 1 139 ? 57.761  161.644 38.024  1.00 15.14 ? 139  MET A CB    1 
ATOM   1087  C  CG    . MET A 1 139 ? 59.154  161.554 37.447  1.00 18.16 ? 139  MET A CG    1 
ATOM   1088  S  SD    . MET A 1 139 ? 59.768  163.169 37.114  1.00 19.95 ? 139  MET A SD    1 
ATOM   1089  C  CE    . MET A 1 139 ? 58.791  163.616 35.705  1.00 18.89 ? 139  MET A CE    1 
ATOM   1090  N  N     . PRO A 1 140 ? 55.922  163.545 39.760  1.00 16.85 ? 140  PRO A N     1 
ATOM   1091  C  CA    . PRO A 1 140 ? 54.576  164.036 40.068  1.00 18.74 ? 140  PRO A CA    1 
ATOM   1092  C  C     . PRO A 1 140 ? 53.700  163.841 38.826  1.00 19.73 ? 140  PRO A C     1 
ATOM   1093  O  O     . PRO A 1 140 ? 54.160  163.293 37.820  1.00 21.00 ? 140  PRO A O     1 
ATOM   1094  C  CB    . PRO A 1 140 ? 54.819  165.505 40.379  1.00 18.79 ? 140  PRO A CB    1 
ATOM   1095  C  CG    . PRO A 1 140 ? 55.875  165.853 39.352  1.00 18.26 ? 140  PRO A CG    1 
ATOM   1096  C  CD    . PRO A 1 140 ? 56.830  164.664 39.449  1.00 17.17 ? 140  PRO A CD    1 
ATOM   1097  N  N     . MET A 1 141 ? 52.450  164.291 38.880  1.00 19.74 ? 141  MET A N     1 
ATOM   1098  C  CA    . MET A 1 141 ? 51.551  164.133 37.735  1.00 18.63 ? 141  MET A CA    1 
ATOM   1099  C  C     . MET A 1 141 ? 51.772  165.180 36.626  1.00 17.74 ? 141  MET A C     1 
ATOM   1100  O  O     . MET A 1 141 ? 51.030  166.158 36.493  1.00 16.41 ? 141  MET A O     1 
ATOM   1101  C  CB    . MET A 1 141 ? 50.098  164.161 38.212  1.00 18.15 ? 141  MET A CB    1 
ATOM   1102  C  CG    . MET A 1 141 ? 49.671  162.899 38.934  1.00 14.58 ? 141  MET A CG    1 
ATOM   1103  S  SD    . MET A 1 141 ? 49.546  161.483 37.794  1.00 14.22 ? 141  MET A SD    1 
ATOM   1104  C  CE    . MET A 1 141 ? 47.789  161.534 37.402  1.00 13.39 ? 141  MET A CE    1 
ATOM   1105  N  N     . VAL A 1 142 ? 52.816  164.955 35.838  1.00 16.58 ? 142  VAL A N     1 
ATOM   1106  C  CA    . VAL A 1 142 ? 53.172  165.827 34.727  1.00 15.62 ? 142  VAL A CA    1 
ATOM   1107  C  C     . VAL A 1 142 ? 53.519  164.951 33.523  1.00 14.93 ? 142  VAL A C     1 
ATOM   1108  O  O     . VAL A 1 142 ? 53.947  163.808 33.687  1.00 12.35 ? 142  VAL A O     1 
ATOM   1109  C  CB    . VAL A 1 142 ? 54.395  166.717 35.080  1.00 16.29 ? 142  VAL A CB    1 
ATOM   1110  C  CG1   . VAL A 1 142 ? 53.963  167.840 36.012  1.00 17.35 ? 142  VAL A CG1   1 
ATOM   1111  C  CG2   . VAL A 1 142 ? 55.487  165.876 35.736  1.00 14.13 ? 142  VAL A CG2   1 
ATOM   1112  N  N     . PRO A 1 143 ? 53.349  165.482 32.300  1.00 15.83 ? 143  PRO A N     1 
ATOM   1113  C  CA    . PRO A 1 143 ? 53.643  164.740 31.065  1.00 14.85 ? 143  PRO A CA    1 
ATOM   1114  C  C     . PRO A 1 143 ? 54.992  164.021 31.109  1.00 15.91 ? 143  PRO A C     1 
ATOM   1115  O  O     . PRO A 1 143 ? 55.102  162.854 30.718  1.00 16.41 ? 143  PRO A O     1 
ATOM   1116  C  CB    . PRO A 1 143 ? 53.612  165.829 29.997  1.00 14.77 ? 143  PRO A CB    1 
ATOM   1117  C  CG    . PRO A 1 143 ? 52.604  166.800 30.542  1.00 13.97 ? 143  PRO A CG    1 
ATOM   1118  C  CD    . PRO A 1 143 ? 52.982  166.878 31.996  1.00 14.92 ? 143  PRO A CD    1 
ATOM   1119  N  N     . GLU A 1 144 ? 56.014  164.731 31.585  1.00 14.44 ? 144  GLU A N     1 
ATOM   1120  C  CA    . GLU A 1 144 ? 57.364  164.181 31.680  1.00 13.75 ? 144  GLU A CA    1 
ATOM   1121  C  C     . GLU A 1 144 ? 57.401  162.790 32.317  1.00 13.13 ? 144  GLU A C     1 
ATOM   1122  O  O     . GLU A 1 144 ? 58.271  161.985 32.000  1.00 13.24 ? 144  GLU A O     1 
ATOM   1123  C  CB    . GLU A 1 144 ? 58.273  165.124 32.479  1.00 15.36 ? 144  GLU A CB    1 
ATOM   1124  C  CG    . GLU A 1 144 ? 58.648  166.433 31.786  1.00 17.57 ? 144  GLU A CG    1 
ATOM   1125  C  CD    . GLU A 1 144 ? 57.466  167.372 31.554  1.00 18.97 ? 144  GLU A CD    1 
ATOM   1126  O  OE1   . GLU A 1 144 ? 56.474  167.314 32.315  1.00 17.77 ? 144  GLU A OE1   1 
ATOM   1127  O  OE2   . GLU A 1 144 ? 57.549  168.192 30.614  1.00 20.47 ? 144  GLU A OE2   1 
ATOM   1128  N  N     . ALA A 1 145 ? 56.465  162.509 33.219  1.00 12.40 ? 145  ALA A N     1 
ATOM   1129  C  CA    . ALA A 1 145 ? 56.423  161.204 33.868  1.00 13.24 ? 145  ALA A CA    1 
ATOM   1130  C  C     . ALA A 1 145 ? 56.076  160.127 32.853  1.00 13.92 ? 145  ALA A C     1 
ATOM   1131  O  O     . ALA A 1 145 ? 56.673  159.053 32.856  1.00 14.71 ? 145  ALA A O     1 
ATOM   1132  C  CB    . ALA A 1 145 ? 55.402  161.199 35.003  1.00 12.64 ? 145  ALA A CB    1 
ATOM   1133  N  N     . ALA A 1 146 ? 55.116  160.425 31.981  1.00 13.34 ? 146  ALA A N     1 
ATOM   1134  C  CA    . ALA A 1 146 ? 54.690  159.478 30.957  1.00 13.96 ? 146  ALA A CA    1 
ATOM   1135  C  C     . ALA A 1 146 ? 55.779  159.329 29.896  1.00 14.82 ? 146  ALA A C     1 
ATOM   1136  O  O     . ALA A 1 146 ? 55.960  158.252 29.326  1.00 14.43 ? 146  ALA A O     1 
ATOM   1137  C  CB    . ALA A 1 146 ? 53.379  159.950 30.306  1.00 12.10 ? 146  ALA A CB    1 
ATOM   1138  N  N     . VAL A 1 147 ? 56.498  160.418 29.628  1.00 13.69 ? 147  VAL A N     1 
ATOM   1139  C  CA    . VAL A 1 147 ? 57.561  160.374 28.638  1.00 12.27 ? 147  VAL A CA    1 
ATOM   1140  C  C     . VAL A 1 147 ? 58.674  159.483 29.151  1.00 12.42 ? 147  VAL A C     1 
ATOM   1141  O  O     . VAL A 1 147 ? 59.229  158.684 28.406  1.00 13.97 ? 147  VAL A O     1 
ATOM   1142  C  CB    . VAL A 1 147 ? 58.138  161.779 28.343  1.00 12.66 ? 147  VAL A CB    1 
ATOM   1143  C  CG1   . VAL A 1 147 ? 59.423  161.644 27.529  1.00 9.94  ? 147  VAL A CG1   1 
ATOM   1144  C  CG2   . VAL A 1 147 ? 57.121  162.612 27.568  1.00 8.76  ? 147  VAL A CG2   1 
ATOM   1145  N  N     . ALA A 1 148 ? 58.985  159.613 30.435  1.00 12.46 ? 148  ALA A N     1 
ATOM   1146  C  CA    . ALA A 1 148 ? 60.042  158.811 31.030  1.00 11.13 ? 148  ALA A CA    1 
ATOM   1147  C  C     . ALA A 1 148 ? 59.669  157.333 31.036  1.00 11.09 ? 148  ALA A C     1 
ATOM   1148  O  O     . ALA A 1 148 ? 60.508  156.481 30.725  1.00 11.10 ? 148  ALA A O     1 
ATOM   1149  C  CB    . ALA A 1 148 ? 60.332  159.292 32.453  1.00 9.74  ? 148  ALA A CB    1 
ATOM   1150  N  N     . MET A 1 149 ? 58.417  157.029 31.381  1.00 10.31 ? 149  MET A N     1 
ATOM   1151  C  CA    . MET A 1 149 ? 57.962  155.640 31.422  1.00 10.77 ? 149  MET A CA    1 
ATOM   1152  C  C     . MET A 1 149 ? 57.926  155.011 30.027  1.00 10.58 ? 149  MET A C     1 
ATOM   1153  O  O     . MET A 1 149 ? 58.360  153.874 29.844  1.00 11.65 ? 149  MET A O     1 
ATOM   1154  C  CB    . MET A 1 149 ? 56.576  155.546 32.069  1.00 9.92  ? 149  MET A CB    1 
ATOM   1155  C  CG    . MET A 1 149 ? 56.600  155.677 33.572  1.00 10.15 ? 149  MET A CG    1 
ATOM   1156  S  SD    . MET A 1 149 ? 54.941  155.928 34.250  1.00 13.99 ? 149  MET A SD    1 
ATOM   1157  C  CE    . MET A 1 149 ? 54.187  154.302 34.038  1.00 5.35  ? 149  MET A CE    1 
ATOM   1158  N  N     . LEU A 1 150 ? 57.426  155.753 29.044  1.00 11.03 ? 150  LEU A N     1 
ATOM   1159  C  CA    . LEU A 1 150 ? 57.352  155.233 27.684  1.00 10.45 ? 150  LEU A CA    1 
ATOM   1160  C  C     . LEU A 1 150 ? 58.747  155.044 27.088  1.00 12.03 ? 150  LEU A C     1 
ATOM   1161  O  O     . LEU A 1 150 ? 58.997  154.053 26.393  1.00 10.44 ? 150  LEU A O     1 
ATOM   1162  C  CB    . LEU A 1 150 ? 56.509  156.164 26.802  1.00 9.30  ? 150  LEU A CB    1 
ATOM   1163  C  CG    . LEU A 1 150 ? 55.007  156.177 27.104  1.00 11.68 ? 150  LEU A CG    1 
ATOM   1164  C  CD1   . LEU A 1 150 ? 54.340  157.376 26.413  1.00 10.49 ? 150  LEU A CD1   1 
ATOM   1165  C  CD2   . LEU A 1 150 ? 54.371  154.861 26.651  1.00 9.10  ? 150  LEU A CD2   1 
ATOM   1166  N  N     . ALA A 1 151 ? 59.655  155.987 27.361  1.00 12.79 ? 151  ALA A N     1 
ATOM   1167  C  CA    . ALA A 1 151 ? 61.028  155.894 26.857  1.00 12.78 ? 151  ALA A CA    1 
ATOM   1168  C  C     . ALA A 1 151 ? 61.712  154.638 27.417  1.00 14.68 ? 151  ALA A C     1 
ATOM   1169  O  O     . ALA A 1 151 ? 62.369  153.902 26.674  1.00 15.73 ? 151  ALA A O     1 
ATOM   1170  C  CB    . ALA A 1 151 ? 61.821  157.139 27.247  1.00 12.82 ? 151  ALA A CB    1 
ATOM   1171  N  N     . CYS A 1 152 ? 61.542  154.397 28.718  1.00 13.18 ? 152  CYS A N     1 
ATOM   1172  C  CA    . CYS A 1 152 ? 62.136  153.236 29.380  1.00 14.48 ? 152  CYS A CA    1 
ATOM   1173  C  C     . CYS A 1 152 ? 61.635  151.954 28.724  1.00 16.45 ? 152  CYS A C     1 
ATOM   1174  O  O     . CYS A 1 152 ? 62.419  151.052 28.405  1.00 17.35 ? 152  CYS A O     1 
ATOM   1175  C  CB    . CYS A 1 152 ? 61.769  153.207 30.868  1.00 13.19 ? 152  CYS A CB    1 
ATOM   1176  S  SG    . CYS A 1 152 ? 62.660  154.345 31.927  1.00 14.82 ? 152  CYS A SG    1 
ATOM   1177  N  N     . ALA A 1 153 ? 60.321  151.889 28.525  1.00 15.00 ? 153  ALA A N     1 
ATOM   1178  C  CA    . ALA A 1 153 ? 59.689  150.733 27.916  1.00 14.60 ? 153  ALA A CA    1 
ATOM   1179  C  C     . ALA A 1 153 ? 60.157  150.572 26.471  1.00 15.53 ? 153  ALA A C     1 
ATOM   1180  O  O     . ALA A 1 153 ? 60.377  149.453 26.000  1.00 15.31 ? 153  ALA A O     1 
ATOM   1181  C  CB    . ALA A 1 153 ? 58.169  150.889 27.966  1.00 11.50 ? 153  ALA A CB    1 
ATOM   1182  N  N     . ARG A 1 154 ? 60.319  151.696 25.778  1.00 14.38 ? 154  ARG A N     1 
ATOM   1183  C  CA    . ARG A 1 154 ? 60.746  151.677 24.384  1.00 13.81 ? 154  ARG A CA    1 
ATOM   1184  C  C     . ARG A 1 154 ? 62.076  150.964 24.162  1.00 14.12 ? 154  ARG A C     1 
ATOM   1185  O  O     . ARG A 1 154 ? 62.249  150.284 23.152  1.00 14.66 ? 154  ARG A O     1 
ATOM   1186  C  CB    . ARG A 1 154 ? 60.844  153.105 23.836  1.00 15.75 ? 154  ARG A CB    1 
ATOM   1187  C  CG    . ARG A 1 154 ? 60.973  153.164 22.315  1.00 15.38 ? 154  ARG A CG    1 
ATOM   1188  C  CD    . ARG A 1 154 ? 61.280  154.567 21.842  1.00 18.21 ? 154  ARG A CD    1 
ATOM   1189  N  NE    . ARG A 1 154 ? 61.237  154.688 20.384  1.00 19.05 ? 154  ARG A NE    1 
ATOM   1190  C  CZ    . ARG A 1 154 ? 60.117  154.678 19.669  1.00 17.68 ? 154  ARG A CZ    1 
ATOM   1191  N  NH1   . ARG A 1 154 ? 58.942  154.553 20.274  1.00 17.24 ? 154  ARG A NH1   1 
ATOM   1192  N  NH2   . ARG A 1 154 ? 60.169  154.796 18.349  1.00 15.34 ? 154  ARG A NH2   1 
ATOM   1193  N  N     . ILE A 1 155 ? 63.015  151.117 25.095  1.00 13.97 ? 155  ILE A N     1 
ATOM   1194  C  CA    . ILE A 1 155 ? 64.324  150.482 24.954  1.00 13.76 ? 155  ILE A CA    1 
ATOM   1195  C  C     . ILE A 1 155 ? 64.475  149.201 25.766  1.00 15.35 ? 155  ILE A C     1 
ATOM   1196  O  O     . ILE A 1 155 ? 65.557  148.622 25.826  1.00 16.39 ? 155  ILE A O     1 
ATOM   1197  C  CB    . ILE A 1 155 ? 65.471  151.443 25.345  1.00 13.93 ? 155  ILE A CB    1 
ATOM   1198  C  CG1   . ILE A 1 155 ? 65.300  151.896 26.798  1.00 14.39 ? 155  ILE A CG1   1 
ATOM   1199  C  CG2   . ILE A 1 155 ? 65.498  152.645 24.397  1.00 12.91 ? 155  ILE A CG2   1 
ATOM   1200  C  CD1   . ILE A 1 155 ? 66.388  152.849 27.273  1.00 15.22 ? 155  ILE A CD1   1 
ATOM   1201  N  N     . GLY A 1 156 ? 63.388  148.751 26.381  1.00 15.89 ? 156  GLY A N     1 
ATOM   1202  C  CA    . GLY A 1 156 ? 63.458  147.537 27.169  1.00 16.94 ? 156  GLY A CA    1 
ATOM   1203  C  C     . GLY A 1 156 ? 64.004  147.741 28.570  1.00 18.10 ? 156  GLY A C     1 
ATOM   1204  O  O     . GLY A 1 156 ? 64.373  146.776 29.237  1.00 16.99 ? 156  GLY A O     1 
ATOM   1205  N  N     . ALA A 1 157 ? 64.068  148.988 29.025  1.00 16.60 ? 157  ALA A N     1 
ATOM   1206  C  CA    . ALA A 1 157 ? 64.560  149.258 30.369  1.00 18.83 ? 157  ALA A CA    1 
ATOM   1207  C  C     . ALA A 1 157 ? 63.376  149.119 31.317  1.00 18.62 ? 157  ALA A C     1 
ATOM   1208  O  O     . ALA A 1 157 ? 62.322  149.705 31.091  1.00 21.60 ? 157  ALA A O     1 
ATOM   1209  C  CB    . ALA A 1 157 ? 65.148  150.675 30.459  1.00 16.44 ? 157  ALA A CB    1 
ATOM   1210  N  N     . VAL A 1 158 ? 63.560  148.340 32.375  1.00 17.60 ? 158  VAL A N     1 
ATOM   1211  C  CA    . VAL A 1 158 ? 62.516  148.111 33.364  1.00 16.63 ? 158  VAL A CA    1 
ATOM   1212  C  C     . VAL A 1 158 ? 62.386  149.321 34.282  1.00 17.08 ? 158  VAL A C     1 
ATOM   1213  O  O     . VAL A 1 158 ? 63.306  149.624 35.044  1.00 18.54 ? 158  VAL A O     1 
ATOM   1214  C  CB    . VAL A 1 158 ? 62.858  146.879 34.220  1.00 15.76 ? 158  VAL A CB    1 
ATOM   1215  C  CG1   . VAL A 1 158 ? 61.730  146.577 35.188  1.00 14.53 ? 158  VAL A CG1   1 
ATOM   1216  C  CG2   . VAL A 1 158 ? 63.131  145.696 33.313  1.00 15.90 ? 158  VAL A CG2   1 
ATOM   1217  N  N     . HIS A 1 159 ? 61.258  150.019 34.223  1.00 15.47 ? 159  HIS A N     1 
ATOM   1218  C  CA    . HIS A 1 159 ? 61.107  151.179 35.091  1.00 15.66 ? 159  HIS A CA    1 
ATOM   1219  C  C     . HIS A 1 159 ? 60.478  150.834 36.434  1.00 15.89 ? 159  HIS A C     1 
ATOM   1220  O  O     . HIS A 1 159 ? 59.678  149.903 36.556  1.00 15.33 ? 159  HIS A O     1 
ATOM   1221  C  CB    . HIS A 1 159 ? 60.314  152.298 34.393  1.00 15.00 ? 159  HIS A CB    1 
ATOM   1222  C  CG    . HIS A 1 159 ? 58.890  151.957 34.091  1.00 14.24 ? 159  HIS A CG    1 
ATOM   1223  N  ND1   . HIS A 1 159 ? 57.960  151.703 35.078  1.00 13.93 ? 159  HIS A ND1   1 
ATOM   1224  C  CD2   . HIS A 1 159 ? 58.218  151.901 32.916  1.00 15.50 ? 159  HIS A CD2   1 
ATOM   1225  C  CE1   . HIS A 1 159 ? 56.776  151.511 34.523  1.00 15.07 ? 159  HIS A CE1   1 
ATOM   1226  N  NE2   . HIS A 1 159 ? 56.904  151.625 33.213  1.00 15.67 ? 159  HIS A NE2   1 
ATOM   1227  N  N     . SER A 1 160 ? 60.879  151.580 37.453  1.00 16.33 ? 160  SER A N     1 
ATOM   1228  C  CA    . SER A 1 160 ? 60.376  151.375 38.797  1.00 15.13 ? 160  SER A CA    1 
ATOM   1229  C  C     . SER A 1 160 ? 59.813  152.697 39.299  1.00 14.85 ? 160  SER A C     1 
ATOM   1230  O  O     . SER A 1 160 ? 60.516  153.488 39.944  1.00 13.54 ? 160  SER A O     1 
ATOM   1231  C  CB    . SER A 1 160 ? 61.506  150.899 39.711  1.00 17.34 ? 160  SER A CB    1 
ATOM   1232  O  OG    . SER A 1 160 ? 61.013  150.590 40.999  1.00 19.02 ? 160  SER A OG    1 
ATOM   1233  N  N     . VAL A 1 161 ? 58.545  152.940 38.981  1.00 14.40 ? 161  VAL A N     1 
ATOM   1234  C  CA    . VAL A 1 161 ? 57.881  154.166 39.402  1.00 14.20 ? 161  VAL A CA    1 
ATOM   1235  C  C     . VAL A 1 161 ? 57.610  154.112 40.899  1.00 14.54 ? 161  VAL A C     1 
ATOM   1236  O  O     . VAL A 1 161 ? 57.176  153.093 41.429  1.00 16.04 ? 161  VAL A O     1 
ATOM   1237  C  CB    . VAL A 1 161 ? 56.541  154.377 38.651  1.00 14.43 ? 161  VAL A CB    1 
ATOM   1238  C  CG1   . VAL A 1 161 ? 55.825  155.611 39.189  1.00 12.49 ? 161  VAL A CG1   1 
ATOM   1239  C  CG2   . VAL A 1 161 ? 56.799  154.532 37.166  1.00 11.51 ? 161  VAL A CG2   1 
ATOM   1240  N  N     . ILE A 1 162 ? 57.889  155.219 41.572  1.00 14.67 ? 162  ILE A N     1 
ATOM   1241  C  CA    . ILE A 1 162 ? 57.675  155.322 43.007  1.00 12.97 ? 162  ILE A CA    1 
ATOM   1242  C  C     . ILE A 1 162 ? 56.770  156.521 43.305  1.00 12.51 ? 162  ILE A C     1 
ATOM   1243  O  O     . ILE A 1 162 ? 57.119  157.660 43.008  1.00 11.96 ? 162  ILE A O     1 
ATOM   1244  C  CB    . ILE A 1 162 ? 59.020  155.503 43.734  1.00 11.84 ? 162  ILE A CB    1 
ATOM   1245  C  CG1   . ILE A 1 162 ? 59.952  154.347 43.372  1.00 11.65 ? 162  ILE A CG1   1 
ATOM   1246  C  CG2   . ILE A 1 162 ? 58.788  155.605 45.234  1.00 9.29  ? 162  ILE A CG2   1 
ATOM   1247  C  CD1   . ILE A 1 162 ? 61.351  154.494 43.908  1.00 9.25  ? 162  ILE A CD1   1 
ATOM   1248  N  N     . PHE A 1 163 ? 55.608  156.251 43.889  1.00 13.33 ? 163  PHE A N     1 
ATOM   1249  C  CA    . PHE A 1 163 ? 54.650  157.296 44.238  1.00 13.94 ? 163  PHE A CA    1 
ATOM   1250  C  C     . PHE A 1 163 ? 55.346  158.442 44.978  1.00 14.68 ? 163  PHE A C     1 
ATOM   1251  O  O     . PHE A 1 163 ? 56.088  158.217 45.937  1.00 15.02 ? 163  PHE A O     1 
ATOM   1252  C  CB    . PHE A 1 163 ? 53.530  156.696 45.105  1.00 13.70 ? 163  PHE A CB    1 
ATOM   1253  C  CG    . PHE A 1 163 ? 52.503  157.700 45.567  1.00 13.11 ? 163  PHE A CG    1 
ATOM   1254  C  CD1   . PHE A 1 163 ? 51.796  158.475 44.649  1.00 11.68 ? 163  PHE A CD1   1 
ATOM   1255  C  CD2   . PHE A 1 163 ? 52.227  157.852 46.926  1.00 12.81 ? 163  PHE A CD2   1 
ATOM   1256  C  CE1   . PHE A 1 163 ? 50.825  159.390 45.079  1.00 11.82 ? 163  PHE A CE1   1 
ATOM   1257  C  CE2   . PHE A 1 163 ? 51.259  158.761 47.365  1.00 13.64 ? 163  PHE A CE2   1 
ATOM   1258  C  CZ    . PHE A 1 163 ? 50.557  159.532 46.438  1.00 10.08 ? 163  PHE A CZ    1 
ATOM   1259  N  N     . GLY A 1 164 ? 55.092  159.671 44.528  1.00 14.82 ? 164  GLY A N     1 
ATOM   1260  C  CA    . GLY A 1 164 ? 55.699  160.845 45.138  1.00 14.86 ? 164  GLY A CA    1 
ATOM   1261  C  C     . GLY A 1 164 ? 55.451  161.007 46.628  1.00 16.04 ? 164  GLY A C     1 
ATOM   1262  O  O     . GLY A 1 164 ? 56.155  161.759 47.307  1.00 16.26 ? 164  GLY A O     1 
ATOM   1263  N  N     . GLY A 1 165 ? 54.453  160.301 47.145  1.00 17.34 ? 165  GLY A N     1 
ATOM   1264  C  CA    . GLY A 1 165 ? 54.133  160.392 48.557  1.00 16.52 ? 165  GLY A CA    1 
ATOM   1265  C  C     . GLY A 1 165 ? 55.018  159.559 49.465  1.00 16.80 ? 165  GLY A C     1 
ATOM   1266  O  O     . GLY A 1 165 ? 54.889  159.628 50.687  1.00 17.53 ? 165  GLY A O     1 
ATOM   1267  N  N     . PHE A 1 166 ? 55.913  158.762 48.893  1.00 17.23 ? 166  PHE A N     1 
ATOM   1268  C  CA    . PHE A 1 166 ? 56.796  157.963 49.730  1.00 18.49 ? 166  PHE A CA    1 
ATOM   1269  C  C     . PHE A 1 166 ? 57.926  158.813 50.268  1.00 18.09 ? 166  PHE A C     1 
ATOM   1270  O  O     . PHE A 1 166 ? 58.426  159.716 49.597  1.00 17.48 ? 166  PHE A O     1 
ATOM   1271  C  CB    . PHE A 1 166 ? 57.349  156.751 48.976  1.00 20.21 ? 166  PHE A CB    1 
ATOM   1272  C  CG    . PHE A 1 166 ? 56.374  155.617 48.876  1.00 23.89 ? 166  PHE A CG    1 
ATOM   1273  C  CD1   . PHE A 1 166 ? 55.628  155.421 47.723  1.00 24.21 ? 166  PHE A CD1   1 
ATOM   1274  C  CD2   . PHE A 1 166 ? 56.165  154.771 49.959  1.00 25.82 ? 166  PHE A CD2   1 
ATOM   1275  C  CE1   . PHE A 1 166 ? 54.687  154.400 47.651  1.00 26.08 ? 166  PHE A CE1   1 
ATOM   1276  C  CE2   . PHE A 1 166 ? 55.223  153.744 49.897  1.00 27.42 ? 166  PHE A CE2   1 
ATOM   1277  C  CZ    . PHE A 1 166 ? 54.483  153.559 48.740  1.00 26.14 ? 166  PHE A CZ    1 
ATOM   1278  N  N     . SER A 1 167 ? 58.308  158.516 51.500  1.00 17.78 ? 167  SER A N     1 
ATOM   1279  C  CA    . SER A 1 167 ? 59.367  159.245 52.179  1.00 17.50 ? 167  SER A CA    1 
ATOM   1280  C  C     . SER A 1 167 ? 60.742  158.888 51.629  1.00 17.70 ? 167  SER A C     1 
ATOM   1281  O  O     . SER A 1 167 ? 60.884  157.957 50.833  1.00 18.24 ? 167  SER A O     1 
ATOM   1282  C  CB    . SER A 1 167 ? 59.322  158.906 53.663  1.00 17.26 ? 167  SER A CB    1 
ATOM   1283  O  OG    . SER A 1 167 ? 59.632  157.538 53.848  1.00 15.63 ? 167  SER A OG    1 
ATOM   1284  N  N     . PRO A 1 168 ? 61.777  159.634 52.042  1.00 17.13 ? 168  PRO A N     1 
ATOM   1285  C  CA    . PRO A 1 168 ? 63.142  159.362 51.579  1.00 17.68 ? 168  PRO A CA    1 
ATOM   1286  C  C     . PRO A 1 168 ? 63.523  157.914 51.925  1.00 18.41 ? 168  PRO A C     1 
ATOM   1287  O  O     . PRO A 1 168 ? 64.082  157.188 51.104  1.00 16.88 ? 168  PRO A O     1 
ATOM   1288  C  CB    . PRO A 1 168 ? 63.970  160.385 52.352  1.00 16.82 ? 168  PRO A CB    1 
ATOM   1289  C  CG    . PRO A 1 168 ? 63.029  161.551 52.444  1.00 15.57 ? 168  PRO A CG    1 
ATOM   1290  C  CD    . PRO A 1 168 ? 61.724  160.890 52.813  1.00 15.98 ? 168  PRO A CD    1 
ATOM   1291  N  N     . GLU A 1 169 ? 63.203  157.511 53.153  1.00 19.85 ? 169  GLU A N     1 
ATOM   1292  C  CA    . GLU A 1 169 ? 63.476  156.160 53.644  1.00 21.03 ? 169  GLU A CA    1 
ATOM   1293  C  C     . GLU A 1 169 ? 62.815  155.123 52.728  1.00 21.33 ? 169  GLU A C     1 
ATOM   1294  O  O     . GLU A 1 169 ? 63.458  154.158 52.304  1.00 20.25 ? 169  GLU A O     1 
ATOM   1295  C  CB    . GLU A 1 169 ? 62.929  156.014 55.066  1.00 22.52 ? 169  GLU A CB    1 
ATOM   1296  C  CG    . GLU A 1 169 ? 63.173  154.666 55.724  1.00 26.18 ? 169  GLU A CG    1 
ATOM   1297  C  CD    . GLU A 1 169 ? 64.646  154.396 55.977  1.00 29.94 ? 169  GLU A CD    1 
ATOM   1298  O  OE1   . GLU A 1 169 ? 65.376  155.353 56.319  1.00 31.46 ? 169  GLU A OE1   1 
ATOM   1299  O  OE2   . GLU A 1 169 ? 65.068  153.225 55.847  1.00 31.38 ? 169  GLU A OE2   1 
ATOM   1300  N  N     . ALA A 1 170 ? 61.534  155.338 52.425  1.00 19.59 ? 170  ALA A N     1 
ATOM   1301  C  CA    . ALA A 1 170 ? 60.764  154.441 51.560  1.00 18.74 ? 170  ALA A CA    1 
ATOM   1302  C  C     . ALA A 1 170 ? 61.369  154.366 50.159  1.00 17.83 ? 170  ALA A C     1 
ATOM   1303  O  O     . ALA A 1 170 ? 61.400  153.296 49.544  1.00 18.81 ? 170  ALA A O     1 
ATOM   1304  C  CB    . ALA A 1 170 ? 59.310  154.912 51.481  1.00 16.84 ? 170  ALA A CB    1 
ATOM   1305  N  N     . VAL A 1 171 ? 61.843  155.506 49.661  1.00 15.88 ? 171  VAL A N     1 
ATOM   1306  C  CA    . VAL A 1 171 ? 62.464  155.578 48.340  1.00 16.28 ? 171  VAL A CA    1 
ATOM   1307  C  C     . VAL A 1 171 ? 63.771  154.788 48.328  1.00 16.08 ? 171  VAL A C     1 
ATOM   1308  O  O     . VAL A 1 171 ? 64.055  154.051 47.386  1.00 15.76 ? 171  VAL A O     1 
ATOM   1309  C  CB    . VAL A 1 171 ? 62.776  157.033 47.940  1.00 16.66 ? 171  VAL A CB    1 
ATOM   1310  C  CG1   . VAL A 1 171 ? 63.546  157.053 46.644  1.00 16.64 ? 171  VAL A CG1   1 
ATOM   1311  C  CG2   . VAL A 1 171 ? 61.488  157.833 47.810  1.00 18.86 ? 171  VAL A CG2   1 
ATOM   1312  N  N     . ALA A 1 172 ? 64.568  154.942 49.381  1.00 15.71 ? 172  ALA A N     1 
ATOM   1313  C  CA    . ALA A 1 172 ? 65.834  154.226 49.475  1.00 15.65 ? 172  ALA A CA    1 
ATOM   1314  C  C     . ALA A 1 172 ? 65.572  152.720 49.440  1.00 15.40 ? 172  ALA A C     1 
ATOM   1315  O  O     . ALA A 1 172 ? 66.264  151.977 48.753  1.00 16.23 ? 172  ALA A O     1 
ATOM   1316  C  CB    . ALA A 1 172 ? 66.552  154.604 50.764  1.00 15.51 ? 172  ALA A CB    1 
ATOM   1317  N  N     . GLY A 1 173 ? 64.565  152.279 50.186  1.00 16.86 ? 173  GLY A N     1 
ATOM   1318  C  CA    . GLY A 1 173 ? 64.218  150.868 50.227  1.00 16.44 ? 173  GLY A CA    1 
ATOM   1319  C  C     . GLY A 1 173 ? 63.902  150.282 48.859  1.00 16.75 ? 173  GLY A C     1 
ATOM   1320  O  O     . GLY A 1 173 ? 64.222  149.124 48.595  1.00 16.64 ? 173  GLY A O     1 
ATOM   1321  N  N     . CYS A 1 174 ? 63.274  151.071 47.989  1.00 16.06 ? 174  CYS A N     1 
ATOM   1322  C  CA    . CYS A 1 174 ? 62.938  150.616 46.642  1.00 16.10 ? 174  CYS A CA    1 
ATOM   1323  C  C     . CYS A 1 174 ? 64.174  150.549 45.750  1.00 15.39 ? 174  CYS A C     1 
ATOM   1324  O  O     . CYS A 1 174 ? 64.351  149.596 44.988  1.00 16.58 ? 174  CYS A O     1 
ATOM   1325  C  CB    . CYS A 1 174 ? 61.913  151.550 45.996  1.00 19.26 ? 174  CYS A CB    1 
ATOM   1326  S  SG    . CYS A 1 174 ? 60.260  151.501 46.748  1.00 21.36 ? 174  CYS A SG    1 
ATOM   1327  N  N     . ILE A 1 175 ? 65.017  151.574 45.838  1.00 14.68 ? 175  ILE A N     1 
ATOM   1328  C  CA    . ILE A 1 175 ? 66.239  151.643 45.038  1.00 14.70 ? 175  ILE A CA    1 
ATOM   1329  C  C     . ILE A 1 175 ? 67.219  150.532 45.422  1.00 17.24 ? 175  ILE A C     1 
ATOM   1330  O  O     . ILE A 1 175 ? 67.817  149.890 44.559  1.00 17.33 ? 175  ILE A O     1 
ATOM   1331  C  CB    . ILE A 1 175 ? 66.923  153.005 45.217  1.00 15.06 ? 175  ILE A CB    1 
ATOM   1332  C  CG1   . ILE A 1 175 ? 66.046  154.097 44.604  1.00 13.90 ? 175  ILE A CG1   1 
ATOM   1333  C  CG2   . ILE A 1 175 ? 68.305  152.985 44.598  1.00 13.81 ? 175  ILE A CG2   1 
ATOM   1334  C  CD1   . ILE A 1 175 ? 66.469  155.494 44.983  1.00 14.65 ? 175  ILE A CD1   1 
ATOM   1335  N  N     . ILE A 1 176 ? 67.370  150.311 46.723  1.00 17.29 ? 176  ILE A N     1 
ATOM   1336  C  CA    . ILE A 1 176 ? 68.256  149.274 47.238  1.00 17.98 ? 176  ILE A CA    1 
ATOM   1337  C  C     . ILE A 1 176 ? 67.850  147.914 46.683  1.00 18.66 ? 176  ILE A C     1 
ATOM   1338  O  O     . ILE A 1 176 ? 68.677  147.163 46.178  1.00 20.60 ? 176  ILE A O     1 
ATOM   1339  C  CB    . ILE A 1 176 ? 68.198  149.232 48.784  1.00 16.79 ? 176  ILE A CB    1 
ATOM   1340  C  CG1   . ILE A 1 176 ? 68.899  150.467 49.352  1.00 18.35 ? 176  ILE A CG1   1 
ATOM   1341  C  CG2   . ILE A 1 176 ? 68.827  147.948 49.311  1.00 17.06 ? 176  ILE A CG2   1 
ATOM   1342  C  CD1   . ILE A 1 176 ? 68.616  150.719 50.811  1.00 16.02 ? 176  ILE A CD1   1 
ATOM   1343  N  N     . ASP A 1 177 ? 66.564  147.615 46.760  1.00 18.70 ? 177  ASP A N     1 
ATOM   1344  C  CA    . ASP A 1 177 ? 66.045  146.347 46.286  1.00 20.20 ? 177  ASP A CA    1 
ATOM   1345  C  C     . ASP A 1 177 ? 66.150  146.151 44.765  1.00 21.97 ? 177  ASP A C     1 
ATOM   1346  O  O     . ASP A 1 177 ? 66.464  145.052 44.295  1.00 21.27 ? 177  ASP A O     1 
ATOM   1347  C  CB    . ASP A 1 177 ? 64.593  146.204 46.745  1.00 18.93 ? 177  ASP A CB    1 
ATOM   1348  C  CG    . ASP A 1 177 ? 64.028  144.834 46.462  1.00 17.61 ? 177  ASP A CG    1 
ATOM   1349  O  OD1   . ASP A 1 177 ? 63.213  144.708 45.526  1.00 14.93 ? 177  ASP A OD1   1 
ATOM   1350  O  OD2   . ASP A 1 177 ? 64.412  143.885 47.175  1.00 17.55 ? 177  ASP A OD2   1 
ATOM   1351  N  N     . SER A 1 178 ? 65.899  147.210 43.998  1.00 22.35 ? 178  SER A N     1 
ATOM   1352  C  CA    . SER A 1 178 ? 65.958  147.120 42.539  1.00 23.01 ? 178  SER A CA    1 
ATOM   1353  C  C     . SER A 1 178 ? 67.332  147.446 41.950  1.00 24.16 ? 178  SER A C     1 
ATOM   1354  O  O     . SER A 1 178 ? 67.580  147.191 40.773  1.00 21.61 ? 178  SER A O     1 
ATOM   1355  C  CB    . SER A 1 178 ? 64.928  148.057 41.908  1.00 23.74 ? 178  SER A CB    1 
ATOM   1356  O  OG    . SER A 1 178 ? 65.255  149.408 42.168  1.00 21.76 ? 178  SER A OG    1 
ATOM   1357  N  N     . SER A 1 179 ? 68.217  148.013 42.764  1.00 24.23 ? 179  SER A N     1 
ATOM   1358  C  CA    . SER A 1 179 ? 69.548  148.381 42.302  1.00 23.96 ? 179  SER A CA    1 
ATOM   1359  C  C     . SER A 1 179 ? 69.439  149.292 41.074  1.00 24.55 ? 179  SER A C     1 
ATOM   1360  O  O     . SER A 1 179 ? 70.164  149.129 40.090  1.00 24.76 ? 179  SER A O     1 
ATOM   1361  C  CB    . SER A 1 179 ? 70.367  147.124 41.958  1.00 22.97 ? 179  SER A CB    1 
ATOM   1362  O  OG    . SER A 1 179 ? 70.737  146.406 43.128  1.00 23.64 ? 179  SER A OG    1 
ATOM   1363  N  N     . SER A 1 180 ? 68.520  150.247 41.131  1.00 22.49 ? 180  SER A N     1 
ATOM   1364  C  CA    . SER A 1 180 ? 68.347  151.174 40.022  1.00 22.65 ? 180  SER A CA    1 
ATOM   1365  C  C     . SER A 1 180 ? 69.639  151.959 39.798  1.00 22.09 ? 180  SER A C     1 
ATOM   1366  O  O     . SER A 1 180 ? 70.284  152.377 40.755  1.00 19.71 ? 180  SER A O     1 
ATOM   1367  C  CB    . SER A 1 180 ? 67.199  152.145 40.314  1.00 23.53 ? 180  SER A CB    1 
ATOM   1368  O  OG    . SER A 1 180 ? 65.967  151.454 40.429  1.00 25.61 ? 180  SER A OG    1 
ATOM   1369  N  N     . ARG A 1 181 ? 70.010  152.144 38.532  1.00 22.72 ? 181  ARG A N     1 
ATOM   1370  C  CA    . ARG A 1 181 ? 71.212  152.894 38.168  1.00 24.28 ? 181  ARG A CA    1 
ATOM   1371  C  C     . ARG A 1 181 ? 70.894  154.375 38.018  1.00 23.47 ? 181  ARG A C     1 
ATOM   1372  O  O     . ARG A 1 181 ? 71.770  155.231 38.161  1.00 24.52 ? 181  ARG A O     1 
ATOM   1373  C  CB    . ARG A 1 181 ? 71.773  152.400 36.833  1.00 26.72 ? 181  ARG A CB    1 
ATOM   1374  C  CG    . ARG A 1 181 ? 72.643  151.164 36.906  1.00 31.27 ? 181  ARG A CG    1 
ATOM   1375  C  CD    . ARG A 1 181 ? 73.212  150.845 35.527  1.00 33.37 ? 181  ARG A CD    1 
ATOM   1376  N  NE    . ARG A 1 181 ? 74.164  151.863 35.085  1.00 34.92 ? 181  ARG A NE    1 
ATOM   1377  C  CZ    . ARG A 1 181 ? 74.763  151.865 33.899  1.00 35.44 ? 181  ARG A CZ    1 
ATOM   1378  N  NH1   . ARG A 1 181 ? 74.507  150.899 33.023  1.00 37.67 ? 181  ARG A NH1   1 
ATOM   1379  N  NH2   . ARG A 1 181 ? 75.628  152.824 33.597  1.00 34.93 ? 181  ARG A NH2   1 
ATOM   1380  N  N     . LEU A 1 182 ? 69.631  154.661 37.719  1.00 22.38 ? 182  LEU A N     1 
ATOM   1381  C  CA    . LEU A 1 182 ? 69.172  156.019 37.501  1.00 19.34 ? 182  LEU A CA    1 
ATOM   1382  C  C     . LEU A 1 182 ? 67.889  156.350 38.249  1.00 19.38 ? 182  LEU A C     1 
ATOM   1383  O  O     . LEU A 1 182 ? 67.056  155.483 38.502  1.00 20.57 ? 182  LEU A O     1 
ATOM   1384  C  CB    . LEU A 1 182 ? 68.937  156.232 36.004  1.00 19.64 ? 182  LEU A CB    1 
ATOM   1385  C  CG    . LEU A 1 182 ? 68.281  157.539 35.557  1.00 20.65 ? 182  LEU A CG    1 
ATOM   1386  C  CD1   . LEU A 1 182 ? 69.226  158.692 35.804  1.00 18.74 ? 182  LEU A CD1   1 
ATOM   1387  C  CD2   . LEU A 1 182 ? 67.920  157.454 34.079  1.00 21.71 ? 182  LEU A CD2   1 
ATOM   1388  N  N     . VAL A 1 183 ? 67.746  157.624 38.592  1.00 17.42 ? 183  VAL A N     1 
ATOM   1389  C  CA    . VAL A 1 183 ? 66.558  158.111 39.269  1.00 16.09 ? 183  VAL A CA    1 
ATOM   1390  C  C     . VAL A 1 183 ? 66.096  159.336 38.498  1.00 15.95 ? 183  VAL A C     1 
ATOM   1391  O  O     . VAL A 1 183 ? 66.875  160.254 38.240  1.00 15.74 ? 183  VAL A O     1 
ATOM   1392  C  CB    . VAL A 1 183 ? 66.845  158.512 40.732  1.00 15.13 ? 183  VAL A CB    1 
ATOM   1393  C  CG1   . VAL A 1 183 ? 65.653  159.271 41.306  1.00 9.24  ? 183  VAL A CG1   1 
ATOM   1394  C  CG2   . VAL A 1 183 ? 67.124  157.274 41.564  1.00 12.77 ? 183  VAL A CG2   1 
ATOM   1395  N  N     . ILE A 1 184 ? 64.831  159.333 38.104  1.00 17.41 ? 184  ILE A N     1 
ATOM   1396  C  CA    . ILE A 1 184 ? 64.258  160.450 37.369  1.00 17.05 ? 184  ILE A CA    1 
ATOM   1397  C  C     . ILE A 1 184 ? 63.199  161.069 38.269  1.00 17.32 ? 184  ILE A C     1 
ATOM   1398  O  O     . ILE A 1 184 ? 62.241  160.405 38.666  1.00 19.70 ? 184  ILE A O     1 
ATOM   1399  C  CB    . ILE A 1 184 ? 63.617  159.989 36.051  1.00 16.54 ? 184  ILE A CB    1 
ATOM   1400  C  CG1   . ILE A 1 184 ? 64.691  159.388 35.140  1.00 15.08 ? 184  ILE A CG1   1 
ATOM   1401  C  CG2   . ILE A 1 184 ? 62.935  161.172 35.365  1.00 16.06 ? 184  ILE A CG2   1 
ATOM   1402  C  CD1   . ILE A 1 184 ? 64.140  158.759 33.877  1.00 13.18 ? 184  ILE A CD1   1 
ATOM   1403  N  N     . THR A 1 185 ? 63.391  162.339 38.600  1.00 15.79 ? 185  THR A N     1 
ATOM   1404  C  CA    . THR A 1 185 ? 62.477  163.044 39.480  1.00 14.81 ? 185  THR A CA    1 
ATOM   1405  C  C     . THR A 1 185 ? 62.389  164.514 39.060  1.00 15.13 ? 185  THR A C     1 
ATOM   1406  O  O     . THR A 1 185 ? 62.918  164.907 38.015  1.00 14.35 ? 185  THR A O     1 
ATOM   1407  C  CB    . THR A 1 185 ? 62.979  162.945 40.944  1.00 16.08 ? 185  THR A CB    1 
ATOM   1408  O  OG1   . THR A 1 185 ? 61.957  163.390 41.846  1.00 17.13 ? 185  THR A OG1   1 
ATOM   1409  C  CG2   . THR A 1 185 ? 64.227  163.807 41.141  1.00 15.77 ? 185  THR A CG2   1 
ATOM   1410  N  N     . ALA A 1 186 ? 61.713  165.320 39.874  1.00 14.12 ? 186  ALA A N     1 
ATOM   1411  C  CA    . ALA A 1 186 ? 61.556  166.749 39.608  1.00 15.18 ? 186  ALA A CA    1 
ATOM   1412  C  C     . ALA A 1 186 ? 61.999  167.539 40.846  1.00 15.44 ? 186  ALA A C     1 
ATOM   1413  O  O     . ALA A 1 186 ? 62.145  166.965 41.928  1.00 14.11 ? 186  ALA A O     1 
ATOM   1414  C  CB    . ALA A 1 186 ? 60.089  167.056 39.280  1.00 14.43 ? 186  ALA A CB    1 
ATOM   1415  N  N     . ASP A 1 187 ? 62.222  168.845 40.709  1.00 16.27 ? 187  ASP A N     1 
ATOM   1416  C  CA    . ASP A 1 187 ? 62.614  169.596 41.894  1.00 17.93 ? 187  ASP A CA    1 
ATOM   1417  C  C     . ASP A 1 187 ? 61.495  169.468 42.923  1.00 17.63 ? 187  ASP A C     1 
ATOM   1418  O  O     . ASP A 1 187 ? 61.740  169.096 44.070  1.00 19.92 ? 187  ASP A O     1 
ATOM   1419  C  CB    . ASP A 1 187 ? 62.911  171.078 41.590  1.00 18.61 ? 187  ASP A CB    1 
ATOM   1420  C  CG    . ASP A 1 187 ? 61.965  171.692 40.571  1.00 20.67 ? 187  ASP A CG    1 
ATOM   1421  O  OD1   . ASP A 1 187 ? 60.769  171.339 40.545  1.00 18.50 ? 187  ASP A OD1   1 
ATOM   1422  O  OD2   . ASP A 1 187 ? 62.430  172.561 39.802  1.00 22.08 ? 187  ASP A OD2   1 
ATOM   1423  N  N     . GLU A 1 188 ? 60.267  169.746 42.504  1.00 15.66 ? 188  GLU A N     1 
ATOM   1424  C  CA    . GLU A 1 188 ? 59.116  169.637 43.394  1.00 15.95 ? 188  GLU A CA    1 
ATOM   1425  C  C     . GLU A 1 188 ? 57.874  169.319 42.581  1.00 15.41 ? 188  GLU A C     1 
ATOM   1426  O  O     . GLU A 1 188 ? 57.832  169.553 41.373  1.00 13.90 ? 188  GLU A O     1 
ATOM   1427  C  CB    . GLU A 1 188 ? 58.858  170.952 44.145  1.00 16.60 ? 188  GLU A CB    1 
ATOM   1428  C  CG    . GLU A 1 188 ? 60.051  171.560 44.868  1.00 17.71 ? 188  GLU A CG    1 
ATOM   1429  C  CD    . GLU A 1 188 ? 59.680  172.841 45.606  1.00 19.32 ? 188  GLU A CD    1 
ATOM   1430  O  OE1   . GLU A 1 188 ? 58.967  173.678 45.011  1.00 16.34 ? 188  GLU A OE1   1 
ATOM   1431  O  OE2   . GLU A 1 188 ? 60.105  173.010 46.771  1.00 18.78 ? 188  GLU A OE2   1 
ATOM   1432  N  N     . GLY A 1 189 ? 56.864  168.777 43.251  1.00 14.66 ? 189  GLY A N     1 
ATOM   1433  C  CA    . GLY A 1 189 ? 55.610  168.492 42.586  1.00 16.26 ? 189  GLY A CA    1 
ATOM   1434  C  C     . GLY A 1 189 ? 54.666  169.597 43.024  1.00 17.04 ? 189  GLY A C     1 
ATOM   1435  O  O     . GLY A 1 189 ? 54.980  170.325 43.960  1.00 19.03 ? 189  GLY A O     1 
ATOM   1436  N  N     . VAL A 1 190 ? 53.536  169.754 42.349  1.00 17.13 ? 190  VAL A N     1 
ATOM   1437  C  CA    . VAL A 1 190 ? 52.578  170.782 42.740  1.00 19.31 ? 190  VAL A CA    1 
ATOM   1438  C  C     . VAL A 1 190 ? 51.251  170.081 42.993  1.00 20.33 ? 190  VAL A C     1 
ATOM   1439  O  O     . VAL A 1 190 ? 50.708  169.414 42.106  1.00 20.92 ? 190  VAL A O     1 
ATOM   1440  C  CB    . VAL A 1 190 ? 52.389  171.855 41.638  1.00 19.68 ? 190  VAL A CB    1 
ATOM   1441  C  CG1   . VAL A 1 190 ? 51.495  172.974 42.154  1.00 18.56 ? 190  VAL A CG1   1 
ATOM   1442  C  CG2   . VAL A 1 190 ? 53.737  172.423 41.224  1.00 20.62 ? 190  VAL A CG2   1 
ATOM   1443  N  N     . ARG A 1 191 ? 50.722  170.229 44.201  1.00 20.37 ? 191  ARG A N     1 
ATOM   1444  C  CA    . ARG A 1 191 ? 49.473  169.566 44.545  1.00 20.45 ? 191  ARG A CA    1 
ATOM   1445  C  C     . ARG A 1 191 ? 48.637  170.379 45.516  1.00 20.75 ? 191  ARG A C     1 
ATOM   1446  O  O     . ARG A 1 191 ? 49.039  170.612 46.657  1.00 20.22 ? 191  ARG A O     1 
ATOM   1447  C  CB    . ARG A 1 191 ? 49.784  168.187 45.138  1.00 20.36 ? 191  ARG A CB    1 
ATOM   1448  C  CG    . ARG A 1 191 ? 48.577  167.358 45.536  1.00 21.49 ? 191  ARG A CG    1 
ATOM   1449  C  CD    . ARG A 1 191 ? 49.010  165.945 45.896  1.00 20.22 ? 191  ARG A CD    1 
ATOM   1450  N  NE    . ARG A 1 191 ? 47.908  165.123 46.398  1.00 23.45 ? 191  ARG A NE    1 
ATOM   1451  C  CZ    . ARG A 1 191 ? 47.274  165.332 47.550  1.00 24.46 ? 191  ARG A CZ    1 
ATOM   1452  N  NH1   . ARG A 1 191 ? 47.623  166.343 48.342  1.00 24.83 ? 191  ARG A NH1   1 
ATOM   1453  N  NH2   . ARG A 1 191 ? 46.288  164.523 47.915  1.00 26.19 ? 191  ARG A NH2   1 
ATOM   1454  N  N     . ALA A 1 192 ? 47.472  170.817 45.047  1.00 20.35 ? 192  ALA A N     1 
ATOM   1455  C  CA    . ALA A 1 192 ? 46.559  171.601 45.867  1.00 22.17 ? 192  ALA A CA    1 
ATOM   1456  C  C     . ALA A 1 192 ? 47.155  172.939 46.294  1.00 23.77 ? 192  ALA A C     1 
ATOM   1457  O  O     . ALA A 1 192 ? 46.993  173.361 47.438  1.00 25.36 ? 192  ALA A O     1 
ATOM   1458  C  CB    . ALA A 1 192 ? 46.146  170.801 47.093  1.00 20.17 ? 192  ALA A CB    1 
ATOM   1459  N  N     . GLY A 1 193 ? 47.843  173.603 45.371  1.00 26.70 ? 193  GLY A N     1 
ATOM   1460  C  CA    . GLY A 1 193 ? 48.437  174.896 45.669  1.00 27.72 ? 193  GLY A CA    1 
ATOM   1461  C  C     . GLY A 1 193 ? 49.777  174.818 46.373  1.00 28.88 ? 193  GLY A C     1 
ATOM   1462  O  O     . GLY A 1 193 ? 50.548  175.780 46.366  1.00 29.88 ? 193  GLY A O     1 
ATOM   1463  N  N     . ARG A 1 194 ? 50.058  173.667 46.973  1.00 29.28 ? 194  ARG A N     1 
ATOM   1464  C  CA    . ARG A 1 194 ? 51.307  173.460 47.699  1.00 31.11 ? 194  ARG A CA    1 
ATOM   1465  C  C     . ARG A 1 194 ? 52.394  172.821 46.837  1.00 30.50 ? 194  ARG A C     1 
ATOM   1466  O  O     . ARG A 1 194 ? 52.115  172.148 45.847  1.00 31.80 ? 194  ARG A O     1 
ATOM   1467  C  CB    . ARG A 1 194 ? 51.058  172.573 48.923  1.00 32.50 ? 194  ARG A CB    1 
ATOM   1468  C  CG    . ARG A 1 194 ? 50.210  173.208 50.019  1.00 37.09 ? 194  ARG A CG    1 
ATOM   1469  C  CD    . ARG A 1 194 ? 49.841  172.172 51.072  1.00 39.71 ? 194  ARG A CD    1 
ATOM   1470  N  NE    . ARG A 1 194 ? 51.011  171.397 51.480  1.00 43.86 ? 194  ARG A NE    1 
ATOM   1471  C  CZ    . ARG A 1 194 ? 50.981  170.373 52.328  1.00 45.69 ? 194  ARG A CZ    1 
ATOM   1472  N  NH1   . ARG A 1 194 ? 49.831  169.986 52.873  1.00 47.35 ? 194  ARG A NH1   1 
ATOM   1473  N  NH2   . ARG A 1 194 ? 52.105  169.729 52.625  1.00 47.18 ? 194  ARG A NH2   1 
ATOM   1474  N  N     . SER A 1 195 ? 53.640  173.044 47.227  1.00 30.24 ? 195  SER A N     1 
ATOM   1475  C  CA    . SER A 1 195 ? 54.775  172.472 46.521  1.00 29.59 ? 195  SER A CA    1 
ATOM   1476  C  C     . SER A 1 195 ? 55.298  171.320 47.370  1.00 28.49 ? 195  SER A C     1 
ATOM   1477  O  O     . SER A 1 195 ? 55.606  171.495 48.543  1.00 29.04 ? 195  SER A O     1 
ATOM   1478  C  CB    . SER A 1 195 ? 55.868  173.526 46.320  1.00 30.42 ? 195  SER A CB    1 
ATOM   1479  O  OG    . SER A 1 195 ? 55.399  174.591 45.502  1.00 30.83 ? 195  SER A OG    1 
ATOM   1480  N  N     . ILE A 1 196 ? 55.372  170.138 46.775  1.00 27.67 ? 196  ILE A N     1 
ATOM   1481  C  CA    . ILE A 1 196 ? 55.845  168.946 47.465  1.00 27.43 ? 196  ILE A CA    1 
ATOM   1482  C  C     . ILE A 1 196 ? 57.294  168.687 47.074  1.00 27.87 ? 196  ILE A C     1 
ATOM   1483  O  O     . ILE A 1 196 ? 57.638  168.680 45.893  1.00 27.72 ? 196  ILE A O     1 
ATOM   1484  C  CB    . ILE A 1 196 ? 55.012  167.694 47.069  1.00 27.97 ? 196  ILE A CB    1 
ATOM   1485  C  CG1   . ILE A 1 196 ? 53.537  167.898 47.437  1.00 28.36 ? 196  ILE A CG1   1 
ATOM   1486  C  CG2   . ILE A 1 196 ? 55.594  166.451 47.730  1.00 26.99 ? 196  ILE A CG2   1 
ATOM   1487  C  CD1   . ILE A 1 196 ? 53.290  168.158 48.914  1.00 29.92 ? 196  ILE A CD1   1 
ATOM   1488  N  N     . PRO A 1 197 ? 58.167  168.465 48.065  1.00 28.20 ? 197  PRO A N     1 
ATOM   1489  C  CA    . PRO A 1 197 ? 59.573  168.205 47.762  1.00 28.62 ? 197  PRO A CA    1 
ATOM   1490  C  C     . PRO A 1 197 ? 59.746  166.818 47.136  1.00 28.81 ? 197  PRO A C     1 
ATOM   1491  O  O     . PRO A 1 197 ? 59.116  165.849 47.573  1.00 31.89 ? 197  PRO A O     1 
ATOM   1492  C  CB    . PRO A 1 197 ? 60.235  168.310 49.133  1.00 29.21 ? 197  PRO A CB    1 
ATOM   1493  C  CG    . PRO A 1 197 ? 59.180  167.743 50.041  1.00 28.82 ? 197  PRO A CG    1 
ATOM   1494  C  CD    . PRO A 1 197 ? 57.931  168.435 49.519  1.00 28.77 ? 197  PRO A CD    1 
ATOM   1495  N  N     . LEU A 1 198 ? 60.568  166.724 46.099  1.00 25.28 ? 198  LEU A N     1 
ATOM   1496  C  CA    . LEU A 1 198 ? 60.823  165.432 45.472  1.00 21.57 ? 198  LEU A CA    1 
ATOM   1497  C  C     . LEU A 1 198 ? 62.326  165.252 45.351  1.00 19.71 ? 198  LEU A C     1 
ATOM   1498  O  O     . LEU A 1 198 ? 62.891  164.286 45.877  1.00 17.24 ? 198  LEU A O     1 
ATOM   1499  C  CB    . LEU A 1 198 ? 60.153  165.336 44.094  1.00 19.80 ? 198  LEU A CB    1 
ATOM   1500  C  CG    . LEU A 1 198 ? 58.621  165.285 44.116  1.00 19.30 ? 198  LEU A CG    1 
ATOM   1501  C  CD1   . LEU A 1 198 ? 58.089  165.192 42.691  1.00 20.62 ? 198  LEU A CD1   1 
ATOM   1502  C  CD2   . LEU A 1 198 ? 58.150  164.101 44.942  1.00 19.90 ? 198  LEU A CD2   1 
ATOM   1503  N  N     . LYS A 1 199 ? 62.965  166.204 44.678  1.00 18.16 ? 199  LYS A N     1 
ATOM   1504  C  CA    . LYS A 1 199 ? 64.407  166.179 44.487  1.00 19.83 ? 199  LYS A CA    1 
ATOM   1505  C  C     . LYS A 1 199 ? 65.149  166.070 45.826  1.00 19.60 ? 199  LYS A C     1 
ATOM   1506  O  O     . LYS A 1 199 ? 66.068  165.263 45.967  1.00 18.47 ? 199  LYS A O     1 
ATOM   1507  C  CB    . LYS A 1 199 ? 64.848  167.438 43.731  1.00 20.36 ? 199  LYS A CB    1 
ATOM   1508  C  CG    . LYS A 1 199 ? 66.346  167.711 43.731  1.00 22.10 ? 199  LYS A CG    1 
ATOM   1509  C  CD    . LYS A 1 199 ? 67.133  166.614 43.071  1.00 20.44 ? 199  LYS A CD    1 
ATOM   1510  C  CE    . LYS A 1 199 ? 68.572  167.063 42.788  1.00 21.09 ? 199  LYS A CE    1 
ATOM   1511  N  NZ    . LYS A 1 199 ? 69.432  167.153 43.999  1.00 17.59 ? 199  LYS A NZ    1 
ATOM   1512  N  N     . LYS A 1 200 ? 64.751  166.877 46.806  1.00 19.53 ? 200  LYS A N     1 
ATOM   1513  C  CA    . LYS A 1 200 ? 65.399  166.840 48.115  1.00 20.36 ? 200  LYS A CA    1 
ATOM   1514  C  C     . LYS A 1 200 ? 65.239  165.459 48.742  1.00 20.26 ? 200  LYS A C     1 
ATOM   1515  O  O     . LYS A 1 200 ? 66.136  164.974 49.446  1.00 18.53 ? 200  LYS A O     1 
ATOM   1516  C  CB    . LYS A 1 200 ? 64.797  167.889 49.053  1.00 21.69 ? 200  LYS A CB    1 
ATOM   1517  C  CG    . LYS A 1 200 ? 65.381  167.869 50.471  1.00 22.22 ? 200  LYS A CG    1 
ATOM   1518  C  CD    . LYS A 1 200 ? 64.564  168.757 51.407  1.00 23.97 ? 200  LYS A CD    1 
ATOM   1519  C  CE    . LYS A 1 200 ? 65.150  168.798 52.815  1.00 25.34 ? 200  LYS A CE    1 
ATOM   1520  N  NZ    . LYS A 1 200 ? 66.466  169.507 52.893  1.00 24.66 ? 200  LYS A NZ    1 
ATOM   1521  N  N     . ASN A 1 201 ? 64.089  164.833 48.501  1.00 18.92 ? 201  ASN A N     1 
ATOM   1522  C  CA    . ASN A 1 201 ? 63.844  163.510 49.050  1.00 18.41 ? 201  ASN A CA    1 
ATOM   1523  C  C     . ASN A 1 201 ? 64.802  162.505 48.444  1.00 16.66 ? 201  ASN A C     1 
ATOM   1524  O  O     . ASN A 1 201 ? 65.223  161.565 49.112  1.00 17.13 ? 201  ASN A O     1 
ATOM   1525  C  CB    . ASN A 1 201 ? 62.401  163.067 48.809  1.00 19.04 ? 201  ASN A CB    1 
ATOM   1526  C  CG    . ASN A 1 201 ? 61.437  163.712 49.772  1.00 18.42 ? 201  ASN A CG    1 
ATOM   1527  O  OD1   . ASN A 1 201 ? 61.843  164.187 50.834  1.00 20.35 ? 201  ASN A OD1   1 
ATOM   1528  N  ND2   . ASN A 1 201 ? 60.152  163.726 49.420  1.00 14.89 ? 201  ASN A ND2   1 
ATOM   1529  N  N     . VAL A 1 202 ? 65.153  162.706 47.181  1.00 16.09 ? 202  VAL A N     1 
ATOM   1530  C  CA    . VAL A 1 202 ? 66.076  161.796 46.522  1.00 16.30 ? 202  VAL A CA    1 
ATOM   1531  C  C     . VAL A 1 202 ? 67.470  161.980 47.124  1.00 16.52 ? 202  VAL A C     1 
ATOM   1532  O  O     . VAL A 1 202 ? 68.160  160.997 47.392  1.00 16.25 ? 202  VAL A O     1 
ATOM   1533  C  CB    . VAL A 1 202 ? 66.112  162.022 44.985  1.00 16.04 ? 202  VAL A CB    1 
ATOM   1534  C  CG1   . VAL A 1 202 ? 67.121  161.077 44.334  1.00 14.19 ? 202  VAL A CG1   1 
ATOM   1535  C  CG2   . VAL A 1 202 ? 64.735  161.770 44.396  1.00 14.53 ? 202  VAL A CG2   1 
ATOM   1536  N  N     . ASP A 1 203 ? 67.879  163.229 47.353  1.00 15.64 ? 203  ASP A N     1 
ATOM   1537  C  CA    . ASP A 1 203 ? 69.190  163.486 47.951  1.00 16.06 ? 203  ASP A CA    1 
ATOM   1538  C  C     . ASP A 1 203 ? 69.272  162.736 49.275  1.00 16.84 ? 203  ASP A C     1 
ATOM   1539  O  O     . ASP A 1 203 ? 70.241  162.030 49.544  1.00 17.12 ? 203  ASP A O     1 
ATOM   1540  C  CB    . ASP A 1 203 ? 69.415  164.977 48.242  1.00 15.81 ? 203  ASP A CB    1 
ATOM   1541  C  CG    . ASP A 1 203 ? 69.461  165.831 46.990  1.00 17.15 ? 203  ASP A CG    1 
ATOM   1542  O  OD1   . ASP A 1 203 ? 69.778  165.316 45.899  1.00 16.38 ? 203  ASP A OD1   1 
ATOM   1543  O  OD2   . ASP A 1 203 ? 69.200  167.043 47.106  1.00 20.76 ? 203  ASP A OD2   1 
ATOM   1544  N  N     . ASP A 1 204 ? 68.244  162.906 50.101  1.00 16.44 ? 204  ASP A N     1 
ATOM   1545  C  CA    . ASP A 1 204 ? 68.202  162.251 51.397  1.00 16.69 ? 204  ASP A CA    1 
ATOM   1546  C  C     . ASP A 1 204 ? 68.237  160.740 51.247  1.00 17.26 ? 204  ASP A C     1 
ATOM   1547  O  O     . ASP A 1 204 ? 68.960  160.061 51.974  1.00 17.43 ? 204  ASP A O     1 
ATOM   1548  C  CB    . ASP A 1 204 ? 66.955  162.687 52.166  1.00 16.56 ? 204  ASP A CB    1 
ATOM   1549  C  CG    . ASP A 1 204 ? 67.045  164.134 52.643  1.00 18.71 ? 204  ASP A CG    1 
ATOM   1550  O  OD1   . ASP A 1 204 ? 66.038  164.659 53.175  1.00 17.93 ? 204  ASP A OD1   1 
ATOM   1551  O  OD2   . ASP A 1 204 ? 68.134  164.739 52.487  1.00 18.48 ? 204  ASP A OD2   1 
ATOM   1552  N  N     . ALA A 1 205 ? 67.470  160.219 50.295  1.00 16.60 ? 205  ALA A N     1 
ATOM   1553  C  CA    . ALA A 1 205 ? 67.434  158.779 50.063  1.00 17.31 ? 205  ALA A CA    1 
ATOM   1554  C  C     . ALA A 1 205 ? 68.805  158.272 49.619  1.00 18.11 ? 205  ALA A C     1 
ATOM   1555  O  O     . ALA A 1 205 ? 69.229  157.175 49.998  1.00 16.69 ? 205  ALA A O     1 
ATOM   1556  C  CB    . ALA A 1 205 ? 66.382  158.439 49.006  1.00 16.01 ? 205  ALA A CB    1 
ATOM   1557  N  N     . LEU A 1 206 ? 69.505  159.077 48.827  1.00 18.87 ? 206  LEU A N     1 
ATOM   1558  C  CA    . LEU A 1 206 ? 70.817  158.673 48.343  1.00 20.91 ? 206  LEU A CA    1 
ATOM   1559  C  C     . LEU A 1 206 ? 71.909  158.686 49.408  1.00 21.96 ? 206  LEU A C     1 
ATOM   1560  O  O     . LEU A 1 206 ? 72.959  158.064 49.221  1.00 21.81 ? 206  LEU A O     1 
ATOM   1561  C  CB    . LEU A 1 206 ? 71.233  159.532 47.145  1.00 19.29 ? 206  LEU A CB    1 
ATOM   1562  C  CG    . LEU A 1 206 ? 70.318  159.376 45.923  1.00 21.85 ? 206  LEU A CG    1 
ATOM   1563  C  CD1   . LEU A 1 206 ? 70.956  160.056 44.715  1.00 21.39 ? 206  LEU A CD1   1 
ATOM   1564  C  CD2   . LEU A 1 206 ? 70.068  157.900 45.633  1.00 17.97 ? 206  LEU A CD2   1 
ATOM   1565  N  N     . LYS A 1 207 ? 71.668  159.375 50.526  1.00 21.84 ? 207  LYS A N     1 
ATOM   1566  C  CA    . LYS A 1 207 ? 72.656  159.418 51.604  1.00 22.34 ? 207  LYS A CA    1 
ATOM   1567  C  C     . LYS A 1 207 ? 72.705  158.071 52.343  1.00 22.39 ? 207  LYS A C     1 
ATOM   1568  O  O     . LYS A 1 207 ? 73.685  157.753 53.020  1.00 21.89 ? 207  LYS A O     1 
ATOM   1569  C  CB    . LYS A 1 207 ? 72.339  160.552 52.582  1.00 21.70 ? 207  LYS A CB    1 
ATOM   1570  C  CG    . LYS A 1 207 ? 72.531  161.947 52.010  1.00 25.44 ? 207  LYS A CG    1 
ATOM   1571  C  CD    . LYS A 1 207 ? 72.069  163.002 53.008  1.00 28.68 ? 207  LYS A CD    1 
ATOM   1572  C  CE    . LYS A 1 207 ? 71.962  164.384 52.380  1.00 30.48 ? 207  LYS A CE    1 
ATOM   1573  N  NZ    . LYS A 1 207 ? 73.285  164.993 52.104  1.00 32.95 ? 207  LYS A NZ    1 
ATOM   1574  N  N     . ASN A 1 208 ? 71.642  157.284 52.203  1.00 22.81 ? 208  ASN A N     1 
ATOM   1575  C  CA    . ASN A 1 208 ? 71.568  155.965 52.820  1.00 23.83 ? 208  ASN A CA    1 
ATOM   1576  C  C     . ASN A 1 208 ? 72.782  155.164 52.327  1.00 25.13 ? 208  ASN A C     1 
ATOM   1577  O  O     . ASN A 1 208 ? 72.914  154.892 51.134  1.00 25.76 ? 208  ASN A O     1 
ATOM   1578  C  CB    . ASN A 1 208 ? 70.269  155.276 52.394  1.00 23.65 ? 208  ASN A CB    1 
ATOM   1579  C  CG    . ASN A 1 208 ? 69.990  154.013 53.179  1.00 23.39 ? 208  ASN A CG    1 
ATOM   1580  O  OD1   . ASN A 1 208 ? 70.826  153.110 53.254  1.00 24.25 ? 208  ASN A OD1   1 
ATOM   1581  N  ND2   . ASN A 1 208 ? 68.803  153.938 53.766  1.00 23.38 ? 208  ASN A ND2   1 
ATOM   1582  N  N     . PRO A 1 209 ? 73.681  154.769 53.240  1.00 26.97 ? 209  PRO A N     1 
ATOM   1583  C  CA    . PRO A 1 209 ? 74.874  154.007 52.849  1.00 25.69 ? 209  PRO A CA    1 
ATOM   1584  C  C     . PRO A 1 209 ? 74.637  152.697 52.090  1.00 25.28 ? 209  PRO A C     1 
ATOM   1585  O  O     . PRO A 1 209 ? 75.561  152.163 51.471  1.00 25.65 ? 209  PRO A O     1 
ATOM   1586  C  CB    . PRO A 1 209 ? 75.595  153.798 54.180  1.00 25.79 ? 209  PRO A CB    1 
ATOM   1587  C  CG    . PRO A 1 209 ? 74.471  153.756 55.167  1.00 27.39 ? 209  PRO A CG    1 
ATOM   1588  C  CD    . PRO A 1 209 ? 73.587  154.883 54.707  1.00 26.29 ? 209  PRO A CD    1 
ATOM   1589  N  N     . ASN A 1 210 ? 73.409  152.187 52.115  1.00 24.62 ? 210  ASN A N     1 
ATOM   1590  C  CA    . ASN A 1 210 ? 73.115  150.941 51.406  1.00 25.25 ? 210  ASN A CA    1 
ATOM   1591  C  C     . ASN A 1 210 ? 72.792  151.161 49.930  1.00 25.27 ? 210  ASN A C     1 
ATOM   1592  O  O     . ASN A 1 210 ? 72.823  150.215 49.133  1.00 25.95 ? 210  ASN A O     1 
ATOM   1593  C  CB    . ASN A 1 210 ? 71.970  150.192 52.087  1.00 26.61 ? 210  ASN A CB    1 
ATOM   1594  C  CG    . ASN A 1 210 ? 72.364  149.651 53.444  1.00 29.07 ? 210  ASN A CG    1 
ATOM   1595  O  OD1   . ASN A 1 210 ? 73.274  148.833 53.552  1.00 29.08 ? 210  ASN A OD1   1 
ATOM   1596  N  ND2   . ASN A 1 210 ? 71.685  150.111 54.489  1.00 30.94 ? 210  ASN A ND2   1 
ATOM   1597  N  N     . VAL A 1 211 ? 72.479  152.402 49.565  1.00 22.85 ? 211  VAL A N     1 
ATOM   1598  C  CA    . VAL A 1 211 ? 72.189  152.734 48.174  1.00 21.22 ? 211  VAL A CA    1 
ATOM   1599  C  C     . VAL A 1 211 ? 73.533  152.881 47.475  1.00 22.34 ? 211  VAL A C     1 
ATOM   1600  O  O     . VAL A 1 211 ? 74.312  153.782 47.789  1.00 22.90 ? 211  VAL A O     1 
ATOM   1601  C  CB    . VAL A 1 211 ? 71.417  154.059 48.052  1.00 19.75 ? 211  VAL A CB    1 
ATOM   1602  C  CG1   . VAL A 1 211 ? 71.232  154.412 46.584  1.00 18.05 ? 211  VAL A CG1   1 
ATOM   1603  C  CG2   . VAL A 1 211 ? 70.075  153.941 48.753  1.00 18.68 ? 211  VAL A CG2   1 
ATOM   1604  N  N     . THR A 1 212 ? 73.806  151.993 46.526  1.00 23.79 ? 212  THR A N     1 
ATOM   1605  C  CA    . THR A 1 212 ? 75.089  152.016 45.826  1.00 25.52 ? 212  THR A CA    1 
ATOM   1606  C  C     . THR A 1 212 ? 74.984  151.944 44.306  1.00 25.53 ? 212  THR A C     1 
ATOM   1607  O  O     . THR A 1 212 ? 75.977  152.138 43.601  1.00 25.35 ? 212  THR A O     1 
ATOM   1608  C  CB    . THR A 1 212 ? 75.973  150.833 46.291  1.00 26.41 ? 212  THR A CB    1 
ATOM   1609  O  OG1   . THR A 1 212 ? 75.288  149.597 46.031  1.00 25.22 ? 212  THR A OG1   1 
ATOM   1610  C  CG2   . THR A 1 212 ? 76.270  150.932 47.783  1.00 27.30 ? 212  THR A CG2   1 
ATOM   1611  N  N     . SER A 1 213 ? 73.785  151.670 43.806  1.00 24.46 ? 213  SER A N     1 
ATOM   1612  C  CA    . SER A 1 213 ? 73.561  151.523 42.375  1.00 23.18 ? 213  SER A CA    1 
ATOM   1613  C  C     . SER A 1 213 ? 73.278  152.795 41.583  1.00 22.95 ? 213  SER A C     1 
ATOM   1614  O  O     . SER A 1 213 ? 73.471  152.814 40.367  1.00 21.91 ? 213  SER A O     1 
ATOM   1615  C  CB    . SER A 1 213 ? 72.415  150.536 42.150  1.00 23.22 ? 213  SER A CB    1 
ATOM   1616  O  OG    . SER A 1 213 ? 71.259  150.931 42.871  1.00 21.04 ? 213  SER A OG    1 
ATOM   1617  N  N     . VAL A 1 214 ? 72.826  153.850 42.257  1.00 21.79 ? 214  VAL A N     1 
ATOM   1618  C  CA    . VAL A 1 214 ? 72.492  155.094 41.569  1.00 21.06 ? 214  VAL A CA    1 
ATOM   1619  C  C     . VAL A 1 214 ? 73.713  155.924 41.180  1.00 20.86 ? 214  VAL A C     1 
ATOM   1620  O  O     . VAL A 1 214 ? 74.511  156.318 42.029  1.00 20.61 ? 214  VAL A O     1 
ATOM   1621  C  CB    . VAL A 1 214 ? 71.533  155.961 42.425  1.00 20.22 ? 214  VAL A CB    1 
ATOM   1622  C  CG1   . VAL A 1 214 ? 71.139  157.221 41.659  1.00 21.54 ? 214  VAL A CG1   1 
ATOM   1623  C  CG2   . VAL A 1 214 ? 70.291  155.154 42.790  1.00 19.91 ? 214  VAL A CG2   1 
ATOM   1624  N  N     . GLU A 1 215 ? 73.834  156.200 39.884  1.00 20.08 ? 215  GLU A N     1 
ATOM   1625  C  CA    . GLU A 1 215 ? 74.960  156.965 39.359  1.00 20.54 ? 215  GLU A CA    1 
ATOM   1626  C  C     . GLU A 1 215 ? 74.544  158.340 38.851  1.00 19.60 ? 215  GLU A C     1 
ATOM   1627  O  O     . GLU A 1 215 ? 75.363  159.255 38.779  1.00 19.25 ? 215  GLU A O     1 
ATOM   1628  C  CB    . GLU A 1 215 ? 75.632  156.186 38.218  1.00 20.66 ? 215  GLU A CB    1 
ATOM   1629  C  CG    . GLU A 1 215 ? 76.093  154.791 38.611  1.00 22.28 ? 215  GLU A CG    1 
ATOM   1630  C  CD    . GLU A 1 215 ? 76.654  153.995 37.449  1.00 24.05 ? 215  GLU A CD    1 
ATOM   1631  O  OE1   . GLU A 1 215 ? 77.014  152.823 37.661  1.00 29.06 ? 215  GLU A OE1   1 
ATOM   1632  O  OE2   . GLU A 1 215 ? 76.739  154.531 36.326  1.00 23.63 ? 215  GLU A OE2   1 
ATOM   1633  N  N     . HIS A 1 216 ? 73.273  158.479 38.484  1.00 19.46 ? 216  HIS A N     1 
ATOM   1634  C  CA    . HIS A 1 216 ? 72.767  159.747 37.971  1.00 19.09 ? 216  HIS A CA    1 
ATOM   1635  C  C     . HIS A 1 216 ? 71.350  160.066 38.408  1.00 19.86 ? 216  HIS A C     1 
ATOM   1636  O  O     . HIS A 1 216 ? 70.560  159.181 38.718  1.00 19.77 ? 216  HIS A O     1 
ATOM   1637  C  CB    . HIS A 1 216 ? 72.816  159.759 36.439  1.00 18.91 ? 216  HIS A CB    1 
ATOM   1638  C  CG    . HIS A 1 216 ? 74.195  159.910 35.885  1.00 20.90 ? 216  HIS A CG    1 
ATOM   1639  N  ND1   . HIS A 1 216 ? 74.940  161.055 36.059  1.00 18.21 ? 216  HIS A ND1   1 
ATOM   1640  C  CD2   . HIS A 1 216 ? 74.981  159.049 35.197  1.00 20.78 ? 216  HIS A CD2   1 
ATOM   1641  C  CE1   . HIS A 1 216 ? 76.126  160.895 35.503  1.00 21.06 ? 216  HIS A CE1   1 
ATOM   1642  N  NE2   . HIS A 1 216 ? 76.177  159.686 34.974  1.00 22.02 ? 216  HIS A NE2   1 
ATOM   1643  N  N     . VAL A 1 217 ? 71.040  161.354 38.421  1.00 20.29 ? 217  VAL A N     1 
ATOM   1644  C  CA    . VAL A 1 217 ? 69.713  161.811 38.770  1.00 20.48 ? 217  VAL A CA    1 
ATOM   1645  C  C     . VAL A 1 217 ? 69.307  162.862 37.747  1.00 21.30 ? 217  VAL A C     1 
ATOM   1646  O  O     . VAL A 1 217 ? 69.961  163.895 37.612  1.00 21.98 ? 217  VAL A O     1 
ATOM   1647  C  CB    . VAL A 1 217 ? 69.677  162.427 40.184  1.00 20.08 ? 217  VAL A CB    1 
ATOM   1648  C  CG1   . VAL A 1 217 ? 68.296  162.999 40.468  1.00 18.64 ? 217  VAL A CG1   1 
ATOM   1649  C  CG2   . VAL A 1 217 ? 70.008  161.366 41.220  1.00 16.99 ? 217  VAL A CG2   1 
ATOM   1650  N  N     . ILE A 1 218 ? 68.243  162.579 37.003  1.00 20.01 ? 218  ILE A N     1 
ATOM   1651  C  CA    . ILE A 1 218 ? 67.749  163.525 36.017  1.00 18.91 ? 218  ILE A CA    1 
ATOM   1652  C  C     . ILE A 1 218 ? 66.665  164.282 36.765  1.00 19.70 ? 218  ILE A C     1 
ATOM   1653  O  O     . ILE A 1 218 ? 65.817  163.674 37.420  1.00 19.42 ? 218  ILE A O     1 
ATOM   1654  C  CB    . ILE A 1 218 ? 67.155  162.808 34.779  1.00 16.52 ? 218  ILE A CB    1 
ATOM   1655  C  CG1   . ILE A 1 218 ? 68.272  162.101 33.999  1.00 14.97 ? 218  ILE A CG1   1 
ATOM   1656  C  CG2   . ILE A 1 218 ? 66.433  163.816 33.890  1.00 15.68 ? 218  ILE A CG2   1 
ATOM   1657  C  CD1   . ILE A 1 218 ? 67.793  161.318 32.787  1.00 13.66 ? 218  ILE A CD1   1 
ATOM   1658  N  N     . VAL A 1 219 ? 66.704  165.606 36.678  1.00 18.73 ? 219  VAL A N     1 
ATOM   1659  C  CA    . VAL A 1 219 ? 65.747  166.436 37.389  1.00 18.16 ? 219  VAL A CA    1 
ATOM   1660  C  C     . VAL A 1 219 ? 64.960  167.344 36.465  1.00 19.47 ? 219  VAL A C     1 
ATOM   1661  O  O     . VAL A 1 219 ? 65.532  168.039 35.619  1.00 21.38 ? 219  VAL A O     1 
ATOM   1662  C  CB    . VAL A 1 219 ? 66.477  167.302 38.448  1.00 18.08 ? 219  VAL A CB    1 
ATOM   1663  C  CG1   . VAL A 1 219 ? 65.480  168.151 39.222  1.00 16.89 ? 219  VAL A CG1   1 
ATOM   1664  C  CG2   . VAL A 1 219 ? 67.267  166.394 39.401  1.00 16.35 ? 219  VAL A CG2   1 
ATOM   1665  N  N     . LEU A 1 220 ? 63.641  167.327 36.625  1.00 18.00 ? 220  LEU A N     1 
ATOM   1666  C  CA    . LEU A 1 220 ? 62.764  168.179 35.832  1.00 18.37 ? 220  LEU A CA    1 
ATOM   1667  C  C     . LEU A 1 220 ? 62.482  169.433 36.657  1.00 18.48 ? 220  LEU A C     1 
ATOM   1668  O  O     . LEU A 1 220 ? 62.084  169.337 37.818  1.00 18.72 ? 220  LEU A O     1 
ATOM   1669  C  CB    . LEU A 1 220 ? 61.441  167.462 35.535  1.00 16.77 ? 220  LEU A CB    1 
ATOM   1670  C  CG    . LEU A 1 220 ? 60.281  168.341 35.046  1.00 16.60 ? 220  LEU A CG    1 
ATOM   1671  C  CD1   . LEU A 1 220 ? 60.524  168.764 33.610  1.00 19.01 ? 220  LEU A CD1   1 
ATOM   1672  C  CD2   . LEU A 1 220 ? 58.974  167.586 35.151  1.00 15.34 ? 220  LEU A CD2   1 
ATOM   1673  N  N     . LYS A 1 221 ? 62.694  170.607 36.079  1.00 17.60 ? 221  LYS A N     1 
ATOM   1674  C  CA    . LYS A 1 221 ? 62.418  171.831 36.815  1.00 18.57 ? 221  LYS A CA    1 
ATOM   1675  C  C     . LYS A 1 221 ? 60.939  172.167 36.666  1.00 16.48 ? 221  LYS A C     1 
ATOM   1676  O  O     . LYS A 1 221 ? 60.519  172.734 35.662  1.00 14.89 ? 221  LYS A O     1 
ATOM   1677  C  CB    . LYS A 1 221 ? 63.281  172.995 36.301  1.00 22.33 ? 221  LYS A CB    1 
ATOM   1678  C  CG    . LYS A 1 221 ? 63.227  174.222 37.206  1.00 24.02 ? 221  LYS A CG    1 
ATOM   1679  C  CD    . LYS A 1 221 ? 64.301  175.241 36.882  1.00 27.11 ? 221  LYS A CD    1 
ATOM   1680  C  CE    . LYS A 1 221 ? 63.952  176.065 35.657  1.00 29.84 ? 221  LYS A CE    1 
ATOM   1681  N  NZ    . LYS A 1 221 ? 64.891  177.224 35.511  1.00 33.97 ? 221  LYS A NZ    1 
ATOM   1682  N  N     . ARG A 1 222 ? 60.151  171.804 37.670  1.00 15.83 ? 222  ARG A N     1 
ATOM   1683  C  CA    . ARG A 1 222 ? 58.718  172.062 37.652  1.00 14.23 ? 222  ARG A CA    1 
ATOM   1684  C  C     . ARG A 1 222 ? 58.354  173.341 38.396  1.00 14.21 ? 222  ARG A C     1 
ATOM   1685  O  O     . ARG A 1 222 ? 57.445  174.060 37.984  1.00 14.37 ? 222  ARG A O     1 
ATOM   1686  C  CB    . ARG A 1 222 ? 57.961  170.887 38.273  1.00 13.61 ? 222  ARG A CB    1 
ATOM   1687  C  CG    . ARG A 1 222 ? 56.498  171.177 38.537  1.00 12.19 ? 222  ARG A CG    1 
ATOM   1688  C  CD    . ARG A 1 222 ? 55.716  171.260 37.239  1.00 13.29 ? 222  ARG A CD    1 
ATOM   1689  N  NE    . ARG A 1 222 ? 54.308  171.597 37.452  1.00 14.01 ? 222  ARG A NE    1 
ATOM   1690  C  CZ    . ARG A 1 222 ? 53.849  172.837 37.583  1.00 16.70 ? 222  ARG A CZ    1 
ATOM   1691  N  NH1   . ARG A 1 222 ? 54.684  173.873 37.529  1.00 16.23 ? 222  ARG A NH1   1 
ATOM   1692  N  NH2   . ARG A 1 222 ? 52.549  173.044 37.750  1.00 16.74 ? 222  ARG A NH2   1 
ATOM   1693  N  N     . THR A 1 223 ? 59.052  173.620 39.492  1.00 14.04 ? 223  THR A N     1 
ATOM   1694  C  CA    . THR A 1 223 ? 58.765  174.823 40.265  1.00 15.85 ? 223  THR A CA    1 
ATOM   1695  C  C     . THR A 1 223 ? 59.919  175.820 40.268  1.00 17.23 ? 223  THR A C     1 
ATOM   1696  O  O     . THR A 1 223 ? 59.712  177.011 40.468  1.00 18.82 ? 223  THR A O     1 
ATOM   1697  C  CB    . THR A 1 223 ? 58.390  174.482 41.728  1.00 14.39 ? 223  THR A CB    1 
ATOM   1698  O  OG1   . THR A 1 223 ? 59.555  174.037 42.434  1.00 12.55 ? 223  THR A OG1   1 
ATOM   1699  C  CG2   . THR A 1 223 ? 57.329  173.372 41.760  1.00 12.51 ? 223  THR A CG2   1 
ATOM   1700  N  N     . GLY A 1 224 ? 61.134  175.339 40.042  1.00 19.59 ? 224  GLY A N     1 
ATOM   1701  C  CA    . GLY A 1 224 ? 62.277  176.235 40.025  1.00 21.19 ? 224  GLY A CA    1 
ATOM   1702  C  C     . GLY A 1 224 ? 62.747  176.620 41.417  1.00 23.02 ? 224  GLY A C     1 
ATOM   1703  O  O     . GLY A 1 224 ? 63.502  177.579 41.588  1.00 21.52 ? 224  GLY A O     1 
ATOM   1704  N  N     . SER A 1 225 ? 62.303  175.874 42.422  1.00 24.94 ? 225  SER A N     1 
ATOM   1705  C  CA    . SER A 1 225 ? 62.696  176.151 43.801  1.00 28.40 ? 225  SER A CA    1 
ATOM   1706  C  C     . SER A 1 225 ? 64.177  175.892 44.038  1.00 29.03 ? 225  SER A C     1 
ATOM   1707  O  O     . SER A 1 225 ? 64.805  175.113 43.320  1.00 29.88 ? 225  SER A O     1 
ATOM   1708  C  CB    . SER A 1 225 ? 61.874  175.294 44.762  1.00 28.51 ? 225  SER A CB    1 
ATOM   1709  O  OG    . SER A 1 225 ? 60.520  175.708 44.760  1.00 30.94 ? 225  SER A OG    1 
ATOM   1710  N  N     . ASP A 1 226 ? 64.734  176.550 45.047  1.00 30.45 ? 226  ASP A N     1 
ATOM   1711  C  CA    . ASP A 1 226 ? 66.142  176.364 45.370  1.00 32.06 ? 226  ASP A CA    1 
ATOM   1712  C  C     . ASP A 1 226 ? 66.365  174.949 45.882  1.00 31.81 ? 226  ASP A C     1 
ATOM   1713  O  O     . ASP A 1 226 ? 65.784  174.539 46.889  1.00 32.37 ? 226  ASP A O     1 
ATOM   1714  C  CB    . ASP A 1 226 ? 66.593  177.374 46.436  1.00 33.98 ? 226  ASP A CB    1 
ATOM   1715  C  CG    . ASP A 1 226 ? 66.720  178.786 45.888  1.00 36.41 ? 226  ASP A CG    1 
ATOM   1716  O  OD1   . ASP A 1 226 ? 67.468  178.977 44.900  1.00 37.81 ? 226  ASP A OD1   1 
ATOM   1717  O  OD2   . ASP A 1 226 ? 66.075  179.704 46.443  1.00 37.77 ? 226  ASP A OD2   1 
ATOM   1718  N  N     . ILE A 1 227 ? 67.192  174.196 45.171  1.00 30.17 ? 227  ILE A N     1 
ATOM   1719  C  CA    . ILE A 1 227 ? 67.499  172.833 45.579  1.00 29.97 ? 227  ILE A CA    1 
ATOM   1720  C  C     . ILE A 1 227 ? 69.007  172.644 45.594  1.00 28.50 ? 227  ILE A C     1 
ATOM   1721  O  O     . ILE A 1 227 ? 69.745  173.430 45.001  1.00 26.10 ? 227  ILE A O     1 
ATOM   1722  C  CB    . ILE A 1 227 ? 66.863  171.781 44.624  1.00 30.21 ? 227  ILE A CB    1 
ATOM   1723  C  CG1   . ILE A 1 227 ? 67.266  172.071 43.176  1.00 31.34 ? 227  ILE A CG1   1 
ATOM   1724  C  CG2   . ILE A 1 227 ? 65.349  171.784 44.778  1.00 28.16 ? 227  ILE A CG2   1 
ATOM   1725  C  CD1   . ILE A 1 227 ? 66.839  170.991 42.187  1.00 32.48 ? 227  ILE A CD1   1 
ATOM   1726  N  N     . ASP A 1 228 ? 69.459  171.613 46.300  1.00 28.43 ? 228  ASP A N     1 
ATOM   1727  C  CA    . ASP A 1 228 ? 70.877  171.309 46.375  1.00 27.86 ? 228  ASP A CA    1 
ATOM   1728  C  C     . ASP A 1 228 ? 71.236  170.576 45.098  1.00 27.79 ? 228  ASP A C     1 
ATOM   1729  O  O     . ASP A 1 228 ? 70.431  169.813 44.567  1.00 27.58 ? 228  ASP A O     1 
ATOM   1730  C  CB    . ASP A 1 228 ? 71.168  170.447 47.603  1.00 28.47 ? 228  ASP A CB    1 
ATOM   1731  C  CG    . ASP A 1 228 ? 71.051  171.233 48.899  1.00 30.58 ? 228  ASP A CG    1 
ATOM   1732  O  OD1   . ASP A 1 228 ? 70.851  170.610 49.968  1.00 30.52 ? 228  ASP A OD1   1 
ATOM   1733  O  OD2   . ASP A 1 228 ? 71.167  172.482 48.847  1.00 30.51 ? 228  ASP A OD2   1 
ATOM   1734  N  N     . TRP A 1 229 ? 72.437  170.822 44.593  1.00 27.58 ? 229  TRP A N     1 
ATOM   1735  C  CA    . TRP A 1 229 ? 72.864  170.188 43.359  1.00 27.85 ? 229  TRP A CA    1 
ATOM   1736  C  C     . TRP A 1 229 ? 74.209  169.503 43.521  1.00 28.85 ? 229  TRP A C     1 
ATOM   1737  O  O     . TRP A 1 229 ? 75.123  170.039 44.155  1.00 29.03 ? 229  TRP A O     1 
ATOM   1738  C  CB    . TRP A 1 229 ? 72.945  171.236 42.248  1.00 27.97 ? 229  TRP A CB    1 
ATOM   1739  C  CG    . TRP A 1 229 ? 72.873  170.670 40.860  1.00 30.34 ? 229  TRP A CG    1 
ATOM   1740  C  CD1   . TRP A 1 229 ? 73.911  170.481 39.984  1.00 30.25 ? 229  TRP A CD1   1 
ATOM   1741  C  CD2   . TRP A 1 229 ? 71.693  170.214 40.185  1.00 30.58 ? 229  TRP A CD2   1 
ATOM   1742  N  NE1   . TRP A 1 229 ? 73.445  169.938 38.808  1.00 29.85 ? 229  TRP A NE1   1 
ATOM   1743  C  CE2   . TRP A 1 229 ? 72.089  169.763 38.906  1.00 30.33 ? 229  TRP A CE2   1 
ATOM   1744  C  CE3   . TRP A 1 229 ? 70.339  170.141 40.539  1.00 29.67 ? 229  TRP A CE3   1 
ATOM   1745  C  CZ2   . TRP A 1 229 ? 71.177  169.247 37.981  1.00 30.74 ? 229  TRP A CZ2   1 
ATOM   1746  C  CZ3   . TRP A 1 229 ? 69.432  169.625 39.615  1.00 29.83 ? 229  TRP A CZ3   1 
ATOM   1747  C  CH2   . TRP A 1 229 ? 69.857  169.187 38.356  1.00 28.95 ? 229  TRP A CH2   1 
ATOM   1748  N  N     . GLN A 1 230 ? 74.317  168.309 42.949  1.00 29.57 ? 230  GLN A N     1 
ATOM   1749  C  CA    . GLN A 1 230 ? 75.560  167.551 42.998  1.00 30.62 ? 230  GLN A CA    1 
ATOM   1750  C  C     . GLN A 1 230 ? 76.047  167.416 41.562  1.00 30.87 ? 230  GLN A C     1 
ATOM   1751  O  O     . GLN A 1 230 ? 75.555  166.580 40.802  1.00 29.99 ? 230  GLN A O     1 
ATOM   1752  C  CB    . GLN A 1 230 ? 75.328  166.173 43.626  1.00 32.32 ? 230  GLN A CB    1 
ATOM   1753  C  CG    . GLN A 1 230 ? 76.605  165.362 43.820  1.00 34.62 ? 230  GLN A CG    1 
ATOM   1754  C  CD    . GLN A 1 230 ? 76.455  164.279 44.876  1.00 37.24 ? 230  GLN A CD    1 
ATOM   1755  O  OE1   . GLN A 1 230 ? 76.184  164.574 46.042  1.00 40.15 ? 230  GLN A OE1   1 
ATOM   1756  N  NE2   . GLN A 1 230 ? 76.635  163.021 44.476  1.00 37.25 ? 230  GLN A NE2   1 
ATOM   1757  N  N     . GLU A 1 231 ? 77.001  168.266 41.192  1.00 30.88 ? 231  GLU A N     1 
ATOM   1758  C  CA    . GLU A 1 231 ? 77.551  168.263 39.845  1.00 31.07 ? 231  GLU A CA    1 
ATOM   1759  C  C     . GLU A 1 231 ? 78.054  166.874 39.469  1.00 30.13 ? 231  GLU A C     1 
ATOM   1760  O  O     . GLU A 1 231 ? 78.711  166.197 40.265  1.00 30.51 ? 231  GLU A O     1 
ATOM   1761  C  CB    . GLU A 1 231 ? 78.683  169.287 39.736  1.00 33.54 ? 231  GLU A CB    1 
ATOM   1762  C  CG    . GLU A 1 231 ? 78.659  170.092 38.442  1.00 36.27 ? 231  GLU A CG    1 
ATOM   1763  C  CD    . GLU A 1 231 ? 77.355  170.864 38.258  1.00 38.66 ? 231  GLU A CD    1 
ATOM   1764  O  OE1   . GLU A 1 231 ? 77.100  171.817 39.032  1.00 39.04 ? 231  GLU A OE1   1 
ATOM   1765  O  OE2   . GLU A 1 231 ? 76.579  170.512 37.339  1.00 41.88 ? 231  GLU A OE2   1 
ATOM   1766  N  N     . GLY A 1 232 ? 77.738  166.448 38.253  1.00 28.63 ? 232  GLY A N     1 
ATOM   1767  C  CA    . GLY A 1 232 ? 78.159  165.135 37.811  1.00 26.89 ? 232  GLY A CA    1 
ATOM   1768  C  C     . GLY A 1 232 ? 77.035  164.126 37.954  1.00 25.94 ? 232  GLY A C     1 
ATOM   1769  O  O     . GLY A 1 232 ? 76.651  163.473 36.984  1.00 28.40 ? 232  GLY A O     1 
ATOM   1770  N  N     . ARG A 1 233 ? 76.493  163.998 39.160  1.00 22.73 ? 233  ARG A N     1 
ATOM   1771  C  CA    . ARG A 1 233 ? 75.408  163.055 39.386  1.00 20.61 ? 233  ARG A CA    1 
ATOM   1772  C  C     . ARG A 1 233 ? 74.082  163.604 38.857  1.00 19.69 ? 233  ARG A C     1 
ATOM   1773  O  O     . ARG A 1 233 ? 73.392  162.943 38.078  1.00 18.62 ? 233  ARG A O     1 
ATOM   1774  C  CB    . ARG A 1 233 ? 75.273  162.746 40.876  1.00 19.90 ? 233  ARG A CB    1 
ATOM   1775  C  CG    . ARG A 1 233 ? 74.339  161.583 41.191  1.00 19.81 ? 233  ARG A CG    1 
ATOM   1776  C  CD    . ARG A 1 233 ? 73.957  161.597 42.660  1.00 19.50 ? 233  ARG A CD    1 
ATOM   1777  N  NE    . ARG A 1 233 ? 73.205  162.800 43.003  1.00 19.10 ? 233  ARG A NE    1 
ATOM   1778  C  CZ    . ARG A 1 233 ? 72.837  163.128 44.234  1.00 19.64 ? 233  ARG A CZ    1 
ATOM   1779  N  NH1   . ARG A 1 233 ? 73.153  162.340 45.252  1.00 19.06 ? 233  ARG A NH1   1 
ATOM   1780  N  NH2   . ARG A 1 233 ? 72.154  164.248 44.447  1.00 17.79 ? 233  ARG A NH2   1 
ATOM   1781  N  N     . ASP A 1 234 ? 73.742  164.821 39.268  1.00 18.98 ? 234  ASP A N     1 
ATOM   1782  C  CA    . ASP A 1 234 ? 72.488  165.439 38.856  1.00 19.74 ? 234  ASP A CA    1 
ATOM   1783  C  C     . ASP A 1 234 ? 72.545  166.116 37.491  1.00 20.10 ? 234  ASP A C     1 
ATOM   1784  O  O     . ASP A 1 234 ? 73.519  166.788 37.158  1.00 21.27 ? 234  ASP A O     1 
ATOM   1785  C  CB    . ASP A 1 234 ? 72.035  166.436 39.926  1.00 19.42 ? 234  ASP A CB    1 
ATOM   1786  C  CG    . ASP A 1 234 ? 71.958  165.804 41.303  1.00 21.44 ? 234  ASP A CG    1 
ATOM   1787  O  OD1   . ASP A 1 234 ? 71.618  164.602 41.376  1.00 21.72 ? 234  ASP A OD1   1 
ATOM   1788  O  OD2   . ASP A 1 234 ? 72.226  166.499 42.311  1.00 22.38 ? 234  ASP A OD2   1 
ATOM   1789  N  N     . LEU A 1 235 ? 71.484  165.930 36.710  1.00 20.65 ? 235  LEU A N     1 
ATOM   1790  C  CA    . LEU A 1 235 ? 71.392  166.503 35.369  1.00 20.27 ? 235  LEU A CA    1 
ATOM   1791  C  C     . LEU A 1 235 ? 69.984  167.047 35.130  1.00 20.73 ? 235  LEU A C     1 
ATOM   1792  O  O     . LEU A 1 235 ? 69.005  166.431 35.542  1.00 21.59 ? 235  LEU A O     1 
ATOM   1793  C  CB    . LEU A 1 235 ? 71.714  165.431 34.320  1.00 19.10 ? 235  LEU A CB    1 
ATOM   1794  C  CG    . LEU A 1 235 ? 73.075  164.721 34.407  1.00 20.30 ? 235  LEU A CG    1 
ATOM   1795  C  CD1   . LEU A 1 235 ? 73.139  163.605 33.377  1.00 18.19 ? 235  LEU A CD1   1 
ATOM   1796  C  CD2   . LEU A 1 235 ? 74.198  165.715 34.171  1.00 17.69 ? 235  LEU A CD2   1 
ATOM   1797  N  N     . TRP A 1 236 ? 69.890  168.200 34.471  1.00 20.91 ? 236  TRP A N     1 
ATOM   1798  C  CA    . TRP A 1 236 ? 68.597  168.810 34.183  1.00 21.90 ? 236  TRP A CA    1 
ATOM   1799  C  C     . TRP A 1 236 ? 67.918  168.121 33.010  1.00 24.22 ? 236  TRP A C     1 
ATOM   1800  O  O     . TRP A 1 236 ? 68.541  167.862 31.975  1.00 23.22 ? 236  TRP A O     1 
ATOM   1801  C  CB    . TRP A 1 236 ? 68.744  170.306 33.866  1.00 21.80 ? 236  TRP A CB    1 
ATOM   1802  C  CG    . TRP A 1 236 ? 69.059  171.160 35.053  1.00 22.49 ? 236  TRP A CG    1 
ATOM   1803  C  CD1   . TRP A 1 236 ? 70.231  171.814 35.306  1.00 24.28 ? 236  TRP A CD1   1 
ATOM   1804  C  CD2   . TRP A 1 236 ? 68.194  171.443 36.162  1.00 20.76 ? 236  TRP A CD2   1 
ATOM   1805  N  NE1   . TRP A 1 236 ? 70.151  172.488 36.504  1.00 24.36 ? 236  TRP A NE1   1 
ATOM   1806  C  CE2   . TRP A 1 236 ? 68.915  172.276 37.051  1.00 22.57 ? 236  TRP A CE2   1 
ATOM   1807  C  CE3   . TRP A 1 236 ? 66.883  171.072 36.491  1.00 17.94 ? 236  TRP A CE3   1 
ATOM   1808  C  CZ2   . TRP A 1 236 ? 68.368  172.746 38.251  1.00 22.22 ? 236  TRP A CZ2   1 
ATOM   1809  C  CZ3   . TRP A 1 236 ? 66.334  171.536 37.681  1.00 19.99 ? 236  TRP A CZ3   1 
ATOM   1810  C  CH2   . TRP A 1 236 ? 67.080  172.367 38.551  1.00 23.53 ? 236  TRP A CH2   1 
ATOM   1811  N  N     . TRP A 1 237 ? 66.632  167.831 33.183  1.00 25.66 ? 237  TRP A N     1 
ATOM   1812  C  CA    . TRP A 1 237 ? 65.841  167.178 32.150  1.00 26.31 ? 237  TRP A CA    1 
ATOM   1813  C  C     . TRP A 1 237 ? 65.923  167.955 30.841  1.00 27.81 ? 237  TRP A C     1 
ATOM   1814  O  O     . TRP A 1 237 ? 66.243  167.394 29.794  1.00 28.63 ? 237  TRP A O     1 
ATOM   1815  C  CB    . TRP A 1 237 ? 64.378  167.068 32.605  1.00 23.74 ? 237  TRP A CB    1 
ATOM   1816  C  CG    . TRP A 1 237 ? 63.448  166.514 31.558  1.00 23.58 ? 237  TRP A CG    1 
ATOM   1817  C  CD1   . TRP A 1 237 ? 63.061  167.123 30.394  1.00 23.28 ? 237  TRP A CD1   1 
ATOM   1818  C  CD2   . TRP A 1 237 ? 62.790  165.236 31.576  1.00 21.74 ? 237  TRP A CD2   1 
ATOM   1819  N  NE1   . TRP A 1 237 ? 62.208  166.306 29.692  1.00 21.62 ? 237  TRP A NE1   1 
ATOM   1820  C  CE2   . TRP A 1 237 ? 62.025  165.144 30.393  1.00 20.75 ? 237  TRP A CE2   1 
ATOM   1821  C  CE3   . TRP A 1 237 ? 62.774  164.162 32.476  1.00 21.83 ? 237  TRP A CE3   1 
ATOM   1822  C  CZ2   . TRP A 1 237 ? 61.250  164.020 30.086  1.00 19.98 ? 237  TRP A CZ2   1 
ATOM   1823  C  CZ3   . TRP A 1 237 ? 62.003  163.042 32.169  1.00 22.08 ? 237  TRP A CZ3   1 
ATOM   1824  C  CH2   . TRP A 1 237 ? 61.251  162.981 30.981  1.00 20.98 ? 237  TRP A CH2   1 
ATOM   1825  N  N     . ARG A 1 238 ? 65.633  169.250 30.909  1.00 28.22 ? 238  ARG A N     1 
ATOM   1826  C  CA    . ARG A 1 238 ? 65.654  170.110 29.731  1.00 30.24 ? 238  ARG A CA    1 
ATOM   1827  C  C     . ARG A 1 238 ? 66.985  170.082 28.974  1.00 31.17 ? 238  ARG A C     1 
ATOM   1828  O  O     . ARG A 1 238 ? 67.000  169.998 27.745  1.00 31.75 ? 238  ARG A O     1 
ATOM   1829  C  CB    . ARG A 1 238 ? 65.314  171.542 30.145  1.00 32.49 ? 238  ARG A CB    1 
ATOM   1830  C  CG    . ARG A 1 238 ? 65.186  172.539 29.008  1.00 36.34 ? 238  ARG A CG    1 
ATOM   1831  C  CD    . ARG A 1 238 ? 64.615  173.847 29.546  1.00 41.49 ? 238  ARG A CD    1 
ATOM   1832  N  NE    . ARG A 1 238 ? 64.680  174.959 28.599  1.00 43.95 ? 238  ARG A NE    1 
ATOM   1833  C  CZ    . ARG A 1 238 ? 64.008  175.016 27.454  1.00 46.64 ? 238  ARG A CZ    1 
ATOM   1834  N  NH1   . ARG A 1 238 ? 63.210  174.015 27.092  1.00 48.22 ? 238  ARG A NH1   1 
ATOM   1835  N  NH2   . ARG A 1 238 ? 64.118  176.086 26.676  1.00 46.80 ? 238  ARG A NH2   1 
ATOM   1836  N  N     . ASP A 1 239 ? 68.100  170.143 29.700  1.00 30.51 ? 239  ASP A N     1 
ATOM   1837  C  CA    . ASP A 1 239 ? 69.413  170.129 29.059  1.00 30.41 ? 239  ASP A CA    1 
ATOM   1838  C  C     . ASP A 1 239 ? 69.715  168.835 28.316  1.00 29.77 ? 239  ASP A C     1 
ATOM   1839  O  O     . ASP A 1 239 ? 70.367  168.856 27.274  1.00 29.62 ? 239  ASP A O     1 
ATOM   1840  C  CB    . ASP A 1 239 ? 70.529  170.383 30.078  1.00 31.24 ? 239  ASP A CB    1 
ATOM   1841  C  CG    . ASP A 1 239 ? 70.498  171.793 30.643  1.00 33.36 ? 239  ASP A CG    1 
ATOM   1842  O  OD1   . ASP A 1 239 ? 70.069  172.726 29.922  1.00 35.16 ? 239  ASP A OD1   1 
ATOM   1843  O  OD2   . ASP A 1 239 ? 70.920  171.968 31.806  1.00 33.05 ? 239  ASP A OD2   1 
ATOM   1844  N  N     . LEU A 1 240 ? 69.252  167.710 28.851  1.00 28.98 ? 240  LEU A N     1 
ATOM   1845  C  CA    . LEU A 1 240 ? 69.503  166.424 28.215  1.00 28.55 ? 240  LEU A CA    1 
ATOM   1846  C  C     . LEU A 1 240 ? 68.627  166.143 26.992  1.00 28.96 ? 240  LEU A C     1 
ATOM   1847  O  O     . LEU A 1 240 ? 69.138  165.838 25.908  1.00 29.32 ? 240  LEU A O     1 
ATOM   1848  C  CB    . LEU A 1 240 ? 69.332  165.286 29.226  1.00 27.40 ? 240  LEU A CB    1 
ATOM   1849  C  CG    . LEU A 1 240 ? 70.369  165.143 30.339  1.00 26.86 ? 240  LEU A CG    1 
ATOM   1850  C  CD1   . LEU A 1 240 ? 70.030  163.927 31.190  1.00 27.31 ? 240  LEU A CD1   1 
ATOM   1851  C  CD2   . LEU A 1 240 ? 71.757  164.986 29.741  1.00 25.03 ? 240  LEU A CD2   1 
ATOM   1852  N  N     . ILE A 1 241 ? 67.313  166.255 27.164  1.00 28.42 ? 241  ILE A N     1 
ATOM   1853  C  CA    . ILE A 1 241 ? 66.381  165.967 26.081  1.00 28.52 ? 241  ILE A CA    1 
ATOM   1854  C  C     . ILE A 1 241 ? 66.587  166.844 24.848  1.00 30.09 ? 241  ILE A C     1 
ATOM   1855  O  O     . ILE A 1 241 ? 66.345  166.406 23.723  1.00 30.55 ? 241  ILE A O     1 
ATOM   1856  C  CB    . ILE A 1 241 ? 64.910  166.090 26.559  1.00 26.48 ? 241  ILE A CB    1 
ATOM   1857  C  CG1   . ILE A 1 241 ? 63.988  165.307 25.619  1.00 26.59 ? 241  ILE A CG1   1 
ATOM   1858  C  CG2   . ILE A 1 241 ? 64.487  167.555 26.593  1.00 24.12 ? 241  ILE A CG2   1 
ATOM   1859  C  CD1   . ILE A 1 241 ? 62.545  165.206 26.103  1.00 25.20 ? 241  ILE A CD1   1 
ATOM   1860  N  N     . GLU A 1 242 ? 67.040  168.077 25.056  1.00 31.33 ? 242  GLU A N     1 
ATOM   1861  C  CA    . GLU A 1 242 ? 67.270  168.992 23.943  1.00 31.77 ? 242  GLU A CA    1 
ATOM   1862  C  C     . GLU A 1 242 ? 68.535  168.646 23.166  1.00 31.05 ? 242  GLU A C     1 
ATOM   1863  O  O     . GLU A 1 242 ? 68.746  169.146 22.066  1.00 32.13 ? 242  GLU A O     1 
ATOM   1864  C  CB    . GLU A 1 242 ? 67.347  170.440 24.438  1.00 33.11 ? 242  GLU A CB    1 
ATOM   1865  C  CG    . GLU A 1 242 ? 66.035  170.969 25.002  1.00 35.55 ? 242  GLU A CG    1 
ATOM   1866  C  CD    . GLU A 1 242 ? 66.021  172.480 25.136  1.00 37.72 ? 242  GLU A CD    1 
ATOM   1867  O  OE1   . GLU A 1 242 ? 66.945  173.030 25.774  1.00 39.79 ? 242  GLU A OE1   1 
ATOM   1868  O  OE2   . GLU A 1 242 ? 65.086  173.122 24.607  1.00 38.01 ? 242  GLU A OE2   1 
ATOM   1869  N  N     . LYS A 1 243 ? 69.376  167.791 23.735  1.00 30.15 ? 243  LYS A N     1 
ATOM   1870  C  CA    . LYS A 1 243 ? 70.607  167.397 23.062  1.00 29.97 ? 243  LYS A CA    1 
ATOM   1871  C  C     . LYS A 1 243 ? 70.429  166.049 22.366  1.00 30.30 ? 243  LYS A C     1 
ATOM   1872  O  O     . LYS A 1 243 ? 71.279  165.629 21.581  1.00 30.84 ? 243  LYS A O     1 
ATOM   1873  C  CB    . LYS A 1 243 ? 71.754  167.323 24.071  1.00 29.00 ? 243  LYS A CB    1 
ATOM   1874  N  N     . ALA A 1 244 ? 69.316  165.378 22.651  1.00 29.57 ? 244  ALA A N     1 
ATOM   1875  C  CA    . ALA A 1 244 ? 69.041  164.072 22.064  1.00 27.86 ? 244  ALA A CA    1 
ATOM   1876  C  C     . ALA A 1 244 ? 68.333  164.148 20.723  1.00 26.98 ? 244  ALA A C     1 
ATOM   1877  O  O     . ALA A 1 244 ? 67.577  165.083 20.446  1.00 27.51 ? 244  ALA A O     1 
ATOM   1878  C  CB    . ALA A 1 244 ? 68.220  163.231 23.024  1.00 27.78 ? 244  ALA A CB    1 
ATOM   1879  N  N     . SER A 1 245 ? 68.599  163.151 19.887  1.00 25.52 ? 245  SER A N     1 
ATOM   1880  C  CA    . SER A 1 245 ? 67.988  163.068 18.570  1.00 24.66 ? 245  SER A CA    1 
ATOM   1881  C  C     . SER A 1 245 ? 66.546  162.581 18.686  1.00 24.19 ? 245  SER A C     1 
ATOM   1882  O  O     . SER A 1 245 ? 66.248  161.685 19.475  1.00 23.96 ? 245  SER A O     1 
ATOM   1883  C  CB    . SER A 1 245 ? 68.772  162.098 17.696  1.00 23.66 ? 245  SER A CB    1 
ATOM   1884  O  OG    . SER A 1 245 ? 67.985  161.672 16.599  1.00 27.81 ? 245  SER A OG    1 
ATOM   1885  N  N     . PRO A 1 246 ? 65.630  163.182 17.916  1.00 23.14 ? 246  PRO A N     1 
ATOM   1886  C  CA    . PRO A 1 246 ? 64.225  162.773 17.954  1.00 23.51 ? 246  PRO A CA    1 
ATOM   1887  C  C     . PRO A 1 246 ? 64.008  161.575 17.030  1.00 24.00 ? 246  PRO A C     1 
ATOM   1888  O  O     . PRO A 1 246 ? 62.873  161.221 16.705  1.00 25.70 ? 246  PRO A O     1 
ATOM   1889  C  CB    . PRO A 1 246 ? 63.496  164.022 17.477  1.00 22.68 ? 246  PRO A CB    1 
ATOM   1890  C  CG    . PRO A 1 246 ? 64.438  164.559 16.450  1.00 24.17 ? 246  PRO A CG    1 
ATOM   1891  C  CD    . PRO A 1 246 ? 65.797  164.416 17.128  1.00 23.83 ? 246  PRO A CD    1 
ATOM   1892  N  N     . GLU A 1 247 ? 65.115  160.961 16.612  1.00 25.62 ? 247  GLU A N     1 
ATOM   1893  C  CA    . GLU A 1 247 ? 65.095  159.793 15.728  1.00 27.38 ? 247  GLU A CA    1 
ATOM   1894  C  C     . GLU A 1 247 ? 65.439  158.532 16.516  1.00 25.59 ? 247  GLU A C     1 
ATOM   1895  O  O     . GLU A 1 247 ? 66.582  158.358 16.938  1.00 25.31 ? 247  GLU A O     1 
ATOM   1896  C  CB    . GLU A 1 247 ? 66.142  159.927 14.618  1.00 30.69 ? 247  GLU A CB    1 
ATOM   1897  C  CG    . GLU A 1 247 ? 66.111  161.227 13.837  1.00 36.13 ? 247  GLU A CG    1 
ATOM   1898  C  CD    . GLU A 1 247 ? 65.003  161.257 12.814  1.00 38.35 ? 247  GLU A CD    1 
ATOM   1899  O  OE1   . GLU A 1 247 ? 65.029  160.420 11.884  1.00 40.47 ? 247  GLU A OE1   1 
ATOM   1900  O  OE2   . GLU A 1 247 ? 64.104  162.114 12.943  1.00 41.41 ? 247  GLU A OE2   1 
ATOM   1901  N  N     . HIS A 1 248 ? 64.467  157.653 16.715  1.00 23.46 ? 248  HIS A N     1 
ATOM   1902  C  CA    . HIS A 1 248 ? 64.746  156.417 17.430  1.00 22.78 ? 248  HIS A CA    1 
ATOM   1903  C  C     . HIS A 1 248 ? 63.891  155.260 16.945  1.00 22.34 ? 248  HIS A C     1 
ATOM   1904  O  O     . HIS A 1 248 ? 62.666  155.319 16.968  1.00 23.56 ? 248  HIS A O     1 
ATOM   1905  C  CB    . HIS A 1 248 ? 64.577  156.594 18.941  1.00 21.16 ? 248  HIS A CB    1 
ATOM   1906  C  CG    . HIS A 1 248 ? 64.949  155.372 19.722  1.00 21.15 ? 248  HIS A CG    1 
ATOM   1907  N  ND1   . HIS A 1 248 ? 64.091  154.304 19.886  1.00 19.26 ? 248  HIS A ND1   1 
ATOM   1908  C  CD2   . HIS A 1 248 ? 66.116  155.009 20.304  1.00 20.81 ? 248  HIS A CD2   1 
ATOM   1909  C  CE1   . HIS A 1 248 ? 64.715  153.334 20.529  1.00 19.44 ? 248  HIS A CE1   1 
ATOM   1910  N  NE2   . HIS A 1 248 ? 65.945  153.736 20.793  1.00 19.55 ? 248  HIS A NE2   1 
ATOM   1911  N  N     . GLN A 1 249 ? 64.562  154.206 16.503  1.00 23.70 ? 249  GLN A N     1 
ATOM   1912  C  CA    . GLN A 1 249 ? 63.902  153.016 15.990  1.00 25.48 ? 249  GLN A CA    1 
ATOM   1913  C  C     . GLN A 1 249 ? 63.630  152.003 17.094  1.00 24.03 ? 249  GLN A C     1 
ATOM   1914  O  O     . GLN A 1 249 ? 64.550  151.556 17.776  1.00 23.28 ? 249  GLN A O     1 
ATOM   1915  C  CB    . GLN A 1 249 ? 64.779  152.385 14.914  1.00 27.75 ? 249  GLN A CB    1 
ATOM   1916  C  CG    . GLN A 1 249 ? 65.140  153.358 13.814  1.00 33.64 ? 249  GLN A CG    1 
ATOM   1917  C  CD    . GLN A 1 249 ? 63.920  153.813 13.041  1.00 37.43 ? 249  GLN A CD    1 
ATOM   1918  O  OE1   . GLN A 1 249 ? 63.774  155.000 12.723  1.00 39.38 ? 249  GLN A OE1   1 
ATOM   1919  N  NE2   . GLN A 1 249 ? 63.032  152.867 12.728  1.00 37.17 ? 249  GLN A NE2   1 
ATOM   1920  N  N     . PRO A 1 250 ? 62.356  151.630 17.285  1.00 24.07 ? 250  PRO A N     1 
ATOM   1921  C  CA    . PRO A 1 250 ? 62.006  150.659 18.327  1.00 24.84 ? 250  PRO A CA    1 
ATOM   1922  C  C     . PRO A 1 250 ? 62.580  149.276 18.022  1.00 24.28 ? 250  PRO A C     1 
ATOM   1923  O  O     . PRO A 1 250 ? 62.476  148.787 16.895  1.00 22.57 ? 250  PRO A O     1 
ATOM   1924  C  CB    . PRO A 1 250 ? 60.471  150.638 18.302  1.00 24.45 ? 250  PRO A CB    1 
ATOM   1925  C  CG    . PRO A 1 250 ? 60.090  151.927 17.648  1.00 25.79 ? 250  PRO A CG    1 
ATOM   1926  C  CD    . PRO A 1 250 ? 61.151  152.089 16.578  1.00 24.96 ? 250  PRO A CD    1 
ATOM   1927  N  N     . GLU A 1 251 ? 63.186  148.653 19.025  1.00 24.86 ? 251  GLU A N     1 
ATOM   1928  C  CA    . GLU A 1 251 ? 63.742  147.316 18.868  1.00 24.85 ? 251  GLU A CA    1 
ATOM   1929  C  C     . GLU A 1 251 ? 62.730  146.325 19.410  1.00 23.23 ? 251  GLU A C     1 
ATOM   1930  O  O     . GLU A 1 251 ? 61.927  146.661 20.276  1.00 24.06 ? 251  GLU A O     1 
ATOM   1931  C  CB    . GLU A 1 251 ? 65.050  147.171 19.650  1.00 27.43 ? 251  GLU A CB    1 
ATOM   1932  C  CG    . GLU A 1 251 ? 66.231  147.930 19.055  1.00 31.22 ? 251  GLU A CG    1 
ATOM   1933  C  CD    . GLU A 1 251 ? 66.518  147.526 17.623  1.00 31.93 ? 251  GLU A CD    1 
ATOM   1934  O  OE1   . GLU A 1 251 ? 66.665  146.310 17.367  1.00 33.82 ? 251  GLU A OE1   1 
ATOM   1935  O  OE2   . GLU A 1 251 ? 66.596  148.425 16.757  1.00 31.81 ? 251  GLU A OE2   1 
ATOM   1936  N  N     . ALA A 1 252 ? 62.776  145.101 18.901  1.00 21.70 ? 252  ALA A N     1 
ATOM   1937  C  CA    . ALA A 1 252 ? 61.861  144.066 19.349  1.00 20.45 ? 252  ALA A CA    1 
ATOM   1938  C  C     . ALA A 1 252 ? 62.180  143.637 20.781  1.00 19.90 ? 252  ALA A C     1 
ATOM   1939  O  O     . ALA A 1 252 ? 63.342  143.450 21.142  1.00 19.83 ? 252  ALA A O     1 
ATOM   1940  C  CB    . ALA A 1 252 ? 61.936  142.864 18.411  1.00 18.99 ? 252  ALA A CB    1 
ATOM   1941  N  N     . MET A 1 253 ? 61.138  143.502 21.593  1.00 19.62 ? 253  MET A N     1 
ATOM   1942  C  CA    . MET A 1 253 ? 61.275  143.052 22.973  1.00 18.47 ? 253  MET A CA    1 
ATOM   1943  C  C     . MET A 1 253 ? 60.495  141.750 23.044  1.00 19.42 ? 253  MET A C     1 
ATOM   1944  O  O     . MET A 1 253 ? 59.473  141.621 22.376  1.00 20.58 ? 253  MET A O     1 
ATOM   1945  C  CB    . MET A 1 253 ? 60.642  144.050 23.938  1.00 18.34 ? 253  MET A CB    1 
ATOM   1946  C  CG    . MET A 1 253 ? 61.279  145.429 23.928  1.00 18.48 ? 253  MET A CG    1 
ATOM   1947  S  SD    . MET A 1 253 ? 63.012  145.391 24.387  1.00 17.04 ? 253  MET A SD    1 
ATOM   1948  C  CE    . MET A 1 253 ? 63.636  146.758 23.426  1.00 18.30 ? 253  MET A CE    1 
ATOM   1949  N  N     . ASN A 1 254 ? 60.969  140.790 23.835  1.00 18.94 ? 254  ASN A N     1 
ATOM   1950  C  CA    . ASN A 1 254 ? 60.268  139.514 23.966  1.00 18.14 ? 254  ASN A CA    1 
ATOM   1951  C  C     . ASN A 1 254 ? 58.992  139.710 24.768  1.00 15.86 ? 254  ASN A C     1 
ATOM   1952  O  O     . ASN A 1 254 ? 58.900  140.620 25.587  1.00 14.46 ? 254  ASN A O     1 
ATOM   1953  C  CB    . ASN A 1 254 ? 61.149  138.481 24.664  1.00 23.12 ? 254  ASN A CB    1 
ATOM   1954  C  CG    . ASN A 1 254 ? 62.267  137.980 23.779  1.00 28.91 ? 254  ASN A CG    1 
ATOM   1955  O  OD1   . ASN A 1 254 ? 62.022  137.450 22.689  1.00 33.38 ? 254  ASN A OD1   1 
ATOM   1956  N  ND2   . ASN A 1 254 ? 63.509  138.145 24.237  1.00 32.35 ? 254  ASN A ND2   1 
ATOM   1957  N  N     . ALA A 1 255 ? 58.012  138.848 24.529  1.00 13.59 ? 255  ALA A N     1 
ATOM   1958  C  CA    . ALA A 1 255 ? 56.743  138.937 25.229  1.00 13.21 ? 255  ALA A CA    1 
ATOM   1959  C  C     . ALA A 1 255 ? 56.933  138.872 26.745  1.00 14.22 ? 255  ALA A C     1 
ATOM   1960  O  O     . ALA A 1 255 ? 56.207  139.526 27.492  1.00 13.95 ? 255  ALA A O     1 
ATOM   1961  C  CB    . ALA A 1 255 ? 55.804  137.817 24.759  1.00 12.76 ? 255  ALA A CB    1 
ATOM   1962  N  N     . GLU A 1 256 ? 57.906  138.084 27.195  1.00 12.92 ? 256  GLU A N     1 
ATOM   1963  C  CA    . GLU A 1 256 ? 58.158  137.939 28.619  1.00 12.79 ? 256  GLU A CA    1 
ATOM   1964  C  C     . GLU A 1 256 ? 59.293  138.799 29.179  1.00 14.36 ? 256  GLU A C     1 
ATOM   1965  O  O     . GLU A 1 256 ? 59.739  138.574 30.302  1.00 14.29 ? 256  GLU A O     1 
ATOM   1966  C  CB    . GLU A 1 256 ? 58.407  136.470 28.970  1.00 12.29 ? 256  GLU A CB    1 
ATOM   1967  C  CG    . GLU A 1 256 ? 57.181  135.588 28.866  1.00 10.86 ? 256  GLU A CG    1 
ATOM   1968  C  CD    . GLU A 1 256 ? 56.010  136.087 29.701  1.00 14.49 ? 256  GLU A CD    1 
ATOM   1969  O  OE1   . GLU A 1 256 ? 56.248  136.759 30.734  1.00 14.11 ? 256  GLU A OE1   1 
ATOM   1970  O  OE2   . GLU A 1 256 ? 54.849  135.793 29.326  1.00 14.03 ? 256  GLU A OE2   1 
ATOM   1971  N  N     . ASP A 1 257 ? 59.776  139.768 28.406  1.00 15.13 ? 257  ASP A N     1 
ATOM   1972  C  CA    . ASP A 1 257 ? 60.818  140.651 28.917  1.00 15.74 ? 257  ASP A CA    1 
ATOM   1973  C  C     . ASP A 1 257 ? 60.168  141.508 30.003  1.00 16.92 ? 257  ASP A C     1 
ATOM   1974  O  O     . ASP A 1 257 ? 59.035  141.975 29.845  1.00 14.14 ? 257  ASP A O     1 
ATOM   1975  C  CB    . ASP A 1 257 ? 61.365  141.582 27.824  1.00 17.43 ? 257  ASP A CB    1 
ATOM   1976  C  CG    . ASP A 1 257 ? 62.414  140.918 26.946  1.00 16.06 ? 257  ASP A CG    1 
ATOM   1977  O  OD1   . ASP A 1 257 ? 63.062  139.964 27.421  1.00 17.30 ? 257  ASP A OD1   1 
ATOM   1978  O  OD2   . ASP A 1 257 ? 62.601  141.365 25.792  1.00 12.96 ? 257  ASP A OD2   1 
ATOM   1979  N  N     . PRO A 1 258 ? 60.867  141.718 31.126  1.00 18.09 ? 258  PRO A N     1 
ATOM   1980  C  CA    . PRO A 1 258 ? 60.275  142.539 32.188  1.00 17.70 ? 258  PRO A CA    1 
ATOM   1981  C  C     . PRO A 1 258 ? 59.978  143.955 31.700  1.00 17.74 ? 258  PRO A C     1 
ATOM   1982  O  O     . PRO A 1 258 ? 60.822  144.586 31.062  1.00 18.30 ? 258  PRO A O     1 
ATOM   1983  C  CB    . PRO A 1 258 ? 61.341  142.512 33.279  1.00 18.23 ? 258  PRO A CB    1 
ATOM   1984  C  CG    . PRO A 1 258 ? 62.622  142.325 32.498  1.00 19.84 ? 258  PRO A CG    1 
ATOM   1985  C  CD    . PRO A 1 258 ? 62.223  141.275 31.492  1.00 18.80 ? 258  PRO A CD    1 
ATOM   1986  N  N     . LEU A 1 259 ? 58.776  144.441 31.996  1.00 16.23 ? 259  LEU A N     1 
ATOM   1987  C  CA    . LEU A 1 259 ? 58.361  145.781 31.594  1.00 12.93 ? 259  LEU A CA    1 
ATOM   1988  C  C     . LEU A 1 259 ? 58.549  146.758 32.751  1.00 12.30 ? 259  LEU A C     1 
ATOM   1989  O  O     . LEU A 1 259 ? 59.142  147.818 32.592  1.00 11.82 ? 259  LEU A O     1 
ATOM   1990  C  CB    . LEU A 1 259 ? 56.892  145.771 31.163  1.00 12.71 ? 259  LEU A CB    1 
ATOM   1991  C  CG    . LEU A 1 259 ? 56.281  147.119 30.761  1.00 11.15 ? 259  LEU A CG    1 
ATOM   1992  C  CD1   . LEU A 1 259 ? 57.036  147.702 29.572  1.00 10.74 ? 259  LEU A CD1   1 
ATOM   1993  C  CD2   . LEU A 1 259 ? 54.808  146.931 30.435  1.00 10.18 ? 259  LEU A CD2   1 
ATOM   1994  N  N     . PHE A 1 260 ? 58.050  146.397 33.925  1.00 12.66 ? 260  PHE A N     1 
ATOM   1995  C  CA    . PHE A 1 260 ? 58.178  147.281 35.074  1.00 13.73 ? 260  PHE A CA    1 
ATOM   1996  C  C     . PHE A 1 260 ? 57.897  146.571 36.380  1.00 14.35 ? 260  PHE A C     1 
ATOM   1997  O  O     . PHE A 1 260 ? 57.421  145.434 36.398  1.00 12.04 ? 260  PHE A O     1 
ATOM   1998  C  CB    . PHE A 1 260 ? 57.214  148.462 34.936  1.00 11.47 ? 260  PHE A CB    1 
ATOM   1999  C  CG    . PHE A 1 260 ? 55.770  148.113 35.203  1.00 11.43 ? 260  PHE A CG    1 
ATOM   2000  C  CD1   . PHE A 1 260 ? 55.307  147.935 36.508  1.00 10.63 ? 260  PHE A CD1   1 
ATOM   2001  C  CD2   . PHE A 1 260 ? 54.867  147.974 34.151  1.00 11.06 ? 260  PHE A CD2   1 
ATOM   2002  C  CE1   . PHE A 1 260 ? 53.971  147.624 36.765  1.00 12.28 ? 260  PHE A CE1   1 
ATOM   2003  C  CE2   . PHE A 1 260 ? 53.527  147.665 34.393  1.00 11.97 ? 260  PHE A CE2   1 
ATOM   2004  C  CZ    . PHE A 1 260 ? 53.077  147.488 35.707  1.00 11.86 ? 260  PHE A CZ    1 
ATOM   2005  N  N     . ILE A 1 261 ? 58.194  147.262 37.477  1.00 15.35 ? 261  ILE A N     1 
ATOM   2006  C  CA    . ILE A 1 261 ? 57.928  146.731 38.802  1.00 15.75 ? 261  ILE A CA    1 
ATOM   2007  C  C     . ILE A 1 261 ? 57.283  147.801 39.673  1.00 15.62 ? 261  ILE A C     1 
ATOM   2008  O  O     . ILE A 1 261 ? 57.586  148.992 39.560  1.00 14.19 ? 261  ILE A O     1 
ATOM   2009  C  CB    . ILE A 1 261 ? 59.205  146.211 39.502  1.00 17.07 ? 261  ILE A CB    1 
ATOM   2010  C  CG1   . ILE A 1 261 ? 60.214  147.340 39.675  1.00 18.87 ? 261  ILE A CG1   1 
ATOM   2011  C  CG2   . ILE A 1 261 ? 59.800  145.059 38.704  1.00 18.19 ? 261  ILE A CG2   1 
ATOM   2012  C  CD1   . ILE A 1 261 ? 61.480  146.913 40.389  1.00 20.15 ? 261  ILE A CD1   1 
ATOM   2013  N  N     . LEU A 1 262 ? 56.372  147.355 40.526  1.00 13.43 ? 262  LEU A N     1 
ATOM   2014  C  CA    . LEU A 1 262 ? 55.670  148.233 41.437  1.00 14.01 ? 262  LEU A CA    1 
ATOM   2015  C  C     . LEU A 1 262 ? 55.746  147.645 42.834  1.00 14.35 ? 262  LEU A C     1 
ATOM   2016  O  O     . LEU A 1 262 ? 55.278  146.522 43.074  1.00 11.74 ? 262  LEU A O     1 
ATOM   2017  C  CB    . LEU A 1 262 ? 54.204  148.386 41.022  1.00 14.23 ? 262  LEU A CB    1 
ATOM   2018  C  CG    . LEU A 1 262 ? 53.900  149.500 40.017  1.00 15.23 ? 262  LEU A CG    1 
ATOM   2019  C  CD1   . LEU A 1 262 ? 52.402  149.538 39.706  1.00 13.50 ? 262  LEU A CD1   1 
ATOM   2020  C  CD2   . LEU A 1 262 ? 54.367  150.835 40.619  1.00 10.71 ? 262  LEU A CD2   1 
ATOM   2021  N  N     . TYR A 1 263 ? 56.353  148.392 43.751  1.00 12.27 ? 263  TYR A N     1 
ATOM   2022  C  CA    . TYR A 1 263 ? 56.452  147.929 45.118  1.00 13.52 ? 263  TYR A CA    1 
ATOM   2023  C  C     . TYR A 1 263 ? 55.088  148.025 45.789  1.00 13.63 ? 263  TYR A C     1 
ATOM   2024  O  O     . TYR A 1 263 ? 54.487  149.091 45.849  1.00 14.94 ? 263  TYR A O     1 
ATOM   2025  C  CB    . TYR A 1 263 ? 57.527  148.728 45.859  1.00 12.86 ? 263  TYR A CB    1 
ATOM   2026  C  CG    . TYR A 1 263 ? 58.912  148.308 45.413  1.00 11.16 ? 263  TYR A CG    1 
ATOM   2027  C  CD1   . TYR A 1 263 ? 59.553  148.935 44.336  1.00 11.02 ? 263  TYR A CD1   1 
ATOM   2028  C  CD2   . TYR A 1 263 ? 59.536  147.207 45.996  1.00 8.68  ? 263  TYR A CD2   1 
ATOM   2029  C  CE1   . TYR A 1 263 ? 60.783  148.463 43.846  1.00 8.80  ? 263  TYR A CE1   1 
ATOM   2030  C  CE2   . TYR A 1 263 ? 60.756  146.731 45.519  1.00 9.50  ? 263  TYR A CE2   1 
ATOM   2031  C  CZ    . TYR A 1 263 ? 61.369  147.358 44.444  1.00 9.33  ? 263  TYR A CZ    1 
ATOM   2032  O  OH    . TYR A 1 263 ? 62.547  146.849 43.951  1.00 12.99 ? 263  TYR A OH    1 
ATOM   2033  N  N     . THR A 1 264 ? 54.603  146.884 46.269  1.00 14.29 ? 264  THR A N     1 
ATOM   2034  C  CA    . THR A 1 264 ? 53.288  146.794 46.895  1.00 15.60 ? 264  THR A CA    1 
ATOM   2035  C  C     . THR A 1 264 ? 53.342  146.211 48.304  1.00 15.88 ? 264  THR A C     1 
ATOM   2036  O  O     . THR A 1 264 ? 54.080  145.257 48.569  1.00 16.21 ? 264  THR A O     1 
ATOM   2037  C  CB    . THR A 1 264 ? 52.347  145.911 46.048  1.00 17.97 ? 264  THR A CB    1 
ATOM   2038  O  OG1   . THR A 1 264 ? 52.540  146.196 44.656  1.00 17.27 ? 264  THR A OG1   1 
ATOM   2039  C  CG2   . THR A 1 264 ? 50.895  146.180 46.416  1.00 20.69 ? 264  THR A CG2   1 
ATOM   2040  N  N     . SER A 1 265 ? 52.533  146.773 49.201  1.00 14.70 ? 265  SER A N     1 
ATOM   2041  C  CA    . SER A 1 265 ? 52.476  146.314 50.589  1.00 14.90 ? 265  SER A CA    1 
ATOM   2042  C  C     . SER A 1 265 ? 51.826  144.936 50.710  1.00 14.58 ? 265  SER A C     1 
ATOM   2043  O  O     . SER A 1 265 ? 50.886  144.612 49.994  1.00 12.88 ? 265  SER A O     1 
ATOM   2044  C  CB    . SER A 1 265 ? 51.700  147.321 51.453  1.00 14.77 ? 265  SER A CB    1 
ATOM   2045  O  OG    . SER A 1 265 ? 52.376  148.563 51.530  1.00 11.66 ? 265  SER A OG    1 
ATOM   2046  N  N     . GLY A 1 266 ? 52.341  144.128 51.626  1.00 15.43 ? 266  GLY A N     1 
ATOM   2047  C  CA    . GLY A 1 266 ? 51.792  142.804 51.832  1.00 16.89 ? 266  GLY A CA    1 
ATOM   2048  C  C     . GLY A 1 266 ? 51.421  142.624 53.287  1.00 19.39 ? 266  GLY A C     1 
ATOM   2049  O  O     . GLY A 1 266 ? 51.717  143.484 54.119  1.00 18.70 ? 266  GLY A O     1 
ATOM   2050  N  N     . SER A 1 267 ? 50.782  141.503 53.604  1.00 22.33 ? 267  SER A N     1 
ATOM   2051  C  CA    . SER A 1 267 ? 50.368  141.231 54.974  1.00 23.75 ? 267  SER A CA    1 
ATOM   2052  C  C     . SER A 1 267 ? 51.554  141.248 55.935  1.00 23.91 ? 267  SER A C     1 
ATOM   2053  O  O     . SER A 1 267 ? 51.411  141.629 57.098  1.00 24.69 ? 267  SER A O     1 
ATOM   2054  C  CB    . SER A 1 267 ? 49.646  139.888 55.050  1.00 23.16 ? 267  SER A CB    1 
ATOM   2055  O  OG    . SER A 1 267 ? 48.921  139.787 56.263  1.00 26.17 ? 267  SER A OG    1 
ATOM   2056  N  N     . THR A 1 268 ? 52.720  140.829 55.453  1.00 24.57 ? 268  THR A N     1 
ATOM   2057  C  CA    . THR A 1 268 ? 53.930  140.828 56.275  1.00 26.46 ? 268  THR A CA    1 
ATOM   2058  C  C     . THR A 1 268 ? 55.090  141.435 55.495  1.00 25.47 ? 268  THR A C     1 
ATOM   2059  O  O     . THR A 1 268 ? 55.019  141.575 54.275  1.00 24.42 ? 268  THR A O     1 
ATOM   2060  C  CB    . THR A 1 268 ? 54.349  139.402 56.702  1.00 27.32 ? 268  THR A CB    1 
ATOM   2061  O  OG1   . THR A 1 268 ? 54.758  138.659 55.547  1.00 29.09 ? 268  THR A OG1   1 
ATOM   2062  C  CG2   . THR A 1 268 ? 53.189  138.685 57.380  1.00 29.01 ? 268  THR A CG2   1 
ATOM   2063  N  N     . GLY A 1 269 ? 56.149  141.801 56.213  1.00 26.20 ? 269  GLY A N     1 
ATOM   2064  C  CA    . GLY A 1 269 ? 57.322  142.381 55.583  1.00 25.46 ? 269  GLY A CA    1 
ATOM   2065  C  C     . GLY A 1 269 ? 57.101  143.746 54.953  1.00 25.56 ? 269  GLY A C     1 
ATOM   2066  O  O     . GLY A 1 269 ? 56.033  144.349 55.082  1.00 25.12 ? 269  GLY A O     1 
ATOM   2067  N  N     . LYS A 1 270 ? 58.135  144.242 54.285  1.00 24.67 ? 270  LYS A N     1 
ATOM   2068  C  CA    . LYS A 1 270 ? 58.064  145.527 53.613  1.00 24.64 ? 270  LYS A CA    1 
ATOM   2069  C  C     . LYS A 1 270 ? 57.549  145.285 52.197  1.00 22.18 ? 270  LYS A C     1 
ATOM   2070  O  O     . LYS A 1 270 ? 57.485  144.143 51.743  1.00 21.27 ? 270  LYS A O     1 
ATOM   2071  C  CB    . LYS A 1 270 ? 59.446  146.192 53.583  1.00 26.47 ? 270  LYS A CB    1 
ATOM   2072  C  CG    . LYS A 1 270 ? 59.982  146.556 54.979  1.00 29.76 ? 270  LYS A CG    1 
ATOM   2073  C  CD    . LYS A 1 270 ? 61.190  147.484 54.907  1.00 31.28 ? 270  LYS A CD    1 
ATOM   2074  C  CE    . LYS A 1 270 ? 60.809  148.829 54.304  1.00 31.88 ? 270  LYS A CE    1 
ATOM   2075  N  NZ    . LYS A 1 270 ? 61.992  149.718 54.085  1.00 32.96 ? 270  LYS A NZ    1 
ATOM   2076  N  N     . PRO A 1 271 ? 57.160  146.357 51.489  1.00 20.78 ? 271  PRO A N     1 
ATOM   2077  C  CA    . PRO A 1 271 ? 56.646  146.238 50.122  1.00 20.11 ? 271  PRO A CA    1 
ATOM   2078  C  C     . PRO A 1 271 ? 57.546  145.447 49.175  1.00 19.64 ? 271  PRO A C     1 
ATOM   2079  O  O     . PRO A 1 271 ? 58.762  145.618 49.170  1.00 19.91 ? 271  PRO A O     1 
ATOM   2080  C  CB    . PRO A 1 271 ? 56.483  147.693 49.698  1.00 19.71 ? 271  PRO A CB    1 
ATOM   2081  C  CG    . PRO A 1 271 ? 56.077  148.354 50.980  1.00 18.46 ? 271  PRO A CG    1 
ATOM   2082  C  CD    . PRO A 1 271 ? 57.045  147.747 51.969  1.00 19.83 ? 271  PRO A CD    1 
ATOM   2083  N  N     . LYS A 1 272 ? 56.938  144.579 48.375  1.00 18.90 ? 272  LYS A N     1 
ATOM   2084  C  CA    . LYS A 1 272 ? 57.685  143.768 47.420  1.00 19.01 ? 272  LYS A CA    1 
ATOM   2085  C  C     . LYS A 1 272 ? 57.541  144.307 45.999  1.00 18.26 ? 272  LYS A C     1 
ATOM   2086  O  O     . LYS A 1 272 ? 56.532  144.942 45.662  1.00 16.77 ? 272  LYS A O     1 
ATOM   2087  C  CB    . LYS A 1 272 ? 57.211  142.314 47.487  1.00 19.49 ? 272  LYS A CB    1 
ATOM   2088  C  CG    . LYS A 1 272 ? 57.422  141.671 48.851  1.00 21.57 ? 272  LYS A CG    1 
ATOM   2089  C  CD    . LYS A 1 272 ? 58.889  141.727 49.263  1.00 22.61 ? 272  LYS A CD    1 
ATOM   2090  C  CE    . LYS A 1 272 ? 59.095  141.156 50.663  1.00 25.00 ? 272  LYS A CE    1 
ATOM   2091  N  NZ    . LYS A 1 272 ? 60.538  140.970 50.986  1.00 23.58 ? 272  LYS A NZ    1 
ATOM   2092  N  N     . GLY A 1 273 ? 58.550  144.054 45.169  1.00 15.34 ? 273  GLY A N     1 
ATOM   2093  C  CA    . GLY A 1 273 ? 58.516  144.528 43.799  1.00 14.38 ? 273  GLY A CA    1 
ATOM   2094  C  C     . GLY A 1 273 ? 57.716  143.663 42.836  1.00 13.82 ? 273  GLY A C     1 
ATOM   2095  O  O     . GLY A 1 273 ? 58.280  142.810 42.153  1.00 12.08 ? 273  GLY A O     1 
ATOM   2096  N  N     . VAL A 1 274 ? 56.404  143.882 42.772  1.00 13.06 ? 274  VAL A N     1 
ATOM   2097  C  CA    . VAL A 1 274 ? 55.554  143.118 41.863  1.00 12.51 ? 274  VAL A CA    1 
ATOM   2098  C  C     . VAL A 1 274 ? 56.071  143.384 40.454  1.00 13.73 ? 274  VAL A C     1 
ATOM   2099  O  O     . VAL A 1 274 ? 56.213  144.540 40.054  1.00 14.65 ? 274  VAL A O     1 
ATOM   2100  C  CB    . VAL A 1 274 ? 54.075  143.556 41.971  1.00 11.50 ? 274  VAL A CB    1 
ATOM   2101  C  CG1   . VAL A 1 274 ? 53.206  142.780 40.968  1.00 9.61  ? 274  VAL A CG1   1 
ATOM   2102  C  CG2   . VAL A 1 274 ? 53.588  143.323 43.368  1.00 8.03  ? 274  VAL A CG2   1 
ATOM   2103  N  N     . LEU A 1 275 ? 56.351  142.319 39.703  1.00 14.03 ? 275  LEU A N     1 
ATOM   2104  C  CA    . LEU A 1 275 ? 56.890  142.469 38.352  1.00 12.41 ? 275  LEU A CA    1 
ATOM   2105  C  C     . LEU A 1 275 ? 55.965  142.003 37.222  1.00 13.20 ? 275  LEU A C     1 
ATOM   2106  O  O     . LEU A 1 275 ? 55.404  140.899 37.256  1.00 12.09 ? 275  LEU A O     1 
ATOM   2107  C  CB    . LEU A 1 275 ? 58.244  141.747 38.266  1.00 11.75 ? 275  LEU A CB    1 
ATOM   2108  C  CG    . LEU A 1 275 ? 59.107  141.829 37.003  1.00 13.47 ? 275  LEU A CG    1 
ATOM   2109  C  CD1   . LEU A 1 275 ? 60.560  141.472 37.344  1.00 13.80 ? 275  LEU A CD1   1 
ATOM   2110  C  CD2   . LEU A 1 275 ? 58.570  140.876 35.940  1.00 14.63 ? 275  LEU A CD2   1 
ATOM   2111  N  N     . HIS A 1 276 ? 55.822  142.867 36.220  1.00 10.75 ? 276  HIS A N     1 
ATOM   2112  C  CA    . HIS A 1 276 ? 54.999  142.589 35.051  1.00 11.60 ? 276  HIS A CA    1 
ATOM   2113  C  C     . HIS A 1 276 ? 55.859  142.536 33.790  1.00 11.97 ? 276  HIS A C     1 
ATOM   2114  O  O     . HIS A 1 276 ? 56.802  143.322 33.635  1.00 11.80 ? 276  HIS A O     1 
ATOM   2115  C  CB    . HIS A 1 276 ? 53.933  143.679 34.878  1.00 9.80  ? 276  HIS A CB    1 
ATOM   2116  C  CG    . HIS A 1 276 ? 52.740  143.504 35.762  1.00 10.88 ? 276  HIS A CG    1 
ATOM   2117  N  ND1   . HIS A 1 276 ? 51.740  142.593 35.489  1.00 11.24 ? 276  HIS A ND1   1 
ATOM   2118  C  CD2   . HIS A 1 276 ? 52.404  144.091 36.936  1.00 10.21 ? 276  HIS A CD2   1 
ATOM   2119  C  CE1   . HIS A 1 276 ? 50.842  142.627 36.457  1.00 9.78  ? 276  HIS A CE1   1 
ATOM   2120  N  NE2   . HIS A 1 276 ? 51.221  143.527 37.347  1.00 9.92  ? 276  HIS A NE2   1 
ATOM   2121  N  N     . THR A 1 277 ? 55.557  141.600 32.896  1.00 10.57 ? 277  THR A N     1 
ATOM   2122  C  CA    . THR A 1 277 ? 56.305  141.534 31.652  1.00 12.50 ? 277  THR A CA    1 
ATOM   2123  C  C     . THR A 1 277 ? 55.595  142.396 30.614  1.00 12.37 ? 277  THR A C     1 
ATOM   2124  O  O     . THR A 1 277 ? 54.767  143.225 30.979  1.00 12.43 ? 277  THR A O     1 
ATOM   2125  C  CB    . THR A 1 277 ? 56.498  140.084 31.148  1.00 12.55 ? 277  THR A CB    1 
ATOM   2126  O  OG1   . THR A 1 277 ? 55.256  139.367 31.185  1.00 13.83 ? 277  THR A OG1   1 
ATOM   2127  C  CG2   . THR A 1 277 ? 57.523  139.376 32.025  1.00 12.67 ? 277  THR A CG2   1 
ATOM   2128  N  N     . THR A 1 278 ? 55.897  142.192 29.334  1.00 13.44 ? 278  THR A N     1 
ATOM   2129  C  CA    . THR A 1 278 ? 55.344  143.024 28.264  1.00 11.68 ? 278  THR A CA    1 
ATOM   2130  C  C     . THR A 1 278 ? 54.089  142.570 27.497  1.00 14.56 ? 278  THR A C     1 
ATOM   2131  O  O     . THR A 1 278 ? 53.084  143.294 27.453  1.00 14.34 ? 278  THR A O     1 
ATOM   2132  C  CB    . THR A 1 278 ? 56.459  143.334 27.236  1.00 12.06 ? 278  THR A CB    1 
ATOM   2133  O  OG1   . THR A 1 278 ? 57.632  143.795 27.921  1.00 6.36  ? 278  THR A OG1   1 
ATOM   2134  C  CG2   . THR A 1 278 ? 55.996  144.409 26.248  1.00 8.31  ? 278  THR A CG2   1 
ATOM   2135  N  N     . GLY A 1 279 ? 54.157  141.389 26.884  1.00 12.09 ? 279  GLY A N     1 
ATOM   2136  C  CA    . GLY A 1 279 ? 53.036  140.885 26.096  1.00 12.57 ? 279  GLY A CA    1 
ATOM   2137  C  C     . GLY A 1 279 ? 51.657  140.800 26.736  1.00 13.14 ? 279  GLY A C     1 
ATOM   2138  O  O     . GLY A 1 279 ? 50.789  141.638 26.483  1.00 12.29 ? 279  GLY A O     1 
ATOM   2139  N  N     . GLY A 1 280 ? 51.448  139.763 27.544  1.00 13.06 ? 280  GLY A N     1 
ATOM   2140  C  CA    . GLY A 1 280 ? 50.168  139.579 28.205  1.00 14.10 ? 280  GLY A CA    1 
ATOM   2141  C  C     . GLY A 1 280 ? 49.690  140.827 28.923  1.00 16.95 ? 280  GLY A C     1 
ATOM   2142  O  O     . GLY A 1 280 ? 48.492  141.143 28.911  1.00 17.28 ? 280  GLY A O     1 
ATOM   2143  N  N     . TYR A 1 281 ? 50.619  141.547 29.548  1.00 16.07 ? 281  TYR A N     1 
ATOM   2144  C  CA    . TYR A 1 281 ? 50.263  142.762 30.269  1.00 16.42 ? 281  TYR A CA    1 
ATOM   2145  C  C     . TYR A 1 281 ? 49.630  143.798 29.352  1.00 15.43 ? 281  TYR A C     1 
ATOM   2146  O  O     . TYR A 1 281 ? 48.537  144.298 29.629  1.00 16.23 ? 281  TYR A O     1 
ATOM   2147  C  CB    . TYR A 1 281 ? 51.491  143.397 30.937  1.00 16.56 ? 281  TYR A CB    1 
ATOM   2148  C  CG    . TYR A 1 281 ? 51.190  144.770 31.505  1.00 15.24 ? 281  TYR A CG    1 
ATOM   2149  C  CD1   . TYR A 1 281 ? 50.453  144.914 32.686  1.00 14.99 ? 281  TYR A CD1   1 
ATOM   2150  C  CD2   . TYR A 1 281 ? 51.565  145.927 30.813  1.00 15.19 ? 281  TYR A CD2   1 
ATOM   2151  C  CE1   . TYR A 1 281 ? 50.089  146.178 33.162  1.00 13.09 ? 281  TYR A CE1   1 
ATOM   2152  C  CE2   . TYR A 1 281 ? 51.205  147.198 31.276  1.00 13.32 ? 281  TYR A CE2   1 
ATOM   2153  C  CZ    . TYR A 1 281 ? 50.464  147.315 32.448  1.00 14.97 ? 281  TYR A CZ    1 
ATOM   2154  O  OH    . TYR A 1 281 ? 50.072  148.559 32.890  1.00 15.05 ? 281  TYR A OH    1 
ATOM   2155  N  N     . LEU A 1 282 ? 50.317  144.127 28.265  1.00 13.74 ? 282  LEU A N     1 
ATOM   2156  C  CA    . LEU A 1 282 ? 49.811  145.138 27.347  1.00 13.37 ? 282  LEU A CA    1 
ATOM   2157  C  C     . LEU A 1 282 ? 48.518  144.693 26.673  1.00 13.95 ? 282  LEU A C     1 
ATOM   2158  O  O     . LEU A 1 282 ? 47.609  145.503 26.462  1.00 14.09 ? 282  LEU A O     1 
ATOM   2159  C  CB    . LEU A 1 282 ? 50.878  145.491 26.299  1.00 10.94 ? 282  LEU A CB    1 
ATOM   2160  C  CG    . LEU A 1 282 ? 50.627  146.789 25.520  1.00 10.70 ? 282  LEU A CG    1 
ATOM   2161  C  CD1   . LEU A 1 282 ? 50.345  147.924 26.498  1.00 8.65  ? 282  LEU A CD1   1 
ATOM   2162  C  CD2   . LEU A 1 282 ? 51.828  147.115 24.650  1.00 9.75  ? 282  LEU A CD2   1 
ATOM   2163  N  N     . VAL A 1 283 ? 48.432  143.408 26.336  1.00 14.33 ? 283  VAL A N     1 
ATOM   2164  C  CA    . VAL A 1 283 ? 47.224  142.876 25.713  1.00 13.50 ? 283  VAL A CA    1 
ATOM   2165  C  C     . VAL A 1 283 ? 46.050  143.028 26.682  1.00 12.78 ? 283  VAL A C     1 
ATOM   2166  O  O     . VAL A 1 283 ? 44.989  143.534 26.315  1.00 13.09 ? 283  VAL A O     1 
ATOM   2167  C  CB    . VAL A 1 283 ? 47.368  141.371 25.356  1.00 13.68 ? 283  VAL A CB    1 
ATOM   2168  C  CG1   . VAL A 1 283 ? 46.041  140.831 24.839  1.00 14.90 ? 283  VAL A CG1   1 
ATOM   2169  C  CG2   . VAL A 1 283 ? 48.445  141.181 24.297  1.00 13.37 ? 283  VAL A CG2   1 
ATOM   2170  N  N     . TYR A 1 284 ? 46.258  142.601 27.924  1.00 12.02 ? 284  TYR A N     1 
ATOM   2171  C  CA    . TYR A 1 284 ? 45.217  142.665 28.942  1.00 12.26 ? 284  TYR A CA    1 
ATOM   2172  C  C     . TYR A 1 284 ? 44.791  144.098 29.277  1.00 12.31 ? 284  TYR A C     1 
ATOM   2173  O  O     . TYR A 1 284 ? 43.610  144.364 29.493  1.00 12.29 ? 284  TYR A O     1 
ATOM   2174  C  CB    . TYR A 1 284 ? 45.688  141.927 30.210  1.00 12.76 ? 284  TYR A CB    1 
ATOM   2175  C  CG    . TYR A 1 284 ? 44.559  141.396 31.073  1.00 14.09 ? 284  TYR A CG    1 
ATOM   2176  C  CD1   . TYR A 1 284 ? 44.251  141.992 32.298  1.00 13.70 ? 284  TYR A CD1   1 
ATOM   2177  C  CD2   . TYR A 1 284 ? 43.764  140.327 30.641  1.00 11.90 ? 284  TYR A CD2   1 
ATOM   2178  C  CE1   . TYR A 1 284 ? 43.179  141.548 33.074  1.00 13.28 ? 284  TYR A CE1   1 
ATOM   2179  C  CE2   . TYR A 1 284 ? 42.688  139.876 31.407  1.00 12.76 ? 284  TYR A CE2   1 
ATOM   2180  C  CZ    . TYR A 1 284 ? 42.401  140.497 32.620  1.00 13.66 ? 284  TYR A CZ    1 
ATOM   2181  O  OH    . TYR A 1 284 ? 41.318  140.089 33.359  1.00 12.00 ? 284  TYR A OH    1 
ATOM   2182  N  N     . ALA A 1 285 ? 45.747  145.021 29.310  1.00 12.20 ? 285  ALA A N     1 
ATOM   2183  C  CA    . ALA A 1 285 ? 45.445  146.412 29.629  1.00 11.69 ? 285  ALA A CA    1 
ATOM   2184  C  C     . ALA A 1 285 ? 44.603  147.079 28.544  1.00 12.82 ? 285  ALA A C     1 
ATOM   2185  O  O     . ALA A 1 285 ? 43.617  147.765 28.840  1.00 11.86 ? 285  ALA A O     1 
ATOM   2186  C  CB    . ALA A 1 285 ? 46.745  147.197 29.840  1.00 12.06 ? 285  ALA A CB    1 
ATOM   2187  N  N     . ALA A 1 286 ? 44.986  146.876 27.288  1.00 12.03 ? 286  ALA A N     1 
ATOM   2188  C  CA    . ALA A 1 286 ? 44.264  147.480 26.174  1.00 13.24 ? 286  ALA A CA    1 
ATOM   2189  C  C     . ALA A 1 286 ? 42.903  146.819 25.960  1.00 13.15 ? 286  ALA A C     1 
ATOM   2190  O  O     . ALA A 1 286 ? 41.941  147.479 25.550  1.00 12.23 ? 286  ALA A O     1 
ATOM   2191  C  CB    . ALA A 1 286 ? 45.103  147.390 24.895  1.00 13.56 ? 286  ALA A CB    1 
ATOM   2192  N  N     . THR A 1 287 ? 42.813  145.521 26.240  1.00 10.14 ? 287  THR A N     1 
ATOM   2193  C  CA    . THR A 1 287 ? 41.550  144.810 26.059  1.00 10.18 ? 287  THR A CA    1 
ATOM   2194  C  C     . THR A 1 287 ? 40.537  145.211 27.126  1.00 10.59 ? 287  THR A C     1 
ATOM   2195  O  O     . THR A 1 287 ? 39.382  145.518 26.822  1.00 10.66 ? 287  THR A O     1 
ATOM   2196  C  CB    . THR A 1 287 ? 41.761  143.286 26.106  1.00 9.45  ? 287  THR A CB    1 
ATOM   2197  O  OG1   . THR A 1 287 ? 42.688  142.906 25.080  1.00 11.16 ? 287  THR A OG1   1 
ATOM   2198  C  CG2   . THR A 1 287 ? 40.449  142.556 25.880  1.00 6.40  ? 287  THR A CG2   1 
ATOM   2199  N  N     . THR A 1 288 ? 40.970  145.193 28.382  1.00 10.84 ? 288  THR A N     1 
ATOM   2200  C  CA    . THR A 1 288 ? 40.100  145.576 29.488  1.00 12.66 ? 288  THR A CA    1 
ATOM   2201  C  C     . THR A 1 288 ? 39.654  147.035 29.343  1.00 12.64 ? 288  THR A C     1 
ATOM   2202  O  O     . THR A 1 288 ? 38.464  147.340 29.405  1.00 12.89 ? 288  THR A O     1 
ATOM   2203  C  CB    . THR A 1 288 ? 40.819  145.401 30.832  1.00 12.83 ? 288  THR A CB    1 
ATOM   2204  O  OG1   . THR A 1 288 ? 42.139  145.951 30.741  1.00 11.75 ? 288  THR A OG1   1 
ATOM   2205  C  CG2   . THR A 1 288 ? 40.908  143.932 31.181  1.00 13.87 ? 288  THR A CG2   1 
ATOM   2206  N  N     . PHE A 1 289 ? 40.615  147.929 29.146  1.00 12.29 ? 289  PHE A N     1 
ATOM   2207  C  CA    . PHE A 1 289 ? 40.320  149.350 28.982  1.00 13.20 ? 289  PHE A CA    1 
ATOM   2208  C  C     . PHE A 1 289 ? 39.280  149.564 27.890  1.00 15.13 ? 289  PHE A C     1 
ATOM   2209  O  O     . PHE A 1 289 ? 38.293  150.276 28.083  1.00 16.79 ? 289  PHE A O     1 
ATOM   2210  C  CB    . PHE A 1 289 ? 41.585  150.119 28.599  1.00 10.91 ? 289  PHE A CB    1 
ATOM   2211  C  CG    . PHE A 1 289 ? 41.308  151.468 28.001  1.00 12.14 ? 289  PHE A CG    1 
ATOM   2212  C  CD1   . PHE A 1 289 ? 41.012  152.557 28.814  1.00 10.58 ? 289  PHE A CD1   1 
ATOM   2213  C  CD2   . PHE A 1 289 ? 41.304  151.642 26.622  1.00 11.72 ? 289  PHE A CD2   1 
ATOM   2214  C  CE1   . PHE A 1 289 ? 40.716  153.800 28.259  1.00 11.97 ? 289  PHE A CE1   1 
ATOM   2215  C  CE2   . PHE A 1 289 ? 41.009  152.881 26.057  1.00 14.10 ? 289  PHE A CE2   1 
ATOM   2216  C  CZ    . PHE A 1 289 ? 40.714  153.963 26.880  1.00 12.12 ? 289  PHE A CZ    1 
ATOM   2217  N  N     . LYS A 1 290 ? 39.523  148.946 26.741  1.00 16.36 ? 290  LYS A N     1 
ATOM   2218  C  CA    . LYS A 1 290 ? 38.641  149.071 25.590  1.00 18.16 ? 290  LYS A CA    1 
ATOM   2219  C  C     . LYS A 1 290 ? 37.199  148.660 25.866  1.00 17.88 ? 290  LYS A C     1 
ATOM   2220  O  O     . LYS A 1 290 ? 36.280  149.456 25.706  1.00 19.10 ? 290  LYS A O     1 
ATOM   2221  C  CB    . LYS A 1 290 ? 39.196  148.241 24.433  1.00 18.96 ? 290  LYS A CB    1 
ATOM   2222  C  CG    . LYS A 1 290 ? 38.451  148.392 23.110  1.00 21.35 ? 290  LYS A CG    1 
ATOM   2223  C  CD    . LYS A 1 290 ? 39.226  147.690 22.008  1.00 23.50 ? 290  LYS A CD    1 
ATOM   2224  C  CE    . LYS A 1 290 ? 38.531  147.756 20.670  1.00 26.86 ? 290  LYS A CE    1 
ATOM   2225  N  NZ    . LYS A 1 290 ? 39.368  147.109 19.626  1.00 28.97 ? 290  LYS A NZ    1 
ATOM   2226  N  N     . TYR A 1 291 ? 37.013  147.420 26.293  1.00 18.00 ? 291  TYR A N     1 
ATOM   2227  C  CA    . TYR A 1 291 ? 35.683  146.887 26.553  1.00 17.12 ? 291  TYR A CA    1 
ATOM   2228  C  C     . TYR A 1 291 ? 34.942  147.390 27.789  1.00 16.57 ? 291  TYR A C     1 
ATOM   2229  O  O     . TYR A 1 291 ? 33.721  147.555 27.751  1.00 16.53 ? 291  TYR A O     1 
ATOM   2230  C  CB    . TYR A 1 291 ? 35.760  145.361 26.576  1.00 17.84 ? 291  TYR A CB    1 
ATOM   2231  C  CG    . TYR A 1 291 ? 36.153  144.765 25.236  1.00 20.25 ? 291  TYR A CG    1 
ATOM   2232  C  CD1   . TYR A 1 291 ? 36.972  143.636 25.165  1.00 22.30 ? 291  TYR A CD1   1 
ATOM   2233  C  CD2   . TYR A 1 291 ? 35.698  145.328 24.034  1.00 20.69 ? 291  TYR A CD2   1 
ATOM   2234  C  CE1   . TYR A 1 291 ? 37.331  143.083 23.935  1.00 24.11 ? 291  TYR A CE1   1 
ATOM   2235  C  CE2   . TYR A 1 291 ? 36.047  144.786 22.804  1.00 21.92 ? 291  TYR A CE2   1 
ATOM   2236  C  CZ    . TYR A 1 291 ? 36.864  143.666 22.760  1.00 24.21 ? 291  TYR A CZ    1 
ATOM   2237  O  OH    . TYR A 1 291 ? 37.218  143.133 21.547  1.00 24.78 ? 291  TYR A OH    1 
ATOM   2238  N  N     . VAL A 1 292 ? 35.658  147.640 28.878  1.00 15.24 ? 292  VAL A N     1 
ATOM   2239  C  CA    . VAL A 1 292 ? 35.008  148.106 30.096  1.00 13.85 ? 292  VAL A CA    1 
ATOM   2240  C  C     . VAL A 1 292 ? 34.605  149.580 30.034  1.00 15.87 ? 292  VAL A C     1 
ATOM   2241  O  O     . VAL A 1 292 ? 33.575  149.970 30.589  1.00 14.79 ? 292  VAL A O     1 
ATOM   2242  C  CB    . VAL A 1 292 ? 35.910  147.853 31.320  1.00 14.25 ? 292  VAL A CB    1 
ATOM   2243  C  CG1   . VAL A 1 292 ? 35.311  148.490 32.572  1.00 12.69 ? 292  VAL A CG1   1 
ATOM   2244  C  CG2   . VAL A 1 292 ? 36.068  146.355 31.522  1.00 12.86 ? 292  VAL A CG2   1 
ATOM   2245  N  N     . PHE A 1 293 ? 35.408  150.408 29.371  1.00 16.38 ? 293  PHE A N     1 
ATOM   2246  C  CA    . PHE A 1 293 ? 35.056  151.818 29.265  1.00 17.08 ? 293  PHE A CA    1 
ATOM   2247  C  C     . PHE A 1 293 ? 34.362  152.046 27.928  1.00 18.39 ? 293  PHE A C     1 
ATOM   2248  O  O     . PHE A 1 293 ? 34.019  153.175 27.576  1.00 19.31 ? 293  PHE A O     1 
ATOM   2249  C  CB    . PHE A 1 293 ? 36.300  152.706 29.384  1.00 17.53 ? 293  PHE A CB    1 
ATOM   2250  C  CG    . PHE A 1 293 ? 36.980  152.618 30.720  1.00 17.89 ? 293  PHE A CG    1 
ATOM   2251  C  CD1   . PHE A 1 293 ? 38.242  152.047 30.840  1.00 18.02 ? 293  PHE A CD1   1 
ATOM   2252  C  CD2   . PHE A 1 293 ? 36.346  153.082 31.867  1.00 17.36 ? 293  PHE A CD2   1 
ATOM   2253  C  CE1   . PHE A 1 293 ? 38.864  151.935 32.081  1.00 17.92 ? 293  PHE A CE1   1 
ATOM   2254  C  CE2   . PHE A 1 293 ? 36.962  152.974 33.118  1.00 20.25 ? 293  PHE A CE2   1 
ATOM   2255  C  CZ    . PHE A 1 293 ? 38.226  152.396 33.222  1.00 17.09 ? 293  PHE A CZ    1 
ATOM   2256  N  N     . ASP A 1 294 ? 34.154  150.955 27.192  1.00 19.02 ? 294  ASP A N     1 
ATOM   2257  C  CA    . ASP A 1 294 ? 33.488  151.004 25.894  1.00 19.24 ? 294  ASP A CA    1 
ATOM   2258  C  C     . ASP A 1 294 ? 34.082  152.123 25.045  1.00 18.75 ? 294  ASP A C     1 
ATOM   2259  O  O     . ASP A 1 294 ? 33.355  152.924 24.458  1.00 17.22 ? 294  ASP A O     1 
ATOM   2260  C  CB    . ASP A 1 294 ? 31.984  151.237 26.091  1.00 18.93 ? 294  ASP A CB    1 
ATOM   2261  C  CG    . ASP A 1 294 ? 31.182  150.999 24.823  1.00 19.74 ? 294  ASP A CG    1 
ATOM   2262  O  OD1   . ASP A 1 294 ? 30.519  151.950 24.356  1.00 21.04 ? 294  ASP A OD1   1 
ATOM   2263  O  OD2   . ASP A 1 294 ? 31.211  149.864 24.299  1.00 18.11 ? 294  ASP A OD2   1 
ATOM   2264  N  N     . TYR A 1 295 ? 35.406  152.162 24.971  1.00 18.11 ? 295  TYR A N     1 
ATOM   2265  C  CA    . TYR A 1 295 ? 36.090  153.203 24.215  1.00 19.74 ? 295  TYR A CA    1 
ATOM   2266  C  C     . TYR A 1 295 ? 35.815  153.249 22.713  1.00 20.42 ? 295  TYR A C     1 
ATOM   2267  O  O     . TYR A 1 295 ? 35.959  152.251 22.001  1.00 20.15 ? 295  TYR A O     1 
ATOM   2268  C  CB    . TYR A 1 295 ? 37.606  153.118 24.428  1.00 20.83 ? 295  TYR A CB    1 
ATOM   2269  C  CG    . TYR A 1 295 ? 38.366  154.075 23.544  1.00 20.32 ? 295  TYR A CG    1 
ATOM   2270  C  CD1   . TYR A 1 295 ? 38.389  155.436 23.821  1.00 23.02 ? 295  TYR A CD1   1 
ATOM   2271  C  CD2   . TYR A 1 295 ? 38.991  153.629 22.384  1.00 22.14 ? 295  TYR A CD2   1 
ATOM   2272  C  CE1   . TYR A 1 295 ? 39.011  156.343 22.958  1.00 25.92 ? 295  TYR A CE1   1 
ATOM   2273  C  CE2   . TYR A 1 295 ? 39.613  154.520 21.512  1.00 26.04 ? 295  TYR A CE2   1 
ATOM   2274  C  CZ    . TYR A 1 295 ? 39.620  155.880 21.803  1.00 26.80 ? 295  TYR A CZ    1 
ATOM   2275  O  OH    . TYR A 1 295 ? 40.227  156.773 20.935  1.00 30.69 ? 295  TYR A OH    1 
ATOM   2276  N  N     . HIS A 1 296 ? 35.424  154.429 22.241  1.00 20.33 ? 296  HIS A N     1 
ATOM   2277  C  CA    . HIS A 1 296 ? 35.171  154.663 20.822  1.00 22.07 ? 296  HIS A CA    1 
ATOM   2278  C  C     . HIS A 1 296 ? 36.129  155.769 20.401  1.00 21.56 ? 296  HIS A C     1 
ATOM   2279  O  O     . HIS A 1 296 ? 36.314  156.741 21.132  1.00 20.69 ? 296  HIS A O     1 
ATOM   2280  C  CB    . HIS A 1 296 ? 33.737  155.141 20.571  1.00 22.23 ? 296  HIS A CB    1 
ATOM   2281  C  CG    . HIS A 1 296 ? 32.720  154.044 20.566  1.00 23.98 ? 296  HIS A CG    1 
ATOM   2282  N  ND1   . HIS A 1 296 ? 32.346  153.368 21.707  1.00 25.44 ? 296  HIS A ND1   1 
ATOM   2283  C  CD2   . HIS A 1 296 ? 32.007  153.496 19.553  1.00 24.74 ? 296  HIS A CD2   1 
ATOM   2284  C  CE1   . HIS A 1 296 ? 31.446  152.452 21.398  1.00 25.40 ? 296  HIS A CE1   1 
ATOM   2285  N  NE2   . HIS A 1 296 ? 31.223  152.508 20.098  1.00 26.07 ? 296  HIS A NE2   1 
ATOM   2286  N  N     . PRO A 1 297 ? 36.763  155.636 19.229  1.00 21.47 ? 297  PRO A N     1 
ATOM   2287  C  CA    . PRO A 1 297 ? 37.675  156.712 18.839  1.00 20.77 ? 297  PRO A CA    1 
ATOM   2288  C  C     . PRO A 1 297 ? 36.997  158.066 19.008  1.00 20.35 ? 297  PRO A C     1 
ATOM   2289  O  O     . PRO A 1 297 ? 35.838  158.238 18.632  1.00 19.57 ? 297  PRO A O     1 
ATOM   2290  C  CB    . PRO A 1 297 ? 38.009  156.377 17.381  1.00 20.94 ? 297  PRO A CB    1 
ATOM   2291  C  CG    . PRO A 1 297 ? 36.855  155.528 16.934  1.00 22.39 ? 297  PRO A CG    1 
ATOM   2292  C  CD    . PRO A 1 297 ? 36.594  154.665 18.138  1.00 21.22 ? 297  PRO A CD    1 
ATOM   2293  N  N     . GLY A 1 298 ? 37.715  159.009 19.609  1.00 20.41 ? 298  GLY A N     1 
ATOM   2294  C  CA    . GLY A 1 298 ? 37.159  160.330 19.830  1.00 18.99 ? 298  GLY A CA    1 
ATOM   2295  C  C     . GLY A 1 298 ? 36.759  160.577 21.276  1.00 20.49 ? 298  GLY A C     1 
ATOM   2296  O  O     . GLY A 1 298 ? 36.573  161.728 21.680  1.00 21.09 ? 298  GLY A O     1 
ATOM   2297  N  N     . ASP A 1 299 ? 36.621  159.507 22.059  1.00 18.98 ? 299  ASP A N     1 
ATOM   2298  C  CA    . ASP A 1 299 ? 36.241  159.654 23.457  1.00 17.99 ? 299  ASP A CA    1 
ATOM   2299  C  C     . ASP A 1 299 ? 37.359  160.290 24.266  1.00 19.06 ? 299  ASP A C     1 
ATOM   2300  O  O     . ASP A 1 299 ? 38.533  159.953 24.094  1.00 21.05 ? 299  ASP A O     1 
ATOM   2301  C  CB    . ASP A 1 299 ? 35.901  158.299 24.086  1.00 19.00 ? 299  ASP A CB    1 
ATOM   2302  C  CG    . ASP A 1 299 ? 34.625  157.689 23.531  1.00 20.22 ? 299  ASP A CG    1 
ATOM   2303  O  OD1   . ASP A 1 299 ? 33.842  158.420 22.886  1.00 19.72 ? 299  ASP A OD1   1 
ATOM   2304  O  OD2   . ASP A 1 299 ? 34.404  156.478 23.756  1.00 19.10 ? 299  ASP A OD2   1 
ATOM   2305  N  N     . ILE A 1 300 ? 36.984  161.218 25.141  1.00 17.81 ? 300  ILE A N     1 
ATOM   2306  C  CA    . ILE A 1 300 ? 37.939  161.890 26.013  1.00 17.70 ? 300  ILE A CA    1 
ATOM   2307  C  C     . ILE A 1 300 ? 37.903  161.099 27.308  1.00 18.04 ? 300  ILE A C     1 
ATOM   2308  O  O     . ILE A 1 300 ? 36.906  161.132 28.028  1.00 16.65 ? 300  ILE A O     1 
ATOM   2309  C  CB    . ILE A 1 300 ? 37.511  163.339 26.314  1.00 18.98 ? 300  ILE A CB    1 
ATOM   2310  C  CG1   . ILE A 1 300 ? 37.349  164.119 25.004  1.00 19.31 ? 300  ILE A CG1   1 
ATOM   2311  C  CG2   . ILE A 1 300 ? 38.521  163.995 27.255  1.00 18.84 ? 300  ILE A CG2   1 
ATOM   2312  C  CD1   . ILE A 1 300 ? 38.565  164.105 24.108  1.00 16.74 ? 300  ILE A CD1   1 
ATOM   2313  N  N     . TYR A 1 301 ? 38.987  160.391 27.606  1.00 18.53 ? 301  TYR A N     1 
ATOM   2314  C  CA    . TYR A 1 301 ? 39.042  159.560 28.807  1.00 17.82 ? 301  TYR A CA    1 
ATOM   2315  C  C     . TYR A 1 301 ? 39.866  160.166 29.942  1.00 17.89 ? 301  TYR A C     1 
ATOM   2316  O  O     . TYR A 1 301 ? 40.961  160.688 29.718  1.00 17.11 ? 301  TYR A O     1 
ATOM   2317  C  CB    . TYR A 1 301 ? 39.583  158.175 28.425  1.00 18.66 ? 301  TYR A CB    1 
ATOM   2318  C  CG    . TYR A 1 301 ? 39.978  157.276 29.578  1.00 18.84 ? 301  TYR A CG    1 
ATOM   2319  C  CD1   . TYR A 1 301 ? 41.290  157.259 30.056  1.00 18.81 ? 301  TYR A CD1   1 
ATOM   2320  C  CD2   . TYR A 1 301 ? 39.054  156.401 30.150  1.00 17.42 ? 301  TYR A CD2   1 
ATOM   2321  C  CE1   . TYR A 1 301 ? 41.676  156.387 31.069  1.00 17.84 ? 301  TYR A CE1   1 
ATOM   2322  C  CE2   . TYR A 1 301 ? 39.426  155.527 31.163  1.00 18.47 ? 301  TYR A CE2   1 
ATOM   2323  C  CZ    . TYR A 1 301 ? 40.737  155.522 31.617  1.00 18.26 ? 301  TYR A CZ    1 
ATOM   2324  O  OH    . TYR A 1 301 ? 41.094  154.644 32.611  1.00 17.26 ? 301  TYR A OH    1 
ATOM   2325  N  N     . TRP A 1 302 ? 39.324  160.101 31.159  1.00 17.53 ? 302  TRP A N     1 
ATOM   2326  C  CA    . TRP A 1 302 ? 40.035  160.635 32.315  1.00 17.98 ? 302  TRP A CA    1 
ATOM   2327  C  C     . TRP A 1 302 ? 40.088  159.727 33.533  1.00 17.03 ? 302  TRP A C     1 
ATOM   2328  O  O     . TRP A 1 302 ? 39.088  159.526 34.210  1.00 17.37 ? 302  TRP A O     1 
ATOM   2329  C  CB    . TRP A 1 302 ? 39.456  161.989 32.744  1.00 17.46 ? 302  TRP A CB    1 
ATOM   2330  C  CG    . TRP A 1 302 ? 40.155  162.600 33.953  1.00 17.52 ? 302  TRP A CG    1 
ATOM   2331  C  CD1   . TRP A 1 302 ? 41.408  162.294 34.433  1.00 17.65 ? 302  TRP A CD1   1 
ATOM   2332  C  CD2   . TRP A 1 302 ? 39.651  163.640 34.806  1.00 17.85 ? 302  TRP A CD2   1 
ATOM   2333  N  NE1   . TRP A 1 302 ? 41.709  163.080 35.529  1.00 14.07 ? 302  TRP A NE1   1 
ATOM   2334  C  CE2   . TRP A 1 302 ? 40.651  163.914 35.777  1.00 16.92 ? 302  TRP A CE2   1 
ATOM   2335  C  CE3   . TRP A 1 302 ? 38.452  164.369 34.843  1.00 18.55 ? 302  TRP A CE3   1 
ATOM   2336  C  CZ2   . TRP A 1 302 ? 40.485  164.886 36.771  1.00 17.96 ? 302  TRP A CZ2   1 
ATOM   2337  C  CZ3   . TRP A 1 302 ? 38.286  165.335 35.829  1.00 18.69 ? 302  TRP A CZ3   1 
ATOM   2338  C  CH2   . TRP A 1 302 ? 39.301  165.586 36.782  1.00 18.88 ? 302  TRP A CH2   1 
ATOM   2339  N  N     . CYS A 1 303 ? 41.275  159.183 33.789  1.00 16.34 ? 303  CYS A N     1 
ATOM   2340  C  CA    . CYS A 1 303 ? 41.531  158.351 34.956  1.00 14.17 ? 303  CYS A CA    1 
ATOM   2341  C  C     . CYS A 1 303 ? 42.251  159.288 35.930  1.00 13.26 ? 303  CYS A C     1 
ATOM   2342  O  O     . CYS A 1 303 ? 43.252  159.927 35.580  1.00 10.92 ? 303  CYS A O     1 
ATOM   2343  C  CB    . CYS A 1 303 ? 42.435  157.172 34.597  1.00 14.76 ? 303  CYS A CB    1 
ATOM   2344  S  SG    . CYS A 1 303 ? 43.175  156.360 36.035  1.00 19.52 ? 303  CYS A SG    1 
ATOM   2345  N  N     . THR A 1 304 ? 41.733  159.378 37.150  1.00 14.41 ? 304  THR A N     1 
ATOM   2346  C  CA    . THR A 1 304 ? 42.312  160.260 38.159  1.00 13.70 ? 304  THR A CA    1 
ATOM   2347  C  C     . THR A 1 304 ? 43.402  159.608 38.992  1.00 15.96 ? 304  THR A C     1 
ATOM   2348  O  O     . THR A 1 304 ? 44.071  160.290 39.774  1.00 16.86 ? 304  THR A O     1 
ATOM   2349  C  CB    . THR A 1 304 ? 41.241  160.783 39.133  1.00 13.53 ? 304  THR A CB    1 
ATOM   2350  O  OG1   . THR A 1 304 ? 40.715  159.695 39.900  1.00 14.46 ? 304  THR A OG1   1 
ATOM   2351  C  CG2   . THR A 1 304 ? 40.113  161.454 38.374  1.00 9.79  ? 304  THR A CG2   1 
ATOM   2352  N  N     . ALA A 1 305 ? 43.583  158.297 38.832  1.00 15.50 ? 305  ALA A N     1 
ATOM   2353  C  CA    . ALA A 1 305 ? 44.600  157.570 39.598  1.00 16.32 ? 305  ALA A CA    1 
ATOM   2354  C  C     . ALA A 1 305 ? 45.993  158.134 39.347  1.00 16.50 ? 305  ALA A C     1 
ATOM   2355  O  O     . ALA A 1 305 ? 46.325  158.506 38.219  1.00 15.50 ? 305  ALA A O     1 
ATOM   2356  C  CB    . ALA A 1 305 ? 44.570  156.090 39.247  1.00 14.55 ? 305  ALA A CB    1 
ATOM   2357  N  N     . ASP A 1 306 ? 46.802  158.211 40.404  1.00 16.27 ? 306  ASP A N     1 
ATOM   2358  C  CA    . ASP A 1 306 ? 48.160  158.729 40.281  1.00 15.37 ? 306  ASP A CA    1 
ATOM   2359  C  C     . ASP A 1 306 ? 49.022  157.783 39.451  1.00 15.09 ? 306  ASP A C     1 
ATOM   2360  O  O     . ASP A 1 306 ? 48.841  156.567 39.487  1.00 15.44 ? 306  ASP A O     1 
ATOM   2361  C  CB    . ASP A 1 306 ? 48.796  158.926 41.659  1.00 14.58 ? 306  ASP A CB    1 
ATOM   2362  C  CG    . ASP A 1 306 ? 50.091  159.730 41.593  1.00 15.88 ? 306  ASP A CG    1 
ATOM   2363  O  OD1   . ASP A 1 306 ? 51.180  159.129 41.442  1.00 14.98 ? 306  ASP A OD1   1 
ATOM   2364  O  OD2   . ASP A 1 306 ? 50.015  160.972 41.680  1.00 16.58 ? 306  ASP A OD2   1 
ATOM   2365  N  N     . VAL A 1 307 ? 49.959  158.358 38.708  1.00 13.82 ? 307  VAL A N     1 
ATOM   2366  C  CA    . VAL A 1 307 ? 50.843  157.593 37.848  1.00 14.26 ? 307  VAL A CA    1 
ATOM   2367  C  C     . VAL A 1 307 ? 51.692  156.598 38.634  1.00 13.79 ? 307  VAL A C     1 
ATOM   2368  O  O     . VAL A 1 307 ? 52.189  155.616 38.082  1.00 15.39 ? 307  VAL A O     1 
ATOM   2369  C  CB    . VAL A 1 307 ? 51.763  158.546 37.056  1.00 15.80 ? 307  VAL A CB    1 
ATOM   2370  C  CG1   . VAL A 1 307 ? 52.861  159.081 37.969  1.00 16.18 ? 307  VAL A CG1   1 
ATOM   2371  C  CG2   . VAL A 1 307 ? 52.333  157.838 35.832  1.00 13.03 ? 307  VAL A CG2   1 
ATOM   2372  N  N     . GLY A 1 308 ? 51.841  156.847 39.929  1.00 14.80 ? 308  GLY A N     1 
ATOM   2373  C  CA    . GLY A 1 308 ? 52.640  155.972 40.772  1.00 14.81 ? 308  GLY A CA    1 
ATOM   2374  C  C     . GLY A 1 308 ? 51.963  154.686 41.212  1.00 17.54 ? 308  GLY A C     1 
ATOM   2375  O  O     . GLY A 1 308 ? 52.620  153.812 41.789  1.00 16.34 ? 308  GLY A O     1 
ATOM   2376  N  N     . TRP A 1 309 ? 50.661  154.559 40.951  1.00 16.86 ? 309  TRP A N     1 
ATOM   2377  C  CA    . TRP A 1 309 ? 49.907  153.365 41.337  1.00 15.45 ? 309  TRP A CA    1 
ATOM   2378  C  C     . TRP A 1 309 ? 49.637  152.500 40.111  1.00 14.63 ? 309  TRP A C     1 
ATOM   2379  O  O     . TRP A 1 309 ? 49.687  152.987 38.980  1.00 15.31 ? 309  TRP A O     1 
ATOM   2380  C  CB    . TRP A 1 309 ? 48.581  153.770 41.991  1.00 15.92 ? 309  TRP A CB    1 
ATOM   2381  C  CG    . TRP A 1 309 ? 48.764  154.628 43.206  1.00 16.86 ? 309  TRP A CG    1 
ATOM   2382  C  CD1   . TRP A 1 309 ? 48.177  155.837 43.451  1.00 17.70 ? 309  TRP A CD1   1 
ATOM   2383  C  CD2   . TRP A 1 309 ? 49.602  154.352 44.335  1.00 17.90 ? 309  TRP A CD2   1 
ATOM   2384  N  NE1   . TRP A 1 309 ? 48.601  156.334 44.660  1.00 17.53 ? 309  TRP A NE1   1 
ATOM   2385  C  CE2   . TRP A 1 309 ? 49.474  155.441 45.226  1.00 18.75 ? 309  TRP A CE2   1 
ATOM   2386  C  CE3   . TRP A 1 309 ? 50.448  153.289 44.684  1.00 18.11 ? 309  TRP A CE3   1 
ATOM   2387  C  CZ2   . TRP A 1 309 ? 50.160  155.496 46.444  1.00 17.95 ? 309  TRP A CZ2   1 
ATOM   2388  C  CZ3   . TRP A 1 309 ? 51.131  153.346 45.897  1.00 15.84 ? 309  TRP A CZ3   1 
ATOM   2389  C  CH2   . TRP A 1 309 ? 50.981  154.441 46.759  1.00 17.89 ? 309  TRP A CH2   1 
ATOM   2390  N  N     . VAL A 1 310 ? 49.348  151.222 40.327  1.00 13.11 ? 310  VAL A N     1 
ATOM   2391  C  CA    . VAL A 1 310 ? 49.099  150.336 39.202  1.00 12.47 ? 310  VAL A CA    1 
ATOM   2392  C  C     . VAL A 1 310 ? 47.999  150.879 38.283  1.00 13.14 ? 310  VAL A C     1 
ATOM   2393  O  O     . VAL A 1 310 ? 48.096  150.757 37.063  1.00 13.50 ? 310  VAL A O     1 
ATOM   2394  C  CB    . VAL A 1 310 ? 48.749  148.895 39.671  1.00 10.68 ? 310  VAL A CB    1 
ATOM   2395  C  CG1   . VAL A 1 310 ? 47.414  148.870 40.395  1.00 8.24  ? 310  VAL A CG1   1 
ATOM   2396  C  CG2   . VAL A 1 310 ? 48.751  147.951 38.472  1.00 9.51  ? 310  VAL A CG2   1 
ATOM   2397  N  N     . THR A 1 311 ? 46.972  151.496 38.868  1.00 13.87 ? 311  THR A N     1 
ATOM   2398  C  CA    . THR A 1 311 ? 45.876  152.051 38.079  1.00 13.56 ? 311  THR A CA    1 
ATOM   2399  C  C     . THR A 1 311 ? 46.424  153.097 37.114  1.00 15.35 ? 311  THR A C     1 
ATOM   2400  O  O     . THR A 1 311 ? 45.978  153.201 35.973  1.00 17.24 ? 311  THR A O     1 
ATOM   2401  C  CB    . THR A 1 311 ? 44.813  152.706 38.980  1.00 14.28 ? 311  THR A CB    1 
ATOM   2402  O  OG1   . THR A 1 311 ? 44.430  151.791 40.011  1.00 17.07 ? 311  THR A OG1   1 
ATOM   2403  C  CG2   . THR A 1 311 ? 43.574  153.081 38.170  1.00 13.88 ? 311  THR A CG2   1 
ATOM   2404  N  N     . GLY A 1 312 ? 47.399  153.867 37.590  1.00 15.81 ? 312  GLY A N     1 
ATOM   2405  C  CA    . GLY A 1 312 ? 48.018  154.889 36.769  1.00 14.31 ? 312  GLY A CA    1 
ATOM   2406  C  C     . GLY A 1 312 ? 48.787  154.276 35.615  1.00 15.01 ? 312  GLY A C     1 
ATOM   2407  O  O     . GLY A 1 312 ? 48.752  154.793 34.506  1.00 17.33 ? 312  GLY A O     1 
ATOM   2408  N  N     . HIS A 1 313 ? 49.488  153.177 35.865  1.00 13.18 ? 313  HIS A N     1 
ATOM   2409  C  CA    . HIS A 1 313 ? 50.247  152.504 34.810  1.00 11.93 ? 313  HIS A CA    1 
ATOM   2410  C  C     . HIS A 1 313 ? 49.293  151.902 33.785  1.00 10.92 ? 313  HIS A C     1 
ATOM   2411  O  O     . HIS A 1 313 ? 49.427  152.115 32.590  1.00 8.35  ? 313  HIS A O     1 
ATOM   2412  C  CB    . HIS A 1 313 ? 51.087  151.354 35.386  1.00 12.32 ? 313  HIS A CB    1 
ATOM   2413  C  CG    . HIS A 1 313 ? 52.280  151.790 36.179  1.00 14.40 ? 313  HIS A CG    1 
ATOM   2414  N  ND1   . HIS A 1 313 ? 52.275  152.904 36.991  1.00 13.83 ? 313  HIS A ND1   1 
ATOM   2415  C  CD2   . HIS A 1 313 ? 53.491  151.206 36.350  1.00 16.92 ? 313  HIS A CD2   1 
ATOM   2416  C  CE1   . HIS A 1 313 ? 53.428  152.986 37.629  1.00 15.31 ? 313  HIS A CE1   1 
ATOM   2417  N  NE2   . HIS A 1 313 ? 54.184  151.968 37.259  1.00 14.82 ? 313  HIS A NE2   1 
ATOM   2418  N  N     . SER A 1 314 ? 48.320  151.141 34.268  1.00 11.45 ? 314  SER A N     1 
ATOM   2419  C  CA    . SER A 1 314 ? 47.388  150.466 33.384  1.00 13.33 ? 314  SER A CA    1 
ATOM   2420  C  C     . SER A 1 314 ? 46.272  151.277 32.743  1.00 14.62 ? 314  SER A C     1 
ATOM   2421  O  O     . SER A 1 314 ? 45.976  151.068 31.569  1.00 14.76 ? 314  SER A O     1 
ATOM   2422  C  CB    . SER A 1 314 ? 46.779  149.255 34.096  1.00 12.87 ? 314  SER A CB    1 
ATOM   2423  O  OG    . SER A 1 314 ? 47.743  148.229 34.272  1.00 14.29 ? 314  SER A OG    1 
ATOM   2424  N  N     . TYR A 1 315 ? 45.656  152.200 33.474  1.00 13.53 ? 315  TYR A N     1 
ATOM   2425  C  CA    . TYR A 1 315 ? 44.549  152.941 32.887  1.00 16.00 ? 315  TYR A CA    1 
ATOM   2426  C  C     . TYR A 1 315 ? 44.669  154.447 32.774  1.00 17.27 ? 315  TYR A C     1 
ATOM   2427  O  O     . TYR A 1 315 ? 43.672  155.140 32.630  1.00 19.60 ? 315  TYR A O     1 
ATOM   2428  C  CB    . TYR A 1 315 ? 43.243  152.545 33.586  1.00 14.68 ? 315  TYR A CB    1 
ATOM   2429  C  CG    . TYR A 1 315 ? 43.043  151.051 33.518  1.00 15.33 ? 315  TYR A CG    1 
ATOM   2430  C  CD1   . TYR A 1 315 ? 43.467  150.225 34.553  1.00 15.30 ? 315  TYR A CD1   1 
ATOM   2431  C  CD2   . TYR A 1 315 ? 42.527  150.449 32.371  1.00 15.72 ? 315  TYR A CD2   1 
ATOM   2432  C  CE1   . TYR A 1 315 ? 43.388  148.834 34.447  1.00 15.27 ? 315  TYR A CE1   1 
ATOM   2433  C  CE2   . TYR A 1 315 ? 42.447  149.055 32.257  1.00 16.12 ? 315  TYR A CE2   1 
ATOM   2434  C  CZ    . TYR A 1 315 ? 42.879  148.259 33.300  1.00 13.80 ? 315  TYR A CZ    1 
ATOM   2435  O  OH    . TYR A 1 315 ? 42.793  146.891 33.211  1.00 15.97 ? 315  TYR A OH    1 
ATOM   2436  N  N     . LEU A 1 316 ? 45.892  154.956 32.833  1.00 19.10 ? 316  LEU A N     1 
ATOM   2437  C  CA    . LEU A 1 316 ? 46.130  156.378 32.661  1.00 16.67 ? 316  LEU A CA    1 
ATOM   2438  C  C     . LEU A 1 316 ? 46.954  156.473 31.385  1.00 15.99 ? 316  LEU A C     1 
ATOM   2439  O  O     . LEU A 1 316 ? 46.687  157.301 30.509  1.00 13.32 ? 316  LEU A O     1 
ATOM   2440  C  CB    . LEU A 1 316 ? 46.925  156.956 33.839  1.00 15.93 ? 316  LEU A CB    1 
ATOM   2441  C  CG    . LEU A 1 316 ? 47.380  158.419 33.707  1.00 18.79 ? 316  LEU A CG    1 
ATOM   2442  C  CD1   . LEU A 1 316 ? 46.207  159.331 33.424  1.00 16.50 ? 316  LEU A CD1   1 
ATOM   2443  C  CD2   . LEU A 1 316 ? 48.061  158.848 34.992  1.00 20.25 ? 316  LEU A CD2   1 
ATOM   2444  N  N     . LEU A 1 317 ? 47.928  155.571 31.271  1.00 14.32 ? 317  LEU A N     1 
ATOM   2445  C  CA    . LEU A 1 317 ? 48.821  155.555 30.126  1.00 15.05 ? 317  LEU A CA    1 
ATOM   2446  C  C     . LEU A 1 317 ? 48.761  154.389 29.154  1.00 14.38 ? 317  LEU A C     1 
ATOM   2447  O  O     . LEU A 1 317 ? 48.261  154.522 28.042  1.00 16.22 ? 317  LEU A O     1 
ATOM   2448  C  CB    . LEU A 1 317 ? 50.259  155.681 30.609  1.00 17.31 ? 317  LEU A CB    1 
ATOM   2449  C  CG    . LEU A 1 317 ? 50.549  156.891 31.493  1.00 21.73 ? 317  LEU A CG    1 
ATOM   2450  C  CD1   . LEU A 1 317 ? 52.046  156.891 31.841  1.00 20.27 ? 317  LEU A CD1   1 
ATOM   2451  C  CD2   . LEU A 1 317 ? 50.135  158.181 30.769  1.00 17.70 ? 317  LEU A CD2   1 
ATOM   2452  N  N     . TYR A 1 318 ? 49.280  153.244 29.576  1.00 13.03 ? 318  TYR A N     1 
ATOM   2453  C  CA    . TYR A 1 318 ? 49.359  152.087 28.701  1.00 12.55 ? 318  TYR A CA    1 
ATOM   2454  C  C     . TYR A 1 318 ? 48.069  151.593 28.052  1.00 12.50 ? 318  TYR A C     1 
ATOM   2455  O  O     . TYR A 1 318 ? 47.984  151.545 26.831  1.00 11.99 ? 318  TYR A O     1 
ATOM   2456  C  CB    . TYR A 1 318 ? 50.093  150.956 29.426  1.00 13.62 ? 318  TYR A CB    1 
ATOM   2457  C  CG    . TYR A 1 318 ? 51.500  151.346 29.842  1.00 11.92 ? 318  TYR A CG    1 
ATOM   2458  C  CD1   . TYR A 1 318 ? 52.263  152.211 29.055  1.00 13.93 ? 318  TYR A CD1   1 
ATOM   2459  C  CD2   . TYR A 1 318 ? 52.079  150.840 31.005  1.00 14.19 ? 318  TYR A CD2   1 
ATOM   2460  C  CE1   . TYR A 1 318 ? 53.565  152.564 29.409  1.00 14.22 ? 318  TYR A CE1   1 
ATOM   2461  C  CE2   . TYR A 1 318 ? 53.391  151.187 31.370  1.00 13.68 ? 318  TYR A CE2   1 
ATOM   2462  C  CZ    . TYR A 1 318 ? 54.123  152.049 30.564  1.00 14.83 ? 318  TYR A CZ    1 
ATOM   2463  O  OH    . TYR A 1 318 ? 55.411  152.393 30.906  1.00 16.60 ? 318  TYR A OH    1 
ATOM   2464  N  N     . GLY A 1 319 ? 47.075  151.231 28.853  1.00 13.09 ? 319  GLY A N     1 
ATOM   2465  C  CA    . GLY A 1 319 ? 45.828  150.760 28.284  1.00 11.74 ? 319  GLY A CA    1 
ATOM   2466  C  C     . GLY A 1 319 ? 45.225  151.734 27.280  1.00 14.46 ? 319  GLY A C     1 
ATOM   2467  O  O     . GLY A 1 319 ? 44.943  151.353 26.134  1.00 13.86 ? 319  GLY A O     1 
ATOM   2468  N  N     . PRO A 1 320 ? 45.042  153.009 27.662  1.00 15.20 ? 320  PRO A N     1 
ATOM   2469  C  CA    . PRO A 1 320 ? 44.453  153.946 26.702  1.00 14.73 ? 320  PRO A CA    1 
ATOM   2470  C  C     . PRO A 1 320 ? 45.323  154.398 25.530  1.00 14.07 ? 320  PRO A C     1 
ATOM   2471  O  O     . PRO A 1 320 ? 44.811  154.625 24.440  1.00 14.00 ? 320  PRO A O     1 
ATOM   2472  C  CB    . PRO A 1 320 ? 44.001  155.109 27.588  1.00 14.61 ? 320  PRO A CB    1 
ATOM   2473  C  CG    . PRO A 1 320 ? 44.993  155.088 28.697  1.00 16.04 ? 320  PRO A CG    1 
ATOM   2474  C  CD    . PRO A 1 320 ? 45.146  153.618 29.000  1.00 13.12 ? 320  PRO A CD    1 
ATOM   2475  N  N     . LEU A 1 321 ? 46.627  154.531 25.733  1.00 13.36 ? 321  LEU A N     1 
ATOM   2476  C  CA    . LEU A 1 321 ? 47.468  154.964 24.622  1.00 12.62 ? 321  LEU A CA    1 
ATOM   2477  C  C     . LEU A 1 321 ? 47.583  153.845 23.593  1.00 13.42 ? 321  LEU A C     1 
ATOM   2478  O  O     . LEU A 1 321 ? 47.642  154.102 22.382  1.00 14.77 ? 321  LEU A O     1 
ATOM   2479  C  CB    . LEU A 1 321 ? 48.855  155.384 25.116  1.00 11.00 ? 321  LEU A CB    1 
ATOM   2480  C  CG    . LEU A 1 321 ? 48.896  156.644 25.994  1.00 10.78 ? 321  LEU A CG    1 
ATOM   2481  C  CD1   . LEU A 1 321 ? 50.319  156.872 26.479  1.00 11.12 ? 321  LEU A CD1   1 
ATOM   2482  C  CD2   . LEU A 1 321 ? 48.391  157.851 25.212  1.00 7.17  ? 321  LEU A CD2   1 
ATOM   2483  N  N     . ALA A 1 322 ? 47.602  152.605 24.078  1.00 12.14 ? 322  ALA A N     1 
ATOM   2484  C  CA    . ALA A 1 322 ? 47.694  151.448 23.198  1.00 12.58 ? 322  ALA A CA    1 
ATOM   2485  C  C     . ALA A 1 322 ? 46.509  151.440 22.250  1.00 11.97 ? 322  ALA A C     1 
ATOM   2486  O  O     . ALA A 1 322 ? 46.631  151.050 21.087  1.00 13.65 ? 322  ALA A O     1 
ATOM   2487  C  CB    . ALA A 1 322 ? 47.719  150.162 24.010  1.00 10.71 ? 322  ALA A CB    1 
ATOM   2488  N  N     . CYS A 1 323 ? 45.362  151.885 22.751  1.00 12.01 ? 323  CYS A N     1 
ATOM   2489  C  CA    . CYS A 1 323 ? 44.152  151.925 21.940  1.00 13.06 ? 323  CYS A CA    1 
ATOM   2490  C  C     . CYS A 1 323 ? 44.016  153.228 21.158  1.00 14.11 ? 323  CYS A C     1 
ATOM   2491  O  O     . CYS A 1 323 ? 43.008  153.438 20.484  1.00 13.90 ? 323  CYS A O     1 
ATOM   2492  C  CB    . CYS A 1 323 ? 42.918  151.735 22.822  1.00 13.72 ? 323  CYS A CB    1 
ATOM   2493  S  SG    . CYS A 1 323 ? 42.843  150.160 23.693  1.00 18.80 ? 323  CYS A SG    1 
ATOM   2494  N  N     . GLY A 1 324 ? 45.026  154.093 21.266  1.00 14.50 ? 324  GLY A N     1 
ATOM   2495  C  CA    . GLY A 1 324 ? 45.026  155.367 20.566  1.00 15.12 ? 324  GLY A CA    1 
ATOM   2496  C  C     . GLY A 1 324 ? 44.041  156.395 21.107  1.00 16.03 ? 324  GLY A C     1 
ATOM   2497  O  O     . GLY A 1 324 ? 43.586  157.273 20.375  1.00 15.65 ? 324  GLY A O     1 
ATOM   2498  N  N     . ALA A 1 325 ? 43.719  156.299 22.390  1.00 15.85 ? 325  ALA A N     1 
ATOM   2499  C  CA    . ALA A 1 325 ? 42.768  157.218 23.014  1.00 15.96 ? 325  ALA A CA    1 
ATOM   2500  C  C     . ALA A 1 325 ? 43.405  158.506 23.516  1.00 16.69 ? 325  ALA A C     1 
ATOM   2501  O  O     . ALA A 1 325 ? 44.630  158.633 23.576  1.00 16.71 ? 325  ALA A O     1 
ATOM   2502  C  CB    . ALA A 1 325 ? 42.073  156.521 24.174  1.00 16.93 ? 325  ALA A CB    1 
ATOM   2503  N  N     . THR A 1 326 ? 42.555  159.468 23.861  1.00 15.45 ? 326  THR A N     1 
ATOM   2504  C  CA    . THR A 1 326 ? 43.021  160.726 24.412  1.00 14.06 ? 326  THR A CA    1 
ATOM   2505  C  C     . THR A 1 326 ? 42.827  160.530 25.905  1.00 14.52 ? 326  THR A C     1 
ATOM   2506  O  O     . THR A 1 326 ? 41.702  160.359 26.370  1.00 14.93 ? 326  THR A O     1 
ATOM   2507  C  CB    . THR A 1 326 ? 42.172  161.913 23.932  1.00 13.62 ? 326  THR A CB    1 
ATOM   2508  O  OG1   . THR A 1 326 ? 42.425  162.150 22.543  1.00 14.89 ? 326  THR A OG1   1 
ATOM   2509  C  CG2   . THR A 1 326 ? 42.507  163.172 24.740  1.00 12.14 ? 326  THR A CG2   1 
ATOM   2510  N  N     . THR A 1 327 ? 43.928  160.521 26.651  1.00 14.06 ? 327  THR A N     1 
ATOM   2511  C  CA    . THR A 1 327 ? 43.871  160.313 28.093  1.00 12.84 ? 327  THR A CA    1 
ATOM   2512  C  C     . THR A 1 327 ? 44.243  161.587 28.841  1.00 12.89 ? 327  THR A C     1 
ATOM   2513  O  O     . THR A 1 327 ? 45.159  162.305 28.451  1.00 12.36 ? 327  THR A O     1 
ATOM   2514  C  CB    . THR A 1 327 ? 44.810  159.157 28.515  1.00 11.91 ? 327  THR A CB    1 
ATOM   2515  O  OG1   . THR A 1 327 ? 44.553  158.803 29.879  1.00 8.93  ? 327  THR A OG1   1 
ATOM   2516  C  CG2   . THR A 1 327 ? 46.271  159.565 28.358  1.00 10.44 ? 327  THR A CG2   1 
ATOM   2517  N  N     . LEU A 1 328 ? 43.526  161.859 29.922  1.00 14.57 ? 328  LEU A N     1 
ATOM   2518  C  CA    . LEU A 1 328 ? 43.760  163.067 30.698  1.00 15.02 ? 328  LEU A CA    1 
ATOM   2519  C  C     . LEU A 1 328 ? 44.541  162.814 31.980  1.00 16.06 ? 328  LEU A C     1 
ATOM   2520  O  O     . LEU A 1 328 ? 44.192  161.951 32.782  1.00 18.86 ? 328  LEU A O     1 
ATOM   2521  C  CB    . LEU A 1 328 ? 42.415  163.734 31.028  1.00 14.09 ? 328  LEU A CB    1 
ATOM   2522  C  CG    . LEU A 1 328 ? 42.376  165.186 31.528  1.00 15.00 ? 328  LEU A CG    1 
ATOM   2523  C  CD1   . LEU A 1 328 ? 40.972  165.725 31.376  1.00 11.40 ? 328  LEU A CD1   1 
ATOM   2524  C  CD2   . LEU A 1 328 ? 42.831  165.281 32.978  1.00 11.82 ? 328  LEU A CD2   1 
ATOM   2525  N  N     . MET A 1 329 ? 45.604  163.588 32.159  1.00 15.41 ? 329  MET A N     1 
ATOM   2526  C  CA    . MET A 1 329 ? 46.436  163.486 33.342  1.00 15.30 ? 329  MET A CA    1 
ATOM   2527  C  C     . MET A 1 329 ? 46.234  164.763 34.136  1.00 15.67 ? 329  MET A C     1 
ATOM   2528  O  O     . MET A 1 329 ? 46.649  165.842 33.707  1.00 14.98 ? 329  MET A O     1 
ATOM   2529  C  CB    . MET A 1 329 ? 47.912  163.353 32.959  1.00 16.43 ? 329  MET A CB    1 
ATOM   2530  C  CG    . MET A 1 329 ? 48.859  163.472 34.151  1.00 17.08 ? 329  MET A CG    1 
ATOM   2531  S  SD    . MET A 1 329 ? 50.611  163.446 33.703  1.00 15.70 ? 329  MET A SD    1 
ATOM   2532  C  CE    . MET A 1 329 ? 50.849  161.669 33.518  1.00 13.88 ? 329  MET A CE    1 
ATOM   2533  N  N     . PHE A 1 330 ? 45.580  164.638 35.285  1.00 15.31 ? 330  PHE A N     1 
ATOM   2534  C  CA    . PHE A 1 330 ? 45.317  165.767 36.161  1.00 14.28 ? 330  PHE A CA    1 
ATOM   2535  C  C     . PHE A 1 330 ? 46.452  165.873 37.178  1.00 13.94 ? 330  PHE A C     1 
ATOM   2536  O  O     . PHE A 1 330 ? 46.853  164.880 37.784  1.00 13.55 ? 330  PHE A O     1 
ATOM   2537  C  CB    . PHE A 1 330 ? 43.967  165.569 36.867  1.00 14.85 ? 330  PHE A CB    1 
ATOM   2538  C  CG    . PHE A 1 330 ? 43.609  166.668 37.819  1.00 12.75 ? 330  PHE A CG    1 
ATOM   2539  C  CD1   . PHE A 1 330 ? 43.737  168.002 37.450  1.00 14.47 ? 330  PHE A CD1   1 
ATOM   2540  C  CD2   . PHE A 1 330 ? 43.115  166.366 39.082  1.00 12.25 ? 330  PHE A CD2   1 
ATOM   2541  C  CE1   . PHE A 1 330 ? 43.375  169.027 38.333  1.00 14.20 ? 330  PHE A CE1   1 
ATOM   2542  C  CE2   . PHE A 1 330 ? 42.751  167.379 39.967  1.00 12.71 ? 330  PHE A CE2   1 
ATOM   2543  C  CZ    . PHE A 1 330 ? 42.881  168.713 39.590  1.00 13.19 ? 330  PHE A CZ    1 
ATOM   2544  N  N     . GLU A 1 331 ? 46.962  167.084 37.363  1.00 15.14 ? 331  GLU A N     1 
ATOM   2545  C  CA    . GLU A 1 331 ? 48.075  167.314 38.281  1.00 15.02 ? 331  GLU A CA    1 
ATOM   2546  C  C     . GLU A 1 331 ? 47.724  167.445 39.761  1.00 15.68 ? 331  GLU A C     1 
ATOM   2547  O  O     . GLU A 1 331 ? 48.487  166.988 40.612  1.00 14.30 ? 331  GLU A O     1 
ATOM   2548  C  CB    . GLU A 1 331 ? 48.865  168.559 37.846  1.00 14.62 ? 331  GLU A CB    1 
ATOM   2549  C  CG    . GLU A 1 331 ? 49.950  168.984 38.845  1.00 15.35 ? 331  GLU A CG    1 
ATOM   2550  C  CD    . GLU A 1 331 ? 50.825  170.120 38.338  1.00 16.17 ? 331  GLU A CD    1 
ATOM   2551  O  OE1   . GLU A 1 331 ? 50.277  171.139 37.860  1.00 13.53 ? 331  GLU A OE1   1 
ATOM   2552  O  OE2   . GLU A 1 331 ? 52.065  169.998 38.430  1.00 16.54 ? 331  GLU A OE2   1 
ATOM   2553  N  N     . GLY A 1 332 ? 46.579  168.054 40.068  1.00 16.13 ? 332  GLY A N     1 
ATOM   2554  C  CA    . GLY A 1 332 ? 46.199  168.254 41.460  1.00 16.99 ? 332  GLY A CA    1 
ATOM   2555  C  C     . GLY A 1 332 ? 45.233  167.267 42.089  1.00 18.64 ? 332  GLY A C     1 
ATOM   2556  O  O     . GLY A 1 332 ? 45.323  166.062 41.855  1.00 17.82 ? 332  GLY A O     1 
ATOM   2557  N  N     . VAL A 1 333 ? 44.318  167.787 42.910  1.00 19.33 ? 333  VAL A N     1 
ATOM   2558  C  CA    . VAL A 1 333 ? 43.310  166.965 43.591  1.00 20.18 ? 333  VAL A CA    1 
ATOM   2559  C  C     . VAL A 1 333 ? 41.887  167.374 43.157  1.00 21.03 ? 333  VAL A C     1 
ATOM   2560  O  O     . VAL A 1 333 ? 41.650  168.523 42.758  1.00 20.55 ? 333  VAL A O     1 
ATOM   2561  C  CB    . VAL A 1 333 ? 43.425  167.082 45.148  1.00 19.55 ? 333  VAL A CB    1 
ATOM   2562  C  CG1   . VAL A 1 333 ? 44.800  166.622 45.613  1.00 16.58 ? 333  VAL A CG1   1 
ATOM   2563  C  CG2   . VAL A 1 333 ? 43.170  168.506 45.585  1.00 19.42 ? 333  VAL A CG2   1 
ATOM   2564  N  N     . PRO A 1 334 ? 40.924  166.432 43.235  1.00 20.14 ? 334  PRO A N     1 
ATOM   2565  C  CA    . PRO A 1 334 ? 39.508  166.583 42.871  1.00 19.55 ? 334  PRO A CA    1 
ATOM   2566  C  C     . PRO A 1 334 ? 38.740  167.741 43.498  1.00 19.31 ? 334  PRO A C     1 
ATOM   2567  O  O     . PRO A 1 334 ? 37.768  168.225 42.915  1.00 19.39 ? 334  PRO A O     1 
ATOM   2568  C  CB    . PRO A 1 334 ? 38.905  165.237 43.266  1.00 18.91 ? 334  PRO A CB    1 
ATOM   2569  C  CG    . PRO A 1 334 ? 40.046  164.300 43.093  1.00 19.86 ? 334  PRO A CG    1 
ATOM   2570  C  CD    . PRO A 1 334 ? 41.179  165.060 43.707  1.00 18.99 ? 334  PRO A CD    1 
ATOM   2571  N  N     . ASN A 1 335 ? 39.160  168.182 44.679  1.00 18.03 ? 335  ASN A N     1 
ATOM   2572  C  CA    . ASN A 1 335 ? 38.461  169.270 45.354  1.00 19.07 ? 335  ASN A CA    1 
ATOM   2573  C  C     . ASN A 1 335 ? 39.284  170.522 45.671  1.00 18.33 ? 335  ASN A C     1 
ATOM   2574  O  O     . ASN A 1 335 ? 39.082  171.159 46.705  1.00 17.23 ? 335  ASN A O     1 
ATOM   2575  C  CB    . ASN A 1 335 ? 37.805  168.737 46.635  1.00 20.18 ? 335  ASN A CB    1 
ATOM   2576  C  CG    . ASN A 1 335 ? 38.777  167.967 47.516  1.00 20.28 ? 335  ASN A CG    1 
ATOM   2577  O  OD1   . ASN A 1 335 ? 38.375  167.326 48.489  1.00 21.51 ? 335  ASN A OD1   1 
ATOM   2578  N  ND2   . ASN A 1 335 ? 40.062  168.032 47.183  1.00 18.97 ? 335  ASN A ND2   1 
ATOM   2579  N  N     . TRP A 1 336 ? 40.205  170.880 44.782  1.00 18.79 ? 336  TRP A N     1 
ATOM   2580  C  CA    . TRP A 1 336 ? 41.023  172.075 44.981  1.00 19.51 ? 336  TRP A CA    1 
ATOM   2581  C  C     . TRP A 1 336 ? 41.098  172.851 43.679  1.00 19.34 ? 336  TRP A C     1 
ATOM   2582  O  O     . TRP A 1 336 ? 41.414  172.285 42.637  1.00 19.03 ? 336  TRP A O     1 
ATOM   2583  C  CB    . TRP A 1 336 ? 42.441  171.718 45.421  1.00 21.22 ? 336  TRP A CB    1 
ATOM   2584  C  CG    . TRP A 1 336 ? 43.162  172.896 45.992  1.00 23.20 ? 336  TRP A CG    1 
ATOM   2585  C  CD1   . TRP A 1 336 ? 43.187  173.280 47.300  1.00 24.87 ? 336  TRP A CD1   1 
ATOM   2586  C  CD2   . TRP A 1 336 ? 43.876  173.904 45.265  1.00 24.58 ? 336  TRP A CD2   1 
ATOM   2587  N  NE1   . TRP A 1 336 ? 43.866  174.468 47.435  1.00 27.57 ? 336  TRP A NE1   1 
ATOM   2588  C  CE2   . TRP A 1 336 ? 44.301  174.874 46.203  1.00 25.97 ? 336  TRP A CE2   1 
ATOM   2589  C  CE3   . TRP A 1 336 ? 44.195  174.085 43.913  1.00 23.11 ? 336  TRP A CE3   1 
ATOM   2590  C  CZ2   . TRP A 1 336 ? 45.032  176.011 45.832  1.00 26.19 ? 336  TRP A CZ2   1 
ATOM   2591  C  CZ3   . TRP A 1 336 ? 44.920  175.217 43.543  1.00 26.10 ? 336  TRP A CZ3   1 
ATOM   2592  C  CH2   . TRP A 1 336 ? 45.331  176.165 44.503  1.00 25.01 ? 336  TRP A CH2   1 
ATOM   2593  N  N     . PRO A 1 337 ? 40.851  174.172 43.721  1.00 22.07 ? 337  PRO A N     1 
ATOM   2594  C  CA    . PRO A 1 337 ? 40.503  175.048 44.852  1.00 22.82 ? 337  PRO A CA    1 
ATOM   2595  C  C     . PRO A 1 337 ? 39.187  174.738 45.578  1.00 23.79 ? 337  PRO A C     1 
ATOM   2596  O  O     . PRO A 1 337 ? 39.059  175.013 46.772  1.00 23.77 ? 337  PRO A O     1 
ATOM   2597  C  CB    . PRO A 1 337 ? 40.464  176.438 44.211  1.00 22.80 ? 337  PRO A CB    1 
ATOM   2598  C  CG    . PRO A 1 337 ? 41.393  176.309 43.039  1.00 21.11 ? 337  PRO A CG    1 
ATOM   2599  C  CD    . PRO A 1 337 ? 41.032  174.963 42.491  1.00 20.33 ? 337  PRO A CD    1 
ATOM   2600  N  N     . THR A 1 338 ? 38.217  174.179 44.855  1.00 23.46 ? 338  THR A N     1 
ATOM   2601  C  CA    . THR A 1 338 ? 36.909  173.861 45.433  1.00 23.53 ? 338  THR A CA    1 
ATOM   2602  C  C     . THR A 1 338 ? 36.463  172.437 45.090  1.00 23.89 ? 338  THR A C     1 
ATOM   2603  O  O     . THR A 1 338 ? 36.989  171.820 44.160  1.00 23.65 ? 338  THR A O     1 
ATOM   2604  C  CB    . THR A 1 338 ? 35.824  174.819 44.899  1.00 23.36 ? 338  THR A CB    1 
ATOM   2605  O  OG1   . THR A 1 338 ? 35.560  174.507 43.522  1.00 23.78 ? 338  THR A OG1   1 
ATOM   2606  C  CG2   . THR A 1 338 ? 36.291  176.274 45.001  1.00 21.04 ? 338  THR A CG2   1 
ATOM   2607  N  N     . PRO A 1 339 ? 35.471  171.904 45.828  1.00 23.55 ? 339  PRO A N     1 
ATOM   2608  C  CA    . PRO A 1 339 ? 34.954  170.550 45.593  1.00 22.27 ? 339  PRO A CA    1 
ATOM   2609  C  C     . PRO A 1 339 ? 34.348  170.344 44.208  1.00 21.69 ? 339  PRO A C     1 
ATOM   2610  O  O     . PRO A 1 339 ? 34.074  169.218 43.805  1.00 21.53 ? 339  PRO A O     1 
ATOM   2611  C  CB    . PRO A 1 339 ? 33.929  170.368 46.715  1.00 22.19 ? 339  PRO A CB    1 
ATOM   2612  C  CG    . PRO A 1 339 ? 33.503  171.761 47.028  1.00 23.53 ? 339  PRO A CG    1 
ATOM   2613  C  CD    . PRO A 1 339 ? 34.812  172.507 47.000  1.00 23.09 ? 339  PRO A CD    1 
ATOM   2614  N  N     . ALA A 1 340 ? 34.149  171.432 43.476  1.00 20.54 ? 340  ALA A N     1 
ATOM   2615  C  CA    . ALA A 1 340 ? 33.594  171.332 42.139  1.00 19.48 ? 340  ALA A CA    1 
ATOM   2616  C  C     . ALA A 1 340 ? 34.701  171.256 41.087  1.00 19.80 ? 340  ALA A C     1 
ATOM   2617  O  O     . ALA A 1 340 ? 34.421  171.274 39.890  1.00 20.79 ? 340  ALA A O     1 
ATOM   2618  C  CB    . ALA A 1 340 ? 32.698  172.529 41.862  1.00 20.39 ? 340  ALA A CB    1 
ATOM   2619  N  N     . ARG A 1 341 ? 35.954  171.171 41.525  1.00 17.37 ? 341  ARG A N     1 
ATOM   2620  C  CA    . ARG A 1 341 ? 37.068  171.109 40.590  1.00 17.61 ? 341  ARG A CA    1 
ATOM   2621  C  C     . ARG A 1 341 ? 36.958  169.937 39.622  1.00 16.12 ? 341  ARG A C     1 
ATOM   2622  O  O     . ARG A 1 341 ? 37.080  170.115 38.406  1.00 14.94 ? 341  ARG A O     1 
ATOM   2623  C  CB    . ARG A 1 341 ? 38.404  171.022 41.345  1.00 20.40 ? 341  ARG A CB    1 
ATOM   2624  C  CG    . ARG A 1 341 ? 39.639  171.087 40.429  1.00 21.86 ? 341  ARG A CG    1 
ATOM   2625  C  CD    . ARG A 1 341 ? 39.648  172.370 39.601  1.00 20.95 ? 341  ARG A CD    1 
ATOM   2626  N  NE    . ARG A 1 341 ? 40.657  172.365 38.539  1.00 21.12 ? 341  ARG A NE    1 
ATOM   2627  C  CZ    . ARG A 1 341 ? 41.970  172.455 38.736  1.00 21.26 ? 341  ARG A CZ    1 
ATOM   2628  N  NH1   . ARG A 1 341 ? 42.463  172.560 39.963  1.00 20.12 ? 341  ARG A NH1   1 
ATOM   2629  N  NH2   . ARG A 1 341 ? 42.793  172.445 37.696  1.00 19.30 ? 341  ARG A NH2   1 
ATOM   2630  N  N     . MET A 1 342 ? 36.723  168.740 40.151  1.00 15.58 ? 342  MET A N     1 
ATOM   2631  C  CA    . MET A 1 342 ? 36.629  167.558 39.301  1.00 15.96 ? 342  MET A CA    1 
ATOM   2632  C  C     . MET A 1 342 ? 35.655  167.739 38.141  1.00 16.88 ? 342  MET A C     1 
ATOM   2633  O  O     . MET A 1 342 ? 35.989  167.432 36.998  1.00 17.40 ? 342  MET A O     1 
ATOM   2634  C  CB    . MET A 1 342 ? 36.221  166.327 40.114  1.00 16.52 ? 342  MET A CB    1 
ATOM   2635  C  CG    . MET A 1 342 ? 36.185  165.038 39.291  1.00 15.89 ? 342  MET A CG    1 
ATOM   2636  S  SD    . MET A 1 342 ? 35.703  163.605 40.280  1.00 20.18 ? 342  MET A SD    1 
ATOM   2637  C  CE    . MET A 1 342 ? 33.920  163.678 40.121  1.00 18.09 ? 342  MET A CE    1 
ATOM   2638  N  N     . CYS A 1 343 ? 34.458  168.246 38.425  1.00 16.41 ? 343  CYS A N     1 
ATOM   2639  C  CA    . CYS A 1 343 ? 33.467  168.439 37.373  1.00 17.55 ? 343  CYS A CA    1 
ATOM   2640  C  C     . CYS A 1 343 ? 33.814  169.609 36.455  1.00 17.56 ? 343  CYS A C     1 
ATOM   2641  O  O     . CYS A 1 343 ? 33.477  169.602 35.270  1.00 18.48 ? 343  CYS A O     1 
ATOM   2642  C  CB    . CYS A 1 343 ? 32.076  168.614 37.984  1.00 18.33 ? 343  CYS A CB    1 
ATOM   2643  S  SG    . CYS A 1 343 ? 31.520  167.148 38.864  1.00 17.43 ? 343  CYS A SG    1 
ATOM   2644  N  N     . GLN A 1 344 ? 34.499  170.610 36.994  1.00 16.93 ? 344  GLN A N     1 
ATOM   2645  C  CA    . GLN A 1 344 ? 34.905  171.749 36.181  1.00 17.38 ? 344  GLN A CA    1 
ATOM   2646  C  C     . GLN A 1 344 ? 35.864  171.257 35.094  1.00 16.27 ? 344  GLN A C     1 
ATOM   2647  O  O     . GLN A 1 344 ? 35.794  171.690 33.953  1.00 16.58 ? 344  GLN A O     1 
ATOM   2648  C  CB    . GLN A 1 344 ? 35.573  172.810 37.059  1.00 17.39 ? 344  GLN A CB    1 
ATOM   2649  C  CG    . GLN A 1 344 ? 34.590  173.504 37.993  1.00 21.03 ? 344  GLN A CG    1 
ATOM   2650  C  CD    . GLN A 1 344 ? 35.250  174.455 38.976  1.00 21.86 ? 344  GLN A CD    1 
ATOM   2651  O  OE1   . GLN A 1 344 ? 34.570  175.235 39.643  1.00 23.52 ? 344  GLN A OE1   1 
ATOM   2652  N  NE2   . GLN A 1 344 ? 36.578  174.391 39.077  1.00 21.74 ? 344  GLN A NE2   1 
ATOM   2653  N  N     . VAL A 1 345 ? 36.748  170.333 35.457  1.00 17.27 ? 345  VAL A N     1 
ATOM   2654  C  CA    . VAL A 1 345 ? 37.709  169.764 34.524  1.00 17.63 ? 345  VAL A CA    1 
ATOM   2655  C  C     . VAL A 1 345 ? 36.981  168.948 33.467  1.00 17.60 ? 345  VAL A C     1 
ATOM   2656  O  O     . VAL A 1 345 ? 37.362  168.943 32.290  1.00 17.38 ? 345  VAL A O     1 
ATOM   2657  C  CB    . VAL A 1 345 ? 38.718  168.842 35.254  1.00 18.76 ? 345  VAL A CB    1 
ATOM   2658  C  CG1   . VAL A 1 345 ? 39.556  168.073 34.237  1.00 18.81 ? 345  VAL A CG1   1 
ATOM   2659  C  CG2   . VAL A 1 345 ? 39.620  169.685 36.170  1.00 18.31 ? 345  VAL A CG2   1 
ATOM   2660  N  N     . VAL A 1 346 ? 35.937  168.248 33.903  1.00 17.29 ? 346  VAL A N     1 
ATOM   2661  C  CA    . VAL A 1 346 ? 35.119  167.426 33.020  1.00 15.73 ? 346  VAL A CA    1 
ATOM   2662  C  C     . VAL A 1 346 ? 34.516  168.289 31.918  1.00 16.76 ? 346  VAL A C     1 
ATOM   2663  O  O     . VAL A 1 346 ? 34.543  167.916 30.741  1.00 15.84 ? 346  VAL A O     1 
ATOM   2664  C  CB    . VAL A 1 346 ? 33.979  166.740 33.809  1.00 14.71 ? 346  VAL A CB    1 
ATOM   2665  C  CG1   . VAL A 1 346 ? 32.959  166.138 32.855  1.00 11.84 ? 346  VAL A CG1   1 
ATOM   2666  C  CG2   . VAL A 1 346 ? 34.562  165.674 34.719  1.00 13.93 ? 346  VAL A CG2   1 
ATOM   2667  N  N     . ASP A 1 347 ? 33.965  169.439 32.303  1.00 17.39 ? 347  ASP A N     1 
ATOM   2668  C  CA    . ASP A 1 347 ? 33.368  170.359 31.338  1.00 19.84 ? 347  ASP A CA    1 
ATOM   2669  C  C     . ASP A 1 347 ? 34.446  171.040 30.514  1.00 18.27 ? 347  ASP A C     1 
ATOM   2670  O  O     . ASP A 1 347 ? 34.289  171.225 29.312  1.00 18.12 ? 347  ASP A O     1 
ATOM   2671  C  CB    . ASP A 1 347 ? 32.550  171.456 32.032  1.00 20.41 ? 347  ASP A CB    1 
ATOM   2672  C  CG    . ASP A 1 347 ? 31.324  170.923 32.738  1.00 23.21 ? 347  ASP A CG    1 
ATOM   2673  O  OD1   . ASP A 1 347 ? 30.873  169.814 32.391  1.00 24.42 ? 347  ASP A OD1   1 
ATOM   2674  O  OD2   . ASP A 1 347 ? 30.801  171.630 33.631  1.00 25.89 ? 347  ASP A OD2   1 
ATOM   2675  N  N     . LYS A 1 348 ? 35.536  171.429 31.170  1.00 18.47 ? 348  LYS A N     1 
ATOM   2676  C  CA    . LYS A 1 348 ? 36.618  172.118 30.479  1.00 18.63 ? 348  LYS A CA    1 
ATOM   2677  C  C     . LYS A 1 348 ? 37.121  171.321 29.282  1.00 17.69 ? 348  LYS A C     1 
ATOM   2678  O  O     . LYS A 1 348 ? 37.305  171.869 28.193  1.00 16.18 ? 348  LYS A O     1 
ATOM   2679  C  CB    . LYS A 1 348 ? 37.779  172.394 31.439  1.00 17.34 ? 348  LYS A CB    1 
ATOM   2680  C  CG    . LYS A 1 348 ? 38.894  173.230 30.813  1.00 19.64 ? 348  LYS A CG    1 
ATOM   2681  C  CD    . LYS A 1 348 ? 40.038  173.484 31.782  1.00 18.63 ? 348  LYS A CD    1 
ATOM   2682  C  CE    . LYS A 1 348 ? 41.185  174.221 31.100  1.00 16.24 ? 348  LYS A CE    1 
ATOM   2683  N  NZ    . LYS A 1 348 ? 42.259  174.579 32.063  1.00 13.99 ? 348  LYS A NZ    1 
ATOM   2684  N  N     . HIS A 1 349 ? 37.324  170.023 29.478  1.00 17.29 ? 349  HIS A N     1 
ATOM   2685  C  CA    . HIS A 1 349 ? 37.833  169.172 28.409  1.00 18.09 ? 349  HIS A CA    1 
ATOM   2686  C  C     . HIS A 1 349 ? 36.831  168.185 27.818  1.00 16.59 ? 349  HIS A C     1 
ATOM   2687  O  O     . HIS A 1 349 ? 37.220  167.237 27.149  1.00 17.85 ? 349  HIS A O     1 
ATOM   2688  C  CB    . HIS A 1 349 ? 39.070  168.423 28.913  1.00 17.81 ? 349  HIS A CB    1 
ATOM   2689  C  CG    . HIS A 1 349 ? 40.154  169.329 29.411  1.00 16.57 ? 349  HIS A CG    1 
ATOM   2690  N  ND1   . HIS A 1 349 ? 40.746  170.287 28.613  1.00 13.79 ? 349  HIS A ND1   1 
ATOM   2691  C  CD2   . HIS A 1 349 ? 40.738  169.436 30.631  1.00 17.01 ? 349  HIS A CD2   1 
ATOM   2692  C  CE1   . HIS A 1 349 ? 41.649  170.944 29.320  1.00 13.76 ? 349  HIS A CE1   1 
ATOM   2693  N  NE2   . HIS A 1 349 ? 41.664  170.448 30.546  1.00 12.48 ? 349  HIS A NE2   1 
ATOM   2694  N  N     . GLN A 1 350 ? 35.544  168.415 28.062  1.00 17.38 ? 350  GLN A N     1 
ATOM   2695  C  CA    . GLN A 1 350 ? 34.486  167.544 27.541  1.00 17.49 ? 350  GLN A CA    1 
ATOM   2696  C  C     . GLN A 1 350 ? 34.760  166.055 27.762  1.00 16.22 ? 350  GLN A C     1 
ATOM   2697  O  O     . GLN A 1 350 ? 34.683  165.259 26.825  1.00 15.89 ? 350  GLN A O     1 
ATOM   2698  C  CB    . GLN A 1 350 ? 34.282  167.798 26.042  1.00 18.00 ? 350  GLN A CB    1 
ATOM   2699  C  CG    . GLN A 1 350 ? 33.750  169.181 25.698  1.00 19.12 ? 350  GLN A CG    1 
ATOM   2700  C  CD    . GLN A 1 350 ? 32.393  169.450 26.319  1.00 20.59 ? 350  GLN A CD    1 
ATOM   2701  O  OE1   . GLN A 1 350 ? 32.298  169.875 27.468  1.00 23.71 ? 350  GLN A OE1   1 
ATOM   2702  N  NE2   . GLN A 1 350 ? 31.334  169.184 25.567  1.00 21.83 ? 350  GLN A NE2   1 
ATOM   2703  N  N     . VAL A 1 351 ? 35.080  165.677 28.995  1.00 15.07 ? 351  VAL A N     1 
ATOM   2704  C  CA    . VAL A 1 351 ? 35.365  164.280 29.312  1.00 12.97 ? 351  VAL A CA    1 
ATOM   2705  C  C     . VAL A 1 351 ? 34.130  163.406 29.113  1.00 14.13 ? 351  VAL A C     1 
ATOM   2706  O  O     . VAL A 1 351 ? 33.038  163.753 29.562  1.00 11.97 ? 351  VAL A O     1 
ATOM   2707  C  CB    . VAL A 1 351 ? 35.835  164.128 30.768  1.00 12.12 ? 351  VAL A CB    1 
ATOM   2708  C  CG1   . VAL A 1 351 ? 36.140  162.662 31.062  1.00 8.57  ? 351  VAL A CG1   1 
ATOM   2709  C  CG2   . VAL A 1 351 ? 37.060  165.022 31.020  1.00 9.34  ? 351  VAL A CG2   1 
ATOM   2710  N  N     . ASN A 1 352 ? 34.302  162.270 28.442  1.00 13.88 ? 352  ASN A N     1 
ATOM   2711  C  CA    . ASN A 1 352 ? 33.195  161.357 28.200  1.00 13.20 ? 352  ASN A CA    1 
ATOM   2712  C  C     . ASN A 1 352 ? 33.284  160.146 29.129  1.00 13.81 ? 352  ASN A C     1 
ATOM   2713  O  O     . ASN A 1 352 ? 32.288  159.465 29.377  1.00 14.74 ? 352  ASN A O     1 
ATOM   2714  C  CB    . ASN A 1 352 ? 33.199  160.899 26.740  1.00 12.38 ? 352  ASN A CB    1 
ATOM   2715  C  CG    . ASN A 1 352 ? 33.318  162.066 25.767  1.00 13.74 ? 352  ASN A CG    1 
ATOM   2716  O  OD1   . ASN A 1 352 ? 34.306  162.181 25.038  1.00 13.56 ? 352  ASN A OD1   1 
ATOM   2717  N  ND2   . ASN A 1 352 ? 32.314  162.948 25.763  1.00 9.53  ? 352  ASN A ND2   1 
ATOM   2718  N  N     . ILE A 1 353 ? 34.476  159.880 29.649  1.00 13.57 ? 353  ILE A N     1 
ATOM   2719  C  CA    . ILE A 1 353 ? 34.681  158.749 30.545  1.00 13.03 ? 353  ILE A CA    1 
ATOM   2720  C  C     . ILE A 1 353 ? 35.481  159.192 31.765  1.00 13.96 ? 353  ILE A C     1 
ATOM   2721  O  O     . ILE A 1 353 ? 36.621  159.645 31.630  1.00 14.79 ? 353  ILE A O     1 
ATOM   2722  C  CB    . ILE A 1 353 ? 35.467  157.622 29.843  1.00 14.27 ? 353  ILE A CB    1 
ATOM   2723  C  CG1   . ILE A 1 353 ? 34.803  157.263 28.513  1.00 15.42 ? 353  ILE A CG1   1 
ATOM   2724  C  CG2   . ILE A 1 353 ? 35.518  156.393 30.731  1.00 12.07 ? 353  ILE A CG2   1 
ATOM   2725  C  CD1   . ILE A 1 353 ? 35.631  156.311 27.670  1.00 15.27 ? 353  ILE A CD1   1 
ATOM   2726  N  N     . LEU A 1 354 ? 34.881  159.067 32.947  1.00 14.27 ? 354  LEU A N     1 
ATOM   2727  C  CA    . LEU A 1 354 ? 35.541  159.433 34.199  1.00 13.18 ? 354  LEU A CA    1 
ATOM   2728  C  C     . LEU A 1 354 ? 35.734  158.176 35.041  1.00 13.75 ? 354  LEU A C     1 
ATOM   2729  O  O     . LEU A 1 354 ? 34.785  157.441 35.303  1.00 15.96 ? 354  LEU A O     1 
ATOM   2730  C  CB    . LEU A 1 354 ? 34.705  160.456 34.974  1.00 13.63 ? 354  LEU A CB    1 
ATOM   2731  C  CG    . LEU A 1 354 ? 35.174  160.821 36.386  1.00 14.67 ? 354  LEU A CG    1 
ATOM   2732  C  CD1   . LEU A 1 354 ? 36.555  161.467 36.352  1.00 14.98 ? 354  LEU A CD1   1 
ATOM   2733  C  CD2   . LEU A 1 354 ? 34.174  161.785 36.998  1.00 15.65 ? 354  LEU A CD2   1 
ATOM   2734  N  N     . TYR A 1 355 ? 36.974  157.940 35.451  1.00 12.99 ? 355  TYR A N     1 
ATOM   2735  C  CA    . TYR A 1 355 ? 37.341  156.765 36.235  1.00 13.01 ? 355  TYR A CA    1 
ATOM   2736  C  C     . TYR A 1 355 ? 38.064  157.233 37.491  1.00 14.78 ? 355  TYR A C     1 
ATOM   2737  O  O     . TYR A 1 355 ? 39.255  157.556 37.443  1.00 14.86 ? 355  TYR A O     1 
ATOM   2738  C  CB    . TYR A 1 355 ? 38.260  155.882 35.386  1.00 13.08 ? 355  TYR A CB    1 
ATOM   2739  C  CG    . TYR A 1 355 ? 38.716  154.583 36.013  1.00 11.03 ? 355  TYR A CG    1 
ATOM   2740  C  CD1   . TYR A 1 355 ? 37.837  153.791 36.753  1.00 10.81 ? 355  TYR A CD1   1 
ATOM   2741  C  CD2   . TYR A 1 355 ? 40.012  154.108 35.801  1.00 11.86 ? 355  TYR A CD2   1 
ATOM   2742  C  CE1   . TYR A 1 355 ? 38.232  152.552 37.265  1.00 9.29  ? 355  TYR A CE1   1 
ATOM   2743  C  CE2   . TYR A 1 355 ? 40.423  152.865 36.306  1.00 11.69 ? 355  TYR A CE2   1 
ATOM   2744  C  CZ    . TYR A 1 355 ? 39.523  152.094 37.035  1.00 11.32 ? 355  TYR A CZ    1 
ATOM   2745  O  OH    . TYR A 1 355 ? 39.917  150.862 37.502  1.00 11.09 ? 355  TYR A OH    1 
ATOM   2746  N  N     . THR A 1 356 ? 37.353  157.268 38.614  1.00 15.04 ? 356  THR A N     1 
ATOM   2747  C  CA    . THR A 1 356 ? 37.960  157.733 39.853  1.00 15.12 ? 356  THR A CA    1 
ATOM   2748  C  C     . THR A 1 356 ? 37.839  156.739 41.019  1.00 15.98 ? 356  THR A C     1 
ATOM   2749  O  O     . THR A 1 356 ? 37.519  155.569 40.810  1.00 19.10 ? 356  THR A O     1 
ATOM   2750  C  CB    . THR A 1 356 ? 37.378  159.121 40.245  1.00 14.74 ? 356  THR A CB    1 
ATOM   2751  O  OG1   . THR A 1 356 ? 38.197  159.719 41.256  1.00 15.76 ? 356  THR A OG1   1 
ATOM   2752  C  CG2   . THR A 1 356 ? 35.959  158.981 40.765  1.00 13.40 ? 356  THR A CG2   1 
ATOM   2753  N  N     . ALA A 1 357 ? 38.104  157.203 42.240  1.00 16.48 ? 357  ALA A N     1 
ATOM   2754  C  CA    . ALA A 1 357 ? 38.061  156.344 43.427  1.00 16.32 ? 357  ALA A CA    1 
ATOM   2755  C  C     . ALA A 1 357 ? 37.035  156.730 44.496  1.00 15.74 ? 357  ALA A C     1 
ATOM   2756  O  O     . ALA A 1 357 ? 36.718  157.904 44.688  1.00 13.66 ? 357  ALA A O     1 
ATOM   2757  C  CB    . ALA A 1 357 ? 39.446  156.283 44.059  1.00 16.45 ? 357  ALA A CB    1 
ATOM   2758  N  N     . PRO A 1 358 ? 36.519  155.726 45.223  1.00 15.88 ? 358  PRO A N     1 
ATOM   2759  C  CA    . PRO A 1 358 ? 35.528  155.909 46.285  1.00 15.62 ? 358  PRO A CA    1 
ATOM   2760  C  C     . PRO A 1 358 ? 35.893  156.978 47.316  1.00 16.50 ? 358  PRO A C     1 
ATOM   2761  O  O     . PRO A 1 358 ? 35.019  157.703 47.794  1.00 17.55 ? 358  PRO A O     1 
ATOM   2762  C  CB    . PRO A 1 358 ? 35.432  154.512 46.898  1.00 15.09 ? 358  PRO A CB    1 
ATOM   2763  C  CG    . PRO A 1 358 ? 35.618  153.630 45.713  1.00 13.53 ? 358  PRO A CG    1 
ATOM   2764  C  CD    . PRO A 1 358 ? 36.801  154.291 45.021  1.00 14.95 ? 358  PRO A CD    1 
ATOM   2765  N  N     . THR A 1 359 ? 37.171  157.080 47.671  1.00 15.81 ? 359  THR A N     1 
ATOM   2766  C  CA    . THR A 1 359 ? 37.572  158.089 48.651  1.00 16.46 ? 359  THR A CA    1 
ATOM   2767  C  C     . THR A 1 359 ? 37.278  159.488 48.122  1.00 14.81 ? 359  THR A C     1 
ATOM   2768  O  O     . THR A 1 359 ? 36.711  160.310 48.828  1.00 15.97 ? 359  THR A O     1 
ATOM   2769  C  CB    . THR A 1 359 ? 39.081  157.985 49.015  1.00 16.67 ? 359  THR A CB    1 
ATOM   2770  O  OG1   . THR A 1 359 ? 39.284  156.881 49.911  1.00 17.59 ? 359  THR A OG1   1 
ATOM   2771  C  CG2   . THR A 1 359 ? 39.571  159.270 49.685  1.00 16.77 ? 359  THR A CG2   1 
ATOM   2772  N  N     . ALA A 1 360 ? 37.667  159.749 46.880  1.00 15.32 ? 360  ALA A N     1 
ATOM   2773  C  CA    . ALA A 1 360 ? 37.436  161.046 46.261  1.00 15.98 ? 360  ALA A CA    1 
ATOM   2774  C  C     . ALA A 1 360 ? 35.933  161.313 46.168  1.00 17.23 ? 360  ALA A C     1 
ATOM   2775  O  O     . ALA A 1 360 ? 35.470  162.429 46.429  1.00 18.07 ? 360  ALA A O     1 
ATOM   2776  C  CB    . ALA A 1 360 ? 38.068  161.082 44.878  1.00 10.89 ? 360  ALA A CB    1 
ATOM   2777  N  N     . ILE A 1 361 ? 35.178  160.283 45.796  1.00 17.41 ? 361  ILE A N     1 
ATOM   2778  C  CA    . ILE A 1 361 ? 33.729  160.391 45.677  1.00 18.05 ? 361  ILE A CA    1 
ATOM   2779  C  C     . ILE A 1 361 ? 33.112  160.714 47.035  1.00 17.67 ? 361  ILE A C     1 
ATOM   2780  O  O     . ILE A 1 361 ? 32.213  161.546 47.128  1.00 19.07 ? 361  ILE A O     1 
ATOM   2781  C  CB    . ILE A 1 361 ? 33.110  159.077 45.143  1.00 18.78 ? 361  ILE A CB    1 
ATOM   2782  C  CG1   . ILE A 1 361 ? 33.678  158.760 43.757  1.00 18.57 ? 361  ILE A CG1   1 
ATOM   2783  C  CG2   . ILE A 1 361 ? 31.601  159.195 45.083  1.00 18.56 ? 361  ILE A CG2   1 
ATOM   2784  C  CD1   . ILE A 1 361 ? 33.163  157.467 43.155  1.00 17.79 ? 361  ILE A CD1   1 
ATOM   2785  N  N     . ARG A 1 362 ? 33.595  160.056 48.085  1.00 16.59 ? 362  ARG A N     1 
ATOM   2786  C  CA    . ARG A 1 362 ? 33.077  160.304 49.426  1.00 18.06 ? 362  ARG A CA    1 
ATOM   2787  C  C     . ARG A 1 362 ? 33.430  161.711 49.905  1.00 19.58 ? 362  ARG A C     1 
ATOM   2788  O  O     . ARG A 1 362 ? 32.596  162.387 50.512  1.00 21.12 ? 362  ARG A O     1 
ATOM   2789  C  CB    . ARG A 1 362 ? 33.610  159.263 50.410  1.00 18.96 ? 362  ARG A CB    1 
ATOM   2790  C  CG    . ARG A 1 362 ? 33.002  157.873 50.212  1.00 21.10 ? 362  ARG A CG    1 
ATOM   2791  C  CD    . ARG A 1 362 ? 33.391  156.938 51.341  1.00 21.47 ? 362  ARG A CD    1 
ATOM   2792  N  NE    . ARG A 1 362 ? 34.794  156.551 51.289  1.00 20.77 ? 362  ARG A NE    1 
ATOM   2793  C  CZ    . ARG A 1 362 ? 35.225  155.377 50.841  1.00 21.59 ? 362  ARG A CZ    1 
ATOM   2794  N  NH1   . ARG A 1 362 ? 34.364  154.466 50.406  1.00 18.85 ? 362  ARG A NH1   1 
ATOM   2795  N  NH2   . ARG A 1 362 ? 36.521  155.108 50.836  1.00 22.22 ? 362  ARG A NH2   1 
ATOM   2796  N  N     . ALA A 1 363 ? 34.656  162.149 49.622  1.00 18.06 ? 363  ALA A N     1 
ATOM   2797  C  CA    . ALA A 1 363 ? 35.100  163.482 50.012  1.00 19.65 ? 363  ALA A CA    1 
ATOM   2798  C  C     . ALA A 1 363 ? 34.252  164.553 49.328  1.00 20.09 ? 363  ALA A C     1 
ATOM   2799  O  O     . ALA A 1 363 ? 33.950  165.589 49.926  1.00 20.39 ? 363  ALA A O     1 
ATOM   2800  C  CB    . ALA A 1 363 ? 36.572  163.677 49.658  1.00 21.07 ? 363  ALA A CB    1 
ATOM   2801  N  N     . LEU A 1 364 ? 33.871  164.301 48.078  1.00 20.14 ? 364  LEU A N     1 
ATOM   2802  C  CA    . LEU A 1 364 ? 33.040  165.242 47.332  1.00 20.60 ? 364  LEU A CA    1 
ATOM   2803  C  C     . LEU A 1 364 ? 31.588  165.151 47.794  1.00 20.48 ? 364  LEU A C     1 
ATOM   2804  O  O     . LEU A 1 364 ? 30.916  166.169 47.970  1.00 20.32 ? 364  LEU A O     1 
ATOM   2805  C  CB    . LEU A 1 364 ? 33.112  164.953 45.830  1.00 20.82 ? 364  LEU A CB    1 
ATOM   2806  C  CG    . LEU A 1 364 ? 34.447  165.212 45.129  1.00 22.80 ? 364  LEU A CG    1 
ATOM   2807  C  CD1   . LEU A 1 364 ? 34.370  164.744 43.681  1.00 22.51 ? 364  LEU A CD1   1 
ATOM   2808  C  CD2   . LEU A 1 364 ? 34.780  166.691 45.190  1.00 22.07 ? 364  LEU A CD2   1 
ATOM   2809  N  N     . MET A 1 365 ? 31.107  163.925 47.984  1.00 20.18 ? 365  MET A N     1 
ATOM   2810  C  CA    . MET A 1 365 ? 29.740  163.710 48.433  1.00 19.72 ? 365  MET A CA    1 
ATOM   2811  C  C     . MET A 1 365 ? 29.535  164.432 49.757  1.00 18.58 ? 365  MET A C     1 
ATOM   2812  O  O     . MET A 1 365 ? 28.448  164.911 50.055  1.00 18.39 ? 365  MET A O     1 
ATOM   2813  C  CB    . MET A 1 365 ? 29.450  162.208 48.588  1.00 19.74 ? 365  MET A CB    1 
ATOM   2814  C  CG    . MET A 1 365 ? 28.054  161.892 49.116  1.00 22.57 ? 365  MET A CG    1 
ATOM   2815  S  SD    . MET A 1 365 ? 27.581  160.156 49.003  1.00 23.87 ? 365  MET A SD    1 
ATOM   2816  C  CE    . MET A 1 365 ? 28.717  159.415 50.161  1.00 26.48 ? 365  MET A CE    1 
ATOM   2817  N  N     . ALA A 1 366 ? 30.594  164.518 50.546  1.00 18.37 ? 366  ALA A N     1 
ATOM   2818  C  CA    . ALA A 1 366 ? 30.511  165.194 51.831  1.00 19.07 ? 366  ALA A CA    1 
ATOM   2819  C  C     . ALA A 1 366 ? 30.221  166.684 51.654  1.00 19.56 ? 366  ALA A C     1 
ATOM   2820  O  O     . ALA A 1 366 ? 29.781  167.348 52.588  1.00 20.23 ? 366  ALA A O     1 
ATOM   2821  C  CB    . ALA A 1 366 ? 31.808  164.999 52.598  1.00 16.56 ? 366  ALA A CB    1 
ATOM   2822  N  N     . GLU A 1 367 ? 30.465  167.206 50.457  1.00 19.90 ? 367  GLU A N     1 
ATOM   2823  C  CA    . GLU A 1 367 ? 30.229  168.620 50.178  1.00 21.81 ? 367  GLU A CA    1 
ATOM   2824  C  C     . GLU A 1 367 ? 28.895  168.871 49.477  1.00 20.92 ? 367  GLU A C     1 
ATOM   2825  O  O     . GLU A 1 367 ? 28.644  169.971 48.988  1.00 21.04 ? 367  GLU A O     1 
ATOM   2826  C  CB    . GLU A 1 367 ? 31.360  169.192 49.318  1.00 23.21 ? 367  GLU A CB    1 
ATOM   2827  C  CG    . GLU A 1 367 ? 32.726  169.170 49.974  1.00 25.52 ? 367  GLU A CG    1 
ATOM   2828  C  CD    . GLU A 1 367 ? 32.754  169.938 51.279  1.00 28.66 ? 367  GLU A CD    1 
ATOM   2829  O  OE1   . GLU A 1 367 ? 32.164  171.036 51.324  1.00 32.02 ? 367  GLU A OE1   1 
ATOM   2830  O  OE2   . GLU A 1 367 ? 33.371  169.451 52.254  1.00 28.57 ? 367  GLU A OE2   1 
ATOM   2831  N  N     . GLY A 1 368 ? 28.047  167.850 49.421  1.00 21.42 ? 368  GLY A N     1 
ATOM   2832  C  CA    . GLY A 1 368 ? 26.754  168.000 48.782  1.00 21.86 ? 368  GLY A CA    1 
ATOM   2833  C  C     . GLY A 1 368 ? 26.840  168.490 47.349  1.00 23.93 ? 368  GLY A C     1 
ATOM   2834  O  O     . GLY A 1 368 ? 27.750  168.116 46.604  1.00 24.44 ? 368  GLY A O     1 
ATOM   2835  N  N     . ASP A 1 369 ? 25.896  169.343 46.965  1.00 23.34 ? 369  ASP A N     1 
ATOM   2836  C  CA    . ASP A 1 369 ? 25.858  169.872 45.610  1.00 24.23 ? 369  ASP A CA    1 
ATOM   2837  C  C     . ASP A 1 369 ? 26.996  170.825 45.290  1.00 23.38 ? 369  ASP A C     1 
ATOM   2838  O  O     . ASP A 1 369 ? 27.133  171.260 44.150  1.00 23.83 ? 369  ASP A O     1 
ATOM   2839  C  CB    . ASP A 1 369 ? 24.524  170.584 45.338  1.00 25.95 ? 369  ASP A CB    1 
ATOM   2840  C  CG    . ASP A 1 369 ? 23.336  169.638 45.354  1.00 28.85 ? 369  ASP A CG    1 
ATOM   2841  O  OD1   . ASP A 1 369 ? 23.533  168.412 45.182  1.00 28.04 ? 369  ASP A OD1   1 
ATOM   2842  O  OD2   . ASP A 1 369 ? 22.196  170.130 45.523  1.00 32.11 ? 369  ASP A OD2   1 
ATOM   2843  N  N     . LYS A 1 370 ? 27.811  171.160 46.284  1.00 23.00 ? 370  LYS A N     1 
ATOM   2844  C  CA    . LYS A 1 370 ? 28.931  172.064 46.044  1.00 23.93 ? 370  LYS A CA    1 
ATOM   2845  C  C     . LYS A 1 370 ? 29.937  171.419 45.081  1.00 23.52 ? 370  LYS A C     1 
ATOM   2846  O  O     . LYS A 1 370 ? 30.767  172.104 44.482  1.00 23.17 ? 370  LYS A O     1 
ATOM   2847  C  CB    . LYS A 1 370 ? 29.611  172.428 47.373  1.00 23.69 ? 370  LYS A CB    1 
ATOM   2848  N  N     . ALA A 1 371 ? 29.850  170.098 44.928  1.00 23.46 ? 371  ALA A N     1 
ATOM   2849  C  CA    . ALA A 1 371 ? 30.747  169.360 44.036  1.00 22.77 ? 371  ALA A CA    1 
ATOM   2850  C  C     . ALA A 1 371 ? 30.345  169.476 42.567  1.00 22.77 ? 371  ALA A C     1 
ATOM   2851  O  O     . ALA A 1 371 ? 31.175  169.290 41.675  1.00 22.56 ? 371  ALA A O     1 
ATOM   2852  C  CB    . ALA A 1 371 ? 30.796  167.889 44.439  1.00 19.64 ? 371  ALA A CB    1 
ATOM   2853  N  N     . ILE A 1 372 ? 29.072  169.771 42.316  1.00 22.55 ? 372  ILE A N     1 
ATOM   2854  C  CA    . ILE A 1 372 ? 28.575  169.909 40.945  1.00 22.39 ? 372  ILE A CA    1 
ATOM   2855  C  C     . ILE A 1 372 ? 28.031  171.314 40.685  1.00 23.06 ? 372  ILE A C     1 
ATOM   2856  O  O     . ILE A 1 372 ? 27.445  171.582 39.633  1.00 24.03 ? 372  ILE A O     1 
ATOM   2857  C  CB    . ILE A 1 372 ? 27.437  168.906 40.650  1.00 20.68 ? 372  ILE A CB    1 
ATOM   2858  C  CG1   . ILE A 1 372 ? 26.219  169.231 41.522  1.00 17.71 ? 372  ILE A CG1   1 
ATOM   2859  C  CG2   . ILE A 1 372 ? 27.922  167.487 40.886  1.00 19.33 ? 372  ILE A CG2   1 
ATOM   2860  C  CD1   . ILE A 1 372 ? 24.982  168.448 41.156  1.00 19.51 ? 372  ILE A CD1   1 
ATOM   2861  N  N     . GLU A 1 373 ? 28.229  172.206 41.649  1.00 23.03 ? 373  GLU A N     1 
ATOM   2862  C  CA    . GLU A 1 373 ? 27.745  173.574 41.544  1.00 25.07 ? 373  GLU A CA    1 
ATOM   2863  C  C     . GLU A 1 373 ? 28.380  174.338 40.384  1.00 24.58 ? 373  GLU A C     1 
ATOM   2864  O  O     . GLU A 1 373 ? 29.603  174.466 40.295  1.00 24.29 ? 373  GLU A O     1 
ATOM   2865  C  CB    . GLU A 1 373 ? 27.997  174.318 42.857  1.00 28.05 ? 373  GLU A CB    1 
ATOM   2866  C  CG    . GLU A 1 373 ? 27.300  175.663 42.948  1.00 33.66 ? 373  GLU A CG    1 
ATOM   2867  C  CD    . GLU A 1 373 ? 27.645  176.420 44.222  1.00 37.12 ? 373  GLU A CD    1 
ATOM   2868  O  OE1   . GLU A 1 373 ? 27.429  175.871 45.327  1.00 38.83 ? 373  GLU A OE1   1 
ATOM   2869  O  OE2   . GLU A 1 373 ? 28.130  177.568 44.118  1.00 40.21 ? 373  GLU A OE2   1 
ATOM   2870  N  N     . GLY A 1 374 ? 27.537  174.842 39.489  1.00 24.46 ? 374  GLY A N     1 
ATOM   2871  C  CA    . GLY A 1 374 ? 28.024  175.596 38.351  1.00 23.27 ? 374  GLY A CA    1 
ATOM   2872  C  C     . GLY A 1 374 ? 28.543  174.772 37.187  1.00 23.46 ? 374  GLY A C     1 
ATOM   2873  O  O     . GLY A 1 374 ? 28.946  175.337 36.176  1.00 24.97 ? 374  GLY A O     1 
ATOM   2874  N  N     . THR A 1 375 ? 28.534  173.446 37.305  1.00 22.96 ? 375  THR A N     1 
ATOM   2875  C  CA    . THR A 1 375 ? 29.039  172.600 36.223  1.00 21.05 ? 375  THR A CA    1 
ATOM   2876  C  C     . THR A 1 375 ? 27.918  171.935 35.419  1.00 20.52 ? 375  THR A C     1 
ATOM   2877  O  O     . THR A 1 375 ? 26.799  171.776 35.905  1.00 20.03 ? 375  THR A O     1 
ATOM   2878  C  CB    . THR A 1 375 ? 30.008  171.525 36.767  1.00 19.18 ? 375  THR A CB    1 
ATOM   2879  O  OG1   . THR A 1 375 ? 29.272  170.514 37.469  1.00 19.92 ? 375  THR A OG1   1 
ATOM   2880  C  CG2   . THR A 1 375 ? 31.007  172.161 37.721  1.00 17.26 ? 375  THR A CG2   1 
ATOM   2881  N  N     . ASP A 1 376 ? 28.227  171.555 34.182  1.00 20.63 ? 376  ASP A N     1 
ATOM   2882  C  CA    . ASP A 1 376 ? 27.255  170.927 33.295  1.00 21.02 ? 376  ASP A CA    1 
ATOM   2883  C  C     . ASP A 1 376 ? 27.260  169.394 33.337  1.00 20.75 ? 376  ASP A C     1 
ATOM   2884  O  O     . ASP A 1 376 ? 26.217  168.783 33.549  1.00 19.68 ? 376  ASP A O     1 
ATOM   2885  C  CB    . ASP A 1 376 ? 27.485  171.420 31.865  1.00 22.93 ? 376  ASP A CB    1 
ATOM   2886  C  CG    . ASP A 1 376 ? 26.655  170.668 30.847  1.00 26.64 ? 376  ASP A CG    1 
ATOM   2887  O  OD1   . ASP A 1 376 ? 27.074  169.563 30.456  1.00 28.85 ? 376  ASP A OD1   1 
ATOM   2888  O  OD2   . ASP A 1 376 ? 25.584  171.172 30.445  1.00 28.97 ? 376  ASP A OD2   1 
ATOM   2889  N  N     . ARG A 1 377 ? 28.428  168.783 33.122  1.00 20.26 ? 377  ARG A N     1 
ATOM   2890  C  CA    . ARG A 1 377 ? 28.597  167.323 33.150  1.00 19.91 ? 377  ARG A CA    1 
ATOM   2891  C  C     . ARG A 1 377 ? 27.930  166.521 32.031  1.00 19.42 ? 377  ARG A C     1 
ATOM   2892  O  O     . ARG A 1 377 ? 27.965  165.291 32.056  1.00 20.17 ? 377  ARG A O     1 
ATOM   2893  C  CB    . ARG A 1 377 ? 28.116  166.770 34.499  1.00 19.44 ? 377  ARG A CB    1 
ATOM   2894  C  CG    . ARG A 1 377 ? 29.090  166.974 35.652  1.00 21.98 ? 377  ARG A CG    1 
ATOM   2895  C  CD    . ARG A 1 377 ? 28.355  167.141 36.977  1.00 21.20 ? 377  ARG A CD    1 
ATOM   2896  N  NE    . ARG A 1 377 ? 27.587  168.382 36.969  1.00 24.46 ? 377  ARG A NE    1 
ATOM   2897  C  CZ    . ARG A 1 377 ? 26.281  168.462 37.198  1.00 23.95 ? 377  ARG A CZ    1 
ATOM   2898  N  NH1   . ARG A 1 377 ? 25.580  167.367 37.466  1.00 21.76 ? 377  ARG A NH1   1 
ATOM   2899  N  NH2   . ARG A 1 377 ? 25.674  169.638 37.131  1.00 24.12 ? 377  ARG A NH2   1 
ATOM   2900  N  N     . SER A 1 378 ? 27.343  167.198 31.047  1.00 18.21 ? 378  SER A N     1 
ATOM   2901  C  CA    . SER A 1 378 ? 26.656  166.512 29.947  1.00 18.06 ? 378  SER A CA    1 
ATOM   2902  C  C     . SER A 1 378 ? 27.527  165.674 29.007  1.00 16.65 ? 378  SER A C     1 
ATOM   2903  O  O     . SER A 1 378 ? 27.031  164.754 28.365  1.00 15.91 ? 378  SER A O     1 
ATOM   2904  C  CB    . SER A 1 378 ? 25.857  167.521 29.110  1.00 19.64 ? 378  SER A CB    1 
ATOM   2905  O  OG    . SER A 1 378 ? 24.875  168.183 29.899  1.00 22.37 ? 378  SER A OG    1 
ATOM   2906  N  N     . SER A 1 379 ? 28.816  165.986 28.923  1.00 16.56 ? 379  SER A N     1 
ATOM   2907  C  CA    . SER A 1 379 ? 29.721  165.247 28.043  1.00 14.69 ? 379  SER A CA    1 
ATOM   2908  C  C     . SER A 1 379 ? 29.987  163.820 28.513  1.00 15.53 ? 379  SER A C     1 
ATOM   2909  O  O     . SER A 1 379 ? 30.429  162.980 27.728  1.00 16.42 ? 379  SER A O     1 
ATOM   2910  C  CB    . SER A 1 379 ? 31.056  165.986 27.898  1.00 13.89 ? 379  SER A CB    1 
ATOM   2911  O  OG    . SER A 1 379 ? 31.727  166.093 29.143  1.00 13.22 ? 379  SER A OG    1 
ATOM   2912  N  N     . LEU A 1 380 ? 29.724  163.540 29.786  1.00 15.34 ? 380  LEU A N     1 
ATOM   2913  C  CA    . LEU A 1 380 ? 29.963  162.203 30.317  1.00 16.48 ? 380  LEU A CA    1 
ATOM   2914  C  C     . LEU A 1 380 ? 29.002  161.152 29.760  1.00 18.96 ? 380  LEU A C     1 
ATOM   2915  O  O     . LEU A 1 380 ? 27.818  161.421 29.562  1.00 19.80 ? 380  LEU A O     1 
ATOM   2916  C  CB    . LEU A 1 380 ? 29.864  162.208 31.844  1.00 14.46 ? 380  LEU A CB    1 
ATOM   2917  C  CG    . LEU A 1 380 ? 30.934  162.976 32.624  1.00 14.53 ? 380  LEU A CG    1 
ATOM   2918  C  CD1   . LEU A 1 380 ? 30.565  162.986 34.100  1.00 10.01 ? 380  LEU A CD1   1 
ATOM   2919  C  CD2   . LEU A 1 380 ? 32.301  162.332 32.402  1.00 12.64 ? 380  LEU A CD2   1 
ATOM   2920  N  N     . ARG A 1 381 ? 29.535  159.956 29.517  1.00 20.25 ? 381  ARG A N     1 
ATOM   2921  C  CA    . ARG A 1 381 ? 28.767  158.822 29.014  1.00 20.49 ? 381  ARG A CA    1 
ATOM   2922  C  C     . ARG A 1 381 ? 29.063  157.584 29.856  1.00 19.53 ? 381  ARG A C     1 
ATOM   2923  O  O     . ARG A 1 381 ? 28.229  156.691 29.974  1.00 20.88 ? 381  ARG A O     1 
ATOM   2924  C  CB    . ARG A 1 381 ? 29.122  158.520 27.557  1.00 23.10 ? 381  ARG A CB    1 
ATOM   2925  C  CG    . ARG A 1 381 ? 28.513  159.466 26.533  1.00 28.19 ? 381  ARG A CG    1 
ATOM   2926  C  CD    . ARG A 1 381 ? 28.535  158.843 25.130  1.00 30.41 ? 381  ARG A CD    1 
ATOM   2927  N  NE    . ARG A 1 381 ? 29.872  158.828 24.542  1.00 33.84 ? 381  ARG A NE    1 
ATOM   2928  C  CZ    . ARG A 1 381 ? 30.470  159.894 24.016  1.00 34.37 ? 381  ARG A CZ    1 
ATOM   2929  N  NH1   . ARG A 1 381 ? 29.853  161.069 24.001  1.00 35.69 ? 381  ARG A NH1   1 
ATOM   2930  N  NH2   . ARG A 1 381 ? 31.686  159.786 23.500  1.00 33.24 ? 381  ARG A NH2   1 
ATOM   2931  N  N     . ILE A 1 382 ? 30.254  157.526 30.439  1.00 17.78 ? 382  ILE A N     1 
ATOM   2932  C  CA    . ILE A 1 382 ? 30.639  156.377 31.259  1.00 16.84 ? 382  ILE A CA    1 
ATOM   2933  C  C     . ILE A 1 382 ? 31.359  156.793 32.548  1.00 16.26 ? 382  ILE A C     1 
ATOM   2934  O  O     . ILE A 1 382 ? 32.204  157.686 32.536  1.00 17.11 ? 382  ILE A O     1 
ATOM   2935  C  CB    . ILE A 1 382 ? 31.588  155.436 30.490  1.00 16.11 ? 382  ILE A CB    1 
ATOM   2936  C  CG1   . ILE A 1 382 ? 30.954  154.994 29.167  1.00 14.84 ? 382  ILE A CG1   1 
ATOM   2937  C  CG2   . ILE A 1 382 ? 31.936  154.230 31.365  1.00 15.36 ? 382  ILE A CG2   1 
ATOM   2938  C  CD1   . ILE A 1 382 ? 29.855  153.959 29.326  1.00 14.70 ? 382  ILE A CD1   1 
ATOM   2939  N  N     . LEU A 1 383 ? 31.023  156.136 33.653  1.00 14.99 ? 383  LEU A N     1 
ATOM   2940  C  CA    . LEU A 1 383 ? 31.661  156.419 34.932  1.00 12.42 ? 383  LEU A CA    1 
ATOM   2941  C  C     . LEU A 1 383 ? 32.298  155.144 35.473  1.00 15.21 ? 383  LEU A C     1 
ATOM   2942  O  O     . LEU A 1 383 ? 31.790  154.040 35.253  1.00 13.44 ? 383  LEU A O     1 
ATOM   2943  C  CB    . LEU A 1 383 ? 30.644  156.936 35.946  1.00 11.40 ? 383  LEU A CB    1 
ATOM   2944  C  CG    . LEU A 1 383 ? 30.061  158.339 35.772  1.00 10.53 ? 383  LEU A CG    1 
ATOM   2945  C  CD1   . LEU A 1 383 ? 29.089  158.591 36.900  1.00 8.75  ? 383  LEU A CD1   1 
ATOM   2946  C  CD2   . LEU A 1 383 ? 31.163  159.393 35.790  1.00 11.18 ? 383  LEU A CD2   1 
ATOM   2947  N  N     . GLY A 1 384 ? 33.411  155.300 36.188  1.00 14.99 ? 384  GLY A N     1 
ATOM   2948  C  CA    . GLY A 1 384 ? 34.099  154.150 36.750  1.00 13.82 ? 384  GLY A CA    1 
ATOM   2949  C  C     . GLY A 1 384 ? 34.611  154.395 38.156  1.00 13.27 ? 384  GLY A C     1 
ATOM   2950  O  O     . GLY A 1 384 ? 34.877  155.528 38.546  1.00 12.05 ? 384  GLY A O     1 
ATOM   2951  N  N     . SER A 1 385 ? 34.754  153.317 38.914  1.00 13.79 ? 385  SER A N     1 
ATOM   2952  C  CA    . SER A 1 385 ? 35.226  153.386 40.286  1.00 15.42 ? 385  SER A CA    1 
ATOM   2953  C  C     . SER A 1 385 ? 36.236  152.275 40.514  1.00 16.26 ? 385  SER A C     1 
ATOM   2954  O  O     . SER A 1 385 ? 36.064  151.166 40.012  1.00 16.75 ? 385  SER A O     1 
ATOM   2955  C  CB    . SER A 1 385 ? 34.051  153.216 41.248  1.00 15.92 ? 385  SER A CB    1 
ATOM   2956  O  OG    . SER A 1 385 ? 34.500  153.162 42.587  1.00 17.91 ? 385  SER A OG    1 
ATOM   2957  N  N     . VAL A 1 386 ? 37.283  152.564 41.278  1.00 16.97 ? 386  VAL A N     1 
ATOM   2958  C  CA    . VAL A 1 386 ? 38.310  151.562 41.540  1.00 18.64 ? 386  VAL A CA    1 
ATOM   2959  C  C     . VAL A 1 386 ? 39.091  151.816 42.817  1.00 20.03 ? 386  VAL A C     1 
ATOM   2960  O  O     . VAL A 1 386 ? 39.101  152.935 43.346  1.00 20.06 ? 386  VAL A O     1 
ATOM   2961  C  CB    . VAL A 1 386 ? 39.340  151.507 40.389  1.00 19.03 ? 386  VAL A CB    1 
ATOM   2962  C  CG1   . VAL A 1 386 ? 40.052  152.855 40.264  1.00 18.09 ? 386  VAL A CG1   1 
ATOM   2963  C  CG2   . VAL A 1 386 ? 40.360  150.414 40.651  1.00 19.36 ? 386  VAL A CG2   1 
ATOM   2964  N  N     . GLY A 1 387 ? 39.747  150.763 43.304  1.00 20.17 ? 387  GLY A N     1 
ATOM   2965  C  CA    . GLY A 1 387 ? 40.586  150.887 44.481  1.00 20.24 ? 387  GLY A CA    1 
ATOM   2966  C  C     . GLY A 1 387 ? 40.074  150.383 45.811  1.00 20.48 ? 387  GLY A C     1 
ATOM   2967  O  O     . GLY A 1 387 ? 40.850  149.892 46.624  1.00 19.21 ? 387  GLY A O     1 
ATOM   2968  N  N     . GLU A 1 388 ? 38.775  150.485 46.046  1.00 22.01 ? 388  GLU A N     1 
ATOM   2969  C  CA    . GLU A 1 388 ? 38.237  150.068 47.328  1.00 22.58 ? 388  GLU A CA    1 
ATOM   2970  C  C     . GLU A 1 388 ? 36.740  149.863 47.254  1.00 22.13 ? 388  GLU A C     1 
ATOM   2971  O  O     . GLU A 1 388 ? 36.102  150.247 46.276  1.00 23.22 ? 388  GLU A O     1 
ATOM   2972  C  CB    . GLU A 1 388 ? 38.544  151.143 48.367  1.00 23.26 ? 388  GLU A CB    1 
ATOM   2973  C  CG    . GLU A 1 388 ? 37.928  152.481 48.009  1.00 24.21 ? 388  GLU A CG    1 
ATOM   2974  C  CD    . GLU A 1 388 ? 38.530  153.640 48.781  1.00 25.70 ? 388  GLU A CD    1 
ATOM   2975  O  OE1   . GLU A 1 388 ? 38.435  153.640 50.028  1.00 26.11 ? 388  GLU A OE1   1 
ATOM   2976  O  OE2   . GLU A 1 388 ? 39.097  154.551 48.136  1.00 23.67 ? 388  GLU A OE2   1 
ATOM   2977  N  N     . PRO A 1 389 ? 36.160  149.243 48.293  1.00 22.52 ? 389  PRO A N     1 
ATOM   2978  C  CA    . PRO A 1 389 ? 34.714  149.007 48.308  1.00 21.84 ? 389  PRO A CA    1 
ATOM   2979  C  C     . PRO A 1 389 ? 33.967  150.336 48.280  1.00 22.73 ? 389  PRO A C     1 
ATOM   2980  O  O     . PRO A 1 389 ? 34.455  151.339 48.813  1.00 21.77 ? 389  PRO A O     1 
ATOM   2981  C  CB    . PRO A 1 389 ? 34.502  148.261 49.624  1.00 22.09 ? 389  PRO A CB    1 
ATOM   2982  C  CG    . PRO A 1 389 ? 35.806  147.526 49.808  1.00 22.63 ? 389  PRO A CG    1 
ATOM   2983  C  CD    . PRO A 1 389 ? 36.814  148.581 49.438  1.00 21.05 ? 389  PRO A CD    1 
ATOM   2984  N  N     . ILE A 1 390 ? 32.802  150.347 47.639  1.00 22.53 ? 390  ILE A N     1 
ATOM   2985  C  CA    . ILE A 1 390 ? 31.976  151.544 47.573  1.00 22.56 ? 390  ILE A CA    1 
ATOM   2986  C  C     . ILE A 1 390 ? 30.556  151.131 47.947  1.00 22.96 ? 390  ILE A C     1 
ATOM   2987  O  O     . ILE A 1 390 ? 29.980  150.241 47.327  1.00 23.41 ? 390  ILE A O     1 
ATOM   2988  C  CB    . ILE A 1 390 ? 32.002  152.193 46.153  1.00 22.39 ? 390  ILE A CB    1 
ATOM   2989  C  CG1   . ILE A 1 390 ? 31.089  153.423 46.125  1.00 20.66 ? 390  ILE A CG1   1 
ATOM   2990  C  CG2   . ILE A 1 390 ? 31.573  151.185 45.095  1.00 22.70 ? 390  ILE A CG2   1 
ATOM   2991  C  CD1   . ILE A 1 390 ? 31.252  154.287 44.890  1.00 19.23 ? 390  ILE A CD1   1 
ATOM   2992  N  N     . ASN A 1 391 ? 30.003  151.763 48.978  1.00 22.77 ? 391  ASN A N     1 
ATOM   2993  C  CA    . ASN A 1 391 ? 28.662  151.430 49.435  1.00 23.49 ? 391  ASN A CA    1 
ATOM   2994  C  C     . ASN A 1 391 ? 27.596  151.991 48.505  1.00 23.18 ? 391  ASN A C     1 
ATOM   2995  O  O     . ASN A 1 391 ? 27.808  152.996 47.823  1.00 24.16 ? 391  ASN A O     1 
ATOM   2996  C  CB    . ASN A 1 391 ? 28.442  151.952 50.858  1.00 27.09 ? 391  ASN A CB    1 
ATOM   2997  C  CG    . ASN A 1 391 ? 28.017  153.405 50.886  1.00 29.94 ? 391  ASN A CG    1 
ATOM   2998  O  OD1   . ASN A 1 391 ? 28.551  154.235 50.148  1.00 32.65 ? 391  ASN A OD1   1 
ATOM   2999  N  ND2   . ASN A 1 391 ? 27.056  153.722 51.744  1.00 31.67 ? 391  ASN A ND2   1 
ATOM   3000  N  N     . PRO A 1 392 ? 26.424  151.342 48.473  1.00 23.40 ? 392  PRO A N     1 
ATOM   3001  C  CA    . PRO A 1 392 ? 25.288  151.735 47.636  1.00 23.14 ? 392  PRO A CA    1 
ATOM   3002  C  C     . PRO A 1 392 ? 24.957  153.230 47.658  1.00 23.80 ? 392  PRO A C     1 
ATOM   3003  O  O     . PRO A 1 392 ? 24.587  153.813 46.633  1.00 23.85 ? 392  PRO A O     1 
ATOM   3004  C  CB    . PRO A 1 392 ? 24.154  150.878 48.190  1.00 23.34 ? 392  PRO A CB    1 
ATOM   3005  C  CG    . PRO A 1 392 ? 24.874  149.621 48.592  1.00 21.59 ? 392  PRO A CG    1 
ATOM   3006  C  CD    . PRO A 1 392 ? 26.086  150.160 49.291  1.00 21.66 ? 392  PRO A CD    1 
ATOM   3007  N  N     . GLU A 1 393 ? 25.098  153.844 48.826  1.00 22.94 ? 393  GLU A N     1 
ATOM   3008  C  CA    . GLU A 1 393 ? 24.796  155.261 48.977  1.00 23.88 ? 393  GLU A CA    1 
ATOM   3009  C  C     . GLU A 1 393 ? 25.753  156.120 48.153  1.00 23.55 ? 393  GLU A C     1 
ATOM   3010  O  O     . GLU A 1 393 ? 25.327  157.001 47.408  1.00 22.86 ? 393  GLU A O     1 
ATOM   3011  C  CB    . GLU A 1 393 ? 24.889  155.651 50.448  1.00 27.75 ? 393  GLU A CB    1 
ATOM   3012  C  CG    . GLU A 1 393 ? 24.271  156.992 50.791  1.00 31.18 ? 393  GLU A CG    1 
ATOM   3013  C  CD    . GLU A 1 393 ? 24.463  157.338 52.257  1.00 34.41 ? 393  GLU A CD    1 
ATOM   3014  O  OE1   . GLU A 1 393 ? 24.350  156.420 53.103  1.00 37.01 ? 393  GLU A OE1   1 
ATOM   3015  O  OE2   . GLU A 1 393 ? 24.718  158.522 52.566  1.00 35.56 ? 393  GLU A OE2   1 
ATOM   3016  N  N     . ALA A 1 394 ? 27.048  155.859 48.286  1.00 21.48 ? 394  ALA A N     1 
ATOM   3017  C  CA    . ALA A 1 394 ? 28.037  156.618 47.543  1.00 20.73 ? 394  ALA A CA    1 
ATOM   3018  C  C     . ALA A 1 394 ? 27.920  156.298 46.057  1.00 20.36 ? 394  ALA A C     1 
ATOM   3019  O  O     . ALA A 1 394 ? 28.095  157.174 45.208  1.00 21.50 ? 394  ALA A O     1 
ATOM   3020  C  CB    . ALA A 1 394 ? 29.428  156.297 48.046  1.00 19.00 ? 394  ALA A CB    1 
ATOM   3021  N  N     . TRP A 1 395 ? 27.613  155.042 45.747  1.00 20.26 ? 395  TRP A N     1 
ATOM   3022  C  CA    . TRP A 1 395 ? 27.464  154.608 44.361  1.00 19.80 ? 395  TRP A CA    1 
ATOM   3023  C  C     . TRP A 1 395 ? 26.310  155.360 43.699  1.00 19.54 ? 395  TRP A C     1 
ATOM   3024  O  O     . TRP A 1 395 ? 26.438  155.849 42.578  1.00 19.11 ? 395  TRP A O     1 
ATOM   3025  C  CB    . TRP A 1 395 ? 27.189  153.103 44.298  1.00 22.10 ? 395  TRP A CB    1 
ATOM   3026  C  CG    . TRP A 1 395 ? 27.285  152.517 42.914  1.00 21.82 ? 395  TRP A CG    1 
ATOM   3027  C  CD1   . TRP A 1 395 ? 28.317  151.786 42.409  1.00 23.39 ? 395  TRP A CD1   1 
ATOM   3028  C  CD2   . TRP A 1 395 ? 26.302  152.596 41.870  1.00 22.51 ? 395  TRP A CD2   1 
ATOM   3029  N  NE1   . TRP A 1 395 ? 28.043  151.398 41.118  1.00 24.30 ? 395  TRP A NE1   1 
ATOM   3030  C  CE2   . TRP A 1 395 ? 26.813  151.882 40.761  1.00 23.33 ? 395  TRP A CE2   1 
ATOM   3031  C  CE3   . TRP A 1 395 ? 25.042  153.200 41.764  1.00 23.18 ? 395  TRP A CE3   1 
ATOM   3032  C  CZ2   . TRP A 1 395 ? 26.108  151.753 39.557  1.00 23.83 ? 395  TRP A CZ2   1 
ATOM   3033  C  CZ3   . TRP A 1 395 ? 24.335  153.073 40.563  1.00 24.79 ? 395  TRP A CZ3   1 
ATOM   3034  C  CH2   . TRP A 1 395 ? 24.875  152.353 39.477  1.00 24.60 ? 395  TRP A CH2   1 
ATOM   3035  N  N     . GLU A 1 396 ? 25.178  155.441 44.392  1.00 20.08 ? 396  GLU A N     1 
ATOM   3036  C  CA    . GLU A 1 396 ? 24.015  156.139 43.853  1.00 19.20 ? 396  GLU A CA    1 
ATOM   3037  C  C     . GLU A 1 396 ? 24.285  157.637 43.746  1.00 17.38 ? 396  GLU A C     1 
ATOM   3038  O  O     . GLU A 1 396 ? 23.854  158.280 42.790  1.00 17.83 ? 396  GLU A O     1 
ATOM   3039  C  CB    . GLU A 1 396 ? 22.777  155.892 44.726  1.00 20.85 ? 396  GLU A CB    1 
ATOM   3040  C  CG    . GLU A 1 396 ? 22.202  154.475 44.645  1.00 21.72 ? 396  GLU A CG    1 
ATOM   3041  C  CD    . GLU A 1 396 ? 21.769  154.093 43.234  1.00 25.27 ? 396  GLU A CD    1 
ATOM   3042  O  OE1   . GLU A 1 396 ? 21.198  154.948 42.518  1.00 25.65 ? 396  GLU A OE1   1 
ATOM   3043  O  OE2   . GLU A 1 396 ? 21.991  152.928 42.842  1.00 27.63 ? 396  GLU A OE2   1 
ATOM   3044  N  N     . TRP A 1 397 ? 24.998  158.190 44.726  1.00 15.61 ? 397  TRP A N     1 
ATOM   3045  C  CA    . TRP A 1 397 ? 25.328  159.612 44.701  1.00 15.86 ? 397  TRP A CA    1 
ATOM   3046  C  C     . TRP A 1 397 ? 26.160  159.890 43.456  1.00 15.33 ? 397  TRP A C     1 
ATOM   3047  O  O     . TRP A 1 397 ? 25.876  160.816 42.708  1.00 14.92 ? 397  TRP A O     1 
ATOM   3048  C  CB    . TRP A 1 397 ? 26.123  160.023 45.939  1.00 17.09 ? 397  TRP A CB    1 
ATOM   3049  C  CG    . TRP A 1 397 ? 26.314  161.513 46.016  1.00 20.11 ? 397  TRP A CG    1 
ATOM   3050  C  CD1   . TRP A 1 397 ? 25.440  162.425 46.542  1.00 20.54 ? 397  TRP A CD1   1 
ATOM   3051  C  CD2   . TRP A 1 397 ? 27.415  162.271 45.494  1.00 20.87 ? 397  TRP A CD2   1 
ATOM   3052  N  NE1   . TRP A 1 397 ? 25.929  163.704 46.380  1.00 18.43 ? 397  TRP A NE1   1 
ATOM   3053  C  CE2   . TRP A 1 397 ? 27.138  163.638 45.741  1.00 20.75 ? 397  TRP A CE2   1 
ATOM   3054  C  CE3   . TRP A 1 397 ? 28.604  161.930 44.843  1.00 20.67 ? 397  TRP A CE3   1 
ATOM   3055  C  CZ2   . TRP A 1 397 ? 28.014  164.664 45.356  1.00 20.66 ? 397  TRP A CZ2   1 
ATOM   3056  C  CZ3   . TRP A 1 397 ? 29.474  162.954 44.460  1.00 21.82 ? 397  TRP A CZ3   1 
ATOM   3057  C  CH2   . TRP A 1 397 ? 29.171  164.304 44.720  1.00 18.85 ? 397  TRP A CH2   1 
ATOM   3058  N  N     . TYR A 1 398 ? 27.185  159.067 43.242  1.00 14.83 ? 398  TYR A N     1 
ATOM   3059  C  CA    . TYR A 1 398 ? 28.072  159.179 42.083  1.00 14.38 ? 398  TYR A CA    1 
ATOM   3060  C  C     . TYR A 1 398 ? 27.270  159.079 40.784  1.00 13.82 ? 398  TYR A C     1 
ATOM   3061  O  O     . TYR A 1 398 ? 27.391  159.917 39.892  1.00 14.27 ? 398  TYR A O     1 
ATOM   3062  C  CB    . TYR A 1 398 ? 29.118  158.058 42.155  1.00 14.99 ? 398  TYR A CB    1 
ATOM   3063  C  CG    . TYR A 1 398 ? 30.217  158.087 41.113  1.00 15.04 ? 398  TYR A CG    1 
ATOM   3064  C  CD1   . TYR A 1 398 ? 30.832  159.291 40.747  1.00 15.31 ? 398  TYR A CD1   1 
ATOM   3065  C  CD2   . TYR A 1 398 ? 30.700  156.897 40.556  1.00 14.68 ? 398  TYR A CD2   1 
ATOM   3066  C  CE1   . TYR A 1 398 ? 31.904  159.310 39.854  1.00 15.51 ? 398  TYR A CE1   1 
ATOM   3067  C  CE2   . TYR A 1 398 ? 31.772  156.900 39.668  1.00 13.96 ? 398  TYR A CE2   1 
ATOM   3068  C  CZ    . TYR A 1 398 ? 32.372  158.109 39.320  1.00 15.55 ? 398  TYR A CZ    1 
ATOM   3069  O  OH    . TYR A 1 398 ? 33.435  158.112 38.448  1.00 13.33 ? 398  TYR A OH    1 
ATOM   3070  N  N     . TRP A 1 399 ? 26.440  158.049 40.698  1.00 14.01 ? 399  TRP A N     1 
ATOM   3071  C  CA    . TRP A 1 399 ? 25.595  157.796 39.533  1.00 14.81 ? 399  TRP A CA    1 
ATOM   3072  C  C     . TRP A 1 399 ? 24.610  158.943 39.250  1.00 15.66 ? 399  TRP A C     1 
ATOM   3073  O  O     . TRP A 1 399 ? 24.365  159.297 38.099  1.00 13.04 ? 399  TRP A O     1 
ATOM   3074  C  CB    . TRP A 1 399 ? 24.815  156.495 39.764  1.00 16.13 ? 399  TRP A CB    1 
ATOM   3075  C  CG    . TRP A 1 399 ? 23.945  156.074 38.635  1.00 18.80 ? 399  TRP A CG    1 
ATOM   3076  C  CD1   . TRP A 1 399 ? 24.348  155.533 37.455  1.00 20.71 ? 399  TRP A CD1   1 
ATOM   3077  C  CD2   . TRP A 1 399 ? 22.518  156.174 38.569  1.00 21.97 ? 399  TRP A CD2   1 
ATOM   3078  N  NE1   . TRP A 1 399 ? 23.260  155.287 36.653  1.00 22.83 ? 399  TRP A NE1   1 
ATOM   3079  C  CE2   . TRP A 1 399 ? 22.123  155.673 37.312  1.00 22.03 ? 399  TRP A CE2   1 
ATOM   3080  C  CE3   . TRP A 1 399 ? 21.534  156.640 39.451  1.00 23.41 ? 399  TRP A CE3   1 
ATOM   3081  C  CZ2   . TRP A 1 399 ? 20.781  155.623 36.909  1.00 23.33 ? 399  TRP A CZ2   1 
ATOM   3082  C  CZ3   . TRP A 1 399 ? 20.197  156.590 39.050  1.00 24.49 ? 399  TRP A CZ3   1 
ATOM   3083  C  CH2   . TRP A 1 399 ? 19.837  156.084 37.789  1.00 22.81 ? 399  TRP A CH2   1 
ATOM   3084  N  N     . LYS A 1 400 ? 24.048  159.527 40.304  1.00 16.64 ? 400  LYS A N     1 
ATOM   3085  C  CA    . LYS A 1 400 ? 23.072  160.597 40.139  1.00 19.64 ? 400  LYS A CA    1 
ATOM   3086  C  C     . LYS A 1 400 ? 23.635  162.006 39.976  1.00 19.03 ? 400  LYS A C     1 
ATOM   3087  O  O     . LYS A 1 400 ? 23.235  162.731 39.073  1.00 20.27 ? 400  LYS A O     1 
ATOM   3088  C  CB    . LYS A 1 400 ? 22.085  160.592 41.313  1.00 22.35 ? 400  LYS A CB    1 
ATOM   3089  C  CG    . LYS A 1 400 ? 21.154  161.798 41.332  1.00 26.83 ? 400  LYS A CG    1 
ATOM   3090  C  CD    . LYS A 1 400 ? 20.217  161.810 42.538  1.00 29.57 ? 400  LYS A CD    1 
ATOM   3091  C  CE    . LYS A 1 400 ? 19.151  160.730 42.433  1.00 32.71 ? 400  LYS A CE    1 
ATOM   3092  N  NZ    . LYS A 1 400 ? 18.046  160.942 43.427  1.00 35.21 ? 400  LYS A NZ    1 
ATOM   3093  N  N     . LYS A 1 401 ? 24.556  162.389 40.852  1.00 17.55 ? 401  LYS A N     1 
ATOM   3094  C  CA    . LYS A 1 401 ? 25.138  163.720 40.814  1.00 17.39 ? 401  LYS A CA    1 
ATOM   3095  C  C     . LYS A 1 401 ? 26.213  163.920 39.745  1.00 17.64 ? 401  LYS A C     1 
ATOM   3096  O  O     . LYS A 1 401 ? 26.267  164.970 39.103  1.00 16.41 ? 401  LYS A O     1 
ATOM   3097  C  CB    . LYS A 1 401 ? 25.710  164.071 42.190  1.00 16.92 ? 401  LYS A CB    1 
ATOM   3098  C  CG    . LYS A 1 401 ? 24.686  164.022 43.320  1.00 18.26 ? 401  LYS A CG    1 
ATOM   3099  C  CD    . LYS A 1 401 ? 23.593  165.060 43.147  1.00 19.10 ? 401  LYS A CD    1 
ATOM   3100  C  CE    . LYS A 1 401 ? 22.631  165.060 44.340  1.00 19.03 ? 401  LYS A CE    1 
ATOM   3101  N  NZ    . LYS A 1 401 ? 21.708  166.237 44.310  1.00 16.61 ? 401  LYS A NZ    1 
ATOM   3102  N  N     . ILE A 1 402 ? 27.069  162.922 39.555  1.00 17.15 ? 402  ILE A N     1 
ATOM   3103  C  CA    . ILE A 1 402 ? 28.130  163.046 38.569  1.00 16.43 ? 402  ILE A CA    1 
ATOM   3104  C  C     . ILE A 1 402 ? 27.687  162.553 37.198  1.00 17.13 ? 402  ILE A C     1 
ATOM   3105  O  O     . ILE A 1 402 ? 27.939  163.207 36.183  1.00 17.87 ? 402  ILE A O     1 
ATOM   3106  C  CB    . ILE A 1 402 ? 29.395  162.254 38.990  1.00 17.52 ? 402  ILE A CB    1 
ATOM   3107  C  CG1   . ILE A 1 402 ? 29.782  162.587 40.440  1.00 16.75 ? 402  ILE A CG1   1 
ATOM   3108  C  CG2   . ILE A 1 402 ? 30.551  162.593 38.056  1.00 14.61 ? 402  ILE A CG2   1 
ATOM   3109  C  CD1   . ILE A 1 402 ? 30.086  164.049 40.692  1.00 17.46 ? 402  ILE A CD1   1 
ATOM   3110  N  N     . GLY A 1 403 ? 27.016  161.406 37.173  1.00 16.81 ? 403  GLY A N     1 
ATOM   3111  C  CA    . GLY A 1 403 ? 26.575  160.845 35.910  1.00 17.94 ? 403  GLY A CA    1 
ATOM   3112  C  C     . GLY A 1 403 ? 25.187  161.261 35.476  1.00 17.81 ? 403  GLY A C     1 
ATOM   3113  O  O     . GLY A 1 403 ? 24.719  160.848 34.414  1.00 17.74 ? 403  GLY A O     1 
ATOM   3114  N  N     . LYS A 1 404 ? 24.527  162.076 36.294  1.00 18.36 ? 404  LYS A N     1 
ATOM   3115  C  CA    . LYS A 1 404 ? 23.180  162.548 35.989  1.00 20.32 ? 404  LYS A CA    1 
ATOM   3116  C  C     . LYS A 1 404 ? 22.235  161.416 35.599  1.00 20.38 ? 404  LYS A C     1 
ATOM   3117  O  O     . LYS A 1 404 ? 21.363  161.594 34.746  1.00 19.65 ? 404  LYS A O     1 
ATOM   3118  C  CB    . LYS A 1 404 ? 23.230  163.596 34.870  1.00 21.48 ? 404  LYS A CB    1 
ATOM   3119  C  CG    . LYS A 1 404 ? 23.933  164.875 35.292  1.00 26.18 ? 404  LYS A CG    1 
ATOM   3120  C  CD    . LYS A 1 404 ? 24.217  165.804 34.116  1.00 29.30 ? 404  LYS A CD    1 
ATOM   3121  C  CE    . LYS A 1 404 ? 22.957  166.464 33.587  1.00 29.08 ? 404  LYS A CE    1 
ATOM   3122  N  NZ    . LYS A 1 404 ? 23.275  167.460 32.524  1.00 29.86 ? 404  LYS A NZ    1 
ATOM   3123  N  N     . GLU A 1 405 ? 22.419  160.257 36.232  1.00 20.55 ? 405  GLU A N     1 
ATOM   3124  C  CA    . GLU A 1 405 ? 21.597  159.069 35.998  1.00 21.99 ? 405  GLU A CA    1 
ATOM   3125  C  C     . GLU A 1 405 ? 21.604  158.600 34.553  1.00 21.68 ? 405  GLU A C     1 
ATOM   3126  O  O     . GLU A 1 405 ? 20.701  157.893 34.127  1.00 24.31 ? 405  GLU A O     1 
ATOM   3127  C  CB    . GLU A 1 405 ? 20.151  159.335 36.420  1.00 21.73 ? 405  GLU A CB    1 
ATOM   3128  C  CG    . GLU A 1 405 ? 19.991  159.959 37.795  1.00 22.20 ? 405  GLU A CG    1 
ATOM   3129  C  CD    . GLU A 1 405 ? 18.544  159.963 38.257  1.00 22.29 ? 405  GLU A CD    1 
ATOM   3130  O  OE1   . GLU A 1 405 ? 18.188  160.800 39.115  1.00 21.32 ? 405  GLU A OE1   1 
ATOM   3131  O  OE2   . GLU A 1 405 ? 17.767  159.114 37.766  1.00 21.29 ? 405  GLU A OE2   1 
ATOM   3132  N  N     . LYS A 1 406 ? 22.621  158.985 33.795  1.00 22.85 ? 406  LYS A N     1 
ATOM   3133  C  CA    . LYS A 1 406 ? 22.692  158.601 32.395  1.00 22.88 ? 406  LYS A CA    1 
ATOM   3134  C  C     . LYS A 1 406 ? 23.922  157.772 32.057  1.00 21.80 ? 406  LYS A C     1 
ATOM   3135  O  O     . LYS A 1 406 ? 24.030  157.258 30.948  1.00 21.98 ? 406  LYS A O     1 
ATOM   3136  C  CB    . LYS A 1 406 ? 22.674  159.855 31.513  1.00 25.07 ? 406  LYS A CB    1 
ATOM   3137  C  CG    . LYS A 1 406 ? 21.425  160.709 31.681  1.00 29.89 ? 406  LYS A CG    1 
ATOM   3138  C  CD    . LYS A 1 406 ? 21.502  162.018 30.895  1.00 32.77 ? 406  LYS A CD    1 
ATOM   3139  C  CE    . LYS A 1 406 ? 20.195  162.805 31.025  1.00 36.67 ? 406  LYS A CE    1 
ATOM   3140  N  NZ    . LYS A 1 406 ? 20.269  164.171 30.411  1.00 38.40 ? 406  LYS A NZ    1 
ATOM   3141  N  N     . CYS A 1 407 ? 24.837  157.625 33.010  1.00 18.88 ? 407  CYS A N     1 
ATOM   3142  C  CA    . CYS A 1 407 ? 26.051  156.873 32.745  1.00 17.71 ? 407  CYS A CA    1 
ATOM   3143  C  C     . CYS A 1 407 ? 26.227  155.625 33.587  1.00 16.99 ? 407  CYS A C     1 
ATOM   3144  O  O     . CYS A 1 407 ? 26.106  155.665 34.810  1.00 17.77 ? 407  CYS A O     1 
ATOM   3145  C  CB    . CYS A 1 407 ? 27.278  157.760 32.956  1.00 16.58 ? 407  CYS A CB    1 
ATOM   3146  S  SG    . CYS A 1 407 ? 27.152  159.389 32.243  1.00 20.55 ? 407  CYS A SG    1 
ATOM   3147  N  N     . PRO A 1 408 ? 26.496  154.485 32.937  1.00 17.32 ? 408  PRO A N     1 
ATOM   3148  C  CA    . PRO A 1 408 ? 26.695  153.255 33.706  1.00 17.06 ? 408  PRO A CA    1 
ATOM   3149  C  C     . PRO A 1 408 ? 27.978  153.432 34.519  1.00 15.55 ? 408  PRO A C     1 
ATOM   3150  O  O     . PRO A 1 408 ? 28.915  154.099 34.079  1.00 13.19 ? 408  PRO A O     1 
ATOM   3151  C  CB    . PRO A 1 408 ? 26.852  152.188 32.625  1.00 16.32 ? 408  PRO A CB    1 
ATOM   3152  C  CG    . PRO A 1 408 ? 26.014  152.728 31.501  1.00 16.54 ? 408  PRO A CG    1 
ATOM   3153  C  CD    . PRO A 1 408 ? 26.387  154.193 31.497  1.00 15.49 ? 408  PRO A CD    1 
ATOM   3154  N  N     . VAL A 1 409 ? 28.008  152.851 35.709  1.00 16.38 ? 409  VAL A N     1 
ATOM   3155  C  CA    . VAL A 1 409 ? 29.176  152.944 36.570  1.00 14.80 ? 409  VAL A CA    1 
ATOM   3156  C  C     . VAL A 1 409 ? 29.900  151.611 36.543  1.00 15.77 ? 409  VAL A C     1 
ATOM   3157  O  O     . VAL A 1 409 ? 29.294  150.571 36.787  1.00 16.78 ? 409  VAL A O     1 
ATOM   3158  C  CB    . VAL A 1 409 ? 28.770  153.264 38.025  1.00 14.69 ? 409  VAL A CB    1 
ATOM   3159  C  CG1   . VAL A 1 409 ? 29.965  153.116 38.954  1.00 13.38 ? 409  VAL A CG1   1 
ATOM   3160  C  CG2   . VAL A 1 409 ? 28.211  154.674 38.102  1.00 13.52 ? 409  VAL A CG2   1 
ATOM   3161  N  N     . VAL A 1 410 ? 31.192  151.633 36.233  1.00 14.82 ? 410  VAL A N     1 
ATOM   3162  C  CA    . VAL A 1 410 ? 31.958  150.399 36.205  1.00 13.54 ? 410  VAL A CA    1 
ATOM   3163  C  C     . VAL A 1 410 ? 32.854  150.275 37.430  1.00 14.09 ? 410  VAL A C     1 
ATOM   3164  O  O     . VAL A 1 410 ? 33.897  150.918 37.526  1.00 14.37 ? 410  VAL A O     1 
ATOM   3165  C  CB    . VAL A 1 410 ? 32.826  150.282 34.931  1.00 13.02 ? 410  VAL A CB    1 
ATOM   3166  C  CG1   . VAL A 1 410 ? 31.949  149.918 33.744  1.00 12.89 ? 410  VAL A CG1   1 
ATOM   3167  C  CG2   . VAL A 1 410 ? 33.568  151.585 34.680  1.00 10.21 ? 410  VAL A CG2   1 
ATOM   3168  N  N     . ASP A 1 411 ? 32.428  149.453 38.379  1.00 13.86 ? 411  ASP A N     1 
ATOM   3169  C  CA    . ASP A 1 411 ? 33.214  149.233 39.576  1.00 14.56 ? 411  ASP A CA    1 
ATOM   3170  C  C     . ASP A 1 411 ? 34.173  148.082 39.276  1.00 14.92 ? 411  ASP A C     1 
ATOM   3171  O  O     . ASP A 1 411 ? 33.792  146.905 39.309  1.00 12.40 ? 411  ASP A O     1 
ATOM   3172  C  CB    . ASP A 1 411 ? 32.308  148.896 40.751  1.00 15.78 ? 411  ASP A CB    1 
ATOM   3173  C  CG    . ASP A 1 411 ? 33.082  148.702 42.027  1.00 16.22 ? 411  ASP A CG    1 
ATOM   3174  O  OD1   . ASP A 1 411 ? 34.280  149.051 42.044  1.00 17.25 ? 411  ASP A OD1   1 
ATOM   3175  O  OD2   . ASP A 1 411 ? 32.493  148.212 43.014  1.00 19.34 ? 411  ASP A OD2   1 
ATOM   3176  N  N     . THR A 1 412 ? 35.416  148.449 38.973  1.00 13.75 ? 412  THR A N     1 
ATOM   3177  C  CA    . THR A 1 412 ? 36.463  147.497 38.621  1.00 13.33 ? 412  THR A CA    1 
ATOM   3178  C  C     . THR A 1 412 ? 37.308  146.998 39.787  1.00 13.12 ? 412  THR A C     1 
ATOM   3179  O  O     . THR A 1 412 ? 38.031  147.770 40.417  1.00 11.95 ? 412  THR A O     1 
ATOM   3180  C  CB    . THR A 1 412 ? 37.458  148.110 37.615  1.00 13.80 ? 412  THR A CB    1 
ATOM   3181  O  OG1   . THR A 1 412 ? 38.190  149.163 38.255  1.00 14.61 ? 412  THR A OG1   1 
ATOM   3182  C  CG2   . THR A 1 412 ? 36.724  148.663 36.399  1.00 13.56 ? 412  THR A CG2   1 
ATOM   3183  N  N     . TRP A 1 413 ? 37.222  145.703 40.061  1.00 13.09 ? 413  TRP A N     1 
ATOM   3184  C  CA    . TRP A 1 413 ? 38.021  145.094 41.107  1.00 13.74 ? 413  TRP A CA    1 
ATOM   3185  C  C     . TRP A 1 413 ? 39.218  144.415 40.442  1.00 12.82 ? 413  TRP A C     1 
ATOM   3186  O  O     . TRP A 1 413 ? 39.079  143.784 39.401  1.00 13.37 ? 413  TRP A O     1 
ATOM   3187  C  CB    . TRP A 1 413 ? 37.229  144.038 41.876  1.00 15.74 ? 413  TRP A CB    1 
ATOM   3188  C  CG    . TRP A 1 413 ? 38.100  143.303 42.838  1.00 15.75 ? 413  TRP A CG    1 
ATOM   3189  C  CD1   . TRP A 1 413 ? 38.458  143.705 44.092  1.00 16.42 ? 413  TRP A CD1   1 
ATOM   3190  C  CD2   . TRP A 1 413 ? 38.821  142.092 42.585  1.00 14.32 ? 413  TRP A CD2   1 
ATOM   3191  N  NE1   . TRP A 1 413 ? 39.364  142.823 44.638  1.00 15.20 ? 413  TRP A NE1   1 
ATOM   3192  C  CE2   . TRP A 1 413 ? 39.604  141.823 43.733  1.00 15.11 ? 413  TRP A CE2   1 
ATOM   3193  C  CE3   . TRP A 1 413 ? 38.886  141.206 41.500  1.00 14.36 ? 413  TRP A CE3   1 
ATOM   3194  C  CZ2   . TRP A 1 413 ? 40.442  140.705 43.829  1.00 15.23 ? 413  TRP A CZ2   1 
ATOM   3195  C  CZ3   . TRP A 1 413 ? 39.725  140.087 41.595  1.00 14.88 ? 413  TRP A CZ3   1 
ATOM   3196  C  CH2   . TRP A 1 413 ? 40.489  139.852 42.754  1.00 14.42 ? 413  TRP A CH2   1 
ATOM   3197  N  N     . TRP A 1 414 ? 40.389  144.569 41.050  1.00 15.23 ? 414  TRP A N     1 
ATOM   3198  C  CA    . TRP A 1 414 ? 41.634  143.968 40.568  1.00 14.08 ? 414  TRP A CA    1 
ATOM   3199  C  C     . TRP A 1 414 ? 42.762  144.366 41.513  1.00 14.02 ? 414  TRP A C     1 
ATOM   3200  O  O     . TRP A 1 414 ? 42.512  144.989 42.540  1.00 13.51 ? 414  TRP A O     1 
ATOM   3201  C  CB    . TRP A 1 414 ? 41.957  144.386 39.122  1.00 12.65 ? 414  TRP A CB    1 
ATOM   3202  C  CG    . TRP A 1 414 ? 42.099  145.858 38.889  1.00 12.90 ? 414  TRP A CG    1 
ATOM   3203  C  CD1   . TRP A 1 414 ? 41.125  146.819 39.037  1.00 11.98 ? 414  TRP A CD1   1 
ATOM   3204  C  CD2   . TRP A 1 414 ? 43.268  146.540 38.421  1.00 11.82 ? 414  TRP A CD2   1 
ATOM   3205  N  NE1   . TRP A 1 414 ? 41.619  148.051 38.686  1.00 10.04 ? 414  TRP A NE1   1 
ATOM   3206  C  CE2   . TRP A 1 414 ? 42.930  147.913 38.305  1.00 11.69 ? 414  TRP A CE2   1 
ATOM   3207  C  CE3   . TRP A 1 414 ? 44.570  146.127 38.086  1.00 11.37 ? 414  TRP A CE3   1 
ATOM   3208  C  CZ2   . TRP A 1 414 ? 43.848  148.878 37.872  1.00 10.22 ? 414  TRP A CZ2   1 
ATOM   3209  C  CZ3   . TRP A 1 414 ? 45.483  147.087 37.652  1.00 9.09  ? 414  TRP A CZ3   1 
ATOM   3210  C  CH2   . TRP A 1 414 ? 45.114  148.450 37.551  1.00 10.89 ? 414  TRP A CH2   1 
ATOM   3211  N  N     . GLN A 1 415 ? 43.995  144.001 41.170  1.00 16.26 ? 415  GLN A N     1 
ATOM   3212  C  CA    . GLN A 1 415 ? 45.151  144.287 42.024  1.00 14.53 ? 415  GLN A CA    1 
ATOM   3213  C  C     . GLN A 1 415 ? 46.418  144.540 41.215  1.00 14.52 ? 415  GLN A C     1 
ATOM   3214  O  O     . GLN A 1 415 ? 46.461  144.275 40.007  1.00 14.16 ? 415  GLN A O     1 
ATOM   3215  C  CB    . GLN A 1 415 ? 45.410  143.089 42.943  1.00 13.78 ? 415  GLN A CB    1 
ATOM   3216  C  CG    . GLN A 1 415 ? 44.167  142.546 43.617  1.00 16.52 ? 415  GLN A CG    1 
ATOM   3217  C  CD    . GLN A 1 415 ? 44.429  141.259 44.361  1.00 15.61 ? 415  GLN A CD    1 
ATOM   3218  O  OE1   . GLN A 1 415 ? 44.768  140.243 43.760  1.00 18.19 ? 415  GLN A OE1   1 
ATOM   3219  N  NE2   . GLN A 1 415 ? 44.277  141.295 45.676  1.00 15.12 ? 415  GLN A NE2   1 
ATOM   3220  N  N     . THR A 1 416 ? 47.457  145.038 41.885  1.00 13.00 ? 416  THR A N     1 
ATOM   3221  C  CA    . THR A 1 416 ? 48.725  145.293 41.214  1.00 12.64 ? 416  THR A CA    1 
ATOM   3222  C  C     . THR A 1 416 ? 49.181  143.976 40.589  1.00 13.10 ? 416  THR A C     1 
ATOM   3223  O  O     . THR A 1 416 ? 49.701  143.943 39.473  1.00 13.82 ? 416  THR A O     1 
ATOM   3224  C  CB    . THR A 1 416 ? 49.823  145.772 42.202  1.00 12.79 ? 416  THR A CB    1 
ATOM   3225  O  OG1   . THR A 1 416 ? 49.415  146.989 42.849  1.00 8.44  ? 416  THR A OG1   1 
ATOM   3226  C  CG2   . THR A 1 416 ? 51.114  146.030 41.449  1.00 10.47 ? 416  THR A CG2   1 
ATOM   3227  N  N     . GLU A 1 417 ? 48.957  142.884 41.313  1.00 13.29 ? 417  GLU A N     1 
ATOM   3228  C  CA    . GLU A 1 417 ? 49.344  141.562 40.842  1.00 13.19 ? 417  GLU A CA    1 
ATOM   3229  C  C     . GLU A 1 417 ? 48.494  140.988 39.711  1.00 12.71 ? 417  GLU A C     1 
ATOM   3230  O  O     . GLU A 1 417 ? 48.814  139.925 39.201  1.00 13.96 ? 417  GLU A O     1 
ATOM   3231  C  CB    . GLU A 1 417 ? 49.357  140.567 42.006  1.00 13.75 ? 417  GLU A CB    1 
ATOM   3232  C  CG    . GLU A 1 417 ? 50.236  140.994 43.171  1.00 11.45 ? 417  GLU A CG    1 
ATOM   3233  C  CD    . GLU A 1 417 ? 49.478  141.778 44.228  1.00 11.39 ? 417  GLU A CD    1 
ATOM   3234  O  OE1   . GLU A 1 417 ? 48.532  142.503 43.855  1.00 10.33 ? 417  GLU A OE1   1 
ATOM   3235  O  OE2   . GLU A 1 417 ? 49.840  141.677 45.426  1.00 10.86 ? 417  GLU A OE2   1 
ATOM   3236  N  N     . THR A 1 418 ? 47.419  141.668 39.311  1.00 13.78 ? 418  THR A N     1 
ATOM   3237  C  CA    . THR A 1 418 ? 46.588  141.141 38.222  1.00 12.75 ? 418  THR A CA    1 
ATOM   3238  C  C     . THR A 1 418 ? 46.802  141.920 36.921  1.00 12.57 ? 418  THR A C     1 
ATOM   3239  O  O     . THR A 1 418 ? 46.332  141.519 35.856  1.00 11.43 ? 418  THR A O     1 
ATOM   3240  C  CB    . THR A 1 418 ? 45.069  141.134 38.594  1.00 13.90 ? 418  THR A CB    1 
ATOM   3241  O  OG1   . THR A 1 418 ? 44.523  142.456 38.480  1.00 17.26 ? 418  THR A OG1   1 
ATOM   3242  C  CG2   . THR A 1 418 ? 44.868  140.632 40.026  1.00 13.08 ? 418  THR A CG2   1 
ATOM   3243  N  N     . GLY A 1 419 ? 47.527  143.033 37.014  1.00 11.82 ? 419  GLY A N     1 
ATOM   3244  C  CA    . GLY A 1 419 ? 47.809  143.834 35.837  1.00 9.16  ? 419  GLY A CA    1 
ATOM   3245  C  C     . GLY A 1 419 ? 46.632  144.612 35.281  1.00 10.17 ? 419  GLY A C     1 
ATOM   3246  O  O     . GLY A 1 419 ? 46.806  145.742 34.818  1.00 9.82  ? 419  GLY A O     1 
ATOM   3247  N  N     . GLY A 1 420 ? 45.446  144.007 35.316  1.00 10.75 ? 420  GLY A N     1 
ATOM   3248  C  CA    . GLY A 1 420 ? 44.255  144.664 34.805  1.00 11.42 ? 420  GLY A CA    1 
ATOM   3249  C  C     . GLY A 1 420 ? 42.987  144.150 35.464  1.00 12.14 ? 420  GLY A C     1 
ATOM   3250  O  O     . GLY A 1 420 ? 43.050  143.274 36.328  1.00 11.11 ? 420  GLY A O     1 
ATOM   3251  N  N     . PHE A 1 421 ? 41.841  144.693 35.048  1.00 12.70 ? 421  PHE A N     1 
ATOM   3252  C  CA    . PHE A 1 421 ? 40.523  144.330 35.582  1.00 13.17 ? 421  PHE A CA    1 
ATOM   3253  C  C     . PHE A 1 421 ? 40.263  142.827 35.655  1.00 13.99 ? 421  PHE A C     1 
ATOM   3254  O  O     . PHE A 1 421 ? 40.581  142.083 34.722  1.00 14.44 ? 421  PHE A O     1 
ATOM   3255  C  CB    . PHE A 1 421 ? 39.427  144.986 34.738  1.00 11.96 ? 421  PHE A CB    1 
ATOM   3256  C  CG    . PHE A 1 421 ? 39.558  146.481 34.625  1.00 12.89 ? 421  PHE A CG    1 
ATOM   3257  C  CD1   . PHE A 1 421 ? 38.914  147.168 33.605  1.00 12.60 ? 421  PHE A CD1   1 
ATOM   3258  C  CD2   . PHE A 1 421 ? 40.330  147.199 35.535  1.00 14.25 ? 421  PHE A CD2   1 
ATOM   3259  C  CE1   . PHE A 1 421 ? 39.036  148.547 33.487  1.00 12.37 ? 421  PHE A CE1   1 
ATOM   3260  C  CE2   . PHE A 1 421 ? 40.457  148.576 35.428  1.00 12.43 ? 421  PHE A CE2   1 
ATOM   3261  C  CZ    . PHE A 1 421 ? 39.810  149.252 34.401  1.00 13.97 ? 421  PHE A CZ    1 
ATOM   3262  N  N     . MET A 1 422 ? 39.661  142.390 36.759  1.00 14.15 ? 422  MET A N     1 
ATOM   3263  C  CA    . MET A 1 422 ? 39.368  140.976 36.972  1.00 15.46 ? 422  MET A CA    1 
ATOM   3264  C  C     . MET A 1 422 ? 37.867  140.710 37.087  1.00 15.67 ? 422  MET A C     1 
ATOM   3265  O  O     . MET A 1 422 ? 37.330  139.808 36.447  1.00 17.25 ? 422  MET A O     1 
ATOM   3266  C  CB    . MET A 1 422 ? 40.087  140.495 38.230  1.00 15.62 ? 422  MET A CB    1 
ATOM   3267  C  CG    . MET A 1 422 ? 41.593  140.683 38.177  1.00 15.84 ? 422  MET A CG    1 
ATOM   3268  S  SD    . MET A 1 422 ? 42.311  139.722 36.844  1.00 19.36 ? 422  MET A SD    1 
ATOM   3269  C  CE    . MET A 1 422 ? 42.153  138.066 37.506  1.00 14.82 ? 422  MET A CE    1 
ATOM   3270  N  N     . ILE A 1 423 ? 37.196  141.488 37.923  1.00 15.60 ? 423  ILE A N     1 
ATOM   3271  C  CA    . ILE A 1 423 ? 35.760  141.355 38.094  1.00 15.54 ? 423  ILE A CA    1 
ATOM   3272  C  C     . ILE A 1 423 ? 35.232  142.765 37.922  1.00 15.84 ? 423  ILE A C     1 
ATOM   3273  O  O     . ILE A 1 423 ? 35.448  143.636 38.761  1.00 17.59 ? 423  ILE A O     1 
ATOM   3274  C  CB    . ILE A 1 423 ? 35.387  140.828 39.485  1.00 16.23 ? 423  ILE A CB    1 
ATOM   3275  C  CG1   . ILE A 1 423 ? 36.105  139.499 39.741  1.00 16.36 ? 423  ILE A CG1   1 
ATOM   3276  C  CG2   . ILE A 1 423 ? 33.878  140.634 39.568  1.00 13.48 ? 423  ILE A CG2   1 
ATOM   3277  C  CD1   . ILE A 1 423 ? 35.851  138.909 41.117  1.00 17.45 ? 423  ILE A CD1   1 
ATOM   3278  N  N     . THR A 1 424 ? 34.543  142.979 36.814  1.00 15.75 ? 424  THR A N     1 
ATOM   3279  C  CA    . THR A 1 424 ? 34.028  144.294 36.501  1.00 14.41 ? 424  THR A CA    1 
ATOM   3280  C  C     . THR A 1 424 ? 32.827  144.218 35.585  1.00 14.25 ? 424  THR A C     1 
ATOM   3281  O  O     . THR A 1 424 ? 32.609  143.215 34.909  1.00 14.66 ? 424  THR A O     1 
ATOM   3282  C  CB    . THR A 1 424 ? 35.106  145.127 35.780  1.00 15.34 ? 424  THR A CB    1 
ATOM   3283  O  OG1   . THR A 1 424 ? 34.531  146.348 35.302  1.00 14.44 ? 424  THR A OG1   1 
ATOM   3284  C  CG2   . THR A 1 424 ? 35.680  144.346 34.591  1.00 12.49 ? 424  THR A CG2   1 
ATOM   3285  N  N     . PRO A 1 425 ? 32.020  145.284 35.560  1.00 15.85 ? 425  PRO A N     1 
ATOM   3286  C  CA    . PRO A 1 425 ? 30.852  145.274 34.682  1.00 15.03 ? 425  PRO A CA    1 
ATOM   3287  C  C     . PRO A 1 425 ? 31.300  145.725 33.289  1.00 16.06 ? 425  PRO A C     1 
ATOM   3288  O  O     . PRO A 1 425 ? 32.377  146.309 33.131  1.00 13.49 ? 425  PRO A O     1 
ATOM   3289  C  CB    . PRO A 1 425 ? 29.918  146.322 35.312  1.00 15.37 ? 425  PRO A CB    1 
ATOM   3290  C  CG    . PRO A 1 425 ? 30.495  146.588 36.692  1.00 15.21 ? 425  PRO A CG    1 
ATOM   3291  C  CD    . PRO A 1 425 ? 31.969  146.426 36.491  1.00 15.62 ? 425  PRO A CD    1 
ATOM   3292  N  N     . LEU A 1 426 ? 30.487  145.423 32.283  1.00 17.29 ? 426  LEU A N     1 
ATOM   3293  C  CA    . LEU A 1 426 ? 30.737  145.875 30.923  1.00 16.58 ? 426  LEU A CA    1 
ATOM   3294  C  C     . LEU A 1 426 ? 29.467  146.684 30.661  1.00 17.06 ? 426  LEU A C     1 
ATOM   3295  O  O     . LEU A 1 426 ? 28.363  146.143 30.639  1.00 18.03 ? 426  LEU A O     1 
ATOM   3296  C  CB    . LEU A 1 426 ? 30.883  144.700 29.950  1.00 16.96 ? 426  LEU A CB    1 
ATOM   3297  C  CG    . LEU A 1 426 ? 32.350  144.316 29.671  1.00 18.02 ? 426  LEU A CG    1 
ATOM   3298  C  CD1   . LEU A 1 426 ? 32.991  143.759 30.934  1.00 15.87 ? 426  LEU A CD1   1 
ATOM   3299  C  CD2   . LEU A 1 426 ? 32.426  143.278 28.560  1.00 17.88 ? 426  LEU A CD2   1 
ATOM   3300  N  N     . PRO A 1 427 ? 29.618  148.005 30.482  1.00 15.80 ? 427  PRO A N     1 
ATOM   3301  C  CA    . PRO A 1 427 ? 28.573  149.003 30.236  1.00 16.46 ? 427  PRO A CA    1 
ATOM   3302  C  C     . PRO A 1 427 ? 27.387  148.625 29.367  1.00 16.60 ? 427  PRO A C     1 
ATOM   3303  O  O     . PRO A 1 427 ? 26.239  148.924 29.714  1.00 16.11 ? 427  PRO A O     1 
ATOM   3304  C  CB    . PRO A 1 427 ? 29.354  150.198 29.684  1.00 15.15 ? 427  PRO A CB    1 
ATOM   3305  C  CG    . PRO A 1 427 ? 30.584  149.583 29.120  1.00 15.32 ? 427  PRO A CG    1 
ATOM   3306  C  CD    . PRO A 1 427 ? 30.935  148.568 30.154  1.00 14.16 ? 427  PRO A CD    1 
ATOM   3307  N  N     . GLY A 1 428 ? 27.644  147.983 28.239  1.00 17.40 ? 428  GLY A N     1 
ATOM   3308  C  CA    . GLY A 1 428 ? 26.542  147.604 27.375  1.00 19.92 ? 428  GLY A CA    1 
ATOM   3309  C  C     . GLY A 1 428 ? 26.206  146.132 27.446  1.00 20.83 ? 428  GLY A C     1 
ATOM   3310  O  O     . GLY A 1 428 ? 25.536  145.603 26.557  1.00 22.17 ? 428  GLY A O     1 
ATOM   3311  N  N     . ALA A 1 429 ? 26.649  145.456 28.503  1.00 20.44 ? 429  ALA A N     1 
ATOM   3312  C  CA    . ALA A 1 429 ? 26.384  144.025 28.614  1.00 20.43 ? 429  ALA A CA    1 
ATOM   3313  C  C     . ALA A 1 429 ? 25.906  143.530 29.974  1.00 19.10 ? 429  ALA A C     1 
ATOM   3314  O  O     . ALA A 1 429 ? 25.269  142.484 30.057  1.00 18.32 ? 429  ALA A O     1 
ATOM   3315  C  CB    . ALA A 1 429 ? 27.629  143.251 28.196  1.00 20.41 ? 429  ALA A CB    1 
ATOM   3316  N  N     . ILE A 1 430 ? 26.192  144.277 31.034  1.00 18.66 ? 430  ILE A N     1 
ATOM   3317  C  CA    . ILE A 1 430 ? 25.800  143.859 32.375  1.00 19.12 ? 430  ILE A CA    1 
ATOM   3318  C  C     . ILE A 1 430 ? 25.041  144.930 33.167  1.00 19.59 ? 430  ILE A C     1 
ATOM   3319  O  O     . ILE A 1 430 ? 25.497  146.069 33.286  1.00 17.43 ? 430  ILE A O     1 
ATOM   3320  C  CB    . ILE A 1 430 ? 27.054  143.427 33.176  1.00 20.17 ? 430  ILE A CB    1 
ATOM   3321  C  CG1   . ILE A 1 430 ? 27.753  142.274 32.442  1.00 20.50 ? 430  ILE A CG1   1 
ATOM   3322  C  CG2   . ILE A 1 430 ? 26.664  143.024 34.601  1.00 21.33 ? 430  ILE A CG2   1 
ATOM   3323  C  CD1   . ILE A 1 430 ? 29.083  141.856 33.034  1.00 19.05 ? 430  ILE A CD1   1 
ATOM   3324  N  N     . GLU A 1 431 ? 23.881  144.551 33.706  1.00 19.96 ? 431  GLU A N     1 
ATOM   3325  C  CA    . GLU A 1 431 ? 23.065  145.463 34.508  1.00 20.94 ? 431  GLU A CA    1 
ATOM   3326  C  C     . GLU A 1 431 ? 23.778  145.648 35.846  1.00 19.93 ? 431  GLU A C     1 
ATOM   3327  O  O     . GLU A 1 431 ? 24.299  144.691 36.417  1.00 22.18 ? 431  GLU A O     1 
ATOM   3328  C  CB    . GLU A 1 431 ? 21.656  144.894 34.687  1.00 20.08 ? 431  GLU A CB    1 
ATOM   3329  C  CG    . GLU A 1 431 ? 20.983  144.590 33.349  1.00 21.32 ? 431  GLU A CG    1 
ATOM   3330  C  CD    . GLU A 1 431 ? 19.511  144.225 33.473  1.00 20.89 ? 431  GLU A CD    1 
ATOM   3331  O  OE1   . GLU A 1 431 ? 19.187  143.303 34.253  1.00 19.83 ? 431  GLU A OE1   1 
ATOM   3332  O  OE2   . GLU A 1 431 ? 18.683  144.863 32.782  1.00 19.98 ? 431  GLU A OE2   1 
ATOM   3333  N  N     . LEU A 1 432 ? 23.802  146.880 36.338  1.00 19.29 ? 432  LEU A N     1 
ATOM   3334  C  CA    . LEU A 1 432 ? 24.526  147.205 37.563  1.00 19.20 ? 432  LEU A CA    1 
ATOM   3335  C  C     . LEU A 1 432 ? 23.798  147.095 38.900  1.00 20.88 ? 432  LEU A C     1 
ATOM   3336  O  O     . LEU A 1 432 ? 22.596  147.339 39.004  1.00 21.96 ? 432  LEU A O     1 
ATOM   3337  C  CB    . LEU A 1 432 ? 25.098  148.627 37.446  1.00 15.57 ? 432  LEU A CB    1 
ATOM   3338  C  CG    . LEU A 1 432 ? 25.526  149.086 36.048  1.00 13.56 ? 432  LEU A CG    1 
ATOM   3339  C  CD1   . LEU A 1 432 ? 25.979  150.535 36.077  1.00 12.70 ? 432  LEU A CD1   1 
ATOM   3340  C  CD2   . LEU A 1 432 ? 26.635  148.184 35.546  1.00 15.17 ? 432  LEU A CD2   1 
ATOM   3341  N  N     . LYS A 1 433 ? 24.558  146.714 39.921  1.00 20.56 ? 433  LYS A N     1 
ATOM   3342  C  CA    . LYS A 1 433 ? 24.062  146.633 41.287  1.00 20.68 ? 433  LYS A CA    1 
ATOM   3343  C  C     . LYS A 1 433 ? 25.012  147.556 42.046  1.00 20.40 ? 433  LYS A C     1 
ATOM   3344  O  O     . LYS A 1 433 ? 26.234  147.336 42.057  1.00 20.66 ? 433  LYS A O     1 
ATOM   3345  C  CB    . LYS A 1 433 ? 24.170  145.218 41.843  1.00 19.91 ? 433  LYS A CB    1 
ATOM   3346  C  CG    . LYS A 1 433 ? 23.280  144.204 41.157  1.00 21.20 ? 433  LYS A CG    1 
ATOM   3347  C  CD    . LYS A 1 433 ? 23.094  142.985 42.050  1.00 19.46 ? 433  LYS A CD    1 
ATOM   3348  C  CE    . LYS A 1 433 ? 22.328  141.894 41.339  1.00 20.77 ? 433  LYS A CE    1 
ATOM   3349  N  NZ    . LYS A 1 433 ? 21.931  140.836 42.304  1.00 22.63 ? 433  LYS A NZ    1 
ATOM   3350  N  N     . ALA A 1 434 ? 24.460  148.600 42.654  1.00 19.25 ? 434  ALA A N     1 
ATOM   3351  C  CA    . ALA A 1 434 ? 25.271  149.558 43.389  1.00 19.24 ? 434  ALA A CA    1 
ATOM   3352  C  C     . ALA A 1 434 ? 26.137  148.868 44.435  1.00 19.74 ? 434  ALA A C     1 
ATOM   3353  O  O     . ALA A 1 434 ? 25.632  148.151 45.299  1.00 20.30 ? 434  ALA A O     1 
ATOM   3354  C  CB    . ALA A 1 434 ? 24.380  150.597 44.046  1.00 17.82 ? 434  ALA A CB    1 
ATOM   3355  N  N     . GLY A 1 435 ? 27.447  149.076 44.343  1.00 19.97 ? 435  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1 435 ? 28.364  148.474 45.294  1.00 17.88 ? 435  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1 435 ? 28.912  147.123 44.873  1.00 18.38 ? 435  GLY A C     1 
ATOM   3358  O  O     . GLY A 1 435 ? 29.729  146.544 45.586  1.00 19.55 ? 435  GLY A O     1 
ATOM   3359  N  N     . SER A 1 436 ? 28.478  146.619 43.716  1.00 17.17 ? 436  SER A N     1 
ATOM   3360  C  CA    . SER A 1 436 ? 28.925  145.315 43.222  1.00 14.63 ? 436  SER A CA    1 
ATOM   3361  C  C     . SER A 1 436 ? 29.834  145.418 41.994  1.00 14.25 ? 436  SER A C     1 
ATOM   3362  O  O     . SER A 1 436 ? 29.542  146.154 41.055  1.00 13.65 ? 436  SER A O     1 
ATOM   3363  C  CB    . SER A 1 436 ? 27.706  144.443 42.884  1.00 15.23 ? 436  SER A CB    1 
ATOM   3364  O  OG    . SER A 1 436 ? 28.092  143.161 42.414  1.00 16.17 ? 436  SER A OG    1 
ATOM   3365  N  N     . ALA A 1 437 ? 30.938  144.673 42.012  1.00 14.32 ? 437  ALA A N     1 
ATOM   3366  C  CA    . ALA A 1 437 ? 31.887  144.659 40.900  1.00 14.18 ? 437  ALA A CA    1 
ATOM   3367  C  C     . ALA A 1 437 ? 31.317  143.813 39.755  1.00 14.08 ? 437  ALA A C     1 
ATOM   3368  O  O     . ALA A 1 437 ? 31.818  143.843 38.633  1.00 14.01 ? 437  ALA A O     1 
ATOM   3369  C  CB    . ALA A 1 437 ? 33.231  144.095 41.367  1.00 13.07 ? 437  ALA A CB    1 
ATOM   3370  N  N     . THR A 1 438 ? 30.265  143.063 40.076  1.00 15.59 ? 438  THR A N     1 
ATOM   3371  C  CA    . THR A 1 438 ? 29.529  142.194 39.155  1.00 16.33 ? 438  THR A CA    1 
ATOM   3372  C  C     . THR A 1 438 ? 30.186  140.875 38.722  1.00 17.34 ? 438  THR A C     1 
ATOM   3373  O  O     . THR A 1 438 ? 30.504  140.031 39.560  1.00 17.54 ? 438  THR A O     1 
ATOM   3374  C  CB    . THR A 1 438 ? 29.053  142.967 37.883  1.00 16.50 ? 438  THR A CB    1 
ATOM   3375  O  OG1   . THR A 1 438 ? 30.166  143.255 37.030  1.00 20.23 ? 438  THR A OG1   1 
ATOM   3376  C  CG2   . THR A 1 438 ? 28.378  144.276 38.278  1.00 16.89 ? 438  THR A CG2   1 
ATOM   3377  N  N     . ARG A 1 439 ? 30.368  140.688 37.419  1.00 17.45 ? 439  ARG A N     1 
ATOM   3378  C  CA    . ARG A 1 439 ? 30.928  139.449 36.901  1.00 18.49 ? 439  ARG A CA    1 
ATOM   3379  C  C     . ARG A 1 439 ? 32.390  139.542 36.492  1.00 18.35 ? 439  ARG A C     1 
ATOM   3380  O  O     . ARG A 1 439 ? 32.900  140.623 36.200  1.00 19.45 ? 439  ARG A O     1 
ATOM   3381  C  CB    . ARG A 1 439 ? 30.100  138.970 35.701  1.00 20.91 ? 439  ARG A CB    1 
ATOM   3382  C  CG    . ARG A 1 439 ? 28.634  138.707 36.010  1.00 24.50 ? 439  ARG A CG    1 
ATOM   3383  C  CD    . ARG A 1 439 ? 27.902  138.154 34.788  1.00 29.09 ? 439  ARG A CD    1 
ATOM   3384  N  NE    . ARG A 1 439 ? 26.481  137.916 35.042  1.00 32.88 ? 439  ARG A NE    1 
ATOM   3385  C  CZ    . ARG A 1 439 ? 26.005  136.991 35.873  1.00 34.27 ? 439  ARG A CZ    1 
ATOM   3386  N  NH1   . ARG A 1 439 ? 26.833  136.199 36.540  1.00 35.05 ? 439  ARG A NH1   1 
ATOM   3387  N  NH2   . ARG A 1 439 ? 24.696  136.864 36.042  1.00 36.79 ? 439  ARG A NH2   1 
ATOM   3388  N  N     . PRO A 1 440 ? 33.082  138.392 36.449  1.00 16.87 ? 440  PRO A N     1 
ATOM   3389  C  CA    . PRO A 1 440 ? 34.496  138.339 36.068  1.00 15.23 ? 440  PRO A CA    1 
ATOM   3390  C  C     . PRO A 1 440 ? 34.716  138.670 34.594  1.00 15.95 ? 440  PRO A C     1 
ATOM   3391  O  O     . PRO A 1 440 ? 33.851  138.423 33.750  1.00 16.16 ? 440  PRO A O     1 
ATOM   3392  C  CB    . PRO A 1 440 ? 34.896  136.909 36.412  1.00 15.97 ? 440  PRO A CB    1 
ATOM   3393  C  CG    . PRO A 1 440 ? 33.637  136.146 36.152  1.00 17.39 ? 440  PRO A CG    1 
ATOM   3394  C  CD    . PRO A 1 440 ? 32.577  137.046 36.775  1.00 16.68 ? 440  PRO A CD    1 
ATOM   3395  N  N     . PHE A 1 441 ? 35.877  139.243 34.296  1.00 14.52 ? 441  PHE A N     1 
ATOM   3396  C  CA    . PHE A 1 441 ? 36.228  139.624 32.936  1.00 11.89 ? 441  PHE A CA    1 
ATOM   3397  C  C     . PHE A 1 441 ? 36.639  138.374 32.154  1.00 12.28 ? 441  PHE A C     1 
ATOM   3398  O  O     . PHE A 1 441 ? 36.773  137.289 32.728  1.00 12.69 ? 441  PHE A O     1 
ATOM   3399  C  CB    . PHE A 1 441 ? 37.384  140.634 32.970  1.00 8.54  ? 441  PHE A CB    1 
ATOM   3400  C  CG    . PHE A 1 441 ? 37.692  141.248 31.641  1.00 9.11  ? 441  PHE A CG    1 
ATOM   3401  C  CD1   . PHE A 1 441 ? 36.818  142.165 31.056  1.00 9.20  ? 441  PHE A CD1   1 
ATOM   3402  C  CD2   . PHE A 1 441 ? 38.845  140.885 30.953  1.00 9.08  ? 441  PHE A CD2   1 
ATOM   3403  C  CE1   . PHE A 1 441 ? 37.092  142.712 29.802  1.00 9.07  ? 441  PHE A CE1   1 
ATOM   3404  C  CE2   . PHE A 1 441 ? 39.129  141.423 29.701  1.00 8.69  ? 441  PHE A CE2   1 
ATOM   3405  C  CZ    . PHE A 1 441 ? 38.255  142.337 29.122  1.00 8.61  ? 441  PHE A CZ    1 
ATOM   3406  N  N     . PHE A 1 442 ? 36.838  138.534 30.848  1.00 11.58 ? 442  PHE A N     1 
ATOM   3407  C  CA    . PHE A 1 442 ? 37.246  137.425 29.993  1.00 12.55 ? 442  PHE A CA    1 
ATOM   3408  C  C     . PHE A 1 442 ? 38.555  136.835 30.486  1.00 13.71 ? 442  PHE A C     1 
ATOM   3409  O  O     . PHE A 1 442 ? 39.498  137.573 30.786  1.00 13.52 ? 442  PHE A O     1 
ATOM   3410  C  CB    . PHE A 1 442 ? 37.434  137.902 28.553  1.00 12.36 ? 442  PHE A CB    1 
ATOM   3411  C  CG    . PHE A 1 442 ? 36.232  138.583 27.981  1.00 13.63 ? 442  PHE A CG    1 
ATOM   3412  C  CD1   . PHE A 1 442 ? 36.364  139.790 27.300  1.00 12.64 ? 442  PHE A CD1   1 
ATOM   3413  C  CD2   . PHE A 1 442 ? 34.963  138.029 28.133  1.00 13.56 ? 442  PHE A CD2   1 
ATOM   3414  C  CE1   . PHE A 1 442 ? 35.246  140.441 26.779  1.00 11.62 ? 442  PHE A CE1   1 
ATOM   3415  C  CE2   . PHE A 1 442 ? 33.840  138.670 27.613  1.00 14.06 ? 442  PHE A CE2   1 
ATOM   3416  C  CZ    . PHE A 1 442 ? 33.984  139.881 26.936  1.00 11.17 ? 442  PHE A CZ    1 
ATOM   3417  N  N     . GLY A 1 443 ? 38.601  135.505 30.562  1.00 13.75 ? 443  GLY A N     1 
ATOM   3418  C  CA    . GLY A 1 443 ? 39.800  134.812 31.001  1.00 14.37 ? 443  GLY A CA    1 
ATOM   3419  C  C     . GLY A 1 443 ? 39.983  134.714 32.505  1.00 16.36 ? 443  GLY A C     1 
ATOM   3420  O  O     . GLY A 1 443 ? 40.963  134.126 32.977  1.00 16.68 ? 443  GLY A O     1 
ATOM   3421  N  N     . VAL A 1 444 ? 39.043  135.278 33.262  1.00 16.32 ? 444  VAL A N     1 
ATOM   3422  C  CA    . VAL A 1 444 ? 39.122  135.265 34.720  1.00 17.61 ? 444  VAL A CA    1 
ATOM   3423  C  C     . VAL A 1 444 ? 38.182  134.236 35.352  1.00 18.53 ? 444  VAL A C     1 
ATOM   3424  O  O     . VAL A 1 444 ? 36.967  134.293 35.155  1.00 19.09 ? 444  VAL A O     1 
ATOM   3425  C  CB    . VAL A 1 444 ? 38.784  136.665 35.301  1.00 18.35 ? 444  VAL A CB    1 
ATOM   3426  C  CG1   . VAL A 1 444 ? 38.941  136.654 36.817  1.00 16.90 ? 444  VAL A CG1   1 
ATOM   3427  C  CG2   . VAL A 1 444 ? 39.683  137.727 34.666  1.00 17.72 ? 444  VAL A CG2   1 
ATOM   3428  N  N     . GLN A 1 445 ? 38.743  133.303 36.117  1.00 17.62 ? 445  GLN A N     1 
ATOM   3429  C  CA    . GLN A 1 445 ? 37.937  132.280 36.780  1.00 17.70 ? 445  GLN A CA    1 
ATOM   3430  C  C     . GLN A 1 445 ? 37.994  132.423 38.306  1.00 17.02 ? 445  GLN A C     1 
ATOM   3431  O  O     . GLN A 1 445 ? 38.839  131.814 38.972  1.00 14.21 ? 445  GLN A O     1 
ATOM   3432  C  CB    . GLN A 1 445 ? 38.420  130.888 36.369  1.00 20.83 ? 445  GLN A CB    1 
ATOM   3433  C  CG    . GLN A 1 445 ? 38.429  130.669 34.860  1.00 28.07 ? 445  GLN A CG    1 
ATOM   3434  C  CD    . GLN A 1 445 ? 38.746  129.232 34.466  1.00 32.36 ? 445  GLN A CD    1 
ATOM   3435  O  OE1   . GLN A 1 445 ? 38.014  128.305 34.813  1.00 36.73 ? 445  GLN A OE1   1 
ATOM   3436  N  NE2   . GLN A 1 445 ? 39.840  129.043 33.734  1.00 33.12 ? 445  GLN A NE2   1 
ATOM   3437  N  N     . PRO A 1 446 ? 37.089  133.235 38.881  1.00 16.37 ? 446  PRO A N     1 
ATOM   3438  C  CA    . PRO A 1 446 ? 37.057  133.446 40.332  1.00 17.48 ? 446  PRO A CA    1 
ATOM   3439  C  C     . PRO A 1 446 ? 36.398  132.300 41.092  1.00 18.24 ? 446  PRO A C     1 
ATOM   3440  O  O     . PRO A 1 446 ? 35.713  131.462 40.511  1.00 17.74 ? 446  PRO A O     1 
ATOM   3441  C  CB    . PRO A 1 446 ? 36.271  134.742 40.468  1.00 16.10 ? 446  PRO A CB    1 
ATOM   3442  C  CG    . PRO A 1 446 ? 35.251  134.594 39.388  1.00 16.62 ? 446  PRO A CG    1 
ATOM   3443  C  CD    . PRO A 1 446 ? 36.071  134.066 38.212  1.00 16.00 ? 446  PRO A CD    1 
ATOM   3444  N  N     . ALA A 1 447 ? 36.619  132.266 42.401  1.00 19.24 ? 447  ALA A N     1 
ATOM   3445  C  CA    . ALA A 1 447 ? 36.036  131.239 43.250  1.00 19.06 ? 447  ALA A CA    1 
ATOM   3446  C  C     . ALA A 1 447 ? 36.138  131.659 44.702  1.00 18.49 ? 447  ALA A C     1 
ATOM   3447  O  O     . ALA A 1 447 ? 37.021  132.428 45.084  1.00 17.84 ? 447  ALA A O     1 
ATOM   3448  C  CB    . ALA A 1 447 ? 36.749  129.903 43.041  1.00 19.65 ? 447  ALA A CB    1 
ATOM   3449  N  N     . LEU A 1 448 ? 35.210  131.158 45.503  1.00 19.52 ? 448  LEU A N     1 
ATOM   3450  C  CA    . LEU A 1 448 ? 35.193  131.449 46.924  1.00 20.53 ? 448  LEU A CA    1 
ATOM   3451  C  C     . LEU A 1 448 ? 35.485  130.148 47.662  1.00 21.54 ? 448  LEU A C     1 
ATOM   3452  O  O     . LEU A 1 448 ? 34.802  129.138 47.463  1.00 20.44 ? 448  LEU A O     1 
ATOM   3453  C  CB    . LEU A 1 448 ? 33.829  132.016 47.325  1.00 17.59 ? 448  LEU A CB    1 
ATOM   3454  C  CG    . LEU A 1 448 ? 33.420  133.288 46.564  1.00 19.03 ? 448  LEU A CG    1 
ATOM   3455  C  CD1   . LEU A 1 448 ? 32.056  133.767 47.041  1.00 16.20 ? 448  LEU A CD1   1 
ATOM   3456  C  CD2   . LEU A 1 448 ? 34.464  134.379 46.777  1.00 16.88 ? 448  LEU A CD2   1 
ATOM   3457  N  N     . VAL A 1 449 ? 36.523  130.160 48.490  1.00 21.08 ? 449  VAL A N     1 
ATOM   3458  C  CA    . VAL A 1 449 ? 36.889  128.971 49.248  1.00 21.32 ? 449  VAL A CA    1 
ATOM   3459  C  C     . VAL A 1 449 ? 36.941  129.306 50.733  1.00 22.82 ? 449  VAL A C     1 
ATOM   3460  O  O     . VAL A 1 449 ? 37.218  130.448 51.111  1.00 22.83 ? 449  VAL A O     1 
ATOM   3461  C  CB    . VAL A 1 449 ? 38.277  128.411 48.798  1.00 20.81 ? 449  VAL A CB    1 
ATOM   3462  C  CG1   . VAL A 1 449 ? 38.228  127.998 47.335  1.00 16.16 ? 449  VAL A CG1   1 
ATOM   3463  C  CG2   . VAL A 1 449 ? 39.368  129.456 49.020  1.00 18.31 ? 449  VAL A CG2   1 
ATOM   3464  N  N     . ASP A 1 450 ? 36.656  128.319 51.577  1.00 22.95 ? 450  ASP A N     1 
ATOM   3465  C  CA    . ASP A 1 450 ? 36.711  128.536 53.014  1.00 23.82 ? 450  ASP A CA    1 
ATOM   3466  C  C     . ASP A 1 450 ? 38.184  128.606 53.419  1.00 23.78 ? 450  ASP A C     1 
ATOM   3467  O  O     . ASP A 1 450 ? 39.068  128.520 52.564  1.00 23.22 ? 450  ASP A O     1 
ATOM   3468  C  CB    . ASP A 1 450 ? 36.022  127.390 53.752  1.00 26.87 ? 450  ASP A CB    1 
ATOM   3469  C  CG    . ASP A 1 450 ? 36.532  126.025 53.322  1.00 28.13 ? 450  ASP A CG    1 
ATOM   3470  O  OD1   . ASP A 1 450 ? 37.761  125.853 53.191  1.00 27.23 ? 450  ASP A OD1   1 
ATOM   3471  O  OD2   . ASP A 1 450 ? 35.698  125.118 53.122  1.00 31.86 ? 450  ASP A OD2   1 
ATOM   3472  N  N     . ASN A 1 451 ? 38.454  128.759 54.713  1.00 23.44 ? 451  ASN A N     1 
ATOM   3473  C  CA    . ASN A 1 451 ? 39.834  128.831 55.177  1.00 25.39 ? 451  ASN A CA    1 
ATOM   3474  C  C     . ASN A 1 451 ? 40.578  127.511 54.984  1.00 26.70 ? 451  ASN A C     1 
ATOM   3475  O  O     . ASN A 1 451 ? 41.797  127.451 55.126  1.00 26.94 ? 451  ASN A O     1 
ATOM   3476  C  CB    . ASN A 1 451 ? 39.883  129.250 56.644  1.00 25.10 ? 451  ASN A CB    1 
ATOM   3477  C  CG    . ASN A 1 451 ? 39.359  130.650 56.857  1.00 28.41 ? 451  ASN A CG    1 
ATOM   3478  O  OD1   . ASN A 1 451 ? 39.502  131.511 55.988  1.00 27.73 ? 451  ASN A OD1   1 
ATOM   3479  N  ND2   . ASN A 1 451 ? 38.760  130.893 58.018  1.00 29.29 ? 451  ASN A ND2   1 
ATOM   3480  N  N     . GLU A 1 452 ? 39.838  126.460 54.650  1.00 28.19 ? 452  GLU A N     1 
ATOM   3481  C  CA    . GLU A 1 452 ? 40.416  125.141 54.426  1.00 30.00 ? 452  GLU A CA    1 
ATOM   3482  C  C     . GLU A 1 452 ? 40.681  124.887 52.947  1.00 29.90 ? 452  GLU A C     1 
ATOM   3483  O  O     . GLU A 1 452 ? 41.245  123.855 52.579  1.00 30.44 ? 452  GLU A O     1 
ATOM   3484  C  CB    . GLU A 1 452 ? 39.480  124.052 54.962  1.00 32.70 ? 452  GLU A CB    1 
ATOM   3485  C  CG    . GLU A 1 452 ? 39.281  124.071 56.476  1.00 37.99 ? 452  GLU A CG    1 
ATOM   3486  C  CD    . GLU A 1 452 ? 38.544  125.316 56.965  1.00 41.94 ? 452  GLU A CD    1 
ATOM   3487  O  OE1   . GLU A 1 452 ? 37.396  125.561 56.517  1.00 43.24 ? 452  GLU A OE1   1 
ATOM   3488  O  OE2   . GLU A 1 452 ? 39.118  126.047 57.804  1.00 43.41 ? 452  GLU A OE2   1 
ATOM   3489  N  N     . GLY A 1 453 ? 40.257  125.820 52.098  1.00 29.19 ? 453  GLY A N     1 
ATOM   3490  C  CA    . GLY A 1 453 ? 40.473  125.672 50.670  1.00 27.58 ? 453  GLY A CA    1 
ATOM   3491  C  C     . GLY A 1 453 ? 39.328  125.044 49.898  1.00 27.22 ? 453  GLY A C     1 
ATOM   3492  O  O     . GLY A 1 453 ? 39.400  124.930 48.673  1.00 25.67 ? 453  GLY A O     1 
ATOM   3493  N  N     . HIS A 1 454 ? 38.270  124.643 50.597  1.00 27.32 ? 454  HIS A N     1 
ATOM   3494  C  CA    . HIS A 1 454 ? 37.123  124.019 49.946  1.00 29.34 ? 454  HIS A CA    1 
ATOM   3495  C  C     . HIS A 1 454 ? 36.270  125.047 49.216  1.00 29.63 ? 454  HIS A C     1 
ATOM   3496  O  O     . HIS A 1 454 ? 35.839  126.041 49.802  1.00 30.71 ? 454  HIS A O     1 
ATOM   3497  C  CB    . HIS A 1 454 ? 36.257  123.290 50.978  1.00 30.90 ? 454  HIS A CB    1 
ATOM   3498  C  CG    . HIS A 1 454 ? 37.020  122.336 51.843  1.00 33.91 ? 454  HIS A CG    1 
ATOM   3499  N  ND1   . HIS A 1 454 ? 36.797  122.221 53.198  1.00 35.07 ? 454  HIS A ND1   1 
ATOM   3500  C  CD2   . HIS A 1 454 ? 38.006  121.456 51.548  1.00 33.96 ? 454  HIS A CD2   1 
ATOM   3501  C  CE1   . HIS A 1 454 ? 37.617  121.314 53.701  1.00 36.81 ? 454  HIS A CE1   1 
ATOM   3502  N  NE2   . HIS A 1 454 ? 38.361  120.835 52.720  1.00 35.62 ? 454  HIS A NE2   1 
ATOM   3503  N  N     . PRO A 1 455 ? 36.013  124.821 47.919  1.00 29.47 ? 455  PRO A N     1 
ATOM   3504  C  CA    . PRO A 1 455 ? 35.202  125.741 47.122  1.00 29.58 ? 455  PRO A CA    1 
ATOM   3505  C  C     . PRO A 1 455 ? 33.771  125.798 47.648  1.00 30.50 ? 455  PRO A C     1 
ATOM   3506  O  O     . PRO A 1 455 ? 33.246  124.804 48.148  1.00 30.32 ? 455  PRO A O     1 
ATOM   3507  C  CB    . PRO A 1 455 ? 35.266  125.135 45.722  1.00 29.35 ? 455  PRO A CB    1 
ATOM   3508  C  CG    . PRO A 1 455 ? 36.578  124.411 45.718  1.00 29.30 ? 455  PRO A CG    1 
ATOM   3509  C  CD    . PRO A 1 455 ? 36.575  123.757 47.070  1.00 30.64 ? 455  PRO A CD    1 
ATOM   3510  N  N     . GLN A 1 456 ? 33.151  126.967 47.529  1.00 30.49 ? 456  GLN A N     1 
ATOM   3511  C  CA    . GLN A 1 456 ? 31.780  127.176 47.978  1.00 30.11 ? 456  GLN A CA    1 
ATOM   3512  C  C     . GLN A 1 456 ? 30.930  127.576 46.774  1.00 29.32 ? 456  GLN A C     1 
ATOM   3513  O  O     . GLN A 1 456 ? 31.266  128.521 46.060  1.00 28.62 ? 456  GLN A O     1 
ATOM   3514  C  CB    . GLN A 1 456 ? 31.745  128.278 49.033  1.00 31.36 ? 456  GLN A CB    1 
ATOM   3515  C  CG    . GLN A 1 456 ? 32.657  128.022 50.219  1.00 33.59 ? 456  GLN A CG    1 
ATOM   3516  C  CD    . GLN A 1 456 ? 32.358  126.697 50.905  1.00 35.60 ? 456  GLN A CD    1 
ATOM   3517  O  OE1   . GLN A 1 456 ? 33.134  125.741 50.807  1.00 37.44 ? 456  GLN A OE1   1 
ATOM   3518  N  NE2   . GLN A 1 456 ? 31.224  126.633 51.599  1.00 34.86 ? 456  GLN A NE2   1 
ATOM   3519  N  N     . GLU A 1 457 ? 29.830  126.863 46.555  1.00 28.55 ? 457  GLU A N     1 
ATOM   3520  C  CA    . GLU A 1 457 ? 28.950  127.143 45.422  1.00 28.94 ? 457  GLU A CA    1 
ATOM   3521  C  C     . GLU A 1 457 ? 27.678  127.908 45.801  1.00 27.72 ? 457  GLU A C     1 
ATOM   3522  O  O     . GLU A 1 457 ? 27.329  128.020 46.975  1.00 29.22 ? 457  GLU A O     1 
ATOM   3523  C  CB    . GLU A 1 457 ? 28.585  125.832 44.719  1.00 28.01 ? 457  GLU A CB    1 
ATOM   3524  N  N     . GLY A 1 458 ? 26.991  128.436 44.791  1.00 27.39 ? 458  GLY A N     1 
ATOM   3525  C  CA    . GLY A 1 458 ? 25.765  129.178 45.032  1.00 25.04 ? 458  GLY A CA    1 
ATOM   3526  C  C     . GLY A 1 458 ? 25.993  130.471 45.787  1.00 25.11 ? 458  GLY A C     1 
ATOM   3527  O  O     . GLY A 1 458 ? 27.127  130.933 45.903  1.00 24.28 ? 458  GLY A O     1 
ATOM   3528  N  N     . ALA A 1 459 ? 24.911  131.062 46.290  1.00 24.80 ? 459  ALA A N     1 
ATOM   3529  C  CA    . ALA A 1 459 ? 25.000  132.302 47.049  1.00 25.40 ? 459  ALA A CA    1 
ATOM   3530  C  C     . ALA A 1 459 ? 25.766  131.994 48.322  1.00 26.35 ? 459  ALA A C     1 
ATOM   3531  O  O     . ALA A 1 459 ? 25.259  131.310 49.208  1.00 27.74 ? 459  ALA A O     1 
ATOM   3532  C  CB    . ALA A 1 459 ? 23.608  132.823 47.385  1.00 24.27 ? 459  ALA A CB    1 
ATOM   3533  N  N     . THR A 1 460 ? 26.991  132.501 48.408  1.00 26.10 ? 460  THR A N     1 
ATOM   3534  C  CA    . THR A 1 460 ? 27.835  132.258 49.568  1.00 26.39 ? 460  THR A CA    1 
ATOM   3535  C  C     . THR A 1 460 ? 28.939  133.311 49.654  1.00 28.00 ? 460  THR A C     1 
ATOM   3536  O  O     . THR A 1 460 ? 28.877  134.343 48.988  1.00 28.42 ? 460  THR A O     1 
ATOM   3537  C  CB    . THR A 1 460 ? 28.482  130.858 49.478  1.00 25.13 ? 460  THR A CB    1 
ATOM   3538  O  OG1   . THR A 1 460 ? 29.233  130.599 50.671  1.00 26.35 ? 460  THR A OG1   1 
ATOM   3539  C  CG2   . THR A 1 460 ? 29.412  130.773 48.270  1.00 24.72 ? 460  THR A CG2   1 
ATOM   3540  N  N     . GLU A 1 461 ? 29.939  133.049 50.491  1.00 27.63 ? 461  GLU A N     1 
ATOM   3541  C  CA    . GLU A 1 461 ? 31.060  133.960 50.647  1.00 27.43 ? 461  GLU A CA    1 
ATOM   3542  C  C     . GLU A 1 461 ? 32.284  133.204 51.132  1.00 26.06 ? 461  GLU A C     1 
ATOM   3543  O  O     . GLU A 1 461 ? 32.189  132.052 51.561  1.00 25.01 ? 461  GLU A O     1 
ATOM   3544  C  CB    . GLU A 1 461 ? 30.717  135.093 51.621  1.00 31.29 ? 461  GLU A CB    1 
ATOM   3545  C  CG    . GLU A 1 461 ? 30.262  134.646 52.993  1.00 37.38 ? 461  GLU A CG    1 
ATOM   3546  C  CD    . GLU A 1 461 ? 30.110  135.812 53.962  1.00 42.60 ? 461  GLU A CD    1 
ATOM   3547  O  OE1   . GLU A 1 461 ? 29.339  136.756 53.657  1.00 45.00 ? 461  GLU A OE1   1 
ATOM   3548  O  OE2   . GLU A 1 461 ? 30.762  135.781 55.032  1.00 45.11 ? 461  GLU A OE2   1 
ATOM   3549  N  N     . GLY A 1 462 ? 33.439  133.854 51.047  1.00 24.07 ? 462  GLY A N     1 
ATOM   3550  C  CA    . GLY A 1 462 ? 34.672  133.227 51.479  1.00 21.43 ? 462  GLY A CA    1 
ATOM   3551  C  C     . GLY A 1 462 ? 35.874  133.925 50.890  1.00 20.22 ? 462  GLY A C     1 
ATOM   3552  O  O     . GLY A 1 462 ? 35.776  135.073 50.455  1.00 20.42 ? 462  GLY A O     1 
ATOM   3553  N  N     . ASN A 1 463 ? 37.004  133.225 50.869  1.00 18.01 ? 463  ASN A N     1 
ATOM   3554  C  CA    . ASN A 1 463 ? 38.245  133.768 50.334  1.00 17.40 ? 463  ASN A CA    1 
ATOM   3555  C  C     . ASN A 1 463 ? 38.190  133.823 48.809  1.00 17.52 ? 463  ASN A C     1 
ATOM   3556  O  O     . ASN A 1 463 ? 37.874  132.834 48.157  1.00 18.53 ? 463  ASN A O     1 
ATOM   3557  C  CB    . ASN A 1 463 ? 39.417  132.897 50.785  1.00 17.00 ? 463  ASN A CB    1 
ATOM   3558  C  CG    . ASN A 1 463 ? 39.428  132.680 52.282  1.00 15.95 ? 463  ASN A CG    1 
ATOM   3559  O  OD1   . ASN A 1 463 ? 39.482  133.630 53.053  1.00 16.64 ? 463  ASN A OD1   1 
ATOM   3560  N  ND2   . ASN A 1 463 ? 39.372  131.426 52.701  1.00 19.16 ? 463  ASN A ND2   1 
ATOM   3561  N  N     . LEU A 1 464 ? 38.498  134.987 48.247  1.00 17.38 ? 464  LEU A N     1 
ATOM   3562  C  CA    . LEU A 1 464 ? 38.476  135.164 46.797  1.00 15.96 ? 464  LEU A CA    1 
ATOM   3563  C  C     . LEU A 1 464 ? 39.778  134.723 46.133  1.00 15.72 ? 464  LEU A C     1 
ATOM   3564  O  O     . LEU A 1 464 ? 40.838  135.295 46.379  1.00 14.32 ? 464  LEU A O     1 
ATOM   3565  C  CB    . LEU A 1 464 ? 38.197  136.630 46.456  1.00 16.34 ? 464  LEU A CB    1 
ATOM   3566  C  CG    . LEU A 1 464 ? 38.289  137.049 44.982  1.00 17.04 ? 464  LEU A CG    1 
ATOM   3567  C  CD1   . LEU A 1 464 ? 37.343  136.201 44.117  1.00 15.68 ? 464  LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A 1 464 ? 37.939  138.527 44.866  1.00 16.17 ? 464  LEU A CD2   1 
ATOM   3569  N  N     . VAL A 1 465 ? 39.691  133.697 45.293  1.00 15.96 ? 465  VAL A N     1 
ATOM   3570  C  CA    . VAL A 1 465 ? 40.858  133.193 44.579  1.00 17.45 ? 465  VAL A CA    1 
ATOM   3571  C  C     . VAL A 1 465 ? 40.548  133.099 43.088  1.00 18.42 ? 465  VAL A C     1 
ATOM   3572  O  O     . VAL A 1 465 ? 39.383  133.149 42.677  1.00 18.72 ? 465  VAL A O     1 
ATOM   3573  C  CB    . VAL A 1 465 ? 41.284  131.785 45.079  1.00 18.37 ? 465  VAL A CB    1 
ATOM   3574  C  CG1   . VAL A 1 465 ? 41.621  131.830 46.556  1.00 17.01 ? 465  VAL A CG1   1 
ATOM   3575  C  CG2   . VAL A 1 465 ? 40.177  130.778 44.811  1.00 19.07 ? 465  VAL A CG2   1 
ATOM   3576  N  N     . ILE A 1 466 ? 41.595  132.985 42.279  1.00 17.85 ? 466  ILE A N     1 
ATOM   3577  C  CA    . ILE A 1 466 ? 41.435  132.858 40.834  1.00 17.83 ? 466  ILE A CA    1 
ATOM   3578  C  C     . ILE A 1 466 ? 42.025  131.486 40.492  1.00 17.36 ? 466  ILE A C     1 
ATOM   3579  O  O     . ILE A 1 466 ? 43.222  131.258 40.670  1.00 17.30 ? 466  ILE A O     1 
ATOM   3580  C  CB    . ILE A 1 466 ? 42.197  133.974 40.086  1.00 17.72 ? 466  ILE A CB    1 
ATOM   3581  C  CG1   . ILE A 1 466 ? 41.963  135.324 40.775  1.00 17.29 ? 466  ILE A CG1   1 
ATOM   3582  C  CG2   . ILE A 1 466 ? 41.728  134.042 38.633  1.00 17.76 ? 466  ILE A CG2   1 
ATOM   3583  C  CD1   . ILE A 1 466 ? 40.521  135.816 40.750  1.00 15.21 ? 466  ILE A CD1   1 
ATOM   3584  N  N     . THR A 1 467 ? 41.178  130.582 40.009  1.00 16.06 ? 467  THR A N     1 
ATOM   3585  C  CA    . THR A 1 467 ? 41.593  129.219 39.695  1.00 17.80 ? 467  THR A CA    1 
ATOM   3586  C  C     . THR A 1 467 ? 42.519  129.031 38.502  1.00 17.05 ? 467  THR A C     1 
ATOM   3587  O  O     . THR A 1 467 ? 43.040  127.939 38.298  1.00 18.05 ? 467  THR A O     1 
ATOM   3588  C  CB    . THR A 1 467 ? 40.369  128.290 39.487  1.00 18.73 ? 467  THR A CB    1 
ATOM   3589  O  OG1   . THR A 1 467 ? 39.755  128.571 38.221  1.00 20.71 ? 467  THR A OG1   1 
ATOM   3590  C  CG2   . THR A 1 467 ? 39.354  128.495 40.594  1.00 18.94 ? 467  THR A CG2   1 
ATOM   3591  N  N     . ASP A 1 468 ? 42.716  130.067 37.699  1.00 17.04 ? 468  ASP A N     1 
ATOM   3592  C  CA    . ASP A 1 468 ? 43.597  129.936 36.543  1.00 17.26 ? 468  ASP A CA    1 
ATOM   3593  C  C     . ASP A 1 468 ? 44.277  131.259 36.232  1.00 16.46 ? 468  ASP A C     1 
ATOM   3594  O  O     . ASP A 1 468 ? 43.982  132.281 36.857  1.00 16.28 ? 468  ASP A O     1 
ATOM   3595  C  CB    . ASP A 1 468 ? 42.815  129.463 35.312  1.00 18.21 ? 468  ASP A CB    1 
ATOM   3596  C  CG    . ASP A 1 468 ? 43.610  128.499 34.450  1.00 19.72 ? 468  ASP A CG    1 
ATOM   3597  O  OD1   . ASP A 1 468 ? 44.850  128.639 34.385  1.00 17.16 ? 468  ASP A OD1   1 
ATOM   3598  O  OD2   . ASP A 1 468 ? 42.992  127.605 33.827  1.00 22.64 ? 468  ASP A OD2   1 
ATOM   3599  N  N     . SER A 1 469 ? 45.179  131.239 35.257  1.00 15.60 ? 469  SER A N     1 
ATOM   3600  C  CA    . SER A 1 469 ? 45.913  132.439 34.875  1.00 15.59 ? 469  SER A CA    1 
ATOM   3601  C  C     . SER A 1 469 ? 45.173  133.260 33.820  1.00 15.96 ? 469  SER A C     1 
ATOM   3602  O  O     . SER A 1 469 ? 44.179  132.812 33.240  1.00 16.66 ? 469  SER A O     1 
ATOM   3603  C  CB    . SER A 1 469 ? 47.299  132.057 34.349  1.00 13.16 ? 469  SER A CB    1 
ATOM   3604  O  OG    . SER A 1 469 ? 48.084  133.204 34.065  1.00 12.77 ? 469  SER A OG    1 
ATOM   3605  N  N     . TRP A 1 470 ? 45.669  134.471 33.603  1.00 15.85 ? 470  TRP A N     1 
ATOM   3606  C  CA    . TRP A 1 470 ? 45.127  135.406 32.625  1.00 14.69 ? 470  TRP A CA    1 
ATOM   3607  C  C     . TRP A 1 470 ? 46.344  136.194 32.144  1.00 15.03 ? 470  TRP A C     1 
ATOM   3608  O  O     . TRP A 1 470 ? 47.302  136.372 32.899  1.00 15.99 ? 470  TRP A O     1 
ATOM   3609  C  CB    . TRP A 1 470 ? 44.091  136.318 33.282  1.00 15.10 ? 470  TRP A CB    1 
ATOM   3610  C  CG    . TRP A 1 470 ? 44.631  137.112 34.417  1.00 14.82 ? 470  TRP A CG    1 
ATOM   3611  C  CD1   . TRP A 1 470 ? 45.060  138.403 34.379  1.00 14.46 ? 470  TRP A CD1   1 
ATOM   3612  C  CD2   . TRP A 1 470 ? 44.845  136.653 35.757  1.00 14.81 ? 470  TRP A CD2   1 
ATOM   3613  N  NE1   . TRP A 1 470 ? 45.534  138.780 35.614  1.00 15.11 ? 470  TRP A NE1   1 
ATOM   3614  C  CE2   . TRP A 1 470 ? 45.414  137.727 36.479  1.00 14.80 ? 470  TRP A CE2   1 
ATOM   3615  C  CE3   . TRP A 1 470 ? 44.615  135.439 36.417  1.00 13.73 ? 470  TRP A CE3   1 
ATOM   3616  C  CZ2   . TRP A 1 470 ? 45.756  137.625 37.832  1.00 15.80 ? 470  TRP A CZ2   1 
ATOM   3617  C  CZ3   . TRP A 1 470 ? 44.956  135.335 37.762  1.00 16.01 ? 470  TRP A CZ3   1 
ATOM   3618  C  CH2   . TRP A 1 470 ? 45.522  136.427 38.455  1.00 14.81 ? 470  TRP A CH2   1 
ATOM   3619  N  N     . PRO A 1 471 ? 46.332  136.663 30.885  1.00 15.02 ? 471  PRO A N     1 
ATOM   3620  C  CA    . PRO A 1 471 ? 47.436  137.422 30.279  1.00 14.23 ? 471  PRO A CA    1 
ATOM   3621  C  C     . PRO A 1 471 ? 48.151  138.497 31.115  1.00 15.40 ? 471  PRO A C     1 
ATOM   3622  O  O     . PRO A 1 471 ? 49.388  138.565 31.122  1.00 15.21 ? 471  PRO A O     1 
ATOM   3623  C  CB    . PRO A 1 471 ? 46.792  138.007 29.023  1.00 14.52 ? 471  PRO A CB    1 
ATOM   3624  C  CG    . PRO A 1 471 ? 45.797  136.939 28.642  1.00 15.48 ? 471  PRO A CG    1 
ATOM   3625  C  CD    . PRO A 1 471 ? 45.175  136.608 29.971  1.00 12.92 ? 471  PRO A CD    1 
ATOM   3626  N  N     . GLY A 1 472 ? 47.380  139.334 31.806  1.00 15.89 ? 472  GLY A N     1 
ATOM   3627  C  CA    . GLY A 1 472 ? 47.970  140.408 32.592  1.00 16.23 ? 472  GLY A CA    1 
ATOM   3628  C  C     . GLY A 1 472 ? 48.486  140.091 33.986  1.00 17.39 ? 472  GLY A C     1 
ATOM   3629  O  O     . GLY A 1 472 ? 48.919  140.998 34.704  1.00 19.37 ? 472  GLY A O     1 
ATOM   3630  N  N     . GLN A 1 473 ? 48.458  138.824 34.383  1.00 16.34 ? 473  GLN A N     1 
ATOM   3631  C  CA    . GLN A 1 473 ? 48.924  138.445 35.717  1.00 15.82 ? 473  GLN A CA    1 
ATOM   3632  C  C     . GLN A 1 473 ? 50.412  138.702 35.974  1.00 16.19 ? 473  GLN A C     1 
ATOM   3633  O  O     . GLN A 1 473 ? 51.262  138.438 35.115  1.00 13.67 ? 473  GLN A O     1 
ATOM   3634  C  CB    . GLN A 1 473 ? 48.612  136.971 35.977  1.00 17.09 ? 473  GLN A CB    1 
ATOM   3635  C  CG    . GLN A 1 473 ? 49.191  136.421 37.266  1.00 15.17 ? 473  GLN A CG    1 
ATOM   3636  C  CD    . GLN A 1 473 ? 48.778  134.980 37.508  1.00 18.62 ? 473  GLN A CD    1 
ATOM   3637  O  OE1   . GLN A 1 473 ? 48.595  134.204 36.559  1.00 19.87 ? 473  GLN A OE1   1 
ATOM   3638  N  NE2   . GLN A 1 473 ? 48.640  134.606 38.782  1.00 18.09 ? 473  GLN A NE2   1 
ATOM   3639  N  N     . ALA A 1 474 ? 50.716  139.216 37.164  1.00 13.70 ? 474  ALA A N     1 
ATOM   3640  C  CA    . ALA A 1 474 ? 52.096  139.498 37.548  1.00 15.57 ? 474  ALA A CA    1 
ATOM   3641  C  C     . ALA A 1 474 ? 52.890  138.204 37.377  1.00 15.84 ? 474  ALA A C     1 
ATOM   3642  O  O     . ALA A 1 474 ? 52.385  137.112 37.654  1.00 15.94 ? 474  ALA A O     1 
ATOM   3643  C  CB    . ALA A 1 474 ? 52.157  139.977 38.996  1.00 12.94 ? 474  ALA A CB    1 
ATOM   3644  N  N     . ARG A 1 475 ? 54.129  138.319 36.915  1.00 14.92 ? 475  ARG A N     1 
ATOM   3645  C  CA    . ARG A 1 475 ? 54.928  137.131 36.687  1.00 15.16 ? 475  ARG A CA    1 
ATOM   3646  C  C     . ARG A 1 475 ? 55.785  136.708 37.872  1.00 15.55 ? 475  ARG A C     1 
ATOM   3647  O  O     . ARG A 1 475 ? 56.149  135.531 37.986  1.00 17.70 ? 475  ARG A O     1 
ATOM   3648  C  CB    . ARG A 1 475 ? 55.791  137.324 35.436  1.00 14.13 ? 475  ARG A CB    1 
ATOM   3649  C  CG    . ARG A 1 475 ? 54.993  137.653 34.168  1.00 11.56 ? 475  ARG A CG    1 
ATOM   3650  C  CD    . ARG A 1 475 ? 54.067  136.518 33.745  1.00 10.39 ? 475  ARG A CD    1 
ATOM   3651  N  NE    . ARG A 1 475 ? 53.730  136.589 32.324  1.00 8.50  ? 475  ARG A NE    1 
ATOM   3652  C  CZ    . ARG A 1 475 ? 52.604  137.099 31.831  1.00 9.68  ? 475  ARG A CZ    1 
ATOM   3653  N  NH1   . ARG A 1 475 ? 51.668  137.593 32.633  1.00 10.52 ? 475  ARG A NH1   1 
ATOM   3654  N  NH2   . ARG A 1 475 ? 52.413  137.124 30.523  1.00 10.78 ? 475  ARG A NH2   1 
ATOM   3655  N  N     . THR A 1 476 ? 56.095  137.643 38.766  1.00 13.41 ? 476  THR A N     1 
ATOM   3656  C  CA    . THR A 1 476 ? 56.914  137.312 39.933  1.00 13.47 ? 476  THR A CA    1 
ATOM   3657  C  C     . THR A 1 476 ? 57.190  138.544 40.777  1.00 15.15 ? 476  THR A C     1 
ATOM   3658  O  O     . THR A 1 476 ? 56.714  139.641 40.474  1.00 17.77 ? 476  THR A O     1 
ATOM   3659  C  CB    . THR A 1 476 ? 58.288  136.702 39.503  1.00 13.56 ? 476  THR A CB    1 
ATOM   3660  O  OG1   . THR A 1 476 ? 58.987  136.223 40.659  1.00 12.17 ? 476  THR A OG1   1 
ATOM   3661  C  CG2   . THR A 1 476 ? 59.156  137.751 38.805  1.00 9.00  ? 476  THR A CG2   1 
ATOM   3662  N  N     . LEU A 1 477 ? 57.944  138.339 41.851  1.00 15.28 ? 477  LEU A N     1 
ATOM   3663  C  CA    . LEU A 1 477 ? 58.354  139.427 42.734  1.00 14.78 ? 477  LEU A CA    1 
ATOM   3664  C  C     . LEU A 1 477 ? 59.838  139.626 42.445  1.00 15.41 ? 477  LEU A C     1 
ATOM   3665  O  O     . LEU A 1 477 ? 60.627  138.690 42.554  1.00 15.21 ? 477  LEU A O     1 
ATOM   3666  C  CB    . LEU A 1 477 ? 58.142  139.050 44.203  1.00 11.60 ? 477  LEU A CB    1 
ATOM   3667  C  CG    . LEU A 1 477 ? 56.683  138.925 44.658  1.00 11.19 ? 477  LEU A CG    1 
ATOM   3668  C  CD1   . LEU A 1 477 ? 56.630  138.557 46.142  1.00 8.32  ? 477  LEU A CD1   1 
ATOM   3669  C  CD2   . LEU A 1 477 ? 55.950  140.244 44.401  1.00 8.91  ? 477  LEU A CD2   1 
ATOM   3670  N  N     . PHE A 1 478 ? 60.212  140.841 42.060  1.00 16.36 ? 478  PHE A N     1 
ATOM   3671  C  CA    . PHE A 1 478 ? 61.598  141.125 41.728  1.00 16.30 ? 478  PHE A CA    1 
ATOM   3672  C  C     . PHE A 1 478 ? 62.580  140.510 42.722  1.00 18.44 ? 478  PHE A C     1 
ATOM   3673  O  O     . PHE A 1 478 ? 62.486  140.729 43.932  1.00 17.69 ? 478  PHE A O     1 
ATOM   3674  C  CB    . PHE A 1 478 ? 61.837  142.633 41.639  1.00 16.13 ? 478  PHE A CB    1 
ATOM   3675  C  CG    . PHE A 1 478 ? 63.188  142.996 41.085  1.00 16.74 ? 478  PHE A CG    1 
ATOM   3676  C  CD1   . PHE A 1 478 ? 63.432  142.930 39.717  1.00 16.29 ? 478  PHE A CD1   1 
ATOM   3677  C  CD2   . PHE A 1 478 ? 64.232  143.356 41.935  1.00 16.96 ? 478  PHE A CD2   1 
ATOM   3678  C  CE1   . PHE A 1 478 ? 64.698  143.213 39.203  1.00 16.38 ? 478  PHE A CE1   1 
ATOM   3679  C  CE2   . PHE A 1 478 ? 65.498  143.640 41.433  1.00 15.46 ? 478  PHE A CE2   1 
ATOM   3680  C  CZ    . PHE A 1 478 ? 65.730  143.567 40.060  1.00 16.82 ? 478  PHE A CZ    1 
ATOM   3681  N  N     . GLY A 1 479 ? 63.517  139.732 42.184  1.00 18.77 ? 479  GLY A N     1 
ATOM   3682  C  CA    . GLY A 1 479 ? 64.530  139.082 42.998  1.00 18.41 ? 479  GLY A CA    1 
ATOM   3683  C  C     . GLY A 1 479 ? 64.058  138.060 44.018  1.00 19.20 ? 479  GLY A C     1 
ATOM   3684  O  O     . GLY A 1 479 ? 64.857  137.613 44.849  1.00 19.18 ? 479  GLY A O     1 
ATOM   3685  N  N     . ASP A 1 480 ? 62.786  137.665 43.966  1.00 18.21 ? 480  ASP A N     1 
ATOM   3686  C  CA    . ASP A 1 480 ? 62.286  136.704 44.947  1.00 18.82 ? 480  ASP A CA    1 
ATOM   3687  C  C     . ASP A 1 480 ? 61.091  135.879 44.461  1.00 19.53 ? 480  ASP A C     1 
ATOM   3688  O  O     . ASP A 1 480 ? 59.986  135.997 44.987  1.00 19.77 ? 480  ASP A O     1 
ATOM   3689  C  CB    . ASP A 1 480 ? 61.898  137.446 46.233  1.00 17.99 ? 480  ASP A CB    1 
ATOM   3690  C  CG    . ASP A 1 480 ? 61.816  136.528 47.440  1.00 20.13 ? 480  ASP A CG    1 
ATOM   3691  O  OD1   . ASP A 1 480 ? 61.808  135.288 47.250  1.00 19.15 ? 480  ASP A OD1   1 
ATOM   3692  O  OD2   . ASP A 1 480 ? 61.754  137.051 48.579  1.00 20.42 ? 480  ASP A OD2   1 
ATOM   3693  N  N     . HIS A 1 481 ? 61.315  135.023 43.476  1.00 19.66 ? 481  HIS A N     1 
ATOM   3694  C  CA    . HIS A 1 481 ? 60.227  134.209 42.963  1.00 20.74 ? 481  HIS A CA    1 
ATOM   3695  C  C     . HIS A 1 481 ? 59.625  133.287 44.037  1.00 20.84 ? 481  HIS A C     1 
ATOM   3696  O  O     . HIS A 1 481 ? 58.428  132.999 44.015  1.00 19.27 ? 481  HIS A O     1 
ATOM   3697  C  CB    . HIS A 1 481 ? 60.708  133.383 41.771  1.00 21.56 ? 481  HIS A CB    1 
ATOM   3698  C  CG    . HIS A 1 481 ? 59.612  132.642 41.073  1.00 23.87 ? 481  HIS A CG    1 
ATOM   3699  N  ND1   . HIS A 1 481 ? 58.674  133.270 40.282  1.00 24.60 ? 481  HIS A ND1   1 
ATOM   3700  C  CD2   . HIS A 1 481 ? 59.288  131.326 41.069  1.00 24.87 ? 481  HIS A CD2   1 
ATOM   3701  C  CE1   . HIS A 1 481 ? 57.820  132.374 39.819  1.00 25.03 ? 481  HIS A CE1   1 
ATOM   3702  N  NE2   . HIS A 1 481 ? 58.171  131.187 40.281  1.00 25.65 ? 481  HIS A NE2   1 
ATOM   3703  N  N     . GLU A 1 482 ? 60.447  132.823 44.973  1.00 22.81 ? 482  GLU A N     1 
ATOM   3704  C  CA    . GLU A 1 482 ? 59.957  131.935 46.031  1.00 24.05 ? 482  GLU A CA    1 
ATOM   3705  C  C     . GLU A 1 482 ? 58.906  132.619 46.903  1.00 23.38 ? 482  GLU A C     1 
ATOM   3706  O  O     . GLU A 1 482 ? 57.894  132.005 47.261  1.00 22.12 ? 482  GLU A O     1 
ATOM   3707  C  CB    . GLU A 1 482 ? 61.118  131.451 46.899  1.00 28.54 ? 482  GLU A CB    1 
ATOM   3708  C  CG    . GLU A 1 482 ? 62.061  130.510 46.173  1.00 35.16 ? 482  GLU A CG    1 
ATOM   3709  C  CD    . GLU A 1 482 ? 63.458  130.526 46.766  1.00 41.22 ? 482  GLU A CD    1 
ATOM   3710  O  OE1   . GLU A 1 482 ? 63.606  130.224 47.971  1.00 42.39 ? 482  GLU A OE1   1 
ATOM   3711  O  OE2   . GLU A 1 482 ? 64.413  130.846 46.024  1.00 45.96 ? 482  GLU A OE2   1 
ATOM   3712  N  N     . ARG A 1 483 ? 59.150  133.882 47.245  1.00 19.91 ? 483  ARG A N     1 
ATOM   3713  C  CA    . ARG A 1 483 ? 58.203  134.642 48.048  1.00 21.28 ? 483  ARG A CA    1 
ATOM   3714  C  C     . ARG A 1 483 ? 56.912  134.803 47.244  1.00 19.91 ? 483  ARG A C     1 
ATOM   3715  O  O     . ARG A 1 483 ? 55.813  134.784 47.797  1.00 18.44 ? 483  ARG A O     1 
ATOM   3716  C  CB    . ARG A 1 483 ? 58.767  136.021 48.385  1.00 22.87 ? 483  ARG A CB    1 
ATOM   3717  C  CG    . ARG A 1 483 ? 57.786  136.911 49.132  1.00 27.66 ? 483  ARG A CG    1 
ATOM   3718  C  CD    . ARG A 1 483 ? 57.800  136.625 50.616  1.00 34.03 ? 483  ARG A CD    1 
ATOM   3719  N  NE    . ARG A 1 483 ? 59.052  137.082 51.216  1.00 40.43 ? 483  ARG A NE    1 
ATOM   3720  C  CZ    . ARG A 1 483 ? 59.529  136.648 52.378  1.00 41.96 ? 483  ARG A CZ    1 
ATOM   3721  N  NH1   . ARG A 1 483 ? 58.856  135.737 53.077  1.00 42.62 ? 483  ARG A NH1   1 
ATOM   3722  N  NH2   . ARG A 1 483 ? 60.680  137.118 52.839  1.00 42.85 ? 483  ARG A NH2   1 
ATOM   3723  N  N     . PHE A 1 484 ? 57.063  134.963 45.932  1.00 17.90 ? 484  PHE A N     1 
ATOM   3724  C  CA    . PHE A 1 484 ? 55.929  135.114 45.030  1.00 18.22 ? 484  PHE A CA    1 
ATOM   3725  C  C     . PHE A 1 484 ? 55.031  133.880 45.125  1.00 18.62 ? 484  PHE A C     1 
ATOM   3726  O  O     . PHE A 1 484 ? 53.812  133.984 45.299  1.00 18.72 ? 484  PHE A O     1 
ATOM   3727  C  CB    . PHE A 1 484 ? 56.431  135.280 43.593  1.00 16.36 ? 484  PHE A CB    1 
ATOM   3728  C  CG    . PHE A 1 484 ? 55.337  135.355 42.570  1.00 16.34 ? 484  PHE A CG    1 
ATOM   3729  C  CD1   . PHE A 1 484 ? 54.502  136.465 42.510  1.00 15.72 ? 484  PHE A CD1   1 
ATOM   3730  C  CD2   . PHE A 1 484 ? 55.148  134.322 41.658  1.00 16.91 ? 484  PHE A CD2   1 
ATOM   3731  C  CE1   . PHE A 1 484 ? 53.494  136.546 41.550  1.00 16.22 ? 484  PHE A CE1   1 
ATOM   3732  C  CE2   . PHE A 1 484 ? 54.145  134.391 40.697  1.00 15.52 ? 484  PHE A CE2   1 
ATOM   3733  C  CZ    . PHE A 1 484 ? 53.314  135.508 40.641  1.00 17.37 ? 484  PHE A CZ    1 
ATOM   3734  N  N     . GLU A 1 485 ? 55.647  132.711 45.016  1.00 19.58 ? 485  GLU A N     1 
ATOM   3735  C  CA    . GLU A 1 485 ? 54.926  131.447 45.083  1.00 20.69 ? 485  GLU A CA    1 
ATOM   3736  C  C     . GLU A 1 485 ? 54.260  131.228 46.432  1.00 19.31 ? 485  GLU A C     1 
ATOM   3737  O  O     . GLU A 1 485 ? 53.101  130.818 46.508  1.00 18.76 ? 485  GLU A O     1 
ATOM   3738  C  CB    . GLU A 1 485 ? 55.880  130.291 44.795  1.00 19.44 ? 485  GLU A CB    1 
ATOM   3739  C  CG    . GLU A 1 485 ? 56.555  130.391 43.449  1.00 20.50 ? 485  GLU A CG    1 
ATOM   3740  C  CD    . GLU A 1 485 ? 57.491  129.231 43.185  1.00 21.59 ? 485  GLU A CD    1 
ATOM   3741  O  OE1   . GLU A 1 485 ? 58.267  128.878 44.100  1.00 22.12 ? 485  GLU A OE1   1 
ATOM   3742  O  OE2   . GLU A 1 485 ? 57.459  128.682 42.065  1.00 21.96 ? 485  GLU A OE2   1 
ATOM   3743  N  N     . GLN A 1 486 ? 54.996  131.505 47.498  1.00 19.72 ? 486  GLN A N     1 
ATOM   3744  C  CA    . GLN A 1 486 ? 54.469  131.326 48.841  1.00 20.05 ? 486  GLN A CA    1 
ATOM   3745  C  C     . GLN A 1 486 ? 53.359  132.315 49.203  1.00 19.48 ? 486  GLN A C     1 
ATOM   3746  O  O     . GLN A 1 486 ? 52.327  131.929 49.753  1.00 19.42 ? 486  GLN A O     1 
ATOM   3747  C  CB    . GLN A 1 486 ? 55.597  131.433 49.862  1.00 21.79 ? 486  GLN A CB    1 
ATOM   3748  C  CG    . GLN A 1 486 ? 55.123  131.311 51.300  1.00 26.76 ? 486  GLN A CG    1 
ATOM   3749  C  CD    . GLN A 1 486 ? 56.267  131.177 52.268  1.00 28.16 ? 486  GLN A CD    1 
ATOM   3750  O  OE1   . GLN A 1 486 ? 56.977  130.167 52.277  1.00 31.09 ? 486  GLN A OE1   1 
ATOM   3751  N  NE2   . GLN A 1 486 ? 56.466  132.202 53.090  1.00 27.16 ? 486  GLN A NE2   1 
ATOM   3752  N  N     . THR A 1 487 ? 53.568  133.584 48.879  1.00 17.31 ? 487  THR A N     1 
ATOM   3753  C  CA    . THR A 1 487 ? 52.600  134.624 49.184  1.00 16.75 ? 487  THR A CA    1 
ATOM   3754  C  C     . THR A 1 487 ? 51.239  134.460 48.496  1.00 16.05 ? 487  THR A C     1 
ATOM   3755  O  O     . THR A 1 487 ? 50.198  134.703 49.102  1.00 13.41 ? 487  THR A O     1 
ATOM   3756  C  CB    . THR A 1 487 ? 53.173  136.018 48.818  1.00 17.17 ? 487  THR A CB    1 
ATOM   3757  O  OG1   . THR A 1 487 ? 54.303  136.297 49.651  1.00 17.79 ? 487  THR A OG1   1 
ATOM   3758  C  CG2   . THR A 1 487 ? 52.124  137.114 49.009  1.00 16.52 ? 487  THR A CG2   1 
ATOM   3759  N  N     . TYR A 1 488 ? 51.247  134.033 47.240  1.00 16.63 ? 488  TYR A N     1 
ATOM   3760  C  CA    . TYR A 1 488 ? 50.008  133.899 46.480  1.00 17.21 ? 488  TYR A CA    1 
ATOM   3761  C  C     . TYR A 1 488 ? 49.514  132.496 46.145  1.00 16.92 ? 488  TYR A C     1 
ATOM   3762  O  O     . TYR A 1 488 ? 48.339  132.329 45.834  1.00 18.69 ? 488  TYR A O     1 
ATOM   3763  C  CB    . TYR A 1 488 ? 50.131  134.678 45.165  1.00 15.13 ? 488  TYR A CB    1 
ATOM   3764  C  CG    . TYR A 1 488 ? 50.637  136.091 45.344  1.00 15.31 ? 488  TYR A CG    1 
ATOM   3765  C  CD1   . TYR A 1 488 ? 51.967  136.424 45.066  1.00 15.56 ? 488  TYR A CD1   1 
ATOM   3766  C  CD2   . TYR A 1 488 ? 49.796  137.091 45.824  1.00 14.12 ? 488  TYR A CD2   1 
ATOM   3767  C  CE1   . TYR A 1 488 ? 52.445  137.718 45.262  1.00 14.72 ? 488  TYR A CE1   1 
ATOM   3768  C  CE2   . TYR A 1 488 ? 50.261  138.386 46.026  1.00 16.72 ? 488  TYR A CE2   1 
ATOM   3769  C  CZ    . TYR A 1 488 ? 51.583  138.690 45.742  1.00 15.63 ? 488  TYR A CZ    1 
ATOM   3770  O  OH    . TYR A 1 488 ? 52.022  139.968 45.933  1.00 17.61 ? 488  TYR A OH    1 
ATOM   3771  N  N     . PHE A 1 489 ? 50.381  131.492 46.204  1.00 16.06 ? 489  PHE A N     1 
ATOM   3772  C  CA    . PHE A 1 489 ? 49.952  130.150 45.830  1.00 16.67 ? 489  PHE A CA    1 
ATOM   3773  C  C     . PHE A 1 489 ? 50.119  129.034 46.858  1.00 17.69 ? 489  PHE A C     1 
ATOM   3774  O  O     . PHE A 1 489 ? 49.955  127.854 46.518  1.00 15.47 ? 489  PHE A O     1 
ATOM   3775  C  CB    . PHE A 1 489 ? 50.646  129.745 44.521  1.00 14.49 ? 489  PHE A CB    1 
ATOM   3776  C  CG    . PHE A 1 489 ? 50.615  130.817 43.461  1.00 14.37 ? 489  PHE A CG    1 
ATOM   3777  C  CD1   . PHE A 1 489 ? 51.570  131.834 43.453  1.00 13.60 ? 489  PHE A CD1   1 
ATOM   3778  C  CD2   . PHE A 1 489 ? 49.624  130.822 42.483  1.00 14.25 ? 489  PHE A CD2   1 
ATOM   3779  C  CE1   . PHE A 1 489 ? 51.539  132.842 42.484  1.00 14.19 ? 489  PHE A CE1   1 
ATOM   3780  C  CE2   . PHE A 1 489 ? 49.582  131.828 41.507  1.00 13.38 ? 489  PHE A CE2   1 
ATOM   3781  C  CZ    . PHE A 1 489 ? 50.543  132.838 41.509  1.00 13.45 ? 489  PHE A CZ    1 
ATOM   3782  N  N     . SER A 1 490 ? 50.412  129.384 48.110  1.00 17.31 ? 490  SER A N     1 
ATOM   3783  C  CA    . SER A 1 490 ? 50.597  128.370 49.146  1.00 18.49 ? 490  SER A CA    1 
ATOM   3784  C  C     . SER A 1 490 ? 49.376  128.196 50.045  1.00 17.72 ? 490  SER A C     1 
ATOM   3785  O  O     . SER A 1 490 ? 49.117  127.103 50.544  1.00 18.88 ? 490  SER A O     1 
ATOM   3786  C  CB    . SER A 1 490 ? 51.813  128.708 50.012  1.00 18.29 ? 490  SER A CB    1 
ATOM   3787  O  OG    . SER A 1 490 ? 51.515  129.802 50.855  1.00 22.20 ? 490  SER A OG    1 
ATOM   3788  N  N     . THR A 1 491 ? 48.629  129.273 50.257  1.00 17.59 ? 491  THR A N     1 
ATOM   3789  C  CA    . THR A 1 491 ? 47.440  129.219 51.101  1.00 15.39 ? 491  THR A CA    1 
ATOM   3790  C  C     . THR A 1 491 ? 46.421  128.236 50.532  1.00 16.08 ? 491  THR A C     1 
ATOM   3791  O  O     . THR A 1 491 ? 45.822  127.450 51.264  1.00 16.65 ? 491  THR A O     1 
ATOM   3792  C  CB    . THR A 1 491 ? 46.793  130.618 51.222  1.00 16.79 ? 491  THR A CB    1 
ATOM   3793  O  OG1   . THR A 1 491 ? 47.711  131.515 51.862  1.00 17.43 ? 491  THR A OG1   1 
ATOM   3794  C  CG2   . THR A 1 491 ? 45.515  130.551 52.037  1.00 16.89 ? 491  THR A CG2   1 
ATOM   3795  N  N     . PHE A 1 492 ? 46.228  128.287 49.221  1.00 15.36 ? 492  PHE A N     1 
ATOM   3796  C  CA    . PHE A 1 492 ? 45.279  127.405 48.559  1.00 16.59 ? 492  PHE A CA    1 
ATOM   3797  C  C     . PHE A 1 492 ? 45.963  126.828 47.328  1.00 17.78 ? 492  PHE A C     1 
ATOM   3798  O  O     . PHE A 1 492 ? 46.058  127.482 46.292  1.00 19.73 ? 492  PHE A O     1 
ATOM   3799  C  CB    . PHE A 1 492 ? 44.027  128.202 48.178  1.00 16.98 ? 492  PHE A CB    1 
ATOM   3800  C  CG    . PHE A 1 492 ? 43.345  128.858 49.356  1.00 16.16 ? 492  PHE A CG    1 
ATOM   3801  C  CD1   . PHE A 1 492 ? 43.125  130.236 49.374  1.00 15.03 ? 492  PHE A CD1   1 
ATOM   3802  C  CD2   . PHE A 1 492 ? 42.911  128.095 50.443  1.00 15.58 ? 492  PHE A CD2   1 
ATOM   3803  C  CE1   . PHE A 1 492 ? 42.483  130.843 50.454  1.00 16.66 ? 492  PHE A CE1   1 
ATOM   3804  C  CE2   . PHE A 1 492 ? 42.266  128.693 51.526  1.00 14.51 ? 492  PHE A CE2   1 
ATOM   3805  C  CZ    . PHE A 1 492 ? 42.051  130.069 51.532  1.00 13.08 ? 492  PHE A CZ    1 
ATOM   3806  N  N     . LYS A 1 493 ? 46.440  125.596 47.455  1.00 16.33 ? 493  LYS A N     1 
ATOM   3807  C  CA    . LYS A 1 493 ? 47.156  124.934 46.382  1.00 18.11 ? 493  LYS A CA    1 
ATOM   3808  C  C     . LYS A 1 493 ? 46.522  125.021 45.010  1.00 19.00 ? 493  LYS A C     1 
ATOM   3809  O  O     . LYS A 1 493 ? 45.314  124.847 44.850  1.00 20.01 ? 493  LYS A O     1 
ATOM   3810  C  CB    . LYS A 1 493 ? 47.410  123.475 46.752  1.00 19.27 ? 493  LYS A CB    1 
ATOM   3811  C  CG    . LYS A 1 493 ? 48.426  123.334 47.876  1.00 22.56 ? 493  LYS A CG    1 
ATOM   3812  C  CD    . LYS A 1 493 ? 48.682  121.885 48.239  1.00 25.82 ? 493  LYS A CD    1 
ATOM   3813  C  CE    . LYS A 1 493 ? 49.785  121.780 49.282  1.00 26.69 ? 493  LYS A CE    1 
ATOM   3814  N  NZ    . LYS A 1 493 ? 49.472  122.570 50.515  1.00 27.63 ? 493  LYS A NZ    1 
ATOM   3815  N  N     . ASN A 1 494 ? 47.367  125.299 44.021  1.00 18.51 ? 494  ASN A N     1 
ATOM   3816  C  CA    . ASN A 1 494 ? 46.946  125.409 42.630  1.00 19.40 ? 494  ASN A CA    1 
ATOM   3817  C  C     . ASN A 1 494 ? 46.019  126.585 42.360  1.00 18.28 ? 494  ASN A C     1 
ATOM   3818  O  O     . ASN A 1 494 ? 45.354  126.630 41.324  1.00 18.41 ? 494  ASN A O     1 
ATOM   3819  C  CB    . ASN A 1 494 ? 46.266  124.110 42.183  1.00 21.62 ? 494  ASN A CB    1 
ATOM   3820  C  CG    . ASN A 1 494 ? 47.211  122.941 42.184  1.00 22.71 ? 494  ASN A CG    1 
ATOM   3821  O  OD1   . ASN A 1 494 ? 48.190  122.926 41.448  1.00 24.45 ? 494  ASN A OD1   1 
ATOM   3822  N  ND2   . ASN A 1 494 ? 46.929  121.951 43.021  1.00 27.07 ? 494  ASN A ND2   1 
ATOM   3823  N  N     . MET A 1 495 ? 45.978  127.541 43.281  1.00 18.13 ? 495  MET A N     1 
ATOM   3824  C  CA    . MET A 1 495 ? 45.116  128.701 43.107  1.00 18.94 ? 495  MET A CA    1 
ATOM   3825  C  C     . MET A 1 495 ? 45.793  130.007 43.502  1.00 18.12 ? 495  MET A C     1 
ATOM   3826  O  O     . MET A 1 495 ? 46.667  130.040 44.370  1.00 19.93 ? 495  MET A O     1 
ATOM   3827  C  CB    . MET A 1 495 ? 43.841  128.539 43.935  1.00 21.45 ? 495  MET A CB    1 
ATOM   3828  C  CG    . MET A 1 495 ? 43.003  127.319 43.579  1.00 27.16 ? 495  MET A CG    1 
ATOM   3829  S  SD    . MET A 1 495 ? 41.487  127.245 44.562  1.00 34.15 ? 495  MET A SD    1 
ATOM   3830  C  CE    . MET A 1 495 ? 41.835  125.892 45.700  1.00 33.02 ? 495  MET A CE    1 
ATOM   3831  N  N     . TYR A 1 496 ? 45.396  131.083 42.836  1.00 16.19 ? 496  TYR A N     1 
ATOM   3832  C  CA    . TYR A 1 496 ? 45.930  132.399 43.138  1.00 14.24 ? 496  TYR A CA    1 
ATOM   3833  C  C     . TYR A 1 496 ? 45.084  132.974 44.262  1.00 14.17 ? 496  TYR A C     1 
ATOM   3834  O  O     . TYR A 1 496 ? 43.868  133.088 44.128  1.00 14.91 ? 496  TYR A O     1 
ATOM   3835  C  CB    . TYR A 1 496 ? 45.829  133.323 41.924  1.00 13.83 ? 496  TYR A CB    1 
ATOM   3836  C  CG    . TYR A 1 496 ? 46.155  134.761 42.255  1.00 13.72 ? 496  TYR A CG    1 
ATOM   3837  C  CD1   . TYR A 1 496 ? 47.468  135.156 42.506  1.00 13.18 ? 496  TYR A CD1   1 
ATOM   3838  C  CD2   . TYR A 1 496 ? 45.144  135.715 42.376  1.00 15.41 ? 496  TYR A CD2   1 
ATOM   3839  C  CE1   . TYR A 1 496 ? 47.768  136.463 42.874  1.00 15.19 ? 496  TYR A CE1   1 
ATOM   3840  C  CE2   . TYR A 1 496 ? 45.432  137.031 42.743  1.00 14.69 ? 496  TYR A CE2   1 
ATOM   3841  C  CZ    . TYR A 1 496 ? 46.747  137.398 42.991  1.00 16.25 ? 496  TYR A CZ    1 
ATOM   3842  O  OH    . TYR A 1 496 ? 47.044  138.694 43.360  1.00 14.91 ? 496  TYR A OH    1 
ATOM   3843  N  N     . PHE A 1 497 ? 45.717  133.328 45.372  1.00 14.18 ? 497  PHE A N     1 
ATOM   3844  C  CA    . PHE A 1 497 ? 44.979  133.906 46.484  1.00 14.55 ? 497  PHE A CA    1 
ATOM   3845  C  C     . PHE A 1 497 ? 45.205  135.410 46.495  1.00 15.58 ? 497  PHE A C     1 
ATOM   3846  O  O     . PHE A 1 497 ? 46.344  135.880 46.608  1.00 17.00 ? 497  PHE A O     1 
ATOM   3847  C  CB    . PHE A 1 497 ? 45.421  133.292 47.813  1.00 13.82 ? 497  PHE A CB    1 
ATOM   3848  C  CG    . PHE A 1 497 ? 44.685  133.839 49.008  1.00 14.30 ? 497  PHE A CG    1 
ATOM   3849  C  CD1   . PHE A 1 497 ? 43.344  134.209 48.908  1.00 14.57 ? 497  PHE A CD1   1 
ATOM   3850  C  CD2   . PHE A 1 497 ? 45.318  133.942 50.246  1.00 14.42 ? 497  PHE A CD2   1 
ATOM   3851  C  CE1   . PHE A 1 497 ? 42.643  134.668 50.023  1.00 15.83 ? 497  PHE A CE1   1 
ATOM   3852  C  CE2   . PHE A 1 497 ? 44.623  134.401 51.370  1.00 12.91 ? 497  PHE A CE2   1 
ATOM   3853  C  CZ    . PHE A 1 497 ? 43.284  134.763 51.257  1.00 15.67 ? 497  PHE A CZ    1 
ATOM   3854  N  N     . SER A 1 498 ? 44.109  136.156 46.372  1.00 15.25 ? 498  SER A N     1 
ATOM   3855  C  CA    . SER A 1 498 ? 44.146  137.617 46.336  1.00 14.21 ? 498  SER A CA    1 
ATOM   3856  C  C     . SER A 1 498 ? 44.260  138.280 47.709  1.00 15.50 ? 498  SER A C     1 
ATOM   3857  O  O     . SER A 1 498 ? 44.657  139.439 47.809  1.00 15.65 ? 498  SER A O     1 
ATOM   3858  C  CB    . SER A 1 498 ? 42.887  138.144 45.646  1.00 14.24 ? 498  SER A CB    1 
ATOM   3859  O  OG    . SER A 1 498 ? 41.731  137.847 46.420  1.00 11.92 ? 498  SER A OG    1 
ATOM   3860  N  N     . GLY A 1 499 ? 43.906  137.553 48.763  1.00 15.88 ? 499  GLY A N     1 
ATOM   3861  C  CA    . GLY A 1 499 ? 43.967  138.136 50.089  1.00 15.61 ? 499  GLY A CA    1 
ATOM   3862  C  C     . GLY A 1 499 ? 42.712  138.940 50.380  1.00 16.01 ? 499  GLY A C     1 
ATOM   3863  O  O     . GLY A 1 499 ? 42.626  139.628 51.400  1.00 15.68 ? 499  GLY A O     1 
ATOM   3864  N  N     . ASP A 1 500 ? 41.744  138.865 49.465  1.00 16.39 ? 500  ASP A N     1 
ATOM   3865  C  CA    . ASP A 1 500 ? 40.465  139.561 49.604  1.00 15.58 ? 500  ASP A CA    1 
ATOM   3866  C  C     . ASP A 1 500 ? 39.361  138.585 49.951  1.00 15.93 ? 500  ASP A C     1 
ATOM   3867  O  O     . ASP A 1 500 ? 39.465  137.392 49.673  1.00 16.11 ? 500  ASP A O     1 
ATOM   3868  C  CB    . ASP A 1 500 ? 40.054  140.240 48.297  1.00 15.08 ? 500  ASP A CB    1 
ATOM   3869  C  CG    . ASP A 1 500 ? 40.632  141.620 48.145  1.00 16.67 ? 500  ASP A CG    1 
ATOM   3870  O  OD1   . ASP A 1 500 ? 40.633  142.375 49.140  1.00 14.72 ? 500  ASP A OD1   1 
ATOM   3871  O  OD2   . ASP A 1 500 ? 41.063  141.947 47.019  1.00 16.60 ? 500  ASP A OD2   1 
ATOM   3872  N  N     . GLY A 1 501 ? 38.294  139.117 50.534  1.00 16.64 ? 501  GLY A N     1 
ATOM   3873  C  CA    . GLY A 1 501 ? 37.140  138.313 50.879  1.00 16.71 ? 501  GLY A CA    1 
ATOM   3874  C  C     . GLY A 1 501 ? 36.004  138.833 50.013  1.00 19.49 ? 501  GLY A C     1 
ATOM   3875  O  O     . GLY A 1 501 ? 36.015  140.002 49.605  1.00 19.19 ? 501  GLY A O     1 
ATOM   3876  N  N     . ALA A 1 502 ? 35.030  137.983 49.710  1.00 19.04 ? 502  ALA A N     1 
ATOM   3877  C  CA    . ALA A 1 502 ? 33.912  138.418 48.883  1.00 21.09 ? 502  ALA A CA    1 
ATOM   3878  C  C     . ALA A 1 502 ? 32.723  137.480 48.963  1.00 22.47 ? 502  ALA A C     1 
ATOM   3879  O  O     . ALA A 1 502 ? 32.865  136.321 49.340  1.00 23.23 ? 502  ALA A O     1 
ATOM   3880  C  CB    . ALA A 1 502 ? 34.361  138.549 47.432  1.00 21.96 ? 502  ALA A CB    1 
ATOM   3881  N  N     . ARG A 1 503 ? 31.545  137.992 48.622  1.00 24.43 ? 503  ARG A N     1 
ATOM   3882  C  CA    . ARG A 1 503 ? 30.349  137.167 48.616  1.00 25.78 ? 503  ARG A CA    1 
ATOM   3883  C  C     . ARG A 1 503 ? 29.769  137.164 47.208  1.00 25.50 ? 503  ARG A C     1 
ATOM   3884  O  O     . ARG A 1 503 ? 29.994  138.093 46.428  1.00 24.86 ? 503  ARG A O     1 
ATOM   3885  C  CB    . ARG A 1 503 ? 29.306  137.680 49.617  1.00 27.87 ? 503  ARG A CB    1 
ATOM   3886  C  CG    . ARG A 1 503 ? 28.603  138.970 49.246  1.00 32.89 ? 503  ARG A CG    1 
ATOM   3887  C  CD    . ARG A 1 503 ? 27.459  139.260 50.221  1.00 35.46 ? 503  ARG A CD    1 
ATOM   3888  N  NE    . ARG A 1 503 ? 26.781  140.523 49.926  1.00 38.28 ? 503  ARG A NE    1 
ATOM   3889  C  CZ    . ARG A 1 503 ? 27.292  141.731 50.162  1.00 39.89 ? 503  ARG A CZ    1 
ATOM   3890  N  NH1   . ARG A 1 503 ? 28.501  141.854 50.707  1.00 38.41 ? 503  ARG A NH1   1 
ATOM   3891  N  NH2   . ARG A 1 503 ? 26.588  142.819 49.850  1.00 39.88 ? 503  ARG A NH2   1 
ATOM   3892  N  N     . ARG A 1 504 ? 29.049  136.098 46.881  1.00 23.63 ? 504  ARG A N     1 
ATOM   3893  C  CA    . ARG A 1 504 ? 28.423  135.968 45.576  1.00 23.68 ? 504  ARG A CA    1 
ATOM   3894  C  C     . ARG A 1 504 ? 26.924  135.860 45.844  1.00 21.95 ? 504  ARG A C     1 
ATOM   3895  O  O     . ARG A 1 504 ? 26.501  135.029 46.647  1.00 20.64 ? 504  ARG A O     1 
ATOM   3896  C  CB    . ARG A 1 504 ? 28.952  134.716 44.875  1.00 22.76 ? 504  ARG A CB    1 
ATOM   3897  C  CG    . ARG A 1 504 ? 28.556  134.572 43.415  1.00 22.61 ? 504  ARG A CG    1 
ATOM   3898  C  CD    . ARG A 1 504 ? 29.380  133.464 42.777  1.00 24.88 ? 504  ARG A CD    1 
ATOM   3899  N  NE    . ARG A 1 504 ? 29.261  132.226 43.540  1.00 24.49 ? 504  ARG A NE    1 
ATOM   3900  C  CZ    . ARG A 1 504 ? 30.258  131.378 43.765  1.00 24.50 ? 504  ARG A CZ    1 
ATOM   3901  N  NH1   . ARG A 1 504 ? 31.472  131.624 43.285  1.00 23.34 ? 504  ARG A NH1   1 
ATOM   3902  N  NH2   . ARG A 1 504 ? 30.037  130.284 44.482  1.00 24.46 ? 504  ARG A NH2   1 
ATOM   3903  N  N     . ASP A 1 505 ? 26.128  136.704 45.187  1.00 21.55 ? 505  ASP A N     1 
ATOM   3904  C  CA    . ASP A 1 505 ? 24.683  136.691 45.397  1.00 21.39 ? 505  ASP A CA    1 
ATOM   3905  C  C     . ASP A 1 505 ? 23.937  135.687 44.521  1.00 21.39 ? 505  ASP A C     1 
ATOM   3906  O  O     . ASP A 1 505 ? 24.548  134.972 43.725  1.00 19.79 ? 505  ASP A O     1 
ATOM   3907  C  CB    . ASP A 1 505 ? 24.091  138.102 45.206  1.00 20.23 ? 505  ASP A CB    1 
ATOM   3908  C  CG    . ASP A 1 505 ? 24.219  138.619 43.780  1.00 20.23 ? 505  ASP A CG    1 
ATOM   3909  O  OD1   . ASP A 1 505 ? 24.174  137.809 42.833  1.00 17.60 ? 505  ASP A OD1   1 
ATOM   3910  O  OD2   . ASP A 1 505 ? 24.343  139.846 43.601  1.00 23.04 ? 505  ASP A OD2   1 
ATOM   3911  N  N     . GLU A 1 506 ? 22.613  135.643 44.681  1.00 22.16 ? 506  GLU A N     1 
ATOM   3912  C  CA    . GLU A 1 506 ? 21.745  134.729 43.938  1.00 22.16 ? 506  GLU A CA    1 
ATOM   3913  C  C     . GLU A 1 506 ? 21.908  134.815 42.420  1.00 22.16 ? 506  GLU A C     1 
ATOM   3914  O  O     . GLU A 1 506 ? 21.542  133.882 41.702  1.00 22.58 ? 506  GLU A O     1 
ATOM   3915  C  CB    . GLU A 1 506 ? 20.276  134.970 44.321  1.00 20.42 ? 506  GLU A CB    1 
ATOM   3916  N  N     . ASP A 1 507 ? 22.461  135.923 41.929  1.00 21.82 ? 507  ASP A N     1 
ATOM   3917  C  CA    . ASP A 1 507 ? 22.657  136.098 40.491  1.00 22.83 ? 507  ASP A CA    1 
ATOM   3918  C  C     . ASP A 1 507 ? 24.072  135.793 40.013  1.00 21.66 ? 507  ASP A C     1 
ATOM   3919  O  O     . ASP A 1 507 ? 24.344  135.811 38.814  1.00 24.46 ? 507  ASP A O     1 
ATOM   3920  C  CB    . ASP A 1 507 ? 22.284  137.521 40.070  1.00 23.69 ? 507  ASP A CB    1 
ATOM   3921  C  CG    . ASP A 1 507 ? 20.808  137.802 40.237  1.00 26.68 ? 507  ASP A CG    1 
ATOM   3922  O  OD1   . ASP A 1 507 ? 20.000  136.913 39.879  1.00 24.51 ? 507  ASP A OD1   1 
ATOM   3923  O  OD2   . ASP A 1 507 ? 20.461  138.908 40.714  1.00 27.26 ? 507  ASP A OD2   1 
ATOM   3924  N  N     . GLY A 1 508 ? 24.975  135.510 40.942  1.00 21.37 ? 508  GLY A N     1 
ATOM   3925  C  CA    . GLY A 1 508 ? 26.337  135.217 40.543  1.00 19.94 ? 508  GLY A CA    1 
ATOM   3926  C  C     . GLY A 1 508 ? 27.232  136.442 40.559  1.00 19.79 ? 508  GLY A C     1 
ATOM   3927  O  O     . GLY A 1 508 ? 28.391  136.351 40.163  1.00 19.96 ? 508  GLY A O     1 
ATOM   3928  N  N     . TYR A 1 509 ? 26.696  137.579 41.013  1.00 18.53 ? 509  TYR A N     1 
ATOM   3929  C  CA    . TYR A 1 509 ? 27.443  138.841 41.109  1.00 18.15 ? 509  TYR A CA    1 
ATOM   3930  C  C     . TYR A 1 509 ? 28.367  138.840 42.332  1.00 17.82 ? 509  TYR A C     1 
ATOM   3931  O  O     . TYR A 1 509 ? 27.974  138.401 43.412  1.00 18.73 ? 509  TYR A O     1 
ATOM   3932  C  CB    . TYR A 1 509 ? 26.476  140.028 41.232  1.00 16.34 ? 509  TYR A CB    1 
ATOM   3933  C  CG    . TYR A 1 509 ? 25.883  140.529 39.930  1.00 18.48 ? 509  TYR A CG    1 
ATOM   3934  C  CD1   . TYR A 1 509 ? 25.397  139.643 38.966  1.00 19.98 ? 509  TYR A CD1   1 
ATOM   3935  C  CD2   . TYR A 1 509 ? 25.766  141.897 39.685  1.00 17.70 ? 509  TYR A CD2   1 
ATOM   3936  C  CE1   . TYR A 1 509 ? 24.806  140.111 37.792  1.00 19.24 ? 509  TYR A CE1   1 
ATOM   3937  C  CE2   . TYR A 1 509 ? 25.180  142.373 38.524  1.00 17.68 ? 509  TYR A CE2   1 
ATOM   3938  C  CZ    . TYR A 1 509 ? 24.701  141.479 37.579  1.00 19.86 ? 509  TYR A CZ    1 
ATOM   3939  O  OH    . TYR A 1 509 ? 24.124  141.961 36.423  1.00 18.64 ? 509  TYR A OH    1 
ATOM   3940  N  N     . TYR A 1 510 ? 29.583  139.347 42.169  1.00 16.27 ? 510  TYR A N     1 
ATOM   3941  C  CA    . TYR A 1 510 ? 30.527  139.383 43.277  1.00 17.16 ? 510  TYR A CA    1 
ATOM   3942  C  C     . TYR A 1 510 ? 30.544  140.705 44.027  1.00 18.26 ? 510  TYR A C     1 
ATOM   3943  O  O     . TYR A 1 510 ? 30.441  141.780 43.432  1.00 20.07 ? 510  TYR A O     1 
ATOM   3944  C  CB    . TYR A 1 510 ? 31.947  139.066 42.797  1.00 17.09 ? 510  TYR A CB    1 
ATOM   3945  C  CG    . TYR A 1 510 ? 32.158  137.615 42.435  1.00 16.10 ? 510  TYR A CG    1 
ATOM   3946  C  CD1   . TYR A 1 510 ? 31.722  137.101 41.213  1.00 16.13 ? 510  TYR A CD1   1 
ATOM   3947  C  CD2   . TYR A 1 510 ? 32.786  136.749 43.323  1.00 16.73 ? 510  TYR A CD2   1 
ATOM   3948  C  CE1   . TYR A 1 510 ? 31.913  135.755 40.891  1.00 16.42 ? 510  TYR A CE1   1 
ATOM   3949  C  CE2   . TYR A 1 510 ? 32.980  135.410 43.012  1.00 16.64 ? 510  TYR A CE2   1 
ATOM   3950  C  CZ    . TYR A 1 510 ? 32.545  134.919 41.800  1.00 16.40 ? 510  TYR A CZ    1 
ATOM   3951  O  OH    . TYR A 1 510 ? 32.750  133.590 41.500  1.00 18.96 ? 510  TYR A OH    1 
ATOM   3952  N  N     . TRP A 1 511 ? 30.660  140.604 45.346  1.00 18.86 ? 511  TRP A N     1 
ATOM   3953  C  CA    . TRP A 1 511 ? 30.721  141.767 46.223  1.00 18.84 ? 511  TRP A CA    1 
ATOM   3954  C  C     . TRP A 1 511 ? 31.985  141.598 47.054  1.00 20.24 ? 511  TRP A C     1 
ATOM   3955  O  O     . TRP A 1 511 ? 32.048  140.745 47.943  1.00 20.44 ? 511  TRP A O     1 
ATOM   3956  C  CB    . TRP A 1 511 ? 29.510  141.820 47.160  1.00 16.04 ? 511  TRP A CB    1 
ATOM   3957  C  CG    . TRP A 1 511 ? 28.188  141.819 46.456  1.00 14.76 ? 511  TRP A CG    1 
ATOM   3958  C  CD1   . TRP A 1 511 ? 27.604  140.771 45.803  1.00 12.31 ? 511  TRP A CD1   1 
ATOM   3959  C  CD2   . TRP A 1 511 ? 27.294  142.934 46.305  1.00 13.79 ? 511  TRP A CD2   1 
ATOM   3960  N  NE1   . TRP A 1 511 ? 26.404  141.162 45.254  1.00 13.39 ? 511  TRP A NE1   1 
ATOM   3961  C  CE2   . TRP A 1 511 ? 26.190  142.483 45.547  1.00 13.04 ? 511  TRP A CE2   1 
ATOM   3962  C  CE3   . TRP A 1 511 ? 27.321  144.268 46.734  1.00 11.32 ? 511  TRP A CE3   1 
ATOM   3963  C  CZ2   . TRP A 1 511 ? 25.123  143.319 45.211  1.00 11.83 ? 511  TRP A CZ2   1 
ATOM   3964  C  CZ3   . TRP A 1 511 ? 26.258  145.102 46.399  1.00 10.82 ? 511  TRP A CZ3   1 
ATOM   3965  C  CH2   . TRP A 1 511 ? 25.173  144.623 45.644  1.00 12.31 ? 511  TRP A CH2   1 
ATOM   3966  N  N     . ILE A 1 512 ? 32.997  142.398 46.752  1.00 21.28 ? 512  ILE A N     1 
ATOM   3967  C  CA    . ILE A 1 512 ? 34.248  142.323 47.485  1.00 22.42 ? 512  ILE A CA    1 
ATOM   3968  C  C     . ILE A 1 512 ? 34.101  143.072 48.802  1.00 22.91 ? 512  ILE A C     1 
ATOM   3969  O  O     . ILE A 1 512 ? 33.864  144.277 48.811  1.00 23.47 ? 512  ILE A O     1 
ATOM   3970  C  CB    . ILE A 1 512 ? 35.406  142.936 46.671  1.00 23.24 ? 512  ILE A CB    1 
ATOM   3971  C  CG1   . ILE A 1 512 ? 35.677  142.082 45.427  1.00 22.80 ? 512  ILE A CG1   1 
ATOM   3972  C  CG2   . ILE A 1 512 ? 36.663  143.023 47.529  1.00 22.28 ? 512  ILE A CG2   1 
ATOM   3973  C  CD1   . ILE A 1 512 ? 34.575  142.114 44.407  1.00 24.34 ? 512  ILE A CD1   1 
ATOM   3974  N  N     . THR A 1 513 ? 34.228  142.355 49.912  1.00 21.94 ? 513  THR A N     1 
ATOM   3975  C  CA    . THR A 1 513 ? 34.111  142.982 51.216  1.00 23.50 ? 513  THR A CA    1 
ATOM   3976  C  C     . THR A 1 513 ? 35.416  143.629 51.696  1.00 23.63 ? 513  THR A C     1 
ATOM   3977  O  O     . THR A 1 513 ? 35.381  144.559 52.493  1.00 25.79 ? 513  THR A O     1 
ATOM   3978  C  CB    . THR A 1 513 ? 33.588  141.972 52.277  1.00 23.43 ? 513  THR A CB    1 
ATOM   3979  O  OG1   . THR A 1 513 ? 34.103  140.660 52.003  1.00 22.33 ? 513  THR A OG1   1 
ATOM   3980  C  CG2   . THR A 1 513 ? 32.061  141.929 52.258  1.00 24.15 ? 513  THR A CG2   1 
ATOM   3981  N  N     . GLY A 1 514 ? 36.559  143.156 51.207  1.00 23.26 ? 514  GLY A N     1 
ATOM   3982  C  CA    . GLY A 1 514 ? 37.825  143.742 51.616  1.00 21.70 ? 514  GLY A CA    1 
ATOM   3983  C  C     . GLY A 1 514 ? 38.901  142.729 51.960  1.00 21.21 ? 514  GLY A C     1 
ATOM   3984  O  O     . GLY A 1 514 ? 38.642  141.524 51.940  1.00 21.46 ? 514  GLY A O     1 
ATOM   3985  N  N     . ARG A 1 515 ? 40.106  143.210 52.277  1.00 18.57 ? 515  ARG A N     1 
ATOM   3986  C  CA    . ARG A 1 515 ? 41.222  142.323 52.616  1.00 19.66 ? 515  ARG A CA    1 
ATOM   3987  C  C     . ARG A 1 515 ? 40.890  141.423 53.807  1.00 20.23 ? 515  ARG A C     1 
ATOM   3988  O  O     . ARG A 1 515 ? 40.272  141.866 54.778  1.00 19.15 ? 515  ARG A O     1 
ATOM   3989  C  CB    . ARG A 1 515 ? 42.485  143.130 52.949  1.00 18.72 ? 515  ARG A CB    1 
ATOM   3990  C  CG    . ARG A 1 515 ? 42.991  144.060 51.849  1.00 16.96 ? 515  ARG A CG    1 
ATOM   3991  C  CD    . ARG A 1 515 ? 43.427  143.332 50.582  1.00 14.99 ? 515  ARG A CD    1 
ATOM   3992  N  NE    . ARG A 1 515 ? 44.489  142.353 50.809  1.00 14.22 ? 515  ARG A NE    1 
ATOM   3993  C  CZ    . ARG A 1 515 ? 45.402  142.022 49.898  1.00 15.92 ? 515  ARG A CZ    1 
ATOM   3994  N  NH1   . ARG A 1 515 ? 45.393  142.597 48.701  1.00 16.43 ? 515  ARG A NH1   1 
ATOM   3995  N  NH2   . ARG A 1 515 ? 46.316  141.100 50.169  1.00 18.29 ? 515  ARG A NH2   1 
ATOM   3996  N  N     . VAL A 1 516 ? 41.293  140.159 53.721  1.00 20.32 ? 516  VAL A N     1 
ATOM   3997  C  CA    . VAL A 1 516 ? 41.057  139.212 54.803  1.00 21.56 ? 516  VAL A CA    1 
ATOM   3998  C  C     . VAL A 1 516 ? 42.356  138.963 55.551  1.00 21.94 ? 516  VAL A C     1 
ATOM   3999  O  O     . VAL A 1 516 ? 42.362  138.316 56.596  1.00 23.26 ? 516  VAL A O     1 
ATOM   4000  C  CB    . VAL A 1 516 ? 40.486  137.869 54.286  1.00 21.90 ? 516  VAL A CB    1 
ATOM   4001  C  CG1   . VAL A 1 516 ? 39.061  138.076 53.797  1.00 22.71 ? 516  VAL A CG1   1 
ATOM   4002  C  CG2   . VAL A 1 516 ? 41.353  137.323 53.166  1.00 22.68 ? 516  VAL A CG2   1 
ATOM   4003  N  N     . ASP A 1 517 ? 43.457  139.468 54.999  1.00 22.70 ? 517  ASP A N     1 
ATOM   4004  C  CA    . ASP A 1 517 ? 44.757  139.351 55.643  1.00 23.56 ? 517  ASP A CA    1 
ATOM   4005  C  C     . ASP A 1 517 ? 44.964  140.669 56.377  1.00 24.29 ? 517  ASP A C     1 
ATOM   4006  O  O     . ASP A 1 517 ? 44.006  141.413 56.567  1.00 25.49 ? 517  ASP A O     1 
ATOM   4007  C  CB    . ASP A 1 517 ? 45.872  139.092 54.613  1.00 22.20 ? 517  ASP A CB    1 
ATOM   4008  C  CG    . ASP A 1 517 ? 45.860  140.074 53.449  1.00 24.17 ? 517  ASP A CG    1 
ATOM   4009  O  OD1   . ASP A 1 517 ? 46.609  139.833 52.473  1.00 22.65 ? 517  ASP A OD1   1 
ATOM   4010  O  OD2   . ASP A 1 517 ? 45.125  141.082 53.498  1.00 24.48 ? 517  ASP A OD2   1 
ATOM   4011  N  N     . ASP A 1 518 ? 46.184  140.972 56.799  1.00 26.40 ? 518  ASP A N     1 
ATOM   4012  C  CA    . ASP A 1 518 ? 46.411  142.221 57.520  1.00 26.42 ? 518  ASP A CA    1 
ATOM   4013  C  C     . ASP A 1 518 ? 46.874  143.372 56.652  1.00 25.71 ? 518  ASP A C     1 
ATOM   4014  O  O     . ASP A 1 518 ? 47.883  144.011 56.934  1.00 28.35 ? 518  ASP A O     1 
ATOM   4015  C  CB    . ASP A 1 518 ? 47.403  142.004 58.656  1.00 28.62 ? 518  ASP A CB    1 
ATOM   4016  C  CG    . ASP A 1 518 ? 46.846  141.103 59.736  1.00 31.23 ? 518  ASP A CG    1 
ATOM   4017  O  OD1   . ASP A 1 518 ? 45.674  141.306 60.126  1.00 31.48 ? 518  ASP A OD1   1 
ATOM   4018  O  OD2   . ASP A 1 518 ? 47.578  140.202 60.196  1.00 34.16 ? 518  ASP A OD2   1 
ATOM   4019  N  N     . VAL A 1 519 ? 46.120  143.638 55.597  1.00 23.61 ? 519  VAL A N     1 
ATOM   4020  C  CA    . VAL A 1 519 ? 46.434  144.723 54.688  1.00 20.76 ? 519  VAL A CA    1 
ATOM   4021  C  C     . VAL A 1 519 ? 45.344  145.760 54.893  1.00 20.11 ? 519  VAL A C     1 
ATOM   4022  O  O     . VAL A 1 519 ? 44.158  145.427 54.928  1.00 20.87 ? 519  VAL A O     1 
ATOM   4023  C  CB    . VAL A 1 519 ? 46.445  144.224 53.227  1.00 20.53 ? 519  VAL A CB    1 
ATOM   4024  C  CG1   . VAL A 1 519 ? 46.632  145.385 52.271  1.00 19.26 ? 519  VAL A CG1   1 
ATOM   4025  C  CG2   . VAL A 1 519 ? 47.555  143.215 53.049  1.00 17.61 ? 519  VAL A CG2   1 
ATOM   4026  N  N     . LEU A 1 520 ? 45.747  147.015 55.046  1.00 18.94 ? 520  LEU A N     1 
ATOM   4027  C  CA    . LEU A 1 520 ? 44.803  148.094 55.278  1.00 18.39 ? 520  LEU A CA    1 
ATOM   4028  C  C     . LEU A 1 520 ? 44.413  148.819 53.999  1.00 19.56 ? 520  LEU A C     1 
ATOM   4029  O  O     . LEU A 1 520 ? 45.075  148.686 52.972  1.00 19.20 ? 520  LEU A O     1 
ATOM   4030  C  CB    . LEU A 1 520 ? 45.404  149.097 56.262  1.00 17.40 ? 520  LEU A CB    1 
ATOM   4031  C  CG    . LEU A 1 520 ? 45.718  148.583 57.660  1.00 17.79 ? 520  LEU A CG    1 
ATOM   4032  C  CD1   . LEU A 1 520 ? 46.435  149.660 58.433  1.00 17.64 ? 520  LEU A CD1   1 
ATOM   4033  C  CD2   . LEU A 1 520 ? 44.427  148.183 58.367  1.00 18.20 ? 520  LEU A CD2   1 
ATOM   4034  N  N     . ASN A 1 521 ? 43.331  149.586 54.076  1.00 20.64 ? 521  ASN A N     1 
ATOM   4035  C  CA    . ASN A 1 521 ? 42.846  150.379 52.948  1.00 22.95 ? 521  ASN A CA    1 
ATOM   4036  C  C     . ASN A 1 521 ? 42.606  151.796 53.457  1.00 21.80 ? 521  ASN A C     1 
ATOM   4037  O  O     . ASN A 1 521 ? 41.518  152.130 53.932  1.00 20.35 ? 521  ASN A O     1 
ATOM   4038  C  CB    . ASN A 1 521 ? 41.546  149.812 52.402  1.00 26.43 ? 521  ASN A CB    1 
ATOM   4039  C  CG    . ASN A 1 521 ? 40.909  150.730 51.391  1.00 31.93 ? 521  ASN A CG    1 
ATOM   4040  O  OD1   . ASN A 1 521 ? 41.474  150.972 50.321  1.00 33.87 ? 521  ASN A OD1   1 
ATOM   4041  N  ND2   . ASN A 1 521 ? 39.731  151.265 51.727  1.00 33.55 ? 521  ASN A ND2   1 
ATOM   4042  N  N     . VAL A 1 522 ? 43.641  152.621 53.349  1.00 21.68 ? 522  VAL A N     1 
ATOM   4043  C  CA    . VAL A 1 522 ? 43.609  153.996 53.825  1.00 20.17 ? 522  VAL A CA    1 
ATOM   4044  C  C     . VAL A 1 522 ? 43.484  154.993 52.680  1.00 20.71 ? 522  VAL A C     1 
ATOM   4045  O  O     . VAL A 1 522 ? 44.450  155.256 51.961  1.00 19.84 ? 522  VAL A O     1 
ATOM   4046  C  CB    . VAL A 1 522 ? 44.891  154.298 54.628  1.00 19.96 ? 522  VAL A CB    1 
ATOM   4047  C  CG1   . VAL A 1 522 ? 44.860  155.717 55.170  1.00 22.13 ? 522  VAL A CG1   1 
ATOM   4048  C  CG2   . VAL A 1 522 ? 45.029  153.300 55.762  1.00 19.25 ? 522  VAL A CG2   1 
ATOM   4049  N  N     . SER A 1 523 ? 42.288  155.554 52.527  1.00 21.21 ? 523  SER A N     1 
ATOM   4050  C  CA    . SER A 1 523 ? 42.021  156.526 51.471  1.00 22.12 ? 523  SER A CA    1 
ATOM   4051  C  C     . SER A 1 523 ? 42.341  155.910 50.123  1.00 21.90 ? 523  SER A C     1 
ATOM   4052  O  O     . SER A 1 523 ? 42.963  156.546 49.275  1.00 23.64 ? 523  SER A O     1 
ATOM   4053  C  CB    . SER A 1 523 ? 42.872  157.781 51.666  1.00 22.87 ? 523  SER A CB    1 
ATOM   4054  O  OG    . SER A 1 523 ? 42.813  158.233 53.005  1.00 26.98 ? 523  SER A OG    1 
ATOM   4055  N  N     . GLY A 1 524 ? 41.924  154.666 49.926  1.00 21.37 ? 524  GLY A N     1 
ATOM   4056  C  CA    . GLY A 1 524 ? 42.194  154.004 48.665  1.00 21.72 ? 524  GLY A CA    1 
ATOM   4057  C  C     . GLY A 1 524 ? 43.642  153.570 48.497  1.00 21.30 ? 524  GLY A C     1 
ATOM   4058  O  O     . GLY A 1 524 ? 44.086  153.335 47.377  1.00 19.72 ? 524  GLY A O     1 
ATOM   4059  N  N     . HIS A 1 525 ? 44.384  153.470 49.598  1.00 20.38 ? 525  HIS A N     1 
ATOM   4060  C  CA    . HIS A 1 525 ? 45.778  153.043 49.532  1.00 22.63 ? 525  HIS A CA    1 
ATOM   4061  C  C     . HIS A 1 525 ? 46.015  151.736 50.279  1.00 19.98 ? 525  HIS A C     1 
ATOM   4062  O  O     . HIS A 1 525 ? 45.533  151.533 51.392  1.00 19.84 ? 525  HIS A O     1 
ATOM   4063  C  CB    . HIS A 1 525 ? 46.721  154.107 50.100  1.00 25.81 ? 525  HIS A CB    1 
ATOM   4064  C  CG    . HIS A 1 525 ? 46.661  155.421 49.389  1.00 31.63 ? 525  HIS A CG    1 
ATOM   4065  N  ND1   . HIS A 1 525 ? 46.021  156.523 49.914  1.00 33.77 ? 525  HIS A ND1   1 
ATOM   4066  C  CD2   . HIS A 1 525 ? 47.174  155.816 48.199  1.00 33.31 ? 525  HIS A CD2   1 
ATOM   4067  C  CE1   . HIS A 1 525 ? 46.144  157.541 49.079  1.00 35.32 ? 525  HIS A CE1   1 
ATOM   4068  N  NE2   . HIS A 1 525 ? 46.839  157.138 48.030  1.00 34.90 ? 525  HIS A NE2   1 
ATOM   4069  N  N     . ARG A 1 526 ? 46.784  150.863 49.649  1.00 18.65 ? 526  ARG A N     1 
ATOM   4070  C  CA    . ARG A 1 526 ? 47.123  149.563 50.193  1.00 18.06 ? 526  ARG A CA    1 
ATOM   4071  C  C     . ARG A 1 526 ? 48.367  149.679 51.084  1.00 18.13 ? 526  ARG A C     1 
ATOM   4072  O  O     . ARG A 1 526 ? 49.442  150.074 50.626  1.00 17.40 ? 526  ARG A O     1 
ATOM   4073  C  CB    . ARG A 1 526 ? 47.352  148.606 49.020  1.00 16.92 ? 526  ARG A CB    1 
ATOM   4074  C  CG    . ARG A 1 526 ? 47.826  147.213 49.374  1.00 17.58 ? 526  ARG A CG    1 
ATOM   4075  C  CD    . ARG A 1 526 ? 47.878  146.363 48.117  1.00 15.95 ? 526  ARG A CD    1 
ATOM   4076  N  NE    . ARG A 1 526 ? 48.547  145.084 48.341  1.00 15.38 ? 526  ARG A NE    1 
ATOM   4077  C  CZ    . ARG A 1 526 ? 48.621  144.122 47.430  1.00 13.09 ? 526  ARG A CZ    1 
ATOM   4078  N  NH1   . ARG A 1 526 ? 48.061  144.296 46.237  1.00 9.86  ? 526  ARG A NH1   1 
ATOM   4079  N  NH2   . ARG A 1 526 ? 49.271  143.000 47.705  1.00 12.10 ? 526  ARG A NH2   1 
ATOM   4080  N  N     . LEU A 1 527 ? 48.205  149.357 52.365  1.00 19.13 ? 527  LEU A N     1 
ATOM   4081  C  CA    . LEU A 1 527 ? 49.298  149.425 53.339  1.00 21.02 ? 527  LEU A CA    1 
ATOM   4082  C  C     . LEU A 1 527 ? 49.236  148.247 54.299  1.00 21.00 ? 527  LEU A C     1 
ATOM   4083  O  O     . LEU A 1 527 ? 48.173  147.920 54.819  1.00 23.51 ? 527  LEU A O     1 
ATOM   4084  C  CB    . LEU A 1 527 ? 49.224  150.727 54.146  1.00 22.69 ? 527  LEU A CB    1 
ATOM   4085  C  CG    . LEU A 1 527 ? 49.606  152.033 53.439  1.00 22.49 ? 527  LEU A CG    1 
ATOM   4086  C  CD1   . LEU A 1 527 ? 49.280  153.227 54.322  1.00 22.62 ? 527  LEU A CD1   1 
ATOM   4087  C  CD2   . LEU A 1 527 ? 51.085  152.000 53.109  1.00 22.22 ? 527  LEU A CD2   1 
ATOM   4088  N  N     . GLY A 1 528 ? 50.377  147.618 54.548  1.00 20.57 ? 528  GLY A N     1 
ATOM   4089  C  CA    . GLY A 1 528 ? 50.398  146.488 55.460  1.00 18.86 ? 528  GLY A CA    1 
ATOM   4090  C  C     . GLY A 1 528 ? 50.491  146.912 56.917  1.00 19.73 ? 528  GLY A C     1 
ATOM   4091  O  O     . GLY A 1 528 ? 51.156  147.889 57.250  1.00 19.59 ? 528  GLY A O     1 
ATOM   4092  N  N     . THR A 1 529 ? 49.808  146.187 57.793  1.00 20.53 ? 529  THR A N     1 
ATOM   4093  C  CA    . THR A 1 529 ? 49.854  146.508 59.214  1.00 20.33 ? 529  THR A CA    1 
ATOM   4094  C  C     . THR A 1 529 ? 51.275  146.249 59.711  1.00 18.20 ? 529  THR A C     1 
ATOM   4095  O  O     . THR A 1 529 ? 51.859  147.072 60.421  1.00 17.05 ? 529  THR A O     1 
ATOM   4096  C  CB    . THR A 1 529 ? 48.863  145.636 60.026  1.00 21.41 ? 529  THR A CB    1 
ATOM   4097  O  OG1   . THR A 1 529 ? 49.220  144.253 59.897  1.00 23.61 ? 529  THR A OG1   1 
ATOM   4098  C  CG2   . THR A 1 529 ? 47.445  145.828 59.517  1.00 24.03 ? 529  THR A CG2   1 
ATOM   4099  N  N     . ALA A 1 530 ? 51.833  145.111 59.305  1.00 16.72 ? 530  ALA A N     1 
ATOM   4100  C  CA    . ALA A 1 530 ? 53.178  144.730 59.714  1.00 16.81 ? 530  ALA A CA    1 
ATOM   4101  C  C     . ALA A 1 530 ? 54.215  145.810 59.435  1.00 16.78 ? 530  ALA A C     1 
ATOM   4102  O  O     . ALA A 1 530 ? 55.008  146.154 60.311  1.00 17.00 ? 530  ALA A O     1 
ATOM   4103  C  CB    . ALA A 1 530 ? 53.589  143.424 59.031  1.00 14.23 ? 530  ALA A CB    1 
ATOM   4104  N  N     . GLU A 1 531 ? 54.211  146.358 58.226  1.00 17.40 ? 531  GLU A N     1 
ATOM   4105  C  CA    . GLU A 1 531 ? 55.201  147.371 57.890  1.00 18.56 ? 531  GLU A CA    1 
ATOM   4106  C  C     . GLU A 1 531 ? 55.043  148.634 58.730  1.00 18.69 ? 531  GLU A C     1 
ATOM   4107  O  O     . GLU A 1 531 ? 56.026  149.310 59.029  1.00 20.54 ? 531  GLU A O     1 
ATOM   4108  C  CB    . GLU A 1 531 ? 55.142  147.718 56.398  1.00 19.93 ? 531  GLU A CB    1 
ATOM   4109  C  CG    . GLU A 1 531 ? 53.963  148.567 55.987  1.00 22.76 ? 531  GLU A CG    1 
ATOM   4110  C  CD    . GLU A 1 531 ? 54.067  149.026 54.549  1.00 25.83 ? 531  GLU A CD    1 
ATOM   4111  O  OE1   . GLU A 1 531 ? 55.010  149.781 54.227  1.00 28.16 ? 531  GLU A OE1   1 
ATOM   4112  O  OE2   . GLU A 1 531 ? 53.208  148.628 53.739  1.00 26.89 ? 531  GLU A OE2   1 
ATOM   4113  N  N     . ILE A 1 532 ? 53.816  148.963 59.111  1.00 17.60 ? 532  ILE A N     1 
ATOM   4114  C  CA    . ILE A 1 532 ? 53.608  150.143 59.934  1.00 18.24 ? 532  ILE A CA    1 
ATOM   4115  C  C     . ILE A 1 532 ? 54.146  149.870 61.347  1.00 18.28 ? 532  ILE A C     1 
ATOM   4116  O  O     . ILE A 1 532 ? 54.707  150.759 61.989  1.00 18.65 ? 532  ILE A O     1 
ATOM   4117  C  CB    . ILE A 1 532 ? 52.118  150.514 60.013  1.00 17.97 ? 532  ILE A CB    1 
ATOM   4118  C  CG1   . ILE A 1 532 ? 51.560  150.689 58.601  1.00 19.82 ? 532  ILE A CG1   1 
ATOM   4119  C  CG2   . ILE A 1 532 ? 51.946  151.802 60.813  1.00 16.05 ? 532  ILE A CG2   1 
ATOM   4120  C  CD1   . ILE A 1 532 ? 50.084  151.036 58.555  1.00 20.17 ? 532  ILE A CD1   1 
ATOM   4121  N  N     . GLU A 1 533 ? 53.997  148.632 61.815  1.00 17.98 ? 533  GLU A N     1 
ATOM   4122  C  CA    . GLU A 1 533 ? 54.462  148.259 63.144  1.00 16.48 ? 533  GLU A CA    1 
ATOM   4123  C  C     . GLU A 1 533 ? 55.983  148.237 63.228  1.00 16.87 ? 533  GLU A C     1 
ATOM   4124  O  O     . GLU A 1 533 ? 56.559  148.677 64.218  1.00 17.59 ? 533  GLU A O     1 
ATOM   4125  C  CB    . GLU A 1 533 ? 53.871  146.905 63.537  1.00 15.55 ? 533  GLU A CB    1 
ATOM   4126  C  CG    . GLU A 1 533 ? 52.357  146.938 63.588  1.00 15.57 ? 533  GLU A CG    1 
ATOM   4127  C  CD    . GLU A 1 533 ? 51.725  145.560 63.708  1.00 17.09 ? 533  GLU A CD    1 
ATOM   4128  O  OE1   . GLU A 1 533 ? 52.390  144.566 63.333  1.00 17.13 ? 533  GLU A OE1   1 
ATOM   4129  O  OE2   . GLU A 1 533 ? 50.557  145.484 64.158  1.00 12.34 ? 533  GLU A OE2   1 
ATOM   4130  N  N     . SER A 1 534 ? 56.638  147.745 62.187  1.00 16.98 ? 534  SER A N     1 
ATOM   4131  C  CA    . SER A 1 534 ? 58.094  147.705 62.174  1.00 17.92 ? 534  SER A CA    1 
ATOM   4132  C  C     . SER A 1 534 ? 58.631  149.130 62.249  1.00 16.72 ? 534  SER A C     1 
ATOM   4133  O  O     . SER A 1 534 ? 59.540  149.422 63.024  1.00 17.42 ? 534  SER A O     1 
ATOM   4134  C  CB    . SER A 1 534 ? 58.598  147.036 60.896  1.00 17.44 ? 534  SER A CB    1 
ATOM   4135  O  OG    . SER A 1 534 ? 57.976  145.781 60.721  1.00 25.04 ? 534  SER A OG    1 
ATOM   4136  N  N     . ALA A 1 535 ? 58.062  150.010 61.430  1.00 15.98 ? 535  ALA A N     1 
ATOM   4137  C  CA    . ALA A 1 535 ? 58.462  151.412 61.389  1.00 16.18 ? 535  ALA A CA    1 
ATOM   4138  C  C     . ALA A 1 535 ? 58.356  152.045 62.777  1.00 17.15 ? 535  ALA A C     1 
ATOM   4139  O  O     . ALA A 1 535 ? 59.252  152.778 63.204  1.00 17.46 ? 535  ALA A O     1 
ATOM   4140  C  CB    . ALA A 1 535 ? 57.589  152.172 60.403  1.00 14.80 ? 535  ALA A CB    1 
ATOM   4141  N  N     . LEU A 1 536 ? 57.256  151.758 63.470  1.00 17.81 ? 536  LEU A N     1 
ATOM   4142  C  CA    . LEU A 1 536 ? 57.028  152.282 64.811  1.00 18.28 ? 536  LEU A CA    1 
ATOM   4143  C  C     . LEU A 1 536 ? 58.043  151.727 65.807  1.00 19.06 ? 536  LEU A C     1 
ATOM   4144  O  O     . LEU A 1 536 ? 58.680  152.484 66.543  1.00 20.46 ? 536  LEU A O     1 
ATOM   4145  C  CB    . LEU A 1 536 ? 55.606  151.941 65.273  1.00 18.03 ? 536  LEU A CB    1 
ATOM   4146  C  CG    . LEU A 1 536 ? 54.475  152.822 64.716  1.00 18.85 ? 536  LEU A CG    1 
ATOM   4147  C  CD1   . LEU A 1 536 ? 53.122  152.112 64.841  1.00 16.00 ? 536  LEU A CD1   1 
ATOM   4148  C  CD2   . LEU A 1 536 ? 54.460  154.137 65.475  1.00 15.94 ? 536  LEU A CD2   1 
ATOM   4149  N  N     . VAL A 1 537 ? 58.198  150.405 65.822  1.00 19.21 ? 537  VAL A N     1 
ATOM   4150  C  CA    . VAL A 1 537 ? 59.135  149.748 66.734  1.00 17.63 ? 537  VAL A CA    1 
ATOM   4151  C  C     . VAL A 1 537 ? 60.588  150.166 66.478  1.00 18.22 ? 537  VAL A C     1 
ATOM   4152  O  O     . VAL A 1 537 ? 61.446  150.022 67.347  1.00 17.79 ? 537  VAL A O     1 
ATOM   4153  C  CB    . VAL A 1 537 ? 59.020  148.208 66.620  1.00 17.92 ? 537  VAL A CB    1 
ATOM   4154  C  CG1   . VAL A 1 537 ? 60.103  147.529 67.454  1.00 17.92 ? 537  VAL A CG1   1 
ATOM   4155  C  CG2   . VAL A 1 537 ? 57.647  147.762 67.098  1.00 17.56 ? 537  VAL A CG2   1 
ATOM   4156  N  N     . ALA A 1 538 ? 60.859  150.690 65.286  1.00 17.36 ? 538  ALA A N     1 
ATOM   4157  C  CA    . ALA A 1 538 ? 62.205  151.115 64.948  1.00 18.24 ? 538  ALA A CA    1 
ATOM   4158  C  C     . ALA A 1 538 ? 62.573  152.371 65.735  1.00 19.54 ? 538  ALA A C     1 
ATOM   4159  O  O     . ALA A 1 538 ? 63.747  152.736 65.828  1.00 19.52 ? 538  ALA A O     1 
ATOM   4160  C  CB    . ALA A 1 538 ? 62.319  151.372 63.447  1.00 18.14 ? 538  ALA A CB    1 
ATOM   4161  N  N     . HIS A 1 539 ? 61.569  153.033 66.301  1.00 19.79 ? 539  HIS A N     1 
ATOM   4162  C  CA    . HIS A 1 539 ? 61.822  154.232 67.085  1.00 20.18 ? 539  HIS A CA    1 
ATOM   4163  C  C     . HIS A 1 539 ? 62.512  153.822 68.388  1.00 21.11 ? 539  HIS A C     1 
ATOM   4164  O  O     . HIS A 1 539 ? 62.091  152.882 69.057  1.00 20.43 ? 539  HIS A O     1 
ATOM   4165  C  CB    . HIS A 1 539 ? 60.512  154.961 67.378  1.00 21.46 ? 539  HIS A CB    1 
ATOM   4166  C  CG    . HIS A 1 539 ? 60.702  156.321 67.973  1.00 23.16 ? 539  HIS A CG    1 
ATOM   4167  N  ND1   . HIS A 1 539 ? 61.099  156.516 69.278  1.00 23.19 ? 539  HIS A ND1   1 
ATOM   4168  C  CD2   . HIS A 1 539 ? 60.583  157.555 67.428  1.00 21.82 ? 539  HIS A CD2   1 
ATOM   4169  C  CE1   . HIS A 1 539 ? 61.217  157.811 69.512  1.00 22.44 ? 539  HIS A CE1   1 
ATOM   4170  N  NE2   . HIS A 1 539 ? 60.910  158.463 68.405  1.00 20.82 ? 539  HIS A NE2   1 
ATOM   4171  N  N     . PRO A 1 540 ? 63.587  154.536 68.760  1.00 22.30 ? 540  PRO A N     1 
ATOM   4172  C  CA    . PRO A 1 540 ? 64.385  154.288 69.970  1.00 22.42 ? 540  PRO A CA    1 
ATOM   4173  C  C     . PRO A 1 540 ? 63.591  154.195 71.273  1.00 22.52 ? 540  PRO A C     1 
ATOM   4174  O  O     . PRO A 1 540 ? 64.060  153.611 72.254  1.00 23.15 ? 540  PRO A O     1 
ATOM   4175  C  CB    . PRO A 1 540 ? 65.360  155.467 69.989  1.00 23.51 ? 540  PRO A CB    1 
ATOM   4176  C  CG    . PRO A 1 540 ? 65.503  155.819 68.544  1.00 22.74 ? 540  PRO A CG    1 
ATOM   4177  C  CD    . PRO A 1 540 ? 64.078  155.733 68.057  1.00 21.52 ? 540  PRO A CD    1 
ATOM   4178  N  N     . LYS A 1 541 ? 62.395  154.772 71.285  1.00 21.52 ? 541  LYS A N     1 
ATOM   4179  C  CA    . LYS A 1 541 ? 61.575  154.759 72.487  1.00 20.58 ? 541  LYS A CA    1 
ATOM   4180  C  C     . LYS A 1 541 ? 60.413  153.778 72.436  1.00 19.28 ? 541  LYS A C     1 
ATOM   4181  O  O     . LYS A 1 541 ? 59.721  153.568 73.426  1.00 18.82 ? 541  LYS A O     1 
ATOM   4182  C  CB    . LYS A 1 541 ? 61.060  156.170 72.766  1.00 21.54 ? 541  LYS A CB    1 
ATOM   4183  C  CG    . LYS A 1 541 ? 62.168  157.137 73.136  1.00 20.92 ? 541  LYS A CG    1 
ATOM   4184  C  CD    . LYS A 1 541 ? 61.627  158.512 73.455  1.00 22.64 ? 541  LYS A CD    1 
ATOM   4185  C  CE    . LYS A 1 541 ? 62.731  159.427 73.959  1.00 24.96 ? 541  LYS A CE    1 
ATOM   4186  N  NZ    . LYS A 1 541 ? 63.876  159.493 73.000  1.00 28.20 ? 541  LYS A NZ    1 
ATOM   4187  N  N     . ILE A 1 542 ? 60.209  153.170 71.278  1.00 19.59 ? 542  ILE A N     1 
ATOM   4188  C  CA    . ILE A 1 542 ? 59.122  152.222 71.121  1.00 20.39 ? 542  ILE A CA    1 
ATOM   4189  C  C     . ILE A 1 542 ? 59.599  150.779 71.254  1.00 20.05 ? 542  ILE A C     1 
ATOM   4190  O  O     . ILE A 1 542 ? 60.509  150.341 70.549  1.00 19.92 ? 542  ILE A O     1 
ATOM   4191  C  CB    . ILE A 1 542 ? 58.418  152.426 69.766  1.00 19.52 ? 542  ILE A CB    1 
ATOM   4192  C  CG1   . ILE A 1 542 ? 57.746  153.803 69.757  1.00 19.22 ? 542  ILE A CG1   1 
ATOM   4193  C  CG2   . ILE A 1 542 ? 57.421  151.292 69.519  1.00 14.50 ? 542  ILE A CG2   1 
ATOM   4194  C  CD1   . ILE A 1 542 ? 56.921  154.101 68.518  1.00 20.90 ? 542  ILE A CD1   1 
ATOM   4195  N  N     . ALA A 1 543 ? 58.981  150.038 72.163  1.00 21.64 ? 543  ALA A N     1 
ATOM   4196  C  CA    . ALA A 1 543 ? 59.356  148.650 72.384  1.00 23.09 ? 543  ALA A CA    1 
ATOM   4197  C  C     . ALA A 1 543 ? 58.541  147.719 71.504  1.00 24.06 ? 543  ALA A C     1 
ATOM   4198  O  O     . ALA A 1 543 ? 59.071  146.786 70.907  1.00 24.72 ? 543  ALA A O     1 
ATOM   4199  C  CB    . ALA A 1 543 ? 59.150  148.280 73.845  1.00 22.05 ? 543  ALA A CB    1 
ATOM   4200  N  N     . GLU A 1 544 ? 57.246  147.983 71.411  1.00 24.76 ? 544  GLU A N     1 
ATOM   4201  C  CA    . GLU A 1 544 ? 56.379  147.125 70.629  1.00 25.16 ? 544  GLU A CA    1 
ATOM   4202  C  C     . GLU A 1 544 ? 55.124  147.879 70.157  1.00 25.08 ? 544  GLU A C     1 
ATOM   4203  O  O     . GLU A 1 544 ? 54.694  148.856 70.785  1.00 25.19 ? 544  GLU A O     1 
ATOM   4204  C  CB    . GLU A 1 544 ? 56.025  145.922 71.502  1.00 25.72 ? 544  GLU A CB    1 
ATOM   4205  C  CG    . GLU A 1 544 ? 55.096  144.908 70.901  1.00 30.52 ? 544  GLU A CG    1 
ATOM   4206  C  CD    . GLU A 1 544 ? 54.864  143.731 71.842  1.00 32.40 ? 544  GLU A CD    1 
ATOM   4207  O  OE1   . GLU A 1 544 ? 54.701  143.968 73.065  1.00 31.63 ? 544  GLU A OE1   1 
ATOM   4208  O  OE2   . GLU A 1 544 ? 54.838  142.577 71.354  1.00 32.82 ? 544  GLU A OE2   1 
ATOM   4209  N  N     . ALA A 1 545 ? 54.546  147.421 69.047  1.00 23.38 ? 545  ALA A N     1 
ATOM   4210  C  CA    . ALA A 1 545 ? 53.360  148.061 68.488  1.00 20.98 ? 545  ALA A CA    1 
ATOM   4211  C  C     . ALA A 1 545 ? 52.419  147.083 67.803  1.00 21.17 ? 545  ALA A C     1 
ATOM   4212  O  O     . ALA A 1 545 ? 52.831  146.008 67.362  1.00 19.78 ? 545  ALA A O     1 
ATOM   4213  C  CB    . ALA A 1 545 ? 53.775  149.142 67.504  1.00 19.61 ? 545  ALA A CB    1 
ATOM   4214  N  N     . ALA A 1 546 ? 51.149  147.475 67.720  1.00 19.66 ? 546  ALA A N     1 
ATOM   4215  C  CA    . ALA A 1 546 ? 50.105  146.683 67.081  1.00 20.04 ? 546  ALA A CA    1 
ATOM   4216  C  C     . ALA A 1 546 ? 49.191  147.652 66.330  1.00 19.97 ? 546  ALA A C     1 
ATOM   4217  O  O     . ALA A 1 546 ? 48.541  148.505 66.937  1.00 20.47 ? 546  ALA A O     1 
ATOM   4218  C  CB    . ALA A 1 546 ? 49.310  145.907 68.125  1.00 19.64 ? 546  ALA A CB    1 
ATOM   4219  N  N     . VAL A 1 547 ? 49.146  147.519 65.010  1.00 18.59 ? 547  VAL A N     1 
ATOM   4220  C  CA    . VAL A 1 547 ? 48.332  148.404 64.192  1.00 16.68 ? 547  VAL A CA    1 
ATOM   4221  C  C     . VAL A 1 547 ? 47.098  147.732 63.627  1.00 17.69 ? 547  VAL A C     1 
ATOM   4222  O  O     . VAL A 1 547 ? 47.147  146.583 63.182  1.00 17.78 ? 547  VAL A O     1 
ATOM   4223  C  CB    . VAL A 1 547 ? 49.143  148.961 63.013  1.00 16.02 ? 547  VAL A CB    1 
ATOM   4224  C  CG1   . VAL A 1 547 ? 48.262  149.832 62.140  1.00 13.38 ? 547  VAL A CG1   1 
ATOM   4225  C  CG2   . VAL A 1 547 ? 50.343  149.751 63.539  1.00 17.35 ? 547  VAL A CG2   1 
ATOM   4226  N  N     . VAL A 1 548 ? 45.986  148.455 63.655  1.00 17.00 ? 548  VAL A N     1 
ATOM   4227  C  CA    . VAL A 1 548 ? 44.742  147.953 63.103  1.00 17.31 ? 548  VAL A CA    1 
ATOM   4228  C  C     . VAL A 1 548 ? 44.064  149.110 62.390  1.00 17.36 ? 548  VAL A C     1 
ATOM   4229  O  O     . VAL A 1 548 ? 44.413  150.278 62.586  1.00 14.74 ? 548  VAL A O     1 
ATOM   4230  C  CB    . VAL A 1 548 ? 43.777  147.410 64.192  1.00 18.00 ? 548  VAL A CB    1 
ATOM   4231  C  CG1   . VAL A 1 548 ? 44.448  146.287 64.973  1.00 19.63 ? 548  VAL A CG1   1 
ATOM   4232  C  CG2   . VAL A 1 548 ? 43.336  148.544 65.126  1.00 20.42 ? 548  VAL A CG2   1 
ATOM   4233  N  N     . GLY A 1 549 ? 43.096  148.778 61.551  1.00 18.30 ? 549  GLY A N     1 
ATOM   4234  C  CA    . GLY A 1 549 ? 42.374  149.812 60.848  1.00 19.15 ? 549  GLY A CA    1 
ATOM   4235  C  C     . GLY A 1 549 ? 41.015  149.938 61.491  1.00 20.84 ? 549  GLY A C     1 
ATOM   4236  O  O     . GLY A 1 549 ? 40.533  148.992 62.116  1.00 21.94 ? 549  GLY A O     1 
ATOM   4237  N  N     . ILE A 1 550 ? 40.412  151.114 61.375  1.00 20.25 ? 550  ILE A N     1 
ATOM   4238  C  CA    . ILE A 1 550 ? 39.078  151.342 61.902  1.00 20.10 ? 550  ILE A CA    1 
ATOM   4239  C  C     . ILE A 1 550 ? 38.288  152.060 60.812  1.00 21.58 ? 550  ILE A C     1 
ATOM   4240  O  O     . ILE A 1 550 ? 38.859  152.771 59.973  1.00 18.86 ? 550  ILE A O     1 
ATOM   4241  C  CB    . ILE A 1 550 ? 39.083  152.211 63.190  1.00 20.88 ? 550  ILE A CB    1 
ATOM   4242  C  CG1   . ILE A 1 550 ? 39.797  153.535 62.938  1.00 22.39 ? 550  ILE A CG1   1 
ATOM   4243  C  CG2   . ILE A 1 550 ? 39.719  151.439 64.337  1.00 21.66 ? 550  ILE A CG2   1 
ATOM   4244  C  CD1   . ILE A 1 550 ? 39.671  154.511 64.080  1.00 22.06 ? 550  ILE A CD1   1 
ATOM   4245  N  N     . PRO A 1 551 ? 36.961  151.863 60.791  1.00 20.92 ? 551  PRO A N     1 
ATOM   4246  C  CA    . PRO A 1 551 ? 36.103  152.500 59.794  1.00 21.11 ? 551  PRO A CA    1 
ATOM   4247  C  C     . PRO A 1 551 ? 36.229  154.014 59.820  1.00 22.00 ? 551  PRO A C     1 
ATOM   4248  O  O     . PRO A 1 551 ? 36.374  154.616 60.885  1.00 22.00 ? 551  PRO A O     1 
ATOM   4249  C  CB    . PRO A 1 551 ? 34.708  152.030 60.194  1.00 20.47 ? 551  PRO A CB    1 
ATOM   4250  C  CG    . PRO A 1 551 ? 34.973  150.660 60.733  1.00 22.11 ? 551  PRO A CG    1 
ATOM   4251  C  CD    . PRO A 1 551 ? 36.192  150.902 61.601  1.00 21.91 ? 551  PRO A CD    1 
ATOM   4252  N  N     . HIS A 1 552 ? 36.196  154.612 58.633  1.00 22.40 ? 552  HIS A N     1 
ATOM   4253  C  CA    . HIS A 1 552 ? 36.260  156.056 58.483  1.00 23.90 ? 552  HIS A CA    1 
ATOM   4254  C  C     . HIS A 1 552 ? 35.296  156.410 57.356  1.00 24.35 ? 552  HIS A C     1 
ATOM   4255  O  O     . HIS A 1 552 ? 35.389  155.864 56.256  1.00 23.72 ? 552  HIS A O     1 
ATOM   4256  C  CB    . HIS A 1 552 ? 37.669  156.514 58.122  1.00 24.97 ? 552  HIS A CB    1 
ATOM   4257  C  CG    . HIS A 1 552 ? 37.843  157.996 58.199  1.00 25.59 ? 552  HIS A CG    1 
ATOM   4258  N  ND1   . HIS A 1 552 ? 38.154  158.648 59.372  1.00 27.15 ? 552  HIS A ND1   1 
ATOM   4259  C  CD2   . HIS A 1 552 ? 37.686  158.961 57.263  1.00 26.83 ? 552  HIS A CD2   1 
ATOM   4260  C  CE1   . HIS A 1 552 ? 38.181  159.951 59.156  1.00 27.71 ? 552  HIS A CE1   1 
ATOM   4261  N  NE2   . HIS A 1 552 ? 37.900  160.168 57.883  1.00 27.57 ? 552  HIS A NE2   1 
ATOM   4262  N  N     . ALA A 1 553 ? 34.378  157.329 57.633  1.00 24.87 ? 553  ALA A N     1 
ATOM   4263  C  CA    . ALA A 1 553 ? 33.360  157.727 56.668  1.00 25.97 ? 553  ALA A CA    1 
ATOM   4264  C  C     . ALA A 1 553 ? 33.873  158.233 55.329  1.00 26.37 ? 553  ALA A C     1 
ATOM   4265  O  O     . ALA A 1 553 ? 33.181  158.118 54.321  1.00 28.31 ? 553  ALA A O     1 
ATOM   4266  C  CB    . ALA A 1 553 ? 32.436  158.770 57.293  1.00 25.93 ? 553  ALA A CB    1 
ATOM   4267  N  N     . ILE A 1 554 ? 35.073  158.799 55.311  1.00 27.49 ? 554  ILE A N     1 
ATOM   4268  C  CA    . ILE A 1 554 ? 35.626  159.325 54.070  1.00 27.59 ? 554  ILE A CA    1 
ATOM   4269  C  C     . ILE A 1 554 ? 36.735  158.452 53.481  1.00 28.80 ? 554  ILE A C     1 
ATOM   4270  O  O     . ILE A 1 554 ? 36.622  157.970 52.351  1.00 27.70 ? 554  ILE A O     1 
ATOM   4271  C  CB    . ILE A 1 554 ? 36.193  160.749 54.274  1.00 28.71 ? 554  ILE A CB    1 
ATOM   4272  C  CG1   . ILE A 1 554 ? 35.109  161.668 54.839  1.00 29.87 ? 554  ILE A CG1   1 
ATOM   4273  C  CG2   . ILE A 1 554 ? 36.718  161.297 52.948  1.00 29.78 ? 554  ILE A CG2   1 
ATOM   4274  C  CD1   . ILE A 1 554 ? 33.895  161.805 53.953  1.00 30.12 ? 554  ILE A CD1   1 
ATOM   4275  N  N     . LYS A 1 555 ? 37.795  158.238 54.258  1.00 27.90 ? 555  LYS A N     1 
ATOM   4276  C  CA    . LYS A 1 555 ? 38.941  157.466 53.792  1.00 27.91 ? 555  LYS A CA    1 
ATOM   4277  C  C     . LYS A 1 555 ? 38.831  155.934 53.859  1.00 25.64 ? 555  LYS A C     1 
ATOM   4278  O  O     . LYS A 1 555 ? 39.787  155.227 53.542  1.00 25.28 ? 555  LYS A O     1 
ATOM   4279  C  CB    . LYS A 1 555 ? 40.202  157.939 54.530  1.00 28.64 ? 555  LYS A CB    1 
ATOM   4280  C  CG    . LYS A 1 555 ? 40.275  157.538 55.986  1.00 31.87 ? 555  LYS A CG    1 
ATOM   4281  C  CD    . LYS A 1 555 ? 41.558  158.038 56.666  1.00 34.06 ? 555  LYS A CD    1 
ATOM   4282  C  CE    . LYS A 1 555 ? 41.546  159.547 56.885  1.00 35.13 ? 555  LYS A CE    1 
ATOM   4283  N  NZ    . LYS A 1 555 ? 42.748  159.988 57.646  1.00 35.46 ? 555  LYS A NZ    1 
ATOM   4284  N  N     . GLY A 1 556 ? 37.668  155.424 54.253  1.00 25.47 ? 556  GLY A N     1 
ATOM   4285  C  CA    . GLY A 1 556 ? 37.477  153.982 54.333  1.00 22.69 ? 556  GLY A CA    1 
ATOM   4286  C  C     . GLY A 1 556 ? 37.967  153.406 55.650  1.00 22.77 ? 556  GLY A C     1 
ATOM   4287  O  O     . GLY A 1 556 ? 37.189  152.866 56.436  1.00 21.74 ? 556  GLY A O     1 
ATOM   4288  N  N     . GLN A 1 557 ? 39.271  153.505 55.883  1.00 21.67 ? 557  GLN A N     1 
ATOM   4289  C  CA    . GLN A 1 557 ? 39.869  153.030 57.123  1.00 20.77 ? 557  GLN A CA    1 
ATOM   4290  C  C     . GLN A 1 557 ? 40.868  154.049 57.634  1.00 20.19 ? 557  GLN A C     1 
ATOM   4291  O  O     . GLN A 1 557 ? 41.570  154.689 56.852  1.00 20.17 ? 557  GLN A O     1 
ATOM   4292  C  CB    . GLN A 1 557 ? 40.613  151.710 56.924  1.00 20.03 ? 557  GLN A CB    1 
ATOM   4293  C  CG    . GLN A 1 557 ? 39.756  150.468 56.881  1.00 16.71 ? 557  GLN A CG    1 
ATOM   4294  C  CD    . GLN A 1 557 ? 40.601  149.220 56.996  1.00 16.51 ? 557  GLN A CD    1 
ATOM   4295  O  OE1   . GLN A 1 557 ? 41.456  148.965 56.158  1.00 16.76 ? 557  GLN A OE1   1 
ATOM   4296  N  NE2   . GLN A 1 557 ? 40.376  148.443 58.046  1.00 17.59 ? 557  GLN A NE2   1 
ATOM   4297  N  N     . ALA A 1 558 ? 40.916  154.199 58.953  1.00 19.44 ? 558  ALA A N     1 
ATOM   4298  C  CA    . ALA A 1 558 ? 41.861  155.099 59.594  1.00 18.37 ? 558  ALA A CA    1 
ATOM   4299  C  C     . ALA A 1 558 ? 42.867  154.168 60.254  1.00 16.67 ? 558  ALA A C     1 
ATOM   4300  O  O     . ALA A 1 558 ? 42.579  152.987 60.460  1.00 14.36 ? 558  ALA A O     1 
ATOM   4301  C  CB    . ALA A 1 558 ? 41.167  155.963 60.640  1.00 17.21 ? 558  ALA A CB    1 
ATOM   4302  N  N     . ILE A 1 559 ? 44.046  154.690 60.572  1.00 16.32 ? 559  ILE A N     1 
ATOM   4303  C  CA    . ILE A 1 559 ? 45.088  153.891 61.196  1.00 15.27 ? 559  ILE A CA    1 
ATOM   4304  C  C     . ILE A 1 559 ? 45.103  154.072 62.708  1.00 15.83 ? 559  ILE A C     1 
ATOM   4305  O  O     . ILE A 1 559 ? 45.382  155.164 63.202  1.00 15.84 ? 559  ILE A O     1 
ATOM   4306  C  CB    . ILE A 1 559 ? 46.477  154.268 60.648  1.00 15.28 ? 559  ILE A CB    1 
ATOM   4307  C  CG1   . ILE A 1 559 ? 46.530  154.015 59.139  1.00 15.13 ? 559  ILE A CG1   1 
ATOM   4308  C  CG2   . ILE A 1 559 ? 47.557  153.473 61.379  1.00 12.54 ? 559  ILE A CG2   1 
ATOM   4309  C  CD1   . ILE A 1 559 ? 47.780  154.564 58.467  1.00 13.86 ? 559  ILE A CD1   1 
ATOM   4310  N  N     . TYR A 1 560 ? 44.805  153.000 63.438  1.00 16.00 ? 560  TYR A N     1 
ATOM   4311  C  CA    . TYR A 1 560 ? 44.805  153.038 64.897  1.00 15.69 ? 560  TYR A CA    1 
ATOM   4312  C  C     . TYR A 1 560 ? 46.004  152.226 65.387  1.00 15.61 ? 560  TYR A C     1 
ATOM   4313  O  O     . TYR A 1 560 ? 46.110  151.027 65.122  1.00 14.94 ? 560  TYR A O     1 
ATOM   4314  C  CB    . TYR A 1 560 ? 43.503  152.440 65.431  1.00 18.70 ? 560  TYR A CB    1 
ATOM   4315  C  CG    . TYR A 1 560 ? 43.253  152.655 66.910  1.00 20.76 ? 560  TYR A CG    1 
ATOM   4316  C  CD1   . TYR A 1 560 ? 44.022  151.995 67.875  1.00 21.94 ? 560  TYR A CD1   1 
ATOM   4317  C  CD2   . TYR A 1 560 ? 42.221  153.492 67.346  1.00 21.98 ? 560  TYR A CD2   1 
ATOM   4318  C  CE1   . TYR A 1 560 ? 43.764  152.158 69.244  1.00 23.24 ? 560  TYR A CE1   1 
ATOM   4319  C  CE2   . TYR A 1 560 ? 41.955  153.664 68.710  1.00 22.63 ? 560  TYR A CE2   1 
ATOM   4320  C  CZ    . TYR A 1 560 ? 42.728  152.991 69.649  1.00 22.95 ? 560  TYR A CZ    1 
ATOM   4321  O  OH    . TYR A 1 560 ? 42.442  153.119 70.984  1.00 21.10 ? 560  TYR A OH    1 
ATOM   4322  N  N     . ALA A 1 561 ? 46.913  152.874 66.101  1.00 14.53 ? 561  ALA A N     1 
ATOM   4323  C  CA    . ALA A 1 561 ? 48.097  152.179 66.581  1.00 16.12 ? 561  ALA A CA    1 
ATOM   4324  C  C     . ALA A 1 561 ? 48.250  152.084 68.096  1.00 15.92 ? 561  ALA A C     1 
ATOM   4325  O  O     . ALA A 1 561 ? 48.240  153.089 68.809  1.00 15.63 ? 561  ALA A O     1 
ATOM   4326  C  CB    . ALA A 1 561 ? 49.354  152.816 65.974  1.00 13.34 ? 561  ALA A CB    1 
ATOM   4327  N  N     . TYR A 1 562 ? 48.404  150.850 68.567  1.00 16.48 ? 562  TYR A N     1 
ATOM   4328  C  CA    . TYR A 1 562 ? 48.621  150.583 69.977  1.00 17.38 ? 562  TYR A CA    1 
ATOM   4329  C  C     . TYR A 1 562 ? 50.135  150.609 70.133  1.00 18.62 ? 562  TYR A C     1 
ATOM   4330  O  O     . TYR A 1 562 ? 50.840  149.856 69.467  1.00 18.94 ? 562  TYR A O     1 
ATOM   4331  C  CB    . TYR A 1 562 ? 48.082  149.205 70.358  1.00 17.23 ? 562  TYR A CB    1 
ATOM   4332  C  CG    . TYR A 1 562 ? 46.580  149.071 70.241  1.00 16.86 ? 562  TYR A CG    1 
ATOM   4333  C  CD1   . TYR A 1 562 ? 45.966  148.867 69.003  1.00 15.86 ? 562  TYR A CD1   1 
ATOM   4334  C  CD2   . TYR A 1 562 ? 45.768  149.148 71.373  1.00 16.95 ? 562  TYR A CD2   1 
ATOM   4335  C  CE1   . TYR A 1 562 ? 44.580  148.739 68.899  1.00 17.55 ? 562  TYR A CE1   1 
ATOM   4336  C  CE2   . TYR A 1 562 ? 44.385  149.025 71.278  1.00 17.98 ? 562  TYR A CE2   1 
ATOM   4337  C  CZ    . TYR A 1 562 ? 43.799  148.818 70.040  1.00 18.09 ? 562  TYR A CZ    1 
ATOM   4338  O  OH    . TYR A 1 562 ? 42.433  148.678 69.951  1.00 20.00 ? 562  TYR A OH    1 
ATOM   4339  N  N     . VAL A 1 563 ? 50.633  151.484 71.004  1.00 18.29 ? 563  VAL A N     1 
ATOM   4340  C  CA    . VAL A 1 563 ? 52.068  151.618 71.205  1.00 17.16 ? 563  VAL A CA    1 
ATOM   4341  C  C     . VAL A 1 563 ? 52.531  151.372 72.635  1.00 18.82 ? 563  VAL A C     1 
ATOM   4342  O  O     . VAL A 1 563 ? 51.925  151.864 73.595  1.00 17.65 ? 563  VAL A O     1 
ATOM   4343  C  CB    . VAL A 1 563 ? 52.533  153.020 70.779  1.00 15.27 ? 563  VAL A CB    1 
ATOM   4344  C  CG1   . VAL A 1 563 ? 54.042  153.141 70.905  1.00 15.73 ? 563  VAL A CG1   1 
ATOM   4345  C  CG2   . VAL A 1 563 ? 52.091  153.285 69.354  1.00 16.05 ? 563  VAL A CG2   1 
ATOM   4346  N  N     . THR A 1 564 ? 53.612  150.604 72.765  1.00 17.99 ? 564  THR A N     1 
ATOM   4347  C  CA    . THR A 1 564 ? 54.200  150.298 74.065  1.00 17.62 ? 564  THR A CA    1 
ATOM   4348  C  C     . THR A 1 564 ? 55.564  150.977 74.108  1.00 18.23 ? 564  THR A C     1 
ATOM   4349  O  O     . THR A 1 564 ? 56.446  150.665 73.308  1.00 19.18 ? 564  THR A O     1 
ATOM   4350  C  CB    . THR A 1 564 ? 54.403  148.770 74.272  1.00 18.40 ? 564  THR A CB    1 
ATOM   4351  O  OG1   . THR A 1 564 ? 53.149  148.085 74.139  1.00 20.34 ? 564  THR A OG1   1 
ATOM   4352  C  CG2   . THR A 1 564 ? 54.964  148.495 75.668  1.00 18.30 ? 564  THR A CG2   1 
ATOM   4353  N  N     . LEU A 1 565 ? 55.733  151.908 75.036  1.00 18.32 ? 565  LEU A N     1 
ATOM   4354  C  CA    . LEU A 1 565 ? 56.999  152.614 75.153  1.00 20.99 ? 565  LEU A CA    1 
ATOM   4355  C  C     . LEU A 1 565 ? 57.952  151.847 76.057  1.00 23.10 ? 565  LEU A C     1 
ATOM   4356  O  O     . LEU A 1 565 ? 57.520  151.117 76.950  1.00 23.88 ? 565  LEU A O     1 
ATOM   4357  C  CB    . LEU A 1 565 ? 56.765  154.015 75.725  1.00 21.03 ? 565  LEU A CB    1 
ATOM   4358  C  CG    . LEU A 1 565 ? 55.809  154.904 74.926  1.00 20.98 ? 565  LEU A CG    1 
ATOM   4359  C  CD1   . LEU A 1 565 ? 55.552  156.198 75.685  1.00 19.59 ? 565  LEU A CD1   1 
ATOM   4360  C  CD2   . LEU A 1 565 ? 56.403  155.173 73.544  1.00 17.84 ? 565  LEU A CD2   1 
ATOM   4361  N  N     . ASN A 1 566 ? 59.249  152.000 75.815  1.00 24.06 ? 566  ASN A N     1 
ATOM   4362  C  CA    . ASN A 1 566 ? 60.244  151.337 76.647  1.00 26.48 ? 566  ASN A CA    1 
ATOM   4363  C  C     . ASN A 1 566 ? 60.098  151.897 78.063  1.00 28.07 ? 566  ASN A C     1 
ATOM   4364  O  O     . ASN A 1 566 ? 59.462  152.935 78.260  1.00 27.97 ? 566  ASN A O     1 
ATOM   4365  C  CB    . ASN A 1 566 ? 61.659  151.616 76.126  1.00 25.63 ? 566  ASN A CB    1 
ATOM   4366  C  CG    . ASN A 1 566 ? 61.934  150.946 74.788  1.00 28.47 ? 566  ASN A CG    1 
ATOM   4367  O  OD1   . ASN A 1 566 ? 61.721  149.738 74.629  1.00 28.86 ? 566  ASN A OD1   1 
ATOM   4368  N  ND2   . ASN A 1 566 ? 62.419  151.722 73.822  1.00 27.94 ? 566  ASN A ND2   1 
ATOM   4369  N  N     . HIS A 1 567 ? 60.668  151.208 79.046  1.00 29.26 ? 567  HIS A N     1 
ATOM   4370  C  CA    . HIS A 1 567 ? 60.591  151.682 80.423  1.00 30.05 ? 567  HIS A CA    1 
ATOM   4371  C  C     . HIS A 1 567 ? 61.382  152.973 80.560  1.00 31.38 ? 567  HIS A C     1 
ATOM   4372  O  O     . HIS A 1 567 ? 62.430  153.141 79.933  1.00 32.43 ? 567  HIS A O     1 
ATOM   4373  C  CB    . HIS A 1 567 ? 61.142  150.630 81.390  1.00 29.99 ? 567  HIS A CB    1 
ATOM   4374  C  CG    . HIS A 1 567 ? 60.196  149.503 81.658  1.00 30.59 ? 567  HIS A CG    1 
ATOM   4375  N  ND1   . HIS A 1 567 ? 60.479  148.490 82.550  1.00 29.90 ? 567  HIS A ND1   1 
ATOM   4376  C  CD2   . HIS A 1 567 ? 58.960  149.240 81.171  1.00 31.34 ? 567  HIS A CD2   1 
ATOM   4377  C  CE1   . HIS A 1 567 ? 59.457  147.653 82.602  1.00 32.27 ? 567  HIS A CE1   1 
ATOM   4378  N  NE2   . HIS A 1 567 ? 58.521  148.086 81.774  1.00 30.40 ? 567  HIS A NE2   1 
ATOM   4379  N  N     . GLY A 1 568 ? 60.871  153.888 81.376  1.00 32.64 ? 568  GLY A N     1 
ATOM   4380  C  CA    . GLY A 1 568 ? 61.549  155.154 81.576  1.00 34.71 ? 568  GLY A CA    1 
ATOM   4381  C  C     . GLY A 1 568 ? 61.015  156.229 80.652  1.00 35.29 ? 568  GLY A C     1 
ATOM   4382  O  O     . GLY A 1 568 ? 61.392  157.399 80.764  1.00 35.53 ? 568  GLY A O     1 
ATOM   4383  N  N     . GLU A 1 569 ? 60.143  155.827 79.732  1.00 35.69 ? 569  GLU A N     1 
ATOM   4384  C  CA    . GLU A 1 569 ? 59.543  156.756 78.782  1.00 35.88 ? 569  GLU A CA    1 
ATOM   4385  C  C     . GLU A 1 569 ? 58.098  157.016 79.200  1.00 35.87 ? 569  GLU A C     1 
ATOM   4386  O  O     . GLU A 1 569 ? 57.443  156.153 79.794  1.00 36.73 ? 569  GLU A O     1 
ATOM   4387  C  CB    . GLU A 1 569 ? 59.566  156.172 77.367  1.00 36.65 ? 569  GLU A CB    1 
ATOM   4388  C  CG    . GLU A 1 569 ? 60.921  155.655 76.894  1.00 38.46 ? 569  GLU A CG    1 
ATOM   4389  C  CD    . GLU A 1 569 ? 62.008  156.718 76.885  1.00 39.27 ? 569  GLU A CD    1 
ATOM   4390  O  OE1   . GLU A 1 569 ? 61.719  157.869 76.489  1.00 39.75 ? 569  GLU A OE1   1 
ATOM   4391  O  OE2   . GLU A 1 569 ? 63.158  156.393 77.258  1.00 37.33 ? 569  GLU A OE2   1 
ATOM   4392  N  N     . GLU A 1 570 ? 57.603  158.204 78.880  1.00 33.79 ? 570  GLU A N     1 
ATOM   4393  C  CA    . GLU A 1 570 ? 56.248  158.579 79.237  1.00 33.35 ? 570  GLU A CA    1 
ATOM   4394  C  C     . GLU A 1 570 ? 55.580  159.388 78.133  1.00 31.19 ? 570  GLU A C     1 
ATOM   4395  O  O     . GLU A 1 570 ? 56.212  160.208 77.470  1.00 29.86 ? 570  GLU A O     1 
ATOM   4396  C  CB    . GLU A 1 570 ? 56.268  159.378 80.544  1.00 36.00 ? 570  GLU A CB    1 
ATOM   4397  C  CG    . GLU A 1 570 ? 55.018  160.191 80.827  1.00 40.78 ? 570  GLU A CG    1 
ATOM   4398  C  CD    . GLU A 1 570 ? 55.160  161.023 82.091  1.00 44.10 ? 570  GLU A CD    1 
ATOM   4399  O  OE1   . GLU A 1 570 ? 55.151  160.434 83.196  1.00 46.63 ? 570  GLU A OE1   1 
ATOM   4400  O  OE2   . GLU A 1 570 ? 55.298  162.264 81.980  1.00 45.27 ? 570  GLU A OE2   1 
ATOM   4401  N  N     . PRO A 1 571 ? 54.284  159.147 77.909  1.00 29.97 ? 571  PRO A N     1 
ATOM   4402  C  CA    . PRO A 1 571 ? 53.529  159.862 76.879  1.00 28.80 ? 571  PRO A CA    1 
ATOM   4403  C  C     . PRO A 1 571 ? 53.540  161.370 77.123  1.00 27.21 ? 571  PRO A C     1 
ATOM   4404  O  O     . PRO A 1 571 ? 53.632  161.824 78.262  1.00 27.13 ? 571  PRO A O     1 
ATOM   4405  C  CB    . PRO A 1 571 ? 52.128  159.267 77.007  1.00 28.01 ? 571  PRO A CB    1 
ATOM   4406  C  CG    . PRO A 1 571 ? 52.413  157.863 77.444  1.00 30.01 ? 571  PRO A CG    1 
ATOM   4407  C  CD    . PRO A 1 571 ? 53.470  158.074 78.504  1.00 28.98 ? 571  PRO A CD    1 
ATOM   4408  N  N     . SER A 1 572 ? 53.458  162.137 76.043  1.00 26.19 ? 572  SER A N     1 
ATOM   4409  C  CA    . SER A 1 572 ? 53.443  163.591 76.130  1.00 24.60 ? 572  SER A CA    1 
ATOM   4410  C  C     . SER A 1 572 ? 53.099  164.151 74.759  1.00 24.18 ? 572  SER A C     1 
ATOM   4411  O  O     . SER A 1 572 ? 53.171  163.439 73.757  1.00 22.66 ? 572  SER A O     1 
ATOM   4412  C  CB    . SER A 1 572 ? 54.809  164.120 76.572  1.00 24.57 ? 572  SER A CB    1 
ATOM   4413  O  OG    . SER A 1 572 ? 55.790  163.899 75.578  1.00 23.90 ? 572  SER A OG    1 
ATOM   4414  N  N     . PRO A 1 573 ? 52.700  165.431 74.698  1.00 23.52 ? 573  PRO A N     1 
ATOM   4415  C  CA    . PRO A 1 573 ? 52.356  166.047 73.415  1.00 21.98 ? 573  PRO A CA    1 
ATOM   4416  C  C     . PRO A 1 573 ? 53.525  165.946 72.439  1.00 20.66 ? 573  PRO A C     1 
ATOM   4417  O  O     . PRO A 1 573 ? 53.337  165.676 71.253  1.00 18.35 ? 573  PRO A O     1 
ATOM   4418  C  CB    . PRO A 1 573 ? 52.056  167.489 73.803  1.00 23.60 ? 573  PRO A CB    1 
ATOM   4419  C  CG    . PRO A 1 573 ? 51.464  167.338 75.167  1.00 24.47 ? 573  PRO A CG    1 
ATOM   4420  C  CD    . PRO A 1 573 ? 52.399  166.344 75.815  1.00 23.18 ? 573  PRO A CD    1 
ATOM   4421  N  N     . GLU A 1 574 ? 54.731  166.160 72.956  1.00 20.14 ? 574  GLU A N     1 
ATOM   4422  C  CA    . GLU A 1 574 ? 55.945  166.102 72.148  1.00 19.62 ? 574  GLU A CA    1 
ATOM   4423  C  C     . GLU A 1 574 ? 56.180  164.723 71.550  1.00 20.44 ? 574  GLU A C     1 
ATOM   4424  O  O     . GLU A 1 574 ? 56.453  164.605 70.361  1.00 20.21 ? 574  GLU A O     1 
ATOM   4425  C  CB    . GLU A 1 574 ? 57.163  166.495 72.990  1.00 18.08 ? 574  GLU A CB    1 
ATOM   4426  C  CG    . GLU A 1 574 ? 58.502  166.549 72.234  1.00 18.75 ? 574  GLU A CG    1 
ATOM   4427  C  CD    . GLU A 1 574 ? 59.056  165.172 71.852  1.00 19.21 ? 574  GLU A CD    1 
ATOM   4428  O  OE1   . GLU A 1 574 ? 59.023  164.250 72.697  1.00 17.87 ? 574  GLU A OE1   1 
ATOM   4429  O  OE2   . GLU A 1 574 ? 59.541  165.020 70.709  1.00 18.30 ? 574  GLU A OE2   1 
ATOM   4430  N  N     . LEU A 1 575 ? 56.083  163.687 72.380  1.00 20.69 ? 575  LEU A N     1 
ATOM   4431  C  CA    . LEU A 1 575 ? 56.306  162.325 71.913  1.00 21.73 ? 575  LEU A CA    1 
ATOM   4432  C  C     . LEU A 1 575 ? 55.175  161.871 70.989  1.00 20.99 ? 575  LEU A C     1 
ATOM   4433  O  O     . LEU A 1 575 ? 55.385  161.072 70.074  1.00 20.38 ? 575  LEU A O     1 
ATOM   4434  C  CB    . LEU A 1 575 ? 56.436  161.367 73.102  1.00 23.20 ? 575  LEU A CB    1 
ATOM   4435  C  CG    . LEU A 1 575 ? 56.952  159.969 72.736  1.00 24.93 ? 575  LEU A CG    1 
ATOM   4436  C  CD1   . LEU A 1 575 ? 58.328  160.094 72.094  1.00 23.33 ? 575  LEU A CD1   1 
ATOM   4437  C  CD2   . LEU A 1 575 ? 57.016  159.083 73.975  1.00 25.35 ? 575  LEU A CD2   1 
ATOM   4438  N  N     . TYR A 1 576 ? 53.976  162.389 71.229  1.00 21.62 ? 576  TYR A N     1 
ATOM   4439  C  CA    . TYR A 1 576 ? 52.831  162.049 70.399  1.00 21.71 ? 576  TYR A CA    1 
ATOM   4440  C  C     . TYR A 1 576 ? 53.128  162.548 68.991  1.00 22.83 ? 576  TYR A C     1 
ATOM   4441  O  O     . TYR A 1 576 ? 52.870  161.859 67.994  1.00 22.61 ? 576  TYR A O     1 
ATOM   4442  C  CB    . TYR A 1 576 ? 51.572  162.745 70.905  1.00 22.22 ? 576  TYR A CB    1 
ATOM   4443  C  CG    . TYR A 1 576 ? 50.298  162.200 70.298  1.00 24.28 ? 576  TYR A CG    1 
ATOM   4444  C  CD1   . TYR A 1 576 ? 49.663  161.093 70.858  1.00 25.26 ? 576  TYR A CD1   1 
ATOM   4445  C  CD2   . TYR A 1 576 ? 49.737  162.771 69.156  1.00 25.35 ? 576  TYR A CD2   1 
ATOM   4446  C  CE1   . TYR A 1 576 ? 48.502  160.563 70.303  1.00 26.09 ? 576  TYR A CE1   1 
ATOM   4447  C  CE2   . TYR A 1 576 ? 48.569  162.244 68.586  1.00 27.59 ? 576  TYR A CE2   1 
ATOM   4448  C  CZ    . TYR A 1 576 ? 47.959  161.138 69.168  1.00 27.51 ? 576  TYR A CZ    1 
ATOM   4449  O  OH    . TYR A 1 576 ? 46.811  160.607 68.618  1.00 27.53 ? 576  TYR A OH    1 
ATOM   4450  N  N     . ALA A 1 577 ? 53.678  163.758 68.929  1.00 21.76 ? 577  ALA A N     1 
ATOM   4451  C  CA    . ALA A 1 577 ? 54.025  164.385 67.663  1.00 22.32 ? 577  ALA A CA    1 
ATOM   4452  C  C     . ALA A 1 577 ? 55.230  163.710 67.017  1.00 21.56 ? 577  ALA A C     1 
ATOM   4453  O  O     . ALA A 1 577 ? 55.281  163.552 65.800  1.00 22.86 ? 577  ALA A O     1 
ATOM   4454  C  CB    . ALA A 1 577 ? 54.307  165.874 67.882  1.00 22.61 ? 577  ALA A CB    1 
ATOM   4455  N  N     . GLU A 1 578 ? 56.192  163.301 67.835  1.00 20.20 ? 578  GLU A N     1 
ATOM   4456  C  CA    . GLU A 1 578 ? 57.396  162.653 67.320  1.00 19.54 ? 578  GLU A CA    1 
ATOM   4457  C  C     . GLU A 1 578 ? 57.103  161.286 66.705  1.00 18.15 ? 578  GLU A C     1 
ATOM   4458  O  O     . GLU A 1 578 ? 57.619  160.955 65.635  1.00 18.01 ? 578  GLU A O     1 
ATOM   4459  C  CB    . GLU A 1 578 ? 58.443  162.506 68.433  1.00 18.02 ? 578  GLU A CB    1 
ATOM   4460  C  CG    . GLU A 1 578 ? 59.844  162.161 67.931  1.00 21.81 ? 578  GLU A CG    1 
ATOM   4461  C  CD    . GLU A 1 578 ? 60.850  162.005 69.064  1.00 23.93 ? 578  GLU A CD    1 
ATOM   4462  O  OE1   . GLU A 1 578 ? 60.913  162.899 69.940  1.00 23.47 ? 578  GLU A OE1   1 
ATOM   4463  O  OE2   . GLU A 1 578 ? 61.581  160.989 69.078  1.00 23.48 ? 578  GLU A OE2   1 
ATOM   4464  N  N     . VAL A 1 579 ? 56.270  160.494 67.371  1.00 17.00 ? 579  VAL A N     1 
ATOM   4465  C  CA    . VAL A 1 579 ? 55.940  159.168 66.859  1.00 15.56 ? 579  VAL A CA    1 
ATOM   4466  C  C     . VAL A 1 579 ? 55.185  159.250 65.531  1.00 16.20 ? 579  VAL A C     1 
ATOM   4467  O  O     . VAL A 1 579 ? 55.523  158.538 64.585  1.00 17.20 ? 579  VAL A O     1 
ATOM   4468  C  CB    . VAL A 1 579 ? 55.136  158.354 67.905  1.00 14.12 ? 579  VAL A CB    1 
ATOM   4469  C  CG1   . VAL A 1 579 ? 54.596  157.067 67.286  1.00 14.10 ? 579  VAL A CG1   1 
ATOM   4470  C  CG2   . VAL A 1 579 ? 56.045  158.017 69.089  1.00 14.93 ? 579  VAL A CG2   1 
ATOM   4471  N  N     . ARG A 1 580 ? 54.182  160.123 65.446  1.00 15.84 ? 580  ARG A N     1 
ATOM   4472  C  CA    . ARG A 1 580 ? 53.436  160.264 64.199  1.00 16.14 ? 580  ARG A CA    1 
ATOM   4473  C  C     . ARG A 1 580 ? 54.366  160.682 63.064  1.00 15.67 ? 580  ARG A C     1 
ATOM   4474  O  O     . ARG A 1 580 ? 54.242  160.189 61.947  1.00 15.84 ? 580  ARG A O     1 
ATOM   4475  C  CB    . ARG A 1 580 ? 52.322  161.300 64.332  1.00 17.33 ? 580  ARG A CB    1 
ATOM   4476  C  CG    . ARG A 1 580 ? 51.297  161.004 65.407  1.00 20.51 ? 580  ARG A CG    1 
ATOM   4477  C  CD    . ARG A 1 580 ? 49.912  161.369 64.913  1.00 21.79 ? 580  ARG A CD    1 
ATOM   4478  N  NE    . ARG A 1 580 ? 49.910  162.659 64.235  1.00 24.56 ? 580  ARG A NE    1 
ATOM   4479  C  CZ    . ARG A 1 580 ? 49.033  163.001 63.297  1.00 23.85 ? 580  ARG A CZ    1 
ATOM   4480  N  NH1   . ARG A 1 580 ? 48.089  162.146 62.928  1.00 23.70 ? 580  ARG A NH1   1 
ATOM   4481  N  NH2   . ARG A 1 580 ? 49.109  164.194 62.722  1.00 22.39 ? 580  ARG A NH2   1 
ATOM   4482  N  N     . ASN A 1 581 ? 55.292  161.595 63.353  1.00 15.11 ? 581  ASN A N     1 
ATOM   4483  C  CA    . ASN A 1 581 ? 56.235  162.063 62.347  1.00 15.37 ? 581  ASN A CA    1 
ATOM   4484  C  C     . ASN A 1 581 ? 57.293  161.021 62.058  1.00 15.87 ? 581  ASN A C     1 
ATOM   4485  O  O     . ASN A 1 581 ? 57.971  161.075 61.029  1.00 15.12 ? 581  ASN A O     1 
ATOM   4486  C  CB    . ASN A 1 581 ? 56.909  163.356 62.787  1.00 14.11 ? 581  ASN A CB    1 
ATOM   4487  C  CG    . ASN A 1 581 ? 56.017  164.551 62.615  1.00 18.82 ? 581  ASN A CG    1 
ATOM   4488  O  OD1   . ASN A 1 581 ? 55.119  164.545 61.774  1.00 20.49 ? 581  ASN A OD1   1 
ATOM   4489  N  ND2   . ASN A 1 581 ? 56.264  165.598 63.397  1.00 20.81 ? 581  ASN A ND2   1 
ATOM   4490  N  N     . TRP A 1 582 ? 57.448  160.076 62.975  1.00 15.14 ? 582  TRP A N     1 
ATOM   4491  C  CA    . TRP A 1 582 ? 58.419  159.019 62.769  1.00 16.84 ? 582  TRP A CA    1 
ATOM   4492  C  C     . TRP A 1 582 ? 57.900  158.118 61.651  1.00 18.11 ? 582  TRP A C     1 
ATOM   4493  O  O     . TRP A 1 582 ? 58.648  157.739 60.749  1.00 19.58 ? 582  TRP A O     1 
ATOM   4494  C  CB    . TRP A 1 582 ? 58.620  158.217 64.054  1.00 17.04 ? 582  TRP A CB    1 
ATOM   4495  C  CG    . TRP A 1 582 ? 59.622  157.121 63.911  1.00 18.04 ? 582  TRP A CG    1 
ATOM   4496  C  CD1   . TRP A 1 582 ? 59.367  155.786 63.773  1.00 14.73 ? 582  TRP A CD1   1 
ATOM   4497  C  CD2   . TRP A 1 582 ? 61.046  157.265 63.893  1.00 16.95 ? 582  TRP A CD2   1 
ATOM   4498  N  NE1   . TRP A 1 582 ? 60.544  155.089 63.675  1.00 17.87 ? 582  TRP A NE1   1 
ATOM   4499  C  CE2   . TRP A 1 582 ? 61.592  155.971 63.745  1.00 17.68 ? 582  TRP A CE2   1 
ATOM   4500  C  CE3   . TRP A 1 582 ? 61.914  158.364 63.988  1.00 19.74 ? 582  TRP A CE3   1 
ATOM   4501  C  CZ2   . TRP A 1 582 ? 62.973  155.739 63.689  1.00 16.82 ? 582  TRP A CZ2   1 
ATOM   4502  C  CZ3   . TRP A 1 582 ? 63.293  158.137 63.932  1.00 19.87 ? 582  TRP A CZ3   1 
ATOM   4503  C  CH2   . TRP A 1 582 ? 63.807  156.827 63.784  1.00 20.19 ? 582  TRP A CH2   1 
ATOM   4504  N  N     . VAL A 1 583 ? 56.615  157.784 61.704  1.00 17.59 ? 583  VAL A N     1 
ATOM   4505  C  CA    . VAL A 1 583 ? 56.022  156.932 60.676  1.00 17.98 ? 583  VAL A CA    1 
ATOM   4506  C  C     . VAL A 1 583 ? 55.997  157.662 59.339  1.00 18.53 ? 583  VAL A C     1 
ATOM   4507  O  O     . VAL A 1 583 ? 56.218  157.058 58.289  1.00 17.82 ? 583  VAL A O     1 
ATOM   4508  C  CB    . VAL A 1 583 ? 54.574  156.528 61.031  1.00 18.66 ? 583  VAL A CB    1 
ATOM   4509  C  CG1   . VAL A 1 583 ? 53.957  155.736 59.877  1.00 17.66 ? 583  VAL A CG1   1 
ATOM   4510  C  CG2   . VAL A 1 583 ? 54.557  155.706 62.319  1.00 16.27 ? 583  VAL A CG2   1 
ATOM   4511  N  N     . ARG A 1 584 ? 55.722  158.963 59.383  1.00 19.17 ? 584  ARG A N     1 
ATOM   4512  C  CA    . ARG A 1 584 ? 55.667  159.779 58.170  1.00 20.14 ? 584  ARG A CA    1 
ATOM   4513  C  C     . ARG A 1 584 ? 57.036  159.799 57.499  1.00 20.31 ? 584  ARG A C     1 
ATOM   4514  O  O     . ARG A 1 584 ? 57.145  159.774 56.271  1.00 20.60 ? 584  ARG A O     1 
ATOM   4515  C  CB    . ARG A 1 584 ? 55.242  161.205 58.516  1.00 19.01 ? 584  ARG A CB    1 
ATOM   4516  C  CG    . ARG A 1 584 ? 55.148  162.143 57.322  1.00 22.25 ? 584  ARG A CG    1 
ATOM   4517  C  CD    . ARG A 1 584 ? 54.722  163.542 57.766  1.00 24.78 ? 584  ARG A CD    1 
ATOM   4518  N  NE    . ARG A 1 584 ? 54.228  164.349 56.654  1.00 27.88 ? 584  ARG A NE    1 
ATOM   4519  C  CZ    . ARG A 1 584 ? 54.957  164.697 55.595  1.00 30.11 ? 584  ARG A CZ    1 
ATOM   4520  N  NH1   . ARG A 1 584 ? 56.226  164.309 55.501  1.00 31.03 ? 584  ARG A NH1   1 
ATOM   4521  N  NH2   . ARG A 1 584 ? 54.414  165.427 54.621  1.00 28.21 ? 584  ARG A NH2   1 
ATOM   4522  N  N     . LYS A 1 585 ? 58.079  159.828 58.321  1.00 19.65 ? 585  LYS A N     1 
ATOM   4523  C  CA    . LYS A 1 585 ? 59.453  159.848 57.844  1.00 22.00 ? 585  LYS A CA    1 
ATOM   4524  C  C     . LYS A 1 585 ? 59.945  158.445 57.457  1.00 21.50 ? 585  LYS A C     1 
ATOM   4525  O  O     . LYS A 1 585 ? 60.797  158.296 56.584  1.00 21.60 ? 585  LYS A O     1 
ATOM   4526  C  CB    . LYS A 1 585 ? 60.345  160.467 58.923  1.00 24.61 ? 585  LYS A CB    1 
ATOM   4527  C  CG    . LYS A 1 585 ? 61.836  160.335 58.684  1.00 30.80 ? 585  LYS A CG    1 
ATOM   4528  C  CD    . LYS A 1 585 ? 62.433  159.277 59.596  1.00 35.41 ? 585  LYS A CD    1 
ATOM   4529  C  CE    . LYS A 1 585 ? 63.852  158.913 59.188  1.00 39.45 ? 585  LYS A CE    1 
ATOM   4530  N  NZ    . LYS A 1 585 ? 64.387  157.785 60.012  1.00 39.86 ? 585  LYS A NZ    1 
ATOM   4531  N  N     . GLU A 1 586 ? 59.401  157.419 58.103  1.00 20.34 ? 586  GLU A N     1 
ATOM   4532  C  CA    . GLU A 1 586 ? 59.785  156.039 57.816  1.00 20.90 ? 586  GLU A CA    1 
ATOM   4533  C  C     . GLU A 1 586 ? 59.111  155.476 56.566  1.00 19.69 ? 586  GLU A C     1 
ATOM   4534  O  O     . GLU A 1 586 ? 59.742  154.789 55.773  1.00 19.22 ? 586  GLU A O     1 
ATOM   4535  C  CB    . GLU A 1 586 ? 59.458  155.136 59.012  1.00 22.15 ? 586  GLU A CB    1 
ATOM   4536  C  CG    . GLU A 1 586 ? 60.387  155.329 60.198  1.00 24.60 ? 586  GLU A CG    1 
ATOM   4537  C  CD    . GLU A 1 586 ? 61.799  154.876 59.895  1.00 27.34 ? 586  GLU A CD    1 
ATOM   4538  O  OE1   . GLU A 1 586 ? 62.044  153.651 59.897  1.00 29.20 ? 586  GLU A OE1   1 
ATOM   4539  O  OE2   . GLU A 1 586 ? 62.662  155.745 59.642  1.00 30.84 ? 586  GLU A OE2   1 
ATOM   4540  N  N     . ILE A 1 587 ? 57.830  155.781 56.392  1.00 18.85 ? 587  ILE A N     1 
ATOM   4541  C  CA    . ILE A 1 587 ? 57.080  155.273 55.255  1.00 18.71 ? 587  ILE A CA    1 
ATOM   4542  C  C     . ILE A 1 587 ? 56.533  156.382 54.360  1.00 19.75 ? 587  ILE A C     1 
ATOM   4543  O  O     . ILE A 1 587 ? 56.754  156.388 53.148  1.00 20.81 ? 587  ILE A O     1 
ATOM   4544  C  CB    . ILE A 1 587 ? 55.908  154.393 55.739  1.00 18.77 ? 587  ILE A CB    1 
ATOM   4545  C  CG1   . ILE A 1 587 ? 56.454  153.215 56.555  1.00 19.44 ? 587  ILE A CG1   1 
ATOM   4546  C  CG2   . ILE A 1 587 ? 55.085  153.912 54.545  1.00 16.54 ? 587  ILE A CG2   1 
ATOM   4547  C  CD1   . ILE A 1 587 ? 55.371  152.345 57.193  1.00 18.67 ? 587  ILE A CD1   1 
ATOM   4548  N  N     . GLY A 1 588 ? 55.814  157.316 54.970  1.00 19.87 ? 588  GLY A N     1 
ATOM   4549  C  CA    . GLY A 1 588 ? 55.233  158.416 54.228  1.00 18.88 ? 588  GLY A CA    1 
ATOM   4550  C  C     . GLY A 1 588 ? 53.980  158.894 54.935  1.00 19.37 ? 588  GLY A C     1 
ATOM   4551  O  O     . GLY A 1 588 ? 53.435  158.167 55.768  1.00 18.68 ? 588  GLY A O     1 
ATOM   4552  N  N     . PRO A 1 589 ? 53.486  160.103 54.618  1.00 19.17 ? 589  PRO A N     1 
ATOM   4553  C  CA    . PRO A 1 589 ? 52.281  160.644 55.257  1.00 20.37 ? 589  PRO A CA    1 
ATOM   4554  C  C     . PRO A 1 589 ? 51.036  159.757 55.166  1.00 21.61 ? 589  PRO A C     1 
ATOM   4555  O  O     . PRO A 1 589 ? 50.184  159.791 56.055  1.00 21.61 ? 589  PRO A O     1 
ATOM   4556  C  CB    . PRO A 1 589 ? 52.101  161.996 54.567  1.00 20.95 ? 589  PRO A CB    1 
ATOM   4557  C  CG    . PRO A 1 589 ? 52.763  161.804 53.239  1.00 20.12 ? 589  PRO A CG    1 
ATOM   4558  C  CD    . PRO A 1 589 ? 53.995  161.029 53.591  1.00 18.05 ? 589  PRO A CD    1 
ATOM   4559  N  N     . LEU A 1 590 ? 50.937  158.955 54.109  1.00 22.39 ? 590  LEU A N     1 
ATOM   4560  C  CA    . LEU A 1 590 ? 49.791  158.065 53.942  1.00 22.47 ? 590  LEU A CA    1 
ATOM   4561  C  C     . LEU A 1 590 ? 49.683  156.999 55.031  1.00 22.65 ? 590  LEU A C     1 
ATOM   4562  O  O     . LEU A 1 590 ? 48.590  156.504 55.312  1.00 23.13 ? 590  LEU A O     1 
ATOM   4563  C  CB    . LEU A 1 590 ? 49.849  157.371 52.586  1.00 25.07 ? 590  LEU A CB    1 
ATOM   4564  C  CG    . LEU A 1 590 ? 49.643  158.257 51.361  1.00 29.81 ? 590  LEU A CG    1 
ATOM   4565  C  CD1   . LEU A 1 590 ? 49.666  157.375 50.116  1.00 32.17 ? 590  LEU A CD1   1 
ATOM   4566  C  CD2   . LEU A 1 590 ? 48.313  159.004 51.472  1.00 31.19 ? 590  LEU A CD2   1 
ATOM   4567  N  N     . ALA A 1 591 ? 50.812  156.649 55.641  1.00 21.55 ? 591  ALA A N     1 
ATOM   4568  C  CA    . ALA A 1 591 ? 50.815  155.633 56.687  1.00 21.95 ? 591  ALA A CA    1 
ATOM   4569  C  C     . ALA A 1 591 ? 50.788  156.229 58.086  1.00 22.24 ? 591  ALA A C     1 
ATOM   4570  O  O     . ALA A 1 591 ? 50.907  155.510 59.079  1.00 22.18 ? 591  ALA A O     1 
ATOM   4571  C  CB    . ALA A 1 591 ? 52.034  154.732 56.535  1.00 20.94 ? 591  ALA A CB    1 
ATOM   4572  N  N     . THR A 1 592 ? 50.632  157.543 58.164  1.00 22.01 ? 592  THR A N     1 
ATOM   4573  C  CA    . THR A 1 592 ? 50.598  158.224 59.451  1.00 24.22 ? 592  THR A CA    1 
ATOM   4574  C  C     . THR A 1 592 ? 49.358  157.871 60.270  1.00 23.71 ? 592  THR A C     1 
ATOM   4575  O  O     . THR A 1 592 ? 48.227  158.066 59.831  1.00 24.00 ? 592  THR A O     1 
ATOM   4576  C  CB    . THR A 1 592 ? 50.645  159.749 59.269  1.00 25.42 ? 592  THR A CB    1 
ATOM   4577  O  OG1   . THR A 1 592 ? 51.829  160.104 58.546  1.00 29.42 ? 592  THR A OG1   1 
ATOM   4578  C  CG2   . THR A 1 592 ? 50.657  160.443 60.616  1.00 25.83 ? 592  THR A CG2   1 
ATOM   4579  N  N     . PRO A 1 593 ? 49.559  157.333 61.477  1.00 23.27 ? 593  PRO A N     1 
ATOM   4580  C  CA    . PRO A 1 593 ? 48.444  156.958 62.353  1.00 23.15 ? 593  PRO A CA    1 
ATOM   4581  C  C     . PRO A 1 593 ? 47.597  158.170 62.720  1.00 22.76 ? 593  PRO A C     1 
ATOM   4582  O  O     . PRO A 1 593 ? 48.123  159.262 62.943  1.00 21.63 ? 593  PRO A O     1 
ATOM   4583  C  CB    . PRO A 1 593 ? 49.146  156.363 63.573  1.00 22.59 ? 593  PRO A CB    1 
ATOM   4584  C  CG    . PRO A 1 593 ? 50.392  155.782 62.991  1.00 23.11 ? 593  PRO A CG    1 
ATOM   4585  C  CD    . PRO A 1 593 ? 50.840  156.866 62.030  1.00 23.10 ? 593  PRO A CD    1 
ATOM   4586  N  N     . ASP A 1 594 ? 46.285  157.974 62.780  1.00 23.21 ? 594  ASP A N     1 
ATOM   4587  C  CA    . ASP A 1 594 ? 45.372  159.053 63.138  1.00 23.93 ? 594  ASP A CA    1 
ATOM   4588  C  C     . ASP A 1 594 ? 45.168  158.999 64.647  1.00 23.02 ? 594  ASP A C     1 
ATOM   4589  O  O     . ASP A 1 594 ? 44.720  159.964 65.268  1.00 24.57 ? 594  ASP A O     1 
ATOM   4590  C  CB    . ASP A 1 594 ? 44.025  158.871 62.431  1.00 26.33 ? 594  ASP A CB    1 
ATOM   4591  C  CG    . ASP A 1 594 ? 44.165  158.754 60.925  1.00 28.54 ? 594  ASP A CG    1 
ATOM   4592  O  OD1   . ASP A 1 594 ? 44.533  159.758 60.282  1.00 25.64 ? 594  ASP A OD1   1 
ATOM   4593  O  OD2   . ASP A 1 594 ? 43.918  157.650 60.386  1.00 33.25 ? 594  ASP A OD2   1 
ATOM   4594  N  N     . VAL A 1 595 ? 45.505  157.852 65.224  1.00 21.68 ? 595  VAL A N     1 
ATOM   4595  C  CA    . VAL A 1 595 ? 45.358  157.633 66.655  1.00 21.05 ? 595  VAL A CA    1 
ATOM   4596  C  C     . VAL A 1 595 ? 46.527  156.837 67.238  1.00 20.17 ? 595  VAL A C     1 
ATOM   4597  O  O     . VAL A 1 595 ? 46.969  155.845 66.655  1.00 20.09 ? 595  VAL A O     1 
ATOM   4598  C  CB    . VAL A 1 595 ? 44.063  156.849 66.964  1.00 21.93 ? 595  VAL A CB    1 
ATOM   4599  C  CG1   . VAL A 1 595 ? 43.926  156.630 68.466  1.00 22.15 ? 595  VAL A CG1   1 
ATOM   4600  C  CG2   . VAL A 1 595 ? 42.857  157.598 66.418  1.00 24.71 ? 595  VAL A CG2   1 
ATOM   4601  N  N     . LEU A 1 596 ? 47.020  157.280 68.388  1.00 17.78 ? 596  LEU A N     1 
ATOM   4602  C  CA    . LEU A 1 596 ? 48.088  156.567 69.071  1.00 17.93 ? 596  LEU A CA    1 
ATOM   4603  C  C     . LEU A 1 596 ? 47.550  156.196 70.449  1.00 18.19 ? 596  LEU A C     1 
ATOM   4604  O  O     . LEU A 1 596 ? 47.179  157.071 71.227  1.00 17.98 ? 596  LEU A O     1 
ATOM   4605  C  CB    . LEU A 1 596 ? 49.338  157.441 69.198  1.00 14.53 ? 596  LEU A CB    1 
ATOM   4606  C  CG    . LEU A 1 596 ? 50.109  157.694 67.901  1.00 15.38 ? 596  LEU A CG    1 
ATOM   4607  C  CD1   . LEU A 1 596 ? 51.227  158.682 68.163  1.00 13.44 ? 596  LEU A CD1   1 
ATOM   4608  C  CD2   . LEU A 1 596 ? 50.679  156.390 67.364  1.00 14.94 ? 596  LEU A CD2   1 
ATOM   4609  N  N     . HIS A 1 597 ? 47.473  154.897 70.728  1.00 18.18 ? 597  HIS A N     1 
ATOM   4610  C  CA    . HIS A 1 597 ? 46.974  154.398 72.010  1.00 19.05 ? 597  HIS A CA    1 
ATOM   4611  C  C     . HIS A 1 597 ? 48.139  153.830 72.811  1.00 19.56 ? 597  HIS A C     1 
ATOM   4612  O  O     . HIS A 1 597 ? 48.643  152.753 72.505  1.00 19.89 ? 597  HIS A O     1 
ATOM   4613  C  CB    . HIS A 1 597 ? 45.905  153.326 71.754  1.00 21.67 ? 597  HIS A CB    1 
ATOM   4614  C  CG    . HIS A 1 597 ? 45.392  152.643 72.990  1.00 22.92 ? 597  HIS A CG    1 
ATOM   4615  N  ND1   . HIS A 1 597 ? 44.055  152.355 73.171  1.00 21.73 ? 597  HIS A ND1   1 
ATOM   4616  C  CD2   . HIS A 1 597 ? 46.035  152.120 74.063  1.00 24.33 ? 597  HIS A CD2   1 
ATOM   4617  C  CE1   . HIS A 1 597 ? 43.897  151.685 74.297  1.00 22.60 ? 597  HIS A CE1   1 
ATOM   4618  N  NE2   . HIS A 1 597 ? 45.083  151.527 74.858  1.00 25.30 ? 597  HIS A NE2   1 
ATOM   4619  N  N     . TRP A 1 598 ? 48.570  154.569 73.830  1.00 19.57 ? 598  TRP A N     1 
ATOM   4620  C  CA    . TRP A 1 598 ? 49.679  154.139 74.675  1.00 19.63 ? 598  TRP A CA    1 
ATOM   4621  C  C     . TRP A 1 598 ? 49.184  153.067 75.633  1.00 19.86 ? 598  TRP A C     1 
ATOM   4622  O  O     . TRP A 1 598 ? 48.208  153.271 76.352  1.00 18.48 ? 598  TRP A O     1 
ATOM   4623  C  CB    . TRP A 1 598 ? 50.237  155.315 75.486  1.00 18.42 ? 598  TRP A CB    1 
ATOM   4624  C  CG    . TRP A 1 598 ? 50.464  156.561 74.687  1.00 19.93 ? 598  TRP A CG    1 
ATOM   4625  C  CD1   . TRP A 1 598 ? 49.719  157.706 74.729  1.00 18.41 ? 598  TRP A CD1   1 
ATOM   4626  C  CD2   . TRP A 1 598 ? 51.505  156.795 73.734  1.00 19.17 ? 598  TRP A CD2   1 
ATOM   4627  N  NE1   . TRP A 1 598 ? 50.231  158.637 73.866  1.00 19.29 ? 598  TRP A NE1   1 
ATOM   4628  C  CE2   . TRP A 1 598 ? 51.329  158.108 73.240  1.00 20.72 ? 598  TRP A CE2   1 
ATOM   4629  C  CE3   . TRP A 1 598 ? 52.571  156.024 73.248  1.00 19.11 ? 598  TRP A CE3   1 
ATOM   4630  C  CZ2   . TRP A 1 598 ? 52.182  158.674 72.281  1.00 21.06 ? 598  TRP A CZ2   1 
ATOM   4631  C  CZ3   . TRP A 1 598 ? 53.420  156.584 72.294  1.00 20.57 ? 598  TRP A CZ3   1 
ATOM   4632  C  CH2   . TRP A 1 598 ? 53.219  157.899 71.821  1.00 20.28 ? 598  TRP A CH2   1 
ATOM   4633  N  N     . THR A 1 599 ? 49.862  151.927 75.648  1.00 21.60 ? 599  THR A N     1 
ATOM   4634  C  CA    . THR A 1 599 ? 49.457  150.841 76.520  1.00 25.53 ? 599  THR A CA    1 
ATOM   4635  C  C     . THR A 1 599 ? 50.633  149.918 76.835  1.00 28.69 ? 599  THR A C     1 
ATOM   4636  O  O     . THR A 1 599 ? 51.557  149.777 76.032  1.00 28.54 ? 599  THR A O     1 
ATOM   4637  C  CB    . THR A 1 599 ? 48.307  150.031 75.862  1.00 24.71 ? 599  THR A CB    1 
ATOM   4638  O  OG1   . THR A 1 599 ? 47.818  149.042 76.780  1.00 24.50 ? 599  THR A OG1   1 
ATOM   4639  C  CG2   . THR A 1 599 ? 48.791  149.355 74.590  1.00 25.02 ? 599  THR A CG2   1 
ATOM   4640  N  N     . ASP A 1 600 ? 50.602  149.317 78.022  1.00 32.37 ? 600  ASP A N     1 
ATOM   4641  C  CA    . ASP A 1 600 ? 51.644  148.383 78.447  1.00 35.31 ? 600  ASP A CA    1 
ATOM   4642  C  C     . ASP A 1 600 ? 50.985  147.015 78.537  1.00 36.84 ? 600  ASP A C     1 
ATOM   4643  O  O     . ASP A 1 600 ? 51.500  146.105 79.189  1.00 37.56 ? 600  ASP A O     1 
ATOM   4644  C  CB    . ASP A 1 600 ? 52.202  148.760 79.826  1.00 37.01 ? 600  ASP A CB    1 
ATOM   4645  C  CG    . ASP A 1 600 ? 52.990  150.059 79.810  1.00 40.29 ? 600  ASP A CG    1 
ATOM   4646  O  OD1   . ASP A 1 600 ? 53.979  150.155 79.048  1.00 43.71 ? 600  ASP A OD1   1 
ATOM   4647  O  OD2   . ASP A 1 600 ? 52.623  150.983 80.570  1.00 39.74 ? 600  ASP A OD2   1 
ATOM   4648  N  N     . SER A 1 601 ? 49.838  146.876 77.880  1.00 37.04 ? 601  SER A N     1 
ATOM   4649  C  CA    . SER A 1 601 ? 49.102  145.624 77.908  1.00 38.14 ? 601  SER A CA    1 
ATOM   4650  C  C     . SER A 1 601 ? 48.576  145.160 76.548  1.00 36.91 ? 601  SER A C     1 
ATOM   4651  O  O     . SER A 1 601 ? 47.374  145.182 76.296  1.00 38.35 ? 601  SER A O     1 
ATOM   4652  C  CB    . SER A 1 601 ? 47.945  145.741 78.904  1.00 38.91 ? 601  SER A CB    1 
ATOM   4653  O  OG    . SER A 1 601 ? 47.143  146.877 78.617  1.00 39.36 ? 601  SER A OG    1 
ATOM   4654  N  N     . LEU A 1 602 ? 49.475  144.728 75.672  1.00 35.33 ? 602  LEU A N     1 
ATOM   4655  C  CA    . LEU A 1 602 ? 49.058  144.237 74.361  1.00 34.17 ? 602  LEU A CA    1 
ATOM   4656  C  C     . LEU A 1 602 ? 48.543  142.806 74.496  1.00 34.27 ? 602  LEU A C     1 
ATOM   4657  O  O     . LEU A 1 602 ? 49.182  141.960 75.127  1.00 33.05 ? 602  LEU A O     1 
ATOM   4658  C  CB    . LEU A 1 602 ? 50.230  144.270 73.366  1.00 31.61 ? 602  LEU A CB    1 
ATOM   4659  C  CG    . LEU A 1 602 ? 50.627  145.624 72.774  1.00 29.92 ? 602  LEU A CG    1 
ATOM   4660  C  CD1   . LEU A 1 602 ? 51.863  145.466 71.912  1.00 28.07 ? 602  LEU A CD1   1 
ATOM   4661  C  CD2   . LEU A 1 602 ? 49.470  146.179 71.955  1.00 27.17 ? 602  LEU A CD2   1 
ATOM   4662  N  N     . PRO A 1 603 ? 47.368  142.519 73.915  1.00 34.38 ? 603  PRO A N     1 
ATOM   4663  C  CA    . PRO A 1 603 ? 46.803  141.170 73.991  1.00 35.88 ? 603  PRO A CA    1 
ATOM   4664  C  C     . PRO A 1 603 ? 47.674  140.167 73.235  1.00 37.33 ? 603  PRO A C     1 
ATOM   4665  O  O     . PRO A 1 603 ? 48.016  140.381 72.071  1.00 39.16 ? 603  PRO A O     1 
ATOM   4666  C  CB    . PRO A 1 603 ? 45.424  141.345 73.365  1.00 35.47 ? 603  PRO A CB    1 
ATOM   4667  C  CG    . PRO A 1 603 ? 45.644  142.442 72.369  1.00 34.41 ? 603  PRO A CG    1 
ATOM   4668  C  CD    . PRO A 1 603 ? 46.479  143.416 73.159  1.00 34.50 ? 603  PRO A CD    1 
ATOM   4669  N  N     . LYS A 1 604 ? 48.038  139.077 73.900  1.00 37.39 ? 604  LYS A N     1 
ATOM   4670  C  CA    . LYS A 1 604 ? 48.877  138.063 73.269  1.00 38.14 ? 604  LYS A CA    1 
ATOM   4671  C  C     . LYS A 1 604 ? 48.439  136.642 73.603  1.00 39.01 ? 604  LYS A C     1 
ATOM   4672  O  O     . LYS A 1 604 ? 47.584  136.423 74.467  1.00 39.26 ? 604  LYS A O     1 
ATOM   4673  C  CB    . LYS A 1 604 ? 50.338  138.245 73.697  1.00 37.35 ? 604  LYS A CB    1 
ATOM   4674  C  CG    . LYS A 1 604 ? 50.935  139.603 73.363  1.00 38.13 ? 604  LYS A CG    1 
ATOM   4675  C  CD    . LYS A 1 604 ? 52.409  139.644 73.728  1.00 38.83 ? 604  LYS A CD    1 
ATOM   4676  C  CE    . LYS A 1 604 ? 53.016  141.013 73.486  1.00 38.41 ? 604  LYS A CE    1 
ATOM   4677  N  NZ    . LYS A 1 604 ? 54.471  141.013 73.805  1.00 40.49 ? 604  LYS A NZ    1 
ATOM   4678  N  N     . THR A 1 605 ? 49.029  135.681 72.897  1.00 38.90 ? 605  THR A N     1 
ATOM   4679  C  CA    . THR A 1 605 ? 48.745  134.266 73.108  1.00 38.51 ? 605  THR A CA    1 
ATOM   4680  C  C     . THR A 1 605 ? 49.905  133.697 73.907  1.00 38.18 ? 605  THR A C     1 
ATOM   4681  O  O     . THR A 1 605 ? 51.014  134.236 73.877  1.00 36.29 ? 605  THR A O     1 
ATOM   4682  C  CB    . THR A 1 605 ? 48.670  133.491 71.782  1.00 38.52 ? 605  THR A CB    1 
ATOM   4683  O  OG1   . THR A 1 605 ? 49.938  133.570 71.116  1.00 39.68 ? 605  THR A OG1   1 
ATOM   4684  C  CG2   . THR A 1 605 ? 47.575  134.066 70.888  1.00 36.87 ? 605  THR A CG2   1 
ATOM   4685  N  N     . ARG A 1 606 ? 49.654  132.598 74.606  1.00 37.85 ? 606  ARG A N     1 
ATOM   4686  C  CA    . ARG A 1 606 ? 50.682  131.975 75.422  1.00 37.71 ? 606  ARG A CA    1 
ATOM   4687  C  C     . ARG A 1 606 ? 51.962  131.673 74.650  1.00 37.89 ? 606  ARG A C     1 
ATOM   4688  O  O     . ARG A 1 606 ? 53.033  131.533 75.247  1.00 36.66 ? 606  ARG A O     1 
ATOM   4689  C  CB    . ARG A 1 606 ? 50.129  130.705 76.061  1.00 38.21 ? 606  ARG A CB    1 
ATOM   4690  C  CG    . ARG A 1 606 ? 48.961  130.972 76.978  1.00 38.35 ? 606  ARG A CG    1 
ATOM   4691  C  CD    . ARG A 1 606 ? 48.430  129.694 77.589  1.00 42.25 ? 606  ARG A CD    1 
ATOM   4692  N  NE    . ARG A 1 606 ? 47.285  129.944 78.457  1.00 45.17 ? 606  ARG A NE    1 
ATOM   4693  C  CZ    . ARG A 1 606 ? 46.127  130.458 78.046  1.00 48.46 ? 606  ARG A CZ    1 
ATOM   4694  N  NH1   . ARG A 1 606 ? 45.953  130.786 76.769  1.00 49.54 ? 606  ARG A NH1   1 
ATOM   4695  N  NH2   . ARG A 1 606 ? 45.137  130.641 78.914  1.00 50.59 ? 606  ARG A NH2   1 
ATOM   4696  N  N     . SER A 1 607 ? 51.857  131.589 73.326  1.00 37.91 ? 607  SER A N     1 
ATOM   4697  C  CA    . SER A 1 607 ? 53.021  131.308 72.486  1.00 38.52 ? 607  SER A CA    1 
ATOM   4698  C  C     . SER A 1 607 ? 53.826  132.578 72.228  1.00 38.55 ? 607  SER A C     1 
ATOM   4699  O  O     . SER A 1 607 ? 54.966  132.522 71.770  1.00 38.42 ? 607  SER A O     1 
ATOM   4700  C  CB    . SER A 1 607 ? 52.577  130.688 71.160  1.00 39.74 ? 607  SER A CB    1 
ATOM   4701  N  N     . GLY A 1 608 ? 53.216  133.724 72.515  1.00 39.82 ? 608  GLY A N     1 
ATOM   4702  C  CA    . GLY A 1 608 ? 53.896  134.994 72.321  1.00 40.59 ? 608  GLY A CA    1 
ATOM   4703  C  C     . GLY A 1 608 ? 53.363  135.848 71.183  1.00 41.12 ? 608  GLY A C     1 
ATOM   4704  O  O     . GLY A 1 608 ? 53.658  137.041 71.112  1.00 40.92 ? 608  GLY A O     1 
ATOM   4705  N  N     . LYS A 1 609 ? 52.581  135.249 70.291  1.00 41.56 ? 609  LYS A N     1 
ATOM   4706  C  CA    . LYS A 1 609 ? 52.031  135.976 69.154  1.00 42.48 ? 609  LYS A CA    1 
ATOM   4707  C  C     . LYS A 1 609 ? 50.914  136.913 69.606  1.00 43.21 ? 609  LYS A C     1 
ATOM   4708  O  O     . LYS A 1 609 ? 50.165  136.598 70.534  1.00 43.43 ? 609  LYS A O     1 
ATOM   4709  C  CB    . LYS A 1 609 ? 51.508  134.993 68.109  1.00 41.09 ? 609  LYS A CB    1 
ATOM   4710  N  N     . ILE A 1 610 ? 50.803  138.062 68.943  1.00 43.29 ? 610  ILE A N     1 
ATOM   4711  C  CA    . ILE A 1 610 ? 49.783  139.048 69.284  1.00 43.61 ? 610  ILE A CA    1 
ATOM   4712  C  C     . ILE A 1 610 ? 48.484  138.849 68.513  1.00 43.57 ? 610  ILE A C     1 
ATOM   4713  O  O     . ILE A 1 610 ? 48.498  138.649 67.298  1.00 44.56 ? 610  ILE A O     1 
ATOM   4714  C  CB    . ILE A 1 610 ? 50.292  140.483 69.034  1.00 42.95 ? 610  ILE A CB    1 
ATOM   4715  C  CG1   . ILE A 1 610 ? 49.143  141.475 69.197  1.00 40.82 ? 610  ILE A CG1   1 
ATOM   4716  C  CG2   . ILE A 1 610 ? 50.910  140.587 67.647  1.00 43.50 ? 610  ILE A CG2   1 
ATOM   4717  C  CD1   . ILE A 1 610 ? 49.594  142.899 69.219  1.00 40.30 ? 610  ILE A CD1   1 
ATOM   4718  N  N     . MET A 1 611 ? 47.368  138.915 69.237  1.00 42.72 ? 611  MET A N     1 
ATOM   4719  C  CA    . MET A 1 611 ? 46.044  138.742 68.650  1.00 42.97 ? 611  MET A CA    1 
ATOM   4720  C  C     . MET A 1 611 ? 45.418  140.087 68.274  1.00 43.41 ? 611  MET A C     1 
ATOM   4721  O  O     . MET A 1 611 ? 44.890  140.797 69.135  1.00 44.36 ? 611  MET A O     1 
ATOM   4722  C  CB    . MET A 1 611 ? 45.139  138.001 69.633  1.00 44.18 ? 611  MET A CB    1 
ATOM   4723  N  N     . ARG A 1 612 ? 45.466  140.428 66.988  1.00 41.69 ? 612  ARG A N     1 
ATOM   4724  C  CA    . ARG A 1 612 ? 44.913  141.693 66.510  1.00 39.71 ? 612  ARG A CA    1 
ATOM   4725  C  C     . ARG A 1 612 ? 43.398  141.685 66.337  1.00 38.76 ? 612  ARG A C     1 
ATOM   4726  O  O     . ARG A 1 612 ? 42.806  142.709 66.008  1.00 38.72 ? 612  ARG A O     1 
ATOM   4727  C  CB    . ARG A 1 612 ? 45.571  142.094 65.183  1.00 39.56 ? 612  ARG A CB    1 
ATOM   4728  C  CG    . ARG A 1 612 ? 47.081  142.222 65.259  1.00 39.62 ? 612  ARG A CG    1 
ATOM   4729  C  CD    . ARG A 1 612 ? 47.650  142.949 64.054  1.00 39.39 ? 612  ARG A CD    1 
ATOM   4730  N  NE    . ARG A 1 612 ? 49.108  142.975 64.099  1.00 40.03 ? 612  ARG A NE    1 
ATOM   4731  C  CZ    . ARG A 1 612 ? 49.871  141.890 64.010  1.00 42.55 ? 612  ARG A CZ    1 
ATOM   4732  N  NH1   . ARG A 1 612 ? 49.311  140.694 63.867  1.00 42.95 ? 612  ARG A NH1   1 
ATOM   4733  N  NH2   . ARG A 1 612 ? 51.194  141.995 64.069  1.00 42.71 ? 612  ARG A NH2   1 
ATOM   4734  N  N     . ARG A 1 613 ? 42.769  140.538 66.564  1.00 37.88 ? 613  ARG A N     1 
ATOM   4735  C  CA    . ARG A 1 613 ? 41.320  140.432 66.422  1.00 37.93 ? 613  ARG A CA    1 
ATOM   4736  C  C     . ARG A 1 613 ? 40.617  141.255 67.497  1.00 37.38 ? 613  ARG A C     1 
ATOM   4737  O  O     . ARG A 1 613 ? 39.739  142.074 67.204  1.00 36.85 ? 613  ARG A O     1 
ATOM   4738  C  CB    . ARG A 1 613 ? 40.889  138.965 66.517  1.00 39.23 ? 613  ARG A CB    1 
ATOM   4739  N  N     . ILE A 1 614 ? 41.012  141.026 68.744  1.00 36.63 ? 614  ILE A N     1 
ATOM   4740  C  CA    . ILE A 1 614 ? 40.433  141.733 69.877  1.00 35.82 ? 614  ILE A CA    1 
ATOM   4741  C  C     . ILE A 1 614 ? 40.777  143.234 69.802  1.00 34.15 ? 614  ILE A C     1 
ATOM   4742  O  O     . ILE A 1 614 ? 39.979  144.089 70.196  1.00 33.76 ? 614  ILE A O     1 
ATOM   4743  C  CB    . ILE A 1 614 ? 40.944  141.115 71.210  1.00 36.59 ? 614  ILE A CB    1 
ATOM   4744  C  CG1   . ILE A 1 614 ? 40.281  141.804 72.401  1.00 37.17 ? 614  ILE A CG1   1 
ATOM   4745  C  CG2   . ILE A 1 614 ? 42.460  141.191 71.278  1.00 36.61 ? 614  ILE A CG2   1 
ATOM   4746  C  CD1   . ILE A 1 614 ? 38.824  141.441 72.560  1.00 40.45 ? 614  ILE A CD1   1 
ATOM   4747  N  N     . LEU A 1 615 ? 41.956  143.549 69.273  1.00 31.60 ? 615  LEU A N     1 
ATOM   4748  C  CA    . LEU A 1 615 ? 42.385  144.940 69.146  1.00 30.08 ? 615  LEU A CA    1 
ATOM   4749  C  C     . LEU A 1 615 ? 41.532  145.694 68.128  1.00 30.81 ? 615  LEU A C     1 
ATOM   4750  O  O     . LEU A 1 615 ? 41.185  146.856 68.326  1.00 30.50 ? 615  LEU A O     1 
ATOM   4751  C  CB    . LEU A 1 615 ? 43.854  145.002 68.725  1.00 27.20 ? 615  LEU A CB    1 
ATOM   4752  C  CG    . LEU A 1 615 ? 44.877  144.560 69.772  1.00 27.30 ? 615  LEU A CG    1 
ATOM   4753  C  CD1   . LEU A 1 615 ? 46.262  144.500 69.146  1.00 26.86 ? 615  LEU A CD1   1 
ATOM   4754  C  CD2   . LEU A 1 615 ? 44.865  145.531 70.939  1.00 25.90 ? 615  LEU A CD2   1 
ATOM   4755  N  N     . ARG A 1 616 ? 41.191  145.012 67.041  1.00 31.25 ? 616  ARG A N     1 
ATOM   4756  C  CA    . ARG A 1 616 ? 40.385  145.597 65.984  1.00 30.60 ? 616  ARG A CA    1 
ATOM   4757  C  C     . ARG A 1 616 ? 38.993  145.943 66.510  1.00 30.20 ? 616  ARG A C     1 
ATOM   4758  O  O     . ARG A 1 616 ? 38.401  146.954 66.117  1.00 28.83 ? 616  ARG A O     1 
ATOM   4759  C  CB    . ARG A 1 616 ? 40.291  144.611 64.819  1.00 32.48 ? 616  ARG A CB    1 
ATOM   4760  C  CG    . ARG A 1 616 ? 39.930  145.244 63.487  1.00 37.17 ? 616  ARG A CG    1 
ATOM   4761  C  CD    . ARG A 1 616 ? 40.115  144.258 62.326  1.00 38.60 ? 616  ARG A CD    1 
ATOM   4762  N  NE    . ARG A 1 616 ? 41.518  143.887 62.113  1.00 39.25 ? 616  ARG A NE    1 
ATOM   4763  C  CZ    . ARG A 1 616 ? 42.061  142.731 62.486  1.00 38.32 ? 616  ARG A CZ    1 
ATOM   4764  N  NH1   . ARG A 1 616 ? 41.318  141.815 63.098  1.00 37.38 ? 616  ARG A NH1   1 
ATOM   4765  N  NH2   . ARG A 1 616 ? 43.344  142.487 62.242  1.00 37.14 ? 616  ARG A NH2   1 
ATOM   4766  N  N     . LYS A 1 617 ? 38.487  145.110 67.418  1.00 29.80 ? 617  LYS A N     1 
ATOM   4767  C  CA    . LYS A 1 617 ? 37.170  145.321 68.007  1.00 29.01 ? 617  LYS A CA    1 
ATOM   4768  C  C     . LYS A 1 617 ? 37.135  146.571 68.883  1.00 28.71 ? 617  LYS A C     1 
ATOM   4769  O  O     . LYS A 1 617 ? 36.354  147.494 68.644  1.00 28.70 ? 617  LYS A O     1 
ATOM   4770  C  CB    . LYS A 1 617 ? 36.769  144.101 68.822  1.00 28.61 ? 617  LYS A CB    1 
ATOM   4771  N  N     . ILE A 1 618 ? 37.993  146.598 69.893  1.00 29.51 ? 618  ILE A N     1 
ATOM   4772  C  CA    . ILE A 1 618 ? 38.067  147.725 70.811  1.00 28.95 ? 618  ILE A CA    1 
ATOM   4773  C  C     . ILE A 1 618 ? 38.256  149.047 70.059  1.00 28.91 ? 618  ILE A C     1 
ATOM   4774  O  O     . ILE A 1 618 ? 37.496  149.995 70.250  1.00 28.59 ? 618  ILE A O     1 
ATOM   4775  C  CB    . ILE A 1 618 ? 39.226  147.517 71.820  1.00 29.68 ? 618  ILE A CB    1 
ATOM   4776  C  CG1   . ILE A 1 618 ? 39.012  146.201 72.579  1.00 31.07 ? 618  ILE A CG1   1 
ATOM   4777  C  CG2   . ILE A 1 618 ? 39.299  148.682 72.790  1.00 30.55 ? 618  ILE A CG2   1 
ATOM   4778  C  CD1   . ILE A 1 618 ? 40.108  145.853 73.577  1.00 30.48 ? 618  ILE A CD1   1 
ATOM   4779  N  N     . ALA A 1 619 ? 39.262  149.105 69.195  1.00 29.24 ? 619  ALA A N     1 
ATOM   4780  C  CA    . ALA A 1 619 ? 39.541  150.319 68.433  1.00 28.80 ? 619  ALA A CA    1 
ATOM   4781  C  C     . ALA A 1 619 ? 38.323  150.859 67.690  1.00 29.51 ? 619  ALA A C     1 
ATOM   4782  O  O     . ALA A 1 619 ? 38.158  152.069 67.563  1.00 28.70 ? 619  ALA A O     1 
ATOM   4783  C  CB    . ALA A 1 619 ? 40.665  150.061 67.452  1.00 28.80 ? 619  ALA A CB    1 
ATOM   4784  N  N     . ALA A 1 620 ? 37.475  149.961 67.197  1.00 30.73 ? 620  ALA A N     1 
ATOM   4785  C  CA    . ALA A 1 620 ? 36.280  150.361 66.462  1.00 31.36 ? 620  ALA A CA    1 
ATOM   4786  C  C     . ALA A 1 620 ? 35.230  150.968 67.391  1.00 32.71 ? 620  ALA A C     1 
ATOM   4787  O  O     . ALA A 1 620 ? 34.517  151.896 67.008  1.00 32.86 ? 620  ALA A O     1 
ATOM   4788  C  CB    . ALA A 1 620 ? 35.695  149.155 65.715  1.00 30.89 ? 620  ALA A CB    1 
ATOM   4789  N  N     . GLY A 1 621 ? 35.127  150.435 68.606  1.00 33.44 ? 621  GLY A N     1 
ATOM   4790  C  CA    . GLY A 1 621 ? 34.161  150.956 69.560  1.00 33.76 ? 621  GLY A CA    1 
ATOM   4791  C  C     . GLY A 1 621 ? 33.385  149.883 70.310  1.00 36.05 ? 621  GLY A C     1 
ATOM   4792  O  O     . GLY A 1 621 ? 32.573  150.196 71.179  1.00 36.89 ? 621  GLY A O     1 
ATOM   4793  N  N     . ASP A 1 622 ? 33.628  148.620 69.975  1.00 36.21 ? 622  ASP A N     1 
ATOM   4794  C  CA    . ASP A 1 622 ? 32.946  147.504 70.624  1.00 37.63 ? 622  ASP A CA    1 
ATOM   4795  C  C     . ASP A 1 622 ? 33.345  147.402 72.095  1.00 38.53 ? 622  ASP A C     1 
ATOM   4796  O  O     . ASP A 1 622 ? 32.606  147.837 72.980  1.00 40.58 ? 622  ASP A O     1 
ATOM   4797  C  CB    . ASP A 1 622 ? 33.288  146.192 69.909  1.00 36.82 ? 622  ASP A CB    1 
ATOM   4798  C  CG    . ASP A 1 622 ? 32.858  146.189 68.453  1.00 37.20 ? 622  ASP A CG    1 
ATOM   4799  O  OD1   . ASP A 1 622 ? 32.480  147.264 67.940  1.00 36.88 ? 622  ASP A OD1   1 
ATOM   4800  O  OD2   . ASP A 1 622 ? 32.907  145.112 67.820  1.00 38.09 ? 622  ASP A OD2   1 
ATOM   4801  N  N     . LEU A 1 632 ? 45.389  134.621 74.789  1.00 43.40 ? 632  LEU A N     1 
ATOM   4802  C  CA    . LEU A 1 632 ? 44.698  134.880 76.051  1.00 43.28 ? 632  LEU A CA    1 
ATOM   4803  C  C     . LEU A 1 632 ? 45.647  134.715 77.241  1.00 42.84 ? 632  LEU A C     1 
ATOM   4804  O  O     . LEU A 1 632 ? 45.205  134.519 78.371  1.00 42.43 ? 632  LEU A O     1 
ATOM   4805  C  CB    . LEU A 1 632 ? 43.510  133.931 76.194  1.00 43.57 ? 632  LEU A CB    1 
ATOM   4806  N  N     . ALA A 1 633 ? 46.949  134.803 76.971  1.00 42.49 ? 633  ALA A N     1 
ATOM   4807  C  CA    . ALA A 1 633 ? 47.986  134.665 77.996  1.00 40.89 ? 633  ALA A CA    1 
ATOM   4808  C  C     . ALA A 1 633 ? 47.763  135.564 79.212  1.00 40.65 ? 633  ALA A C     1 
ATOM   4809  O  O     . ALA A 1 633 ? 48.464  135.450 80.217  1.00 40.78 ? 633  ALA A O     1 
ATOM   4810  C  CB    . ALA A 1 633 ? 49.357  134.946 77.388  1.00 40.85 ? 633  ALA A CB    1 
ATOM   4811  N  N     . ASP A 1 634 ? 46.795  136.466 79.109  1.00 40.54 ? 634  ASP A N     1 
ATOM   4812  C  CA    . ASP A 1 634 ? 46.447  137.370 80.201  1.00 40.32 ? 634  ASP A CA    1 
ATOM   4813  C  C     . ASP A 1 634 ? 45.212  138.151 79.804  1.00 40.51 ? 634  ASP A C     1 
ATOM   4814  O  O     . ASP A 1 634 ? 45.301  139.274 79.298  1.00 40.22 ? 634  ASP A O     1 
ATOM   4815  C  CB    . ASP A 1 634 ? 47.593  138.329 80.518  1.00 40.16 ? 634  ASP A CB    1 
ATOM   4816  C  CG    . ASP A 1 634 ? 47.257  139.272 81.658  1.00 40.71 ? 634  ASP A CG    1 
ATOM   4817  O  OD1   . ASP A 1 634 ? 46.633  138.814 82.639  1.00 41.11 ? 634  ASP A OD1   1 
ATOM   4818  O  OD2   . ASP A 1 634 ? 47.621  140.464 81.581  1.00 40.73 ? 634  ASP A OD2   1 
ATOM   4819  N  N     . PRO A 1 635 ? 44.056  137.535 80.033  1.00 40.41 ? 635  PRO A N     1 
ATOM   4820  C  CA    . PRO A 1 635 ? 42.769  138.126 79.695  1.00 39.64 ? 635  PRO A CA    1 
ATOM   4821  C  C     . PRO A 1 635 ? 42.537  139.464 80.384  1.00 38.78 ? 635  PRO A C     1 
ATOM   4822  O  O     . PRO A 1 635 ? 41.597  140.185 80.050  1.00 39.42 ? 635  PRO A O     1 
ATOM   4823  C  CB    . PRO A 1 635 ? 41.647  137.153 80.051  1.00 40.71 ? 635  PRO A CB    1 
ATOM   4824  N  N     . GLY A 1 636 ? 43.394  139.793 81.345  1.00 37.53 ? 636  GLY A N     1 
ATOM   4825  C  CA    . GLY A 1 636 ? 43.245  141.047 82.056  1.00 37.24 ? 636  GLY A CA    1 
ATOM   4826  C  C     . GLY A 1 636 ? 43.435  142.267 81.170  1.00 36.94 ? 636  GLY A C     1 
ATOM   4827  O  O     . GLY A 1 636 ? 42.818  143.310 81.402  1.00 37.78 ? 636  GLY A O     1 
ATOM   4828  N  N     . VAL A 1 637 ? 44.280  142.134 80.149  1.00 35.52 ? 637  VAL A N     1 
ATOM   4829  C  CA    . VAL A 1 637 ? 44.569  143.236 79.238  1.00 34.43 ? 637  VAL A CA    1 
ATOM   4830  C  C     . VAL A 1 637 ? 43.327  143.832 78.577  1.00 35.03 ? 637  VAL A C     1 
ATOM   4831  O  O     . VAL A 1 637 ? 43.280  145.035 78.318  1.00 34.80 ? 637  VAL A O     1 
ATOM   4832  C  CB    . VAL A 1 637 ? 45.551  142.804 78.120  1.00 33.18 ? 637  VAL A CB    1 
ATOM   4833  C  CG1   . VAL A 1 637 ? 46.865  142.342 78.728  1.00 32.83 ? 637  VAL A CG1   1 
ATOM   4834  C  CG2   . VAL A 1 637 ? 44.936  141.705 77.279  1.00 31.84 ? 637  VAL A CG2   1 
ATOM   4835  N  N     . VAL A 1 638 ? 42.324  142.996 78.313  1.00 34.50 ? 638  VAL A N     1 
ATOM   4836  C  CA    . VAL A 1 638 ? 41.106  143.469 77.666  1.00 35.27 ? 638  VAL A CA    1 
ATOM   4837  C  C     . VAL A 1 638 ? 40.419  144.583 78.441  1.00 37.03 ? 638  VAL A C     1 
ATOM   4838  O  O     . VAL A 1 638 ? 40.110  145.637 77.883  1.00 37.95 ? 638  VAL A O     1 
ATOM   4839  C  CB    . VAL A 1 638 ? 40.085  142.334 77.458  1.00 34.86 ? 638  VAL A CB    1 
ATOM   4840  C  CG1   . VAL A 1 638 ? 38.908  142.847 76.627  1.00 32.42 ? 638  VAL A CG1   1 
ATOM   4841  C  CG2   . VAL A 1 638 ? 40.749  141.159 76.771  1.00 33.47 ? 638  VAL A CG2   1 
ATOM   4842  N  N     . GLU A 1 639 ? 40.179  144.350 79.728  1.00 38.66 ? 639  GLU A N     1 
ATOM   4843  C  CA    . GLU A 1 639 ? 39.521  145.351 80.560  1.00 38.78 ? 639  GLU A CA    1 
ATOM   4844  C  C     . GLU A 1 639 ? 40.343  146.635 80.617  1.00 37.66 ? 639  GLU A C     1 
ATOM   4845  O  O     . GLU A 1 639 ? 39.792  147.729 80.510  1.00 38.45 ? 639  GLU A O     1 
ATOM   4846  C  CB    . GLU A 1 639 ? 39.298  144.805 81.975  1.00 40.84 ? 639  GLU A CB    1 
ATOM   4847  C  CG    . GLU A 1 639 ? 38.512  145.739 82.896  1.00 43.38 ? 639  GLU A CG    1 
ATOM   4848  C  CD    . GLU A 1 639 ? 37.304  146.371 82.206  1.00 44.82 ? 639  GLU A CD    1 
ATOM   4849  O  OE1   . GLU A 1 639 ? 36.614  145.666 81.431  1.00 44.20 ? 639  GLU A OE1   1 
ATOM   4850  O  OE2   . GLU A 1 639 ? 37.044  147.574 82.445  1.00 44.93 ? 639  GLU A OE2   1 
ATOM   4851  N  N     . LYS A 1 640 ? 41.657  146.501 80.784  1.00 35.43 ? 640  LYS A N     1 
ATOM   4852  C  CA    . LYS A 1 640 ? 42.528  147.670 80.835  1.00 33.57 ? 640  LYS A CA    1 
ATOM   4853  C  C     . LYS A 1 640 ? 42.475  148.419 79.501  1.00 33.71 ? 640  LYS A C     1 
ATOM   4854  O  O     . LYS A 1 640 ? 42.337  149.645 79.471  1.00 32.49 ? 640  LYS A O     1 
ATOM   4855  C  CB    . LYS A 1 640 ? 43.958  147.249 81.147  1.00 31.93 ? 640  LYS A CB    1 
ATOM   4856  N  N     . LEU A 1 641 ? 42.579  147.675 78.400  1.00 33.01 ? 641  LEU A N     1 
ATOM   4857  C  CA    . LEU A 1 641 ? 42.540  148.257 77.061  1.00 33.01 ? 641  LEU A CA    1 
ATOM   4858  C  C     . LEU A 1 641 ? 41.226  148.992 76.820  1.00 33.87 ? 641  LEU A C     1 
ATOM   4859  O  O     . LEU A 1 641 ? 41.205  150.086 76.252  1.00 34.00 ? 641  LEU A O     1 
ATOM   4860  C  CB    . LEU A 1 641 ? 42.719  147.162 76.003  1.00 31.69 ? 641  LEU A CB    1 
ATOM   4861  C  CG    . LEU A 1 641 ? 44.099  146.505 75.952  1.00 31.46 ? 641  LEU A CG    1 
ATOM   4862  C  CD1   . LEU A 1 641 ? 44.083  145.315 75.011  1.00 30.10 ? 641  LEU A CD1   1 
ATOM   4863  C  CD2   . LEU A 1 641 ? 45.129  147.533 75.506  1.00 31.45 ? 641  LEU A CD2   1 
ATOM   4864  N  N     . LEU A 1 642 ? 40.132  148.378 77.256  1.00 35.91 ? 642  LEU A N     1 
ATOM   4865  C  CA    . LEU A 1 642 ? 38.802  148.955 77.100  1.00 36.90 ? 642  LEU A CA    1 
ATOM   4866  C  C     . LEU A 1 642 ? 38.689  150.328 77.741  1.00 35.76 ? 642  LEU A C     1 
ATOM   4867  O  O     . LEU A 1 642 ? 38.046  151.223 77.200  1.00 37.28 ? 642  LEU A O     1 
ATOM   4868  C  CB    . LEU A 1 642 ? 37.756  148.028 77.716  1.00 37.92 ? 642  LEU A CB    1 
ATOM   4869  C  CG    . LEU A 1 642 ? 37.460  146.766 76.916  1.00 38.87 ? 642  LEU A CG    1 
ATOM   4870  C  CD1   . LEU A 1 642 ? 36.955  145.673 77.846  1.00 40.47 ? 642  LEU A CD1   1 
ATOM   4871  C  CD2   . LEU A 1 642 ? 36.447  147.090 75.826  1.00 40.35 ? 642  LEU A CD2   1 
ATOM   4872  N  N     . GLU A 1 643 ? 39.311  150.491 78.898  1.00 35.78 ? 643  GLU A N     1 
ATOM   4873  C  CA    . GLU A 1 643 ? 39.249  151.763 79.592  1.00 36.81 ? 643  GLU A CA    1 
ATOM   4874  C  C     . GLU A 1 643 ? 40.184  152.798 78.983  1.00 36.58 ? 643  GLU A C     1 
ATOM   4875  O  O     . GLU A 1 643 ? 39.790  153.947 78.778  1.00 36.70 ? 643  GLU A O     1 
ATOM   4876  C  CB    . GLU A 1 643 ? 39.545  151.552 81.075  1.00 39.43 ? 643  GLU A CB    1 
ATOM   4877  C  CG    . GLU A 1 643 ? 38.437  150.775 81.776  1.00 43.71 ? 643  GLU A CG    1 
ATOM   4878  C  CD    . GLU A 1 643 ? 38.641  150.668 83.277  1.00 47.19 ? 643  GLU A CD    1 
ATOM   4879  O  OE1   . GLU A 1 643 ? 38.972  151.702 83.903  1.00 49.23 ? 643  GLU A OE1   1 
ATOM   4880  O  OE2   . GLU A 1 643 ? 38.460  149.558 83.832  1.00 47.14 ? 643  GLU A OE2   1 
ATOM   4881  N  N     . GLU A 1 644 ? 41.411  152.391 78.675  1.00 36.23 ? 644  GLU A N     1 
ATOM   4882  C  CA    . GLU A 1 644 ? 42.368  153.314 78.074  1.00 36.81 ? 644  GLU A CA    1 
ATOM   4883  C  C     . GLU A 1 644 ? 41.749  153.897 76.810  1.00 37.02 ? 644  GLU A C     1 
ATOM   4884  O  O     . GLU A 1 644 ? 41.961  155.061 76.478  1.00 36.99 ? 644  GLU A O     1 
ATOM   4885  C  CB    . GLU A 1 644 ? 43.664  152.585 77.716  1.00 36.48 ? 644  GLU A CB    1 
ATOM   4886  C  CG    . GLU A 1 644 ? 44.271  151.800 78.862  1.00 37.57 ? 644  GLU A CG    1 
ATOM   4887  C  CD    . GLU A 1 644 ? 45.572  151.126 78.475  1.00 38.61 ? 644  GLU A CD    1 
ATOM   4888  O  OE1   . GLU A 1 644 ? 45.613  150.483 77.404  1.00 39.47 ? 644  GLU A OE1   1 
ATOM   4889  O  OE2   . GLU A 1 644 ? 46.551  151.233 79.242  1.00 38.43 ? 644  GLU A OE2   1 
ATOM   4890  N  N     . LYS A 1 645 ? 40.975  153.068 76.117  1.00 38.23 ? 645  LYS A N     1 
ATOM   4891  C  CA    . LYS A 1 645 ? 40.311  153.469 74.881  1.00 39.02 ? 645  LYS A CA    1 
ATOM   4892  C  C     . LYS A 1 645 ? 39.174  154.446 75.194  1.00 40.08 ? 645  LYS A C     1 
ATOM   4893  O  O     . LYS A 1 645 ? 38.952  155.413 74.460  1.00 39.98 ? 645  LYS A O     1 
ATOM   4894  C  CB    . LYS A 1 645 ? 39.766  152.223 74.172  1.00 39.40 ? 645  LYS A CB    1 
ATOM   4895  C  CG    . LYS A 1 645 ? 39.491  152.386 72.683  1.00 39.73 ? 645  LYS A CG    1 
ATOM   4896  C  CD    . LYS A 1 645 ? 38.287  153.261 72.411  1.00 40.85 ? 645  LYS A CD    1 
ATOM   4897  C  CE    . LYS A 1 645 ? 38.032  153.399 70.915  1.00 40.45 ? 645  LYS A CE    1 
ATOM   4898  N  NZ    . LYS A 1 645 ? 36.819  154.221 70.634  1.00 41.58 ? 645  LYS A NZ    1 
ATOM   4899  N  N     . GLN A 1 646 ? 38.464  154.195 76.292  1.00 41.05 ? 646  GLN A N     1 
ATOM   4900  C  CA    . GLN A 1 646 ? 37.350  155.055 76.692  1.00 41.56 ? 646  GLN A CA    1 
ATOM   4901  C  C     . GLN A 1 646 ? 37.831  156.467 77.008  1.00 43.03 ? 646  GLN A C     1 
ATOM   4902  O  O     . GLN A 1 646 ? 37.041  157.414 77.015  1.00 43.73 ? 646  GLN A O     1 
ATOM   4903  C  CB    . GLN A 1 646 ? 36.636  154.461 77.917  1.00 42.10 ? 646  GLN A CB    1 
ATOM   4904  C  CG    . GLN A 1 646 ? 35.315  155.146 78.287  1.00 43.67 ? 646  GLN A CG    1 
ATOM   4905  C  CD    . GLN A 1 646 ? 35.482  156.410 79.124  1.00 46.09 ? 646  GLN A CD    1 
ATOM   4906  O  OE1   . GLN A 1 646 ? 34.507  157.131 79.379  1.00 47.06 ? 646  GLN A OE1   1 
ATOM   4907  N  NE2   . GLN A 1 646 ? 36.713  156.683 79.567  1.00 46.57 ? 646  GLN A NE2   1 
ATOM   4908  N  N     . ALA A 1 647 ? 39.132  156.603 77.258  1.00 44.05 ? 647  ALA A N     1 
ATOM   4909  C  CA    . ALA A 1 647 ? 39.726  157.897 77.584  1.00 45.07 ? 647  ALA A CA    1 
ATOM   4910  C  C     . ALA A 1 647 ? 40.246  158.653 76.358  1.00 45.98 ? 647  ALA A C     1 
ATOM   4911  O  O     . ALA A 1 647 ? 40.128  158.134 75.227  1.00 47.13 ? 647  ALA A O     1 
ATOM   4912  C  CB    . ALA A 1 647 ? 40.854  157.703 78.593  1.00 44.40 ? 647  ALA A CB    1 
ATOM   4913  N  N     . HIS B 1 5   ? 99.286  125.625 81.902  1.00 40.83 ? 5    HIS B N     1 
ATOM   4914  C  CA    . HIS B 1 5   ? 98.784  124.237 81.702  1.00 40.15 ? 5    HIS B CA    1 
ATOM   4915  C  C     . HIS B 1 5   ? 97.934  124.123 80.436  1.00 39.78 ? 5    HIS B C     1 
ATOM   4916  O  O     . HIS B 1 5   ? 96.762  123.749 80.500  1.00 40.16 ? 5    HIS B O     1 
ATOM   4917  C  CB    . HIS B 1 5   ? 97.973  123.799 82.917  1.00 40.83 ? 5    HIS B CB    1 
ATOM   4918  N  N     . LYS B 1 6   ? 98.527  124.446 79.290  1.00 38.80 ? 6    LYS B N     1 
ATOM   4919  C  CA    . LYS B 1 6   ? 97.820  124.368 78.013  1.00 37.75 ? 6    LYS B CA    1 
ATOM   4920  C  C     . LYS B 1 6   ? 98.179  123.116 77.219  1.00 36.18 ? 6    LYS B C     1 
ATOM   4921  O  O     . LYS B 1 6   ? 99.351  122.763 77.095  1.00 36.93 ? 6    LYS B O     1 
ATOM   4922  C  CB    . LYS B 1 6   ? 98.133  125.589 77.141  1.00 37.48 ? 6    LYS B CB    1 
ATOM   4923  C  CG    . LYS B 1 6   ? 97.358  126.858 77.467  1.00 39.01 ? 6    LYS B CG    1 
ATOM   4924  C  CD    . LYS B 1 6   ? 97.701  127.952 76.450  1.00 38.63 ? 6    LYS B CD    1 
ATOM   4925  C  CE    . LYS B 1 6   ? 96.874  129.205 76.652  1.00 39.83 ? 6    LYS B CE    1 
ATOM   4926  N  NZ    . LYS B 1 6   ? 97.167  130.231 75.608  1.00 39.99 ? 6    LYS B NZ    1 
ATOM   4927  N  N     . HIS B 1 7   ? 97.161  122.445 76.689  1.00 33.71 ? 7    HIS B N     1 
ATOM   4928  C  CA    . HIS B 1 7   ? 97.367  121.259 75.866  1.00 32.80 ? 7    HIS B CA    1 
ATOM   4929  C  C     . HIS B 1 7   ? 97.261  121.703 74.416  1.00 32.48 ? 7    HIS B C     1 
ATOM   4930  O  O     . HIS B 1 7   ? 96.226  122.219 73.988  1.00 33.96 ? 7    HIS B O     1 
ATOM   4931  C  CB    . HIS B 1 7   ? 96.311  120.189 76.149  1.00 31.58 ? 7    HIS B CB    1 
ATOM   4932  C  CG    . HIS B 1 7   ? 96.566  119.402 77.396  1.00 31.87 ? 7    HIS B CG    1 
ATOM   4933  N  ND1   . HIS B 1 7   ? 96.419  119.936 78.658  1.00 31.50 ? 7    HIS B ND1   1 
ATOM   4934  C  CD2   . HIS B 1 7   ? 96.972  118.123 77.574  1.00 31.65 ? 7    HIS B CD2   1 
ATOM   4935  C  CE1   . HIS B 1 7   ? 96.724  119.021 79.559  1.00 31.97 ? 7    HIS B CE1   1 
ATOM   4936  N  NE2   . HIS B 1 7   ? 97.064  117.912 78.927  1.00 31.82 ? 7    HIS B NE2   1 
ATOM   4937  N  N     . ALA B 1 8   ? 98.333  121.503 73.662  1.00 30.31 ? 8    ALA B N     1 
ATOM   4938  C  CA    . ALA B 1 8   ? 98.354  121.907 72.268  1.00 28.72 ? 8    ALA B CA    1 
ATOM   4939  C  C     . ALA B 1 8   ? 97.344  121.153 71.414  1.00 28.29 ? 8    ALA B C     1 
ATOM   4940  O  O     . ALA B 1 8   ? 96.795  120.128 71.814  1.00 27.70 ? 8    ALA B O     1 
ATOM   4941  C  CB    . ALA B 1 8   ? 99.752  121.721 71.699  1.00 30.09 ? 8    ALA B CB    1 
ATOM   4942  N  N     . ILE B 1 9   ? 97.108  121.682 70.222  1.00 27.04 ? 9    ILE B N     1 
ATOM   4943  C  CA    . ILE B 1 9   ? 96.187  121.069 69.285  1.00 24.62 ? 9    ILE B CA    1 
ATOM   4944  C  C     . ILE B 1 9   ? 96.962  119.976 68.545  1.00 25.00 ? 9    ILE B C     1 
ATOM   4945  O  O     . ILE B 1 9   ? 98.009  120.243 67.950  1.00 24.37 ? 9    ILE B O     1 
ATOM   4946  C  CB    . ILE B 1 9   ? 95.668  122.129 68.300  1.00 23.00 ? 9    ILE B CB    1 
ATOM   4947  C  CG1   . ILE B 1 9   ? 94.827  123.155 69.066  1.00 23.18 ? 9    ILE B CG1   1 
ATOM   4948  C  CG2   . ILE B 1 9   ? 94.873  121.476 67.197  1.00 20.85 ? 9    ILE B CG2   1 
ATOM   4949  C  CD1   . ILE B 1 9   ? 94.792  124.524 68.424  1.00 22.12 ? 9    ILE B CD1   1 
ATOM   4950  N  N     . PRO B 1 10  ? 96.467  118.726 68.596  1.00 25.34 ? 10   PRO B N     1 
ATOM   4951  C  CA    . PRO B 1 10  ? 97.129  117.602 67.923  1.00 24.47 ? 10   PRO B CA    1 
ATOM   4952  C  C     . PRO B 1 10  ? 97.283  117.865 66.428  1.00 25.06 ? 10   PRO B C     1 
ATOM   4953  O  O     . PRO B 1 10  ? 96.381  118.409 65.789  1.00 24.76 ? 10   PRO B O     1 
ATOM   4954  C  CB    . PRO B 1 10  ? 96.195  116.433 68.212  1.00 24.98 ? 10   PRO B CB    1 
ATOM   4955  C  CG    . PRO B 1 10  ? 95.596  116.805 69.534  1.00 24.93 ? 10   PRO B CG    1 
ATOM   4956  C  CD    . PRO B 1 10  ? 95.282  118.262 69.340  1.00 24.33 ? 10   PRO B CD    1 
ATOM   4957  N  N     . ALA B 1 11  ? 98.426  117.473 65.875  1.00 25.64 ? 11   ALA B N     1 
ATOM   4958  C  CA    . ALA B 1 11  ? 98.700  117.687 64.460  1.00 25.26 ? 11   ALA B CA    1 
ATOM   4959  C  C     . ALA B 1 11  ? 97.627  117.088 63.556  1.00 25.87 ? 11   ALA B C     1 
ATOM   4960  O  O     . ALA B 1 11  ? 97.232  117.703 62.558  1.00 27.52 ? 11   ALA B O     1 
ATOM   4961  C  CB    . ALA B 1 11  ? 100.065 117.117 64.105  1.00 27.10 ? 11   ALA B CB    1 
ATOM   4962  N  N     . ASN B 1 12  ? 97.150  115.894 63.897  1.00 24.53 ? 12   ASN B N     1 
ATOM   4963  C  CA    . ASN B 1 12  ? 96.117  115.255 63.088  1.00 23.35 ? 12   ASN B CA    1 
ATOM   4964  C  C     . ASN B 1 12  ? 94.864  116.136 63.060  1.00 22.30 ? 12   ASN B C     1 
ATOM   4965  O  O     . ASN B 1 12  ? 94.198  116.252 62.031  1.00 21.84 ? 12   ASN B O     1 
ATOM   4966  C  CB    . ASN B 1 12  ? 95.780  113.872 63.651  1.00 22.90 ? 12   ASN B CB    1 
ATOM   4967  C  CG    . ASN B 1 12  ? 95.096  113.947 64.999  1.00 24.45 ? 12   ASN B CG    1 
ATOM   4968  O  OD1   . ASN B 1 12  ? 95.630  114.529 65.945  1.00 23.22 ? 12   ASN B OD1   1 
ATOM   4969  N  ND2   . ASN B 1 12  ? 93.902  113.359 65.095  1.00 21.53 ? 12   ASN B ND2   1 
ATOM   4970  N  N     . ILE B 1 13  ? 94.550  116.772 64.185  1.00 21.64 ? 13   ILE B N     1 
ATOM   4971  C  CA    . ILE B 1 13  ? 93.377  117.636 64.239  1.00 21.55 ? 13   ILE B CA    1 
ATOM   4972  C  C     . ILE B 1 13  ? 93.592  118.907 63.419  1.00 22.19 ? 13   ILE B C     1 
ATOM   4973  O  O     . ILE B 1 13  ? 92.725  119.300 62.643  1.00 21.84 ? 13   ILE B O     1 
ATOM   4974  C  CB    . ILE B 1 13  ? 93.006  118.011 65.700  1.00 20.30 ? 13   ILE B CB    1 
ATOM   4975  C  CG1   . ILE B 1 13  ? 92.463  116.778 66.428  1.00 20.55 ? 13   ILE B CG1   1 
ATOM   4976  C  CG2   . ILE B 1 13  ? 91.954  119.113 65.714  1.00 20.03 ? 13   ILE B CG2   1 
ATOM   4977  C  CD1   . ILE B 1 13  ? 91.285  116.118 65.733  1.00 15.77 ? 13   ILE B CD1   1 
ATOM   4978  N  N     . ALA B 1 14  ? 94.752  119.534 63.579  1.00 22.45 ? 14   ALA B N     1 
ATOM   4979  C  CA    . ALA B 1 14  ? 95.064  120.754 62.843  1.00 24.23 ? 14   ALA B CA    1 
ATOM   4980  C  C     . ALA B 1 14  ? 95.094  120.518 61.333  1.00 25.52 ? 14   ALA B C     1 
ATOM   4981  O  O     . ALA B 1 14  ? 94.677  121.376 60.555  1.00 26.63 ? 14   ALA B O     1 
ATOM   4982  C  CB    . ALA B 1 14  ? 96.406  121.321 63.311  1.00 22.33 ? 14   ALA B CB    1 
ATOM   4983  N  N     . ASP B 1 15  ? 95.580  119.351 60.922  1.00 27.62 ? 15   ASP B N     1 
ATOM   4984  C  CA    . ASP B 1 15  ? 95.672  119.011 59.502  1.00 29.64 ? 15   ASP B CA    1 
ATOM   4985  C  C     . ASP B 1 15  ? 94.334  118.951 58.767  1.00 30.77 ? 15   ASP B C     1 
ATOM   4986  O  O     . ASP B 1 15  ? 94.295  119.056 57.537  1.00 31.58 ? 15   ASP B O     1 
ATOM   4987  C  CB    . ASP B 1 15  ? 96.388  117.667 59.329  1.00 29.85 ? 15   ASP B CB    1 
ATOM   4988  C  CG    . ASP B 1 15  ? 97.890  117.815 59.202  1.00 31.39 ? 15   ASP B CG    1 
ATOM   4989  O  OD1   . ASP B 1 15  ? 98.475  118.652 59.921  1.00 32.49 ? 15   ASP B OD1   1 
ATOM   4990  O  OD2   . ASP B 1 15  ? 98.488  117.082 58.388  1.00 32.52 ? 15   ASP B OD2   1 
ATOM   4991  N  N     . ARG B 1 16  ? 93.239  118.794 59.506  1.00 30.65 ? 16   ARG B N     1 
ATOM   4992  C  CA    . ARG B 1 16  ? 91.931  118.687 58.868  1.00 30.70 ? 16   ARG B CA    1 
ATOM   4993  C  C     . ARG B 1 16  ? 90.826  119.555 59.449  1.00 28.36 ? 16   ARG B C     1 
ATOM   4994  O  O     . ARG B 1 16  ? 89.719  119.569 58.918  1.00 26.88 ? 16   ARG B O     1 
ATOM   4995  C  CB    . ARG B 1 16  ? 91.464  117.235 58.899  1.00 34.12 ? 16   ARG B CB    1 
ATOM   4996  C  CG    . ARG B 1 16  ? 91.225  116.704 60.303  1.00 38.58 ? 16   ARG B CG    1 
ATOM   4997  C  CD    . ARG B 1 16  ? 90.782  115.254 60.264  1.00 43.06 ? 16   ARG B CD    1 
ATOM   4998  N  NE    . ARG B 1 16  ? 89.579  115.074 59.454  1.00 45.93 ? 16   ARG B NE    1 
ATOM   4999  C  CZ    . ARG B 1 16  ? 89.165  113.902 58.982  1.00 47.29 ? 16   ARG B CZ    1 
ATOM   5000  N  NH1   . ARG B 1 16  ? 89.863  112.802 59.238  1.00 47.42 ? 16   ARG B NH1   1 
ATOM   5001  N  NH2   . ARG B 1 16  ? 88.059  113.830 58.252  1.00 47.77 ? 16   ARG B NH2   1 
ATOM   5002  N  N     . CYS B 1 17  ? 91.113  120.273 60.529  1.00 26.02 ? 17   CYS B N     1 
ATOM   5003  C  CA    . CYS B 1 17  ? 90.099  121.111 61.153  1.00 23.79 ? 17   CYS B CA    1 
ATOM   5004  C  C     . CYS B 1 17  ? 89.454  122.098 60.172  1.00 23.35 ? 17   CYS B C     1 
ATOM   5005  O  O     . CYS B 1 17  ? 90.047  122.465 59.159  1.00 23.07 ? 17   CYS B O     1 
ATOM   5006  C  CB    . CYS B 1 17  ? 90.697  121.870 62.345  1.00 22.95 ? 17   CYS B CB    1 
ATOM   5007  S  SG    . CYS B 1 17  ? 91.948  123.110 61.928  1.00 26.68 ? 17   CYS B SG    1 
ATOM   5008  N  N     . LEU B 1 18  ? 88.228  122.507 60.483  1.00 21.58 ? 18   LEU B N     1 
ATOM   5009  C  CA    . LEU B 1 18  ? 87.491  123.448 59.656  1.00 22.71 ? 18   LEU B CA    1 
ATOM   5010  C  C     . LEU B 1 18  ? 87.820  124.867 60.113  1.00 24.61 ? 18   LEU B C     1 
ATOM   5011  O  O     . LEU B 1 18  ? 87.732  125.824 59.337  1.00 24.86 ? 18   LEU B O     1 
ATOM   5012  C  CB    . LEU B 1 18  ? 85.986  123.207 59.796  1.00 21.60 ? 18   LEU B CB    1 
ATOM   5013  C  CG    . LEU B 1 18  ? 85.443  121.832 59.394  1.00 21.71 ? 18   LEU B CG    1 
ATOM   5014  C  CD1   . LEU B 1 18  ? 83.990  121.726 59.811  1.00 20.17 ? 18   LEU B CD1   1 
ATOM   5015  C  CD2   . LEU B 1 18  ? 85.581  121.630 57.893  1.00 20.73 ? 18   LEU B CD2   1 
ATOM   5016  N  N     . ILE B 1 19  ? 88.204  124.989 61.382  1.00 24.25 ? 19   ILE B N     1 
ATOM   5017  C  CA    . ILE B 1 19  ? 88.535  126.281 61.965  1.00 24.30 ? 19   ILE B CA    1 
ATOM   5018  C  C     . ILE B 1 19  ? 89.895  126.238 62.663  1.00 25.12 ? 19   ILE B C     1 
ATOM   5019  O  O     . ILE B 1 19  ? 90.055  125.555 63.675  1.00 23.21 ? 19   ILE B O     1 
ATOM   5020  C  CB    . ILE B 1 19  ? 87.463  126.709 63.009  1.00 23.57 ? 19   ILE B CB    1 
ATOM   5021  C  CG1   . ILE B 1 19  ? 86.058  126.582 62.409  1.00 23.48 ? 19   ILE B CG1   1 
ATOM   5022  C  CG2   . ILE B 1 19  ? 87.708  128.157 63.455  1.00 20.81 ? 19   ILE B CG2   1 
ATOM   5023  C  CD1   . ILE B 1 19  ? 85.737  127.598 61.338  1.00 22.38 ? 19   ILE B CD1   1 
ATOM   5024  N  N     . ASN B 1 20  ? 90.872  126.963 62.122  1.00 26.22 ? 20   ASN B N     1 
ATOM   5025  C  CA    . ASN B 1 20  ? 92.200  127.017 62.726  1.00 28.04 ? 20   ASN B CA    1 
ATOM   5026  C  C     . ASN B 1 20  ? 92.238  128.208 63.684  1.00 27.51 ? 20   ASN B C     1 
ATOM   5027  O  O     . ASN B 1 20  ? 91.291  129.002 63.738  1.00 27.40 ? 20   ASN B O     1 
ATOM   5028  C  CB    . ASN B 1 20  ? 93.285  127.159 61.649  1.00 30.64 ? 20   ASN B CB    1 
ATOM   5029  C  CG    . ASN B 1 20  ? 93.118  128.411 60.806  1.00 33.55 ? 20   ASN B CG    1 
ATOM   5030  O  OD1   . ASN B 1 20  ? 93.013  129.526 61.329  1.00 34.78 ? 20   ASN B OD1   1 
ATOM   5031  N  ND2   . ASN B 1 20  ? 93.102  128.233 59.488  1.00 33.04 ? 20   ASN B ND2   1 
ATOM   5032  N  N     . PRO B 1 21  ? 93.326  128.351 64.458  1.00 26.84 ? 21   PRO B N     1 
ATOM   5033  C  CA    . PRO B 1 21  ? 93.400  129.476 65.392  1.00 26.98 ? 21   PRO B CA    1 
ATOM   5034  C  C     . PRO B 1 21  ? 93.090  130.826 64.751  1.00 26.99 ? 21   PRO B C     1 
ATOM   5035  O  O     . PRO B 1 21  ? 92.333  131.627 65.307  1.00 27.23 ? 21   PRO B O     1 
ATOM   5036  C  CB    . PRO B 1 21  ? 94.832  129.392 65.910  1.00 27.09 ? 21   PRO B CB    1 
ATOM   5037  C  CG    . PRO B 1 21  ? 95.106  127.921 65.884  1.00 25.48 ? 21   PRO B CG    1 
ATOM   5038  C  CD    . PRO B 1 21  ? 94.540  127.517 64.549  1.00 26.26 ? 21   PRO B CD    1 
ATOM   5039  N  N     . GLU B 1 22  ? 93.668  131.072 63.580  1.00 27.38 ? 22   GLU B N     1 
ATOM   5040  C  CA    . GLU B 1 22  ? 93.468  132.340 62.882  1.00 28.81 ? 22   GLU B CA    1 
ATOM   5041  C  C     . GLU B 1 22  ? 92.012  132.578 62.485  1.00 28.60 ? 22   GLU B C     1 
ATOM   5042  O  O     . GLU B 1 22  ? 91.459  133.650 62.742  1.00 27.26 ? 22   GLU B O     1 
ATOM   5043  C  CB    . GLU B 1 22  ? 94.376  132.410 61.638  1.00 29.48 ? 22   GLU B CB    1 
ATOM   5044  N  N     . GLN B 1 23  ? 91.400  131.577 61.856  1.00 28.98 ? 23   GLN B N     1 
ATOM   5045  C  CA    . GLN B 1 23  ? 90.010  131.675 61.421  1.00 29.09 ? 23   GLN B CA    1 
ATOM   5046  C  C     . GLN B 1 23  ? 89.037  131.988 62.556  1.00 28.95 ? 23   GLN B C     1 
ATOM   5047  O  O     . GLN B 1 23  ? 88.120  132.789 62.381  1.00 30.32 ? 23   GLN B O     1 
ATOM   5048  C  CB    . GLN B 1 23  ? 89.596  130.385 60.721  1.00 30.42 ? 23   GLN B CB    1 
ATOM   5049  C  CG    . GLN B 1 23  ? 90.225  130.219 59.352  1.00 31.68 ? 23   GLN B CG    1 
ATOM   5050  C  CD    . GLN B 1 23  ? 90.143  128.798 58.841  1.00 33.87 ? 23   GLN B CD    1 
ATOM   5051  O  OE1   . GLN B 1 23  ? 90.320  128.544 57.650  1.00 37.63 ? 23   GLN B OE1   1 
ATOM   5052  N  NE2   . GLN B 1 23  ? 89.888  127.858 59.742  1.00 34.38 ? 23   GLN B NE2   1 
ATOM   5053  N  N     . TYR B 1 24  ? 89.224  131.360 63.713  1.00 26.90 ? 24   TYR B N     1 
ATOM   5054  C  CA    . TYR B 1 24  ? 88.350  131.625 64.846  1.00 26.00 ? 24   TYR B CA    1 
ATOM   5055  C  C     . TYR B 1 24  ? 88.401  133.111 65.194  1.00 25.83 ? 24   TYR B C     1 
ATOM   5056  O  O     . TYR B 1 24  ? 87.371  133.780 65.240  1.00 25.87 ? 24   TYR B O     1 
ATOM   5057  C  CB    . TYR B 1 24  ? 88.775  130.810 66.075  1.00 24.65 ? 24   TYR B CB    1 
ATOM   5058  C  CG    . TYR B 1 24  ? 88.158  131.334 67.358  1.00 25.35 ? 24   TYR B CG    1 
ATOM   5059  C  CD1   . TYR B 1 24  ? 86.824  131.063 67.686  1.00 24.98 ? 24   TYR B CD1   1 
ATOM   5060  C  CD2   . TYR B 1 24  ? 88.882  132.187 68.197  1.00 24.64 ? 24   TYR B CD2   1 
ATOM   5061  C  CE1   . TYR B 1 24  ? 86.225  131.636 68.817  1.00 24.72 ? 24   TYR B CE1   1 
ATOM   5062  C  CE2   . TYR B 1 24  ? 88.293  132.764 69.323  1.00 24.59 ? 24   TYR B CE2   1 
ATOM   5063  C  CZ    . TYR B 1 24  ? 86.967  132.486 69.626  1.00 25.16 ? 24   TYR B CZ    1 
ATOM   5064  O  OH    . TYR B 1 24  ? 86.393  133.068 70.733  1.00 24.25 ? 24   TYR B OH    1 
ATOM   5065  N  N     . GLU B 1 25  ? 89.608  133.617 65.440  1.00 25.82 ? 25   GLU B N     1 
ATOM   5066  C  CA    . GLU B 1 25  ? 89.804  135.015 65.809  1.00 26.17 ? 25   GLU B CA    1 
ATOM   5067  C  C     . GLU B 1 25  ? 89.129  135.990 64.852  1.00 26.35 ? 25   GLU B C     1 
ATOM   5068  O  O     . GLU B 1 25  ? 88.392  136.875 65.290  1.00 26.12 ? 25   GLU B O     1 
ATOM   5069  C  CB    . GLU B 1 25  ? 91.304  135.334 65.910  1.00 25.33 ? 25   GLU B CB    1 
ATOM   5070  N  N     . THR B 1 26  ? 89.375  135.838 63.552  1.00 25.64 ? 26   THR B N     1 
ATOM   5071  C  CA    . THR B 1 26  ? 88.777  136.745 62.582  1.00 27.21 ? 26   THR B CA    1 
ATOM   5072  C  C     . THR B 1 26  ? 87.259  136.578 62.519  1.00 26.64 ? 26   THR B C     1 
ATOM   5073  O  O     . THR B 1 26  ? 86.517  137.559 62.608  1.00 26.18 ? 26   THR B O     1 
ATOM   5074  C  CB    . THR B 1 26  ? 89.381  136.559 61.166  1.00 27.63 ? 26   THR B CB    1 
ATOM   5075  O  OG1   . THR B 1 26  ? 88.955  135.307 60.619  1.00 31.74 ? 26   THR B OG1   1 
ATOM   5076  C  CG2   . THR B 1 26  ? 90.903  136.583 61.230  1.00 28.92 ? 26   THR B CG2   1 
ATOM   5077  N  N     . LYS B 1 27  ? 86.792  135.342 62.379  1.00 25.08 ? 27   LYS B N     1 
ATOM   5078  C  CA    . LYS B 1 27  ? 85.358  135.102 62.322  1.00 24.27 ? 27   LYS B CA    1 
ATOM   5079  C  C     . LYS B 1 27  ? 84.653  135.594 63.584  1.00 23.48 ? 27   LYS B C     1 
ATOM   5080  O  O     . LYS B 1 27  ? 83.565  136.167 63.517  1.00 21.75 ? 27   LYS B O     1 
ATOM   5081  C  CB    . LYS B 1 27  ? 85.070  133.618 62.123  1.00 26.69 ? 27   LYS B CB    1 
ATOM   5082  C  CG    . LYS B 1 27  ? 85.384  133.104 60.738  1.00 27.77 ? 27   LYS B CG    1 
ATOM   5083  C  CD    . LYS B 1 27  ? 84.803  131.719 60.555  1.00 30.73 ? 27   LYS B CD    1 
ATOM   5084  C  CE    . LYS B 1 27  ? 84.768  131.317 59.092  1.00 32.50 ? 27   LYS B CE    1 
ATOM   5085  N  NZ    . LYS B 1 27  ? 83.780  130.220 58.874  1.00 35.24 ? 27   LYS B NZ    1 
ATOM   5086  N  N     . TYR B 1 28  ? 85.272  135.373 64.738  1.00 23.29 ? 28   TYR B N     1 
ATOM   5087  C  CA    . TYR B 1 28  ? 84.666  135.818 65.984  1.00 23.72 ? 28   TYR B CA    1 
ATOM   5088  C  C     . TYR B 1 28  ? 84.523  137.332 65.973  1.00 23.58 ? 28   TYR B C     1 
ATOM   5089  O  O     . TYR B 1 28  ? 83.472  137.870 66.330  1.00 23.49 ? 28   TYR B O     1 
ATOM   5090  C  CB    . TYR B 1 28  ? 85.507  135.411 67.199  1.00 21.56 ? 28   TYR B CB    1 
ATOM   5091  C  CG    . TYR B 1 28  ? 84.909  135.913 68.494  1.00 21.06 ? 28   TYR B CG    1 
ATOM   5092  C  CD1   . TYR B 1 28  ? 83.795  135.291 69.061  1.00 18.61 ? 28   TYR B CD1   1 
ATOM   5093  C  CD2   . TYR B 1 28  ? 85.407  137.059 69.113  1.00 19.50 ? 28   TYR B CD2   1 
ATOM   5094  C  CE1   . TYR B 1 28  ? 83.192  135.802 70.208  1.00 18.97 ? 28   TYR B CE1   1 
ATOM   5095  C  CE2   . TYR B 1 28  ? 84.810  137.578 70.258  1.00 19.09 ? 28   TYR B CE2   1 
ATOM   5096  C  CZ    . TYR B 1 28  ? 83.703  136.946 70.801  1.00 18.83 ? 28   TYR B CZ    1 
ATOM   5097  O  OH    . TYR B 1 28  ? 83.108  137.460 71.935  1.00 19.01 ? 28   TYR B OH    1 
ATOM   5098  N  N     . LYS B 1 29  ? 85.592  138.008 65.563  1.00 24.48 ? 29   LYS B N     1 
ATOM   5099  C  CA    . LYS B 1 29  ? 85.621  139.468 65.504  1.00 26.01 ? 29   LYS B CA    1 
ATOM   5100  C  C     . LYS B 1 29  ? 84.495  140.002 64.632  1.00 24.73 ? 29   LYS B C     1 
ATOM   5101  O  O     . LYS B 1 29  ? 83.778  140.919 65.032  1.00 25.46 ? 29   LYS B O     1 
ATOM   5102  C  CB    . LYS B 1 29  ? 86.971  139.949 64.960  1.00 27.14 ? 29   LYS B CB    1 
ATOM   5103  C  CG    . LYS B 1 29  ? 87.206  141.440 65.117  1.00 31.93 ? 29   LYS B CG    1 
ATOM   5104  C  CD    . LYS B 1 29  ? 88.594  141.846 64.616  1.00 35.27 ? 29   LYS B CD    1 
ATOM   5105  C  CE    . LYS B 1 29  ? 88.845  143.337 64.836  1.00 36.94 ? 29   LYS B CE    1 
ATOM   5106  N  NZ    . LYS B 1 29  ? 90.169  143.786 64.310  1.00 37.00 ? 29   LYS B NZ    1 
ATOM   5107  N  N     . GLN B 1 30  ? 84.342  139.423 63.445  1.00 24.67 ? 30   GLN B N     1 
ATOM   5108  C  CA    . GLN B 1 30  ? 83.292  139.841 62.522  1.00 26.22 ? 30   GLN B CA    1 
ATOM   5109  C  C     . GLN B 1 30  ? 81.911  139.525 63.089  1.00 25.68 ? 30   GLN B C     1 
ATOM   5110  O  O     . GLN B 1 30  ? 80.987  140.332 62.987  1.00 25.44 ? 30   GLN B O     1 
ATOM   5111  C  CB    . GLN B 1 30  ? 83.443  139.129 61.179  1.00 27.46 ? 30   GLN B CB    1 
ATOM   5112  C  CG    . GLN B 1 30  ? 82.491  139.643 60.110  1.00 29.36 ? 30   GLN B CG    1 
ATOM   5113  C  CD    . GLN B 1 30  ? 82.363  138.693 58.930  1.00 31.47 ? 30   GLN B CD    1 
ATOM   5114  O  OE1   . GLN B 1 30  ? 81.947  139.091 57.841  1.00 32.81 ? 30   GLN B OE1   1 
ATOM   5115  N  NE2   . GLN B 1 30  ? 82.706  137.426 59.147  1.00 30.52 ? 30   GLN B NE2   1 
ATOM   5116  N  N     . SER B 1 31  ? 81.777  138.347 63.691  1.00 25.13 ? 31   SER B N     1 
ATOM   5117  C  CA    . SER B 1 31  ? 80.500  137.930 64.260  1.00 24.85 ? 31   SER B CA    1 
ATOM   5118  C  C     . SER B 1 31  ? 80.052  138.906 65.339  1.00 26.05 ? 31   SER B C     1 
ATOM   5119  O  O     . SER B 1 31  ? 78.864  138.981 65.671  1.00 27.16 ? 31   SER B O     1 
ATOM   5120  C  CB    . SER B 1 31  ? 80.609  136.528 64.869  1.00 23.19 ? 31   SER B CB    1 
ATOM   5121  O  OG    . SER B 1 31  ? 81.098  136.579 66.199  1.00 19.99 ? 31   SER B OG    1 
ATOM   5122  N  N     . ILE B 1 32  ? 81.003  139.657 65.884  1.00 23.42 ? 32   ILE B N     1 
ATOM   5123  C  CA    . ILE B 1 32  ? 80.684  140.611 66.931  1.00 25.14 ? 32   ILE B CA    1 
ATOM   5124  C  C     . ILE B 1 32  ? 80.469  142.020 66.390  1.00 25.98 ? 32   ILE B C     1 
ATOM   5125  O  O     . ILE B 1 32  ? 79.482  142.681 66.730  1.00 24.93 ? 32   ILE B O     1 
ATOM   5126  C  CB    . ILE B 1 32  ? 81.801  140.658 68.000  1.00 25.56 ? 32   ILE B CB    1 
ATOM   5127  C  CG1   . ILE B 1 32  ? 81.993  139.271 68.615  1.00 26.77 ? 32   ILE B CG1   1 
ATOM   5128  C  CG2   . ILE B 1 32  ? 81.453  141.669 69.075  1.00 26.48 ? 32   ILE B CG2   1 
ATOM   5129  C  CD1   . ILE B 1 32  ? 80.718  138.646 69.155  1.00 23.89 ? 32   ILE B CD1   1 
ATOM   5130  N  N     . ASN B 1 33  ? 81.395  142.477 65.552  1.00 26.25 ? 33   ASN B N     1 
ATOM   5131  C  CA    . ASN B 1 33  ? 81.310  143.815 64.984  1.00 26.19 ? 33   ASN B CA    1 
ATOM   5132  C  C     . ASN B 1 33  ? 80.226  143.933 63.923  1.00 26.53 ? 33   ASN B C     1 
ATOM   5133  O  O     . ASN B 1 33  ? 79.554  144.960 63.829  1.00 25.46 ? 33   ASN B O     1 
ATOM   5134  C  CB    . ASN B 1 33  ? 82.660  144.225 64.398  1.00 28.72 ? 33   ASN B CB    1 
ATOM   5135  C  CG    . ASN B 1 33  ? 83.778  144.152 65.418  1.00 32.55 ? 33   ASN B CG    1 
ATOM   5136  O  OD1   . ASN B 1 33  ? 83.544  144.304 66.621  1.00 34.89 ? 33   ASN B OD1   1 
ATOM   5137  N  ND2   . ASN B 1 33  ? 85.003  143.932 64.947  1.00 33.64 ? 33   ASN B ND2   1 
ATOM   5138  N  N     . ASP B 1 34  ? 80.056  142.883 63.126  1.00 25.53 ? 34   ASP B N     1 
ATOM   5139  C  CA    . ASP B 1 34  ? 79.044  142.889 62.079  1.00 25.81 ? 34   ASP B CA    1 
ATOM   5140  C  C     . ASP B 1 34  ? 78.271  141.575 62.054  1.00 25.04 ? 34   ASP B C     1 
ATOM   5141  O  O     . ASP B 1 34  ? 78.439  140.769 61.139  1.00 24.50 ? 34   ASP B O     1 
ATOM   5142  C  CB    . ASP B 1 34  ? 79.693  143.116 60.714  1.00 26.25 ? 34   ASP B CB    1 
ATOM   5143  C  CG    . ASP B 1 34  ? 78.673  143.401 59.624  1.00 28.78 ? 34   ASP B CG    1 
ATOM   5144  O  OD1   . ASP B 1 34  ? 77.465  143.163 59.845  1.00 28.84 ? 34   ASP B OD1   1 
ATOM   5145  O  OD2   . ASP B 1 34  ? 79.081  143.858 58.536  1.00 30.54 ? 34   ASP B OD2   1 
ATOM   5146  N  N     . PRO B 1 35  ? 77.411  141.342 63.060  1.00 24.23 ? 35   PRO B N     1 
ATOM   5147  C  CA    . PRO B 1 35  ? 76.607  140.120 63.151  1.00 24.28 ? 35   PRO B CA    1 
ATOM   5148  C  C     . PRO B 1 35  ? 75.667  139.910 61.970  1.00 24.49 ? 35   PRO B C     1 
ATOM   5149  O  O     . PRO B 1 35  ? 75.469  138.774 61.525  1.00 25.84 ? 35   PRO B O     1 
ATOM   5150  C  CB    . PRO B 1 35  ? 75.863  140.286 64.476  1.00 25.47 ? 35   PRO B CB    1 
ATOM   5151  C  CG    . PRO B 1 35  ? 75.757  141.759 64.635  1.00 25.85 ? 35   PRO B CG    1 
ATOM   5152  C  CD    . PRO B 1 35  ? 77.127  142.236 64.195  1.00 25.66 ? 35   PRO B CD    1 
ATOM   5153  N  N     . ASP B 1 36  ? 75.086  140.996 61.466  1.00 22.26 ? 36   ASP B N     1 
ATOM   5154  C  CA    . ASP B 1 36  ? 74.182  140.910 60.319  1.00 22.67 ? 36   ASP B CA    1 
ATOM   5155  C  C     . ASP B 1 36  ? 74.826  140.202 59.144  1.00 21.06 ? 36   ASP B C     1 
ATOM   5156  O  O     . ASP B 1 36  ? 74.224  139.324 58.533  1.00 21.38 ? 36   ASP B O     1 
ATOM   5157  C  CB    . ASP B 1 36  ? 73.746  142.301 59.860  1.00 24.49 ? 36   ASP B CB    1 
ATOM   5158  C  CG    . ASP B 1 36  ? 72.575  142.825 60.643  1.00 27.14 ? 36   ASP B CG    1 
ATOM   5159  O  OD1   . ASP B 1 36  ? 72.243  144.015 60.478  1.00 31.45 ? 36   ASP B OD1   1 
ATOM   5160  O  OD2   . ASP B 1 36  ? 71.980  142.044 61.417  1.00 29.07 ? 36   ASP B OD2   1 
ATOM   5161  N  N     . THR B 1 37  ? 76.052  140.601 58.830  1.00 20.12 ? 37   THR B N     1 
ATOM   5162  C  CA    . THR B 1 37  ? 76.794  140.017 57.726  1.00 20.24 ? 37   THR B CA    1 
ATOM   5163  C  C     . THR B 1 37  ? 77.308  138.621 58.057  1.00 20.16 ? 37   THR B C     1 
ATOM   5164  O  O     . THR B 1 37  ? 77.231  137.709 57.232  1.00 18.04 ? 37   THR B O     1 
ATOM   5165  C  CB    . THR B 1 37  ? 77.992  140.899 57.353  1.00 21.67 ? 37   THR B CB    1 
ATOM   5166  O  OG1   . THR B 1 37  ? 77.526  142.217 57.048  1.00 22.37 ? 37   THR B OG1   1 
ATOM   5167  C  CG2   . THR B 1 37  ? 78.734  140.317 56.147  1.00 20.32 ? 37   THR B CG2   1 
ATOM   5168  N  N     . PHE B 1 38  ? 77.845  138.457 59.264  1.00 20.46 ? 38   PHE B N     1 
ATOM   5169  C  CA    . PHE B 1 38  ? 78.369  137.159 59.668  1.00 19.66 ? 38   PHE B CA    1 
ATOM   5170  C  C     . PHE B 1 38  ? 77.263  136.113 59.660  1.00 18.70 ? 38   PHE B C     1 
ATOM   5171  O  O     . PHE B 1 38  ? 77.350  135.104 58.959  1.00 18.80 ? 38   PHE B O     1 
ATOM   5172  C  CB    . PHE B 1 38  ? 78.974  137.219 61.070  1.00 20.14 ? 38   PHE B CB    1 
ATOM   5173  C  CG    . PHE B 1 38  ? 79.497  135.896 61.545  1.00 20.98 ? 38   PHE B CG    1 
ATOM   5174  C  CD1   . PHE B 1 38  ? 80.742  135.439 61.127  1.00 19.37 ? 38   PHE B CD1   1 
ATOM   5175  C  CD2   . PHE B 1 38  ? 78.711  135.069 62.346  1.00 19.96 ? 38   PHE B CD2   1 
ATOM   5176  C  CE1   . PHE B 1 38  ? 81.194  134.176 61.496  1.00 21.83 ? 38   PHE B CE1   1 
ATOM   5177  C  CE2   . PHE B 1 38  ? 79.152  133.810 62.719  1.00 18.62 ? 38   PHE B CE2   1 
ATOM   5178  C  CZ    . PHE B 1 38  ? 80.395  133.358 62.293  1.00 21.49 ? 38   PHE B CZ    1 
ATOM   5179  N  N     . TRP B 1 39  ? 76.221  136.356 60.445  1.00 18.62 ? 39   TRP B N     1 
ATOM   5180  C  CA    . TRP B 1 39  ? 75.114  135.419 60.516  1.00 18.20 ? 39   TRP B CA    1 
ATOM   5181  C  C     . TRP B 1 39  ? 74.305  135.383 59.226  1.00 18.16 ? 39   TRP B C     1 
ATOM   5182  O  O     . TRP B 1 39  ? 73.670  134.375 58.912  1.00 18.35 ? 39   TRP B O     1 
ATOM   5183  C  CB    . TRP B 1 39  ? 74.231  135.748 61.719  1.00 19.64 ? 39   TRP B CB    1 
ATOM   5184  C  CG    . TRP B 1 39  ? 74.911  135.426 63.029  1.00 18.44 ? 39   TRP B CG    1 
ATOM   5185  C  CD1   . TRP B 1 39  ? 75.289  136.309 63.995  1.00 18.35 ? 39   TRP B CD1   1 
ATOM   5186  C  CD2   . TRP B 1 39  ? 75.307  134.131 63.491  1.00 18.46 ? 39   TRP B CD2   1 
ATOM   5187  N  NE1   . TRP B 1 39  ? 75.895  135.647 65.033  1.00 17.72 ? 39   TRP B NE1   1 
ATOM   5188  C  CE2   . TRP B 1 39  ? 75.920  134.307 64.751  1.00 19.46 ? 39   TRP B CE2   1 
ATOM   5189  C  CE3   . TRP B 1 39  ? 75.204  132.837 62.964  1.00 19.18 ? 39   TRP B CE3   1 
ATOM   5190  C  CZ2   . TRP B 1 39  ? 76.429  133.232 65.495  1.00 17.65 ? 39   TRP B CZ2   1 
ATOM   5191  C  CZ3   . TRP B 1 39  ? 75.710  131.768 63.703  1.00 18.32 ? 39   TRP B CZ3   1 
ATOM   5192  C  CH2   . TRP B 1 39  ? 76.315  131.975 64.955  1.00 17.59 ? 39   TRP B CH2   1 
ATOM   5193  N  N     . GLY B 1 40  ? 74.337  136.477 58.469  1.00 17.11 ? 40   GLY B N     1 
ATOM   5194  C  CA    . GLY B 1 40  ? 73.620  136.509 57.208  1.00 15.78 ? 40   GLY B CA    1 
ATOM   5195  C  C     . GLY B 1 40  ? 74.202  135.462 56.273  1.00 16.24 ? 40   GLY B C     1 
ATOM   5196  O  O     . GLY B 1 40  ? 73.483  134.824 55.504  1.00 15.93 ? 40   GLY B O     1 
ATOM   5197  N  N     . GLU B 1 41  ? 75.517  135.280 56.347  1.00 16.48 ? 41   GLU B N     1 
ATOM   5198  C  CA    . GLU B 1 41  ? 76.210  134.307 55.510  1.00 17.96 ? 41   GLU B CA    1 
ATOM   5199  C  C     . GLU B 1 41  ? 76.186  132.918 56.151  1.00 19.10 ? 41   GLU B C     1 
ATOM   5200  O  O     . GLU B 1 41  ? 76.049  131.908 55.467  1.00 19.54 ? 41   GLU B O     1 
ATOM   5201  C  CB    . GLU B 1 41  ? 77.663  134.750 55.273  1.00 20.15 ? 41   GLU B CB    1 
ATOM   5202  C  CG    . GLU B 1 41  ? 77.793  136.065 54.502  1.00 24.70 ? 41   GLU B CG    1 
ATOM   5203  C  CD    . GLU B 1 41  ? 79.229  136.551 54.377  1.00 27.83 ? 41   GLU B CD    1 
ATOM   5204  O  OE1   . GLU B 1 41  ? 79.449  137.607 53.750  1.00 30.10 ? 41   GLU B OE1   1 
ATOM   5205  O  OE2   . GLU B 1 41  ? 80.138  135.879 54.907  1.00 30.41 ? 41   GLU B OE2   1 
ATOM   5206  N  N     . GLN B 1 42  ? 76.302  132.873 57.471  1.00 19.65 ? 42   GLN B N     1 
ATOM   5207  C  CA    . GLN B 1 42  ? 76.303  131.611 58.179  1.00 19.38 ? 42   GLN B CA    1 
ATOM   5208  C  C     . GLN B 1 42  ? 74.930  130.927 58.156  1.00 19.31 ? 42   GLN B C     1 
ATOM   5209  O  O     . GLN B 1 42  ? 74.840  129.705 58.294  1.00 17.70 ? 42   GLN B O     1 
ATOM   5210  C  CB    . GLN B 1 42  ? 76.768  131.827 59.622  1.00 19.94 ? 42   GLN B CB    1 
ATOM   5211  C  CG    . GLN B 1 42  ? 76.974  130.537 60.374  1.00 22.21 ? 42   GLN B CG    1 
ATOM   5212  C  CD    . GLN B 1 42  ? 77.709  129.503 59.536  1.00 23.06 ? 42   GLN B CD    1 
ATOM   5213  O  OE1   . GLN B 1 42  ? 77.246  128.374 59.379  1.00 24.41 ? 42   GLN B OE1   1 
ATOM   5214  N  NE2   . GLN B 1 42  ? 78.858  129.886 58.991  1.00 24.53 ? 42   GLN B NE2   1 
ATOM   5215  N  N     . GLY B 1 43  ? 73.872  131.715 57.972  1.00 17.72 ? 43   GLY B N     1 
ATOM   5216  C  CA    . GLY B 1 43  ? 72.528  131.166 57.936  1.00 17.89 ? 43   GLY B CA    1 
ATOM   5217  C  C     . GLY B 1 43  ? 72.274  130.309 56.708  1.00 20.04 ? 43   GLY B C     1 
ATOM   5218  O  O     . GLY B 1 43  ? 71.292  129.566 56.640  1.00 18.46 ? 43   GLY B O     1 
ATOM   5219  N  N     . LYS B 1 44  ? 73.173  130.403 55.733  1.00 22.15 ? 44   LYS B N     1 
ATOM   5220  C  CA    . LYS B 1 44  ? 73.061  129.642 54.492  1.00 22.92 ? 44   LYS B CA    1 
ATOM   5221  C  C     . LYS B 1 44  ? 73.379  128.166 54.689  1.00 21.20 ? 44   LYS B C     1 
ATOM   5222  O  O     . LYS B 1 44  ? 73.324  127.390 53.737  1.00 22.21 ? 44   LYS B O     1 
ATOM   5223  C  CB    . LYS B 1 44  ? 74.008  130.214 53.430  1.00 25.58 ? 44   LYS B CB    1 
ATOM   5224  C  CG    . LYS B 1 44  ? 73.845  131.704 53.174  1.00 27.65 ? 44   LYS B CG    1 
ATOM   5225  C  CD    . LYS B 1 44  ? 72.435  132.046 52.725  1.00 29.85 ? 44   LYS B CD    1 
ATOM   5226  C  CE    . LYS B 1 44  ? 72.274  133.548 52.526  1.00 32.32 ? 44   LYS B CE    1 
ATOM   5227  N  NZ    . LYS B 1 44  ? 70.855  133.922 52.271  1.00 32.80 ? 44   LYS B NZ    1 
ATOM   5228  N  N     . ILE B 1 45  ? 73.729  127.782 55.913  1.00 18.81 ? 45   ILE B N     1 
ATOM   5229  C  CA    . ILE B 1 45  ? 74.046  126.387 56.205  1.00 19.35 ? 45   ILE B CA    1 
ATOM   5230  C  C     . ILE B 1 45  ? 72.755  125.581 56.182  1.00 19.48 ? 45   ILE B C     1 
ATOM   5231  O  O     . ILE B 1 45  ? 72.767  124.350 56.247  1.00 20.51 ? 45   ILE B O     1 
ATOM   5232  C  CB    . ILE B 1 45  ? 74.715  126.230 57.592  1.00 20.30 ? 45   ILE B CB    1 
ATOM   5233  C  CG1   . ILE B 1 45  ? 75.311  124.828 57.725  1.00 18.88 ? 45   ILE B CG1   1 
ATOM   5234  C  CG2   . ILE B 1 45  ? 73.698  126.486 58.706  1.00 20.43 ? 45   ILE B CG2   1 
ATOM   5235  C  CD1   . ILE B 1 45  ? 76.138  124.647 58.969  1.00 18.57 ? 45   ILE B CD1   1 
ATOM   5236  N  N     . LEU B 1 46  ? 71.639  126.294 56.089  1.00 19.25 ? 46   LEU B N     1 
ATOM   5237  C  CA    . LEU B 1 46  ? 70.326  125.665 56.037  1.00 18.83 ? 46   LEU B CA    1 
ATOM   5238  C  C     . LEU B 1 46  ? 69.631  126.059 54.745  1.00 19.21 ? 46   LEU B C     1 
ATOM   5239  O  O     . LEU B 1 46  ? 69.997  127.050 54.100  1.00 19.69 ? 46   LEU B O     1 
ATOM   5240  C  CB    . LEU B 1 46  ? 69.454  126.121 57.209  1.00 17.27 ? 46   LEU B CB    1 
ATOM   5241  C  CG    . LEU B 1 46  ? 69.992  126.026 58.640  1.00 15.80 ? 46   LEU B CG    1 
ATOM   5242  C  CD1   . LEU B 1 46  ? 68.921  126.521 59.603  1.00 14.32 ? 46   LEU B CD1   1 
ATOM   5243  C  CD2   . LEU B 1 46  ? 70.372  124.592 58.969  1.00 17.12 ? 46   LEU B CD2   1 
ATOM   5244  N  N     . ASP B 1 47  ? 68.630  125.273 54.369  1.00 18.51 ? 47   ASP B N     1 
ATOM   5245  C  CA    . ASP B 1 47  ? 67.852  125.569 53.180  1.00 18.79 ? 47   ASP B CA    1 
ATOM   5246  C  C     . ASP B 1 47  ? 66.673  126.426 53.617  1.00 19.28 ? 47   ASP B C     1 
ATOM   5247  O  O     . ASP B 1 47  ? 65.977  126.098 54.575  1.00 19.22 ? 47   ASP B O     1 
ATOM   5248  C  CB    . ASP B 1 47  ? 67.332  124.284 52.529  1.00 18.77 ? 47   ASP B CB    1 
ATOM   5249  C  CG    . ASP B 1 47  ? 68.415  123.519 51.794  1.00 19.98 ? 47   ASP B CG    1 
ATOM   5250  O  OD1   . ASP B 1 47  ? 68.098  122.480 51.173  1.00 20.72 ? 47   ASP B OD1   1 
ATOM   5251  O  OD2   . ASP B 1 47  ? 69.583  123.959 51.831  1.00 21.99 ? 47   ASP B OD2   1 
ATOM   5252  N  N     . TRP B 1 48  ? 66.469  127.537 52.923  1.00 19.43 ? 48   TRP B N     1 
ATOM   5253  C  CA    . TRP B 1 48  ? 65.365  128.432 53.219  1.00 17.91 ? 48   TRP B CA    1 
ATOM   5254  C  C     . TRP B 1 48  ? 64.376  128.376 52.065  1.00 18.12 ? 48   TRP B C     1 
ATOM   5255  O  O     . TRP B 1 48  ? 64.768  128.479 50.905  1.00 18.55 ? 48   TRP B O     1 
ATOM   5256  C  CB    . TRP B 1 48  ? 65.876  129.867 53.410  1.00 15.95 ? 48   TRP B CB    1 
ATOM   5257  C  CG    . TRP B 1 48  ? 66.708  130.027 54.648  1.00 14.68 ? 48   TRP B CG    1 
ATOM   5258  C  CD1   . TRP B 1 48  ? 68.008  129.648 54.813  1.00 14.18 ? 48   TRP B CD1   1 
ATOM   5259  C  CD2   . TRP B 1 48  ? 66.267  130.518 55.921  1.00 13.66 ? 48   TRP B CD2   1 
ATOM   5260  N  NE1   . TRP B 1 48  ? 68.401  129.864 56.109  1.00 14.31 ? 48   TRP B NE1   1 
ATOM   5261  C  CE2   . TRP B 1 48  ? 67.353  130.397 56.812  1.00 14.65 ? 48   TRP B CE2   1 
ATOM   5262  C  CE3   . TRP B 1 48  ? 65.058  131.041 56.395  1.00 13.64 ? 48   TRP B CE3   1 
ATOM   5263  C  CZ2   . TRP B 1 48  ? 67.266  130.781 58.156  1.00 15.19 ? 48   TRP B CZ2   1 
ATOM   5264  C  CZ3   . TRP B 1 48  ? 64.969  131.420 57.728  1.00 12.68 ? 48   TRP B CZ3   1 
ATOM   5265  C  CH2   . TRP B 1 48  ? 66.067  131.288 58.595  1.00 14.07 ? 48   TRP B CH2   1 
ATOM   5266  N  N     . ILE B 1 49  ? 63.099  128.196 52.385  1.00 17.49 ? 49   ILE B N     1 
ATOM   5267  C  CA    . ILE B 1 49  ? 62.055  128.141 51.368  1.00 17.16 ? 49   ILE B CA    1 
ATOM   5268  C  C     . ILE B 1 49  ? 61.935  129.526 50.736  1.00 16.87 ? 49   ILE B C     1 
ATOM   5269  O  O     . ILE B 1 49  ? 61.748  129.663 49.527  1.00 14.94 ? 49   ILE B O     1 
ATOM   5270  C  CB    . ILE B 1 49  ? 60.728  127.694 51.991  1.00 17.17 ? 49   ILE B CB    1 
ATOM   5271  C  CG1   . ILE B 1 49  ? 60.893  126.257 52.515  1.00 19.30 ? 49   ILE B CG1   1 
ATOM   5272  C  CG2   . ILE B 1 49  ? 59.603  127.780 50.961  1.00 16.07 ? 49   ILE B CG2   1 
ATOM   5273  C  CD1   . ILE B 1 49  ? 59.726  125.734 53.302  1.00 19.74 ? 49   ILE B CD1   1 
ATOM   5274  N  N     . THR B 1 50  ? 62.033  130.550 51.571  1.00 16.00 ? 50   THR B N     1 
ATOM   5275  C  CA    . THR B 1 50  ? 62.026  131.927 51.111  1.00 18.29 ? 50   THR B CA    1 
ATOM   5276  C  C     . THR B 1 50  ? 63.203  132.538 51.859  1.00 18.78 ? 50   THR B C     1 
ATOM   5277  O  O     . THR B 1 50  ? 63.347  132.361 53.068  1.00 18.70 ? 50   THR B O     1 
ATOM   5278  C  CB    . THR B 1 50  ? 60.706  132.684 51.441  1.00 18.75 ? 50   THR B CB    1 
ATOM   5279  O  OG1   . THR B 1 50  ? 60.455  132.650 52.850  1.00 21.72 ? 50   THR B OG1   1 
ATOM   5280  C  CG2   . THR B 1 50  ? 59.538  132.067 50.690  1.00 17.81 ? 50   THR B CG2   1 
ATOM   5281  N  N     . PRO B 1 51  ? 64.077  133.250 51.141  1.00 20.50 ? 51   PRO B N     1 
ATOM   5282  C  CA    . PRO B 1 51  ? 65.243  133.863 51.775  1.00 20.47 ? 51   PRO B CA    1 
ATOM   5283  C  C     . PRO B 1 51  ? 64.844  134.946 52.748  1.00 21.38 ? 51   PRO B C     1 
ATOM   5284  O  O     . PRO B 1 51  ? 63.727  135.460 52.691  1.00 22.79 ? 51   PRO B O     1 
ATOM   5285  C  CB    . PRO B 1 51  ? 66.013  134.425 50.593  1.00 20.50 ? 51   PRO B CB    1 
ATOM   5286  C  CG    . PRO B 1 51  ? 64.898  134.887 49.695  1.00 19.69 ? 51   PRO B CG    1 
ATOM   5287  C  CD    . PRO B 1 51  ? 63.932  133.714 49.749  1.00 19.44 ? 51   PRO B CD    1 
ATOM   5288  N  N     . TYR B 1 52  ? 65.762  135.280 53.644  1.00 21.86 ? 52   TYR B N     1 
ATOM   5289  C  CA    . TYR B 1 52  ? 65.527  136.339 54.610  1.00 23.29 ? 52   TYR B CA    1 
ATOM   5290  C  C     . TYR B 1 52  ? 66.262  137.578 54.099  1.00 24.04 ? 52   TYR B C     1 
ATOM   5291  O  O     . TYR B 1 52  ? 66.954  137.515 53.086  1.00 23.25 ? 52   TYR B O     1 
ATOM   5292  C  CB    . TYR B 1 52  ? 66.066  135.923 55.981  1.00 22.45 ? 52   TYR B CB    1 
ATOM   5293  C  CG    . TYR B 1 52  ? 67.446  135.300 55.946  1.00 22.45 ? 52   TYR B CG    1 
ATOM   5294  C  CD1   . TYR B 1 52  ? 68.584  136.074 55.704  1.00 22.66 ? 52   TYR B CD1   1 
ATOM   5295  C  CD2   . TYR B 1 52  ? 67.609  133.931 56.142  1.00 23.57 ? 52   TYR B CD2   1 
ATOM   5296  C  CE1   . TYR B 1 52  ? 69.855  135.490 55.662  1.00 23.52 ? 52   TYR B CE1   1 
ATOM   5297  C  CE2   . TYR B 1 52  ? 68.864  133.338 56.100  1.00 24.23 ? 52   TYR B CE2   1 
ATOM   5298  C  CZ    . TYR B 1 52  ? 69.982  134.119 55.861  1.00 25.26 ? 52   TYR B CZ    1 
ATOM   5299  O  OH    . TYR B 1 52  ? 71.217  133.508 55.827  1.00 27.00 ? 52   TYR B OH    1 
ATOM   5300  N  N     . GLN B 1 53  ? 66.093  138.701 54.785  1.00 25.13 ? 53   GLN B N     1 
ATOM   5301  C  CA    . GLN B 1 53  ? 66.765  139.939 54.415  1.00 26.23 ? 53   GLN B CA    1 
ATOM   5302  C  C     . GLN B 1 53  ? 67.365  140.487 55.695  1.00 25.90 ? 53   GLN B C     1 
ATOM   5303  O  O     . GLN B 1 53  ? 68.581  140.633 55.813  1.00 29.14 ? 53   GLN B O     1 
ATOM   5304  C  CB    . GLN B 1 53  ? 65.769  140.936 53.820  1.00 25.60 ? 53   GLN B CB    1 
ATOM   5305  N  N     . LYS B 1 54  ? 66.495  140.765 56.660  1.00 25.90 ? 54   LYS B N     1 
ATOM   5306  C  CA    . LYS B 1 54  ? 66.914  141.282 57.959  1.00 25.67 ? 54   LYS B CA    1 
ATOM   5307  C  C     . LYS B 1 54  ? 67.463  140.123 58.789  1.00 24.79 ? 54   LYS B C     1 
ATOM   5308  O  O     . LYS B 1 54  ? 66.801  139.101 58.948  1.00 24.40 ? 54   LYS B O     1 
ATOM   5309  C  CB    . LYS B 1 54  ? 65.723  141.924 58.671  1.00 26.16 ? 54   LYS B CB    1 
ATOM   5310  N  N     . VAL B 1 55  ? 68.673  140.274 59.310  1.00 22.85 ? 55   VAL B N     1 
ATOM   5311  C  CA    . VAL B 1 55  ? 69.274  139.216 60.113  1.00 20.37 ? 55   VAL B CA    1 
ATOM   5312  C  C     . VAL B 1 55  ? 68.998  139.420 61.596  1.00 20.40 ? 55   VAL B C     1 
ATOM   5313  O  O     . VAL B 1 55  ? 68.127  138.760 62.164  1.00 20.53 ? 55   VAL B O     1 
ATOM   5314  C  CB    . VAL B 1 55  ? 70.798  139.141 59.884  1.00 20.81 ? 55   VAL B CB    1 
ATOM   5315  C  CG1   . VAL B 1 55  ? 71.397  137.969 60.663  1.00 17.29 ? 55   VAL B CG1   1 
ATOM   5316  C  CG2   . VAL B 1 55  ? 71.077  138.996 58.384  1.00 20.19 ? 55   VAL B CG2   1 
ATOM   5317  N  N     . LYS B 1 56  ? 69.726  140.343 62.218  1.00 18.88 ? 56   LYS B N     1 
ATOM   5318  C  CA    . LYS B 1 56  ? 69.555  140.608 63.643  1.00 18.02 ? 56   LYS B CA    1 
ATOM   5319  C  C     . LYS B 1 56  ? 68.543  141.715 63.971  1.00 18.47 ? 56   LYS B C     1 
ATOM   5320  O  O     . LYS B 1 56  ? 68.627  142.830 63.456  1.00 17.87 ? 56   LYS B O     1 
ATOM   5321  C  CB    . LYS B 1 56  ? 70.914  140.946 64.262  1.00 17.47 ? 56   LYS B CB    1 
ATOM   5322  C  CG    . LYS B 1 56  ? 70.899  141.124 65.769  1.00 16.55 ? 56   LYS B CG    1 
ATOM   5323  C  CD    . LYS B 1 56  ? 72.318  141.240 66.302  1.00 15.24 ? 56   LYS B CD    1 
ATOM   5324  C  CE    . LYS B 1 56  ? 72.334  141.516 67.794  1.00 14.25 ? 56   LYS B CE    1 
ATOM   5325  N  NZ    . LYS B 1 56  ? 71.765  142.854 68.111  1.00 19.98 ? 56   LYS B NZ    1 
ATOM   5326  N  N     . ASN B 1 57  ? 67.583  141.393 64.832  1.00 17.91 ? 57   ASN B N     1 
ATOM   5327  C  CA    . ASN B 1 57  ? 66.565  142.351 65.258  1.00 18.06 ? 57   ASN B CA    1 
ATOM   5328  C  C     . ASN B 1 57  ? 66.171  142.006 66.692  1.00 18.34 ? 57   ASN B C     1 
ATOM   5329  O  O     . ASN B 1 57  ? 65.099  141.451 66.944  1.00 18.54 ? 57   ASN B O     1 
ATOM   5330  C  CB    . ASN B 1 57  ? 65.350  142.281 64.329  1.00 16.62 ? 57   ASN B CB    1 
ATOM   5331  C  CG    . ASN B 1 57  ? 64.293  143.309 64.673  1.00 17.14 ? 57   ASN B CG    1 
ATOM   5332  O  OD1   . ASN B 1 57  ? 64.602  144.376 65.199  1.00 18.46 ? 57   ASN B OD1   1 
ATOM   5333  N  ND2   . ASN B 1 57  ? 63.040  143.003 64.360  1.00 15.61 ? 57   ASN B ND2   1 
ATOM   5334  N  N     . THR B 1 58  ? 67.052  142.348 67.629  1.00 18.36 ? 58   THR B N     1 
ATOM   5335  C  CA    . THR B 1 58  ? 66.847  142.047 69.043  1.00 17.82 ? 58   THR B CA    1 
ATOM   5336  C  C     . THR B 1 58  ? 67.029  143.239 69.984  1.00 17.88 ? 58   THR B C     1 
ATOM   5337  O  O     . THR B 1 58  ? 67.657  144.243 69.639  1.00 17.90 ? 58   THR B O     1 
ATOM   5338  C  CB    . THR B 1 58  ? 67.828  140.948 69.513  1.00 17.42 ? 58   THR B CB    1 
ATOM   5339  O  OG1   . THR B 1 58  ? 69.156  141.486 69.551  1.00 17.90 ? 58   THR B OG1   1 
ATOM   5340  C  CG2   . THR B 1 58  ? 67.801  139.756 68.570  1.00 15.63 ? 58   THR B CG2   1 
ATOM   5341  N  N     . SER B 1 59  ? 66.493  143.094 71.191  1.00 18.33 ? 59   SER B N     1 
ATOM   5342  C  CA    . SER B 1 59  ? 66.581  144.127 72.215  1.00 18.16 ? 59   SER B CA    1 
ATOM   5343  C  C     . SER B 1 59  ? 66.471  143.505 73.603  1.00 18.35 ? 59   SER B C     1 
ATOM   5344  O  O     . SER B 1 59  ? 65.601  142.670 73.844  1.00 20.83 ? 59   SER B O     1 
ATOM   5345  C  CB    . SER B 1 59  ? 65.462  145.159 72.029  1.00 17.63 ? 59   SER B CB    1 
ATOM   5346  O  OG    . SER B 1 59  ? 65.255  145.910 73.216  1.00 15.48 ? 59   SER B OG    1 
ATOM   5347  N  N     . PHE B 1 60  ? 67.359  143.918 74.506  1.00 18.10 ? 60   PHE B N     1 
ATOM   5348  C  CA    . PHE B 1 60  ? 67.364  143.426 75.882  1.00 17.79 ? 60   PHE B CA    1 
ATOM   5349  C  C     . PHE B 1 60  ? 66.871  144.518 76.829  1.00 20.46 ? 60   PHE B C     1 
ATOM   5350  O  O     . PHE B 1 60  ? 67.044  144.409 78.052  1.00 20.78 ? 60   PHE B O     1 
ATOM   5351  C  CB    . PHE B 1 60  ? 68.778  143.012 76.316  1.00 14.87 ? 60   PHE B CB    1 
ATOM   5352  C  CG    . PHE B 1 60  ? 69.255  141.707 75.732  1.00 13.15 ? 60   PHE B CG    1 
ATOM   5353  C  CD1   . PHE B 1 60  ? 70.531  141.230 76.040  1.00 12.06 ? 60   PHE B CD1   1 
ATOM   5354  C  CD2   . PHE B 1 60  ? 68.445  140.956 74.878  1.00 11.15 ? 60   PHE B CD2   1 
ATOM   5355  C  CE1   . PHE B 1 60  ? 70.995  140.029 75.508  1.00 9.57  ? 60   PHE B CE1   1 
ATOM   5356  C  CE2   . PHE B 1 60  ? 68.903  139.752 74.340  1.00 9.09  ? 60   PHE B CE2   1 
ATOM   5357  C  CZ    . PHE B 1 60  ? 70.176  139.290 74.654  1.00 11.48 ? 60   PHE B CZ    1 
ATOM   5358  N  N     . ALA B 1 61  ? 66.268  145.561 76.259  1.00 20.98 ? 61   ALA B N     1 
ATOM   5359  C  CA    . ALA B 1 61  ? 65.760  146.691 77.037  1.00 22.30 ? 61   ALA B CA    1 
ATOM   5360  C  C     . ALA B 1 61  ? 64.830  146.243 78.153  1.00 22.74 ? 61   ALA B C     1 
ATOM   5361  O  O     . ALA B 1 61  ? 63.953  145.410 77.941  1.00 22.74 ? 61   ALA B O     1 
ATOM   5362  C  CB    . ALA B 1 61  ? 65.037  147.682 76.126  1.00 22.41 ? 61   ALA B CB    1 
ATOM   5363  N  N     . PRO B 1 62  ? 65.003  146.817 79.355  1.00 24.32 ? 62   PRO B N     1 
ATOM   5364  C  CA    . PRO B 1 62  ? 64.221  146.528 80.563  1.00 26.81 ? 62   PRO B CA    1 
ATOM   5365  C  C     . PRO B 1 62  ? 62.719  146.327 80.337  1.00 29.16 ? 62   PRO B C     1 
ATOM   5366  O  O     . PRO B 1 62  ? 62.055  147.160 79.715  1.00 29.88 ? 62   PRO B O     1 
ATOM   5367  C  CB    . PRO B 1 62  ? 64.512  147.736 81.455  1.00 25.85 ? 62   PRO B CB    1 
ATOM   5368  C  CG    . PRO B 1 62  ? 65.931  148.040 81.117  1.00 24.05 ? 62   PRO B CG    1 
ATOM   5369  C  CD    . PRO B 1 62  ? 65.938  147.930 79.598  1.00 24.60 ? 62   PRO B CD    1 
ATOM   5370  N  N     . GLY B 1 63  ? 62.204  145.208 80.847  1.00 31.16 ? 63   GLY B N     1 
ATOM   5371  C  CA    . GLY B 1 63  ? 60.792  144.890 80.719  1.00 32.96 ? 63   GLY B CA    1 
ATOM   5372  C  C     . GLY B 1 63  ? 60.246  144.950 79.302  1.00 34.48 ? 63   GLY B C     1 
ATOM   5373  O  O     . GLY B 1 63  ? 59.028  144.975 79.100  1.00 33.49 ? 63   GLY B O     1 
ATOM   5374  N  N     . ASN B 1 64  ? 61.146  144.975 78.322  1.00 34.82 ? 64   ASN B N     1 
ATOM   5375  C  CA    . ASN B 1 64  ? 60.766  145.033 76.913  1.00 33.43 ? 64   ASN B CA    1 
ATOM   5376  C  C     . ASN B 1 64  ? 61.770  144.263 76.051  1.00 31.88 ? 64   ASN B C     1 
ATOM   5377  O  O     . ASN B 1 64  ? 62.463  144.837 75.201  1.00 31.05 ? 64   ASN B O     1 
ATOM   5378  C  CB    . ASN B 1 64  ? 60.690  146.491 76.467  1.00 33.29 ? 64   ASN B CB    1 
ATOM   5379  C  CG    . ASN B 1 64  ? 59.688  147.296 77.282  1.00 34.64 ? 64   ASN B CG    1 
ATOM   5380  O  OD1   . ASN B 1 64  ? 58.487  147.027 77.254  1.00 33.78 ? 64   ASN B OD1   1 
ATOM   5381  N  ND2   . ASN B 1 64  ? 60.182  148.288 78.018  1.00 36.31 ? 64   ASN B ND2   1 
ATOM   5382  N  N     . VAL B 1 65  ? 61.834  142.953 76.286  1.00 29.09 ? 65   VAL B N     1 
ATOM   5383  C  CA    . VAL B 1 65  ? 62.739  142.057 75.573  1.00 25.51 ? 65   VAL B CA    1 
ATOM   5384  C  C     . VAL B 1 65  ? 62.085  141.489 74.313  1.00 23.93 ? 65   VAL B C     1 
ATOM   5385  O  O     . VAL B 1 65  ? 60.996  140.920 74.366  1.00 22.32 ? 65   VAL B O     1 
ATOM   5386  C  CB    . VAL B 1 65  ? 63.177  140.891 76.489  1.00 24.03 ? 65   VAL B CB    1 
ATOM   5387  C  CG1   . VAL B 1 65  ? 64.123  139.960 75.748  1.00 22.73 ? 65   VAL B CG1   1 
ATOM   5388  C  CG2   . VAL B 1 65  ? 63.830  141.441 77.736  1.00 21.29 ? 65   VAL B CG2   1 
ATOM   5389  N  N     . SER B 1 66  ? 62.761  141.652 73.181  1.00 22.85 ? 66   SER B N     1 
ATOM   5390  C  CA    . SER B 1 66  ? 62.264  141.175 71.895  1.00 21.58 ? 66   SER B CA    1 
ATOM   5391  C  C     . SER B 1 66  ? 63.448  140.598 71.130  1.00 20.86 ? 66   SER B C     1 
ATOM   5392  O  O     . SER B 1 66  ? 64.449  141.287 70.913  1.00 20.38 ? 66   SER B O     1 
ATOM   5393  C  CB    . SER B 1 66  ? 61.638  142.337 71.119  1.00 20.94 ? 66   SER B CB    1 
ATOM   5394  O  OG    . SER B 1 66  ? 61.026  141.893 69.925  1.00 23.52 ? 66   SER B OG    1 
ATOM   5395  N  N     . ILE B 1 67  ? 63.336  139.334 70.733  1.00 21.33 ? 67   ILE B N     1 
ATOM   5396  C  CA    . ILE B 1 67  ? 64.417  138.657 70.014  1.00 20.51 ? 67   ILE B CA    1 
ATOM   5397  C  C     . ILE B 1 67  ? 63.943  138.045 68.696  1.00 21.18 ? 67   ILE B C     1 
ATOM   5398  O  O     . ILE B 1 67  ? 63.134  137.114 68.685  1.00 22.12 ? 67   ILE B O     1 
ATOM   5399  C  CB    . ILE B 1 67  ? 65.039  137.547 70.910  1.00 18.78 ? 67   ILE B CB    1 
ATOM   5400  C  CG1   . ILE B 1 67  ? 65.652  138.186 72.160  1.00 20.06 ? 67   ILE B CG1   1 
ATOM   5401  C  CG2   . ILE B 1 67  ? 66.078  136.753 70.143  1.00 15.78 ? 67   ILE B CG2   1 
ATOM   5402  C  CD1   . ILE B 1 67  ? 65.854  137.226 73.315  1.00 18.14 ? 67   ILE B CD1   1 
ATOM   5403  N  N     . LYS B 1 68  ? 64.453  138.578 67.588  1.00 20.89 ? 68   LYS B N     1 
ATOM   5404  C  CA    . LYS B 1 68  ? 64.100  138.082 66.262  1.00 20.45 ? 68   LYS B CA    1 
ATOM   5405  C  C     . LYS B 1 68  ? 65.350  137.929 65.398  1.00 18.51 ? 68   LYS B C     1 
ATOM   5406  O  O     . LYS B 1 68  ? 66.205  138.812 65.362  1.00 19.44 ? 68   LYS B O     1 
ATOM   5407  C  CB    . LYS B 1 68  ? 63.112  139.037 65.575  1.00 21.66 ? 68   LYS B CB    1 
ATOM   5408  C  CG    . LYS B 1 68  ? 61.818  139.262 66.359  1.00 23.06 ? 68   LYS B CG    1 
ATOM   5409  C  CD    . LYS B 1 68  ? 60.903  140.284 65.685  1.00 23.80 ? 68   LYS B CD    1 
ATOM   5410  C  CE    . LYS B 1 68  ? 59.694  140.613 66.559  1.00 24.93 ? 68   LYS B CE    1 
ATOM   5411  N  NZ    . LYS B 1 68  ? 58.785  141.635 65.941  1.00 25.75 ? 68   LYS B NZ    1 
ATOM   5412  N  N     . TRP B 1 69  ? 65.447  136.790 64.722  1.00 16.67 ? 69   TRP B N     1 
ATOM   5413  C  CA    . TRP B 1 69  ? 66.558  136.484 63.833  1.00 13.82 ? 69   TRP B CA    1 
ATOM   5414  C  C     . TRP B 1 69  ? 65.980  135.936 62.535  1.00 14.57 ? 69   TRP B C     1 
ATOM   5415  O  O     . TRP B 1 69  ? 65.080  135.098 62.567  1.00 13.49 ? 69   TRP B O     1 
ATOM   5416  C  CB    . TRP B 1 69  ? 67.477  135.433 64.456  1.00 12.81 ? 69   TRP B CB    1 
ATOM   5417  C  CG    . TRP B 1 69  ? 68.349  135.964 65.552  1.00 14.77 ? 69   TRP B CG    1 
ATOM   5418  C  CD1   . TRP B 1 69  ? 68.050  136.041 66.879  1.00 13.21 ? 69   TRP B CD1   1 
ATOM   5419  C  CD2   . TRP B 1 69  ? 69.665  136.513 65.404  1.00 13.88 ? 69   TRP B CD2   1 
ATOM   5420  N  NE1   . TRP B 1 69  ? 69.095  136.602 67.566  1.00 13.03 ? 69   TRP B NE1   1 
ATOM   5421  C  CE2   . TRP B 1 69  ? 70.099  136.901 66.686  1.00 14.32 ? 69   TRP B CE2   1 
ATOM   5422  C  CE3   . TRP B 1 69  ? 70.516  136.714 64.311  1.00 14.53 ? 69   TRP B CE3   1 
ATOM   5423  C  CZ2   . TRP B 1 69  ? 71.353  137.480 66.910  1.00 16.17 ? 69   TRP B CZ2   1 
ATOM   5424  C  CZ3   . TRP B 1 69  ? 71.766  137.291 64.530  1.00 17.00 ? 69   TRP B CZ3   1 
ATOM   5425  C  CH2   . TRP B 1 69  ? 72.171  137.667 65.821  1.00 18.21 ? 69   TRP B CH2   1 
ATOM   5426  N  N     . TYR B 1 70  ? 66.490  136.415 61.401  1.00 14.72 ? 70   TYR B N     1 
ATOM   5427  C  CA    . TYR B 1 70  ? 66.021  135.959 60.090  1.00 14.23 ? 70   TYR B CA    1 
ATOM   5428  C  C     . TYR B 1 70  ? 64.492  136.035 59.987  1.00 14.88 ? 70   TYR B C     1 
ATOM   5429  O  O     . TYR B 1 70  ? 63.890  135.366 59.153  1.00 17.77 ? 70   TYR B O     1 
ATOM   5430  C  CB    . TYR B 1 70  ? 66.459  134.505 59.860  1.00 12.20 ? 70   TYR B CB    1 
ATOM   5431  C  CG    . TYR B 1 70  ? 67.926  134.212 60.144  1.00 13.60 ? 70   TYR B CG    1 
ATOM   5432  C  CD1   . TYR B 1 70  ? 68.298  133.335 61.174  1.00 12.36 ? 70   TYR B CD1   1 
ATOM   5433  C  CD2   . TYR B 1 70  ? 68.940  134.784 59.366  1.00 14.48 ? 70   TYR B CD2   1 
ATOM   5434  C  CE1   . TYR B 1 70  ? 69.642  133.029 61.417  1.00 10.83 ? 70   TYR B CE1   1 
ATOM   5435  C  CE2   . TYR B 1 70  ? 70.291  134.486 59.604  1.00 13.19 ? 70   TYR B CE2   1 
ATOM   5436  C  CZ    . TYR B 1 70  ? 70.634  133.606 60.628  1.00 14.63 ? 70   TYR B CZ    1 
ATOM   5437  O  OH    . TYR B 1 70  ? 71.962  133.279 60.846  1.00 13.08 ? 70   TYR B OH    1 
ATOM   5438  N  N     . GLU B 1 71  ? 63.875  136.871 60.812  1.00 15.57 ? 71   GLU B N     1 
ATOM   5439  C  CA    . GLU B 1 71  ? 62.416  136.979 60.872  1.00 18.61 ? 71   GLU B CA    1 
ATOM   5440  C  C     . GLU B 1 71  ? 61.600  136.891 59.586  1.00 20.05 ? 71   GLU B C     1 
ATOM   5441  O  O     . GLU B 1 71  ? 60.508  136.329 59.586  1.00 21.46 ? 71   GLU B O     1 
ATOM   5442  C  CB    . GLU B 1 71  ? 62.020  138.251 61.629  1.00 19.23 ? 71   GLU B CB    1 
ATOM   5443  C  CG    . GLU B 1 71  ? 62.136  139.538 60.830  1.00 16.95 ? 71   GLU B CG    1 
ATOM   5444  C  CD    . GLU B 1 71  ? 62.016  140.752 61.709  1.00 17.53 ? 71   GLU B CD    1 
ATOM   5445  O  OE1   . GLU B 1 71  ? 62.916  140.965 62.547  1.00 17.64 ? 71   GLU B OE1   1 
ATOM   5446  O  OE2   . GLU B 1 71  ? 61.021  141.493 61.572  1.00 18.20 ? 71   GLU B OE2   1 
ATOM   5447  N  N     . ASP B 1 72  ? 62.115  137.440 58.495  1.00 22.35 ? 72   ASP B N     1 
ATOM   5448  C  CA    . ASP B 1 72  ? 61.386  137.434 57.234  1.00 23.91 ? 72   ASP B CA    1 
ATOM   5449  C  C     . ASP B 1 72  ? 61.648  136.204 56.365  1.00 23.85 ? 72   ASP B C     1 
ATOM   5450  O  O     . ASP B 1 72  ? 61.125  136.096 55.258  1.00 25.26 ? 72   ASP B O     1 
ATOM   5451  C  CB    . ASP B 1 72  ? 61.702  138.717 56.449  1.00 26.84 ? 72   ASP B CB    1 
ATOM   5452  C  CG    . ASP B 1 72  ? 63.173  138.838 56.083  1.00 29.58 ? 72   ASP B CG    1 
ATOM   5453  O  OD1   . ASP B 1 72  ? 64.043  138.525 56.929  1.00 29.31 ? 72   ASP B OD1   1 
ATOM   5454  O  OD2   . ASP B 1 72  ? 63.457  139.261 54.945  1.00 34.30 ? 72   ASP B OD2   1 
ATOM   5455  N  N     . GLY B 1 73  ? 62.457  135.275 56.860  1.00 22.57 ? 73   GLY B N     1 
ATOM   5456  C  CA    . GLY B 1 73  ? 62.727  134.081 56.083  1.00 20.40 ? 73   GLY B CA    1 
ATOM   5457  C  C     . GLY B 1 73  ? 61.823  132.949 56.528  1.00 19.11 ? 73   GLY B C     1 
ATOM   5458  O  O     . GLY B 1 73  ? 61.320  132.969 57.646  1.00 19.83 ? 73   GLY B O     1 
ATOM   5459  N  N     . THR B 1 74  ? 61.585  131.976 55.655  1.00 17.64 ? 74   THR B N     1 
ATOM   5460  C  CA    . THR B 1 74  ? 60.756  130.832 56.014  1.00 15.71 ? 74   THR B CA    1 
ATOM   5461  C  C     . THR B 1 74  ? 61.543  129.579 55.674  1.00 15.69 ? 74   THR B C     1 
ATOM   5462  O  O     . THR B 1 74  ? 62.449  129.617 54.836  1.00 15.42 ? 74   THR B O     1 
ATOM   5463  C  CB    . THR B 1 74  ? 59.407  130.806 55.253  1.00 15.76 ? 74   THR B CB    1 
ATOM   5464  O  OG1   . THR B 1 74  ? 59.628  130.548 53.861  1.00 14.73 ? 74   THR B OG1   1 
ATOM   5465  C  CG2   . THR B 1 74  ? 58.685  132.121 55.423  1.00 12.48 ? 74   THR B CG2   1 
ATOM   5466  N  N     . LEU B 1 75  ? 61.201  128.476 56.331  1.00 14.76 ? 75   LEU B N     1 
ATOM   5467  C  CA    . LEU B 1 75  ? 61.899  127.214 56.114  1.00 14.48 ? 75   LEU B CA    1 
ATOM   5468  C  C     . LEU B 1 75  ? 61.174  126.108 56.851  1.00 13.96 ? 75   LEU B C     1 
ATOM   5469  O  O     . LEU B 1 75  ? 60.122  126.331 57.436  1.00 12.86 ? 75   LEU B O     1 
ATOM   5470  C  CB    . LEU B 1 75  ? 63.334  127.296 56.644  1.00 15.44 ? 75   LEU B CB    1 
ATOM   5471  C  CG    . LEU B 1 75  ? 63.452  127.330 58.176  1.00 15.74 ? 75   LEU B CG    1 
ATOM   5472  C  CD1   . LEU B 1 75  ? 64.908  127.153 58.580  1.00 15.88 ? 75   LEU B CD1   1 
ATOM   5473  C  CD2   . LEU B 1 75  ? 62.878  128.641 58.718  1.00 12.97 ? 75   LEU B CD2   1 
ATOM   5474  N  N     . ASN B 1 76  ? 61.760  124.918 56.833  1.00 13.79 ? 76   ASN B N     1 
ATOM   5475  C  CA    . ASN B 1 76  ? 61.183  123.762 57.501  1.00 13.23 ? 76   ASN B CA    1 
ATOM   5476  C  C     . ASN B 1 76  ? 62.315  122.940 58.104  1.00 13.45 ? 76   ASN B C     1 
ATOM   5477  O  O     . ASN B 1 76  ? 63.195  122.475 57.382  1.00 15.91 ? 76   ASN B O     1 
ATOM   5478  C  CB    . ASN B 1 76  ? 60.410  122.902 56.499  1.00 11.58 ? 76   ASN B CB    1 
ATOM   5479  C  CG    . ASN B 1 76  ? 59.623  121.791 57.174  1.00 12.91 ? 76   ASN B CG    1 
ATOM   5480  O  OD1   . ASN B 1 76  ? 58.434  121.940 57.450  1.00 11.71 ? 76   ASN B OD1   1 
ATOM   5481  N  ND2   . ASN B 1 76  ? 60.288  120.676 57.458  1.00 11.26 ? 76   ASN B ND2   1 
ATOM   5482  N  N     . LEU B 1 77  ? 62.287  122.755 59.420  1.00 14.18 ? 77   LEU B N     1 
ATOM   5483  C  CA    . LEU B 1 77  ? 63.331  121.997 60.108  1.00 13.42 ? 77   LEU B CA    1 
ATOM   5484  C  C     . LEU B 1 77  ? 63.435  120.531 59.693  1.00 12.76 ? 77   LEU B C     1 
ATOM   5485  O  O     . LEU B 1 77  ? 64.532  119.982 59.651  1.00 13.20 ? 77   LEU B O     1 
ATOM   5486  C  CB    . LEU B 1 77  ? 63.144  122.087 61.631  1.00 12.60 ? 77   LEU B CB    1 
ATOM   5487  C  CG    . LEU B 1 77  ? 64.158  121.295 62.476  1.00 13.98 ? 77   LEU B CG    1 
ATOM   5488  C  CD1   . LEU B 1 77  ? 64.331  121.949 63.841  1.00 14.51 ? 77   LEU B CD1   1 
ATOM   5489  C  CD2   . LEU B 1 77  ? 63.702  119.847 62.620  1.00 13.11 ? 77   LEU B CD2   1 
ATOM   5490  N  N     . ALA B 1 78  ? 62.306  119.889 59.407  1.00 13.39 ? 78   ALA B N     1 
ATOM   5491  C  CA    . ALA B 1 78  ? 62.332  118.485 59.007  1.00 13.18 ? 78   ALA B CA    1 
ATOM   5492  C  C     . ALA B 1 78  ? 63.000  118.348 57.640  1.00 15.06 ? 78   ALA B C     1 
ATOM   5493  O  O     . ALA B 1 78  ? 63.716  117.380 57.375  1.00 16.91 ? 78   ALA B O     1 
ATOM   5494  C  CB    . ALA B 1 78  ? 60.918  117.918 58.960  1.00 12.01 ? 78   ALA B CB    1 
ATOM   5495  N  N     . ALA B 1 79  ? 62.761  119.328 56.774  1.00 15.19 ? 79   ALA B N     1 
ATOM   5496  C  CA    . ALA B 1 79  ? 63.338  119.330 55.438  1.00 14.41 ? 79   ALA B CA    1 
ATOM   5497  C  C     . ALA B 1 79  ? 64.857  119.483 55.514  1.00 14.83 ? 79   ALA B C     1 
ATOM   5498  O  O     . ALA B 1 79  ? 65.594  118.888 54.730  1.00 15.10 ? 79   ALA B O     1 
ATOM   5499  C  CB    . ALA B 1 79  ? 62.737  120.459 54.618  1.00 12.29 ? 79   ALA B CB    1 
ATOM   5500  N  N     . ASN B 1 80  ? 65.323  120.290 56.460  1.00 14.48 ? 80   ASN B N     1 
ATOM   5501  C  CA    . ASN B 1 80  ? 66.751  120.511 56.634  1.00 14.02 ? 80   ASN B CA    1 
ATOM   5502  C  C     . ASN B 1 80  ? 67.435  119.314 57.270  1.00 14.71 ? 80   ASN B C     1 
ATOM   5503  O  O     . ASN B 1 80  ? 68.625  119.078 57.045  1.00 14.20 ? 80   ASN B O     1 
ATOM   5504  C  CB    . ASN B 1 80  ? 66.990  121.749 57.500  1.00 14.48 ? 80   ASN B CB    1 
ATOM   5505  C  CG    . ASN B 1 80  ? 67.094  123.024 56.679  1.00 15.05 ? 80   ASN B CG    1 
ATOM   5506  O  OD1   . ASN B 1 80  ? 68.148  123.337 56.129  1.00 15.96 ? 80   ASN B OD1   1 
ATOM   5507  N  ND2   . ASN B 1 80  ? 65.993  123.756 56.578  1.00 17.10 ? 80   ASN B ND2   1 
ATOM   5508  N  N     . CYS B 1 81  ? 66.682  118.557 58.062  1.00 14.26 ? 81   CYS B N     1 
ATOM   5509  C  CA    . CYS B 1 81  ? 67.238  117.391 58.738  1.00 15.47 ? 81   CYS B CA    1 
ATOM   5510  C  C     . CYS B 1 81  ? 67.000  116.091 57.975  1.00 16.71 ? 81   CYS B C     1 
ATOM   5511  O  O     . CYS B 1 81  ? 67.625  115.068 58.261  1.00 16.29 ? 81   CYS B O     1 
ATOM   5512  C  CB    . CYS B 1 81  ? 66.640  117.265 60.141  1.00 14.42 ? 81   CYS B CB    1 
ATOM   5513  S  SG    . CYS B 1 81  ? 67.160  118.524 61.319  1.00 18.42 ? 81   CYS B SG    1 
ATOM   5514  N  N     . LEU B 1 82  ? 66.113  116.133 56.987  1.00 17.96 ? 82   LEU B N     1 
ATOM   5515  C  CA    . LEU B 1 82  ? 65.794  114.924 56.242  1.00 17.70 ? 82   LEU B CA    1 
ATOM   5516  C  C     . LEU B 1 82  ? 65.797  115.047 54.719  1.00 17.05 ? 82   LEU B C     1 
ATOM   5517  O  O     . LEU B 1 82  ? 66.704  114.559 54.048  1.00 16.09 ? 82   LEU B O     1 
ATOM   5518  C  CB    . LEU B 1 82  ? 64.429  114.408 56.708  1.00 18.25 ? 82   LEU B CB    1 
ATOM   5519  C  CG    . LEU B 1 82  ? 64.281  114.189 58.220  1.00 19.18 ? 82   LEU B CG    1 
ATOM   5520  C  CD1   . LEU B 1 82  ? 62.819  113.981 58.576  1.00 19.83 ? 82   LEU B CD1   1 
ATOM   5521  C  CD2   . LEU B 1 82  ? 65.109  112.984 58.652  1.00 19.71 ? 82   LEU B CD2   1 
ATOM   5522  N  N     . ASP B 1 83  ? 64.773  115.702 54.183  1.00 16.34 ? 83   ASP B N     1 
ATOM   5523  C  CA    . ASP B 1 83  ? 64.606  115.863 52.740  1.00 16.06 ? 83   ASP B CA    1 
ATOM   5524  C  C     . ASP B 1 83  ? 65.816  116.275 51.913  1.00 16.48 ? 83   ASP B C     1 
ATOM   5525  O  O     . ASP B 1 83  ? 66.127  115.626 50.918  1.00 16.66 ? 83   ASP B O     1 
ATOM   5526  C  CB    . ASP B 1 83  ? 63.453  116.829 52.467  1.00 16.01 ? 83   ASP B CB    1 
ATOM   5527  C  CG    . ASP B 1 83  ? 62.175  116.414 53.172  1.00 16.56 ? 83   ASP B CG    1 
ATOM   5528  O  OD1   . ASP B 1 83  ? 61.143  116.260 52.492  1.00 16.60 ? 83   ASP B OD1   1 
ATOM   5529  O  OD2   . ASP B 1 83  ? 62.211  116.238 54.411  1.00 17.27 ? 83   ASP B OD2   1 
ATOM   5530  N  N     . ARG B 1 84  ? 66.495  117.346 52.307  1.00 16.79 ? 84   ARG B N     1 
ATOM   5531  C  CA    . ARG B 1 84  ? 67.642  117.812 51.546  1.00 17.49 ? 84   ARG B CA    1 
ATOM   5532  C  C     . ARG B 1 84  ? 68.848  116.877 51.540  1.00 19.41 ? 84   ARG B C     1 
ATOM   5533  O  O     . ARG B 1 84  ? 69.821  117.128 50.822  1.00 19.57 ? 84   ARG B O     1 
ATOM   5534  C  CB    . ARG B 1 84  ? 68.085  119.183 52.037  1.00 16.81 ? 84   ARG B CB    1 
ATOM   5535  C  CG    . ARG B 1 84  ? 68.777  119.181 53.378  1.00 16.92 ? 84   ARG B CG    1 
ATOM   5536  C  CD    . ARG B 1 84  ? 69.371  120.557 53.629  1.00 16.25 ? 84   ARG B CD    1 
ATOM   5537  N  NE    . ARG B 1 84  ? 69.972  120.707 54.947  1.00 10.88 ? 84   ARG B NE    1 
ATOM   5538  C  CZ    . ARG B 1 84  ? 70.778  121.712 55.271  1.00 13.21 ? 84   ARG B CZ    1 
ATOM   5539  N  NH1   . ARG B 1 84  ? 71.080  122.647 54.370  1.00 10.38 ? 84   ARG B NH1   1 
ATOM   5540  N  NH2   . ARG B 1 84  ? 71.283  121.786 56.493  1.00 13.21 ? 84   ARG B NH2   1 
ATOM   5541  N  N     . HIS B 1 85  ? 68.785  115.800 52.320  1.00 19.87 ? 85   HIS B N     1 
ATOM   5542  C  CA    . HIS B 1 85  ? 69.891  114.851 52.371  1.00 19.22 ? 85   HIS B CA    1 
ATOM   5543  C  C     . HIS B 1 85  ? 69.636  113.602 51.519  1.00 21.17 ? 85   HIS B C     1 
ATOM   5544  O  O     . HIS B 1 85  ? 70.563  112.850 51.213  1.00 21.18 ? 85   HIS B O     1 
ATOM   5545  C  CB    . HIS B 1 85  ? 70.158  114.437 53.822  1.00 17.84 ? 85   HIS B CB    1 
ATOM   5546  C  CG    . HIS B 1 85  ? 70.581  115.567 54.709  1.00 16.31 ? 85   HIS B CG    1 
ATOM   5547  N  ND1   . HIS B 1 85  ? 71.685  116.350 54.448  1.00 14.22 ? 85   HIS B ND1   1 
ATOM   5548  C  CD2   . HIS B 1 85  ? 70.043  116.047 55.854  1.00 15.96 ? 85   HIS B CD2   1 
ATOM   5549  C  CE1   . HIS B 1 85  ? 71.807  117.266 55.394  1.00 14.91 ? 85   HIS B CE1   1 
ATOM   5550  N  NE2   . HIS B 1 85  ? 70.823  117.104 56.259  1.00 17.66 ? 85   HIS B NE2   1 
ATOM   5551  N  N     . LEU B 1 86  ? 68.383  113.399 51.131  1.00 21.80 ? 86   LEU B N     1 
ATOM   5552  C  CA    . LEU B 1 86  ? 67.976  112.237 50.337  1.00 25.66 ? 86   LEU B CA    1 
ATOM   5553  C  C     . LEU B 1 86  ? 68.656  112.034 48.978  1.00 27.71 ? 86   LEU B C     1 
ATOM   5554  O  O     . LEU B 1 86  ? 69.126  110.937 48.666  1.00 27.51 ? 86   LEU B O     1 
ATOM   5555  C  CB    . LEU B 1 86  ? 66.460  112.270 50.115  1.00 24.78 ? 86   LEU B CB    1 
ATOM   5556  C  CG    . LEU B 1 86  ? 65.576  112.151 51.355  1.00 25.25 ? 86   LEU B CG    1 
ATOM   5557  C  CD1   . LEU B 1 86  ? 64.125  112.346 50.974  1.00 23.20 ? 86   LEU B CD1   1 
ATOM   5558  C  CD2   . LEU B 1 86  ? 65.782  110.785 51.993  1.00 25.17 ? 86   LEU B CD2   1 
ATOM   5559  N  N     . GLN B 1 87  ? 68.689  113.086 48.166  1.00 29.68 ? 87   GLN B N     1 
ATOM   5560  C  CA    . GLN B 1 87  ? 69.265  113.009 46.828  1.00 31.28 ? 87   GLN B CA    1 
ATOM   5561  C  C     . GLN B 1 87  ? 70.698  112.484 46.783  1.00 31.07 ? 87   GLN B C     1 
ATOM   5562  O  O     . GLN B 1 87  ? 71.035  111.656 45.933  1.00 29.76 ? 87   GLN B O     1 
ATOM   5563  C  CB    . GLN B 1 87  ? 69.191  114.381 46.157  1.00 33.51 ? 87   GLN B CB    1 
ATOM   5564  C  CG    . GLN B 1 87  ? 69.241  114.334 44.642  1.00 37.81 ? 87   GLN B CG    1 
ATOM   5565  C  CD    . GLN B 1 87  ? 68.191  115.230 44.002  1.00 41.11 ? 87   GLN B CD    1 
ATOM   5566  O  OE1   . GLN B 1 87  ? 66.983  115.037 44.201  1.00 42.45 ? 87   GLN B OE1   1 
ATOM   5567  N  NE2   . GLN B 1 87  ? 68.645  116.217 43.233  1.00 41.98 ? 87   GLN B NE2   1 
ATOM   5568  N  N     . GLU B 1 88  ? 71.535  112.959 47.700  1.00 30.33 ? 88   GLU B N     1 
ATOM   5569  C  CA    . GLU B 1 88  ? 72.927  112.548 47.737  1.00 30.29 ? 88   GLU B CA    1 
ATOM   5570  C  C     . GLU B 1 88  ? 73.250  111.496 48.795  1.00 30.06 ? 88   GLU B C     1 
ATOM   5571  O  O     . GLU B 1 88  ? 74.048  110.593 48.547  1.00 30.77 ? 88   GLU B O     1 
ATOM   5572  C  CB    . GLU B 1 88  ? 73.817  113.773 47.937  1.00 31.21 ? 88   GLU B CB    1 
ATOM   5573  N  N     . ASN B 1 89  ? 72.635  111.606 49.969  1.00 30.52 ? 89   ASN B N     1 
ATOM   5574  C  CA    . ASN B 1 89  ? 72.916  110.659 51.047  1.00 30.05 ? 89   ASN B CA    1 
ATOM   5575  C  C     . ASN B 1 89  ? 71.694  109.930 51.609  1.00 29.76 ? 89   ASN B C     1 
ATOM   5576  O  O     . ASN B 1 89  ? 71.598  109.715 52.815  1.00 29.97 ? 89   ASN B O     1 
ATOM   5577  C  CB    . ASN B 1 89  ? 73.645  111.377 52.188  1.00 30.84 ? 89   ASN B CB    1 
ATOM   5578  C  CG    . ASN B 1 89  ? 74.829  112.191 51.704  1.00 31.66 ? 89   ASN B CG    1 
ATOM   5579  O  OD1   . ASN B 1 89  ? 74.666  113.211 51.037  1.00 33.97 ? 89   ASN B OD1   1 
ATOM   5580  N  ND2   . ASN B 1 89  ? 76.026  111.742 52.034  1.00 33.14 ? 89   ASN B ND2   1 
ATOM   5581  N  N     . GLY B 1 90  ? 70.770  109.540 50.737  1.00 29.43 ? 90   GLY B N     1 
ATOM   5582  C  CA    . GLY B 1 90  ? 69.589  108.827 51.195  1.00 28.66 ? 90   GLY B CA    1 
ATOM   5583  C  C     . GLY B 1 90  ? 69.928  107.483 51.823  1.00 29.17 ? 90   GLY B C     1 
ATOM   5584  O  O     . GLY B 1 90  ? 69.307  107.071 52.808  1.00 26.19 ? 90   GLY B O     1 
ATOM   5585  N  N     . ASP B 1 91  ? 70.914  106.793 51.252  1.00 29.97 ? 91   ASP B N     1 
ATOM   5586  C  CA    . ASP B 1 91  ? 71.331  105.496 51.767  1.00 29.06 ? 91   ASP B CA    1 
ATOM   5587  C  C     . ASP B 1 91  ? 72.213  105.641 53.000  1.00 28.84 ? 91   ASP B C     1 
ATOM   5588  O  O     . ASP B 1 91  ? 72.421  104.674 53.738  1.00 29.70 ? 91   ASP B O     1 
ATOM   5589  C  CB    . ASP B 1 91  ? 72.083  104.702 50.695  1.00 31.73 ? 91   ASP B CB    1 
ATOM   5590  C  CG    . ASP B 1 91  ? 71.182  104.257 49.560  1.00 36.42 ? 91   ASP B CG    1 
ATOM   5591  O  OD1   . ASP B 1 91  ? 70.119  103.665 49.846  1.00 38.64 ? 91   ASP B OD1   1 
ATOM   5592  O  OD2   . ASP B 1 91  ? 71.538  104.489 48.384  1.00 39.52 ? 91   ASP B OD2   1 
ATOM   5593  N  N     . ARG B 1 92  ? 72.736  106.841 53.233  1.00 26.07 ? 92   ARG B N     1 
ATOM   5594  C  CA    . ARG B 1 92  ? 73.589  107.054 54.398  1.00 26.06 ? 92   ARG B CA    1 
ATOM   5595  C  C     . ARG B 1 92  ? 72.834  106.816 55.704  1.00 23.96 ? 92   ARG B C     1 
ATOM   5596  O  O     . ARG B 1 92  ? 71.641  107.092 55.803  1.00 23.55 ? 92   ARG B O     1 
ATOM   5597  C  CB    . ARG B 1 92  ? 74.160  108.474 54.409  1.00 27.54 ? 92   ARG B CB    1 
ATOM   5598  C  CG    . ARG B 1 92  ? 74.895  108.795 55.705  1.00 31.12 ? 92   ARG B CG    1 
ATOM   5599  C  CD    . ARG B 1 92  ? 75.470  110.196 55.736  1.00 34.19 ? 92   ARG B CD    1 
ATOM   5600  N  NE    . ARG B 1 92  ? 76.390  110.445 54.633  1.00 38.04 ? 92   ARG B NE    1 
ATOM   5601  C  CZ    . ARG B 1 92  ? 77.300  111.413 54.632  1.00 41.82 ? 92   ARG B CZ    1 
ATOM   5602  N  NH1   . ARG B 1 92  ? 77.415  112.220 55.684  1.00 43.19 ? 92   ARG B NH1   1 
ATOM   5603  N  NH2   . ARG B 1 92  ? 78.092  111.585 53.579  1.00 43.55 ? 92   ARG B NH2   1 
ATOM   5604  N  N     . THR B 1 93  ? 73.536  106.307 56.710  1.00 22.65 ? 93   THR B N     1 
ATOM   5605  C  CA    . THR B 1 93  ? 72.915  106.054 58.005  1.00 22.11 ? 93   THR B CA    1 
ATOM   5606  C  C     . THR B 1 93  ? 72.678  107.369 58.728  1.00 22.12 ? 93   THR B C     1 
ATOM   5607  O  O     . THR B 1 93  ? 73.611  108.144 58.960  1.00 21.51 ? 93   THR B O     1 
ATOM   5608  C  CB    . THR B 1 93  ? 73.800  105.172 58.907  1.00 21.96 ? 93   THR B CB    1 
ATOM   5609  O  OG1   . THR B 1 93  ? 73.979  103.889 58.297  1.00 24.51 ? 93   THR B OG1   1 
ATOM   5610  C  CG2   . THR B 1 93  ? 73.156  104.999 60.270  1.00 18.49 ? 93   THR B CG2   1 
ATOM   5611  N  N     . ALA B 1 94  ? 71.424  107.608 59.089  1.00 19.57 ? 94   ALA B N     1 
ATOM   5612  C  CA    . ALA B 1 94  ? 71.043  108.825 59.791  1.00 18.08 ? 94   ALA B CA    1 
ATOM   5613  C  C     . ALA B 1 94  ? 71.101  108.600 61.296  1.00 17.95 ? 94   ALA B C     1 
ATOM   5614  O  O     . ALA B 1 94  ? 71.632  109.423 62.038  1.00 17.08 ? 94   ALA B O     1 
ATOM   5615  C  CB    . ALA B 1 94  ? 69.635  109.243 59.379  1.00 19.12 ? 94   ALA B CB    1 
ATOM   5616  N  N     . ILE B 1 95  ? 70.529  107.489 61.746  1.00 16.31 ? 95   ILE B N     1 
ATOM   5617  C  CA    . ILE B 1 95  ? 70.535  107.173 63.163  1.00 17.18 ? 95   ILE B CA    1 
ATOM   5618  C  C     . ILE B 1 95  ? 70.954  105.739 63.444  1.00 16.60 ? 95   ILE B C     1 
ATOM   5619  O  O     . ILE B 1 95  ? 70.393  104.791 62.896  1.00 17.46 ? 95   ILE B O     1 
ATOM   5620  C  CB    . ILE B 1 95  ? 69.141  107.382 63.807  1.00 18.56 ? 95   ILE B CB    1 
ATOM   5621  C  CG1   . ILE B 1 95  ? 68.760  108.861 63.770  1.00 16.59 ? 95   ILE B CG1   1 
ATOM   5622  C  CG2   . ILE B 1 95  ? 69.148  106.853 65.246  1.00 16.75 ? 95   ILE B CG2   1 
ATOM   5623  C  CD1   . ILE B 1 95  ? 67.347  109.149 64.241  1.00 16.25 ? 95   ILE B CD1   1 
ATOM   5624  N  N     . ILE B 1 96  ? 71.956  105.585 64.295  1.00 16.45 ? 96   ILE B N     1 
ATOM   5625  C  CA    . ILE B 1 96  ? 72.397  104.262 64.694  1.00 16.45 ? 96   ILE B CA    1 
ATOM   5626  C  C     . ILE B 1 96  ? 71.798  104.084 66.083  1.00 15.44 ? 96   ILE B C     1 
ATOM   5627  O  O     . ILE B 1 96  ? 72.145  104.807 67.007  1.00 16.76 ? 96   ILE B O     1 
ATOM   5628  C  CB    . ILE B 1 96  ? 73.933  104.165 64.775  1.00 16.77 ? 96   ILE B CB    1 
ATOM   5629  C  CG1   . ILE B 1 96  ? 74.517  104.064 63.364  1.00 16.71 ? 96   ILE B CG1   1 
ATOM   5630  C  CG2   . ILE B 1 96  ? 74.340  102.958 65.625  1.00 17.05 ? 96   ILE B CG2   1 
ATOM   5631  C  CD1   . ILE B 1 96  ? 76.029  104.013 63.335  1.00 19.77 ? 96   ILE B CD1   1 
ATOM   5632  N  N     . TRP B 1 97  ? 70.867  103.150 66.218  1.00 16.85 ? 97   TRP B N     1 
ATOM   5633  C  CA    . TRP B 1 97  ? 70.244  102.917 67.510  1.00 18.04 ? 97   TRP B CA    1 
ATOM   5634  C  C     . TRP B 1 97  ? 70.896  101.721 68.191  1.00 18.02 ? 97   TRP B C     1 
ATOM   5635  O  O     . TRP B 1 97  ? 71.018  100.647 67.603  1.00 16.50 ? 97   TRP B O     1 
ATOM   5636  C  CB    . TRP B 1 97  ? 68.738  102.672 67.354  1.00 17.75 ? 97   TRP B CB    1 
ATOM   5637  C  CG    . TRP B 1 97  ? 68.046  102.477 68.668  1.00 20.76 ? 97   TRP B CG    1 
ATOM   5638  C  CD1   . TRP B 1 97  ? 67.869  103.414 69.649  1.00 22.27 ? 97   TRP B CD1   1 
ATOM   5639  C  CD2   . TRP B 1 97  ? 67.494  101.258 69.175  1.00 20.85 ? 97   TRP B CD2   1 
ATOM   5640  N  NE1   . TRP B 1 97  ? 67.242  102.853 70.737  1.00 20.34 ? 97   TRP B NE1   1 
ATOM   5641  C  CE2   . TRP B 1 97  ? 67.001  101.530 70.475  1.00 22.67 ? 97   TRP B CE2   1 
ATOM   5642  C  CE3   . TRP B 1 97  ? 67.370  99.960  68.663  1.00 21.99 ? 97   TRP B CE3   1 
ATOM   5643  C  CZ2   . TRP B 1 97  ? 66.391  100.546 71.272  1.00 21.96 ? 97   TRP B CZ2   1 
ATOM   5644  C  CZ3   . TRP B 1 97  ? 66.762  98.981  69.457  1.00 22.85 ? 97   TRP B CZ3   1 
ATOM   5645  C  CH2   . TRP B 1 97  ? 66.282  99.284  70.748  1.00 21.61 ? 97   TRP B CH2   1 
ATOM   5646  N  N     . GLU B 1 98  ? 71.333  101.922 69.430  1.00 18.41 ? 98   GLU B N     1 
ATOM   5647  C  CA    . GLU B 1 98  ? 71.969  100.869 70.211  1.00 18.18 ? 98   GLU B CA    1 
ATOM   5648  C  C     . GLU B 1 98  ? 71.072  100.616 71.410  1.00 17.52 ? 98   GLU B C     1 
ATOM   5649  O  O     . GLU B 1 98  ? 70.938  101.473 72.284  1.00 16.93 ? 98   GLU B O     1 
ATOM   5650  C  CB    . GLU B 1 98  ? 73.356  101.321 70.673  1.00 17.51 ? 98   GLU B CB    1 
ATOM   5651  C  CG    . GLU B 1 98  ? 74.048  100.389 71.672  1.00 18.23 ? 98   GLU B CG    1 
ATOM   5652  C  CD    . GLU B 1 98  ? 74.505  99.058  71.077  1.00 17.01 ? 98   GLU B CD    1 
ATOM   5653  O  OE1   . GLU B 1 98  ? 74.490  98.905  69.833  1.00 16.58 ? 98   GLU B OE1   1 
ATOM   5654  O  OE2   . GLU B 1 98  ? 74.897  98.170  71.869  1.00 16.96 ? 98   GLU B OE2   1 
ATOM   5655  N  N     . GLY B 1 99  ? 70.450  99.441  71.445  1.00 17.02 ? 99   GLY B N     1 
ATOM   5656  C  CA    . GLY B 1 99  ? 69.556  99.121  72.543  1.00 16.17 ? 99   GLY B CA    1 
ATOM   5657  C  C     . GLY B 1 99  ? 70.258  98.901  73.870  1.00 15.98 ? 99   GLY B C     1 
ATOM   5658  O  O     . GLY B 1 99  ? 71.471  98.678  73.920  1.00 14.27 ? 99   GLY B O     1 
ATOM   5659  N  N     . ASP B 1 100 ? 69.483  98.980  74.946  1.00 16.82 ? 100  ASP B N     1 
ATOM   5660  C  CA    . ASP B 1 100 ? 69.996  98.761  76.290  1.00 18.96 ? 100  ASP B CA    1 
ATOM   5661  C  C     . ASP B 1 100 ? 70.744  97.426  76.305  1.00 20.67 ? 100  ASP B C     1 
ATOM   5662  O  O     . ASP B 1 100 ? 71.703  97.242  77.060  1.00 20.42 ? 100  ASP B O     1 
ATOM   5663  C  CB    . ASP B 1 100 ? 68.837  98.740  77.294  1.00 20.36 ? 100  ASP B CB    1 
ATOM   5664  C  CG    . ASP B 1 100 ? 69.308  98.633  78.737  1.00 21.61 ? 100  ASP B CG    1 
ATOM   5665  O  OD1   . ASP B 1 100 ? 70.095  99.495  79.180  1.00 20.55 ? 100  ASP B OD1   1 
ATOM   5666  O  OD2   . ASP B 1 100 ? 68.886  97.684  79.430  1.00 21.38 ? 100  ASP B OD2   1 
ATOM   5667  N  N     . ASP B 1 101 ? 70.297  96.503  75.457  1.00 22.33 ? 101  ASP B N     1 
ATOM   5668  C  CA    . ASP B 1 101 ? 70.923  95.193  75.331  1.00 25.27 ? 101  ASP B CA    1 
ATOM   5669  C  C     . ASP B 1 101 ? 71.644  95.200  73.991  1.00 27.04 ? 101  ASP B C     1 
ATOM   5670  O  O     . ASP B 1 101 ? 71.020  95.395  72.941  1.00 26.54 ? 101  ASP B O     1 
ATOM   5671  C  CB    . ASP B 1 101 ? 69.874  94.082  75.352  1.00 28.18 ? 101  ASP B CB    1 
ATOM   5672  C  CG    . ASP B 1 101 ? 70.495  92.698  75.417  1.00 32.54 ? 101  ASP B CG    1 
ATOM   5673  O  OD1   . ASP B 1 101 ? 71.212  92.314  74.462  1.00 31.56 ? 101  ASP B OD1   1 
ATOM   5674  O  OD2   . ASP B 1 101 ? 70.268  91.997  76.431  1.00 36.23 ? 101  ASP B OD2   1 
ATOM   5675  N  N     . THR B 1 102 ? 72.953  94.975  74.027  1.00 28.10 ? 102  THR B N     1 
ATOM   5676  C  CA    . THR B 1 102 ? 73.770  95.007  72.819  1.00 30.93 ? 102  THR B CA    1 
ATOM   5677  C  C     . THR B 1 102 ? 73.274  94.162  71.632  1.00 31.50 ? 102  THR B C     1 
ATOM   5678  O  O     . THR B 1 102 ? 73.546  94.492  70.473  1.00 31.48 ? 102  THR B O     1 
ATOM   5679  C  CB    . THR B 1 102 ? 75.228  94.638  73.150  1.00 31.63 ? 102  THR B CB    1 
ATOM   5680  O  OG1   . THR B 1 102 ? 76.055  94.904  72.010  1.00 34.81 ? 102  THR B OG1   1 
ATOM   5681  C  CG2   . THR B 1 102 ? 75.331  93.173  73.550  1.00 32.58 ? 102  THR B CG2   1 
ATOM   5682  N  N     . SER B 1 103 ? 72.544  93.086  71.908  1.00 30.99 ? 103  SER B N     1 
ATOM   5683  C  CA    . SER B 1 103 ? 72.029  92.243  70.830  1.00 30.95 ? 103  SER B CA    1 
ATOM   5684  C  C     . SER B 1 103 ? 70.974  92.992  70.015  1.00 30.68 ? 103  SER B C     1 
ATOM   5685  O  O     . SER B 1 103 ? 70.678  92.619  68.880  1.00 30.15 ? 103  SER B O     1 
ATOM   5686  C  CB    . SER B 1 103 ? 71.412  90.963  71.397  1.00 31.45 ? 103  SER B CB    1 
ATOM   5687  O  OG    . SER B 1 103 ? 70.314  91.264  72.243  1.00 33.89 ? 103  SER B OG    1 
ATOM   5688  N  N     . GLN B 1 104 ? 70.408  94.045  70.601  1.00 28.69 ? 104  GLN B N     1 
ATOM   5689  C  CA    . GLN B 1 104 ? 69.389  94.837  69.928  1.00 28.41 ? 104  GLN B CA    1 
ATOM   5690  C  C     . GLN B 1 104 ? 69.975  96.151  69.427  1.00 28.34 ? 104  GLN B C     1 
ATOM   5691  O  O     . GLN B 1 104 ? 70.437  96.977  70.215  1.00 29.97 ? 104  GLN B O     1 
ATOM   5692  C  CB    . GLN B 1 104 ? 68.224  95.141  70.875  1.00 29.28 ? 104  GLN B CB    1 
ATOM   5693  C  CG    . GLN B 1 104 ? 67.603  93.930  71.533  1.00 29.89 ? 104  GLN B CG    1 
ATOM   5694  C  CD    . GLN B 1 104 ? 67.256  92.847  70.536  1.00 31.73 ? 104  GLN B CD    1 
ATOM   5695  O  OE1   . GLN B 1 104 ? 66.524  93.085  69.573  1.00 31.22 ? 104  GLN B OE1   1 
ATOM   5696  N  NE2   . GLN B 1 104 ? 67.785  91.644  70.759  1.00 31.88 ? 104  GLN B NE2   1 
ATOM   5697  N  N     . SER B 1 105 ? 69.957  96.340  68.113  1.00 27.24 ? 105  SER B N     1 
ATOM   5698  C  CA    . SER B 1 105 ? 70.479  97.562  67.515  1.00 25.66 ? 105  SER B CA    1 
ATOM   5699  C  C     . SER B 1 105 ? 69.739  97.790  66.212  1.00 25.07 ? 105  SER B C     1 
ATOM   5700  O  O     . SER B 1 105 ? 68.932  96.968  65.788  1.00 25.40 ? 105  SER B O     1 
ATOM   5701  C  CB    . SER B 1 105 ? 71.981  97.451  67.236  1.00 25.55 ? 105  SER B CB    1 
ATOM   5702  O  OG    . SER B 1 105 ? 72.222  96.746  66.031  1.00 25.81 ? 105  SER B OG    1 
ATOM   5703  N  N     . LYS B 1 106 ? 70.037  98.903  65.562  1.00 24.92 ? 106  LYS B N     1 
ATOM   5704  C  CA    . LYS B 1 106 ? 69.353  99.226  64.328  1.00 24.45 ? 106  LYS B CA    1 
ATOM   5705  C  C     . LYS B 1 106 ? 70.036  100.387 63.618  1.00 24.29 ? 106  LYS B C     1 
ATOM   5706  O  O     . LYS B 1 106 ? 70.536  101.314 64.262  1.00 24.82 ? 106  LYS B O     1 
ATOM   5707  C  CB    . LYS B 1 106 ? 67.900  99.569  64.667  1.00 25.53 ? 106  LYS B CB    1 
ATOM   5708  C  CG    . LYS B 1 106 ? 67.041  99.999  63.511  1.00 28.19 ? 106  LYS B CG    1 
ATOM   5709  C  CD    . LYS B 1 106 ? 65.612  99.504  63.691  1.00 30.23 ? 106  LYS B CD    1 
ATOM   5710  C  CE    . LYS B 1 106 ? 64.986  99.964  65.001  1.00 30.63 ? 106  LYS B CE    1 
ATOM   5711  N  NZ    . LYS B 1 106 ? 63.559  99.518  65.089  1.00 29.31 ? 106  LYS B NZ    1 
ATOM   5712  N  N     . HIS B 1 107 ? 70.076  100.321 62.291  1.00 22.86 ? 107  HIS B N     1 
ATOM   5713  C  CA    . HIS B 1 107 ? 70.673  101.378 61.485  1.00 21.82 ? 107  HIS B CA    1 
ATOM   5714  C  C     . HIS B 1 107 ? 69.564  101.977 60.630  1.00 20.98 ? 107  HIS B C     1 
ATOM   5715  O  O     . HIS B 1 107 ? 69.009  101.305 59.763  1.00 20.97 ? 107  HIS B O     1 
ATOM   5716  C  CB    . HIS B 1 107 ? 71.781  100.827 60.587  1.00 21.83 ? 107  HIS B CB    1 
ATOM   5717  C  CG    . HIS B 1 107 ? 73.048  100.491 61.314  1.00 24.07 ? 107  HIS B CG    1 
ATOM   5718  N  ND1   . HIS B 1 107 ? 73.119  99.500  62.270  1.00 23.45 ? 107  HIS B ND1   1 
ATOM   5719  C  CD2   . HIS B 1 107 ? 74.297  101.005 61.214  1.00 24.51 ? 107  HIS B CD2   1 
ATOM   5720  C  CE1   . HIS B 1 107 ? 74.356  99.417  62.726  1.00 24.18 ? 107  HIS B CE1   1 
ATOM   5721  N  NE2   . HIS B 1 107 ? 75.091  100.319 62.100  1.00 24.55 ? 107  HIS B NE2   1 
ATOM   5722  N  N     . ILE B 1 108 ? 69.234  103.237 60.892  1.00 19.95 ? 108  ILE B N     1 
ATOM   5723  C  CA    . ILE B 1 108 ? 68.175  103.925 60.162  1.00 18.43 ? 108  ILE B CA    1 
ATOM   5724  C  C     . ILE B 1 108 ? 68.763  104.921 59.173  1.00 17.99 ? 108  ILE B C     1 
ATOM   5725  O  O     . ILE B 1 108 ? 69.441  105.865 59.564  1.00 18.23 ? 108  ILE B O     1 
ATOM   5726  C  CB    . ILE B 1 108 ? 67.247  104.667 61.135  1.00 18.43 ? 108  ILE B CB    1 
ATOM   5727  C  CG1   . ILE B 1 108 ? 66.698  103.683 62.175  1.00 18.88 ? 108  ILE B CG1   1 
ATOM   5728  C  CG2   . ILE B 1 108 ? 66.118  105.341 60.361  1.00 16.09 ? 108  ILE B CG2   1 
ATOM   5729  C  CD1   . ILE B 1 108 ? 65.953  104.342 63.324  1.00 17.28 ? 108  ILE B CD1   1 
ATOM   5730  N  N     . SER B 1 109 ? 68.506  104.705 57.889  1.00 18.04 ? 109  SER B N     1 
ATOM   5731  C  CA    . SER B 1 109 ? 69.029  105.584 56.847  1.00 19.12 ? 109  SER B CA    1 
ATOM   5732  C  C     . SER B 1 109 ? 68.192  106.848 56.756  1.00 18.60 ? 109  SER B C     1 
ATOM   5733  O  O     . SER B 1 109 ? 67.059  106.888 57.240  1.00 19.24 ? 109  SER B O     1 
ATOM   5734  C  CB    . SER B 1 109 ? 68.989  104.882 55.497  1.00 18.93 ? 109  SER B CB    1 
ATOM   5735  O  OG    . SER B 1 109 ? 67.661  104.877 55.003  1.00 19.55 ? 109  SER B OG    1 
ATOM   5736  N  N     . TYR B 1 110 ? 68.746  107.878 56.124  1.00 18.43 ? 110  TYR B N     1 
ATOM   5737  C  CA    . TYR B 1 110 ? 68.025  109.133 55.966  1.00 18.36 ? 110  TYR B CA    1 
ATOM   5738  C  C     . TYR B 1 110 ? 66.719  108.917 55.209  1.00 18.69 ? 110  TYR B C     1 
ATOM   5739  O  O     . TYR B 1 110 ? 65.695  109.519 55.529  1.00 17.46 ? 110  TYR B O     1 
ATOM   5740  C  CB    . TYR B 1 110 ? 68.896  110.169 55.243  1.00 16.78 ? 110  TYR B CB    1 
ATOM   5741  C  CG    . TYR B 1 110 ? 69.733  111.004 56.194  1.00 17.18 ? 110  TYR B CG    1 
ATOM   5742  C  CD1   . TYR B 1 110 ? 71.000  110.585 56.606  1.00 16.01 ? 110  TYR B CD1   1 
ATOM   5743  C  CD2   . TYR B 1 110 ? 69.232  112.195 56.721  1.00 15.93 ? 110  TYR B CD2   1 
ATOM   5744  C  CE1   . TYR B 1 110 ? 71.744  111.335 57.516  1.00 14.30 ? 110  TYR B CE1   1 
ATOM   5745  C  CE2   . TYR B 1 110 ? 69.961  112.946 57.628  1.00 14.09 ? 110  TYR B CE2   1 
ATOM   5746  C  CZ    . TYR B 1 110 ? 71.215  112.514 58.022  1.00 14.97 ? 110  TYR B CZ    1 
ATOM   5747  O  OH    . TYR B 1 110 ? 71.931  113.261 58.927  1.00 12.67 ? 110  TYR B OH    1 
ATOM   5748  N  N     . ARG B 1 111 ? 66.758  108.046 54.209  1.00 19.20 ? 111  ARG B N     1 
ATOM   5749  C  CA    . ARG B 1 111 ? 65.573  107.756 53.422  1.00 21.01 ? 111  ARG B CA    1 
ATOM   5750  C  C     . ARG B 1 111 ? 64.522  107.075 54.306  1.00 20.25 ? 111  ARG B C     1 
ATOM   5751  O  O     . ARG B 1 111 ? 63.339  107.414 54.254  1.00 20.52 ? 111  ARG B O     1 
ATOM   5752  C  CB    . ARG B 1 111 ? 65.945  106.866 52.228  1.00 23.48 ? 111  ARG B CB    1 
ATOM   5753  C  CG    . ARG B 1 111 ? 64.874  106.772 51.162  1.00 27.87 ? 111  ARG B CG    1 
ATOM   5754  C  CD    . ARG B 1 111 ? 65.343  105.972 49.943  1.00 34.69 ? 111  ARG B CD    1 
ATOM   5755  N  NE    . ARG B 1 111 ? 66.419  106.632 49.195  1.00 38.10 ? 111  ARG B NE    1 
ATOM   5756  C  CZ    . ARG B 1 111 ? 67.708  106.314 49.287  1.00 40.42 ? 111  ARG B CZ    1 
ATOM   5757  N  NH1   . ARG B 1 111 ? 68.095  105.337 50.101  1.00 41.02 ? 111  ARG B NH1   1 
ATOM   5758  N  NH2   . ARG B 1 111 ? 68.609  106.968 48.562  1.00 40.99 ? 111  ARG B NH2   1 
ATOM   5759  N  N     . GLU B 1 112 ? 64.961  106.125 55.125  1.00 19.06 ? 112  GLU B N     1 
ATOM   5760  C  CA    . GLU B 1 112 ? 64.047  105.417 56.010  1.00 20.51 ? 112  GLU B CA    1 
ATOM   5761  C  C     . GLU B 1 112 ? 63.428  106.379 57.033  1.00 17.65 ? 112  GLU B C     1 
ATOM   5762  O  O     . GLU B 1 112 ? 62.214  106.406 57.218  1.00 16.95 ? 112  GLU B O     1 
ATOM   5763  C  CB    . GLU B 1 112 ? 64.782  104.286 56.744  1.00 24.17 ? 112  GLU B CB    1 
ATOM   5764  C  CG    . GLU B 1 112 ? 65.449  103.262 55.827  1.00 31.46 ? 112  GLU B CG    1 
ATOM   5765  C  CD    . GLU B 1 112 ? 66.260  102.209 56.595  1.00 35.22 ? 112  GLU B CD    1 
ATOM   5766  O  OE1   . GLU B 1 112 ? 67.167  102.591 57.375  1.00 35.28 ? 112  GLU B OE1   1 
ATOM   5767  O  OE2   . GLU B 1 112 ? 65.995  100.998 56.412  1.00 36.66 ? 112  GLU B OE2   1 
ATOM   5768  N  N     . LEU B 1 113 ? 64.272  107.165 57.691  1.00 15.41 ? 113  LEU B N     1 
ATOM   5769  C  CA    . LEU B 1 113 ? 63.812  108.119 58.695  1.00 14.76 ? 113  LEU B CA    1 
ATOM   5770  C  C     . LEU B 1 113 ? 62.841  109.116 58.066  1.00 14.56 ? 113  LEU B C     1 
ATOM   5771  O  O     . LEU B 1 113 ? 61.802  109.446 58.644  1.00 15.58 ? 113  LEU B O     1 
ATOM   5772  C  CB    . LEU B 1 113 ? 65.012  108.850 59.306  1.00 12.95 ? 113  LEU B CB    1 
ATOM   5773  C  CG    . LEU B 1 113 ? 64.752  109.793 60.480  1.00 12.95 ? 113  LEU B CG    1 
ATOM   5774  C  CD1   . LEU B 1 113 ? 64.060  109.034 61.615  1.00 12.87 ? 113  LEU B CD1   1 
ATOM   5775  C  CD2   . LEU B 1 113 ? 66.072  110.389 60.945  1.00 9.60  ? 113  LEU B CD2   1 
ATOM   5776  N  N     . HIS B 1 114 ? 63.179  109.581 56.869  1.00 14.21 ? 114  HIS B N     1 
ATOM   5777  C  CA    . HIS B 1 114 ? 62.334  110.522 56.153  1.00 14.77 ? 114  HIS B CA    1 
ATOM   5778  C  C     . HIS B 1 114 ? 60.956  109.904 55.896  1.00 16.01 ? 114  HIS B C     1 
ATOM   5779  O  O     . HIS B 1 114 ? 59.921  110.557 56.075  1.00 14.96 ? 114  HIS B O     1 
ATOM   5780  C  CB    . HIS B 1 114 ? 63.011  110.907 54.838  1.00 15.10 ? 114  HIS B CB    1 
ATOM   5781  C  CG    . HIS B 1 114 ? 62.141  111.701 53.914  1.00 17.68 ? 114  HIS B CG    1 
ATOM   5782  N  ND1   . HIS B 1 114 ? 61.305  111.112 52.990  1.00 18.35 ? 114  HIS B ND1   1 
ATOM   5783  C  CD2   . HIS B 1 114 ? 61.974  113.039 53.775  1.00 17.82 ? 114  HIS B CD2   1 
ATOM   5784  C  CE1   . HIS B 1 114 ? 60.665  112.053 52.319  1.00 16.80 ? 114  HIS B CE1   1 
ATOM   5785  N  NE2   . HIS B 1 114 ? 61.052  113.230 52.776  1.00 17.70 ? 114  HIS B NE2   1 
ATOM   5786  N  N     . ARG B 1 115 ? 60.937  108.636 55.497  1.00 16.29 ? 115  ARG B N     1 
ATOM   5787  C  CA    . ARG B 1 115 ? 59.667  107.977 55.223  1.00 17.71 ? 115  ARG B CA    1 
ATOM   5788  C  C     . ARG B 1 115 ? 58.792  107.888 56.468  1.00 17.86 ? 115  ARG B C     1 
ATOM   5789  O  O     . ARG B 1 115 ? 57.613  108.242 56.417  1.00 18.28 ? 115  ARG B O     1 
ATOM   5790  C  CB    . ARG B 1 115 ? 59.896  106.582 54.637  1.00 19.14 ? 115  ARG B CB    1 
ATOM   5791  C  CG    . ARG B 1 115 ? 58.610  105.861 54.286  1.00 25.42 ? 115  ARG B CG    1 
ATOM   5792  C  CD    . ARG B 1 115 ? 58.838  104.728 53.283  1.00 29.20 ? 115  ARG B CD    1 
ATOM   5793  N  NE    . ARG B 1 115 ? 57.586  104.059 52.937  1.00 34.11 ? 115  ARG B NE    1 
ATOM   5794  C  CZ    . ARG B 1 115 ? 56.894  103.279 53.768  1.00 37.07 ? 115  ARG B CZ    1 
ATOM   5795  N  NH1   . ARG B 1 115 ? 57.334  103.060 55.005  1.00 36.91 ? 115  ARG B NH1   1 
ATOM   5796  N  NH2   . ARG B 1 115 ? 55.755  102.724 53.366  1.00 37.84 ? 115  ARG B NH2   1 
ATOM   5797  N  N     . ASP B 1 116 ? 59.359  107.416 57.579  1.00 16.42 ? 116  ASP B N     1 
ATOM   5798  C  CA    . ASP B 1 116 ? 58.601  107.303 58.825  1.00 16.99 ? 116  ASP B CA    1 
ATOM   5799  C  C     . ASP B 1 116 ? 58.158  108.668 59.313  1.00 16.23 ? 116  ASP B C     1 
ATOM   5800  O  O     . ASP B 1 116 ? 57.059  108.811 59.845  1.00 16.64 ? 116  ASP B O     1 
ATOM   5801  C  CB    . ASP B 1 116 ? 59.421  106.631 59.937  1.00 20.05 ? 116  ASP B CB    1 
ATOM   5802  C  CG    . ASP B 1 116 ? 59.437  105.114 59.829  1.00 22.49 ? 116  ASP B CG    1 
ATOM   5803  O  OD1   . ASP B 1 116 ? 58.448  104.536 59.327  1.00 24.59 ? 116  ASP B OD1   1 
ATOM   5804  O  OD2   . ASP B 1 116 ? 60.436  104.495 60.263  1.00 25.31 ? 116  ASP B OD2   1 
ATOM   5805  N  N     . VAL B 1 117 ? 59.021  109.668 59.154  1.00 14.62 ? 117  VAL B N     1 
ATOM   5806  C  CA    . VAL B 1 117 ? 58.673  111.013 59.581  1.00 14.01 ? 117  VAL B CA    1 
ATOM   5807  C  C     . VAL B 1 117 ? 57.494  111.508 58.751  1.00 14.72 ? 117  VAL B C     1 
ATOM   5808  O  O     . VAL B 1 117 ? 56.603  112.173 59.269  1.00 15.97 ? 117  VAL B O     1 
ATOM   5809  C  CB    . VAL B 1 117 ? 59.871  111.971 59.431  1.00 13.52 ? 117  VAL B CB    1 
ATOM   5810  C  CG1   . VAL B 1 117 ? 59.419  113.428 59.571  1.00 11.53 ? 117  VAL B CG1   1 
ATOM   5811  C  CG2   . VAL B 1 117 ? 60.901  111.652 60.508  1.00 12.50 ? 117  VAL B CG2   1 
ATOM   5812  N  N     . CYS B 1 118 ? 57.488  111.170 57.465  1.00 15.44 ? 118  CYS B N     1 
ATOM   5813  C  CA    . CYS B 1 118 ? 56.400  111.574 56.585  1.00 16.67 ? 118  CYS B CA    1 
ATOM   5814  C  C     . CYS B 1 118 ? 55.107  110.856 56.979  1.00 17.11 ? 118  CYS B C     1 
ATOM   5815  O  O     . CYS B 1 118 ? 54.034  111.465 57.006  1.00 15.42 ? 118  CYS B O     1 
ATOM   5816  C  CB    . CYS B 1 118 ? 56.750  111.276 55.119  1.00 16.92 ? 118  CYS B CB    1 
ATOM   5817  S  SG    . CYS B 1 118 ? 57.964  112.418 54.378  1.00 17.97 ? 118  CYS B SG    1 
ATOM   5818  N  N     . ARG B 1 119 ? 55.212  109.567 57.297  1.00 18.42 ? 119  ARG B N     1 
ATOM   5819  C  CA    . ARG B 1 119 ? 54.040  108.792 57.691  1.00 19.95 ? 119  ARG B CA    1 
ATOM   5820  C  C     . ARG B 1 119 ? 53.490  109.261 59.032  1.00 20.56 ? 119  ARG B C     1 
ATOM   5821  O  O     . ARG B 1 119 ? 52.274  109.364 59.203  1.00 21.25 ? 119  ARG B O     1 
ATOM   5822  C  CB    . ARG B 1 119 ? 54.358  107.291 57.766  1.00 22.34 ? 119  ARG B CB    1 
ATOM   5823  C  CG    . ARG B 1 119 ? 54.570  106.626 56.416  1.00 27.77 ? 119  ARG B CG    1 
ATOM   5824  C  CD    . ARG B 1 119 ? 54.453  105.110 56.514  1.00 31.16 ? 119  ARG B CD    1 
ATOM   5825  N  NE    . ARG B 1 119 ? 55.413  104.537 57.450  1.00 36.22 ? 119  ARG B NE    1 
ATOM   5826  C  CZ    . ARG B 1 119 ? 55.365  103.283 57.900  1.00 39.90 ? 119  ARG B CZ    1 
ATOM   5827  N  NH1   . ARG B 1 119 ? 54.397  102.465 57.497  1.00 40.47 ? 119  ARG B NH1   1 
ATOM   5828  N  NH2   . ARG B 1 119 ? 56.283  102.843 58.758  1.00 39.44 ? 119  ARG B NH2   1 
ATOM   5829  N  N     . PHE B 1 120 ? 54.367  109.557 59.989  1.00 20.13 ? 120  PHE B N     1 
ATOM   5830  C  CA    . PHE B 1 120 ? 53.872  110.012 61.287  1.00 20.60 ? 120  PHE B CA    1 
ATOM   5831  C  C     . PHE B 1 120 ? 53.325  111.433 61.162  1.00 18.90 ? 120  PHE B C     1 
ATOM   5832  O  O     . PHE B 1 120 ? 52.403  111.821 61.878  1.00 19.16 ? 120  PHE B O     1 
ATOM   5833  C  CB    . PHE B 1 120 ? 54.964  109.962 62.365  1.00 18.84 ? 120  PHE B CB    1 
ATOM   5834  C  CG    . PHE B 1 120 ? 54.420  110.042 63.767  1.00 20.02 ? 120  PHE B CG    1 
ATOM   5835  C  CD1   . PHE B 1 120 ? 53.631  109.012 64.275  1.00 21.14 ? 120  PHE B CD1   1 
ATOM   5836  C  CD2   . PHE B 1 120 ? 54.655  111.156 64.563  1.00 20.84 ? 120  PHE B CD2   1 
ATOM   5837  C  CE1   . PHE B 1 120 ? 53.082  109.094 65.557  1.00 21.60 ? 120  PHE B CE1   1 
ATOM   5838  C  CE2   . PHE B 1 120 ? 54.109  111.248 65.846  1.00 20.84 ? 120  PHE B CE2   1 
ATOM   5839  C  CZ    . PHE B 1 120 ? 53.320  110.214 66.341  1.00 20.68 ? 120  PHE B CZ    1 
ATOM   5840  N  N     . ALA B 1 121 ? 53.902  112.202 60.243  1.00 18.05 ? 121  ALA B N     1 
ATOM   5841  C  CA    . ALA B 1 121 ? 53.460  113.567 60.007  1.00 17.37 ? 121  ALA B CA    1 
ATOM   5842  C  C     . ALA B 1 121 ? 51.988  113.531 59.604  1.00 16.51 ? 121  ALA B C     1 
ATOM   5843  O  O     . ALA B 1 121 ? 51.169  114.281 60.138  1.00 15.75 ? 121  ALA B O     1 
ATOM   5844  C  CB    . ALA B 1 121 ? 54.292  114.206 58.910  1.00 15.51 ? 121  ALA B CB    1 
ATOM   5845  N  N     . ASN B 1 122 ? 51.658  112.644 58.666  1.00 16.11 ? 122  ASN B N     1 
ATOM   5846  C  CA    . ASN B 1 122 ? 50.277  112.500 58.208  1.00 15.83 ? 122  ASN B CA    1 
ATOM   5847  C  C     . ASN B 1 122 ? 49.394  111.945 59.322  1.00 16.32 ? 122  ASN B C     1 
ATOM   5848  O  O     . ASN B 1 122 ? 48.207  112.267 59.400  1.00 16.66 ? 122  ASN B O     1 
ATOM   5849  C  CB    . ASN B 1 122 ? 50.196  111.588 56.978  1.00 13.92 ? 122  ASN B CB    1 
ATOM   5850  C  CG    . ASN B 1 122 ? 50.648  112.285 55.710  1.00 17.41 ? 122  ASN B CG    1 
ATOM   5851  O  OD1   . ASN B 1 122 ? 50.253  113.428 55.444  1.00 20.85 ? 122  ASN B OD1   1 
ATOM   5852  N  ND2   . ASN B 1 122 ? 51.468  111.602 54.909  1.00 18.26 ? 122  ASN B ND2   1 
ATOM   5853  N  N     . THR B 1 123 ? 49.978  111.108 60.179  1.00 15.99 ? 123  THR B N     1 
ATOM   5854  C  CA    . THR B 1 123 ? 49.247  110.528 61.296  1.00 15.09 ? 123  THR B CA    1 
ATOM   5855  C  C     . THR B 1 123 ? 48.775  111.654 62.216  1.00 17.15 ? 123  THR B C     1 
ATOM   5856  O  O     . THR B 1 123 ? 47.629  111.652 62.687  1.00 18.57 ? 123  THR B O     1 
ATOM   5857  C  CB    . THR B 1 123 ? 50.137  109.558 62.104  1.00 13.76 ? 123  THR B CB    1 
ATOM   5858  O  OG1   . THR B 1 123 ? 50.488  108.434 61.286  1.00 16.01 ? 123  THR B OG1   1 
ATOM   5859  C  CG2   . THR B 1 123 ? 49.405  109.057 63.333  1.00 13.91 ? 123  THR B CG2   1 
ATOM   5860  N  N     . LEU B 1 124 ? 49.657  112.622 62.463  1.00 17.72 ? 124  LEU B N     1 
ATOM   5861  C  CA    . LEU B 1 124 ? 49.330  113.755 63.326  1.00 18.26 ? 124  LEU B CA    1 
ATOM   5862  C  C     . LEU B 1 124 ? 48.254  114.611 62.688  1.00 17.92 ? 124  LEU B C     1 
ATOM   5863  O  O     . LEU B 1 124 ? 47.275  114.987 63.334  1.00 15.88 ? 124  LEU B O     1 
ATOM   5864  C  CB    . LEU B 1 124 ? 50.571  114.620 63.587  1.00 17.95 ? 124  LEU B CB    1 
ATOM   5865  C  CG    . LEU B 1 124 ? 51.672  113.984 64.442  1.00 19.92 ? 124  LEU B CG    1 
ATOM   5866  C  CD1   . LEU B 1 124 ? 52.887  114.913 64.516  1.00 20.34 ? 124  LEU B CD1   1 
ATOM   5867  C  CD2   . LEU B 1 124 ? 51.124  113.702 65.827  1.00 19.21 ? 124  LEU B CD2   1 
ATOM   5868  N  N     . LEU B 1 125 ? 48.451  114.918 61.412  1.00 19.36 ? 125  LEU B N     1 
ATOM   5869  C  CA    . LEU B 1 125 ? 47.512  115.734 60.664  1.00 21.07 ? 125  LEU B CA    1 
ATOM   5870  C  C     . LEU B 1 125 ? 46.142  115.070 60.632  1.00 22.83 ? 125  LEU B C     1 
ATOM   5871  O  O     . LEU B 1 125 ? 45.111  115.749 60.658  1.00 22.67 ? 125  LEU B O     1 
ATOM   5872  C  CB    . LEU B 1 125 ? 48.031  115.957 59.241  1.00 20.61 ? 125  LEU B CB    1 
ATOM   5873  C  CG    . LEU B 1 125 ? 49.226  116.912 59.127  1.00 20.31 ? 125  LEU B CG    1 
ATOM   5874  C  CD1   . LEU B 1 125 ? 49.875  116.813 57.754  1.00 19.96 ? 125  LEU B CD1   1 
ATOM   5875  C  CD2   . LEU B 1 125 ? 48.756  118.322 59.388  1.00 19.87 ? 125  LEU B CD2   1 
ATOM   5876  N  N     . ASP B 1 126 ? 46.129  113.741 60.591  1.00 23.16 ? 126  ASP B N     1 
ATOM   5877  C  CA    . ASP B 1 126 ? 44.867  113.022 60.555  1.00 24.27 ? 126  ASP B CA    1 
ATOM   5878  C  C     . ASP B 1 126 ? 44.161  112.961 61.907  1.00 24.83 ? 126  ASP B C     1 
ATOM   5879  O  O     . ASP B 1 126 ? 42.941  112.793 61.959  1.00 24.85 ? 126  ASP B O     1 
ATOM   5880  C  CB    . ASP B 1 126 ? 45.071  111.618 59.989  1.00 25.79 ? 126  ASP B CB    1 
ATOM   5881  C  CG    . ASP B 1 126 ? 45.348  111.634 58.494  1.00 27.43 ? 126  ASP B CG    1 
ATOM   5882  O  OD1   . ASP B 1 126 ? 45.168  112.707 57.870  1.00 27.98 ? 126  ASP B OD1   1 
ATOM   5883  O  OD2   . ASP B 1 126 ? 45.737  110.580 57.941  1.00 29.58 ? 126  ASP B OD2   1 
ATOM   5884  N  N     . LEU B 1 127 ? 44.919  113.094 62.996  1.00 22.69 ? 127  LEU B N     1 
ATOM   5885  C  CA    . LEU B 1 127 ? 44.322  113.084 64.327  1.00 21.68 ? 127  LEU B CA    1 
ATOM   5886  C  C     . LEU B 1 127 ? 43.742  114.455 64.652  1.00 21.45 ? 127  LEU B C     1 
ATOM   5887  O  O     . LEU B 1 127 ? 43.011  114.615 65.634  1.00 21.48 ? 127  LEU B O     1 
ATOM   5888  C  CB    . LEU B 1 127 ? 45.356  112.714 65.387  1.00 22.05 ? 127  LEU B CB    1 
ATOM   5889  C  CG    . LEU B 1 127 ? 45.758  111.243 65.445  1.00 24.17 ? 127  LEU B CG    1 
ATOM   5890  C  CD1   . LEU B 1 127 ? 46.853  111.042 66.491  1.00 25.41 ? 127  LEU B CD1   1 
ATOM   5891  C  CD2   . LEU B 1 127 ? 44.530  110.407 65.790  1.00 24.18 ? 127  LEU B CD2   1 
ATOM   5892  N  N     . GLY B 1 128 ? 44.074  115.441 63.824  1.00 20.61 ? 128  GLY B N     1 
ATOM   5893  C  CA    . GLY B 1 128 ? 43.569  116.787 64.035  1.00 21.22 ? 128  GLY B CA    1 
ATOM   5894  C  C     . GLY B 1 128 ? 44.622  117.773 64.510  1.00 22.27 ? 128  GLY B C     1 
ATOM   5895  O  O     . GLY B 1 128 ? 44.317  118.933 64.796  1.00 22.68 ? 128  GLY B O     1 
ATOM   5896  N  N     . ILE B 1 129 ? 45.867  117.321 64.600  1.00 20.75 ? 129  ILE B N     1 
ATOM   5897  C  CA    . ILE B 1 129 ? 46.930  118.207 65.047  1.00 20.89 ? 129  ILE B CA    1 
ATOM   5898  C  C     . ILE B 1 129 ? 47.269  119.177 63.926  1.00 21.45 ? 129  ILE B C     1 
ATOM   5899  O  O     . ILE B 1 129 ? 47.389  118.780 62.764  1.00 21.83 ? 129  ILE B O     1 
ATOM   5900  C  CB    . ILE B 1 129 ? 48.195  117.416 65.453  1.00 19.48 ? 129  ILE B CB    1 
ATOM   5901  C  CG1   . ILE B 1 129 ? 47.850  116.435 66.576  1.00 17.23 ? 129  ILE B CG1   1 
ATOM   5902  C  CG2   . ILE B 1 129 ? 49.287  118.379 65.918  1.00 17.04 ? 129  ILE B CG2   1 
ATOM   5903  C  CD1   . ILE B 1 129 ? 47.323  117.100 67.829  1.00 14.18 ? 129  ILE B CD1   1 
ATOM   5904  N  N     . LYS B 1 130 ? 47.408  120.450 64.283  1.00 21.32 ? 130  LYS B N     1 
ATOM   5905  C  CA    . LYS B 1 130 ? 47.719  121.488 63.315  1.00 23.11 ? 130  LYS B CA    1 
ATOM   5906  C  C     . LYS B 1 130 ? 48.849  122.390 63.790  1.00 22.78 ? 130  LYS B C     1 
ATOM   5907  O  O     . LYS B 1 130 ? 49.202  122.392 64.966  1.00 23.09 ? 130  LYS B O     1 
ATOM   5908  C  CB    . LYS B 1 130 ? 46.483  122.348 63.050  1.00 24.64 ? 130  LYS B CB    1 
ATOM   5909  C  CG    . LYS B 1 130 ? 45.241  121.559 62.690  1.00 28.77 ? 130  LYS B CG    1 
ATOM   5910  C  CD    . LYS B 1 130 ? 44.081  122.490 62.387  1.00 31.55 ? 130  LYS B CD    1 
ATOM   5911  C  CE    . LYS B 1 130 ? 42.778  121.725 62.292  1.00 33.52 ? 130  LYS B CE    1 
ATOM   5912  N  NZ    . LYS B 1 130 ? 42.837  120.650 61.258  1.00 35.03 ? 130  LYS B NZ    1 
ATOM   5913  N  N     . LYS B 1 131 ? 49.405  123.156 62.854  1.00 21.93 ? 131  LYS B N     1 
ATOM   5914  C  CA    . LYS B 1 131 ? 50.478  124.091 63.143  1.00 21.20 ? 131  LYS B CA    1 
ATOM   5915  C  C     . LYS B 1 131 ? 50.104  124.920 64.369  1.00 21.14 ? 131  LYS B C     1 
ATOM   5916  O  O     . LYS B 1 131 ? 48.992  125.439 64.452  1.00 22.00 ? 131  LYS B O     1 
ATOM   5917  C  CB    . LYS B 1 131 ? 50.693  125.015 61.939  1.00 20.99 ? 131  LYS B CB    1 
ATOM   5918  C  CG    . LYS B 1 131 ? 51.618  126.198 62.224  1.00 21.93 ? 131  LYS B CG    1 
ATOM   5919  C  CD    . LYS B 1 131 ? 51.947  126.977 60.966  1.00 20.61 ? 131  LYS B CD    1 
ATOM   5920  C  CE    . LYS B 1 131 ? 52.924  128.090 61.272  1.00 23.56 ? 131  LYS B CE    1 
ATOM   5921  N  NZ    . LYS B 1 131 ? 53.497  128.690 60.042  1.00 25.50 ? 131  LYS B NZ    1 
ATOM   5922  N  N     . GLY B 1 132 ? 51.029  125.032 65.320  1.00 19.12 ? 132  GLY B N     1 
ATOM   5923  C  CA    . GLY B 1 132 ? 50.767  125.804 66.522  1.00 19.11 ? 132  GLY B CA    1 
ATOM   5924  C  C     . GLY B 1 132 ? 50.380  124.979 67.740  1.00 19.45 ? 132  GLY B C     1 
ATOM   5925  O  O     . GLY B 1 132 ? 50.632  125.389 68.873  1.00 19.73 ? 132  GLY B O     1 
ATOM   5926  N  N     . ASP B 1 133 ? 49.762  123.823 67.526  1.00 18.70 ? 133  ASP B N     1 
ATOM   5927  C  CA    . ASP B 1 133 ? 49.373  122.988 68.654  1.00 20.20 ? 133  ASP B CA    1 
ATOM   5928  C  C     . ASP B 1 133 ? 50.580  122.389 69.357  1.00 20.35 ? 133  ASP B C     1 
ATOM   5929  O  O     . ASP B 1 133 ? 51.584  122.074 68.725  1.00 21.29 ? 133  ASP B O     1 
ATOM   5930  C  CB    . ASP B 1 133 ? 48.466  121.841 68.211  1.00 22.49 ? 133  ASP B CB    1 
ATOM   5931  C  CG    . ASP B 1 133 ? 47.131  122.316 67.682  1.00 26.54 ? 133  ASP B CG    1 
ATOM   5932  O  OD1   . ASP B 1 133 ? 46.560  123.281 68.245  1.00 28.33 ? 133  ASP B OD1   1 
ATOM   5933  O  OD2   . ASP B 1 133 ? 46.644  121.703 66.711  1.00 27.76 ? 133  ASP B OD2   1 
ATOM   5934  N  N     . VAL B 1 134 ? 50.470  122.232 70.671  1.00 19.93 ? 134  VAL B N     1 
ATOM   5935  C  CA    . VAL B 1 134 ? 51.535  121.643 71.462  1.00 19.39 ? 134  VAL B CA    1 
ATOM   5936  C  C     . VAL B 1 134 ? 51.285  120.139 71.524  1.00 18.97 ? 134  VAL B C     1 
ATOM   5937  O  O     . VAL B 1 134 ? 50.144  119.701 71.688  1.00 20.38 ? 134  VAL B O     1 
ATOM   5938  C  CB    . VAL B 1 134 ? 51.551  122.223 72.895  1.00 18.97 ? 134  VAL B CB    1 
ATOM   5939  C  CG1   . VAL B 1 134 ? 52.596  121.510 73.742  1.00 19.60 ? 134  VAL B CG1   1 
ATOM   5940  C  CG2   . VAL B 1 134 ? 51.858  123.708 72.840  1.00 19.20 ? 134  VAL B CG2   1 
ATOM   5941  N  N     . VAL B 1 135 ? 52.348  119.362 71.367  1.00 16.92 ? 135  VAL B N     1 
ATOM   5942  C  CA    . VAL B 1 135 ? 52.257  117.905 71.415  1.00 15.95 ? 135  VAL B CA    1 
ATOM   5943  C  C     . VAL B 1 135 ? 53.244  117.415 72.468  1.00 16.93 ? 135  VAL B C     1 
ATOM   5944  O  O     . VAL B 1 135 ? 54.452  117.604 72.321  1.00 19.28 ? 135  VAL B O     1 
ATOM   5945  C  CB    . VAL B 1 135 ? 52.632  117.256 70.054  1.00 13.53 ? 135  VAL B CB    1 
ATOM   5946  C  CG1   . VAL B 1 135 ? 52.630  115.747 70.175  1.00 12.52 ? 135  VAL B CG1   1 
ATOM   5947  C  CG2   . VAL B 1 135 ? 51.655  117.681 68.980  1.00 12.62 ? 135  VAL B CG2   1 
ATOM   5948  N  N     . ALA B 1 136 ? 52.741  116.795 73.530  1.00 16.19 ? 136  ALA B N     1 
ATOM   5949  C  CA    . ALA B 1 136 ? 53.623  116.297 74.586  1.00 15.60 ? 136  ALA B CA    1 
ATOM   5950  C  C     . ALA B 1 136 ? 54.259  114.962 74.202  1.00 16.93 ? 136  ALA B C     1 
ATOM   5951  O  O     . ALA B 1 136 ? 53.581  114.047 73.719  1.00 16.37 ? 136  ALA B O     1 
ATOM   5952  C  CB    . ALA B 1 136 ? 52.855  116.155 75.890  1.00 12.96 ? 136  ALA B CB    1 
ATOM   5953  N  N     . ILE B 1 137 ? 55.567  114.864 74.420  1.00 17.53 ? 137  ILE B N     1 
ATOM   5954  C  CA    . ILE B 1 137 ? 56.314  113.653 74.108  1.00 15.40 ? 137  ILE B CA    1 
ATOM   5955  C  C     . ILE B 1 137 ? 57.017  113.145 75.360  1.00 16.28 ? 137  ILE B C     1 
ATOM   5956  O  O     . ILE B 1 137 ? 57.955  113.768 75.863  1.00 16.68 ? 137  ILE B O     1 
ATOM   5957  C  CB    . ILE B 1 137 ? 57.349  113.912 72.994  1.00 15.35 ? 137  ILE B CB    1 
ATOM   5958  C  CG1   . ILE B 1 137 ? 56.621  114.342 71.712  1.00 15.68 ? 137  ILE B CG1   1 
ATOM   5959  C  CG2   . ILE B 1 137 ? 58.176  112.653 72.743  1.00 12.43 ? 137  ILE B CG2   1 
ATOM   5960  C  CD1   . ILE B 1 137 ? 57.538  114.649 70.532  1.00 12.36 ? 137  ILE B CD1   1 
ATOM   5961  N  N     . TYR B 1 138 ? 56.533  112.012 75.858  1.00 14.48 ? 138  TYR B N     1 
ATOM   5962  C  CA    . TYR B 1 138 ? 57.058  111.371 77.057  1.00 15.04 ? 138  TYR B CA    1 
ATOM   5963  C  C     . TYR B 1 138 ? 57.623  110.035 76.571  1.00 13.62 ? 138  TYR B C     1 
ATOM   5964  O  O     . TYR B 1 138 ? 57.055  108.974 76.831  1.00 8.49  ? 138  TYR B O     1 
ATOM   5965  C  CB    . TYR B 1 138 ? 55.902  111.160 78.040  1.00 16.03 ? 138  TYR B CB    1 
ATOM   5966  C  CG    . TYR B 1 138 ? 56.287  110.713 79.433  1.00 18.53 ? 138  TYR B CG    1 
ATOM   5967  C  CD1   . TYR B 1 138 ? 57.133  111.490 80.237  1.00 19.05 ? 138  TYR B CD1   1 
ATOM   5968  C  CD2   . TYR B 1 138 ? 55.742  109.550 79.980  1.00 17.66 ? 138  TYR B CD2   1 
ATOM   5969  C  CE1   . TYR B 1 138 ? 57.418  111.118 81.561  1.00 20.84 ? 138  TYR B CE1   1 
ATOM   5970  C  CE2   . TYR B 1 138 ? 56.020  109.170 81.295  1.00 22.22 ? 138  TYR B CE2   1 
ATOM   5971  C  CZ    . TYR B 1 138 ? 56.853  109.959 82.078  1.00 21.36 ? 138  TYR B CZ    1 
ATOM   5972  O  OH    . TYR B 1 138 ? 57.095  109.597 83.377  1.00 24.78 ? 138  TYR B OH    1 
ATOM   5973  N  N     . MET B 1 139 ? 58.752  110.107 75.869  1.00 14.13 ? 139  MET B N     1 
ATOM   5974  C  CA    . MET B 1 139 ? 59.382  108.934 75.270  1.00 14.77 ? 139  MET B CA    1 
ATOM   5975  C  C     . MET B 1 139 ? 60.757  108.516 75.797  1.00 16.11 ? 139  MET B C     1 
ATOM   5976  O  O     . MET B 1 139 ? 61.523  109.327 76.313  1.00 14.29 ? 139  MET B O     1 
ATOM   5977  C  CB    . MET B 1 139 ? 59.515  109.157 73.763  1.00 15.18 ? 139  MET B CB    1 
ATOM   5978  C  CG    . MET B 1 139 ? 58.214  109.280 73.013  1.00 18.27 ? 139  MET B CG    1 
ATOM   5979  S  SD    . MET B 1 139 ? 57.453  107.690 72.878  1.00 23.59 ? 139  MET B SD    1 
ATOM   5980  C  CE    . MET B 1 139 ? 58.399  106.957 71.520  1.00 19.33 ? 139  MET B CE    1 
ATOM   5981  N  N     . PRO B 1 140 ? 61.078  107.222 75.663  1.00 17.63 ? 140  PRO B N     1 
ATOM   5982  C  CA    . PRO B 1 140 ? 62.362  106.675 76.104  1.00 17.52 ? 140  PRO B CA    1 
ATOM   5983  C  C     . PRO B 1 140 ? 63.358  106.892 74.959  1.00 19.73 ? 140  PRO B C     1 
ATOM   5984  O  O     . PRO B 1 140 ? 62.991  107.439 73.911  1.00 19.12 ? 140  PRO B O     1 
ATOM   5985  C  CB    . PRO B 1 140 ? 62.038  105.204 76.329  1.00 16.19 ? 140  PRO B CB    1 
ATOM   5986  C  CG    . PRO B 1 140 ? 61.058  104.929 75.247  1.00 16.46 ? 140  PRO B CG    1 
ATOM   5987  C  CD    . PRO B 1 140 ? 60.136  106.134 75.337  1.00 16.48 ? 140  PRO B CD    1 
ATOM   5988  N  N     . MET B 1 141 ? 64.609  106.473 75.138  1.00 19.26 ? 141  MET B N     1 
ATOM   5989  C  CA    . MET B 1 141 ? 65.611  106.660 74.088  1.00 17.68 ? 141  MET B CA    1 
ATOM   5990  C  C     . MET B 1 141 ? 65.494  105.616 72.979  1.00 17.07 ? 141  MET B C     1 
ATOM   5991  O  O     . MET B 1 141 ? 66.273  104.662 72.922  1.00 17.43 ? 141  MET B O     1 
ATOM   5992  C  CB    . MET B 1 141 ? 67.027  106.618 74.672  1.00 15.89 ? 141  MET B CB    1 
ATOM   5993  C  CG    . MET B 1 141 ? 67.463  107.875 75.408  1.00 13.69 ? 141  MET B CG    1 
ATOM   5994  S  SD    . MET B 1 141 ? 67.723  109.295 74.271  1.00 13.84 ? 141  MET B SD    1 
ATOM   5995  C  CE    . MET B 1 141 ? 69.450  109.065 73.791  1.00 11.40 ? 141  MET B CE    1 
ATOM   5996  N  N     . VAL B 1 142 ? 64.503  105.803 72.112  1.00 16.81 ? 142  VAL B N     1 
ATOM   5997  C  CA    . VAL B 1 142 ? 64.253  104.912 70.984  1.00 15.51 ? 142  VAL B CA    1 
ATOM   5998  C  C     . VAL B 1 142 ? 64.009  105.757 69.736  1.00 16.18 ? 142  VAL B C     1 
ATOM   5999  O  O     . VAL B 1 142 ? 63.567  106.896 69.832  1.00 15.68 ? 142  VAL B O     1 
ATOM   6000  C  CB    . VAL B 1 142 ? 63.009  104.024 71.223  1.00 15.85 ? 142  VAL B CB    1 
ATOM   6001  C  CG1   . VAL B 1 142 ? 63.266  103.055 72.361  1.00 14.36 ? 142  VAL B CG1   1 
ATOM   6002  C  CG2   . VAL B 1 142 ? 61.796  104.899 71.526  1.00 14.99 ? 142  VAL B CG2   1 
ATOM   6003  N  N     . PRO B 1 143 ? 64.283  105.203 68.546  1.00 17.74 ? 143  PRO B N     1 
ATOM   6004  C  CA    . PRO B 1 143 ? 64.099  105.906 67.273  1.00 16.99 ? 143  PRO B CA    1 
ATOM   6005  C  C     . PRO B 1 143 ? 62.776  106.664 67.156  1.00 17.09 ? 143  PRO B C     1 
ATOM   6006  O  O     . PRO B 1 143 ? 62.753  107.813 66.713  1.00 16.69 ? 143  PRO B O     1 
ATOM   6007  C  CB    . PRO B 1 143 ? 64.204  104.782 66.246  1.00 17.24 ? 143  PRO B CB    1 
ATOM   6008  C  CG    . PRO B 1 143 ? 65.167  103.841 66.882  1.00 16.47 ? 143  PRO B CG    1 
ATOM   6009  C  CD    . PRO B 1 143 ? 64.690  103.805 68.311  1.00 17.10 ? 143  PRO B CD    1 
ATOM   6010  N  N     . GLU B 1 144 ? 61.683  106.015 67.553  1.00 14.69 ? 144  GLU B N     1 
ATOM   6011  C  CA    . GLU B 1 144 ? 60.360  106.626 67.476  1.00 13.67 ? 144  GLU B CA    1 
ATOM   6012  C  C     . GLU B 1 144 ? 60.323  108.001 68.123  1.00 13.56 ? 144  GLU B C     1 
ATOM   6013  O  O     . GLU B 1 144 ? 59.624  108.892 67.641  1.00 15.62 ? 144  GLU B O     1 
ATOM   6014  C  CB    . GLU B 1 144 ? 59.311  105.739 68.139  1.00 13.12 ? 144  GLU B CB    1 
ATOM   6015  C  CG    . GLU B 1 144 ? 59.109  104.392 67.494  1.00 15.39 ? 144  GLU B CG    1 
ATOM   6016  C  CD    . GLU B 1 144 ? 60.259  103.438 67.738  1.00 13.24 ? 144  GLU B CD    1 
ATOM   6017  O  OE1   . GLU B 1 144 ? 60.990  103.618 68.726  1.00 12.01 ? 144  GLU B OE1   1 
ATOM   6018  O  OE2   . GLU B 1 144 ? 60.416  102.496 66.944  1.00 17.28 ? 144  GLU B OE2   1 
ATOM   6019  N  N     . ALA B 1 145 ? 61.050  108.172 69.226  1.00 11.83 ? 145  ALA B N     1 
ATOM   6020  C  CA    . ALA B 1 145 ? 61.089  109.468 69.900  1.00 12.19 ? 145  ALA B CA    1 
ATOM   6021  C  C     . ALA B 1 145 ? 61.500  110.540 68.895  1.00 11.68 ? 145  ALA B C     1 
ATOM   6022  O  O     . ALA B 1 145 ? 60.881  111.606 68.822  1.00 10.53 ? 145  ALA B O     1 
ATOM   6023  C  CB    . ALA B 1 145 ? 62.078  109.438 71.056  1.00 10.41 ? 145  ALA B CB    1 
ATOM   6024  N  N     . ALA B 1 146 ? 62.538  110.238 68.114  1.00 11.13 ? 146  ALA B N     1 
ATOM   6025  C  CA    . ALA B 1 146 ? 63.055  111.159 67.109  1.00 11.55 ? 146  ALA B CA    1 
ATOM   6026  C  C     . ALA B 1 146 ? 62.033  111.374 66.002  1.00 11.62 ? 146  ALA B C     1 
ATOM   6027  O  O     . ALA B 1 146 ? 61.835  112.498 65.530  1.00 11.42 ? 146  ALA B O     1 
ATOM   6028  C  CB    . ALA B 1 146 ? 64.365  110.620 66.522  1.00 10.50 ? 146  ALA B CB    1 
ATOM   6029  N  N     . VAL B 1 147 ? 61.381  110.294 65.588  1.00 12.20 ? 147  VAL B N     1 
ATOM   6030  C  CA    . VAL B 1 147 ? 60.370  110.376 64.541  1.00 10.55 ? 147  VAL B CA    1 
ATOM   6031  C  C     . VAL B 1 147 ? 59.256  111.331 64.966  1.00 11.09 ? 147  VAL B C     1 
ATOM   6032  O  O     . VAL B 1 147 ? 58.843  112.187 64.186  1.00 9.99  ? 147  VAL B O     1 
ATOM   6033  C  CB    . VAL B 1 147 ? 59.768  108.985 64.242  1.00 10.35 ? 147  VAL B CB    1 
ATOM   6034  C  CG1   . VAL B 1 147 ? 58.671  109.103 63.199  1.00 8.48  ? 147  VAL B CG1   1 
ATOM   6035  C  CG2   . VAL B 1 147 ? 60.855  108.051 63.759  1.00 7.00  ? 147  VAL B CG2   1 
ATOM   6036  N  N     . ALA B 1 148 ? 58.779  111.182 66.204  1.00 10.33 ? 148  ALA B N     1 
ATOM   6037  C  CA    . ALA B 1 148 ? 57.712  112.042 66.723  1.00 11.42 ? 148  ALA B CA    1 
ATOM   6038  C  C     . ALA B 1 148 ? 58.127  113.510 66.723  1.00 11.81 ? 148  ALA B C     1 
ATOM   6039  O  O     . ALA B 1 148 ? 57.321  114.389 66.398  1.00 12.50 ? 148  ALA B O     1 
ATOM   6040  C  CB    . ALA B 1 148 ? 57.322  111.613 68.140  1.00 10.25 ? 148  ALA B CB    1 
ATOM   6041  N  N     . MET B 1 149 ? 59.381  113.775 67.088  1.00 11.49 ? 149  MET B N     1 
ATOM   6042  C  CA    . MET B 1 149 ? 59.889  115.140 67.132  1.00 12.46 ? 149  MET B CA    1 
ATOM   6043  C  C     . MET B 1 149 ? 59.979  115.795 65.757  1.00 13.55 ? 149  MET B C     1 
ATOM   6044  O  O     . MET B 1 149 ? 59.389  116.857 65.539  1.00 13.81 ? 149  MET B O     1 
ATOM   6045  C  CB    . MET B 1 149 ? 61.240  115.154 67.843  1.00 14.57 ? 149  MET B CB    1 
ATOM   6046  C  CG    . MET B 1 149 ? 61.068  115.133 69.367  1.00 14.17 ? 149  MET B CG    1 
ATOM   6047  S  SD    . MET B 1 149 ? 62.596  114.727 70.258  1.00 14.13 ? 149  MET B SD    1 
ATOM   6048  C  CE    . MET B 1 149 ? 63.466  116.302 70.250  1.00 12.21 ? 149  MET B CE    1 
ATOM   6049  N  N     . LEU B 1 150 ? 60.688  115.151 64.831  1.00 12.94 ? 150  LEU B N     1 
ATOM   6050  C  CA    . LEU B 1 150 ? 60.830  115.672 63.478  1.00 11.93 ? 150  LEU B CA    1 
ATOM   6051  C  C     . LEU B 1 150 ? 59.470  115.842 62.798  1.00 12.85 ? 150  LEU B C     1 
ATOM   6052  O  O     . LEU B 1 150 ? 59.267  116.794 62.030  1.00 11.49 ? 150  LEU B O     1 
ATOM   6053  C  CB    . LEU B 1 150 ? 61.703  114.731 62.650  1.00 12.54 ? 150  LEU B CB    1 
ATOM   6054  C  CG    . LEU B 1 150 ? 63.171  114.621 63.082  1.00 14.21 ? 150  LEU B CG    1 
ATOM   6055  C  CD1   . LEU B 1 150 ? 63.800  113.369 62.484  1.00 13.26 ? 150  LEU B CD1   1 
ATOM   6056  C  CD2   . LEU B 1 150 ? 63.921  115.871 62.659  1.00 10.97 ? 150  LEU B CD2   1 
ATOM   6057  N  N     . ALA B 1 151 ? 58.547  114.920 63.079  1.00 11.72 ? 151  ALA B N     1 
ATOM   6058  C  CA    . ALA B 1 151 ? 57.202  114.962 62.501  1.00 11.42 ? 151  ALA B CA    1 
ATOM   6059  C  C     . ALA B 1 151 ? 56.465  116.214 62.968  1.00 12.38 ? 151  ALA B C     1 
ATOM   6060  O  O     . ALA B 1 151 ? 55.815  116.906 62.176  1.00 12.81 ? 151  ALA B O     1 
ATOM   6061  C  CB    . ALA B 1 151 ? 56.417  113.723 62.904  1.00 10.55 ? 151  ALA B CB    1 
ATOM   6062  N  N     . CYS B 1 152 ? 56.566  116.499 64.261  1.00 11.24 ? 152  CYS B N     1 
ATOM   6063  C  CA    . CYS B 1 152 ? 55.902  117.665 64.818  1.00 14.00 ? 152  CYS B CA    1 
ATOM   6064  C  C     . CYS B 1 152 ? 56.429  118.915 64.126  1.00 14.68 ? 152  CYS B C     1 
ATOM   6065  O  O     . CYS B 1 152 ? 55.660  119.750 63.649  1.00 15.52 ? 152  CYS B O     1 
ATOM   6066  C  CB    . CYS B 1 152 ? 56.144  117.758 66.325  1.00 14.62 ? 152  CYS B CB    1 
ATOM   6067  S  SG    . CYS B 1 152 ? 55.262  116.555 67.288  1.00 15.96 ? 152  CYS B SG    1 
ATOM   6068  N  N     . ALA B 1 153 ? 57.750  119.017 64.055  1.00 14.46 ? 153  ALA B N     1 
ATOM   6069  C  CA    . ALA B 1 153 ? 58.402  120.155 63.429  1.00 13.72 ? 153  ALA B CA    1 
ATOM   6070  C  C     . ALA B 1 153 ? 58.058  120.260 61.935  1.00 14.09 ? 153  ALA B C     1 
ATOM   6071  O  O     . ALA B 1 153 ? 57.983  121.356 61.385  1.00 14.28 ? 153  ALA B O     1 
ATOM   6072  C  CB    . ALA B 1 153 ? 59.916  120.048 63.628  1.00 12.37 ? 153  ALA B CB    1 
ATOM   6073  N  N     . ARG B 1 154 ? 57.846  119.122 61.285  1.00 14.00 ? 154  ARG B N     1 
ATOM   6074  C  CA    . ARG B 1 154 ? 57.509  119.108 59.862  1.00 13.76 ? 154  ARG B CA    1 
ATOM   6075  C  C     . ARG B 1 154 ? 56.167  119.802 59.563  1.00 13.16 ? 154  ARG B C     1 
ATOM   6076  O  O     . ARG B 1 154 ? 56.001  120.412 58.502  1.00 16.46 ? 154  ARG B O     1 
ATOM   6077  C  CB    . ARG B 1 154 ? 57.477  117.665 59.348  1.00 12.53 ? 154  ARG B CB    1 
ATOM   6078  C  CG    . ARG B 1 154 ? 57.485  117.535 57.829  1.00 13.29 ? 154  ARG B CG    1 
ATOM   6079  C  CD    . ARG B 1 154 ? 57.475  116.068 57.388  1.00 10.71 ? 154  ARG B CD    1 
ATOM   6080  N  NE    . ARG B 1 154 ? 57.533  115.918 55.932  1.00 10.28 ? 154  ARG B NE    1 
ATOM   6081  C  CZ    . ARG B 1 154 ? 58.638  116.024 55.201  1.00 9.12  ? 154  ARG B CZ    1 
ATOM   6082  N  NH1   . ARG B 1 154 ? 59.806  116.283 55.779  1.00 10.34 ? 154  ARG B NH1   1 
ATOM   6083  N  NH2   . ARG B 1 154 ? 58.574  115.865 53.888  1.00 8.17  ? 154  ARG B NH2   1 
ATOM   6084  N  N     . ILE B 1 155 ? 55.224  119.721 60.500  1.00 11.83 ? 155  ILE B N     1 
ATOM   6085  C  CA    . ILE B 1 155 ? 53.914  120.344 60.320  1.00 11.24 ? 155  ILE B CA    1 
ATOM   6086  C  C     . ILE B 1 155 ? 53.726  121.609 61.150  1.00 14.16 ? 155  ILE B C     1 
ATOM   6087  O  O     . ILE B 1 155 ? 52.625  122.161 61.205  1.00 14.81 ? 155  ILE B O     1 
ATOM   6088  C  CB    . ILE B 1 155 ? 52.763  119.377 60.682  1.00 12.96 ? 155  ILE B CB    1 
ATOM   6089  C  CG1   . ILE B 1 155 ? 52.835  119.004 62.167  1.00 14.91 ? 155  ILE B CG1   1 
ATOM   6090  C  CG2   . ILE B 1 155 ? 52.846  118.119 59.817  1.00 11.59 ? 155  ILE B CG2   1 
ATOM   6091  C  CD1   . ILE B 1 155 ? 51.648  118.192 62.658  1.00 16.14 ? 155  ILE B CD1   1 
ATOM   6092  N  N     . GLY B 1 156 ? 54.790  122.068 61.801  1.00 14.74 ? 156  GLY B N     1 
ATOM   6093  C  CA    . GLY B 1 156 ? 54.679  123.275 62.600  1.00 16.46 ? 156  GLY B CA    1 
ATOM   6094  C  C     . GLY B 1 156 ? 54.001  123.077 63.945  1.00 18.10 ? 156  GLY B C     1 
ATOM   6095  O  O     . GLY B 1 156 ? 53.588  124.045 64.588  1.00 18.63 ? 156  GLY B O     1 
ATOM   6096  N  N     . ALA B 1 157 ? 53.867  121.829 64.374  1.00 17.56 ? 157  ALA B N     1 
ATOM   6097  C  CA    . ALA B 1 157 ? 53.265  121.551 65.669  1.00 18.88 ? 157  ALA B CA    1 
ATOM   6098  C  C     . ALA B 1 157 ? 54.388  121.775 66.670  1.00 19.03 ? 157  ALA B C     1 
ATOM   6099  O  O     . ALA B 1 157 ? 55.531  121.414 66.402  1.00 21.75 ? 157  ALA B O     1 
ATOM   6100  C  CB    . ALA B 1 157 ? 52.784  120.104 65.728  1.00 16.39 ? 157  ALA B CB    1 
ATOM   6101  N  N     . VAL B 1 158 ? 54.078  122.385 67.807  1.00 19.11 ? 158  VAL B N     1 
ATOM   6102  C  CA    . VAL B 1 158 ? 55.092  122.642 68.826  1.00 18.79 ? 158  VAL B CA    1 
ATOM   6103  C  C     . VAL B 1 158 ? 55.237  121.412 69.711  1.00 18.92 ? 158  VAL B C     1 
ATOM   6104  O  O     . VAL B 1 158 ? 54.264  120.983 70.336  1.00 22.76 ? 158  VAL B O     1 
ATOM   6105  C  CB    . VAL B 1 158 ? 54.703  123.853 69.714  1.00 18.35 ? 158  VAL B CB    1 
ATOM   6106  C  CG1   . VAL B 1 158 ? 55.708  124.018 70.849  1.00 17.47 ? 158  VAL B CG1   1 
ATOM   6107  C  CG2   . VAL B 1 158 ? 54.655  125.116 68.870  1.00 16.23 ? 158  VAL B CG2   1 
ATOM   6108  N  N     . HIS B 1 159 ? 56.430  120.826 69.766  1.00 15.69 ? 159  HIS B N     1 
ATOM   6109  C  CA    . HIS B 1 159 ? 56.582  119.652 70.611  1.00 15.36 ? 159  HIS B CA    1 
ATOM   6110  C  C     . HIS B 1 159 ? 57.145  119.984 71.979  1.00 14.15 ? 159  HIS B C     1 
ATOM   6111  O  O     . HIS B 1 159 ? 58.036  120.820 72.133  1.00 14.53 ? 159  HIS B O     1 
ATOM   6112  C  CB    . HIS B 1 159 ? 57.414  118.555 69.918  1.00 14.05 ? 159  HIS B CB    1 
ATOM   6113  C  CG    . HIS B 1 159 ? 58.878  118.855 69.812  1.00 15.23 ? 159  HIS B CG    1 
ATOM   6114  N  ND1   . HIS B 1 159 ? 59.713  118.895 70.911  1.00 14.67 ? 159  HIS B ND1   1 
ATOM   6115  C  CD2   . HIS B 1 159 ? 59.667  119.069 68.731  1.00 13.87 ? 159  HIS B CD2   1 
ATOM   6116  C  CE1   . HIS B 1 159 ? 60.952  119.117 70.511  1.00 15.20 ? 159  HIS B CE1   1 
ATOM   6117  N  NE2   . HIS B 1 159 ? 60.951  119.227 69.194  1.00 13.49 ? 159  HIS B NE2   1 
ATOM   6118  N  N     . SER B 1 160 ? 56.572  119.338 72.984  1.00 15.47 ? 160  SER B N     1 
ATOM   6119  C  CA    . SER B 1 160 ? 56.988  119.531 74.358  1.00 15.65 ? 160  SER B CA    1 
ATOM   6120  C  C     . SER B 1 160 ? 57.473  118.187 74.872  1.00 15.89 ? 160  SER B C     1 
ATOM   6121  O  O     . SER B 1 160 ? 56.687  117.403 75.396  1.00 14.77 ? 160  SER B O     1 
ATOM   6122  C  CB    . SER B 1 160 ? 55.806  120.014 75.197  1.00 16.21 ? 160  SER B CB    1 
ATOM   6123  O  OG    . SER B 1 160 ? 56.240  120.467 76.465  1.00 17.92 ? 160  SER B OG    1 
ATOM   6124  N  N     . VAL B 1 161 ? 58.761  117.909 74.689  1.00 16.23 ? 161  VAL B N     1 
ATOM   6125  C  CA    . VAL B 1 161 ? 59.327  116.652 75.154  1.00 16.63 ? 161  VAL B CA    1 
ATOM   6126  C  C     . VAL B 1 161 ? 59.450  116.701 76.667  1.00 17.13 ? 161  VAL B C     1 
ATOM   6127  O  O     . VAL B 1 161 ? 59.927  117.687 77.229  1.00 18.74 ? 161  VAL B O     1 
ATOM   6128  C  CB    . VAL B 1 161 ? 60.732  116.394 74.565  1.00 16.83 ? 161  VAL B CB    1 
ATOM   6129  C  CG1   . VAL B 1 161 ? 61.271  115.044 75.055  1.00 12.17 ? 161  VAL B CG1   1 
ATOM   6130  C  CG2   . VAL B 1 161 ? 60.669  116.426 73.053  1.00 16.66 ? 161  VAL B CG2   1 
ATOM   6131  N  N     . ILE B 1 162 ? 59.009  115.632 77.319  1.00 16.61 ? 162  ILE B N     1 
ATOM   6132  C  CA    . ILE B 1 162 ? 59.077  115.534 78.766  1.00 14.49 ? 162  ILE B CA    1 
ATOM   6133  C  C     . ILE B 1 162 ? 59.953  114.343 79.135  1.00 14.65 ? 162  ILE B C     1 
ATOM   6134  O  O     . ILE B 1 162 ? 59.616  113.198 78.832  1.00 15.80 ? 162  ILE B O     1 
ATOM   6135  C  CB    . ILE B 1 162 ? 57.680  115.328 79.378  1.00 12.84 ? 162  ILE B CB    1 
ATOM   6136  C  CG1   . ILE B 1 162 ? 56.767  116.484 78.971  1.00 10.78 ? 162  ILE B CG1   1 
ATOM   6137  C  CG2   . ILE B 1 162 ? 57.784  115.234 80.901  1.00 10.92 ? 162  ILE B CG2   1 
ATOM   6138  C  CD1   . ILE B 1 162 ? 55.344  116.315 79.435  1.00 9.47  ? 162  ILE B CD1   1 
ATOM   6139  N  N     . PHE B 1 163 ? 61.081  114.620 79.781  1.00 13.56 ? 163  PHE B N     1 
ATOM   6140  C  CA    . PHE B 1 163 ? 61.992  113.573 80.197  1.00 12.96 ? 163  PHE B CA    1 
ATOM   6141  C  C     . PHE B 1 163 ? 61.225  112.475 80.930  1.00 14.52 ? 163  PHE B C     1 
ATOM   6142  O  O     . PHE B 1 163 ? 60.329  112.760 81.728  1.00 15.12 ? 163  PHE B O     1 
ATOM   6143  C  CB    . PHE B 1 163 ? 63.071  114.159 81.108  1.00 13.43 ? 163  PHE B CB    1 
ATOM   6144  C  CG    . PHE B 1 163 ? 64.075  113.151 81.584  1.00 11.02 ? 163  PHE B CG    1 
ATOM   6145  C  CD1   . PHE B 1 163 ? 64.866  112.455 80.675  1.00 11.23 ? 163  PHE B CD1   1 
ATOM   6146  C  CD2   . PHE B 1 163 ? 64.227  112.888 82.942  1.00 10.22 ? 163  PHE B CD2   1 
ATOM   6147  C  CE1   . PHE B 1 163 ? 65.795  111.507 81.109  1.00 14.00 ? 163  PHE B CE1   1 
ATOM   6148  C  CE2   . PHE B 1 163 ? 65.152  111.943 83.392  1.00 14.37 ? 163  PHE B CE2   1 
ATOM   6149  C  CZ    . PHE B 1 163 ? 65.939  111.249 82.474  1.00 12.51 ? 163  PHE B CZ    1 
ATOM   6150  N  N     . GLY B 1 164 ? 61.585  111.223 80.655  1.00 16.64 ? 164  GLY B N     1 
ATOM   6151  C  CA    . GLY B 1 164 ? 60.925  110.080 81.279  1.00 18.27 ? 164  GLY B CA    1 
ATOM   6152  C  C     . GLY B 1 164 ? 61.063  109.923 82.788  1.00 18.86 ? 164  GLY B C     1 
ATOM   6153  O  O     . GLY B 1 164 ? 60.311  109.164 83.404  1.00 20.21 ? 164  GLY B O     1 
ATOM   6154  N  N     . GLY B 1 165 ? 62.023  110.626 83.384  1.00 18.76 ? 165  GLY B N     1 
ATOM   6155  C  CA    . GLY B 1 165 ? 62.222  110.549 84.823  1.00 17.05 ? 165  GLY B CA    1 
ATOM   6156  C  C     . GLY B 1 165 ? 61.249  111.412 85.607  1.00 18.51 ? 165  GLY B C     1 
ATOM   6157  O  O     . GLY B 1 165 ? 61.273  111.439 86.838  1.00 18.74 ? 165  GLY B O     1 
ATOM   6158  N  N     . PHE B 1 166 ? 60.393  112.133 84.891  1.00 19.59 ? 166  PHE B N     1 
ATOM   6159  C  CA    . PHE B 1 166 ? 59.394  112.991 85.521  1.00 21.73 ? 166  PHE B CA    1 
ATOM   6160  C  C     . PHE B 1 166 ? 58.246  112.135 86.070  1.00 20.99 ? 166  PHE B C     1 
ATOM   6161  O  O     . PHE B 1 166 ? 57.755  111.232 85.393  1.00 19.18 ? 166  PHE B O     1 
ATOM   6162  C  CB    . PHE B 1 166 ? 58.824  113.983 84.499  1.00 24.88 ? 166  PHE B CB    1 
ATOM   6163  C  CG    . PHE B 1 166 ? 59.567  115.285 84.415  1.00 26.59 ? 166  PHE B CG    1 
ATOM   6164  C  CD1   . PHE B 1 166 ? 60.954  115.321 84.346  1.00 27.26 ? 166  PHE B CD1   1 
ATOM   6165  C  CD2   . PHE B 1 166 ? 58.864  116.486 84.365  1.00 30.60 ? 166  PHE B CD2   1 
ATOM   6166  C  CE1   . PHE B 1 166 ? 61.633  116.538 84.229  1.00 28.26 ? 166  PHE B CE1   1 
ATOM   6167  C  CE2   . PHE B 1 166 ? 59.533  117.715 84.247  1.00 31.65 ? 166  PHE B CE2   1 
ATOM   6168  C  CZ    . PHE B 1 166 ? 60.925  117.735 84.180  1.00 29.69 ? 166  PHE B CZ    1 
ATOM   6169  N  N     . SER B 1 167 ? 57.821  112.433 87.291  1.00 20.59 ? 167  SER B N     1 
ATOM   6170  C  CA    . SER B 1 167 ? 56.728  111.712 87.934  1.00 20.47 ? 167  SER B CA    1 
ATOM   6171  C  C     . SER B 1 167 ? 55.413  112.107 87.257  1.00 21.09 ? 167  SER B C     1 
ATOM   6172  O  O     . SER B 1 167 ? 55.367  113.087 86.505  1.00 21.18 ? 167  SER B O     1 
ATOM   6173  C  CB    . SER B 1 167 ? 56.664  112.094 89.411  1.00 21.37 ? 167  SER B CB    1 
ATOM   6174  O  OG    . SER B 1 167 ? 56.317  113.463 89.558  1.00 20.67 ? 167  SER B OG    1 
ATOM   6175  N  N     . PRO B 1 168 ? 54.329  111.352 87.517  1.00 20.15 ? 168  PRO B N     1 
ATOM   6176  C  CA    . PRO B 1 168 ? 53.021  111.654 86.920  1.00 19.81 ? 168  PRO B CA    1 
ATOM   6177  C  C     . PRO B 1 168 ? 52.609  113.094 87.219  1.00 19.53 ? 168  PRO B C     1 
ATOM   6178  O  O     . PRO B 1 168 ? 52.060  113.796 86.364  1.00 20.53 ? 168  PRO B O     1 
ATOM   6179  C  CB    . PRO B 1 168 ? 52.091  110.650 87.595  1.00 20.11 ? 168  PRO B CB    1 
ATOM   6180  C  CG    . PRO B 1 168 ? 52.990  109.471 87.814  1.00 21.37 ? 168  PRO B CG    1 
ATOM   6181  C  CD    . PRO B 1 168 ? 54.266  110.118 88.321  1.00 21.23 ? 168  PRO B CD    1 
ATOM   6182  N  N     . GLU B 1 169 ? 52.888  113.522 88.445  1.00 18.68 ? 169  GLU B N     1 
ATOM   6183  C  CA    . GLU B 1 169 ? 52.562  114.866 88.903  1.00 19.78 ? 169  GLU B CA    1 
ATOM   6184  C  C     . GLU B 1 169 ? 53.322  115.911 88.080  1.00 19.35 ? 169  GLU B C     1 
ATOM   6185  O  O     . GLU B 1 169 ? 52.759  116.940 87.705  1.00 19.87 ? 169  GLU B O     1 
ATOM   6186  C  CB    . GLU B 1 169 ? 52.907  114.996 90.392  1.00 19.83 ? 169  GLU B CB    1 
ATOM   6187  C  CG    . GLU B 1 169 ? 52.622  116.351 91.018  1.00 23.49 ? 169  GLU B CG    1 
ATOM   6188  C  CD    . GLU B 1 169 ? 51.150  116.719 90.981  1.00 26.06 ? 169  GLU B CD    1 
ATOM   6189  O  OE1   . GLU B 1 169 ? 50.299  115.798 90.927  1.00 27.27 ? 169  GLU B OE1   1 
ATOM   6190  O  OE2   . GLU B 1 169 ? 50.844  117.932 91.022  1.00 29.44 ? 169  GLU B OE2   1 
ATOM   6191  N  N     . ALA B 1 170 ? 54.598  115.651 87.804  1.00 17.45 ? 170  ALA B N     1 
ATOM   6192  C  CA    . ALA B 1 170 ? 55.396  116.581 87.012  1.00 16.04 ? 170  ALA B CA    1 
ATOM   6193  C  C     . ALA B 1 170 ? 54.904  116.561 85.561  1.00 16.45 ? 170  ALA B C     1 
ATOM   6194  O  O     . ALA B 1 170 ? 54.839  117.603 84.905  1.00 16.71 ? 170  ALA B O     1 
ATOM   6195  C  CB    . ALA B 1 170 ? 56.866  116.211 87.081  1.00 15.83 ? 170  ALA B CB    1 
ATOM   6196  N  N     . VAL B 1 171 ? 54.548  115.379 85.063  1.00 16.41 ? 171  VAL B N     1 
ATOM   6197  C  CA    . VAL B 1 171 ? 54.035  115.267 83.701  1.00 16.37 ? 171  VAL B CA    1 
ATOM   6198  C  C     . VAL B 1 171 ? 52.733  116.058 83.571  1.00 17.20 ? 171  VAL B C     1 
ATOM   6199  O  O     . VAL B 1 171 ? 52.506  116.719 82.560  1.00 17.03 ? 171  VAL B O     1 
ATOM   6200  C  CB    . VAL B 1 171 ? 53.766  113.800 83.308  1.00 18.20 ? 171  VAL B CB    1 
ATOM   6201  C  CG1   . VAL B 1 171 ? 52.945  113.753 82.023  1.00 15.09 ? 171  VAL B CG1   1 
ATOM   6202  C  CG2   . VAL B 1 171 ? 55.095  113.058 83.111  1.00 16.86 ? 171  VAL B CG2   1 
ATOM   6203  N  N     . ALA B 1 172 ? 51.884  115.997 84.594  1.00 16.88 ? 172  ALA B N     1 
ATOM   6204  C  CA    . ALA B 1 172 ? 50.616  116.729 84.569  1.00 17.27 ? 172  ALA B CA    1 
ATOM   6205  C  C     . ALA B 1 172 ? 50.858  118.240 84.574  1.00 17.00 ? 172  ALA B C     1 
ATOM   6206  O  O     . ALA B 1 172 ? 50.222  118.977 83.825  1.00 16.37 ? 172  ALA B O     1 
ATOM   6207  C  CB    . ALA B 1 172 ? 49.752  116.330 85.763  1.00 14.22 ? 172  ALA B CB    1 
ATOM   6208  N  N     . GLY B 1 173 ? 51.784  118.696 85.414  1.00 19.83 ? 173  GLY B N     1 
ATOM   6209  C  CA    . GLY B 1 173 ? 52.096  120.118 85.484  1.00 20.45 ? 173  GLY B CA    1 
ATOM   6210  C  C     . GLY B 1 173 ? 52.517  120.682 84.132  1.00 21.74 ? 173  GLY B C     1 
ATOM   6211  O  O     . GLY B 1 173 ? 52.156  121.804 83.780  1.00 20.96 ? 173  GLY B O     1 
ATOM   6212  N  N     . CYS B 1 174 ? 53.278  119.894 83.371  1.00 22.43 ? 174  CYS B N     1 
ATOM   6213  C  CA    . CYS B 1 174 ? 53.746  120.294 82.045  1.00 21.64 ? 174  CYS B CA    1 
ATOM   6214  C  C     . CYS B 1 174 ? 52.601  120.363 81.044  1.00 21.34 ? 174  CYS B C     1 
ATOM   6215  O  O     . CYS B 1 174 ? 52.452  121.353 80.329  1.00 22.11 ? 174  CYS B O     1 
ATOM   6216  C  CB    . CYS B 1 174 ? 54.799  119.310 81.527  1.00 21.83 ? 174  CYS B CB    1 
ATOM   6217  S  SG    . CYS B 1 174 ? 56.394  119.421 82.355  1.00 25.24 ? 174  CYS B SG    1 
ATOM   6218  N  N     . ILE B 1 175 ? 51.798  119.304 80.992  1.00 20.05 ? 175  ILE B N     1 
ATOM   6219  C  CA    . ILE B 1 175 ? 50.669  119.252 80.071  1.00 20.53 ? 175  ILE B CA    1 
ATOM   6220  C  C     . ILE B 1 175 ? 49.679  120.386 80.332  1.00 21.39 ? 175  ILE B C     1 
ATOM   6221  O  O     . ILE B 1 175 ? 49.198  121.025 79.398  1.00 22.59 ? 175  ILE B O     1 
ATOM   6222  C  CB    . ILE B 1 175 ? 49.925  117.906 80.182  1.00 20.06 ? 175  ILE B CB    1 
ATOM   6223  C  CG1   . ILE B 1 175 ? 50.843  116.770 79.728  1.00 19.27 ? 175  ILE B CG1   1 
ATOM   6224  C  CG2   . ILE B 1 175 ? 48.657  117.939 79.355  1.00 19.80 ? 175  ILE B CG2   1 
ATOM   6225  C  CD1   . ILE B 1 175 ? 50.222  115.391 79.868  1.00 18.05 ? 175  ILE B CD1   1 
ATOM   6226  N  N     . ILE B 1 176 ? 49.384  120.631 81.604  1.00 20.69 ? 176  ILE B N     1 
ATOM   6227  C  CA    . ILE B 1 176 ? 48.453  121.684 81.989  1.00 19.65 ? 176  ILE B CA    1 
ATOM   6228  C  C     . ILE B 1 176 ? 48.921  123.042 81.482  1.00 19.93 ? 176  ILE B C     1 
ATOM   6229  O  O     . ILE B 1 176 ? 48.148  123.799 80.887  1.00 18.36 ? 176  ILE B O     1 
ATOM   6230  C  CB    . ILE B 1 176 ? 48.299  121.742 83.528  1.00 18.55 ? 176  ILE B CB    1 
ATOM   6231  C  CG1   . ILE B 1 176 ? 47.626  120.457 84.027  1.00 18.44 ? 176  ILE B CG1   1 
ATOM   6232  C  CG2   . ILE B 1 176 ? 47.496  122.972 83.927  1.00 18.12 ? 176  ILE B CG2   1 
ATOM   6233  C  CD1   . ILE B 1 176 ? 47.440  120.384 85.528  1.00 15.45 ? 176  ILE B CD1   1 
ATOM   6234  N  N     . ASP B 1 177 ? 50.198  123.335 81.704  1.00 18.98 ? 177  ASP B N     1 
ATOM   6235  C  CA    . ASP B 1 177 ? 50.774  124.603 81.287  1.00 19.02 ? 177  ASP B CA    1 
ATOM   6236  C  C     . ASP B 1 177 ? 50.826  124.820 79.783  1.00 19.46 ? 177  ASP B C     1 
ATOM   6237  O  O     . ASP B 1 177 ? 50.653  125.944 79.312  1.00 18.84 ? 177  ASP B O     1 
ATOM   6238  C  CB    . ASP B 1 177 ? 52.189  124.754 81.848  1.00 19.75 ? 177  ASP B CB    1 
ATOM   6239  C  CG    . ASP B 1 177 ? 52.764  126.134 81.588  1.00 19.37 ? 177  ASP B CG    1 
ATOM   6240  O  OD1   . ASP B 1 177 ? 53.652  126.264 80.718  1.00 19.79 ? 177  ASP B OD1   1 
ATOM   6241  O  OD2   . ASP B 1 177 ? 52.308  127.092 82.248  1.00 17.86 ? 177  ASP B OD2   1 
ATOM   6242  N  N     . SER B 1 178 ? 51.071  123.754 79.027  1.00 19.87 ? 178  SER B N     1 
ATOM   6243  C  CA    . SER B 1 178 ? 51.177  123.881 77.577  1.00 19.48 ? 178  SER B CA    1 
ATOM   6244  C  C     . SER B 1 178 ? 49.890  123.566 76.845  1.00 19.68 ? 178  SER B C     1 
ATOM   6245  O  O     . SER B 1 178 ? 49.790  123.797 75.645  1.00 19.52 ? 178  SER B O     1 
ATOM   6246  C  CB    . SER B 1 178 ? 52.290  122.970 77.041  1.00 17.88 ? 178  SER B CB    1 
ATOM   6247  O  OG    . SER B 1 178 ? 51.953  121.601 77.205  1.00 15.17 ? 178  SER B OG    1 
ATOM   6248  N  N     . SER B 1 179 ? 48.902  123.047 77.567  1.00 21.53 ? 179  SER B N     1 
ATOM   6249  C  CA    . SER B 1 179 ? 47.634  122.679 76.947  1.00 21.90 ? 179  SER B CA    1 
ATOM   6250  C  C     . SER B 1 179 ? 47.896  121.677 75.824  1.00 21.16 ? 179  SER B C     1 
ATOM   6251  O  O     . SER B 1 179 ? 47.343  121.802 74.729  1.00 20.90 ? 179  SER B O     1 
ATOM   6252  C  CB    . SER B 1 179 ? 46.930  123.917 76.379  1.00 22.12 ? 179  SER B CB    1 
ATOM   6253  O  OG    . SER B 1 179 ? 46.305  124.664 77.404  1.00 23.87 ? 179  SER B OG    1 
ATOM   6254  N  N     . SER B 1 180 ? 48.751  120.694 76.090  1.00 19.50 ? 180  SER B N     1 
ATOM   6255  C  CA    . SER B 1 180 ? 49.071  119.675 75.094  1.00 21.17 ? 180  SER B CA    1 
ATOM   6256  C  C     . SER B 1 180 ? 47.781  119.022 74.623  1.00 21.18 ? 180  SER B C     1 
ATOM   6257  O  O     . SER B 1 180 ? 46.896  118.747 75.430  1.00 22.11 ? 180  SER B O     1 
ATOM   6258  C  CB    . SER B 1 180 ? 49.998  118.615 75.694  1.00 20.97 ? 180  SER B CB    1 
ATOM   6259  O  OG    . SER B 1 180 ? 51.254  119.175 76.032  1.00 23.69 ? 180  SER B OG    1 
ATOM   6260  N  N     . ARG B 1 181 ? 47.665  118.784 73.320  1.00 21.59 ? 181  ARG B N     1 
ATOM   6261  C  CA    . ARG B 1 181 ? 46.455  118.165 72.783  1.00 23.39 ? 181  ARG B CA    1 
ATOM   6262  C  C     . ARG B 1 181 ? 46.695  116.704 72.451  1.00 22.21 ? 181  ARG B C     1 
ATOM   6263  O  O     . ARG B 1 181 ? 45.787  115.999 72.008  1.00 22.92 ? 181  ARG B O     1 
ATOM   6264  C  CB    . ARG B 1 181 ? 45.979  118.898 71.523  1.00 25.15 ? 181  ARG B CB    1 
ATOM   6265  C  CG    . ARG B 1 181 ? 45.602  120.353 71.762  1.00 32.76 ? 181  ARG B CG    1 
ATOM   6266  C  CD    . ARG B 1 181 ? 44.665  120.886 70.684  1.00 38.45 ? 181  ARG B CD    1 
ATOM   6267  N  NE    . ARG B 1 181 ? 44.704  120.094 69.452  1.00 43.47 ? 181  ARG B NE    1 
ATOM   6268  C  CZ    . ARG B 1 181 ? 44.193  120.499 68.291  1.00 46.56 ? 181  ARG B CZ    1 
ATOM   6269  N  NH1   . ARG B 1 181 ? 43.605  121.690 68.197  1.00 47.45 ? 181  ARG B NH1   1 
ATOM   6270  N  NH2   . ARG B 1 181 ? 44.268  119.716 67.222  1.00 47.11 ? 181  ARG B NH2   1 
ATOM   6271  N  N     . LEU B 1 182 ? 47.927  116.259 72.672  1.00 21.23 ? 182  LEU B N     1 
ATOM   6272  C  CA    . LEU B 1 182 ? 48.306  114.883 72.394  1.00 19.56 ? 182  LEU B CA    1 
ATOM   6273  C  C     . LEU B 1 182 ? 49.531  114.492 73.205  1.00 18.80 ? 182  LEU B C     1 
ATOM   6274  O  O     . LEU B 1 182 ? 50.410  115.311 73.462  1.00 18.26 ? 182  LEU B O     1 
ATOM   6275  C  CB    . LEU B 1 182 ? 48.612  114.726 70.898  1.00 19.79 ? 182  LEU B CB    1 
ATOM   6276  C  CG    . LEU B 1 182 ? 49.139  113.392 70.357  1.00 18.56 ? 182  LEU B CG    1 
ATOM   6277  C  CD1   . LEU B 1 182 ? 48.082  112.321 70.504  1.00 21.19 ? 182  LEU B CD1   1 
ATOM   6278  C  CD2   . LEU B 1 182 ? 49.520  113.553 68.893  1.00 17.46 ? 182  LEU B CD2   1 
ATOM   6279  N  N     . VAL B 1 183 ? 49.566  113.237 73.627  1.00 17.12 ? 183  VAL B N     1 
ATOM   6280  C  CA    . VAL B 1 183 ? 50.703  112.720 74.364  1.00 16.16 ? 183  VAL B CA    1 
ATOM   6281  C  C     . VAL B 1 183 ? 51.220  111.513 73.593  1.00 17.55 ? 183  VAL B C     1 
ATOM   6282  O  O     . VAL B 1 183 ? 50.444  110.639 73.182  1.00 17.61 ? 183  VAL B O     1 
ATOM   6283  C  CB    . VAL B 1 183 ? 50.337  112.290 75.806  1.00 15.92 ? 183  VAL B CB    1 
ATOM   6284  C  CG1   . VAL B 1 183 ? 51.546  111.619 76.473  1.00 12.38 ? 183  VAL B CG1   1 
ATOM   6285  C  CG2   . VAL B 1 183 ? 49.916  113.506 76.617  1.00 12.20 ? 183  VAL B CG2   1 
ATOM   6286  N  N     . ILE B 1 184 ? 52.531  111.496 73.372  1.00 17.20 ? 184  ILE B N     1 
ATOM   6287  C  CA    . ILE B 1 184 ? 53.189  110.410 72.667  1.00 17.29 ? 184  ILE B CA    1 
ATOM   6288  C  C     . ILE B 1 184 ? 54.116  109.748 73.682  1.00 18.77 ? 184  ILE B C     1 
ATOM   6289  O  O     . ILE B 1 184 ? 55.071  110.364 74.152  1.00 21.13 ? 184  ILE B O     1 
ATOM   6290  C  CB    . ILE B 1 184 ? 54.018  110.936 71.481  1.00 16.67 ? 184  ILE B CB    1 
ATOM   6291  C  CG1   . ILE B 1 184 ? 53.127  111.750 70.535  1.00 17.68 ? 184  ILE B CG1   1 
ATOM   6292  C  CG2   . ILE B 1 184 ? 54.625  109.764 70.720  1.00 19.18 ? 184  ILE B CG2   1 
ATOM   6293  C  CD1   . ILE B 1 184 ? 53.878  112.385 69.384  1.00 16.23 ? 184  ILE B CD1   1 
ATOM   6294  N  N     . THR B 1 185 ? 53.822  108.499 74.025  1.00 17.73 ? 185  THR B N     1 
ATOM   6295  C  CA    . THR B 1 185 ? 54.612  107.768 75.012  1.00 16.54 ? 185  THR B CA    1 
ATOM   6296  C  C     . THR B 1 185 ? 54.729  106.295 74.615  1.00 17.33 ? 185  THR B C     1 
ATOM   6297  O  O     . THR B 1 185 ? 54.256  105.894 73.553  1.00 19.20 ? 185  THR B O     1 
ATOM   6298  C  CB    . THR B 1 185 ? 53.939  107.858 76.401  1.00 14.08 ? 185  THR B CB    1 
ATOM   6299  O  OG1   . THR B 1 185 ? 54.810  107.316 77.400  1.00 14.47 ? 185  THR B OG1   1 
ATOM   6300  C  CG2   . THR B 1 185 ? 52.632  107.074 76.406  1.00 9.61  ? 185  THR B CG2   1 
ATOM   6301  N  N     . ALA B 1 186 ? 55.370  105.495 75.460  1.00 14.50 ? 186  ALA B N     1 
ATOM   6302  C  CA    . ALA B 1 186 ? 55.513  104.066 75.193  1.00 15.72 ? 186  ALA B CA    1 
ATOM   6303  C  C     . ALA B 1 186 ? 54.965  103.322 76.412  1.00 14.64 ? 186  ALA B C     1 
ATOM   6304  O  O     . ALA B 1 186 ? 54.865  103.905 77.491  1.00 12.76 ? 186  ALA B O     1 
ATOM   6305  C  CB    . ALA B 1 186 ? 56.992  103.715 74.965  1.00 13.75 ? 186  ALA B CB    1 
ATOM   6306  N  N     . ASP B 1 187 ? 54.591  102.054 76.254  1.00 14.46 ? 187  ASP B N     1 
ATOM   6307  C  CA    . ASP B 1 187 ? 54.096  101.307 77.404  1.00 15.25 ? 187  ASP B CA    1 
ATOM   6308  C  C     . ASP B 1 187 ? 55.159  101.382 78.502  1.00 16.62 ? 187  ASP B C     1 
ATOM   6309  O  O     . ASP B 1 187 ? 54.853  101.726 79.645  1.00 18.49 ? 187  ASP B O     1 
ATOM   6310  C  CB    . ASP B 1 187 ? 53.791  99.846  77.037  1.00 14.83 ? 187  ASP B CB    1 
ATOM   6311  C  CG    . ASP B 1 187 ? 54.801  99.258  76.070  1.00 16.32 ? 187  ASP B CG    1 
ATOM   6312  O  OD1   . ASP B 1 187 ? 55.987  99.643  76.130  1.00 14.72 ? 187  ASP B OD1   1 
ATOM   6313  O  OD2   . ASP B 1 187 ? 54.411  98.393  75.256  1.00 18.06 ? 187  ASP B OD2   1 
ATOM   6314  N  N     . GLU B 1 188 ? 56.408  101.075 78.161  1.00 17.04 ? 188  GLU B N     1 
ATOM   6315  C  CA    . GLU B 1 188 ? 57.512  101.158 79.122  1.00 17.88 ? 188  GLU B CA    1 
ATOM   6316  C  C     . GLU B 1 188 ? 58.831  101.439 78.413  1.00 18.45 ? 188  GLU B C     1 
ATOM   6317  O  O     . GLU B 1 188 ? 58.976  101.155 77.224  1.00 18.33 ? 188  GLU B O     1 
ATOM   6318  C  CB    . GLU B 1 188 ? 57.692  99.862  79.914  1.00 15.93 ? 188  GLU B CB    1 
ATOM   6319  C  CG    . GLU B 1 188 ? 56.484  99.353  80.645  1.00 17.58 ? 188  GLU B CG    1 
ATOM   6320  C  CD    . GLU B 1 188 ? 56.792  98.063  81.387  1.00 18.19 ? 188  GLU B CD    1 
ATOM   6321  O  OE1   . GLU B 1 188 ? 57.501  97.204  80.810  1.00 12.67 ? 188  GLU B OE1   1 
ATOM   6322  O  OE2   . GLU B 1 188 ? 56.325  97.911  82.539  1.00 19.65 ? 188  GLU B OE2   1 
ATOM   6323  N  N     . GLY B 1 189 ? 59.783  101.994 79.161  1.00 18.20 ? 189  GLY B N     1 
ATOM   6324  C  CA    . GLY B 1 189 ? 61.099  102.278 78.627  1.00 19.70 ? 189  GLY B CA    1 
ATOM   6325  C  C     . GLY B 1 189 ? 62.038  101.208 79.150  1.00 20.64 ? 189  GLY B C     1 
ATOM   6326  O  O     . GLY B 1 189 ? 61.750  100.574 80.163  1.00 22.66 ? 189  GLY B O     1 
ATOM   6327  N  N     . VAL B 1 190 ? 63.150  100.987 78.462  1.00 21.63 ? 190  VAL B N     1 
ATOM   6328  C  CA    . VAL B 1 190 ? 64.115  99.970  78.878  1.00 22.24 ? 190  VAL B CA    1 
ATOM   6329  C  C     . VAL B 1 190 ? 65.441  100.650 79.179  1.00 22.36 ? 190  VAL B C     1 
ATOM   6330  O  O     . VAL B 1 190 ? 66.039  101.277 78.302  1.00 22.12 ? 190  VAL B O     1 
ATOM   6331  C  CB    . VAL B 1 190 ? 64.310  98.913  77.773  1.00 22.27 ? 190  VAL B CB    1 
ATOM   6332  C  CG1   . VAL B 1 190 ? 65.181  97.767  78.283  1.00 20.56 ? 190  VAL B CG1   1 
ATOM   6333  C  CG2   . VAL B 1 190 ? 62.955  98.401  77.313  1.00 22.79 ? 190  VAL B CG2   1 
ATOM   6334  N  N     . ARG B 1 191 ? 65.894  100.527 80.424  1.00 23.16 ? 191  ARG B N     1 
ATOM   6335  C  CA    . ARG B 1 191 ? 67.136  101.160 80.854  1.00 23.04 ? 191  ARG B CA    1 
ATOM   6336  C  C     . ARG B 1 191 ? 67.863  100.344 81.919  1.00 22.19 ? 191  ARG B C     1 
ATOM   6337  O  O     . ARG B 1 191 ? 67.363  100.173 83.023  1.00 22.36 ? 191  ARG B O     1 
ATOM   6338  C  CB    . ARG B 1 191 ? 66.815  102.556 81.394  1.00 24.43 ? 191  ARG B CB    1 
ATOM   6339  C  CG    . ARG B 1 191 ? 67.985  103.334 81.949  1.00 25.13 ? 191  ARG B CG    1 
ATOM   6340  C  CD    . ARG B 1 191 ? 67.532  104.742 82.338  1.00 28.43 ? 191  ARG B CD    1 
ATOM   6341  N  NE    . ARG B 1 191 ? 68.584  105.516 82.989  1.00 29.80 ? 191  ARG B NE    1 
ATOM   6342  C  CZ    . ARG B 1 191 ? 69.006  105.305 84.233  1.00 32.23 ? 191  ARG B CZ    1 
ATOM   6343  N  NH1   . ARG B 1 191 ? 68.465  104.342 84.970  1.00 32.86 ? 191  ARG B NH1   1 
ATOM   6344  N  NH2   . ARG B 1 191 ? 69.969  106.062 84.745  1.00 34.22 ? 191  ARG B NH2   1 
ATOM   6345  N  N     . ALA B 1 192 ? 69.043  99.844  81.579  1.00 21.78 ? 192  ALA B N     1 
ATOM   6346  C  CA    . ALA B 1 192 ? 69.836  99.051  82.507  1.00 22.86 ? 192  ALA B CA    1 
ATOM   6347  C  C     . ALA B 1 192 ? 69.118  97.766  82.910  1.00 23.63 ? 192  ALA B C     1 
ATOM   6348  O  O     . ALA B 1 192 ? 68.966  97.479  84.092  1.00 24.09 ? 192  ALA B O     1 
ATOM   6349  C  CB    . ALA B 1 192 ? 70.172  99.883  83.751  1.00 22.07 ? 192  ALA B CB    1 
ATOM   6350  N  N     . GLY B 1 193 ? 68.680  96.999  81.916  1.00 24.38 ? 193  GLY B N     1 
ATOM   6351  C  CA    . GLY B 1 193 ? 67.991  95.749  82.181  1.00 24.82 ? 193  GLY B CA    1 
ATOM   6352  C  C     . GLY B 1 193 ? 66.720  95.887  82.995  1.00 25.88 ? 193  GLY B C     1 
ATOM   6353  O  O     . GLY B 1 193 ? 66.145  94.891  83.438  1.00 27.12 ? 193  GLY B O     1 
ATOM   6354  N  N     . ARG B 1 194 ? 66.280  97.123  83.191  1.00 26.26 ? 194  ARG B N     1 
ATOM   6355  C  CA    . ARG B 1 194 ? 65.074  97.386  83.961  1.00 28.21 ? 194  ARG B CA    1 
ATOM   6356  C  C     . ARG B 1 194 ? 64.022  98.101  83.127  1.00 27.90 ? 194  ARG B C     1 
ATOM   6357  O  O     . ARG B 1 194 ? 64.337  99.031  82.391  1.00 28.51 ? 194  ARG B O     1 
ATOM   6358  C  CB    . ARG B 1 194 ? 65.396  98.256  85.180  1.00 30.87 ? 194  ARG B CB    1 
ATOM   6359  C  CG    . ARG B 1 194 ? 66.093  97.560  86.343  1.00 33.60 ? 194  ARG B CG    1 
ATOM   6360  C  CD    . ARG B 1 194 ? 66.311  98.568  87.459  1.00 36.33 ? 194  ARG B CD    1 
ATOM   6361  N  NE    . ARG B 1 194 ? 65.068  99.270  87.779  1.00 40.46 ? 194  ARG B NE    1 
ATOM   6362  C  CZ    . ARG B 1 194 ? 64.993  100.392 88.493  1.00 43.00 ? 194  ARG B CZ    1 
ATOM   6363  N  NH1   . ARG B 1 194 ? 66.096  100.964 88.974  1.00 42.91 ? 194  ARG B NH1   1 
ATOM   6364  N  NH2   . ARG B 1 194 ? 63.809  100.942 88.732  1.00 43.32 ? 194  ARG B NH2   1 
ATOM   6365  N  N     . SER B 1 195 ? 62.771  97.673  83.251  1.00 27.02 ? 195  SER B N     1 
ATOM   6366  C  CA    . SER B 1 195 ? 61.678  98.310  82.523  1.00 26.97 ? 195  SER B CA    1 
ATOM   6367  C  C     . SER B 1 195 ? 61.136  99.445  83.377  1.00 26.63 ? 195  SER B C     1 
ATOM   6368  O  O     . SER B 1 195 ? 60.977  99.298  84.589  1.00 28.43 ? 195  SER B O     1 
ATOM   6369  C  CB    . SER B 1 195 ? 60.562  97.308  82.230  1.00 25.86 ? 195  SER B CB    1 
ATOM   6370  O  OG    . SER B 1 195 ? 60.950  96.406  81.209  1.00 26.09 ? 195  SER B OG    1 
ATOM   6371  N  N     . ILE B 1 196 ? 60.864  100.580 82.748  1.00 25.04 ? 196  ILE B N     1 
ATOM   6372  C  CA    . ILE B 1 196 ? 60.348  101.730 83.473  1.00 26.40 ? 196  ILE B CA    1 
ATOM   6373  C  C     . ILE B 1 196 ? 58.985  102.133 82.938  1.00 26.26 ? 196  ILE B C     1 
ATOM   6374  O  O     . ILE B 1 196 ? 58.826  102.365 81.744  1.00 25.95 ? 196  ILE B O     1 
ATOM   6375  C  CB    . ILE B 1 196 ? 61.311  102.931 83.367  1.00 28.13 ? 196  ILE B CB    1 
ATOM   6376  C  CG1   . ILE B 1 196 ? 62.635  102.585 84.048  1.00 30.53 ? 196  ILE B CG1   1 
ATOM   6377  C  CG2   . ILE B 1 196 ? 60.690  104.162 84.005  1.00 29.39 ? 196  ILE B CG2   1 
ATOM   6378  C  CD1   . ILE B 1 196 ? 63.630  103.722 84.068  1.00 31.49 ? 196  ILE B CD1   1 
ATOM   6379  N  N     . PRO B 1 197 ? 57.980  102.222 83.822  1.00 26.93 ? 197  PRO B N     1 
ATOM   6380  C  CA    . PRO B 1 197 ? 56.625  102.601 83.416  1.00 26.04 ? 197  PRO B CA    1 
ATOM   6381  C  C     . PRO B 1 197 ? 56.607  104.001 82.819  1.00 26.45 ? 197  PRO B C     1 
ATOM   6382  O  O     . PRO B 1 197 ? 57.298  104.903 83.301  1.00 29.56 ? 197  PRO B O     1 
ATOM   6383  C  CB    . PRO B 1 197 ? 55.842  102.513 84.724  1.00 26.03 ? 197  PRO B CB    1 
ATOM   6384  C  CG    . PRO B 1 197 ? 56.865  102.922 85.742  1.00 27.35 ? 197  PRO B CG    1 
ATOM   6385  C  CD    . PRO B 1 197 ? 58.074  102.121 85.290  1.00 27.96 ? 197  PRO B CD    1 
ATOM   6386  N  N     . LEU B 1 198 ? 55.834  104.166 81.753  1.00 24.90 ? 198  LEU B N     1 
ATOM   6387  C  CA    . LEU B 1 198 ? 55.701  105.460 81.097  1.00 22.66 ? 198  LEU B CA    1 
ATOM   6388  C  C     . LEU B 1 198 ? 54.229  105.709 80.827  1.00 21.50 ? 198  LEU B C     1 
ATOM   6389  O  O     . LEU B 1 198 ? 53.702  106.761 81.172  1.00 20.79 ? 198  LEU B O     1 
ATOM   6390  C  CB    . LEU B 1 198 ? 56.495  105.499 79.786  1.00 22.69 ? 198  LEU B CB    1 
ATOM   6391  C  CG    . LEU B 1 198 ? 58.022  105.495 79.919  1.00 24.02 ? 198  LEU B CG    1 
ATOM   6392  C  CD1   . LEU B 1 198 ? 58.663  105.552 78.541  1.00 23.70 ? 198  LEU B CD1   1 
ATOM   6393  C  CD2   . LEU B 1 198 ? 58.462  106.680 80.757  1.00 22.33 ? 198  LEU B CD2   1 
ATOM   6394  N  N     . LYS B 1 199 ? 53.567  104.727 80.223  1.00 20.59 ? 199  LYS B N     1 
ATOM   6395  C  CA    . LYS B 1 199 ? 52.146  104.833 79.914  1.00 20.81 ? 199  LYS B CA    1 
ATOM   6396  C  C     . LYS B 1 199 ? 51.329  105.010 81.199  1.00 19.11 ? 199  LYS B C     1 
ATOM   6397  O  O     . LYS B 1 199 ? 50.473  105.890 81.281  1.00 18.04 ? 199  LYS B O     1 
ATOM   6398  C  CB    . LYS B 1 199 ? 51.691  103.579 79.153  1.00 22.63 ? 199  LYS B CB    1 
ATOM   6399  C  CG    . LYS B 1 199 ? 50.173  103.373 79.063  1.00 24.94 ? 199  LYS B CG    1 
ATOM   6400  C  CD    . LYS B 1 199 ? 49.512  104.381 78.156  1.00 24.82 ? 199  LYS B CD    1 
ATOM   6401  C  CE    . LYS B 1 199 ? 48.133  103.911 77.706  1.00 21.98 ? 199  LYS B CE    1 
ATOM   6402  N  NZ    . LYS B 1 199 ? 47.126  103.916 78.792  1.00 19.59 ? 199  LYS B NZ    1 
ATOM   6403  N  N     . LYS B 1 200 ? 51.606  104.174 82.197  1.00 17.90 ? 200  LYS B N     1 
ATOM   6404  C  CA    . LYS B 1 200 ? 50.914  104.229 83.478  1.00 16.71 ? 200  LYS B CA    1 
ATOM   6405  C  C     . LYS B 1 200 ? 51.036  105.616 84.121  1.00 16.91 ? 200  LYS B C     1 
ATOM   6406  O  O     . LYS B 1 200 ? 50.080  106.125 84.700  1.00 16.58 ? 200  LYS B O     1 
ATOM   6407  C  CB    . LYS B 1 200 ? 51.485  103.167 84.421  1.00 19.13 ? 200  LYS B CB    1 
ATOM   6408  C  CG    . LYS B 1 200 ? 50.816  103.124 85.780  1.00 19.27 ? 200  LYS B CG    1 
ATOM   6409  C  CD    . LYS B 1 200 ? 51.537  102.168 86.713  1.00 22.54 ? 200  LYS B CD    1 
ATOM   6410  C  CE    . LYS B 1 200 ? 50.916  102.187 88.107  1.00 24.15 ? 200  LYS B CE    1 
ATOM   6411  N  NZ    . LYS B 1 200 ? 49.473  101.808 88.058  1.00 23.80 ? 200  LYS B NZ    1 
ATOM   6412  N  N     . ASN B 1 201 ? 52.221  106.217 84.031  1.00 16.13 ? 201  ASN B N     1 
ATOM   6413  C  CA    . ASN B 1 201 ? 52.444  107.548 84.579  1.00 15.89 ? 201  ASN B CA    1 
ATOM   6414  C  C     . ASN B 1 201 ? 51.573  108.547 83.820  1.00 16.09 ? 201  ASN B C     1 
ATOM   6415  O  O     . ASN B 1 201 ? 51.016  109.468 84.409  1.00 16.51 ? 201  ASN B O     1 
ATOM   6416  C  CB    . ASN B 1 201 ? 53.913  107.953 84.441  1.00 15.61 ? 201  ASN B CB    1 
ATOM   6417  C  CG    . ASN B 1 201 ? 54.817  107.227 85.421  1.00 15.94 ? 201  ASN B CG    1 
ATOM   6418  O  OD1   . ASN B 1 201 ? 54.346  106.485 86.285  1.00 15.90 ? 201  ASN B OD1   1 
ATOM   6419  N  ND2   . ASN B 1 201 ? 56.123  107.441 85.292  1.00 12.48 ? 201  ASN B ND2   1 
ATOM   6420  N  N     . VAL B 1 202 ? 51.465  108.358 82.509  1.00 14.98 ? 202  VAL B N     1 
ATOM   6421  C  CA    . VAL B 1 202 ? 50.650  109.238 81.684  1.00 16.37 ? 202  VAL B CA    1 
ATOM   6422  C  C     . VAL B 1 202 ? 49.198  109.109 82.133  1.00 17.63 ? 202  VAL B C     1 
ATOM   6423  O  O     . VAL B 1 202 ? 48.501  110.108 82.282  1.00 18.30 ? 202  VAL B O     1 
ATOM   6424  C  CB    . VAL B 1 202 ? 50.760  108.867 80.182  1.00 17.04 ? 202  VAL B CB    1 
ATOM   6425  C  CG1   . VAL B 1 202 ? 49.829  109.739 79.351  1.00 17.96 ? 202  VAL B CG1   1 
ATOM   6426  C  CG2   . VAL B 1 202 ? 52.192  109.035 79.711  1.00 15.32 ? 202  VAL B CG2   1 
ATOM   6427  N  N     . ASP B 1 203 ? 48.747  107.876 82.354  1.00 18.18 ? 203  ASP B N     1 
ATOM   6428  C  CA    . ASP B 1 203 ? 47.378  107.646 82.805  1.00 19.30 ? 203  ASP B CA    1 
ATOM   6429  C  C     . ASP B 1 203 ? 47.146  108.383 84.115  1.00 19.02 ? 203  ASP B C     1 
ATOM   6430  O  O     . ASP B 1 203 ? 46.144  109.073 84.292  1.00 19.53 ? 203  ASP B O     1 
ATOM   6431  C  CB    . ASP B 1 203 ? 47.106  106.153 83.045  1.00 21.40 ? 203  ASP B CB    1 
ATOM   6432  C  CG    . ASP B 1 203 ? 47.037  105.344 81.762  1.00 22.32 ? 203  ASP B CG    1 
ATOM   6433  O  OD1   . ASP B 1 203 ? 46.494  105.840 80.753  1.00 22.96 ? 203  ASP B OD1   1 
ATOM   6434  O  OD2   . ASP B 1 203 ? 47.509  104.192 81.776  1.00 24.83 ? 203  ASP B OD2   1 
ATOM   6435  N  N     . ASP B 1 204 ? 48.081  108.224 85.041  1.00 18.04 ? 204  ASP B N     1 
ATOM   6436  C  CA    . ASP B 1 204 ? 47.956  108.861 86.335  1.00 17.98 ? 204  ASP B CA    1 
ATOM   6437  C  C     . ASP B 1 204 ? 47.979  110.374 86.214  1.00 17.83 ? 204  ASP B C     1 
ATOM   6438  O  O     . ASP B 1 204 ? 47.349  111.077 87.000  1.00 17.93 ? 204  ASP B O     1 
ATOM   6439  C  CB    . ASP B 1 204 ? 49.073  108.373 87.258  1.00 16.06 ? 204  ASP B CB    1 
ATOM   6440  C  CG    . ASP B 1 204 ? 48.893  106.924 87.664  1.00 17.60 ? 204  ASP B CG    1 
ATOM   6441  O  OD1   . ASP B 1 204 ? 49.825  106.346 88.267  1.00 17.94 ? 204  ASP B OD1   1 
ATOM   6442  O  OD2   . ASP B 1 204 ? 47.809  106.362 87.383  1.00 18.82 ? 204  ASP B OD2   1 
ATOM   6443  N  N     . ALA B 1 205 ? 48.692  110.872 85.214  1.00 18.58 ? 205  ALA B N     1 
ATOM   6444  C  CA    . ALA B 1 205 ? 48.798  112.305 85.015  1.00 19.94 ? 205  ALA B CA    1 
ATOM   6445  C  C     . ALA B 1 205 ? 47.494  112.884 84.480  1.00 21.01 ? 205  ALA B C     1 
ATOM   6446  O  O     . ALA B 1 205 ? 47.057  113.952 84.914  1.00 20.77 ? 205  ALA B O     1 
ATOM   6447  C  CB    . ALA B 1 205 ? 49.952  112.613 84.055  1.00 18.95 ? 205  ALA B CB    1 
ATOM   6448  N  N     . LEU B 1 206 ? 46.862  112.174 83.550  1.00 21.54 ? 206  LEU B N     1 
ATOM   6449  C  CA    . LEU B 1 206 ? 45.617  112.656 82.962  1.00 23.73 ? 206  LEU B CA    1 
ATOM   6450  C  C     . LEU B 1 206 ? 44.397  112.547 83.889  1.00 24.07 ? 206  LEU B C     1 
ATOM   6451  O  O     . LEU B 1 206 ? 43.309  113.028 83.558  1.00 23.97 ? 206  LEU B O     1 
ATOM   6452  C  CB    . LEU B 1 206 ? 45.341  111.936 81.633  1.00 23.00 ? 206  LEU B CB    1 
ATOM   6453  C  CG    . LEU B 1 206 ? 46.395  112.115 80.530  1.00 25.09 ? 206  LEU B CG    1 
ATOM   6454  C  CD1   . LEU B 1 206 ? 45.873  111.523 79.231  1.00 26.91 ? 206  LEU B CD1   1 
ATOM   6455  C  CD2   . LEU B 1 206 ? 46.718  113.580 80.326  1.00 26.27 ? 206  LEU B CD2   1 
ATOM   6456  N  N     . LYS B 1 207 ? 44.568  111.908 85.042  1.00 24.74 ? 207  LYS B N     1 
ATOM   6457  C  CA    . LYS B 1 207 ? 43.465  111.791 85.994  1.00 26.33 ? 207  LYS B CA    1 
ATOM   6458  C  C     . LYS B 1 207 ? 43.323  113.129 86.725  1.00 26.34 ? 207  LYS B C     1 
ATOM   6459  O  O     . LYS B 1 207 ? 42.332  113.384 87.408  1.00 25.42 ? 207  LYS B O     1 
ATOM   6460  C  CB    . LYS B 1 207 ? 43.728  110.666 87.000  1.00 26.79 ? 207  LYS B CB    1 
ATOM   6461  C  CG    . LYS B 1 207 ? 43.723  109.267 86.400  1.00 26.33 ? 207  LYS B CG    1 
ATOM   6462  C  CD    . LYS B 1 207 ? 44.106  108.242 87.450  1.00 28.20 ? 207  LYS B CD    1 
ATOM   6463  C  CE    . LYS B 1 207 ? 44.368  106.875 86.842  1.00 29.34 ? 207  LYS B CE    1 
ATOM   6464  N  NZ    . LYS B 1 207 ? 44.877  105.928 87.871  1.00 30.69 ? 207  LYS B NZ    1 
ATOM   6465  N  N     . ASN B 1 208 ? 44.331  113.983 86.569  1.00 27.48 ? 208  ASN B N     1 
ATOM   6466  C  CA    . ASN B 1 208 ? 44.319  115.299 87.185  1.00 27.70 ? 208  ASN B CA    1 
ATOM   6467  C  C     . ASN B 1 208 ? 43.162  116.075 86.557  1.00 29.30 ? 208  ASN B C     1 
ATOM   6468  O  O     . ASN B 1 208 ? 43.132  116.288 85.349  1.00 28.81 ? 208  ASN B O     1 
ATOM   6469  C  CB    . ASN B 1 208 ? 45.641  116.013 86.916  1.00 26.04 ? 208  ASN B CB    1 
ATOM   6470  C  CG    . ASN B 1 208 ? 45.739  117.339 87.636  1.00 26.64 ? 208  ASN B CG    1 
ATOM   6471  O  OD1   . ASN B 1 208 ? 44.885  118.213 87.475  1.00 26.12 ? 208  ASN B OD1   1 
ATOM   6472  N  ND2   . ASN B 1 208 ? 46.786  117.498 88.438  1.00 25.38 ? 208  ASN B ND2   1 
ATOM   6473  N  N     . PRO B 1 209 ? 42.193  116.511 87.375  1.00 30.65 ? 209  PRO B N     1 
ATOM   6474  C  CA    . PRO B 1 209 ? 41.027  117.260 86.894  1.00 31.31 ? 209  PRO B CA    1 
ATOM   6475  C  C     . PRO B 1 209 ? 41.360  118.510 86.081  1.00 32.47 ? 209  PRO B C     1 
ATOM   6476  O  O     . PRO B 1 209 ? 40.515  119.011 85.336  1.00 34.16 ? 209  PRO B O     1 
ATOM   6477  C  CB    . PRO B 1 209 ? 40.274  117.584 88.184  1.00 30.40 ? 209  PRO B CB    1 
ATOM   6478  C  CG    . PRO B 1 209 ? 41.377  117.735 89.178  1.00 30.49 ? 209  PRO B CG    1 
ATOM   6479  C  CD    . PRO B 1 209 ? 42.255  116.542 88.846  1.00 31.33 ? 209  PRO B CD    1 
ATOM   6480  N  N     . ASN B 1 210 ? 42.589  119.003 86.216  1.00 32.16 ? 210  ASN B N     1 
ATOM   6481  C  CA    . ASN B 1 210 ? 43.015  120.200 85.496  1.00 31.32 ? 210  ASN B CA    1 
ATOM   6482  C  C     . ASN B 1 210 ? 43.467  119.901 84.071  1.00 30.71 ? 210  ASN B C     1 
ATOM   6483  O  O     . ASN B 1 210 ? 43.563  120.808 83.242  1.00 30.60 ? 210  ASN B O     1 
ATOM   6484  C  CB    . ASN B 1 210 ? 44.148  120.893 86.254  1.00 31.05 ? 210  ASN B CB    1 
ATOM   6485  C  CG    . ASN B 1 210 ? 43.732  121.335 87.634  1.00 29.71 ? 210  ASN B CG    1 
ATOM   6486  O  OD1   . ASN B 1 210 ? 43.151  122.402 87.808  1.00 29.40 ? 210  ASN B OD1   1 
ATOM   6487  N  ND2   . ASN B 1 210 ? 44.016  120.505 88.628  1.00 30.16 ? 210  ASN B ND2   1 
ATOM   6488  N  N     . VAL B 1 211 ? 43.762  118.637 83.786  1.00 29.09 ? 211  VAL B N     1 
ATOM   6489  C  CA    . VAL B 1 211 ? 44.177  118.268 82.440  1.00 28.40 ? 211  VAL B CA    1 
ATOM   6490  C  C     . VAL B 1 211 ? 42.912  118.063 81.623  1.00 27.70 ? 211  VAL B C     1 
ATOM   6491  O  O     . VAL B 1 211 ? 42.148  117.130 81.863  1.00 27.50 ? 211  VAL B O     1 
ATOM   6492  C  CB    . VAL B 1 211 ? 45.018  116.972 82.424  1.00 28.21 ? 211  VAL B CB    1 
ATOM   6493  C  CG1   . VAL B 1 211 ? 45.333  116.574 80.983  1.00 27.09 ? 211  VAL B CG1   1 
ATOM   6494  C  CG2   . VAL B 1 211 ? 46.306  117.183 83.207  1.00 26.38 ? 211  VAL B CG2   1 
ATOM   6495  N  N     . THR B 1 212 ? 42.694  118.947 80.658  1.00 28.12 ? 212  THR B N     1 
ATOM   6496  C  CA    . THR B 1 212 ? 41.502  118.879 79.829  1.00 27.58 ? 212  THR B CA    1 
ATOM   6497  C  C     . THR B 1 212 ? 41.784  119.049 78.339  1.00 27.48 ? 212  THR B C     1 
ATOM   6498  O  O     . THR B 1 212 ? 40.858  119.028 77.530  1.00 28.87 ? 212  THR B O     1 
ATOM   6499  C  CB    . THR B 1 212 ? 40.499  119.976 80.249  1.00 29.17 ? 212  THR B CB    1 
ATOM   6500  O  OG1   . THR B 1 212 ? 41.051  121.266 79.949  1.00 27.92 ? 212  THR B OG1   1 
ATOM   6501  C  CG2   . THR B 1 212 ? 40.217  119.899 81.751  1.00 28.52 ? 212  THR B CG2   1 
ATOM   6502  N  N     . SER B 1 213 ? 43.052  119.208 77.971  1.00 25.41 ? 213  SER B N     1 
ATOM   6503  C  CA    . SER B 1 213 ? 43.399  119.413 76.567  1.00 23.85 ? 213  SER B CA    1 
ATOM   6504  C  C     . SER B 1 213 ? 43.798  118.165 75.775  1.00 22.68 ? 213  SER B C     1 
ATOM   6505  O  O     . SER B 1 213 ? 43.733  118.167 74.548  1.00 22.69 ? 213  SER B O     1 
ATOM   6506  C  CB    . SER B 1 213 ? 44.515  120.461 76.460  1.00 22.75 ? 213  SER B CB    1 
ATOM   6507  O  OG    . SER B 1 213 ? 45.659  120.065 77.193  1.00 22.64 ? 213  SER B OG    1 
ATOM   6508  N  N     . VAL B 1 214 ? 44.211  117.109 76.466  1.00 22.33 ? 214  VAL B N     1 
ATOM   6509  C  CA    . VAL B 1 214 ? 44.630  115.877 75.800  1.00 23.88 ? 214  VAL B CA    1 
ATOM   6510  C  C     . VAL B 1 214 ? 43.455  115.131 75.148  1.00 23.97 ? 214  VAL B C     1 
ATOM   6511  O  O     . VAL B 1 214 ? 42.519  114.698 75.826  1.00 22.57 ? 214  VAL B O     1 
ATOM   6512  C  CB    . VAL B 1 214 ? 45.346  114.922 76.795  1.00 23.93 ? 214  VAL B CB    1 
ATOM   6513  C  CG1   . VAL B 1 214 ? 45.878  113.709 76.050  1.00 22.69 ? 214  VAL B CG1   1 
ATOM   6514  C  CG2   . VAL B 1 214 ? 46.477  115.659 77.519  1.00 22.71 ? 214  VAL B CG2   1 
ATOM   6515  N  N     . GLU B 1 215 ? 43.517  114.976 73.829  1.00 24.19 ? 215  GLU B N     1 
ATOM   6516  C  CA    . GLU B 1 215 ? 42.455  114.302 73.095  1.00 23.92 ? 215  GLU B CA    1 
ATOM   6517  C  C     . GLU B 1 215 ? 42.833  112.881 72.697  1.00 23.99 ? 215  GLU B C     1 
ATOM   6518  O  O     . GLU B 1 215 ? 41.964  112.027 72.505  1.00 25.31 ? 215  GLU B O     1 
ATOM   6519  C  CB    . GLU B 1 215 ? 42.097  115.121 71.857  1.00 25.12 ? 215  GLU B CB    1 
ATOM   6520  C  CG    . GLU B 1 215 ? 41.804  116.581 72.193  1.00 28.84 ? 215  GLU B CG    1 
ATOM   6521  C  CD    . GLU B 1 215 ? 41.685  117.467 70.967  1.00 31.31 ? 215  GLU B CD    1 
ATOM   6522  O  OE1   . GLU B 1 215 ? 41.745  118.707 71.123  1.00 33.73 ? 215  GLU B OE1   1 
ATOM   6523  O  OE2   . GLU B 1 215 ? 41.531  116.926 69.850  1.00 32.73 ? 215  GLU B OE2   1 
ATOM   6524  N  N     . HIS B 1 216 ? 44.130  112.625 72.588  1.00 24.17 ? 216  HIS B N     1 
ATOM   6525  C  CA    . HIS B 1 216 ? 44.611  111.305 72.207  1.00 23.74 ? 216  HIS B CA    1 
ATOM   6526  C  C     . HIS B 1 216 ? 45.990  111.021 72.794  1.00 23.07 ? 216  HIS B C     1 
ATOM   6527  O  O     . HIS B 1 216 ? 46.761  111.936 73.083  1.00 24.06 ? 216  HIS B O     1 
ATOM   6528  C  CB    . HIS B 1 216 ? 44.671  111.182 70.676  1.00 26.19 ? 216  HIS B CB    1 
ATOM   6529  C  CG    . HIS B 1 216 ? 43.328  111.143 70.013  1.00 28.00 ? 216  HIS B CG    1 
ATOM   6530  N  ND1   . HIS B 1 216 ? 42.517  110.027 70.033  1.00 28.20 ? 216  HIS B ND1   1 
ATOM   6531  C  CD2   . HIS B 1 216 ? 42.641  112.094 69.336  1.00 29.09 ? 216  HIS B CD2   1 
ATOM   6532  C  CE1   . HIS B 1 216 ? 41.388  110.294 69.400  1.00 29.24 ? 216  HIS B CE1   1 
ATOM   6533  N  NE2   . HIS B 1 216 ? 41.437  111.542 68.970  1.00 28.33 ? 216  HIS B NE2   1 
ATOM   6534  N  N     . VAL B 1 217 ? 46.281  109.739 72.977  1.00 20.90 ? 217  VAL B N     1 
ATOM   6535  C  CA    . VAL B 1 217 ? 47.568  109.294 73.497  1.00 19.66 ? 217  VAL B CA    1 
ATOM   6536  C  C     . VAL B 1 217 ? 48.083  108.186 72.584  1.00 18.36 ? 217  VAL B C     1 
ATOM   6537  O  O     . VAL B 1 217 ? 47.520  107.095 72.561  1.00 20.98 ? 217  VAL B O     1 
ATOM   6538  C  CB    . VAL B 1 217 ? 47.448  108.709 74.926  1.00 19.09 ? 217  VAL B CB    1 
ATOM   6539  C  CG1   . VAL B 1 217 ? 48.789  108.168 75.371  1.00 15.82 ? 217  VAL B CG1   1 
ATOM   6540  C  CG2   . VAL B 1 217 ? 46.954  109.763 75.896  1.00 18.27 ? 217  VAL B CG2   1 
ATOM   6541  N  N     . ILE B 1 218 ? 49.132  108.467 71.819  1.00 17.55 ? 218  ILE B N     1 
ATOM   6542  C  CA    . ILE B 1 218 ? 49.706  107.457 70.936  1.00 15.94 ? 218  ILE B CA    1 
ATOM   6543  C  C     . ILE B 1 218 ? 50.690  106.652 71.780  1.00 16.79 ? 218  ILE B C     1 
ATOM   6544  O  O     . ILE B 1 218 ? 51.594  107.216 72.402  1.00 17.08 ? 218  ILE B O     1 
ATOM   6545  C  CB    . ILE B 1 218 ? 50.445  108.104 69.741  1.00 14.23 ? 218  ILE B CB    1 
ATOM   6546  C  CG1   . ILE B 1 218 ? 49.445  108.848 68.849  1.00 12.97 ? 218  ILE B CG1   1 
ATOM   6547  C  CG2   . ILE B 1 218 ? 51.175  107.038 68.945  1.00 12.37 ? 218  ILE B CG2   1 
ATOM   6548  C  CD1   . ILE B 1 218 ? 50.099  109.723 67.786  1.00 12.33 ? 218  ILE B CD1   1 
ATOM   6549  N  N     . VAL B 1 219 ? 50.510  105.337 71.813  1.00 16.34 ? 219  VAL B N     1 
ATOM   6550  C  CA    . VAL B 1 219 ? 51.374  104.486 72.618  1.00 15.03 ? 219  VAL B CA    1 
ATOM   6551  C  C     . VAL B 1 219 ? 52.226  103.533 71.788  1.00 17.14 ? 219  VAL B C     1 
ATOM   6552  O  O     . VAL B 1 219 ? 51.715  102.805 70.936  1.00 18.36 ? 219  VAL B O     1 
ATOM   6553  C  CB    . VAL B 1 219 ? 50.540  103.643 73.614  1.00 16.37 ? 219  VAL B CB    1 
ATOM   6554  C  CG1   . VAL B 1 219 ? 51.449  103.009 74.659  1.00 13.42 ? 219  VAL B CG1   1 
ATOM   6555  C  CG2   . VAL B 1 219 ? 49.473  104.516 74.270  1.00 17.14 ? 219  VAL B CG2   1 
ATOM   6556  N  N     . LEU B 1 220 ? 53.530  103.547 72.040  1.00 16.61 ? 220  LEU B N     1 
ATOM   6557  C  CA    . LEU B 1 220 ? 54.451  102.662 71.341  1.00 18.12 ? 220  LEU B CA    1 
ATOM   6558  C  C     . LEU B 1 220 ? 54.656  101.400 72.178  1.00 19.30 ? 220  LEU B C     1 
ATOM   6559  O  O     . LEU B 1 220 ? 54.982  101.489 73.365  1.00 19.76 ? 220  LEU B O     1 
ATOM   6560  C  CB    . LEU B 1 220 ? 55.807  103.349 71.151  1.00 17.25 ? 220  LEU B CB    1 
ATOM   6561  C  CG    . LEU B 1 220 ? 56.939  102.450 70.646  1.00 18.80 ? 220  LEU B CG    1 
ATOM   6562  C  CD1   . LEU B 1 220 ? 56.647  102.042 69.212  1.00 18.70 ? 220  LEU B CD1   1 
ATOM   6563  C  CD2   . LEU B 1 220 ? 58.283  103.175 70.737  1.00 14.92 ? 220  LEU B CD2   1 
ATOM   6564  N  N     . LYS B 1 221 ? 54.459  100.227 71.584  1.00 18.84 ? 221  LYS B N     1 
ATOM   6565  C  CA    . LYS B 1 221 ? 54.681  99.001  72.336  1.00 19.67 ? 221  LYS B CA    1 
ATOM   6566  C  C     . LYS B 1 221 ? 56.173  98.702  72.293  1.00 18.01 ? 221  LYS B C     1 
ATOM   6567  O  O     . LYS B 1 221 ? 56.685  98.179  71.304  1.00 18.12 ? 221  LYS B O     1 
ATOM   6568  C  CB    . LYS B 1 221 ? 53.888  97.814  71.760  1.00 20.33 ? 221  LYS B CB    1 
ATOM   6569  C  CG    . LYS B 1 221 ? 53.864  96.631  72.728  1.00 21.76 ? 221  LYS B CG    1 
ATOM   6570  C  CD    . LYS B 1 221 ? 52.812  95.594  72.393  1.00 25.93 ? 221  LYS B CD    1 
ATOM   6571  C  CE    . LYS B 1 221 ? 53.298  94.586  71.376  1.00 26.96 ? 221  LYS B CE    1 
ATOM   6572  N  NZ    . LYS B 1 221 ? 52.266  93.533  71.138  1.00 26.11 ? 221  LYS B NZ    1 
ATOM   6573  N  N     . ARG B 1 222 ? 56.872  99.050  73.367  1.00 17.19 ? 222  ARG B N     1 
ATOM   6574  C  CA    . ARG B 1 222 ? 58.309  98.822  73.442  1.00 16.54 ? 222  ARG B CA    1 
ATOM   6575  C  C     . ARG B 1 222 ? 58.640  97.554  74.207  1.00 16.28 ? 222  ARG B C     1 
ATOM   6576  O  O     . ARG B 1 222 ? 59.605  96.867  73.876  1.00 16.88 ? 222  ARG B O     1 
ATOM   6577  C  CB    . ARG B 1 222 ? 59.007  100.011 74.113  1.00 15.15 ? 222  ARG B CB    1 
ATOM   6578  C  CG    . ARG B 1 222 ? 60.460  99.742  74.471  1.00 15.24 ? 222  ARG B CG    1 
ATOM   6579  C  CD    . ARG B 1 222 ? 61.347  99.699  73.233  1.00 13.94 ? 222  ARG B CD    1 
ATOM   6580  N  NE    . ARG B 1 222 ? 62.700  99.244  73.539  1.00 14.06 ? 222  ARG B NE    1 
ATOM   6581  C  CZ    . ARG B 1 222 ? 63.060  97.965  73.596  1.00 16.48 ? 222  ARG B CZ    1 
ATOM   6582  N  NH1   . ARG B 1 222 ? 62.168  97.007  73.365  1.00 15.10 ? 222  ARG B NH1   1 
ATOM   6583  N  NH2   . ARG B 1 222 ? 64.318  97.641  73.867  1.00 13.82 ? 222  ARG B NH2   1 
ATOM   6584  N  N     . THR B 1 223 ? 57.847  97.246  75.231  1.00 17.37 ? 223  THR B N     1 
ATOM   6585  C  CA    . THR B 1 223 ? 58.086  96.049  76.042  1.00 19.11 ? 223  THR B CA    1 
ATOM   6586  C  C     . THR B 1 223 ? 56.930  95.056  76.022  1.00 19.98 ? 223  THR B C     1 
ATOM   6587  O  O     . THR B 1 223 ? 57.111  93.886  76.345  1.00 19.51 ? 223  THR B O     1 
ATOM   6588  C  CB    . THR B 1 223 ? 58.358  96.409  77.511  1.00 19.22 ? 223  THR B CB    1 
ATOM   6589  O  OG1   . THR B 1 223 ? 57.157  96.918  78.108  1.00 16.69 ? 223  THR B OG1   1 
ATOM   6590  C  CG2   . THR B 1 223 ? 59.457  97.459  77.602  1.00 19.99 ? 223  THR B CG2   1 
ATOM   6591  N  N     . GLY B 1 224 ? 55.742  95.531  75.663  1.00 21.00 ? 224  GLY B N     1 
ATOM   6592  C  CA    . GLY B 1 224 ? 54.585  94.652  75.613  1.00 20.60 ? 224  GLY B CA    1 
ATOM   6593  C  C     . GLY B 1 224 ? 53.981  94.345  76.970  1.00 22.00 ? 224  GLY B C     1 
ATOM   6594  O  O     . GLY B 1 224 ? 53.195  93.405  77.098  1.00 21.86 ? 224  GLY B O     1 
ATOM   6595  N  N     . SER B 1 225 ? 54.344  95.135  77.980  1.00 22.95 ? 225  SER B N     1 
ATOM   6596  C  CA    . SER B 1 225 ? 53.832  94.944  79.334  1.00 23.96 ? 225  SER B CA    1 
ATOM   6597  C  C     . SER B 1 225 ? 52.344  95.248  79.431  1.00 26.75 ? 225  SER B C     1 
ATOM   6598  O  O     . SER B 1 225 ? 51.790  95.982  78.606  1.00 26.35 ? 225  SER B O     1 
ATOM   6599  C  CB    . SER B 1 225 ? 54.591  95.833  80.322  1.00 24.22 ? 225  SER B CB    1 
ATOM   6600  O  OG    . SER B 1 225 ? 55.855  95.278  80.635  1.00 25.52 ? 225  SER B OG    1 
ATOM   6601  N  N     . ASP B 1 226 ? 51.700  94.680  80.448  1.00 27.32 ? 226  ASP B N     1 
ATOM   6602  C  CA    . ASP B 1 226 ? 50.275  94.890  80.656  1.00 27.99 ? 226  ASP B CA    1 
ATOM   6603  C  C     . ASP B 1 226 ? 49.986  96.303  81.122  1.00 26.16 ? 226  ASP B C     1 
ATOM   6604  O  O     . ASP B 1 226 ? 50.349  96.679  82.233  1.00 26.22 ? 226  ASP B O     1 
ATOM   6605  C  CB    . ASP B 1 226 ? 49.726  93.895  81.683  1.00 30.01 ? 226  ASP B CB    1 
ATOM   6606  C  CG    . ASP B 1 226 ? 49.831  92.456  81.213  1.00 33.46 ? 226  ASP B CG    1 
ATOM   6607  O  OD1   . ASP B 1 226 ? 49.426  92.167  80.063  1.00 32.48 ? 226  ASP B OD1   1 
ATOM   6608  O  OD2   . ASP B 1 226 ? 50.318  91.611  81.998  1.00 36.55 ? 226  ASP B OD2   1 
ATOM   6609  N  N     . ILE B 1 227 ? 49.333  97.079  80.264  1.00 25.38 ? 227  ILE B N     1 
ATOM   6610  C  CA    . ILE B 1 227 ? 48.974  98.456  80.586  1.00 26.15 ? 227  ILE B CA    1 
ATOM   6611  C  C     . ILE B 1 227 ? 47.458  98.602  80.494  1.00 26.52 ? 227  ILE B C     1 
ATOM   6612  O  O     . ILE B 1 227 ? 46.790  97.790  79.850  1.00 26.93 ? 227  ILE B O     1 
ATOM   6613  C  CB    . ILE B 1 227 ? 49.603  99.469  79.589  1.00 25.72 ? 227  ILE B CB    1 
ATOM   6614  C  CG1   . ILE B 1 227 ? 49.083  99.200  78.172  1.00 25.46 ? 227  ILE B CG1   1 
ATOM   6615  C  CG2   . ILE B 1 227 ? 51.117  99.373  79.626  1.00 24.96 ? 227  ILE B CG2   1 
ATOM   6616  C  CD1   . ILE B 1 227 ? 49.423  100.286 77.174  1.00 24.84 ? 227  ILE B CD1   1 
ATOM   6617  N  N     . ASP B 1 228 ? 46.923  99.634  81.142  1.00 26.54 ? 228  ASP B N     1 
ATOM   6618  C  CA    . ASP B 1 228 ? 45.494  99.898  81.097  1.00 25.97 ? 228  ASP B CA    1 
ATOM   6619  C  C     . ASP B 1 228 ? 45.247  100.663 79.803  1.00 27.69 ? 228  ASP B C     1 
ATOM   6620  O  O     . ASP B 1 228 ? 46.107  101.416 79.353  1.00 28.49 ? 228  ASP B O     1 
ATOM   6621  C  CB    . ASP B 1 228 ? 45.058  100.745 82.292  1.00 25.85 ? 228  ASP B CB    1 
ATOM   6622  C  CG    . ASP B 1 228 ? 45.356  100.079 83.616  1.00 27.26 ? 228  ASP B CG    1 
ATOM   6623  O  OD1   . ASP B 1 228 ? 46.455  100.297 84.161  1.00 28.36 ? 228  ASP B OD1   1 
ATOM   6624  O  OD2   . ASP B 1 228 ? 44.494  99.325  84.109  1.00 29.31 ? 228  ASP B OD2   1 
ATOM   6625  N  N     . TRP B 1 229 ? 44.074  100.481 79.211  1.00 28.60 ? 229  TRP B N     1 
ATOM   6626  C  CA    . TRP B 1 229 ? 43.758  101.145 77.959  1.00 29.25 ? 229  TRP B CA    1 
ATOM   6627  C  C     . TRP B 1 229 ? 42.455  101.923 78.054  1.00 29.75 ? 229  TRP B C     1 
ATOM   6628  O  O     . TRP B 1 229 ? 41.466  101.424 78.594  1.00 31.59 ? 229  TRP B O     1 
ATOM   6629  C  CB    . TRP B 1 229 ? 43.658  100.092 76.852  1.00 29.92 ? 229  TRP B CB    1 
ATOM   6630  C  CG    . TRP B 1 229 ? 43.823  100.626 75.462  1.00 30.84 ? 229  TRP B CG    1 
ATOM   6631  C  CD1   . TRP B 1 229 ? 42.836  100.883 74.550  1.00 30.67 ? 229  TRP B CD1   1 
ATOM   6632  C  CD2   . TRP B 1 229 ? 45.061  100.933 74.811  1.00 30.00 ? 229  TRP B CD2   1 
ATOM   6633  N  NE1   . TRP B 1 229 ? 43.389  101.325 73.369  1.00 29.43 ? 229  TRP B NE1   1 
ATOM   6634  C  CE2   . TRP B 1 229 ? 44.752  101.366 73.504  1.00 29.83 ? 229  TRP B CE2   1 
ATOM   6635  C  CE3   . TRP B 1 229 ? 46.404  100.883 75.205  1.00 29.09 ? 229  TRP B CE3   1 
ATOM   6636  C  CZ2   . TRP B 1 229 ? 45.738  101.745 72.589  1.00 27.51 ? 229  TRP B CZ2   1 
ATOM   6637  C  CZ3   . TRP B 1 229 ? 47.380  101.261 74.294  1.00 27.48 ? 229  TRP B CZ3   1 
ATOM   6638  C  CH2   . TRP B 1 229 ? 47.041  101.686 73.004  1.00 27.43 ? 229  TRP B CH2   1 
ATOM   6639  N  N     . GLN B 1 230 ? 42.456  103.146 77.534  1.00 28.03 ? 230  GLN B N     1 
ATOM   6640  C  CA    . GLN B 1 230 ? 41.258  103.977 77.544  1.00 27.35 ? 230  GLN B CA    1 
ATOM   6641  C  C     . GLN B 1 230 ? 40.699  104.046 76.129  1.00 27.04 ? 230  GLN B C     1 
ATOM   6642  O  O     . GLN B 1 230 ? 41.234  104.752 75.274  1.00 27.58 ? 230  GLN B O     1 
ATOM   6643  C  CB    . GLN B 1 230 ? 41.577  105.388 78.047  1.00 27.84 ? 230  GLN B CB    1 
ATOM   6644  C  CG    . GLN B 1 230 ? 40.498  106.422 77.727  1.00 32.03 ? 230  GLN B CG    1 
ATOM   6645  C  CD    . GLN B 1 230 ? 39.147  106.096 78.343  1.00 35.34 ? 230  GLN B CD    1 
ATOM   6646  O  OE1   . GLN B 1 230 ? 38.944  106.269 79.543  1.00 38.43 ? 230  GLN B OE1   1 
ATOM   6647  N  NE2   . GLN B 1 230 ? 38.215  105.620 77.520  1.00 35.14 ? 230  GLN B NE2   1 
ATOM   6648  N  N     . GLU B 1 231 ? 39.626  103.301 75.889  1.00 25.28 ? 231  GLU B N     1 
ATOM   6649  C  CA    . GLU B 1 231 ? 38.982  103.260 74.578  1.00 24.21 ? 231  GLU B CA    1 
ATOM   6650  C  C     . GLU B 1 231 ? 38.817  104.657 73.982  1.00 24.15 ? 231  GLU B C     1 
ATOM   6651  O  O     . GLU B 1 231 ? 38.463  105.608 74.687  1.00 24.13 ? 231  GLU B O     1 
ATOM   6652  C  CB    . GLU B 1 231 ? 37.611  102.598 74.695  1.00 23.94 ? 231  GLU B CB    1 
ATOM   6653  C  CG    . GLU B 1 231 ? 36.591  103.421 75.475  1.00 22.86 ? 231  GLU B CG    1 
ATOM   6654  C  CD    . GLU B 1 231 ? 35.282  102.686 75.684  1.00 24.00 ? 231  GLU B CD    1 
ATOM   6655  O  OE1   . GLU B 1 231 ? 34.946  101.821 74.844  1.00 24.57 ? 231  GLU B OE1   1 
ATOM   6656  O  OE2   . GLU B 1 231 ? 34.580  102.986 76.679  1.00 23.52 ? 231  GLU B OE2   1 
ATOM   6657  N  N     . GLY B 1 232 ? 39.083  104.772 72.684  1.00 22.44 ? 232  GLY B N     1 
ATOM   6658  C  CA    . GLY B 1 232 ? 38.946  106.048 72.006  1.00 24.05 ? 232  GLY B CA    1 
ATOM   6659  C  C     . GLY B 1 232 ? 40.111  107.010 72.175  1.00 24.24 ? 232  GLY B C     1 
ATOM   6660  O  O     . GLY B 1 232 ? 40.548  107.641 71.214  1.00 25.33 ? 232  GLY B O     1 
ATOM   6661  N  N     . ARG B 1 233 ? 40.614  107.134 73.395  1.00 23.63 ? 233  ARG B N     1 
ATOM   6662  C  CA    . ARG B 1 233 ? 41.723  108.038 73.662  1.00 22.93 ? 233  ARG B CA    1 
ATOM   6663  C  C     . ARG B 1 233 ? 43.073  107.445 73.278  1.00 22.65 ? 233  ARG B C     1 
ATOM   6664  O  O     . ARG B 1 233 ? 43.840  108.067 72.542  1.00 22.49 ? 233  ARG B O     1 
ATOM   6665  C  CB    . ARG B 1 233 ? 41.746  108.423 75.141  1.00 21.40 ? 233  ARG B CB    1 
ATOM   6666  C  CG    . ARG B 1 233 ? 42.722  109.536 75.473  1.00 20.89 ? 233  ARG B CG    1 
ATOM   6667  C  CD    . ARG B 1 233 ? 42.925  109.646 76.974  1.00 22.73 ? 233  ARG B CD    1 
ATOM   6668  N  NE    . ARG B 1 233 ? 43.594  108.462 77.513  1.00 23.45 ? 233  ARG B NE    1 
ATOM   6669  C  CZ    . ARG B 1 233 ? 43.865  108.270 78.800  1.00 23.87 ? 233  ARG B CZ    1 
ATOM   6670  N  NH1   . ARG B 1 233 ? 43.523  109.184 79.700  1.00 23.48 ? 233  ARG B NH1   1 
ATOM   6671  N  NH2   . ARG B 1 233 ? 44.485  107.164 79.186  1.00 22.81 ? 233  ARG B NH2   1 
ATOM   6672  N  N     . ASP B 1 234 ? 43.363  106.244 73.770  1.00 22.54 ? 234  ASP B N     1 
ATOM   6673  C  CA    . ASP B 1 234 ? 44.640  105.600 73.487  1.00 22.02 ? 234  ASP B CA    1 
ATOM   6674  C  C     . ASP B 1 234 ? 44.719  104.928 72.118  1.00 22.51 ? 234  ASP B C     1 
ATOM   6675  O  O     . ASP B 1 234 ? 43.788  104.255 71.680  1.00 23.60 ? 234  ASP B O     1 
ATOM   6676  C  CB    . ASP B 1 234 ? 44.965  104.585 74.584  1.00 20.56 ? 234  ASP B CB    1 
ATOM   6677  C  CG    . ASP B 1 234 ? 44.990  105.213 75.956  1.00 20.28 ? 234  ASP B CG    1 
ATOM   6678  O  OD1   . ASP B 1 234 ? 45.389  106.392 76.047  1.00 20.19 ? 234  ASP B OD1   1 
ATOM   6679  O  OD2   . ASP B 1 234 ? 44.630  104.536 76.941  1.00 21.74 ? 234  ASP B OD2   1 
ATOM   6680  N  N     . LEU B 1 235 ? 45.849  105.113 71.450  1.00 21.70 ? 235  LEU B N     1 
ATOM   6681  C  CA    . LEU B 1 235 ? 46.052  104.532 70.133  1.00 21.96 ? 235  LEU B CA    1 
ATOM   6682  C  C     . LEU B 1 235 ? 47.471  103.985 70.003  1.00 22.36 ? 235  LEU B C     1 
ATOM   6683  O  O     . LEU B 1 235 ? 48.443  104.630 70.418  1.00 22.47 ? 235  LEU B O     1 
ATOM   6684  C  CB    . LEU B 1 235 ? 45.811  105.592 69.058  1.00 22.06 ? 235  LEU B CB    1 
ATOM   6685  C  CG    . LEU B 1 235 ? 44.439  106.270 69.066  1.00 24.86 ? 235  LEU B CG    1 
ATOM   6686  C  CD1   . LEU B 1 235 ? 44.468  107.468 68.125  1.00 23.55 ? 235  LEU B CD1   1 
ATOM   6687  C  CD2   . LEU B 1 235 ? 43.351  105.269 68.670  1.00 22.85 ? 235  LEU B CD2   1 
ATOM   6688  N  N     . TRP B 1 236 ? 47.587  102.800 69.414  1.00 21.62 ? 236  TRP B N     1 
ATOM   6689  C  CA    . TRP B 1 236 ? 48.887  102.179 69.217  1.00 21.54 ? 236  TRP B CA    1 
ATOM   6690  C  C     . TRP B 1 236 ? 49.645  102.881 68.103  1.00 22.06 ? 236  TRP B C     1 
ATOM   6691  O  O     . TRP B 1 236 ? 49.070  103.244 67.074  1.00 21.16 ? 236  TRP B O     1 
ATOM   6692  C  CB    . TRP B 1 236 ? 48.732  100.695 68.876  1.00 20.45 ? 236  TRP B CB    1 
ATOM   6693  C  CG    . TRP B 1 236 ? 48.343  99.850  70.052  1.00 22.87 ? 236  TRP B CG    1 
ATOM   6694  C  CD1   . TRP B 1 236 ? 47.142  99.230  70.263  1.00 21.89 ? 236  TRP B CD1   1 
ATOM   6695  C  CD2   . TRP B 1 236 ? 49.154  99.555  71.198  1.00 21.59 ? 236  TRP B CD2   1 
ATOM   6696  N  NE1   . TRP B 1 236 ? 47.158  98.569  71.467  1.00 22.29 ? 236  TRP B NE1   1 
ATOM   6697  C  CE2   . TRP B 1 236 ? 48.379  98.752  72.062  1.00 22.44 ? 236  TRP B CE2   1 
ATOM   6698  C  CE3   . TRP B 1 236 ? 50.460  99.892  71.577  1.00 21.97 ? 236  TRP B CE3   1 
ATOM   6699  C  CZ2   . TRP B 1 236 ? 48.868  98.279  73.286  1.00 21.88 ? 236  TRP B CZ2   1 
ATOM   6700  C  CZ3   . TRP B 1 236 ? 50.947  99.425  72.790  1.00 22.27 ? 236  TRP B CZ3   1 
ATOM   6701  C  CH2   . TRP B 1 236 ? 50.151  98.626  73.631  1.00 22.69 ? 236  TRP B CH2   1 
ATOM   6702  N  N     . TRP B 1 237 ? 50.940  103.082 68.326  1.00 22.72 ? 237  TRP B N     1 
ATOM   6703  C  CA    . TRP B 1 237 ? 51.811  103.730 67.354  1.00 22.24 ? 237  TRP B CA    1 
ATOM   6704  C  C     . TRP B 1 237 ? 51.793  102.944 66.050  1.00 23.13 ? 237  TRP B C     1 
ATOM   6705  O  O     . TRP B 1 237 ? 51.545  103.496 64.978  1.00 21.65 ? 237  TRP B O     1 
ATOM   6706  C  CB    . TRP B 1 237 ? 53.237  103.797 67.914  1.00 20.85 ? 237  TRP B CB    1 
ATOM   6707  C  CG    . TRP B 1 237 ? 54.282  104.291 66.955  1.00 19.19 ? 237  TRP B CG    1 
ATOM   6708  C  CD1   . TRP B 1 237 ? 54.817  103.612 65.900  1.00 20.74 ? 237  TRP B CD1   1 
ATOM   6709  C  CD2   . TRP B 1 237 ? 54.928  105.569 66.977  1.00 17.19 ? 237  TRP B CD2   1 
ATOM   6710  N  NE1   . TRP B 1 237 ? 55.757  104.387 65.262  1.00 18.38 ? 237  TRP B NE1   1 
ATOM   6711  C  CE2   . TRP B 1 237 ? 55.843  105.594 65.902  1.00 16.29 ? 237  TRP B CE2   1 
ATOM   6712  C  CE3   . TRP B 1 237 ? 54.824  106.696 67.799  1.00 17.63 ? 237  TRP B CE3   1 
ATOM   6713  C  CZ2   . TRP B 1 237 ? 56.647  106.705 65.626  1.00 14.71 ? 237  TRP B CZ2   1 
ATOM   6714  C  CZ3   . TRP B 1 237 ? 55.626  107.802 67.526  1.00 16.29 ? 237  TRP B CZ3   1 
ATOM   6715  C  CH2   . TRP B 1 237 ? 56.523  107.797 66.449  1.00 16.62 ? 237  TRP B CH2   1 
ATOM   6716  N  N     . ARG B 1 238 ? 52.042  101.645 66.152  1.00 25.41 ? 238  ARG B N     1 
ATOM   6717  C  CA    . ARG B 1 238 ? 52.069  100.786 64.978  1.00 27.93 ? 238  ARG B CA    1 
ATOM   6718  C  C     . ARG B 1 238 ? 50.807  100.849 64.117  1.00 27.40 ? 238  ARG B C     1 
ATOM   6719  O  O     . ARG B 1 238 ? 50.898  100.965 62.893  1.00 28.23 ? 238  ARG B O     1 
ATOM   6720  C  CB    . ARG B 1 238 ? 52.337  99.338  65.396  1.00 30.41 ? 238  ARG B CB    1 
ATOM   6721  C  CG    . ARG B 1 238 ? 52.389  98.385  64.224  1.00 35.18 ? 238  ARG B CG    1 
ATOM   6722  C  CD    . ARG B 1 238 ? 53.033  97.059  64.583  1.00 40.57 ? 238  ARG B CD    1 
ATOM   6723  N  NE    . ARG B 1 238 ? 53.206  96.233  63.388  1.00 45.53 ? 238  ARG B NE    1 
ATOM   6724  C  CZ    . ARG B 1 238 ? 54.099  95.256  63.274  1.00 46.50 ? 238  ARG B CZ    1 
ATOM   6725  N  NH1   . ARG B 1 238 ? 54.909  94.976  64.289  1.00 48.06 ? 238  ARG B NH1   1 
ATOM   6726  N  NH2   . ARG B 1 238 ? 54.186  94.568  62.143  1.00 46.48 ? 238  ARG B NH2   1 
ATOM   6727  N  N     . ASP B 1 239 ? 49.638  100.773 64.748  1.00 26.45 ? 239  ASP B N     1 
ATOM   6728  C  CA    . ASP B 1 239 ? 48.372  100.805 64.016  1.00 27.28 ? 239  ASP B CA    1 
ATOM   6729  C  C     . ASP B 1 239 ? 48.128  102.105 63.253  1.00 26.46 ? 239  ASP B C     1 
ATOM   6730  O  O     . ASP B 1 239 ? 47.435  102.108 62.236  1.00 26.74 ? 239  ASP B O     1 
ATOM   6731  C  CB    . ASP B 1 239 ? 47.185  100.566 64.962  1.00 28.13 ? 239  ASP B CB    1 
ATOM   6732  C  CG    . ASP B 1 239 ? 47.200  99.181  65.600  1.00 30.64 ? 239  ASP B CG    1 
ATOM   6733  O  OD1   . ASP B 1 239 ? 47.956  98.299  65.125  1.00 31.41 ? 239  ASP B OD1   1 
ATOM   6734  O  OD2   . ASP B 1 239 ? 46.437  98.973  66.574  1.00 30.06 ? 239  ASP B OD2   1 
ATOM   6735  N  N     . LEU B 1 240 ? 48.689  103.205 63.741  1.00 24.86 ? 240  LEU B N     1 
ATOM   6736  C  CA    . LEU B 1 240 ? 48.497  104.497 63.094  1.00 25.67 ? 240  LEU B CA    1 
ATOM   6737  C  C     . LEU B 1 240 ? 49.465  104.811 61.952  1.00 26.07 ? 240  LEU B C     1 
ATOM   6738  O  O     . LEU B 1 240 ? 49.053  105.296 60.900  1.00 25.51 ? 240  LEU B O     1 
ATOM   6739  C  CB    . LEU B 1 240 ? 48.584  105.622 64.129  1.00 23.57 ? 240  LEU B CB    1 
ATOM   6740  C  CG    . LEU B 1 240 ? 47.560  105.660 65.261  1.00 23.31 ? 240  LEU B CG    1 
ATOM   6741  C  CD1   . LEU B 1 240 ? 47.824  106.882 66.135  1.00 21.10 ? 240  LEU B CD1   1 
ATOM   6742  C  CD2   . LEU B 1 240 ? 46.152  105.715 64.681  1.00 21.65 ? 240  LEU B CD2   1 
ATOM   6743  N  N     . ILE B 1 241 ? 50.750  104.544 62.152  1.00 27.45 ? 241  ILE B N     1 
ATOM   6744  C  CA    . ILE B 1 241 ? 51.740  104.864 61.135  1.00 28.58 ? 241  ILE B CA    1 
ATOM   6745  C  C     . ILE B 1 241 ? 51.709  103.940 59.930  1.00 29.80 ? 241  ILE B C     1 
ATOM   6746  O  O     . ILE B 1 241 ? 51.992  104.369 58.810  1.00 29.30 ? 241  ILE B O     1 
ATOM   6747  C  CB    . ILE B 1 241 ? 53.171  104.880 61.730  1.00 28.28 ? 241  ILE B CB    1 
ATOM   6748  C  CG1   . ILE B 1 241 ? 54.142  105.522 60.736  1.00 30.23 ? 241  ILE B CG1   1 
ATOM   6749  C  CG2   . ILE B 1 241 ? 53.616  103.469 62.062  1.00 27.49 ? 241  ILE B CG2   1 
ATOM   6750  C  CD1   . ILE B 1 241 ? 55.573  105.653 61.249  1.00 30.49 ? 241  ILE B CD1   1 
ATOM   6751  N  N     . GLU B 1 242 ? 51.364  102.676 60.154  1.00 31.53 ? 242  GLU B N     1 
ATOM   6752  C  CA    . GLU B 1 242 ? 51.309  101.695 59.073  1.00 33.15 ? 242  GLU B CA    1 
ATOM   6753  C  C     . GLU B 1 242 ? 50.215  101.980 58.047  1.00 32.62 ? 242  GLU B C     1 
ATOM   6754  O  O     . GLU B 1 242 ? 50.303  101.537 56.903  1.00 32.73 ? 242  GLU B O     1 
ATOM   6755  C  CB    . GLU B 1 242 ? 51.125  100.287 59.649  1.00 34.82 ? 242  GLU B CB    1 
ATOM   6756  C  CG    . GLU B 1 242 ? 52.381  99.435  59.593  1.00 38.52 ? 242  GLU B CG    1 
ATOM   6757  C  CD    . GLU B 1 242 ? 52.250  98.131  60.372  1.00 41.06 ? 242  GLU B CD    1 
ATOM   6758  O  OE1   . GLU B 1 242 ? 51.277  97.379  60.128  1.00 40.26 ? 242  GLU B OE1   1 
ATOM   6759  O  OE2   . GLU B 1 242 ? 53.130  97.859  61.223  1.00 41.40 ? 242  GLU B OE2   1 
ATOM   6760  N  N     . LYS B 1 243 ? 49.194  102.727 58.452  1.00 32.05 ? 243  LYS B N     1 
ATOM   6761  C  CA    . LYS B 1 243 ? 48.088  103.054 57.559  1.00 32.28 ? 243  LYS B CA    1 
ATOM   6762  C  C     . LYS B 1 243 ? 48.258  104.450 56.954  1.00 32.26 ? 243  LYS B C     1 
ATOM   6763  O  O     . LYS B 1 243 ? 47.526  104.838 56.040  1.00 32.70 ? 243  LYS B O     1 
ATOM   6764  C  CB    . LYS B 1 243 ? 46.759  102.980 58.323  1.00 32.27 ? 243  LYS B CB    1 
ATOM   6765  C  CG    . LYS B 1 243 ? 46.631  104.017 59.420  1.00 33.38 ? 243  LYS B CG    1 
ATOM   6766  C  CD    . LYS B 1 243 ? 45.273  103.988 60.090  1.00 34.60 ? 243  LYS B CD    1 
ATOM   6767  C  CE    . LYS B 1 243 ? 45.147  105.129 61.098  1.00 35.57 ? 243  LYS B CE    1 
ATOM   6768  N  NZ    . LYS B 1 243 ? 43.869  105.072 61.860  1.00 33.94 ? 243  LYS B NZ    1 
ATOM   6769  N  N     . ALA B 1 244 ? 49.222  105.204 57.474  1.00 30.78 ? 244  ALA B N     1 
ATOM   6770  C  CA    . ALA B 1 244 ? 49.483  106.557 56.993  1.00 29.26 ? 244  ALA B CA    1 
ATOM   6771  C  C     . ALA B 1 244 ? 50.269  106.557 55.684  1.00 28.83 ? 244  ALA B C     1 
ATOM   6772  O  O     . ALA B 1 244 ? 51.013  105.622 55.391  1.00 29.78 ? 244  ALA B O     1 
ATOM   6773  C  CB    . ALA B 1 244 ? 50.248  107.346 58.048  1.00 28.66 ? 244  ALA B CB    1 
ATOM   6774  N  N     . SER B 1 245 ? 50.102  107.618 54.903  1.00 27.10 ? 245  SER B N     1 
ATOM   6775  C  CA    . SER B 1 245 ? 50.804  107.746 53.635  1.00 26.46 ? 245  SER B CA    1 
ATOM   6776  C  C     . SER B 1 245 ? 52.237  108.240 53.830  1.00 26.24 ? 245  SER B C     1 
ATOM   6777  O  O     . SER B 1 245 ? 52.480  109.187 54.579  1.00 26.52 ? 245  SER B O     1 
ATOM   6778  C  CB    . SER B 1 245 ? 50.058  108.719 52.725  1.00 26.03 ? 245  SER B CB    1 
ATOM   6779  O  OG    . SER B 1 245 ? 50.841  109.029 51.591  1.00 24.74 ? 245  SER B OG    1 
ATOM   6780  N  N     . PRO B 1 246 ? 53.209  107.592 53.166  1.00 26.30 ? 246  PRO B N     1 
ATOM   6781  C  CA    . PRO B 1 246 ? 54.616  107.989 53.276  1.00 24.53 ? 246  PRO B CA    1 
ATOM   6782  C  C     . PRO B 1 246 ? 54.910  109.211 52.409  1.00 24.43 ? 246  PRO B C     1 
ATOM   6783  O  O     . PRO B 1 246 ? 56.064  109.593 52.214  1.00 21.64 ? 246  PRO B O     1 
ATOM   6784  C  CB    . PRO B 1 246 ? 55.358  106.744 52.803  1.00 24.08 ? 246  PRO B CB    1 
ATOM   6785  C  CG    . PRO B 1 246 ? 54.431  106.192 51.766  1.00 25.74 ? 246  PRO B CG    1 
ATOM   6786  C  CD    . PRO B 1 246 ? 53.080  106.315 52.438  1.00 26.70 ? 246  PRO B CD    1 
ATOM   6787  N  N     . GLU B 1 247 ? 53.845  109.820 51.898  1.00 25.28 ? 247  GLU B N     1 
ATOM   6788  C  CA    . GLU B 1 247 ? 53.958  110.999 51.050  1.00 26.97 ? 247  GLU B CA    1 
ATOM   6789  C  C     . GLU B 1 247 ? 53.506  112.244 51.801  1.00 25.19 ? 247  GLU B C     1 
ATOM   6790  O  O     . GLU B 1 247 ? 52.346  112.348 52.207  1.00 25.38 ? 247  GLU B O     1 
ATOM   6791  C  CB    . GLU B 1 247 ? 53.105  110.825 49.786  1.00 31.11 ? 247  GLU B CB    1 
ATOM   6792  C  CG    . GLU B 1 247 ? 53.585  109.726 48.842  1.00 38.48 ? 247  GLU B CG    1 
ATOM   6793  C  CD    . GLU B 1 247 ? 54.659  110.207 47.873  1.00 44.76 ? 247  GLU B CD    1 
ATOM   6794  O  OE1   . GLU B 1 247 ? 54.311  110.922 46.901  1.00 47.38 ? 247  GLU B OE1   1 
ATOM   6795  O  OE2   . GLU B 1 247 ? 55.851  109.878 48.085  1.00 47.15 ? 247  GLU B OE2   1 
ATOM   6796  N  N     . HIS B 1 248 ? 54.426  113.183 51.996  1.00 22.27 ? 248  HIS B N     1 
ATOM   6797  C  CA    . HIS B 1 248 ? 54.108  114.430 52.685  1.00 21.22 ? 248  HIS B CA    1 
ATOM   6798  C  C     . HIS B 1 248 ? 55.022  115.567 52.259  1.00 21.01 ? 248  HIS B C     1 
ATOM   6799  O  O     . HIS B 1 248 ? 56.245  115.476 52.368  1.00 17.97 ? 248  HIS B O     1 
ATOM   6800  C  CB    . HIS B 1 248 ? 54.216  114.284 54.196  1.00 19.22 ? 248  HIS B CB    1 
ATOM   6801  C  CG    . HIS B 1 248 ? 53.990  115.572 54.924  1.00 18.70 ? 248  HIS B CG    1 
ATOM   6802  N  ND1   . HIS B 1 248 ? 52.732  116.080 55.162  1.00 18.25 ? 248  HIS B ND1   1 
ATOM   6803  C  CD2   . HIS B 1 248 ? 54.863  116.496 55.390  1.00 17.68 ? 248  HIS B CD2   1 
ATOM   6804  C  CE1   . HIS B 1 248 ? 52.840  117.262 55.742  1.00 16.03 ? 248  HIS B CE1   1 
ATOM   6805  N  NE2   . HIS B 1 248 ? 54.121  117.538 55.891  1.00 19.72 ? 248  HIS B NE2   1 
ATOM   6806  N  N     . GLN B 1 249 ? 54.416  116.648 51.792  1.00 23.17 ? 249  GLN B N     1 
ATOM   6807  C  CA    . GLN B 1 249 ? 55.169  117.808 51.344  1.00 25.82 ? 249  GLN B CA    1 
ATOM   6808  C  C     . GLN B 1 249 ? 55.384  118.784 52.496  1.00 25.32 ? 249  GLN B C     1 
ATOM   6809  O  O     . GLN B 1 249 ? 54.436  119.220 53.143  1.00 27.09 ? 249  GLN B O     1 
ATOM   6810  C  CB    . GLN B 1 249 ? 54.423  118.494 50.205  1.00 26.59 ? 249  GLN B CB    1 
ATOM   6811  C  CG    . GLN B 1 249 ? 53.974  117.523 49.126  1.00 30.06 ? 249  GLN B CG    1 
ATOM   6812  C  CD    . GLN B 1 249 ? 55.048  116.508 48.761  1.00 32.76 ? 249  GLN B CD    1 
ATOM   6813  O  OE1   . GLN B 1 249 ? 54.927  115.315 49.067  1.00 33.10 ? 249  GLN B OE1   1 
ATOM   6814  N  NE2   . GLN B 1 249 ? 56.110  116.977 48.109  1.00 33.21 ? 249  GLN B NE2   1 
ATOM   6815  N  N     . PRO B 1 250 ? 56.647  119.131 52.773  1.00 24.28 ? 250  PRO B N     1 
ATOM   6816  C  CA    . PRO B 1 250 ? 56.957  120.061 53.862  1.00 23.99 ? 250  PRO B CA    1 
ATOM   6817  C  C     . PRO B 1 250 ? 56.359  121.446 53.616  1.00 24.20 ? 250  PRO B C     1 
ATOM   6818  O  O     . PRO B 1 250 ? 56.579  122.045 52.561  1.00 23.53 ? 250  PRO B O     1 
ATOM   6819  C  CB    . PRO B 1 250 ? 58.486  120.108 53.864  1.00 23.02 ? 250  PRO B CB    1 
ATOM   6820  C  CG    . PRO B 1 250 ? 58.891  118.815 53.220  1.00 24.05 ? 250  PRO B CG    1 
ATOM   6821  C  CD    . PRO B 1 250 ? 57.876  118.666 52.113  1.00 24.56 ? 250  PRO B CD    1 
ATOM   6822  N  N     . GLU B 1 251 ? 55.599  121.951 54.582  1.00 24.40 ? 251  GLU B N     1 
ATOM   6823  C  CA    . GLU B 1 251 ? 55.017  123.284 54.464  1.00 24.80 ? 251  GLU B CA    1 
ATOM   6824  C  C     . GLU B 1 251 ? 56.028  124.283 55.029  1.00 24.15 ? 251  GLU B C     1 
ATOM   6825  O  O     . GLU B 1 251 ? 56.832  123.946 55.900  1.00 23.51 ? 251  GLU B O     1 
ATOM   6826  C  CB    . GLU B 1 251 ? 53.706  123.382 55.249  1.00 27.43 ? 251  GLU B CB    1 
ATOM   6827  C  CG    . GLU B 1 251 ? 52.520  122.681 54.599  1.00 30.18 ? 251  GLU B CG    1 
ATOM   6828  C  CD    . GLU B 1 251 ? 52.244  123.193 53.202  1.00 32.10 ? 251  GLU B CD    1 
ATOM   6829  O  OE1   . GLU B 1 251 ? 52.205  124.430 53.025  1.00 34.67 ? 251  GLU B OE1   1 
ATOM   6830  O  OE2   . GLU B 1 251 ? 52.062  122.364 52.284  1.00 33.19 ? 251  GLU B OE2   1 
ATOM   6831  N  N     . ALA B 1 252 ? 55.989  125.510 54.528  1.00 22.97 ? 252  ALA B N     1 
ATOM   6832  C  CA    . ALA B 1 252 ? 56.909  126.547 54.974  1.00 21.98 ? 252  ALA B CA    1 
ATOM   6833  C  C     . ALA B 1 252 ? 56.574  127.078 56.368  1.00 21.03 ? 252  ALA B C     1 
ATOM   6834  O  O     . ALA B 1 252 ? 55.421  127.381 56.666  1.00 22.25 ? 252  ALA B O     1 
ATOM   6835  C  CB    . ALA B 1 252 ? 56.912  127.693 53.970  1.00 22.31 ? 252  ALA B CB    1 
ATOM   6836  N  N     . MET B 1 253 ? 57.596  127.186 57.211  1.00 18.96 ? 253  MET B N     1 
ATOM   6837  C  CA    . MET B 1 253 ? 57.447  127.698 58.569  1.00 19.04 ? 253  MET B CA    1 
ATOM   6838  C  C     . MET B 1 253 ? 58.211  129.010 58.677  1.00 19.72 ? 253  MET B C     1 
ATOM   6839  O  O     . MET B 1 253 ? 59.305  129.136 58.129  1.00 19.15 ? 253  MET B O     1 
ATOM   6840  C  CB    . MET B 1 253 ? 58.029  126.714 59.586  1.00 19.31 ? 253  MET B CB    1 
ATOM   6841  C  CG    . MET B 1 253 ? 57.307  125.384 59.662  1.00 21.23 ? 253  MET B CG    1 
ATOM   6842  S  SD    . MET B 1 253 ? 55.535  125.588 59.812  1.00 21.15 ? 253  MET B SD    1 
ATOM   6843  C  CE    . MET B 1 253 ? 54.974  124.286 58.732  1.00 20.48 ? 253  MET B CE    1 
ATOM   6844  N  N     . ASN B 1 254 ? 57.643  129.989 59.373  1.00 20.49 ? 254  ASN B N     1 
ATOM   6845  C  CA    . ASN B 1 254 ? 58.336  131.262 59.542  1.00 20.73 ? 254  ASN B CA    1 
ATOM   6846  C  C     . ASN B 1 254 ? 59.510  131.080 60.487  1.00 20.40 ? 254  ASN B C     1 
ATOM   6847  O  O     . ASN B 1 254 ? 59.478  130.218 61.377  1.00 17.85 ? 254  ASN B O     1 
ATOM   6848  C  CB    . ASN B 1 254 ? 57.414  132.333 60.120  1.00 23.58 ? 254  ASN B CB    1 
ATOM   6849  C  CG    . ASN B 1 254 ? 56.473  132.899 59.094  1.00 26.33 ? 254  ASN B CG    1 
ATOM   6850  O  OD1   . ASN B 1 254 ? 55.301  132.528 59.036  1.00 29.50 ? 254  ASN B OD1   1 
ATOM   6851  N  ND2   . ASN B 1 254 ? 56.982  133.800 58.265  1.00 28.07 ? 254  ASN B ND2   1 
ATOM   6852  N  N     . ALA B 1 255 ? 60.536  131.905 60.297  1.00 18.08 ? 255  ALA B N     1 
ATOM   6853  C  CA    . ALA B 1 255 ? 61.731  131.851 61.125  1.00 17.99 ? 255  ALA B CA    1 
ATOM   6854  C  C     . ALA B 1 255 ? 61.367  131.908 62.606  1.00 17.09 ? 255  ALA B C     1 
ATOM   6855  O  O     . ALA B 1 255 ? 61.902  131.142 63.416  1.00 15.30 ? 255  ALA B O     1 
ATOM   6856  C  CB    . ALA B 1 255 ? 62.673  133.008 60.765  1.00 17.37 ? 255  ALA B CB    1 
ATOM   6857  N  N     . GLU B 1 256 ? 60.455  132.810 62.962  1.00 15.08 ? 256  GLU B N     1 
ATOM   6858  C  CA    . GLU B 1 256 ? 60.049  132.935 64.356  1.00 15.58 ? 256  GLU B CA    1 
ATOM   6859  C  C     . GLU B 1 256 ? 58.857  132.072 64.790  1.00 15.11 ? 256  GLU B C     1 
ATOM   6860  O  O     . GLU B 1 256 ? 58.271  132.320 65.840  1.00 16.99 ? 256  GLU B O     1 
ATOM   6861  C  CB    . GLU B 1 256 ? 59.784  134.404 64.714  1.00 14.08 ? 256  GLU B CB    1 
ATOM   6862  C  CG    . GLU B 1 256 ? 61.048  135.269 64.779  1.00 12.91 ? 256  GLU B CG    1 
ATOM   6863  C  CD    . GLU B 1 256 ? 62.111  134.708 65.718  1.00 14.26 ? 256  GLU B CD    1 
ATOM   6864  O  OE1   . GLU B 1 256 ? 61.740  134.145 66.776  1.00 12.42 ? 256  GLU B OE1   1 
ATOM   6865  O  OE2   . GLU B 1 256 ? 63.320  134.848 65.409  1.00 12.17 ? 256  GLU B OE2   1 
ATOM   6866  N  N     . ASP B 1 257 ? 58.487  131.069 64.000  1.00 15.25 ? 257  ASP B N     1 
ATOM   6867  C  CA    . ASP B 1 257 ? 57.393  130.191 64.416  1.00 18.47 ? 257  ASP B CA    1 
ATOM   6868  C  C     . ASP B 1 257 ? 57.939  129.330 65.552  1.00 19.11 ? 257  ASP B C     1 
ATOM   6869  O  O     . ASP B 1 257 ? 59.102  128.939 65.532  1.00 17.63 ? 257  ASP B O     1 
ATOM   6870  C  CB    . ASP B 1 257 ? 56.922  129.268 63.284  1.00 16.93 ? 257  ASP B CB    1 
ATOM   6871  C  CG    . ASP B 1 257 ? 55.941  129.943 62.337  1.00 19.07 ? 257  ASP B CG    1 
ATOM   6872  O  OD1   . ASP B 1 257 ? 55.174  130.820 62.795  1.00 19.67 ? 257  ASP B OD1   1 
ATOM   6873  O  OD2   . ASP B 1 257 ? 55.923  129.579 61.138  1.00 17.81 ? 257  ASP B OD2   1 
ATOM   6874  N  N     . PRO B 1 258 ? 57.113  129.043 66.569  1.00 20.55 ? 258  PRO B N     1 
ATOM   6875  C  CA    . PRO B 1 258 ? 57.592  128.215 67.683  1.00 19.17 ? 258  PRO B CA    1 
ATOM   6876  C  C     . PRO B 1 258 ? 57.909  126.797 67.238  1.00 19.00 ? 258  PRO B C     1 
ATOM   6877  O  O     . PRO B 1 258 ? 57.142  126.184 66.498  1.00 20.46 ? 258  PRO B O     1 
ATOM   6878  C  CB    . PRO B 1 258 ? 56.437  128.270 68.683  1.00 19.03 ? 258  PRO B CB    1 
ATOM   6879  C  CG    . PRO B 1 258 ? 55.237  128.508 67.813  1.00 21.84 ? 258  PRO B CG    1 
ATOM   6880  C  CD    . PRO B 1 258 ? 55.746  129.530 66.818  1.00 19.52 ? 258  PRO B CD    1 
ATOM   6881  N  N     . LEU B 1 259 ? 59.055  126.291 67.677  1.00 18.34 ? 259  LEU B N     1 
ATOM   6882  C  CA    . LEU B 1 259 ? 59.482  124.941 67.336  1.00 17.74 ? 259  LEU B CA    1 
ATOM   6883  C  C     . LEU B 1 259 ? 59.175  124.000 68.495  1.00 16.85 ? 259  LEU B C     1 
ATOM   6884  O  O     . LEU B 1 259 ? 58.406  123.051 68.342  1.00 15.08 ? 259  LEU B O     1 
ATOM   6885  C  CB    . LEU B 1 259 ? 60.987  124.918 67.035  1.00 16.74 ? 259  LEU B CB    1 
ATOM   6886  C  CG    . LEU B 1 259 ? 61.589  123.594 66.578  1.00 15.98 ? 259  LEU B CG    1 
ATOM   6887  C  CD1   . LEU B 1 259 ? 60.892  123.098 65.315  1.00 18.17 ? 259  LEU B CD1   1 
ATOM   6888  C  CD2   . LEU B 1 259 ? 63.066  123.794 66.323  1.00 18.53 ? 259  LEU B CD2   1 
ATOM   6889  N  N     . PHE B 1 260 ? 59.763  124.271 69.660  1.00 15.57 ? 260  PHE B N     1 
ATOM   6890  C  CA    . PHE B 1 260 ? 59.537  123.406 70.816  1.00 15.68 ? 260  PHE B CA    1 
ATOM   6891  C  C     . PHE B 1 260 ? 59.584  124.089 72.171  1.00 16.28 ? 260  PHE B C     1 
ATOM   6892  O  O     . PHE B 1 260 ? 59.945  125.260 72.289  1.00 15.70 ? 260  PHE B O     1 
ATOM   6893  C  CB    . PHE B 1 260 ? 60.538  122.248 70.809  1.00 12.78 ? 260  PHE B CB    1 
ATOM   6894  C  CG    . PHE B 1 260 ? 61.962  122.666 71.031  1.00 12.21 ? 260  PHE B CG    1 
ATOM   6895  C  CD1   . PHE B 1 260 ? 62.427  122.971 72.307  1.00 12.16 ? 260  PHE B CD1   1 
ATOM   6896  C  CD2   . PHE B 1 260 ? 62.852  122.724 69.963  1.00 12.02 ? 260  PHE B CD2   1 
ATOM   6897  C  CE1   . PHE B 1 260 ? 63.765  123.327 72.520  1.00 12.95 ? 260  PHE B CE1   1 
ATOM   6898  C  CE2   . PHE B 1 260 ? 64.193  123.077 70.160  1.00 13.50 ? 260  PHE B CE2   1 
ATOM   6899  C  CZ    . PHE B 1 260 ? 64.651  123.379 71.443  1.00 14.62 ? 260  PHE B CZ    1 
ATOM   6900  N  N     . ILE B 1 261 ? 59.221  123.323 73.195  1.00 17.74 ? 261  ILE B N     1 
ATOM   6901  C  CA    . ILE B 1 261 ? 59.206  123.805 74.568  1.00 18.53 ? 261  ILE B CA    1 
ATOM   6902  C  C     . ILE B 1 261 ? 59.860  122.791 75.503  1.00 19.08 ? 261  ILE B C     1 
ATOM   6903  O  O     . ILE B 1 261 ? 59.542  121.598 75.469  1.00 18.38 ? 261  ILE B O     1 
ATOM   6904  C  CB    . ILE B 1 261 ? 57.765  124.039 75.048  1.00 21.52 ? 261  ILE B CB    1 
ATOM   6905  C  CG1   . ILE B 1 261 ? 57.145  125.200 74.275  1.00 22.19 ? 261  ILE B CG1   1 
ATOM   6906  C  CG2   . ILE B 1 261 ? 57.748  124.310 76.545  1.00 23.36 ? 261  ILE B CG2   1 
ATOM   6907  C  CD1   . ILE B 1 261 ? 55.660  125.311 74.477  1.00 28.58 ? 261  ILE B CD1   1 
ATOM   6908  N  N     . LEU B 1 262 ? 60.770  123.274 76.341  1.00 16.85 ? 262  LEU B N     1 
ATOM   6909  C  CA    . LEU B 1 262 ? 61.454  122.425 77.301  1.00 17.16 ? 262  LEU B CA    1 
ATOM   6910  C  C     . LEU B 1 262 ? 61.335  123.056 78.673  1.00 18.46 ? 262  LEU B C     1 
ATOM   6911  O  O     . LEU B 1 262 ? 61.834  124.165 78.905  1.00 18.86 ? 262  LEU B O     1 
ATOM   6912  C  CB    . LEU B 1 262 ? 62.934  122.267 76.942  1.00 16.73 ? 262  LEU B CB    1 
ATOM   6913  C  CG    . LEU B 1 262 ? 63.307  121.202 75.904  1.00 15.63 ? 262  LEU B CG    1 
ATOM   6914  C  CD1   . LEU B 1 262 ? 64.804  121.248 75.638  1.00 15.28 ? 262  LEU B CD1   1 
ATOM   6915  C  CD2   . LEU B 1 262 ? 62.917  119.827 76.418  1.00 15.56 ? 262  LEU B CD2   1 
ATOM   6916  N  N     . TYR B 1 263 ? 60.660  122.358 79.580  1.00 17.22 ? 263  TYR B N     1 
ATOM   6917  C  CA    . TYR B 1 263 ? 60.494  122.870 80.925  1.00 16.60 ? 263  TYR B CA    1 
ATOM   6918  C  C     . TYR B 1 263 ? 61.804  122.781 81.694  1.00 17.85 ? 263  TYR B C     1 
ATOM   6919  O  O     . TYR B 1 263 ? 62.447  121.730 81.756  1.00 19.09 ? 263  TYR B O     1 
ATOM   6920  C  CB    . TYR B 1 263 ? 59.361  122.124 81.626  1.00 16.57 ? 263  TYR B CB    1 
ATOM   6921  C  CG    . TYR B 1 263 ? 58.020  122.541 81.072  1.00 14.23 ? 263  TYR B CG    1 
ATOM   6922  C  CD1   . TYR B 1 263 ? 57.515  121.970 79.904  1.00 13.87 ? 263  TYR B CD1   1 
ATOM   6923  C  CD2   . TYR B 1 263 ? 57.306  123.591 81.651  1.00 11.82 ? 263  TYR B CD2   1 
ATOM   6924  C  CE1   . TYR B 1 263 ? 56.338  122.438 79.322  1.00 11.30 ? 263  TYR B CE1   1 
ATOM   6925  C  CE2   . TYR B 1 263 ? 56.132  124.066 81.076  1.00 11.45 ? 263  TYR B CE2   1 
ATOM   6926  C  CZ    . TYR B 1 263 ? 55.658  123.489 79.911  1.00 12.41 ? 263  TYR B CZ    1 
ATOM   6927  O  OH    . TYR B 1 263 ? 54.523  123.995 79.319  1.00 16.69 ? 263  TYR B OH    1 
ATOM   6928  N  N     . THR B 1 264 ? 62.203  123.911 82.261  1.00 17.70 ? 264  THR B N     1 
ATOM   6929  C  CA    . THR B 1 264 ? 63.458  124.009 82.989  1.00 18.61 ? 264  THR B CA    1 
ATOM   6930  C  C     . THR B 1 264 ? 63.257  124.548 84.399  1.00 18.10 ? 264  THR B C     1 
ATOM   6931  O  O     . THR B 1 264 ? 62.482  125.482 84.618  1.00 17.64 ? 264  THR B O     1 
ATOM   6932  C  CB    . THR B 1 264 ? 64.425  124.932 82.225  1.00 18.81 ? 264  THR B CB    1 
ATOM   6933  O  OG1   . THR B 1 264 ? 64.235  124.735 80.816  1.00 18.13 ? 264  THR B OG1   1 
ATOM   6934  C  CG2   . THR B 1 264 ? 65.873  124.615 82.585  1.00 19.53 ? 264  THR B CG2   1 
ATOM   6935  N  N     . SER B 1 265 ? 63.965  123.959 85.355  1.00 17.80 ? 265  SER B N     1 
ATOM   6936  C  CA    . SER B 1 265 ? 63.857  124.385 86.741  1.00 20.62 ? 265  SER B CA    1 
ATOM   6937  C  C     . SER B 1 265 ? 64.515  125.744 86.943  1.00 21.52 ? 265  SER B C     1 
ATOM   6938  O  O     . SER B 1 265 ? 65.606  126.007 86.433  1.00 22.26 ? 265  SER B O     1 
ATOM   6939  C  CB    . SER B 1 265 ? 64.509  123.349 87.664  1.00 21.30 ? 265  SER B CB    1 
ATOM   6940  O  OG    . SER B 1 265 ? 63.868  122.087 87.555  1.00 18.95 ? 265  SER B OG    1 
ATOM   6941  N  N     . GLY B 1 266 ? 63.841  126.604 87.691  1.00 22.53 ? 266  GLY B N     1 
ATOM   6942  C  CA    . GLY B 1 266 ? 64.384  127.919 87.955  1.00 23.89 ? 266  GLY B CA    1 
ATOM   6943  C  C     . GLY B 1 266 ? 64.771  128.069 89.410  1.00 26.12 ? 266  GLY B C     1 
ATOM   6944  O  O     . GLY B 1 266 ? 64.708  127.113 90.180  1.00 24.38 ? 266  GLY B O     1 
ATOM   6945  N  N     . SER B 1 267 ? 65.174  129.278 89.789  1.00 28.89 ? 267  SER B N     1 
ATOM   6946  C  CA    . SER B 1 267 ? 65.573  129.553 91.158  1.00 30.25 ? 267  SER B CA    1 
ATOM   6947  C  C     . SER B 1 267 ? 64.338  129.638 92.054  1.00 31.89 ? 267  SER B C     1 
ATOM   6948  O  O     . SER B 1 267 ? 64.439  129.511 93.273  1.00 33.34 ? 267  SER B O     1 
ATOM   6949  C  CB    . SER B 1 267 ? 66.364  130.862 91.218  1.00 30.23 ? 267  SER B CB    1 
ATOM   6950  O  OG    . SER B 1 267 ? 67.094  130.964 92.432  1.00 32.34 ? 267  SER B OG    1 
ATOM   6951  N  N     . THR B 1 268 ? 63.174  129.847 91.443  1.00 31.39 ? 268  THR B N     1 
ATOM   6952  C  CA    . THR B 1 268 ? 61.921  129.926 92.189  1.00 32.45 ? 268  THR B CA    1 
ATOM   6953  C  C     . THR B 1 268 ? 60.780  129.324 91.381  1.00 31.26 ? 268  THR B C     1 
ATOM   6954  O  O     . THR B 1 268 ? 60.907  129.102 90.179  1.00 32.86 ? 268  THR B O     1 
ATOM   6955  C  CB    . THR B 1 268 ? 61.548  131.388 92.550  1.00 33.91 ? 268  THR B CB    1 
ATOM   6956  O  OG1   . THR B 1 268 ? 61.475  132.176 91.354  1.00 33.28 ? 268  THR B OG1   1 
ATOM   6957  C  CG2   . THR B 1 268 ? 62.586  131.991 93.490  1.00 35.47 ? 268  THR B CG2   1 
ATOM   6958  N  N     . GLY B 1 269 ? 59.665  129.058 92.052  1.00 30.32 ? 269  GLY B N     1 
ATOM   6959  C  CA    . GLY B 1 269 ? 58.511  128.489 91.380  1.00 29.00 ? 269  GLY B CA    1 
ATOM   6960  C  C     . GLY B 1 269 ? 58.792  127.182 90.662  1.00 27.58 ? 269  GLY B C     1 
ATOM   6961  O  O     . GLY B 1 269 ? 59.919  126.678 90.671  1.00 26.20 ? 269  GLY B O     1 
ATOM   6962  N  N     . LYS B 1 270 ? 57.754  126.637 90.032  1.00 27.02 ? 270  LYS B N     1 
ATOM   6963  C  CA    . LYS B 1 270 ? 57.851  125.378 89.299  1.00 26.32 ? 270  LYS B CA    1 
ATOM   6964  C  C     . LYS B 1 270 ? 58.595  125.581 87.977  1.00 24.24 ? 270  LYS B C     1 
ATOM   6965  O  O     . LYS B 1 270 ? 58.819  126.711 87.548  1.00 23.90 ? 270  LYS B O     1 
ATOM   6966  C  CB    . LYS B 1 270 ? 56.445  124.817 89.045  1.00 26.13 ? 270  LYS B CB    1 
ATOM   6967  N  N     . PRO B 1 271 ? 58.990  124.483 87.315  1.00 24.16 ? 271  PRO B N     1 
ATOM   6968  C  CA    . PRO B 1 271 ? 59.709  124.605 86.043  1.00 22.88 ? 271  PRO B CA    1 
ATOM   6969  C  C     . PRO B 1 271 ? 58.906  125.369 84.993  1.00 21.73 ? 271  PRO B C     1 
ATOM   6970  O  O     . PRO B 1 271 ? 57.693  125.201 84.892  1.00 20.40 ? 271  PRO B O     1 
ATOM   6971  C  CB    . PRO B 1 271 ? 59.949  123.151 85.643  1.00 22.72 ? 271  PRO B CB    1 
ATOM   6972  C  CG    . PRO B 1 271 ? 60.043  122.446 86.962  1.00 22.18 ? 271  PRO B CG    1 
ATOM   6973  C  CD    . PRO B 1 271 ? 58.890  123.072 87.724  1.00 23.25 ? 271  PRO B CD    1 
ATOM   6974  N  N     . LYS B 1 272 ? 59.581  126.219 84.225  1.00 21.38 ? 272  LYS B N     1 
ATOM   6975  C  CA    . LYS B 1 272 ? 58.920  126.998 83.181  1.00 20.92 ? 272  LYS B CA    1 
ATOM   6976  C  C     . LYS B 1 272 ? 59.272  126.449 81.802  1.00 18.92 ? 272  LYS B C     1 
ATOM   6977  O  O     . LYS B 1 272 ? 60.335  125.854 81.616  1.00 20.19 ? 272  LYS B O     1 
ATOM   6978  C  CB    . LYS B 1 272 ? 59.335  128.471 83.264  1.00 21.98 ? 272  LYS B CB    1 
ATOM   6979  C  CG    . LYS B 1 272 ? 59.108  129.124 84.619  1.00 23.45 ? 272  LYS B CG    1 
ATOM   6980  C  CD    . LYS B 1 272 ? 57.635  129.171 85.013  1.00 24.14 ? 272  LYS B CD    1 
ATOM   6981  C  CE    . LYS B 1 272 ? 57.487  129.714 86.436  1.00 26.22 ? 272  LYS B CE    1 
ATOM   6982  N  NZ    . LYS B 1 272 ? 56.075  129.831 86.892  1.00 27.26 ? 272  LYS B NZ    1 
ATOM   6983  N  N     . GLY B 1 273 ? 58.382  126.657 80.836  1.00 17.34 ? 273  GLY B N     1 
ATOM   6984  C  CA    . GLY B 1 273 ? 58.616  126.159 79.491  1.00 15.51 ? 273  GLY B CA    1 
ATOM   6985  C  C     . GLY B 1 273 ? 59.436  127.068 78.587  1.00 14.41 ? 273  GLY B C     1 
ATOM   6986  O  O     . GLY B 1 273 ? 58.894  127.957 77.939  1.00 12.36 ? 273  GLY B O     1 
ATOM   6987  N  N     . VAL B 1 274 ? 60.745  126.835 78.527  1.00 14.22 ? 274  VAL B N     1 
ATOM   6988  C  CA    . VAL B 1 274 ? 61.617  127.648 77.686  1.00 14.00 ? 274  VAL B CA    1 
ATOM   6989  C  C     . VAL B 1 274 ? 61.214  127.437 76.226  1.00 16.35 ? 274  VAL B C     1 
ATOM   6990  O  O     . VAL B 1 274 ? 61.178  126.298 75.741  1.00 16.54 ? 274  VAL B O     1 
ATOM   6991  C  CB    . VAL B 1 274 ? 63.105  127.265 77.885  1.00 13.25 ? 274  VAL B CB    1 
ATOM   6992  C  CG1   . VAL B 1 274 ? 64.008  128.176 77.053  1.00 10.77 ? 274  VAL B CG1   1 
ATOM   6993  C  CG2   . VAL B 1 274 ? 63.467  127.362 79.350  1.00 7.28  ? 274  VAL B CG2   1 
ATOM   6994  N  N     . LEU B 1 275 ? 60.906  128.532 75.529  1.00 15.62 ? 275  LEU B N     1 
ATOM   6995  C  CA    . LEU B 1 275 ? 60.483  128.431 74.135  1.00 15.56 ? 275  LEU B CA    1 
ATOM   6996  C  C     . LEU B 1 275 ? 61.506  128.883 73.094  1.00 15.64 ? 275  LEU B C     1 
ATOM   6997  O  O     . LEU B 1 275 ? 62.043  129.987 73.154  1.00 16.19 ? 275  LEU B O     1 
ATOM   6998  C  CB    . LEU B 1 275 ? 59.163  129.191 73.924  1.00 13.64 ? 275  LEU B CB    1 
ATOM   6999  C  CG    . LEU B 1 275 ? 58.479  129.014 72.556  1.00 15.84 ? 275  LEU B CG    1 
ATOM   7000  C  CD1   . LEU B 1 275 ? 56.973  129.010 72.722  1.00 10.88 ? 275  LEU B CD1   1 
ATOM   7001  C  CD2   . LEU B 1 275 ? 58.917  130.122 71.602  1.00 15.23 ? 275  LEU B CD2   1 
ATOM   7002  N  N     . HIS B 1 276 ? 61.755  128.000 72.131  1.00 17.03 ? 276  HIS B N     1 
ATOM   7003  C  CA    . HIS B 1 276 ? 62.686  128.244 71.034  1.00 15.09 ? 276  HIS B CA    1 
ATOM   7004  C  C     . HIS B 1 276 ? 61.921  128.335 69.721  1.00 15.50 ? 276  HIS B C     1 
ATOM   7005  O  O     . HIS B 1 276 ? 60.948  127.604 69.511  1.00 14.70 ? 276  HIS B O     1 
ATOM   7006  C  CB    . HIS B 1 276 ? 63.687  127.095 70.921  1.00 14.80 ? 276  HIS B CB    1 
ATOM   7007  C  CG    . HIS B 1 276 ? 64.837  127.198 71.869  1.00 16.19 ? 276  HIS B CG    1 
ATOM   7008  N  ND1   . HIS B 1 276 ? 65.836  128.136 71.728  1.00 15.00 ? 276  HIS B ND1   1 
ATOM   7009  C  CD2   . HIS B 1 276 ? 65.139  126.489 72.980  1.00 15.49 ? 276  HIS B CD2   1 
ATOM   7010  C  CE1   . HIS B 1 276 ? 66.704  128.001 72.713  1.00 16.81 ? 276  HIS B CE1   1 
ATOM   7011  N  NE2   . HIS B 1 276 ? 66.304  127.008 73.488  1.00 18.66 ? 276  HIS B NE2   1 
ATOM   7012  N  N     . THR B 1 277 ? 62.343  129.231 68.836  1.00 13.84 ? 277  THR B N     1 
ATOM   7013  C  CA    . THR B 1 277 ? 61.673  129.313 67.550  1.00 14.44 ? 277  THR B CA    1 
ATOM   7014  C  C     . THR B 1 277 ? 62.424  128.422 66.563  1.00 14.45 ? 277  THR B C     1 
ATOM   7015  O  O     . THR B 1 277 ? 63.191  127.551 66.978  1.00 13.12 ? 277  THR B O     1 
ATOM   7016  C  CB    . THR B 1 277 ? 61.553  130.767 67.028  1.00 13.73 ? 277  THR B CB    1 
ATOM   7017  O  OG1   . THR B 1 277 ? 62.815  131.441 67.132  1.00 14.06 ? 277  THR B OG1   1 
ATOM   7018  C  CG2   . THR B 1 277 ? 60.501  131.513 67.822  1.00 14.57 ? 277  THR B CG2   1 
ATOM   7019  N  N     . THR B 1 278 ? 62.230  128.650 65.269  1.00 15.05 ? 278  THR B N     1 
ATOM   7020  C  CA    . THR B 1 278 ? 62.838  127.800 64.251  1.00 15.10 ? 278  THR B CA    1 
ATOM   7021  C  C     . THR B 1 278 ? 64.164  128.218 63.609  1.00 15.78 ? 278  THR B C     1 
ATOM   7022  O  O     . THR B 1 278 ? 65.185  127.548 63.778  1.00 17.19 ? 278  THR B O     1 
ATOM   7023  C  CB    . THR B 1 278 ? 61.819  127.542 63.121  1.00 13.56 ? 278  THR B CB    1 
ATOM   7024  O  OG1   . THR B 1 278 ? 60.582  127.082 63.687  1.00 12.61 ? 278  THR B OG1   1 
ATOM   7025  C  CG2   . THR B 1 278 ? 62.353  126.489 62.153  1.00 12.80 ? 278  THR B CG2   1 
ATOM   7026  N  N     . GLY B 1 279 ? 64.121  129.308 62.850  1.00 14.39 ? 279  GLY B N     1 
ATOM   7027  C  CA    . GLY B 1 279 ? 65.288  129.801 62.138  1.00 12.70 ? 279  GLY B CA    1 
ATOM   7028  C  C     . GLY B 1 279 ? 66.593  129.917 62.892  1.00 12.96 ? 279  GLY B C     1 
ATOM   7029  O  O     . GLY B 1 279 ? 67.535  129.149 62.653  1.00 12.73 ? 279  GLY B O     1 
ATOM   7030  N  N     . GLY B 1 280 ? 66.656  130.903 63.781  1.00 12.61 ? 280  GLY B N     1 
ATOM   7031  C  CA    . GLY B 1 280 ? 67.854  131.124 64.566  1.00 14.54 ? 280  GLY B CA    1 
ATOM   7032  C  C     . GLY B 1 280 ? 68.287  129.892 65.333  1.00 16.45 ? 280  GLY B C     1 
ATOM   7033  O  O     . GLY B 1 280 ? 69.477  129.578 65.386  1.00 20.10 ? 280  GLY B O     1 
ATOM   7034  N  N     . TYR B 1 281 ? 67.332  129.186 65.933  1.00 16.11 ? 281  TYR B N     1 
ATOM   7035  C  CA    . TYR B 1 281 ? 67.676  127.990 66.689  1.00 16.79 ? 281  TYR B CA    1 
ATOM   7036  C  C     . TYR B 1 281 ? 68.371  126.945 65.826  1.00 17.01 ? 281  TYR B C     1 
ATOM   7037  O  O     . TYR B 1 281 ? 69.450  126.469 66.175  1.00 18.62 ? 281  TYR B O     1 
ATOM   7038  C  CB    . TYR B 1 281 ? 66.437  127.345 67.311  1.00 14.56 ? 281  TYR B CB    1 
ATOM   7039  C  CG    . TYR B 1 281 ? 66.734  125.964 67.864  1.00 13.89 ? 281  TYR B CG    1 
ATOM   7040  C  CD1   . TYR B 1 281 ? 67.470  125.808 69.043  1.00 10.97 ? 281  TYR B CD1   1 
ATOM   7041  C  CD2   . TYR B 1 281 ? 66.321  124.816 67.183  1.00 11.13 ? 281  TYR B CD2   1 
ATOM   7042  C  CE1   . TYR B 1 281 ? 67.786  124.541 69.532  1.00 12.34 ? 281  TYR B CE1   1 
ATOM   7043  C  CE2   . TYR B 1 281 ? 66.636  123.544 67.657  1.00 10.84 ? 281  TYR B CE2   1 
ATOM   7044  C  CZ    . TYR B 1 281 ? 67.367  123.413 68.835  1.00 11.80 ? 281  TYR B CZ    1 
ATOM   7045  O  OH    . TYR B 1 281 ? 67.670  122.160 69.312  1.00 10.36 ? 281  TYR B OH    1 
ATOM   7046  N  N     . LEU B 1 282 ? 67.752  126.580 64.705  1.00 15.48 ? 282  LEU B N     1 
ATOM   7047  C  CA    . LEU B 1 282 ? 68.325  125.556 63.842  1.00 13.46 ? 282  LEU B CA    1 
ATOM   7048  C  C     . LEU B 1 282 ? 69.663  125.964 63.246  1.00 12.37 ? 282  LEU B C     1 
ATOM   7049  O  O     . LEU B 1 282 ? 70.563  125.134 63.131  1.00 11.38 ? 282  LEU B O     1 
ATOM   7050  C  CB    . LEU B 1 282 ? 67.338  125.173 62.739  1.00 11.59 ? 282  LEU B CB    1 
ATOM   7051  C  CG    . LEU B 1 282 ? 67.692  123.905 61.958  1.00 11.57 ? 282  LEU B CG    1 
ATOM   7052  C  CD1   . LEU B 1 282 ? 68.049  122.756 62.929  1.00 10.29 ? 282  LEU B CD1   1 
ATOM   7053  C  CD2   . LEU B 1 282 ? 66.514  123.523 61.088  1.00 7.94  ? 282  LEU B CD2   1 
ATOM   7054  N  N     . VAL B 1 283 ? 69.799  127.234 62.875  1.00 12.14 ? 283  VAL B N     1 
ATOM   7055  C  CA    . VAL B 1 283 ? 71.062  127.729 62.322  1.00 11.31 ? 283  VAL B CA    1 
ATOM   7056  C  C     . VAL B 1 283 ? 72.167  127.572 63.374  1.00 12.09 ? 283  VAL B C     1 
ATOM   7057  O  O     . VAL B 1 283 ? 73.233  127.018 63.098  1.00 12.31 ? 283  VAL B O     1 
ATOM   7058  C  CB    . VAL B 1 283 ? 70.981  129.237 61.949  1.00 11.58 ? 283  VAL B CB    1 
ATOM   7059  C  CG1   . VAL B 1 283 ? 72.365  129.759 61.617  1.00 10.39 ? 283  VAL B CG1   1 
ATOM   7060  C  CG2   . VAL B 1 283 ? 70.047  129.448 60.764  1.00 12.66 ? 283  VAL B CG2   1 
ATOM   7061  N  N     . TYR B 1 284 ? 71.897  128.052 64.583  1.00 11.67 ? 284  TYR B N     1 
ATOM   7062  C  CA    . TYR B 1 284 ? 72.881  127.994 65.657  1.00 12.38 ? 284  TYR B CA    1 
ATOM   7063  C  C     . TYR B 1 284 ? 73.272  126.558 66.024  1.00 12.41 ? 284  TYR B C     1 
ATOM   7064  O  O     . TYR B 1 284 ? 74.459  126.244 66.152  1.00 10.21 ? 284  TYR B O     1 
ATOM   7065  C  CB    . TYR B 1 284 ? 72.357  128.754 66.885  1.00 12.53 ? 284  TYR B CB    1 
ATOM   7066  C  CG    . TYR B 1 284 ? 73.454  129.275 67.798  1.00 11.32 ? 284  TYR B CG    1 
ATOM   7067  C  CD1   . TYR B 1 284 ? 73.700  128.682 69.035  1.00 11.32 ? 284  TYR B CD1   1 
ATOM   7068  C  CD2   . TYR B 1 284 ? 74.259  130.347 67.411  1.00 12.23 ? 284  TYR B CD2   1 
ATOM   7069  C  CE1   . TYR B 1 284 ? 74.723  129.136 69.872  1.00 10.48 ? 284  TYR B CE1   1 
ATOM   7070  C  CE2   . TYR B 1 284 ? 75.296  130.814 68.242  1.00 10.59 ? 284  TYR B CE2   1 
ATOM   7071  C  CZ    . TYR B 1 284 ? 75.518  130.202 69.465  1.00 10.10 ? 284  TYR B CZ    1 
ATOM   7072  O  OH    . TYR B 1 284 ? 76.540  130.642 70.268  1.00 7.02  ? 284  TYR B OH    1 
ATOM   7073  N  N     . ALA B 1 285 ? 72.276  125.687 66.170  1.00 11.00 ? 285  ALA B N     1 
ATOM   7074  C  CA    . ALA B 1 285 ? 72.536  124.295 66.517  1.00 11.74 ? 285  ALA B CA    1 
ATOM   7075  C  C     . ALA B 1 285 ? 73.434  123.615 65.487  1.00 12.50 ? 285  ALA B C     1 
ATOM   7076  O  O     . ALA B 1 285 ? 74.359  122.883 65.844  1.00 11.44 ? 285  ALA B O     1 
ATOM   7077  C  CB    . ALA B 1 285 ? 71.215  123.526 66.647  1.00 12.53 ? 285  ALA B CB    1 
ATOM   7078  N  N     . ALA B 1 286 ? 73.152  123.859 64.212  1.00 13.38 ? 286  ALA B N     1 
ATOM   7079  C  CA    . ALA B 1 286 ? 73.922  123.259 63.129  1.00 15.12 ? 286  ALA B CA    1 
ATOM   7080  C  C     . ALA B 1 286 ? 75.337  123.827 63.018  1.00 15.37 ? 286  ALA B C     1 
ATOM   7081  O  O     . ALA B 1 286 ? 76.288  123.096 62.738  1.00 16.22 ? 286  ALA B O     1 
ATOM   7082  C  CB    . ALA B 1 286 ? 73.188  123.441 61.812  1.00 14.03 ? 286  ALA B CB    1 
ATOM   7083  N  N     . THR B 1 287 ? 75.474  125.127 63.245  1.00 13.99 ? 287  THR B N     1 
ATOM   7084  C  CA    . THR B 1 287 ? 76.773  125.785 63.152  1.00 13.66 ? 287  THR B CA    1 
ATOM   7085  C  C     . THR B 1 287 ? 77.713  125.351 64.281  1.00 15.44 ? 287  THR B C     1 
ATOM   7086  O  O     . THR B 1 287 ? 78.883  125.047 64.039  1.00 15.41 ? 287  THR B O     1 
ATOM   7087  C  CB    . THR B 1 287 ? 76.593  127.322 63.160  1.00 12.73 ? 287  THR B CB    1 
ATOM   7088  O  OG1   . THR B 1 287 ? 75.828  127.706 62.009  1.00 10.18 ? 287  THR B OG1   1 
ATOM   7089  C  CG2   . THR B 1 287 ? 77.936  128.034 63.146  1.00 10.85 ? 287  THR B CG2   1 
ATOM   7090  N  N     . THR B 1 288 ? 77.199  125.326 65.509  1.00 14.70 ? 288  THR B N     1 
ATOM   7091  C  CA    . THR B 1 288 ? 77.989  124.909 66.664  1.00 14.93 ? 288  THR B CA    1 
ATOM   7092  C  C     . THR B 1 288 ? 78.379  123.446 66.515  1.00 16.51 ? 288  THR B C     1 
ATOM   7093  O  O     . THR B 1 288 ? 79.548  123.088 66.685  1.00 18.77 ? 288  THR B O     1 
ATOM   7094  C  CB    . THR B 1 288 ? 77.207  125.073 67.975  1.00 13.10 ? 288  THR B CB    1 
ATOM   7095  O  OG1   . THR B 1 288 ? 75.860  124.621 67.781  1.00 12.70 ? 288  THR B OG1   1 
ATOM   7096  C  CG2   . THR B 1 288 ? 77.203  126.515 68.412  1.00 11.21 ? 288  THR B CG2   1 
ATOM   7097  N  N     . PHE B 1 289 ? 77.406  122.601 66.187  1.00 15.93 ? 289  PHE B N     1 
ATOM   7098  C  CA    . PHE B 1 289 ? 77.684  121.178 66.019  1.00 17.32 ? 289  PHE B CA    1 
ATOM   7099  C  C     . PHE B 1 289 ? 78.836  120.950 65.060  1.00 17.66 ? 289  PHE B C     1 
ATOM   7100  O  O     . PHE B 1 289 ? 79.786  120.243 65.379  1.00 18.15 ? 289  PHE B O     1 
ATOM   7101  C  CB    . PHE B 1 289 ? 76.471  120.422 65.472  1.00 14.64 ? 289  PHE B CB    1 
ATOM   7102  C  CG    . PHE B 1 289 ? 76.814  119.053 64.935  1.00 15.54 ? 289  PHE B CG    1 
ATOM   7103  C  CD1   . PHE B 1 289 ? 76.962  117.967 65.792  1.00 16.48 ? 289  PHE B CD1   1 
ATOM   7104  C  CD2   . PHE B 1 289 ? 77.048  118.865 63.578  1.00 14.59 ? 289  PHE B CD2   1 
ATOM   7105  C  CE1   . PHE B 1 289 ? 77.341  116.712 65.305  1.00 14.50 ? 289  PHE B CE1   1 
ATOM   7106  C  CE2   . PHE B 1 289 ? 77.428  117.616 63.081  1.00 17.03 ? 289  PHE B CE2   1 
ATOM   7107  C  CZ    . PHE B 1 289 ? 77.574  116.540 63.948  1.00 15.49 ? 289  PHE B CZ    1 
ATOM   7108  N  N     . LYS B 1 290 ? 78.727  121.544 63.877  1.00 18.45 ? 290  LYS B N     1 
ATOM   7109  C  CA    . LYS B 1 290 ? 79.736  121.398 62.837  1.00 20.22 ? 290  LYS B CA    1 
ATOM   7110  C  C     . LYS B 1 290 ? 81.136  121.888 63.218  1.00 20.54 ? 290  LYS B C     1 
ATOM   7111  O  O     . LYS B 1 290 ? 82.124  121.177 63.037  1.00 20.48 ? 290  LYS B O     1 
ATOM   7112  C  CB    . LYS B 1 290 ? 79.270  122.131 61.581  1.00 19.45 ? 290  LYS B CB    1 
ATOM   7113  C  CG    . LYS B 1 290 ? 80.176  121.968 60.369  1.00 21.59 ? 290  LYS B CG    1 
ATOM   7114  C  CD    . LYS B 1 290 ? 79.645  122.789 59.197  1.00 23.24 ? 290  LYS B CD    1 
ATOM   7115  C  CE    . LYS B 1 290 ? 80.347  122.445 57.899  1.00 23.89 ? 290  LYS B CE    1 
ATOM   7116  N  NZ    . LYS B 1 290 ? 79.772  123.204 56.759  1.00 25.06 ? 290  LYS B NZ    1 
ATOM   7117  N  N     . TYR B 1 291 ? 81.220  123.100 63.752  1.00 20.75 ? 291  TYR B N     1 
ATOM   7118  C  CA    . TYR B 1 291 ? 82.507  123.676 64.112  1.00 22.13 ? 291  TYR B CA    1 
ATOM   7119  C  C     . TYR B 1 291 ? 83.115  123.180 65.413  1.00 21.57 ? 291  TYR B C     1 
ATOM   7120  O  O     . TYR B 1 291 ? 84.313  122.906 65.474  1.00 22.04 ? 291  TYR B O     1 
ATOM   7121  C  CB    . TYR B 1 291 ? 82.388  125.199 64.126  1.00 22.64 ? 291  TYR B CB    1 
ATOM   7122  C  CG    . TYR B 1 291 ? 82.122  125.770 62.752  1.00 25.59 ? 291  TYR B CG    1 
ATOM   7123  C  CD1   . TYR B 1 291 ? 81.328  126.904 62.584  1.00 27.30 ? 291  TYR B CD1   1 
ATOM   7124  C  CD2   . TYR B 1 291 ? 82.672  125.176 61.612  1.00 26.03 ? 291  TYR B CD2   1 
ATOM   7125  C  CE1   . TYR B 1 291 ? 81.086  127.432 61.318  1.00 28.24 ? 291  TYR B CE1   1 
ATOM   7126  C  CE2   . TYR B 1 291 ? 82.436  125.694 60.344  1.00 27.50 ? 291  TYR B CE2   1 
ATOM   7127  C  CZ    . TYR B 1 291 ? 81.643  126.822 60.203  1.00 28.77 ? 291  TYR B CZ    1 
ATOM   7128  O  OH    . TYR B 1 291 ? 81.407  127.332 58.946  1.00 30.68 ? 291  TYR B OH    1 
ATOM   7129  N  N     . VAL B 1 292 ? 82.303  123.054 66.455  1.00 20.92 ? 292  VAL B N     1 
ATOM   7130  C  CA    . VAL B 1 292 ? 82.822  122.590 67.731  1.00 19.80 ? 292  VAL B CA    1 
ATOM   7131  C  C     . VAL B 1 292 ? 83.220  121.117 67.689  1.00 20.93 ? 292  VAL B C     1 
ATOM   7132  O  O     . VAL B 1 292 ? 84.174  120.710 68.346  1.00 21.39 ? 292  VAL B O     1 
ATOM   7133  C  CB    . VAL B 1 292 ? 81.803  122.824 68.856  1.00 18.26 ? 292  VAL B CB    1 
ATOM   7134  C  CG1   . VAL B 1 292 ? 82.289  122.183 70.144  1.00 18.66 ? 292  VAL B CG1   1 
ATOM   7135  C  CG2   . VAL B 1 292 ? 81.604  124.320 69.058  1.00 16.89 ? 292  VAL B CG2   1 
ATOM   7136  N  N     . PHE B 1 293 ? 82.499  120.314 66.913  1.00 20.13 ? 293  PHE B N     1 
ATOM   7137  C  CA    . PHE B 1 293 ? 82.820  118.898 66.810  1.00 20.80 ? 293  PHE B CA    1 
ATOM   7138  C  C     . PHE B 1 293 ? 83.628  118.587 65.555  1.00 21.17 ? 293  PHE B C     1 
ATOM   7139  O  O     . PHE B 1 293 ? 83.886  117.420 65.249  1.00 18.60 ? 293  PHE B O     1 
ATOM   7140  C  CB    . PHE B 1 293 ? 81.539  118.055 66.833  1.00 19.08 ? 293  PHE B CB    1 
ATOM   7141  C  CG    . PHE B 1 293 ? 80.809  118.103 68.149  1.00 19.23 ? 293  PHE B CG    1 
ATOM   7142  C  CD1   . PHE B 1 293 ? 79.537  118.659 68.239  1.00 19.12 ? 293  PHE B CD1   1 
ATOM   7143  C  CD2   . PHE B 1 293 ? 81.402  117.603 69.305  1.00 17.44 ? 293  PHE B CD2   1 
ATOM   7144  C  CE1   . PHE B 1 293 ? 78.865  118.719 69.461  1.00 18.71 ? 293  PHE B CE1   1 
ATOM   7145  C  CE2   . PHE B 1 293 ? 80.736  117.658 70.532  1.00 17.83 ? 293  PHE B CE2   1 
ATOM   7146  C  CZ    . PHE B 1 293 ? 79.466  118.218 70.609  1.00 17.18 ? 293  PHE B CZ    1 
ATOM   7147  N  N     . ASP B 1 294 ? 84.038  119.638 64.843  1.00 20.91 ? 294  ASP B N     1 
ATOM   7148  C  CA    . ASP B 1 294 ? 84.817  119.507 63.610  1.00 20.08 ? 294  ASP B CA    1 
ATOM   7149  C  C     . ASP B 1 294 ? 84.245  118.421 62.699  1.00 18.62 ? 294  ASP B C     1 
ATOM   7150  O  O     . ASP B 1 294 ? 84.986  117.657 62.087  1.00 17.88 ? 294  ASP B O     1 
ATOM   7151  C  CB    . ASP B 1 294 ? 86.277  119.174 63.923  1.00 21.87 ? 294  ASP B CB    1 
ATOM   7152  C  CG    . ASP B 1 294 ? 87.219  119.578 62.795  1.00 24.04 ? 294  ASP B CG    1 
ATOM   7153  O  OD1   . ASP B 1 294 ? 88.163  118.816 62.485  1.00 23.86 ? 294  ASP B OD1   1 
ATOM   7154  O  OD2   . ASP B 1 294 ? 87.014  120.671 62.228  1.00 23.60 ? 294  ASP B OD2   1 
ATOM   7155  N  N     . TYR B 1 295 ? 82.924  118.374 62.600  1.00 17.57 ? 295  TYR B N     1 
ATOM   7156  C  CA    . TYR B 1 295 ? 82.260  117.373 61.786  1.00 18.98 ? 295  TYR B CA    1 
ATOM   7157  C  C     . TYR B 1 295 ? 82.672  117.301 60.313  1.00 19.47 ? 295  TYR B C     1 
ATOM   7158  O  O     . TYR B 1 295 ? 82.637  118.293 59.581  1.00 17.78 ? 295  TYR B O     1 
ATOM   7159  C  CB    . TYR B 1 295 ? 80.747  117.551 61.867  1.00 20.72 ? 295  TYR B CB    1 
ATOM   7160  C  CG    . TYR B 1 295 ? 80.023  116.613 60.943  1.00 22.19 ? 295  TYR B CG    1 
ATOM   7161  C  CD1   . TYR B 1 295 ? 79.954  115.245 61.221  1.00 22.13 ? 295  TYR B CD1   1 
ATOM   7162  C  CD2   . TYR B 1 295 ? 79.492  117.074 59.737  1.00 23.49 ? 295  TYR B CD2   1 
ATOM   7163  C  CE1   . TYR B 1 295 ? 79.380  114.360 60.313  1.00 23.74 ? 295  TYR B CE1   1 
ATOM   7164  C  CE2   . TYR B 1 295 ? 78.922  116.203 58.823  1.00 24.52 ? 295  TYR B CE2   1 
ATOM   7165  C  CZ    . TYR B 1 295 ? 78.870  114.850 59.114  1.00 25.60 ? 295  TYR B CZ    1 
ATOM   7166  O  OH    . TYR B 1 295 ? 78.330  113.990 58.186  1.00 31.18 ? 295  TYR B OH    1 
ATOM   7167  N  N     . HIS B 1 296 ? 83.048  116.097 59.892  1.00 20.61 ? 296  HIS B N     1 
ATOM   7168  C  CA    . HIS B 1 296 ? 83.455  115.829 58.513  1.00 23.03 ? 296  HIS B CA    1 
ATOM   7169  C  C     . HIS B 1 296 ? 82.555  114.750 57.933  1.00 22.38 ? 296  HIS B C     1 
ATOM   7170  O  O     . HIS B 1 296 ? 82.270  113.752 58.588  1.00 24.21 ? 296  HIS B O     1 
ATOM   7171  C  CB    . HIS B 1 296 ? 84.912  115.345 58.451  1.00 22.93 ? 296  HIS B CB    1 
ATOM   7172  C  CG    . HIS B 1 296 ? 85.922  116.440 58.592  1.00 23.82 ? 296  HIS B CG    1 
ATOM   7173  N  ND1   . HIS B 1 296 ? 86.082  117.163 59.754  1.00 23.58 ? 296  HIS B ND1   1 
ATOM   7174  C  CD2   . HIS B 1 296 ? 86.815  116.943 57.708  1.00 25.28 ? 296  HIS B CD2   1 
ATOM   7175  C  CE1   . HIS B 1 296 ? 87.030  118.065 59.580  1.00 24.53 ? 296  HIS B CE1   1 
ATOM   7176  N  NE2   . HIS B 1 296 ? 87.491  117.953 58.348  1.00 26.98 ? 296  HIS B NE2   1 
ATOM   7177  N  N     . PRO B 1 297 ? 82.099  114.932 56.691  1.00 22.62 ? 297  PRO B N     1 
ATOM   7178  C  CA    . PRO B 1 297 ? 81.229  113.929 56.076  1.00 22.89 ? 297  PRO B CA    1 
ATOM   7179  C  C     . PRO B 1 297 ? 81.731  112.513 56.339  1.00 23.35 ? 297  PRO B C     1 
ATOM   7180  O  O     . PRO B 1 297 ? 82.855  112.171 55.982  1.00 23.53 ? 297  PRO B O     1 
ATOM   7181  C  CB    . PRO B 1 297 ? 81.279  114.301 54.600  1.00 22.37 ? 297  PRO B CB    1 
ATOM   7182  C  CG    . PRO B 1 297 ? 81.364  115.795 54.650  1.00 21.75 ? 297  PRO B CG    1 
ATOM   7183  C  CD    . PRO B 1 297 ? 82.390  116.029 55.750  1.00 22.28 ? 297  PRO B CD    1 
ATOM   7184  N  N     . GLY B 1 298 ? 80.899  111.698 56.980  1.00 23.32 ? 298  GLY B N     1 
ATOM   7185  C  CA    . GLY B 1 298 ? 81.297  110.332 57.257  1.00 21.71 ? 298  GLY B CA    1 
ATOM   7186  C  C     . GLY B 1 298 ? 81.553  110.018 58.719  1.00 21.93 ? 298  GLY B C     1 
ATOM   7187  O  O     . GLY B 1 298 ? 81.494  108.852 59.118  1.00 23.75 ? 298  GLY B O     1 
ATOM   7188  N  N     . ASP B 1 299 ? 81.841  111.042 59.520  1.00 19.96 ? 299  ASP B N     1 
ATOM   7189  C  CA    . ASP B 1 299 ? 82.100  110.836 60.944  1.00 19.00 ? 299  ASP B CA    1 
ATOM   7190  C  C     . ASP B 1 299 ? 80.911  110.248 61.691  1.00 18.56 ? 299  ASP B C     1 
ATOM   7191  O  O     . ASP B 1 299 ? 79.759  110.558 61.395  1.00 19.70 ? 299  ASP B O     1 
ATOM   7192  C  CB    . ASP B 1 299 ? 82.483  112.152 61.626  1.00 20.41 ? 299  ASP B CB    1 
ATOM   7193  C  CG    . ASP B 1 299 ? 83.830  112.680 61.177  1.00 22.56 ? 299  ASP B CG    1 
ATOM   7194  O  OD1   . ASP B 1 299 ? 84.683  111.869 60.760  1.00 25.33 ? 299  ASP B OD1   1 
ATOM   7195  O  OD2   . ASP B 1 299 ? 84.042  113.906 61.258  1.00 22.21 ? 299  ASP B OD2   1 
ATOM   7196  N  N     . ILE B 1 300 ? 81.211  109.400 62.669  1.00 17.87 ? 300  ILE B N     1 
ATOM   7197  C  CA    . ILE B 1 300 ? 80.191  108.775 63.503  1.00 17.23 ? 300  ILE B CA    1 
ATOM   7198  C  C     . ILE B 1 300 ? 80.149  109.599 64.790  1.00 16.89 ? 300  ILE B C     1 
ATOM   7199  O  O     . ILE B 1 300 ? 81.138  109.676 65.521  1.00 17.54 ? 300  ILE B O     1 
ATOM   7200  C  CB    . ILE B 1 300 ? 80.568  107.312 63.829  1.00 18.72 ? 300  ILE B CB    1 
ATOM   7201  C  CG1   . ILE B 1 300 ? 80.873  106.555 62.532  1.00 18.37 ? 300  ILE B CG1   1 
ATOM   7202  C  CG2   . ILE B 1 300 ? 79.444  106.638 64.596  1.00 16.99 ? 300  ILE B CG2   1 
ATOM   7203  C  CD1   . ILE B 1 300 ? 79.754  106.571 61.517  1.00 15.95 ? 300  ILE B CD1   1 
ATOM   7204  N  N     . TYR B 1 301 ? 79.008  110.224 65.058  1.00 15.35 ? 301  TYR B N     1 
ATOM   7205  C  CA    . TYR B 1 301 ? 78.854  111.083 66.228  1.00 13.45 ? 301  TYR B CA    1 
ATOM   7206  C  C     . TYR B 1 301 ? 77.930  110.496 67.280  1.00 13.44 ? 301  TYR B C     1 
ATOM   7207  O  O     . TYR B 1 301 ? 76.865  109.944 66.963  1.00 11.71 ? 301  TYR B O     1 
ATOM   7208  C  CB    . TYR B 1 301 ? 78.347  112.462 65.786  1.00 12.12 ? 301  TYR B CB    1 
ATOM   7209  C  CG    . TYR B 1 301 ? 77.916  113.380 66.904  1.00 12.07 ? 301  TYR B CG    1 
ATOM   7210  C  CD1   . TYR B 1 301 ? 76.601  113.379 67.361  1.00 8.83  ? 301  TYR B CD1   1 
ATOM   7211  C  CD2   . TYR B 1 301 ? 78.822  114.267 67.494  1.00 11.10 ? 301  TYR B CD2   1 
ATOM   7212  C  CE1   . TYR B 1 301 ? 76.202  114.240 68.371  1.00 10.58 ? 301  TYR B CE1   1 
ATOM   7213  C  CE2   . TYR B 1 301 ? 78.430  115.130 68.503  1.00 10.24 ? 301  TYR B CE2   1 
ATOM   7214  C  CZ    . TYR B 1 301 ? 77.118  115.114 68.934  1.00 10.41 ? 301  TYR B CZ    1 
ATOM   7215  O  OH    . TYR B 1 301 ? 76.711  115.989 69.913  1.00 13.79 ? 301  TYR B OH    1 
ATOM   7216  N  N     . TRP B 1 302 ? 78.337  110.625 68.539  1.00 12.54 ? 302  TRP B N     1 
ATOM   7217  C  CA    . TRP B 1 302 ? 77.529  110.094 69.619  1.00 14.07 ? 302  TRP B CA    1 
ATOM   7218  C  C     . TRP B 1 302 ? 77.447  110.978 70.843  1.00 14.43 ? 302  TRP B C     1 
ATOM   7219  O  O     . TRP B 1 302 ? 78.420  111.139 71.583  1.00 15.47 ? 302  TRP B O     1 
ATOM   7220  C  CB    . TRP B 1 302 ? 78.025  108.697 70.028  1.00 11.21 ? 302  TRP B CB    1 
ATOM   7221  C  CG    . TRP B 1 302 ? 77.255  108.079 71.176  1.00 13.06 ? 302  TRP B CG    1 
ATOM   7222  C  CD1   . TRP B 1 302 ? 75.966  108.353 71.546  1.00 12.34 ? 302  TRP B CD1   1 
ATOM   7223  C  CD2   . TRP B 1 302 ? 77.718  107.053 72.069  1.00 13.31 ? 302  TRP B CD2   1 
ATOM   7224  N  NE1   . TRP B 1 302 ? 75.600  107.561 72.616  1.00 12.99 ? 302  TRP B NE1   1 
ATOM   7225  C  CE2   . TRP B 1 302 ? 76.654  106.754 72.955  1.00 12.40 ? 302  TRP B CE2   1 
ATOM   7226  C  CE3   . TRP B 1 302 ? 78.927  106.360 72.206  1.00 14.39 ? 302  TRP B CE3   1 
ATOM   7227  C  CZ2   . TRP B 1 302 ? 76.765  105.788 73.965  1.00 12.98 ? 302  TRP B CZ2   1 
ATOM   7228  C  CZ3   . TRP B 1 302 ? 79.038  105.399 73.210  1.00 14.03 ? 302  TRP B CZ3   1 
ATOM   7229  C  CH2   . TRP B 1 302 ? 77.959  105.124 74.076  1.00 13.54 ? 302  TRP B CH2   1 
ATOM   7230  N  N     . CYS B 1 303 ? 76.260  111.547 71.024  1.00 14.34 ? 303  CYS B N     1 
ATOM   7231  C  CA    . CYS B 1 303 ? 75.921  112.392 72.158  1.00 14.98 ? 303  CYS B CA    1 
ATOM   7232  C  C     . CYS B 1 303 ? 75.128  111.467 73.094  1.00 16.07 ? 303  CYS B C     1 
ATOM   7233  O  O     . CYS B 1 303 ? 74.108  110.890 72.696  1.00 16.72 ? 303  CYS B O     1 
ATOM   7234  C  CB    . CYS B 1 303 ? 75.050  113.563 71.696  1.00 16.76 ? 303  CYS B CB    1 
ATOM   7235  S  SG    . CYS B 1 303 ? 74.110  114.368 73.013  1.00 19.33 ? 303  CYS B SG    1 
ATOM   7236  N  N     . THR B 1 304 ? 75.608  111.315 74.326  1.00 15.75 ? 304  THR B N     1 
ATOM   7237  C  CA    . THR B 1 304 ? 74.946  110.447 75.295  1.00 16.53 ? 304  THR B CA    1 
ATOM   7238  C  C     . THR B 1 304 ? 73.743  111.096 75.988  1.00 16.49 ? 304  THR B C     1 
ATOM   7239  O  O     . THR B 1 304 ? 72.962  110.415 76.653  1.00 15.33 ? 304  THR B O     1 
ATOM   7240  C  CB    . THR B 1 304 ? 75.928  109.981 76.400  1.00 15.75 ? 304  THR B CB    1 
ATOM   7241  O  OG1   . THR B 1 304 ? 76.306  111.106 77.208  1.00 17.77 ? 304  THR B OG1   1 
ATOM   7242  C  CG2   . THR B 1 304 ? 77.176  109.361 75.787  1.00 17.09 ? 304  THR B CG2   1 
ATOM   7243  N  N     . ALA B 1 305 ? 73.596  112.406 75.840  1.00 15.70 ? 305  ALA B N     1 
ATOM   7244  C  CA    . ALA B 1 305 ? 72.484  113.108 76.480  1.00 16.55 ? 305  ALA B CA    1 
ATOM   7245  C  C     . ALA B 1 305 ? 71.117  112.554 76.078  1.00 16.99 ? 305  ALA B C     1 
ATOM   7246  O  O     . ALA B 1 305 ? 70.883  112.209 74.918  1.00 16.28 ? 305  ALA B O     1 
ATOM   7247  C  CB    . ALA B 1 305 ? 72.551  114.594 76.166  1.00 14.82 ? 305  ALA B CB    1 
ATOM   7248  N  N     . ASP B 1 306 ? 70.215  112.478 77.050  1.00 16.85 ? 306  ASP B N     1 
ATOM   7249  C  CA    . ASP B 1 306 ? 68.875  111.975 76.803  1.00 17.02 ? 306  ASP B CA    1 
ATOM   7250  C  C     . ASP B 1 306 ? 68.125  112.930 75.880  1.00 17.72 ? 306  ASP B C     1 
ATOM   7251  O  O     . ASP B 1 306 ? 68.350  114.141 75.901  1.00 16.94 ? 306  ASP B O     1 
ATOM   7252  C  CB    . ASP B 1 306 ? 68.115  111.821 78.122  1.00 16.11 ? 306  ASP B CB    1 
ATOM   7253  C  CG    . ASP B 1 306 ? 66.836  111.026 77.964  1.00 16.75 ? 306  ASP B CG    1 
ATOM   7254  O  OD1   . ASP B 1 306 ? 65.775  111.629 77.725  1.00 14.52 ? 306  ASP B OD1   1 
ATOM   7255  O  OD2   . ASP B 1 306 ? 66.899  109.786 78.069  1.00 19.31 ? 306  ASP B OD2   1 
ATOM   7256  N  N     . VAL B 1 307 ? 67.233  112.370 75.073  1.00 17.05 ? 307  VAL B N     1 
ATOM   7257  C  CA    . VAL B 1 307 ? 66.445  113.153 74.139  1.00 17.06 ? 307  VAL B CA    1 
ATOM   7258  C  C     . VAL B 1 307 ? 65.512  114.111 74.889  1.00 16.67 ? 307  VAL B C     1 
ATOM   7259  O  O     . VAL B 1 307 ? 65.024  115.089 74.319  1.00 17.57 ? 307  VAL B O     1 
ATOM   7260  C  CB    . VAL B 1 307 ? 65.616  112.220 73.216  1.00 17.33 ? 307  VAL B CB    1 
ATOM   7261  C  CG1   . VAL B 1 307 ? 64.548  111.483 74.029  1.00 15.50 ? 307  VAL B CG1   1 
ATOM   7262  C  CG2   . VAL B 1 307 ? 65.001  113.019 72.098  1.00 14.93 ? 307  VAL B CG2   1 
ATOM   7263  N  N     . GLY B 1 308 ? 65.285  113.833 76.170  1.00 14.54 ? 308  GLY B N     1 
ATOM   7264  C  CA    . GLY B 1 308 ? 64.418  114.679 76.973  1.00 14.70 ? 308  GLY B CA    1 
ATOM   7265  C  C     . GLY B 1 308 ? 65.088  115.940 77.499  1.00 15.87 ? 308  GLY B C     1 
ATOM   7266  O  O     . GLY B 1 308 ? 64.472  116.724 78.212  1.00 15.02 ? 308  GLY B O     1 
ATOM   7267  N  N     . TRP B 1 309 ? 66.352  116.145 77.153  1.00 16.09 ? 309  TRP B N     1 
ATOM   7268  C  CA    . TRP B 1 309 ? 67.080  117.329 77.613  1.00 16.20 ? 309  TRP B CA    1 
ATOM   7269  C  C     . TRP B 1 309 ? 67.447  118.203 76.415  1.00 14.69 ? 309  TRP B C     1 
ATOM   7270  O  O     . TRP B 1 309 ? 67.460  117.735 75.274  1.00 15.61 ? 309  TRP B O     1 
ATOM   7271  C  CB    . TRP B 1 309 ? 68.356  116.907 78.357  1.00 16.11 ? 309  TRP B CB    1 
ATOM   7272  C  CG    . TRP B 1 309 ? 68.106  116.075 79.586  1.00 19.71 ? 309  TRP B CG    1 
ATOM   7273  C  CD1   . TRP B 1 309 ? 68.704  114.888 79.905  1.00 19.91 ? 309  TRP B CD1   1 
ATOM   7274  C  CD2   . TRP B 1 309 ? 67.197  116.368 80.657  1.00 21.79 ? 309  TRP B CD2   1 
ATOM   7275  N  NE1   . TRP B 1 309 ? 68.224  114.423 81.105  1.00 20.75 ? 309  TRP B NE1   1 
ATOM   7276  C  CE2   . TRP B 1 309 ? 67.298  115.310 81.590  1.00 21.47 ? 309  TRP B CE2   1 
ATOM   7277  C  CE3   . TRP B 1 309 ? 66.307  117.423 80.921  1.00 22.45 ? 309  TRP B CE3   1 
ATOM   7278  C  CZ2   . TRP B 1 309 ? 66.543  115.272 82.768  1.00 21.43 ? 309  TRP B CZ2   1 
ATOM   7279  C  CZ3   . TRP B 1 309 ? 65.555  117.388 82.095  1.00 20.95 ? 309  TRP B CZ3   1 
ATOM   7280  C  CH2   . TRP B 1 309 ? 65.680  116.315 83.004  1.00 23.02 ? 309  TRP B CH2   1 
ATOM   7281  N  N     . VAL B 1 310 ? 67.761  119.465 76.667  1.00 12.21 ? 310  VAL B N     1 
ATOM   7282  C  CA    . VAL B 1 310 ? 68.110  120.358 75.579  1.00 11.99 ? 310  VAL B CA    1 
ATOM   7283  C  C     . VAL B 1 310 ? 69.329  119.839 74.810  1.00 13.24 ? 310  VAL B C     1 
ATOM   7284  O  O     . VAL B 1 310 ? 69.432  120.057 73.602  1.00 13.52 ? 310  VAL B O     1 
ATOM   7285  C  CB    . VAL B 1 310 ? 68.386  121.798 76.092  1.00 12.50 ? 310  VAL B CB    1 
ATOM   7286  C  CG1   . VAL B 1 310 ? 69.668  121.827 76.945  1.00 9.08  ? 310  VAL B CG1   1 
ATOM   7287  C  CG2   . VAL B 1 310 ? 68.487  122.756 74.907  1.00 11.65 ? 310  VAL B CG2   1 
ATOM   7288  N  N     . THR B 1 311 ? 70.245  119.147 75.491  1.00 12.35 ? 311  THR B N     1 
ATOM   7289  C  CA    . THR B 1 311 ? 71.434  118.622 74.811  1.00 12.04 ? 311  THR B CA    1 
ATOM   7290  C  C     . THR B 1 311 ? 70.977  117.606 73.770  1.00 13.72 ? 311  THR B C     1 
ATOM   7291  O  O     . THR B 1 311 ? 71.485  117.573 72.652  1.00 14.36 ? 311  THR B O     1 
ATOM   7292  C  CB    . THR B 1 311 ? 72.418  117.938 75.797  1.00 13.15 ? 311  THR B CB    1 
ATOM   7293  O  OG1   . THR B 1 311 ? 72.760  118.849 76.848  1.00 11.34 ? 311  THR B OG1   1 
ATOM   7294  C  CG2   . THR B 1 311 ? 73.702  117.525 75.075  1.00 12.06 ? 311  THR B CG2   1 
ATOM   7295  N  N     . GLY B 1 312 ? 69.992  116.793 74.142  1.00 14.43 ? 312  GLY B N     1 
ATOM   7296  C  CA    . GLY B 1 312 ? 69.463  115.801 73.222  1.00 14.60 ? 312  GLY B CA    1 
ATOM   7297  C  C     . GLY B 1 312 ? 68.758  116.470 72.057  1.00 14.62 ? 312  GLY B C     1 
ATOM   7298  O  O     . GLY B 1 312 ? 68.885  116.041 70.915  1.00 14.81 ? 312  GLY B O     1 
ATOM   7299  N  N     . HIS B 1 313 ? 68.008  117.528 72.344  1.00 14.35 ? 313  HIS B N     1 
ATOM   7300  C  CA    . HIS B 1 313 ? 67.305  118.256 71.294  1.00 15.24 ? 313  HIS B CA    1 
ATOM   7301  C  C     . HIS B 1 313 ? 68.293  118.805 70.273  1.00 13.44 ? 313  HIS B C     1 
ATOM   7302  O  O     . HIS B 1 313 ? 68.262  118.445 69.106  1.00 13.87 ? 313  HIS B O     1 
ATOM   7303  C  CB    . HIS B 1 313 ? 66.504  119.425 71.885  1.00 17.16 ? 313  HIS B CB    1 
ATOM   7304  C  CG    . HIS B 1 313 ? 65.189  119.026 72.479  1.00 18.26 ? 313  HIS B CG    1 
ATOM   7305  N  ND1   . HIS B 1 313 ? 65.069  118.040 73.435  1.00 19.42 ? 313  HIS B ND1   1 
ATOM   7306  C  CD2   . HIS B 1 313 ? 63.937  119.491 72.259  1.00 19.56 ? 313  HIS B CD2   1 
ATOM   7307  C  CE1   . HIS B 1 313 ? 63.799  117.916 73.778  1.00 19.55 ? 313  HIS B CE1   1 
ATOM   7308  N  NE2   . HIS B 1 313 ? 63.091  118.784 73.078  1.00 20.33 ? 313  HIS B NE2   1 
ATOM   7309  N  N     . SER B 1 314 ? 69.188  119.666 70.739  1.00 15.25 ? 314  SER B N     1 
ATOM   7310  C  CA    . SER B 1 314 ? 70.175  120.318 69.884  1.00 15.55 ? 314  SER B CA    1 
ATOM   7311  C  C     . SER B 1 314 ? 71.360  119.492 69.384  1.00 15.72 ? 314  SER B C     1 
ATOM   7312  O  O     . SER B 1 314 ? 71.764  119.647 68.236  1.00 17.40 ? 314  SER B O     1 
ATOM   7313  C  CB    . SER B 1 314 ? 70.732  121.562 70.589  1.00 14.37 ? 314  SER B CB    1 
ATOM   7314  O  OG    . SER B 1 314 ? 69.704  122.464 70.957  1.00 14.70 ? 314  SER B OG    1 
ATOM   7315  N  N     . TYR B 1 315 ? 71.927  118.622 70.212  1.00 15.38 ? 315  TYR B N     1 
ATOM   7316  C  CA    . TYR B 1 315 ? 73.102  117.891 69.758  1.00 17.73 ? 315  TYR B CA    1 
ATOM   7317  C  C     . TYR B 1 315 ? 73.048  116.389 69.661  1.00 18.51 ? 315  TYR B C     1 
ATOM   7318  O  O     . TYR B 1 315 ? 74.083  115.725 69.631  1.00 19.48 ? 315  TYR B O     1 
ATOM   7319  C  CB    . TYR B 1 315 ? 74.322  118.321 70.565  1.00 17.19 ? 315  TYR B CB    1 
ATOM   7320  C  CG    . TYR B 1 315 ? 74.533  119.807 70.464  1.00 18.79 ? 315  TYR B CG    1 
ATOM   7321  C  CD1   . TYR B 1 315 ? 74.049  120.665 71.447  1.00 17.72 ? 315  TYR B CD1   1 
ATOM   7322  C  CD2   . TYR B 1 315 ? 75.153  120.368 69.346  1.00 17.63 ? 315  TYR B CD2   1 
ATOM   7323  C  CE1   . TYR B 1 315 ? 74.174  122.042 71.321  1.00 18.67 ? 315  TYR B CE1   1 
ATOM   7324  C  CE2   . TYR B 1 315 ? 75.280  121.747 69.213  1.00 17.74 ? 315  TYR B CE2   1 
ATOM   7325  C  CZ    . TYR B 1 315 ? 74.788  122.573 70.206  1.00 16.40 ? 315  TYR B CZ    1 
ATOM   7326  O  OH    . TYR B 1 315 ? 74.909  123.932 70.100  1.00 20.55 ? 315  TYR B OH    1 
ATOM   7327  N  N     . LEU B 1 316 ? 71.845  115.839 69.612  1.00 20.19 ? 316  LEU B N     1 
ATOM   7328  C  CA    . LEU B 1 316 ? 71.701  114.410 69.431  1.00 18.92 ? 316  LEU B CA    1 
ATOM   7329  C  C     . LEU B 1 316 ? 70.969  114.292 68.102  1.00 17.93 ? 316  LEU B C     1 
ATOM   7330  O  O     . LEU B 1 316 ? 71.324  113.473 67.257  1.00 16.44 ? 316  LEU B O     1 
ATOM   7331  C  CB    . LEU B 1 316 ? 70.866  113.781 70.553  1.00 20.34 ? 316  LEU B CB    1 
ATOM   7332  C  CG    . LEU B 1 316 ? 70.937  112.243 70.608  1.00 22.87 ? 316  LEU B CG    1 
ATOM   7333  C  CD1   . LEU B 1 316 ? 70.164  111.749 71.806  1.00 27.53 ? 316  LEU B CD1   1 
ATOM   7334  C  CD2   . LEU B 1 316 ? 70.378  111.621 69.346  1.00 22.41 ? 316  LEU B CD2   1 
ATOM   7335  N  N     . LEU B 1 317 ? 69.977  115.158 67.907  1.00 17.00 ? 317  LEU B N     1 
ATOM   7336  C  CA    . LEU B 1 317 ? 69.164  115.145 66.698  1.00 17.39 ? 317  LEU B CA    1 
ATOM   7337  C  C     . LEU B 1 317 ? 69.294  116.318 65.728  1.00 16.09 ? 317  LEU B C     1 
ATOM   7338  O  O     . LEU B 1 317 ? 69.970  116.225 64.705  1.00 17.19 ? 317  LEU B O     1 
ATOM   7339  C  CB    . LEU B 1 317 ? 67.684  115.019 67.069  1.00 17.13 ? 317  LEU B CB    1 
ATOM   7340  C  CG    . LEU B 1 317 ? 67.253  113.880 67.993  1.00 20.81 ? 317  LEU B CG    1 
ATOM   7341  C  CD1   . LEU B 1 317 ? 65.716  113.898 68.109  1.00 17.78 ? 317  LEU B CD1   1 
ATOM   7342  C  CD2   . LEU B 1 317 ? 67.735  112.548 67.456  1.00 18.31 ? 317  LEU B CD2   1 
ATOM   7343  N  N     . TYR B 1 318 ? 68.622  117.414 66.057  1.00 14.46 ? 318  TYR B N     1 
ATOM   7344  C  CA    . TYR B 1 318 ? 68.577  118.592 65.201  1.00 13.95 ? 318  TYR B CA    1 
ATOM   7345  C  C     . TYR B 1 318 ? 69.894  119.106 64.629  1.00 12.83 ? 318  TYR B C     1 
ATOM   7346  O  O     . TYR B 1 318 ? 70.024  119.219 63.415  1.00 13.71 ? 318  TYR B O     1 
ATOM   7347  C  CB    . TYR B 1 318 ? 67.812  119.706 65.921  1.00 12.69 ? 318  TYR B CB    1 
ATOM   7348  C  CG    . TYR B 1 318 ? 66.388  119.307 66.272  1.00 13.35 ? 318  TYR B CG    1 
ATOM   7349  C  CD1   . TYR B 1 318 ? 65.660  118.443 65.446  1.00 12.95 ? 318  TYR B CD1   1 
ATOM   7350  C  CD2   . TYR B 1 318 ? 65.759  119.809 67.414  1.00 15.96 ? 318  TYR B CD2   1 
ATOM   7351  C  CE1   . TYR B 1 318 ? 64.345  118.089 65.742  1.00 15.37 ? 318  TYR B CE1   1 
ATOM   7352  C  CE2   . TYR B 1 318 ? 64.431  119.459 67.723  1.00 17.44 ? 318  TYR B CE2   1 
ATOM   7353  C  CZ    . TYR B 1 318 ? 63.733  118.597 66.879  1.00 18.91 ? 318  TYR B CZ    1 
ATOM   7354  O  OH    . TYR B 1 318 ? 62.430  118.237 67.162  1.00 20.81 ? 318  TYR B OH    1 
ATOM   7355  N  N     . GLY B 1 319 ? 70.860  119.418 65.487  1.00 12.57 ? 319  GLY B N     1 
ATOM   7356  C  CA    . GLY B 1 319 ? 72.143  119.899 65.008  1.00 11.58 ? 319  GLY B CA    1 
ATOM   7357  C  C     . GLY B 1 319 ? 72.826  118.895 64.088  1.00 13.28 ? 319  GLY B C     1 
ATOM   7358  O  O     . GLY B 1 319 ? 73.137  119.223 62.939  1.00 11.96 ? 319  GLY B O     1 
ATOM   7359  N  N     . PRO B 1 320 ? 73.070  117.656 64.551  1.00 13.45 ? 320  PRO B N     1 
ATOM   7360  C  CA    . PRO B 1 320 ? 73.729  116.669 63.679  1.00 13.90 ? 320  PRO B CA    1 
ATOM   7361  C  C     . PRO B 1 320 ? 72.943  116.237 62.427  1.00 15.62 ? 320  PRO B C     1 
ATOM   7362  O  O     . PRO B 1 320 ? 73.529  116.059 61.367  1.00 17.73 ? 320  PRO B O     1 
ATOM   7363  C  CB    . PRO B 1 320 ? 74.037  115.507 64.630  1.00 12.85 ? 320  PRO B CB    1 
ATOM   7364  C  CG    . PRO B 1 320 ? 72.986  115.646 65.709  1.00 14.19 ? 320  PRO B CG    1 
ATOM   7365  C  CD    . PRO B 1 320 ? 72.878  117.133 65.916  1.00 10.85 ? 320  PRO B CD    1 
ATOM   7366  N  N     . LEU B 1 321 ? 71.627  116.082 62.531  1.00 15.03 ? 321  LEU B N     1 
ATOM   7367  C  CA    . LEU B 1 321 ? 70.839  115.682 61.368  1.00 15.49 ? 321  LEU B CA    1 
ATOM   7368  C  C     . LEU B 1 321 ? 70.816  116.784 60.314  1.00 16.60 ? 321  LEU B C     1 
ATOM   7369  O  O     . LEU B 1 321 ? 70.836  116.507 59.112  1.00 16.26 ? 321  LEU B O     1 
ATOM   7370  C  CB    . LEU B 1 321 ? 69.407  115.324 61.781  1.00 14.44 ? 321  LEU B CB    1 
ATOM   7371  C  CG    . LEU B 1 321 ? 69.265  114.011 62.554  1.00 15.38 ? 321  LEU B CG    1 
ATOM   7372  C  CD1   . LEU B 1 321 ? 67.809  113.753 62.902  1.00 15.60 ? 321  LEU B CD1   1 
ATOM   7373  C  CD2   . LEU B 1 321 ? 69.812  112.875 61.709  1.00 15.43 ? 321  LEU B CD2   1 
ATOM   7374  N  N     . ALA B 1 322 ? 70.771  118.032 60.767  1.00 16.36 ? 322  ALA B N     1 
ATOM   7375  C  CA    . ALA B 1 322 ? 70.752  119.173 59.859  1.00 17.83 ? 322  ALA B CA    1 
ATOM   7376  C  C     . ALA B 1 322 ? 72.026  119.183 59.017  1.00 18.35 ? 322  ALA B C     1 
ATOM   7377  O  O     . ALA B 1 322 ? 72.031  119.672 57.886  1.00 19.36 ? 322  ALA B O     1 
ATOM   7378  C  CB    . ALA B 1 322 ? 70.636  120.477 60.652  1.00 16.73 ? 322  ALA B CB    1 
ATOM   7379  N  N     . CYS B 1 323 ? 73.101  118.636 59.577  1.00 18.51 ? 323  CYS B N     1 
ATOM   7380  C  CA    . CYS B 1 323 ? 74.386  118.575 58.888  1.00 18.55 ? 323  CYS B CA    1 
ATOM   7381  C  C     . CYS B 1 323 ? 74.557  117.296 58.070  1.00 19.77 ? 323  CYS B C     1 
ATOM   7382  O  O     . CYS B 1 323 ? 75.553  117.136 57.364  1.00 19.94 ? 323  CYS B O     1 
ATOM   7383  C  CB    . CYS B 1 323 ? 75.530  118.678 59.896  1.00 19.60 ? 323  CYS B CB    1 
ATOM   7384  S  SG    . CYS B 1 323 ? 75.751  120.324 60.594  1.00 22.30 ? 323  CYS B SG    1 
ATOM   7385  N  N     . GLY B 1 324 ? 73.587  116.391 58.170  1.00 19.15 ? 324  GLY B N     1 
ATOM   7386  C  CA    . GLY B 1 324 ? 73.665  115.145 57.430  1.00 17.60 ? 324  GLY B CA    1 
ATOM   7387  C  C     . GLY B 1 324 ? 74.608  114.137 58.062  1.00 18.63 ? 324  GLY B C     1 
ATOM   7388  O  O     . GLY B 1 324 ? 75.096  113.225 57.389  1.00 18.46 ? 324  GLY B O     1 
ATOM   7389  N  N     . ALA B 1 325 ? 74.844  114.291 59.362  1.00 17.56 ? 325  ALA B N     1 
ATOM   7390  C  CA    . ALA B 1 325 ? 75.740  113.404 60.097  1.00 17.79 ? 325  ALA B CA    1 
ATOM   7391  C  C     . ALA B 1 325 ? 75.052  112.129 60.577  1.00 18.21 ? 325  ALA B C     1 
ATOM   7392  O  O     . ALA B 1 325 ? 73.829  112.071 60.673  1.00 18.88 ? 325  ALA B O     1 
ATOM   7393  C  CB    . ALA B 1 325 ? 76.319  114.146 61.294  1.00 16.87 ? 325  ALA B CB    1 
ATOM   7394  N  N     . THR B 1 326 ? 75.843  111.102 60.866  1.00 16.41 ? 326  THR B N     1 
ATOM   7395  C  CA    . THR B 1 326 ? 75.295  109.855 61.387  1.00 13.06 ? 326  THR B CA    1 
ATOM   7396  C  C     . THR B 1 326 ? 75.338  110.039 62.897  1.00 14.27 ? 326  THR B C     1 
ATOM   7397  O  O     . THR B 1 326 ? 76.418  110.132 63.487  1.00 15.41 ? 326  THR B O     1 
ATOM   7398  C  CB    . THR B 1 326 ? 76.164  108.639 61.019  1.00 11.38 ? 326  THR B CB    1 
ATOM   7399  O  OG1   . THR B 1 326 ? 76.142  108.450 59.598  1.00 11.18 ? 326  THR B OG1   1 
ATOM   7400  C  CG2   . THR B 1 326 ? 75.656  107.384 61.705  1.00 9.68  ? 326  THR B CG2   1 
ATOM   7401  N  N     . THR B 1 327 ? 74.170  110.119 63.521  1.00 12.87 ? 327  THR B N     1 
ATOM   7402  C  CA    . THR B 1 327 ? 74.122  110.313 64.958  1.00 12.61 ? 327  THR B CA    1 
ATOM   7403  C  C     . THR B 1 327 ? 73.691  109.031 65.656  1.00 14.47 ? 327  THR B C     1 
ATOM   7404  O  O     . THR B 1 327 ? 72.830  108.294 65.160  1.00 14.85 ? 327  THR B O     1 
ATOM   7405  C  CB    . THR B 1 327 ? 73.172  111.472 65.321  1.00 11.92 ? 327  THR B CB    1 
ATOM   7406  O  OG1   . THR B 1 327 ? 73.264  111.740 66.725  1.00 10.58 ? 327  THR B OG1   1 
ATOM   7407  C  CG2   . THR B 1 327 ? 71.735  111.125 64.960  1.00 8.40  ? 327  THR B CG2   1 
ATOM   7408  N  N     . LEU B 1 328 ? 74.300  108.764 66.808  1.00 14.97 ? 328  LEU B N     1 
ATOM   7409  C  CA    . LEU B 1 328 ? 74.018  107.543 67.555  1.00 15.73 ? 328  LEU B CA    1 
ATOM   7410  C  C     . LEU B 1 328 ? 73.121  107.760 68.765  1.00 15.09 ? 328  LEU B C     1 
ATOM   7411  O  O     . LEU B 1 328 ? 73.400  108.597 69.621  1.00 16.39 ? 328  LEU B O     1 
ATOM   7412  C  CB    . LEU B 1 328 ? 75.335  106.897 67.991  1.00 14.21 ? 328  LEU B CB    1 
ATOM   7413  C  CG    . LEU B 1 328 ? 75.332  105.437 68.445  1.00 14.86 ? 328  LEU B CG    1 
ATOM   7414  C  CD1   . LEU B 1 328 ? 76.752  104.888 68.341  1.00 13.17 ? 328  LEU B CD1   1 
ATOM   7415  C  CD2   . LEU B 1 328 ? 74.811  105.320 69.865  1.00 13.99 ? 328  LEU B CD2   1 
ATOM   7416  N  N     . MET B 1 329 ? 72.037  106.998 68.828  1.00 14.55 ? 329  MET B N     1 
ATOM   7417  C  CA    . MET B 1 329 ? 71.103  107.103 69.938  1.00 16.98 ? 329  MET B CA    1 
ATOM   7418  C  C     . MET B 1 329 ? 71.196  105.832 70.761  1.00 16.01 ? 329  MET B C     1 
ATOM   7419  O  O     . MET B 1 329 ? 70.811  104.762 70.295  1.00 17.49 ? 329  MET B O     1 
ATOM   7420  C  CB    . MET B 1 329 ? 69.667  107.277 69.431  1.00 17.32 ? 329  MET B CB    1 
ATOM   7421  C  CG    . MET B 1 329 ? 68.653  107.456 70.545  1.00 19.29 ? 329  MET B CG    1 
ATOM   7422  S  SD    . MET B 1 329 ? 66.940  107.322 70.014  1.00 26.06 ? 329  MET B SD    1 
ATOM   7423  C  CE    . MET B 1 329 ? 66.481  109.059 69.891  1.00 20.98 ? 329  MET B CE    1 
ATOM   7424  N  N     . PHE B 1 330 ? 71.723  105.958 71.977  1.00 16.60 ? 330  PHE B N     1 
ATOM   7425  C  CA    . PHE B 1 330 ? 71.885  104.832 72.898  1.00 15.49 ? 330  PHE B CA    1 
ATOM   7426  C  C     . PHE B 1 330 ? 70.678  104.765 73.832  1.00 15.53 ? 330  PHE B C     1 
ATOM   7427  O  O     . PHE B 1 330 ? 70.231  105.789 74.342  1.00 16.63 ? 330  PHE B O     1 
ATOM   7428  C  CB    . PHE B 1 330 ? 73.181  104.998 73.711  1.00 14.69 ? 330  PHE B CB    1 
ATOM   7429  C  CG    . PHE B 1 330 ? 73.454  103.867 74.662  1.00 14.15 ? 330  PHE B CG    1 
ATOM   7430  C  CD1   . PHE B 1 330 ? 73.250  102.547 74.271  1.00 13.93 ? 330  PHE B CD1   1 
ATOM   7431  C  CD2   . PHE B 1 330 ? 73.942  104.119 75.941  1.00 11.08 ? 330  PHE B CD2   1 
ATOM   7432  C  CE1   . PHE B 1 330 ? 73.529  101.488 75.140  1.00 13.54 ? 330  PHE B CE1   1 
ATOM   7433  C  CE2   . PHE B 1 330 ? 74.223  103.068 76.819  1.00 14.60 ? 330  PHE B CE2   1 
ATOM   7434  C  CZ    . PHE B 1 330 ? 74.016  101.748 76.415  1.00 12.06 ? 330  PHE B CZ    1 
ATOM   7435  N  N     . GLU B 1 331 ? 70.165  103.560 74.062  1.00 15.31 ? 331  GLU B N     1 
ATOM   7436  C  CA    . GLU B 1 331 ? 68.987  103.367 74.904  1.00 15.10 ? 331  GLU B CA    1 
ATOM   7437  C  C     . GLU B 1 331 ? 69.204  103.319 76.418  1.00 15.63 ? 331  GLU B C     1 
ATOM   7438  O  O     . GLU B 1 331 ? 68.368  103.827 77.168  1.00 14.25 ? 331  GLU B O     1 
ATOM   7439  C  CB    . GLU B 1 331 ? 68.240  102.098 74.456  1.00 15.06 ? 331  GLU B CB    1 
ATOM   7440  C  CG    . GLU B 1 331 ? 66.999  101.745 75.283  1.00 15.34 ? 331  GLU B CG    1 
ATOM   7441  C  CD    . GLU B 1 331 ? 66.224  100.551 74.713  1.00 15.80 ? 331  GLU B CD    1 
ATOM   7442  O  OE1   . GLU B 1 331 ? 66.855  99.502  74.466  1.00 17.18 ? 331  GLU B OE1   1 
ATOM   7443  O  OE2   . GLU B 1 331 ? 64.989  100.656 74.520  1.00 11.39 ? 331  GLU B OE2   1 
ATOM   7444  N  N     . GLY B 1 332 ? 70.316  102.735 76.867  1.00 15.73 ? 332  GLY B N     1 
ATOM   7445  C  CA    . GLY B 1 332 ? 70.549  102.609 78.299  1.00 16.94 ? 332  GLY B CA    1 
ATOM   7446  C  C     . GLY B 1 332 ? 71.563  103.527 78.952  1.00 19.65 ? 332  GLY B C     1 
ATOM   7447  O  O     . GLY B 1 332 ? 71.629  104.716 78.642  1.00 20.30 ? 332  GLY B O     1 
ATOM   7448  N  N     . VAL B 1 333 ? 72.345  102.969 79.879  1.00 21.93 ? 333  VAL B N     1 
ATOM   7449  C  CA    . VAL B 1 333 ? 73.376  103.730 80.592  1.00 19.97 ? 333  VAL B CA    1 
ATOM   7450  C  C     . VAL B 1 333 ? 74.773  103.235 80.219  1.00 20.44 ? 333  VAL B C     1 
ATOM   7451  O  O     . VAL B 1 333 ? 74.950  102.077 79.849  1.00 19.03 ? 333  VAL B O     1 
ATOM   7452  C  CB    . VAL B 1 333 ? 73.204  103.635 82.130  1.00 19.27 ? 333  VAL B CB    1 
ATOM   7453  C  CG1   . VAL B 1 333 ? 71.893  104.260 82.537  1.00 16.33 ? 333  VAL B CG1   1 
ATOM   7454  C  CG2   . VAL B 1 333 ? 73.286  102.187 82.582  1.00 16.04 ? 333  VAL B CG2   1 
ATOM   7455  N  N     . PRO B 1 334 ? 75.786  104.110 80.326  1.00 20.11 ? 334  PRO B N     1 
ATOM   7456  C  CA    . PRO B 1 334 ? 77.185  103.813 80.002  1.00 20.87 ? 334  PRO B CA    1 
ATOM   7457  C  C     . PRO B 1 334 ? 77.922  102.758 80.820  1.00 21.05 ? 334  PRO B C     1 
ATOM   7458  O  O     . PRO B 1 334 ? 79.021  102.353 80.446  1.00 19.37 ? 334  PRO B O     1 
ATOM   7459  C  CB    . PRO B 1 334 ? 77.851  105.183 80.098  1.00 20.34 ? 334  PRO B CB    1 
ATOM   7460  C  CG    . PRO B 1 334 ? 77.052  105.869 81.153  1.00 21.02 ? 334  PRO B CG    1 
ATOM   7461  C  CD    . PRO B 1 334 ? 75.641  105.511 80.759  1.00 18.83 ? 334  PRO B CD    1 
ATOM   7462  N  N     . ASN B 1 335 ? 77.328  102.306 81.920  1.00 22.86 ? 335  ASN B N     1 
ATOM   7463  C  CA    . ASN B 1 335 ? 77.976  101.301 82.762  1.00 22.79 ? 335  ASN B CA    1 
ATOM   7464  C  C     . ASN B 1 335 ? 77.145  100.047 83.027  1.00 22.97 ? 335  ASN B C     1 
ATOM   7465  O  O     . ASN B 1 335 ? 77.280  99.414  84.075  1.00 22.26 ? 335  ASN B O     1 
ATOM   7466  C  CB    . ASN B 1 335 ? 78.394  101.930 84.094  1.00 22.80 ? 335  ASN B CB    1 
ATOM   7467  C  CG    . ASN B 1 335 ? 77.269  102.689 84.765  1.00 22.57 ? 335  ASN B CG    1 
ATOM   7468  O  OD1   . ASN B 1 335 ? 77.464  103.289 85.814  1.00 26.38 ? 335  ASN B OD1   1 
ATOM   7469  N  ND2   . ASN B 1 335 ? 76.092  102.670 84.164  1.00 24.49 ? 335  ASN B ND2   1 
ATOM   7470  N  N     . TRP B 1 336 ? 76.288  99.688  82.078  1.00 22.63 ? 336  TRP B N     1 
ATOM   7471  C  CA    . TRP B 1 336 ? 75.468  98.491  82.210  1.00 23.10 ? 336  TRP B CA    1 
ATOM   7472  C  C     . TRP B 1 336 ? 75.481  97.722  80.896  1.00 22.94 ? 336  TRP B C     1 
ATOM   7473  O  O     . TRP B 1 336 ? 75.293  98.305  79.836  1.00 22.75 ? 336  TRP B O     1 
ATOM   7474  C  CB    . TRP B 1 336 ? 74.020  98.843  82.567  1.00 22.66 ? 336  TRP B CB    1 
ATOM   7475  C  CG    . TRP B 1 336 ? 73.232  97.630  82.933  1.00 23.05 ? 336  TRP B CG    1 
ATOM   7476  C  CD1   . TRP B 1 336 ? 73.140  97.060  84.167  1.00 22.64 ? 336  TRP B CD1   1 
ATOM   7477  C  CD2   . TRP B 1 336 ? 72.512  96.773  82.039  1.00 25.03 ? 336  TRP B CD2   1 
ATOM   7478  N  NE1   . TRP B 1 336 ? 72.412  95.894  84.103  1.00 25.54 ? 336  TRP B NE1   1 
ATOM   7479  C  CE2   . TRP B 1 336 ? 72.013  95.693  82.808  1.00 25.90 ? 336  TRP B CE2   1 
ATOM   7480  C  CE3   . TRP B 1 336 ? 72.244  96.809  80.666  1.00 25.71 ? 336  TRP B CE3   1 
ATOM   7481  C  CZ2   . TRP B 1 336 ? 71.257  94.655  82.248  1.00 26.32 ? 336  TRP B CZ2   1 
ATOM   7482  C  CZ3   . TRP B 1 336 ? 71.490  95.772  80.104  1.00 28.24 ? 336  TRP B CZ3   1 
ATOM   7483  C  CH2   . TRP B 1 336 ? 71.006  94.710  80.900  1.00 27.50 ? 336  TRP B CH2   1 
ATOM   7484  N  N     . PRO B 1 337 ? 75.673  96.394  80.952  1.00 24.24 ? 337  PRO B N     1 
ATOM   7485  C  CA    . PRO B 1 337 ? 75.873  95.609  82.177  1.00 24.94 ? 337  PRO B CA    1 
ATOM   7486  C  C     . PRO B 1 337 ? 77.205  95.812  82.899  1.00 25.20 ? 337  PRO B C     1 
ATOM   7487  O  O     . PRO B 1 337 ? 77.309  95.540  84.096  1.00 27.30 ? 337  PRO B O     1 
ATOM   7488  C  CB    . PRO B 1 337 ? 75.673  94.169  81.704  1.00 25.56 ? 337  PRO B CB    1 
ATOM   7489  C  CG    . PRO B 1 337 ? 76.126  94.216  80.273  1.00 26.02 ? 337  PRO B CG    1 
ATOM   7490  C  CD    . PRO B 1 337 ? 75.532  95.514  79.778  1.00 24.38 ? 337  PRO B CD    1 
ATOM   7491  N  N     . THR B 1 338 ? 78.223  96.287  82.193  1.00 23.60 ? 338  THR B N     1 
ATOM   7492  C  CA    . THR B 1 338 ? 79.515  96.514  82.835  1.00 22.49 ? 338  THR B CA    1 
ATOM   7493  C  C     . THR B 1 338 ? 79.981  97.943  82.606  1.00 22.56 ? 338  THR B C     1 
ATOM   7494  O  O     . THR B 1 338 ? 79.446  98.652  81.752  1.00 21.97 ? 338  THR B O     1 
ATOM   7495  C  CB    . THR B 1 338 ? 80.604  95.546  82.304  1.00 22.05 ? 338  THR B CB    1 
ATOM   7496  O  OG1   . THR B 1 338 ? 80.977  95.925  80.973  1.00 19.86 ? 338  THR B OG1   1 
ATOM   7497  C  CG2   . THR B 1 338 ? 80.077  94.101  82.295  1.00 18.65 ? 338  THR B CG2   1 
ATOM   7498  N  N     . PRO B 1 339 ? 80.983  98.390  83.378  1.00 21.90 ? 339  PRO B N     1 
ATOM   7499  C  CA    . PRO B 1 339 ? 81.511  99.753  83.240  1.00 22.28 ? 339  PRO B CA    1 
ATOM   7500  C  C     . PRO B 1 339 ? 82.157  100.022 81.880  1.00 20.56 ? 339  PRO B C     1 
ATOM   7501  O  O     . PRO B 1 339 ? 82.372  101.169 81.502  1.00 21.18 ? 339  PRO B O     1 
ATOM   7502  C  CB    . PRO B 1 339 ? 82.514  99.851  84.390  1.00 23.15 ? 339  PRO B CB    1 
ATOM   7503  C  CG    . PRO B 1 339 ? 81.914  98.946  85.427  1.00 23.00 ? 339  PRO B CG    1 
ATOM   7504  C  CD    . PRO B 1 339 ? 81.499  97.751  84.602  1.00 21.36 ? 339  PRO B CD    1 
ATOM   7505  N  N     . ALA B 1 340 ? 82.459  98.960  81.145  1.00 19.22 ? 340  ALA B N     1 
ATOM   7506  C  CA    . ALA B 1 340 ? 83.076  99.100  79.834  1.00 19.45 ? 340  ALA B CA    1 
ATOM   7507  C  C     . ALA B 1 340 ? 82.052  99.302  78.712  1.00 18.55 ? 340  ALA B C     1 
ATOM   7508  O  O     . ALA B 1 340 ? 82.429  99.434  77.547  1.00 18.35 ? 340  ALA B O     1 
ATOM   7509  C  CB    . ALA B 1 340 ? 83.932  97.873  79.535  1.00 17.33 ? 340  ALA B CB    1 
ATOM   7510  N  N     . ARG B 1 341 ? 80.765  99.344  79.054  1.00 17.80 ? 341  ARG B N     1 
ATOM   7511  C  CA    . ARG B 1 341 ? 79.723  99.501  78.041  1.00 17.66 ? 341  ARG B CA    1 
ATOM   7512  C  C     . ARG B 1 341 ? 79.940  100.660 77.069  1.00 17.86 ? 341  ARG B C     1 
ATOM   7513  O  O     . ARG B 1 341 ? 79.965  100.448 75.854  1.00 19.22 ? 341  ARG B O     1 
ATOM   7514  C  CB    . ARG B 1 341 ? 78.335  99.635  78.685  1.00 17.82 ? 341  ARG B CB    1 
ATOM   7515  C  CG    . ARG B 1 341 ? 77.187  99.563  77.669  1.00 15.52 ? 341  ARG B CG    1 
ATOM   7516  C  CD    . ARG B 1 341 ? 77.266  98.245  76.895  1.00 14.67 ? 341  ARG B CD    1 
ATOM   7517  N  NE    . ARG B 1 341 ? 76.383  98.167  75.732  1.00 12.78 ? 341  ARG B NE    1 
ATOM   7518  C  CZ    . ARG B 1 341 ? 75.057  98.085  75.790  1.00 15.04 ? 341  ARG B CZ    1 
ATOM   7519  N  NH1   . ARG B 1 341 ? 74.427  98.077  76.961  1.00 15.09 ? 341  ARG B NH1   1 
ATOM   7520  N  NH2   . ARG B 1 341 ? 74.356  97.982  74.670  1.00 17.08 ? 341  ARG B NH2   1 
ATOM   7521  N  N     . MET B 1 342 ? 80.091  101.878 77.587  1.00 17.27 ? 342  MET B N     1 
ATOM   7522  C  CA    . MET B 1 342 ? 80.296  103.040 76.727  1.00 15.29 ? 342  MET B CA    1 
ATOM   7523  C  C     . MET B 1 342 ? 81.376  102.795 75.673  1.00 16.35 ? 342  MET B C     1 
ATOM   7524  O  O     . MET B 1 342 ? 81.130  102.956 74.478  1.00 17.02 ? 342  MET B O     1 
ATOM   7525  C  CB    . MET B 1 342 ? 80.669  104.270 77.558  1.00 16.34 ? 342  MET B CB    1 
ATOM   7526  C  CG    . MET B 1 342 ? 80.753  105.557 76.732  1.00 15.56 ? 342  MET B CG    1 
ATOM   7527  S  SD    . MET B 1 342 ? 81.102  107.022 77.747  1.00 15.81 ? 342  MET B SD    1 
ATOM   7528  C  CE    . MET B 1 342 ? 82.906  106.881 77.903  1.00 14.50 ? 342  MET B CE    1 
ATOM   7529  N  N     . CYS B 1 343 ? 82.564  102.391 76.113  1.00 17.07 ? 343  CYS B N     1 
ATOM   7530  C  CA    . CYS B 1 343 ? 83.662  102.141 75.189  1.00 19.79 ? 343  CYS B CA    1 
ATOM   7531  C  C     . CYS B 1 343 ? 83.400  100.968 74.242  1.00 20.51 ? 343  CYS B C     1 
ATOM   7532  O  O     . CYS B 1 343 ? 83.924  100.938 73.128  1.00 22.16 ? 343  CYS B O     1 
ATOM   7533  C  CB    . CYS B 1 343 ? 84.962  101.927 75.964  1.00 21.12 ? 343  CYS B CB    1 
ATOM   7534  S  SG    . CYS B 1 343 ? 85.510  103.413 76.827  1.00 23.78 ? 343  CYS B SG    1 
ATOM   7535  N  N     . GLN B 1 344 ? 82.594  100.006 74.680  1.00 18.69 ? 344  GLN B N     1 
ATOM   7536  C  CA    . GLN B 1 344 ? 82.252  98.873  73.829  1.00 19.31 ? 344  GLN B CA    1 
ATOM   7537  C  C     . GLN B 1 344 ? 81.361  99.378  72.698  1.00 18.01 ? 344  GLN B C     1 
ATOM   7538  O  O     . GLN B 1 344 ? 81.478  98.930  71.563  1.00 18.16 ? 344  GLN B O     1 
ATOM   7539  C  CB    . GLN B 1 344 ? 81.510  97.801  74.624  1.00 19.57 ? 344  GLN B CB    1 
ATOM   7540  C  CG    . GLN B 1 344 ? 82.395  97.006  75.554  1.00 22.96 ? 344  GLN B CG    1 
ATOM   7541  C  CD    . GLN B 1 344 ? 81.605  96.183  76.543  1.00 23.03 ? 344  GLN B CD    1 
ATOM   7542  O  OE1   . GLN B 1 344 ? 82.155  95.316  77.214  1.00 25.55 ? 344  GLN B OE1   1 
ATOM   7543  N  NE2   . GLN B 1 344 ? 80.312  96.460  76.651  1.00 23.31 ? 344  GLN B NE2   1 
ATOM   7544  N  N     . VAL B 1 345 ? 80.455  100.296 73.019  1.00 17.20 ? 345  VAL B N     1 
ATOM   7545  C  CA    . VAL B 1 345 ? 79.575  100.866 72.008  1.00 17.23 ? 345  VAL B CA    1 
ATOM   7546  C  C     . VAL B 1 345 ? 80.471  101.584 71.005  1.00 17.80 ? 345  VAL B C     1 
ATOM   7547  O  O     . VAL B 1 345 ? 80.304  101.439 69.791  1.00 18.81 ? 345  VAL B O     1 
ATOM   7548  C  CB    . VAL B 1 345 ? 78.583  101.880 72.629  1.00 18.79 ? 345  VAL B CB    1 
ATOM   7549  C  CG1   . VAL B 1 345 ? 77.808  102.606 71.531  1.00 17.33 ? 345  VAL B CG1   1 
ATOM   7550  C  CG2   . VAL B 1 345 ? 77.619  101.150 73.562  1.00 17.45 ? 345  VAL B CG2   1 
ATOM   7551  N  N     . VAL B 1 346 ? 81.429  102.347 71.529  1.00 16.03 ? 346  VAL B N     1 
ATOM   7552  C  CA    . VAL B 1 346 ? 82.382  103.086 70.708  1.00 17.40 ? 346  VAL B CA    1 
ATOM   7553  C  C     . VAL B 1 346 ? 83.061  102.196 69.659  1.00 18.03 ? 346  VAL B C     1 
ATOM   7554  O  O     . VAL B 1 346 ? 83.190  102.593 68.494  1.00 17.13 ? 346  VAL B O     1 
ATOM   7555  C  CB    . VAL B 1 346 ? 83.482  103.760 71.584  1.00 15.70 ? 346  VAL B CB    1 
ATOM   7556  C  CG1   . VAL B 1 346 ? 84.607  104.268 70.711  1.00 14.31 ? 346  VAL B CG1   1 
ATOM   7557  C  CG2   . VAL B 1 346 ? 82.892  104.916 72.369  1.00 16.19 ? 346  VAL B CG2   1 
ATOM   7558  N  N     . ASP B 1 347 ? 83.497  101.002 70.064  1.00 17.95 ? 347  ASP B N     1 
ATOM   7559  C  CA    . ASP B 1 347 ? 84.155  100.083 69.131  1.00 18.64 ? 347  ASP B CA    1 
ATOM   7560  C  C     . ASP B 1 347 ? 83.150  99.443  68.177  1.00 16.84 ? 347  ASP B C     1 
ATOM   7561  O  O     . ASP B 1 347 ? 83.413  99.321  66.981  1.00 17.16 ? 347  ASP B O     1 
ATOM   7562  C  CB    . ASP B 1 347 ? 84.894  98.955  69.866  1.00 18.28 ? 347  ASP B CB    1 
ATOM   7563  C  CG    . ASP B 1 347 ? 86.048  99.451  70.702  1.00 19.93 ? 347  ASP B CG    1 
ATOM   7564  O  OD1   . ASP B 1 347 ? 86.668  100.467 70.332  1.00 21.76 ? 347  ASP B OD1   1 
ATOM   7565  O  OD2   . ASP B 1 347 ? 86.350  98.805  71.727  1.00 20.77 ? 347  ASP B OD2   1 
ATOM   7566  N  N     . LYS B 1 348 ? 82.009  99.028  68.717  1.00 15.99 ? 348  LYS B N     1 
ATOM   7567  C  CA    . LYS B 1 348 ? 80.967  98.378  67.929  1.00 17.60 ? 348  LYS B CA    1 
ATOM   7568  C  C     . LYS B 1 348 ? 80.513  99.221  66.739  1.00 18.42 ? 348  LYS B C     1 
ATOM   7569  O  O     . LYS B 1 348 ? 80.327  98.707  65.637  1.00 19.18 ? 348  LYS B O     1 
ATOM   7570  C  CB    . LYS B 1 348 ? 79.759  98.065  68.814  1.00 16.59 ? 348  LYS B CB    1 
ATOM   7571  C  CG    . LYS B 1 348 ? 78.667  97.296  68.099  1.00 18.40 ? 348  LYS B CG    1 
ATOM   7572  C  CD    . LYS B 1 348 ? 77.433  97.085  68.973  1.00 16.43 ? 348  LYS B CD    1 
ATOM   7573  C  CE    . LYS B 1 348 ? 76.324  96.400  68.175  1.00 15.39 ? 348  LYS B CE    1 
ATOM   7574  N  NZ    . LYS B 1 348 ? 75.109  96.112  68.983  1.00 10.04 ? 348  LYS B NZ    1 
ATOM   7575  N  N     . HIS B 1 349 ? 80.349  100.519 66.954  1.00 18.43 ? 349  HIS B N     1 
ATOM   7576  C  CA    . HIS B 1 349 ? 79.896  101.394 65.885  1.00 19.75 ? 349  HIS B CA    1 
ATOM   7577  C  C     . HIS B 1 349 ? 80.970  102.352 65.370  1.00 19.57 ? 349  HIS B C     1 
ATOM   7578  O  O     . HIS B 1 349 ? 80.680  103.258 64.586  1.00 21.27 ? 349  HIS B O     1 
ATOM   7579  C  CB    . HIS B 1 349 ? 78.661  102.166 66.357  1.00 19.66 ? 349  HIS B CB    1 
ATOM   7580  C  CG    . HIS B 1 349 ? 77.540  101.282 66.819  1.00 20.16 ? 349  HIS B CG    1 
ATOM   7581  N  ND1   . HIS B 1 349 ? 76.882  100.408 65.979  1.00 18.30 ? 349  HIS B ND1   1 
ATOM   7582  C  CD2   . HIS B 1 349 ? 76.968  101.130 68.038  1.00 19.59 ? 349  HIS B CD2   1 
ATOM   7583  C  CE1   . HIS B 1 349 ? 75.956  99.756  66.660  1.00 17.73 ? 349  HIS B CE1   1 
ATOM   7584  N  NE2   . HIS B 1 349 ? 75.987  100.175 67.912  1.00 18.17 ? 349  HIS B NE2   1 
ATOM   7585  N  N     . GLN B 1 350 ? 82.211  102.138 65.801  1.00 20.78 ? 350  GLN B N     1 
ATOM   7586  C  CA    . GLN B 1 350 ? 83.343  102.968 65.383  1.00 21.95 ? 350  GLN B CA    1 
ATOM   7587  C  C     . GLN B 1 350 ? 83.098  104.462 65.599  1.00 22.91 ? 350  GLN B C     1 
ATOM   7588  O  O     . GLN B 1 350 ? 83.381  105.278 64.716  1.00 24.32 ? 350  GLN B O     1 
ATOM   7589  C  CB    . GLN B 1 350 ? 83.661  102.729 63.903  1.00 21.27 ? 350  GLN B CB    1 
ATOM   7590  C  CG    . GLN B 1 350 ? 84.146  101.326 63.565  1.00 23.26 ? 350  GLN B CG    1 
ATOM   7591  C  CD    . GLN B 1 350 ? 85.527  101.028 64.124  1.00 23.78 ? 350  GLN B CD    1 
ATOM   7592  O  OE1   . GLN B 1 350 ? 85.671  100.527 65.241  1.00 24.66 ? 350  GLN B OE1   1 
ATOM   7593  N  NE2   . GLN B 1 350 ? 86.556  101.349 63.348  1.00 23.43 ? 350  GLN B NE2   1 
ATOM   7594  N  N     . VAL B 1 351 ? 82.565  104.818 66.764  1.00 21.33 ? 351  VAL B N     1 
ATOM   7595  C  CA    . VAL B 1 351 ? 82.305  106.215 67.086  1.00 20.96 ? 351  VAL B CA    1 
ATOM   7596  C  C     . VAL B 1 351 ? 83.583  107.047 66.940  1.00 21.18 ? 351  VAL B C     1 
ATOM   7597  O  O     . VAL B 1 351 ? 84.646  106.651 67.411  1.00 22.80 ? 351  VAL B O     1 
ATOM   7598  C  CB    . VAL B 1 351 ? 81.766  106.342 68.526  1.00 20.73 ? 351  VAL B CB    1 
ATOM   7599  C  CG1   . VAL B 1 351 ? 81.574  107.803 68.898  1.00 18.42 ? 351  VAL B CG1   1 
ATOM   7600  C  CG2   . VAL B 1 351 ? 80.456  105.589 68.642  1.00 19.62 ? 351  VAL B CG2   1 
ATOM   7601  N  N     . ASN B 1 352 ? 83.480  108.192 66.274  1.00 20.60 ? 352  ASN B N     1 
ATOM   7602  C  CA    . ASN B 1 352 ? 84.636  109.066 66.082  1.00 20.42 ? 352  ASN B CA    1 
ATOM   7603  C  C     . ASN B 1 352 ? 84.550  110.273 67.007  1.00 18.64 ? 352  ASN B C     1 
ATOM   7604  O  O     . ASN B 1 352 ? 85.568  110.870 67.355  1.00 18.49 ? 352  ASN B O     1 
ATOM   7605  C  CB    . ASN B 1 352 ? 84.706  109.549 64.632  1.00 19.41 ? 352  ASN B CB    1 
ATOM   7606  C  CG    . ASN B 1 352 ? 84.856  108.409 63.641  1.00 20.09 ? 352  ASN B CG    1 
ATOM   7607  O  OD1   . ASN B 1 352 ? 84.191  108.378 62.614  1.00 21.77 ? 352  ASN B OD1   1 
ATOM   7608  N  ND2   . ASN B 1 352 ? 85.739  107.472 63.945  1.00 18.99 ? 352  ASN B ND2   1 
ATOM   7609  N  N     . ILE B 1 353 ? 83.328  110.617 67.401  1.00 17.71 ? 353  ILE B N     1 
ATOM   7610  C  CA    . ILE B 1 353 ? 83.089  111.756 68.279  1.00 17.91 ? 353  ILE B CA    1 
ATOM   7611  C  C     . ILE B 1 353 ? 82.164  111.363 69.426  1.00 18.35 ? 353  ILE B C     1 
ATOM   7612  O  O     . ILE B 1 353 ? 81.006  111.028 69.202  1.00 20.76 ? 353  ILE B O     1 
ATOM   7613  C  CB    . ILE B 1 353 ? 82.428  112.911 67.512  1.00 16.93 ? 353  ILE B CB    1 
ATOM   7614  C  CG1   . ILE B 1 353 ? 83.206  113.196 66.225  1.00 15.43 ? 353  ILE B CG1   1 
ATOM   7615  C  CG2   . ILE B 1 353 ? 82.380  114.162 68.398  1.00 17.01 ? 353  ILE B CG2   1 
ATOM   7616  C  CD1   . ILE B 1 353 ? 82.480  114.124 65.271  1.00 13.86 ? 353  ILE B CD1   1 
ATOM   7617  N  N     . LEU B 1 354 ? 82.686  111.408 70.648  1.00 17.73 ? 354  LEU B N     1 
ATOM   7618  C  CA    . LEU B 1 354 ? 81.924  111.071 71.846  1.00 16.94 ? 354  LEU B CA    1 
ATOM   7619  C  C     . LEU B 1 354 ? 81.666  112.314 72.686  1.00 16.16 ? 354  LEU B C     1 
ATOM   7620  O  O     . LEU B 1 354 ? 82.599  112.946 73.177  1.00 17.01 ? 354  LEU B O     1 
ATOM   7621  C  CB    . LEU B 1 354 ? 82.686  110.047 72.689  1.00 16.14 ? 354  LEU B CB    1 
ATOM   7622  C  CG    . LEU B 1 354 ? 82.094  109.748 74.071  1.00 16.34 ? 354  LEU B CG    1 
ATOM   7623  C  CD1   . LEU B 1 354 ? 80.685  109.186 73.912  1.00 15.49 ? 354  LEU B CD1   1 
ATOM   7624  C  CD2   . LEU B 1 354 ? 82.982  108.753 74.817  1.00 13.28 ? 354  LEU B CD2   1 
ATOM   7625  N  N     . TYR B 1 355 ? 80.393  112.646 72.860  1.00 16.06 ? 355  TYR B N     1 
ATOM   7626  C  CA    . TYR B 1 355 ? 79.989  113.819 73.626  1.00 16.34 ? 355  TYR B CA    1 
ATOM   7627  C  C     . TYR B 1 355 ? 79.176  113.366 74.837  1.00 17.71 ? 355  TYR B C     1 
ATOM   7628  O  O     . TYR B 1 355 ? 78.038  112.902 74.695  1.00 17.34 ? 355  TYR B O     1 
ATOM   7629  C  CB    . TYR B 1 355 ? 79.156  114.728 72.717  1.00 15.93 ? 355  TYR B CB    1 
ATOM   7630  C  CG    . TYR B 1 355 ? 78.696  116.033 73.319  1.00 14.68 ? 355  TYR B CG    1 
ATOM   7631  C  CD1   . TYR B 1 355 ? 79.567  116.833 74.067  1.00 16.31 ? 355  TYR B CD1   1 
ATOM   7632  C  CD2   . TYR B 1 355 ? 77.402  116.500 73.091  1.00 13.91 ? 355  TYR B CD2   1 
ATOM   7633  C  CE1   . TYR B 1 355 ? 79.157  118.071 74.571  1.00 15.81 ? 355  TYR B CE1   1 
ATOM   7634  C  CE2   . TYR B 1 355 ? 76.983  117.730 73.589  1.00 14.87 ? 355  TYR B CE2   1 
ATOM   7635  C  CZ    . TYR B 1 355 ? 77.862  118.510 74.325  1.00 14.57 ? 355  TYR B CZ    1 
ATOM   7636  O  OH    . TYR B 1 355 ? 77.440  119.732 74.794  1.00 16.04 ? 355  TYR B OH    1 
ATOM   7637  N  N     . THR B 1 356 ? 79.742  113.507 76.032  1.00 16.97 ? 356  THR B N     1 
ATOM   7638  C  CA    . THR B 1 356 ? 79.039  113.052 77.224  1.00 18.59 ? 356  THR B CA    1 
ATOM   7639  C  C     . THR B 1 356 ? 79.143  113.982 78.442  1.00 19.87 ? 356  THR B C     1 
ATOM   7640  O  O     . THR B 1 356 ? 79.546  115.136 78.317  1.00 20.02 ? 356  THR B O     1 
ATOM   7641  C  CB    . THR B 1 356 ? 79.525  111.636 77.595  1.00 17.20 ? 356  THR B CB    1 
ATOM   7642  O  OG1   . THR B 1 356 ? 78.675  111.085 78.603  1.00 17.87 ? 356  THR B OG1   1 
ATOM   7643  C  CG2   . THR B 1 356 ? 80.961  111.682 78.100  1.00 16.40 ? 356  THR B CG2   1 
ATOM   7644  N  N     . ALA B 1 357 ? 78.787  113.476 79.622  1.00 21.68 ? 357  ALA B N     1 
ATOM   7645  C  CA    . ALA B 1 357 ? 78.794  114.297 80.839  1.00 22.59 ? 357  ALA B CA    1 
ATOM   7646  C  C     . ALA B 1 357 ? 79.744  113.879 81.958  1.00 21.54 ? 357  ALA B C     1 
ATOM   7647  O  O     . ALA B 1 357 ? 80.010  112.692 82.153  1.00 20.46 ? 357  ALA B O     1 
ATOM   7648  C  CB    . ALA B 1 357 ? 77.385  114.380 81.391  1.00 21.31 ? 357  ALA B CB    1 
ATOM   7649  N  N     . PRO B 1 358 ? 80.248  114.864 82.729  1.00 21.39 ? 358  PRO B N     1 
ATOM   7650  C  CA    . PRO B 1 358 ? 81.171  114.602 83.837  1.00 20.54 ? 358  PRO B CA    1 
ATOM   7651  C  C     . PRO B 1 358 ? 80.684  113.523 84.805  1.00 20.05 ? 358  PRO B C     1 
ATOM   7652  O  O     . PRO B 1 358 ? 81.463  112.681 85.239  1.00 20.68 ? 358  PRO B O     1 
ATOM   7653  C  CB    . PRO B 1 358 ? 81.299  115.969 84.508  1.00 19.49 ? 358  PRO B CB    1 
ATOM   7654  C  CG    . PRO B 1 358 ? 81.185  116.905 83.357  1.00 21.14 ? 358  PRO B CG    1 
ATOM   7655  C  CD    . PRO B 1 358 ? 80.014  116.314 82.589  1.00 20.76 ? 358  PRO B CD    1 
ATOM   7656  N  N     . THR B 1 359 ? 79.399  113.542 85.142  1.00 19.21 ? 359  THR B N     1 
ATOM   7657  C  CA    . THR B 1 359 ? 78.858  112.553 86.071  1.00 19.69 ? 359  THR B CA    1 
ATOM   7658  C  C     . THR B 1 359 ? 79.144  111.117 85.613  1.00 18.96 ? 359  THR B C     1 
ATOM   7659  O  O     . THR B 1 359 ? 79.606  110.292 86.404  1.00 17.83 ? 359  THR B O     1 
ATOM   7660  C  CB    . THR B 1 359 ? 77.332  112.756 86.282  1.00 21.61 ? 359  THR B CB    1 
ATOM   7661  O  OG1   . THR B 1 359 ? 77.110  113.968 87.021  1.00 21.85 ? 359  THR B OG1   1 
ATOM   7662  C  CG2   . THR B 1 359 ? 76.728  111.586 87.062  1.00 21.67 ? 359  THR B CG2   1 
ATOM   7663  N  N     . ALA B 1 360 ? 78.875  110.827 84.340  1.00 17.56 ? 360  ALA B N     1 
ATOM   7664  C  CA    . ALA B 1 360 ? 79.125  109.500 83.787  1.00 16.86 ? 360  ALA B CA    1 
ATOM   7665  C  C     . ALA B 1 360 ? 80.618  109.206 83.818  1.00 18.06 ? 360  ALA B C     1 
ATOM   7666  O  O     . ALA B 1 360 ? 81.038  108.086 84.126  1.00 17.88 ? 360  ALA B O     1 
ATOM   7667  C  CB    . ALA B 1 360 ? 78.614  109.413 82.354  1.00 13.20 ? 360  ALA B CB    1 
ATOM   7668  N  N     . ILE B 1 361 ? 81.411  110.226 83.497  1.00 18.72 ? 361  ILE B N     1 
ATOM   7669  C  CA    . ILE B 1 361 ? 82.867  110.115 83.473  1.00 18.17 ? 361  ILE B CA    1 
ATOM   7670  C  C     . ILE B 1 361 ? 83.401  109.754 84.854  1.00 18.05 ? 361  ILE B C     1 
ATOM   7671  O  O     . ILE B 1 361 ? 84.247  108.867 84.987  1.00 19.81 ? 361  ILE B O     1 
ATOM   7672  C  CB    . ILE B 1 361 ? 83.501  111.441 82.987  1.00 18.96 ? 361  ILE B CB    1 
ATOM   7673  C  CG1   . ILE B 1 361 ? 83.154  111.655 81.509  1.00 18.48 ? 361  ILE B CG1   1 
ATOM   7674  C  CG2   . ILE B 1 361 ? 85.013  111.432 83.217  1.00 19.41 ? 361  ILE B CG2   1 
ATOM   7675  C  CD1   . ILE B 1 361 ? 83.410  113.069 81.005  1.00 17.90 ? 361  ILE B CD1   1 
ATOM   7676  N  N     . ARG B 1 362 ? 82.901  110.436 85.879  1.00 17.75 ? 362  ARG B N     1 
ATOM   7677  C  CA    . ARG B 1 362 ? 83.316  110.161 87.250  1.00 18.28 ? 362  ARG B CA    1 
ATOM   7678  C  C     . ARG B 1 362 ? 82.780  108.795 87.675  1.00 20.46 ? 362  ARG B C     1 
ATOM   7679  O  O     . ARG B 1 362 ? 83.451  108.047 88.385  1.00 20.39 ? 362  ARG B O     1 
ATOM   7680  C  CB    . ARG B 1 362 ? 82.805  111.256 88.192  1.00 17.10 ? 362  ARG B CB    1 
ATOM   7681  C  CG    . ARG B 1 362 ? 83.456  112.625 87.963  1.00 15.95 ? 362  ARG B CG    1 
ATOM   7682  C  CD    . ARG B 1 362 ? 83.047  113.633 89.040  1.00 18.12 ? 362  ARG B CD    1 
ATOM   7683  N  NE    . ARG B 1 362 ? 81.626  113.974 88.973  1.00 17.86 ? 362  ARG B NE    1 
ATOM   7684  C  CZ    . ARG B 1 362 ? 81.142  115.069 88.397  1.00 18.17 ? 362  ARG B CZ    1 
ATOM   7685  N  NH1   . ARG B 1 362 ? 81.956  115.954 87.831  1.00 20.12 ? 362  ARG B NH1   1 
ATOM   7686  N  NH2   . ARG B 1 362 ? 79.837  115.274 88.382  1.00 21.08 ? 362  ARG B NH2   1 
ATOM   7687  N  N     . ALA B 1 363 ? 81.575  108.467 87.215  1.00 22.13 ? 363  ALA B N     1 
ATOM   7688  C  CA    . ALA B 1 363 ? 80.955  107.186 87.531  1.00 24.32 ? 363  ALA B CA    1 
ATOM   7689  C  C     . ALA B 1 363 ? 81.820  106.048 87.001  1.00 24.27 ? 363  ALA B C     1 
ATOM   7690  O  O     . ALA B 1 363 ? 82.022  105.041 87.676  1.00 24.90 ? 363  ALA B O     1 
ATOM   7691  C  CB    . ALA B 1 363 ? 79.552  107.109 86.919  1.00 23.95 ? 363  ALA B CB    1 
ATOM   7692  N  N     . LEU B 1 364 ? 82.327  106.211 85.786  1.00 24.75 ? 364  LEU B N     1 
ATOM   7693  C  CA    . LEU B 1 364 ? 83.177  105.194 85.181  1.00 24.70 ? 364  LEU B CA    1 
ATOM   7694  C  C     . LEU B 1 364 ? 84.593  105.270 85.748  1.00 25.65 ? 364  LEU B C     1 
ATOM   7695  O  O     . LEU B 1 364 ? 85.268  104.250 85.892  1.00 26.38 ? 364  LEU B O     1 
ATOM   7696  C  CB    . LEU B 1 364 ? 83.218  105.378 83.664  1.00 21.85 ? 364  LEU B CB    1 
ATOM   7697  C  CG    . LEU B 1 364 ? 81.890  105.172 82.934  1.00 23.12 ? 364  LEU B CG    1 
ATOM   7698  C  CD1   . LEU B 1 364 ? 82.037  105.639 81.479  1.00 20.96 ? 364  LEU B CD1   1 
ATOM   7699  C  CD2   . LEU B 1 364 ? 81.467  103.706 83.011  1.00 18.51 ? 364  LEU B CD2   1 
ATOM   7700  N  N     . MET B 1 365 ? 85.033  106.487 86.062  1.00 26.25 ? 365  MET B N     1 
ATOM   7701  C  CA    . MET B 1 365 ? 86.363  106.711 86.616  1.00 25.86 ? 365  MET B CA    1 
ATOM   7702  C  C     . MET B 1 365 ? 86.543  105.938 87.914  1.00 25.38 ? 365  MET B C     1 
ATOM   7703  O  O     . MET B 1 365 ? 87.630  105.459 88.218  1.00 25.34 ? 365  MET B O     1 
ATOM   7704  C  CB    . MET B 1 365 ? 86.586  108.205 86.865  1.00 26.46 ? 365  MET B CB    1 
ATOM   7705  C  CG    . MET B 1 365 ? 87.905  108.536 87.543  1.00 27.71 ? 365  MET B CG    1 
ATOM   7706  S  SD    . MET B 1 365 ? 88.313  110.290 87.416  1.00 32.15 ? 365  MET B SD    1 
ATOM   7707  C  CE    . MET B 1 365 ? 87.299  110.970 88.727  1.00 30.52 ? 365  MET B CE    1 
ATOM   7708  N  N     . ALA B 1 366 ? 85.463  105.813 88.675  1.00 25.39 ? 366  ALA B N     1 
ATOM   7709  C  CA    . ALA B 1 366 ? 85.512  105.091 89.936  1.00 25.28 ? 366  ALA B CA    1 
ATOM   7710  C  C     . ALA B 1 366 ? 85.771  103.600 89.710  1.00 25.68 ? 366  ALA B C     1 
ATOM   7711  O  O     . ALA B 1 366 ? 86.126  102.887 90.641  1.00 26.01 ? 366  ALA B O     1 
ATOM   7712  C  CB    . ALA B 1 366 ? 84.215  105.291 90.685  1.00 23.21 ? 366  ALA B CB    1 
ATOM   7713  N  N     . GLU B 1 367 ? 85.595  103.138 88.474  1.00 25.74 ? 367  GLU B N     1 
ATOM   7714  C  CA    . GLU B 1 367 ? 85.816  101.734 88.137  1.00 26.91 ? 367  GLU B CA    1 
ATOM   7715  C  C     . GLU B 1 367 ? 87.202  101.518 87.555  1.00 26.54 ? 367  GLU B C     1 
ATOM   7716  O  O     . GLU B 1 367 ? 87.579  100.395 87.221  1.00 28.21 ? 367  GLU B O     1 
ATOM   7717  C  CB    . GLU B 1 367 ? 84.780  101.244 87.123  1.00 27.24 ? 367  GLU B CB    1 
ATOM   7718  C  CG    . GLU B 1 367 ? 83.353  101.282 87.613  1.00 29.91 ? 367  GLU B CG    1 
ATOM   7719  C  CD    . GLU B 1 367 ? 83.195  100.669 88.988  1.00 33.87 ? 367  GLU B CD    1 
ATOM   7720  O  OE1   . GLU B 1 367 ? 83.777  99.587  89.233  1.00 34.45 ? 367  GLU B OE1   1 
ATOM   7721  O  OE2   . GLU B 1 367 ? 82.483  101.269 89.825  1.00 35.04 ? 367  GLU B OE2   1 
ATOM   7722  N  N     . GLY B 1 368 ? 87.958  102.598 87.421  1.00 26.21 ? 368  GLY B N     1 
ATOM   7723  C  CA    . GLY B 1 368 ? 89.298  102.484 86.882  1.00 24.99 ? 368  GLY B CA    1 
ATOM   7724  C  C     . GLY B 1 368 ? 89.335  101.953 85.466  1.00 25.09 ? 368  GLY B C     1 
ATOM   7725  O  O     . GLY B 1 368 ? 88.512  102.326 84.624  1.00 25.63 ? 368  GLY B O     1 
ATOM   7726  N  N     . ASP B 1 369 ? 90.287  101.067 85.203  1.00 24.34 ? 369  ASP B N     1 
ATOM   7727  C  CA    . ASP B 1 369 ? 90.451  100.507 83.865  1.00 25.10 ? 369  ASP B CA    1 
ATOM   7728  C  C     . ASP B 1 369 ? 89.343  99.544  83.462  1.00 23.01 ? 369  ASP B C     1 
ATOM   7729  O  O     . ASP B 1 369 ? 89.270  99.117  82.309  1.00 21.92 ? 369  ASP B O     1 
ATOM   7730  C  CB    . ASP B 1 369 ? 91.824  99.832  83.753  1.00 27.12 ? 369  ASP B CB    1 
ATOM   7731  C  CG    . ASP B 1 369 ? 92.956  100.836 83.702  1.00 27.95 ? 369  ASP B CG    1 
ATOM   7732  O  OD1   . ASP B 1 369 ? 92.733  102.006 84.074  1.00 29.26 ? 369  ASP B OD1   1 
ATOM   7733  O  OD2   . ASP B 1 369 ? 94.072  100.458 83.299  1.00 30.53 ? 369  ASP B OD2   1 
ATOM   7734  N  N     . LYS B 1 370 ? 88.483  99.200  84.413  1.00 22.23 ? 370  LYS B N     1 
ATOM   7735  C  CA    . LYS B 1 370 ? 87.371  98.318  84.114  1.00 23.26 ? 370  LYS B CA    1 
ATOM   7736  C  C     . LYS B 1 370 ? 86.482  99.018  83.081  1.00 22.17 ? 370  LYS B C     1 
ATOM   7737  O  O     . LYS B 1 370 ? 85.665  98.387  82.423  1.00 22.17 ? 370  LYS B O     1 
ATOM   7738  C  CB    . LYS B 1 370 ? 86.577  98.021  85.389  1.00 25.47 ? 370  LYS B CB    1 
ATOM   7739  C  CG    . LYS B 1 370 ? 87.281  97.060  86.353  1.00 28.41 ? 370  LYS B CG    1 
ATOM   7740  C  CD    . LYS B 1 370 ? 86.595  97.028  87.716  1.00 29.83 ? 370  LYS B CD    1 
ATOM   7741  C  CE    . LYS B 1 370 ? 85.125  96.665  87.591  1.00 31.44 ? 370  LYS B CE    1 
ATOM   7742  N  NZ    . LYS B 1 370 ? 84.378  97.055  88.812  1.00 31.56 ? 370  LYS B NZ    1 
ATOM   7743  N  N     . ALA B 1 371 ? 86.670  100.327 82.934  1.00 21.69 ? 371  ALA B N     1 
ATOM   7744  C  CA    . ALA B 1 371 ? 85.896  101.119 81.987  1.00 22.62 ? 371  ALA B CA    1 
ATOM   7745  C  C     . ALA B 1 371 ? 86.436  101.036 80.557  1.00 22.96 ? 371  ALA B C     1 
ATOM   7746  O  O     . ALA B 1 371 ? 85.781  101.481 79.613  1.00 23.64 ? 371  ALA B O     1 
ATOM   7747  C  CB    . ALA B 1 371 ? 85.841  102.581 82.442  1.00 19.40 ? 371  ALA B CB    1 
ATOM   7748  N  N     . ILE B 1 372 ? 87.624  100.467 80.390  1.00 23.80 ? 372  ILE B N     1 
ATOM   7749  C  CA    . ILE B 1 372 ? 88.216  100.349 79.058  1.00 24.82 ? 372  ILE B CA    1 
ATOM   7750  C  C     . ILE B 1 372 ? 88.736  98.944  78.761  1.00 25.78 ? 372  ILE B C     1 
ATOM   7751  O  O     . ILE B 1 372 ? 89.301  98.693  77.701  1.00 25.69 ? 372  ILE B O     1 
ATOM   7752  C  CB    . ILE B 1 372 ? 89.380  101.354 78.876  1.00 22.30 ? 372  ILE B CB    1 
ATOM   7753  C  CG1   . ILE B 1 372 ? 90.528  101.006 79.820  1.00 20.26 ? 372  ILE B CG1   1 
ATOM   7754  C  CG2   . ILE B 1 372 ? 88.892  102.772 79.142  1.00 20.41 ? 372  ILE B CG2   1 
ATOM   7755  C  CD1   . ILE B 1 372 ? 91.725  101.925 79.680  1.00 20.61 ? 372  ILE B CD1   1 
ATOM   7756  N  N     . GLU B 1 373 ? 88.526  98.030  79.698  1.00 28.00 ? 373  GLU B N     1 
ATOM   7757  C  CA    . GLU B 1 373 ? 88.994  96.661  79.554  1.00 30.55 ? 373  GLU B CA    1 
ATOM   7758  C  C     . GLU B 1 373 ? 88.417  95.924  78.352  1.00 29.76 ? 373  GLU B C     1 
ATOM   7759  O  O     . GLU B 1 373 ? 87.204  95.750  78.229  1.00 30.19 ? 373  GLU B O     1 
ATOM   7760  C  CB    . GLU B 1 373 ? 88.693  95.873  80.825  1.00 33.90 ? 373  GLU B CB    1 
ATOM   7761  C  CG    . GLU B 1 373 ? 89.284  94.485  80.824  1.00 38.11 ? 373  GLU B CG    1 
ATOM   7762  C  CD    . GLU B 1 373 ? 88.989  93.733  82.098  1.00 41.51 ? 373  GLU B CD    1 
ATOM   7763  O  OE1   . GLU B 1 373 ? 89.483  94.156  83.167  1.00 43.54 ? 373  GLU B OE1   1 
ATOM   7764  O  OE2   . GLU B 1 373 ? 88.257  92.723  82.028  1.00 42.33 ? 373  GLU B OE2   1 
ATOM   7765  N  N     . GLY B 1 374 ? 89.306  95.484  77.469  1.00 29.02 ? 374  GLY B N     1 
ATOM   7766  C  CA    . GLY B 1 374 ? 88.879  94.764  76.286  1.00 27.65 ? 374  GLY B CA    1 
ATOM   7767  C  C     . GLY B 1 374 ? 88.440  95.672  75.155  1.00 27.14 ? 374  GLY B C     1 
ATOM   7768  O  O     . GLY B 1 374 ? 88.007  95.191  74.109  1.00 26.99 ? 374  GLY B O     1 
ATOM   7769  N  N     . THR B 1 375 ? 88.549  96.982  75.351  1.00 26.47 ? 375  THR B N     1 
ATOM   7770  C  CA    . THR B 1 375 ? 88.143  97.920  74.314  1.00 25.47 ? 375  THR B CA    1 
ATOM   7771  C  C     . THR B 1 375 ? 89.333  98.490  73.557  1.00 25.06 ? 375  THR B C     1 
ATOM   7772  O  O     . THR B 1 375 ? 90.455  98.528  74.062  1.00 25.63 ? 375  THR B O     1 
ATOM   7773  C  CB    . THR B 1 375 ? 87.308  99.078  74.889  1.00 26.18 ? 375  THR B CB    1 
ATOM   7774  O  OG1   . THR B 1 375 ? 88.113  99.862  75.779  1.00 29.12 ? 375  THR B OG1   1 
ATOM   7775  C  CG2   . THR B 1 375 ? 86.110  98.536  75.643  1.00 24.60 ? 375  THR B CG2   1 
ATOM   7776  N  N     . ASP B 1 376 ? 89.065  98.924  72.334  1.00 25.26 ? 376  ASP B N     1 
ATOM   7777  C  CA    . ASP B 1 376 ? 90.075  99.483  71.454  1.00 26.41 ? 376  ASP B CA    1 
ATOM   7778  C  C     . ASP B 1 376 ? 90.088  101.010 71.590  1.00 25.96 ? 376  ASP B C     1 
ATOM   7779  O  O     . ASP B 1 376 ? 91.103  101.593 71.965  1.00 26.11 ? 376  ASP B O     1 
ATOM   7780  C  CB    . ASP B 1 376 ? 89.754  99.077  70.014  1.00 28.55 ? 376  ASP B CB    1 
ATOM   7781  C  CG    . ASP B 1 376 ? 90.945  99.179  69.098  1.00 32.07 ? 376  ASP B CG    1 
ATOM   7782  O  OD1   . ASP B 1 376 ? 91.889  98.375  69.255  1.00 35.19 ? 376  ASP B OD1   1 
ATOM   7783  O  OD2   . ASP B 1 376 ? 90.938  100.061 68.216  1.00 35.39 ? 376  ASP B OD2   1 
ATOM   7784  N  N     . ARG B 1 377 ? 88.956  101.642 71.280  1.00 23.35 ? 377  ARG B N     1 
ATOM   7785  C  CA    . ARG B 1 377 ? 88.815  103.094 71.372  1.00 22.37 ? 377  ARG B CA    1 
ATOM   7786  C  C     . ARG B 1 377 ? 89.617  103.859 70.324  1.00 23.06 ? 377  ARG B C     1 
ATOM   7787  O  O     . ARG B 1 377 ? 89.693  105.086 70.381  1.00 23.43 ? 377  ARG B O     1 
ATOM   7788  C  CB    . ARG B 1 377 ? 89.230  103.575 72.768  1.00 22.37 ? 377  ARG B CB    1 
ATOM   7789  C  CG    . ARG B 1 377 ? 88.223  103.273 73.865  1.00 22.82 ? 377  ARG B CG    1 
ATOM   7790  C  CD    . ARG B 1 377 ? 88.911  103.176 75.217  1.00 23.66 ? 377  ARG B CD    1 
ATOM   7791  N  NE    . ARG B 1 377 ? 89.772  101.996 75.265  1.00 24.53 ? 377  ARG B NE    1 
ATOM   7792  C  CZ    . ARG B 1 377 ? 91.064  102.013 75.578  1.00 25.03 ? 377  ARG B CZ    1 
ATOM   7793  N  NH1   . ARG B 1 377 ? 91.668  103.161 75.883  1.00 21.41 ? 377  ARG B NH1   1 
ATOM   7794  N  NH2   . ARG B 1 377 ? 91.755  100.876 75.573  1.00 23.75 ? 377  ARG B NH2   1 
ATOM   7795  N  N     . SER B 1 378 ? 90.205  103.145 69.367  1.00 21.63 ? 378  SER B N     1 
ATOM   7796  C  CA    . SER B 1 378 ? 91.018  103.774 68.325  1.00 20.71 ? 378  SER B CA    1 
ATOM   7797  C  C     . SER B 1 378 ? 90.260  104.676 67.351  1.00 20.16 ? 378  SER B C     1 
ATOM   7798  O  O     . SER B 1 378 ? 90.855  105.568 66.744  1.00 18.19 ? 378  SER B O     1 
ATOM   7799  C  CB    . SER B 1 378 ? 91.769  102.703 67.527  1.00 20.83 ? 378  SER B CB    1 
ATOM   7800  O  OG    . SER B 1 378 ? 92.619  101.939 68.367  1.00 24.85 ? 378  SER B OG    1 
ATOM   7801  N  N     . SER B 1 379 ? 88.959  104.449 67.195  1.00 19.51 ? 379  SER B N     1 
ATOM   7802  C  CA    . SER B 1 379 ? 88.150  105.252 66.276  1.00 18.15 ? 379  SER B CA    1 
ATOM   7803  C  C     . SER B 1 379 ? 87.880  106.680 66.768  1.00 17.97 ? 379  SER B C     1 
ATOM   7804  O  O     . SER B 1 379 ? 87.579  107.565 65.972  1.00 17.15 ? 379  SER B O     1 
ATOM   7805  C  CB    . SER B 1 379 ? 86.814  104.549 65.990  1.00 18.67 ? 379  SER B CB    1 
ATOM   7806  O  OG    . SER B 1 379 ? 86.025  104.419 67.161  1.00 19.09 ? 379  SER B OG    1 
ATOM   7807  N  N     . LEU B 1 380 ? 88.003  106.904 68.074  1.00 17.45 ? 380  LEU B N     1 
ATOM   7808  C  CA    . LEU B 1 380 ? 87.763  108.224 68.647  1.00 16.63 ? 380  LEU B CA    1 
ATOM   7809  C  C     . LEU B 1 380 ? 88.773  109.260 68.174  1.00 18.29 ? 380  LEU B C     1 
ATOM   7810  O  O     . LEU B 1 380 ? 89.978  109.004 68.145  1.00 17.27 ? 380  LEU B O     1 
ATOM   7811  C  CB    . LEU B 1 380 ? 87.796  108.160 70.175  1.00 13.93 ? 380  LEU B CB    1 
ATOM   7812  C  CG    . LEU B 1 380 ? 86.691  107.387 70.899  1.00 14.76 ? 380  LEU B CG    1 
ATOM   7813  C  CD1   . LEU B 1 380 ? 87.017  107.329 72.382  1.00 12.40 ? 380  LEU B CD1   1 
ATOM   7814  C  CD2   . LEU B 1 380 ? 85.337  108.043 70.662  1.00 12.67 ? 380  LEU B CD2   1 
ATOM   7815  N  N     . ARG B 1 381 ? 88.263  110.431 67.802  1.00 20.18 ? 381  ARG B N     1 
ATOM   7816  C  CA    . ARG B 1 381 ? 89.089  111.543 67.344  1.00 21.62 ? 381  ARG B CA    1 
ATOM   7817  C  C     . ARG B 1 381 ? 88.773  112.799 68.152  1.00 20.43 ? 381  ARG B C     1 
ATOM   7818  O  O     . ARG B 1 381 ? 89.659  113.612 68.411  1.00 20.69 ? 381  ARG B O     1 
ATOM   7819  C  CB    . ARG B 1 381 ? 88.850  111.819 65.850  1.00 23.75 ? 381  ARG B CB    1 
ATOM   7820  C  CG    . ARG B 1 381 ? 89.745  111.025 64.903  1.00 26.73 ? 381  ARG B CG    1 
ATOM   7821  C  CD    . ARG B 1 381 ? 89.397  111.258 63.423  1.00 31.84 ? 381  ARG B CD    1 
ATOM   7822  N  NE    . ARG B 1 381 ? 88.210  110.503 63.010  1.00 36.20 ? 381  ARG B NE    1 
ATOM   7823  C  CZ    . ARG B 1 381 ? 87.747  110.439 61.762  1.00 37.01 ? 381  ARG B CZ    1 
ATOM   7824  N  NH1   . ARG B 1 381 ? 88.365  111.085 60.778  1.00 39.02 ? 381  ARG B NH1   1 
ATOM   7825  N  NH2   . ARG B 1 381 ? 86.657  109.732 61.497  1.00 35.24 ? 381  ARG B NH2   1 
ATOM   7826  N  N     . ILE B 1 382 ? 87.511  112.948 68.552  1.00 19.39 ? 382  ILE B N     1 
ATOM   7827  C  CA    . ILE B 1 382 ? 87.072  114.107 69.329  1.00 16.55 ? 382  ILE B CA    1 
ATOM   7828  C  C     . ILE B 1 382 ? 86.181  113.706 70.514  1.00 16.65 ? 382  ILE B C     1 
ATOM   7829  O  O     . ILE B 1 382 ? 85.283  112.882 70.372  1.00 16.47 ? 382  ILE B O     1 
ATOM   7830  C  CB    . ILE B 1 382 ? 86.250  115.083 68.466  1.00 17.17 ? 382  ILE B CB    1 
ATOM   7831  C  CG1   . ILE B 1 382 ? 87.021  115.473 67.201  1.00 15.29 ? 382  ILE B CG1   1 
ATOM   7832  C  CG2   . ILE B 1 382 ? 85.909  116.329 69.291  1.00 17.29 ? 382  ILE B CG2   1 
ATOM   7833  C  CD1   . ILE B 1 382 ? 88.210  116.360 67.445  1.00 17.73 ? 382  ILE B CD1   1 
ATOM   7834  N  N     . LEU B 1 383 ? 86.435  114.309 71.673  1.00 16.46 ? 383  LEU B N     1 
ATOM   7835  C  CA    . LEU B 1 383 ? 85.657  114.046 72.883  1.00 15.61 ? 383  LEU B CA    1 
ATOM   7836  C  C     . LEU B 1 383 ? 84.955  115.328 73.330  1.00 17.66 ? 383  LEU B C     1 
ATOM   7837  O  O     . LEU B 1 383 ? 85.400  116.436 73.005  1.00 17.14 ? 383  LEU B O     1 
ATOM   7838  C  CB    . LEU B 1 383 ? 86.564  113.555 74.012  1.00 14.02 ? 383  LEU B CB    1 
ATOM   7839  C  CG    . LEU B 1 383 ? 87.137  112.139 73.907  1.00 15.06 ? 383  LEU B CG    1 
ATOM   7840  C  CD1   . LEU B 1 383 ? 88.121  111.913 75.052  1.00 15.10 ? 383  LEU B CD1   1 
ATOM   7841  C  CD2   . LEU B 1 383 ? 86.014  111.110 73.957  1.00 14.46 ? 383  LEU B CD2   1 
ATOM   7842  N  N     . GLY B 1 384 ? 83.865  115.172 74.079  1.00 18.18 ? 384  GLY B N     1 
ATOM   7843  C  CA    . GLY B 1 384 ? 83.119  116.322 74.564  1.00 17.37 ? 384  GLY B CA    1 
ATOM   7844  C  C     . GLY B 1 384 ? 82.563  116.129 75.967  1.00 16.55 ? 384  GLY B C     1 
ATOM   7845  O  O     . GLY B 1 384 ? 82.318  115.002 76.407  1.00 15.44 ? 384  GLY B O     1 
ATOM   7846  N  N     . SER B 1 385 ? 82.364  117.243 76.666  1.00 16.12 ? 385  SER B N     1 
ATOM   7847  C  CA    . SER B 1 385 ? 81.837  117.244 78.027  1.00 16.54 ? 385  SER B CA    1 
ATOM   7848  C  C     . SER B 1 385 ? 80.791  118.354 78.140  1.00 15.58 ? 385  SER B C     1 
ATOM   7849  O  O     . SER B 1 385 ? 80.999  119.455 77.635  1.00 16.25 ? 385  SER B O     1 
ATOM   7850  C  CB    . SER B 1 385 ? 82.975  117.486 79.026  1.00 16.90 ? 385  SER B CB    1 
ATOM   7851  O  OG    . SER B 1 385 ? 82.514  117.398 80.362  1.00 20.52 ? 385  SER B OG    1 
ATOM   7852  N  N     . VAL B 1 386 ? 79.679  118.074 78.814  1.00 15.81 ? 386  VAL B N     1 
ATOM   7853  C  CA    . VAL B 1 386 ? 78.610  119.066 78.952  1.00 16.92 ? 386  VAL B CA    1 
ATOM   7854  C  C     . VAL B 1 386 ? 77.716  118.872 80.178  1.00 19.38 ? 386  VAL B C     1 
ATOM   7855  O  O     . VAL B 1 386 ? 77.649  117.779 80.745  1.00 18.84 ? 386  VAL B O     1 
ATOM   7856  C  CB    . VAL B 1 386 ? 77.705  119.041 77.697  1.00 16.70 ? 386  VAL B CB    1 
ATOM   7857  C  CG1   . VAL B 1 386 ? 77.163  117.633 77.487  1.00 14.56 ? 386  VAL B CG1   1 
ATOM   7858  C  CG2   . VAL B 1 386 ? 76.564  120.043 77.835  1.00 15.90 ? 386  VAL B CG2   1 
ATOM   7859  N  N     . GLY B 1 387 ? 77.048  119.947 80.596  1.00 20.77 ? 387  GLY B N     1 
ATOM   7860  C  CA    . GLY B 1 387 ? 76.119  119.865 81.710  1.00 22.51 ? 387  GLY B CA    1 
ATOM   7861  C  C     . GLY B 1 387 ? 76.573  120.261 83.103  1.00 22.78 ? 387  GLY B C     1 
ATOM   7862  O  O     . GLY B 1 387 ? 75.750  120.599 83.951  1.00 22.97 ? 387  GLY B O     1 
ATOM   7863  N  N     . GLU B 1 388 ? 77.872  120.217 83.354  1.00 24.27 ? 388  GLU B N     1 
ATOM   7864  C  CA    . GLU B 1 388 ? 78.387  120.557 84.674  1.00 26.05 ? 388  GLU B CA    1 
ATOM   7865  C  C     . GLU B 1 388 ? 79.898  120.683 84.614  1.00 25.04 ? 388  GLU B C     1 
ATOM   7866  O  O     . GLU B 1 388 ? 80.535  120.230 83.666  1.00 22.05 ? 388  GLU B O     1 
ATOM   7867  C  CB    . GLU B 1 388 ? 78.002  119.466 85.683  1.00 27.35 ? 388  GLU B CB    1 
ATOM   7868  C  CG    . GLU B 1 388 ? 78.617  118.120 85.367  1.00 29.37 ? 388  GLU B CG    1 
ATOM   7869  C  CD    . GLU B 1 388 ? 77.940  116.968 86.094  1.00 32.17 ? 388  GLU B CD    1 
ATOM   7870  O  OE1   . GLU B 1 388 ? 77.994  116.928 87.348  1.00 32.61 ? 388  GLU B OE1   1 
ATOM   7871  O  OE2   . GLU B 1 388 ? 77.354  116.102 85.402  1.00 30.97 ? 388  GLU B OE2   1 
ATOM   7872  N  N     . PRO B 1 389 ? 80.492  121.319 85.630  1.00 25.32 ? 389  PRO B N     1 
ATOM   7873  C  CA    . PRO B 1 389 ? 81.943  121.495 85.677  1.00 26.49 ? 389  PRO B CA    1 
ATOM   7874  C  C     . PRO B 1 389 ? 82.643  120.145 85.641  1.00 26.66 ? 389  PRO B C     1 
ATOM   7875  O  O     . PRO B 1 389 ? 82.039  119.110 85.931  1.00 26.94 ? 389  PRO B O     1 
ATOM   7876  C  CB    . PRO B 1 389 ? 82.158  122.214 87.007  1.00 27.59 ? 389  PRO B CB    1 
ATOM   7877  C  CG    . PRO B 1 389 ? 80.881  122.990 87.187  1.00 27.20 ? 389  PRO B CG    1 
ATOM   7878  C  CD    . PRO B 1 389 ? 79.844  121.978 86.778  1.00 26.45 ? 389  PRO B CD    1 
ATOM   7879  N  N     . ILE B 1 390 ? 83.919  120.159 85.282  1.00 27.18 ? 390  ILE B N     1 
ATOM   7880  C  CA    . ILE B 1 390 ? 84.709  118.940 85.238  1.00 27.52 ? 390  ILE B CA    1 
ATOM   7881  C  C     . ILE B 1 390 ? 86.079  119.261 85.823  1.00 29.69 ? 390  ILE B C     1 
ATOM   7882  O  O     . ILE B 1 390 ? 86.796  120.129 85.323  1.00 30.16 ? 390  ILE B O     1 
ATOM   7883  C  CB    . ILE B 1 390 ? 84.842  118.405 83.790  1.00 26.07 ? 390  ILE B CB    1 
ATOM   7884  C  CG1   . ILE B 1 390 ? 85.661  117.114 83.781  1.00 23.56 ? 390  ILE B CG1   1 
ATOM   7885  C  CG2   . ILE B 1 390 ? 85.465  119.461 82.888  1.00 26.35 ? 390  ILE B CG2   1 
ATOM   7886  C  CD1   . ILE B 1 390 ? 85.676  116.415 82.442  1.00 21.54 ? 390  ILE B CD1   1 
ATOM   7887  N  N     . ASN B 1 391 ? 86.419  118.575 86.908  1.00 31.46 ? 391  ASN B N     1 
ATOM   7888  C  CA    . ASN B 1 391 ? 87.693  118.783 87.588  1.00 34.12 ? 391  ASN B CA    1 
ATOM   7889  C  C     . ASN B 1 391 ? 88.854  118.217 86.777  1.00 34.47 ? 391  ASN B C     1 
ATOM   7890  O  O     . ASN B 1 391 ? 88.675  117.297 85.984  1.00 35.66 ? 391  ASN B O     1 
ATOM   7891  C  CB    . ASN B 1 391 ? 87.659  118.121 88.968  1.00 36.47 ? 391  ASN B CB    1 
ATOM   7892  C  CG    . ASN B 1 391 ? 87.526  116.612 88.883  1.00 39.45 ? 391  ASN B CG    1 
ATOM   7893  O  OD1   . ASN B 1 391 ? 88.444  115.929 88.426  1.00 41.06 ? 391  ASN B OD1   1 
ATOM   7894  N  ND2   . ASN B 1 391 ? 86.378  116.084 89.312  1.00 40.65 ? 391  ASN B ND2   1 
ATOM   7895  N  N     . PRO B 1 392 ? 90.064  118.766 86.965  1.00 35.15 ? 392  PRO B N     1 
ATOM   7896  C  CA    . PRO B 1 392 ? 91.260  118.312 86.247  1.00 35.94 ? 392  PRO B CA    1 
ATOM   7897  C  C     . PRO B 1 392 ? 91.491  116.803 86.342  1.00 35.56 ? 392  PRO B C     1 
ATOM   7898  O  O     . PRO B 1 392 ? 91.915  116.177 85.371  1.00 37.17 ? 392  PRO B O     1 
ATOM   7899  C  CB    . PRO B 1 392 ? 92.379  119.117 86.906  1.00 36.92 ? 392  PRO B CB    1 
ATOM   7900  C  CG    . PRO B 1 392 ? 91.696  120.409 87.229  1.00 36.72 ? 392  PRO B CG    1 
ATOM   7901  C  CD    . PRO B 1 392 ? 90.380  119.926 87.816  1.00 36.52 ? 392  PRO B CD    1 
ATOM   7902  N  N     . GLU B 1 393 ? 91.219  116.223 87.507  1.00 33.41 ? 393  GLU B N     1 
ATOM   7903  C  CA    . GLU B 1 393 ? 91.398  114.789 87.683  1.00 32.63 ? 393  GLU B CA    1 
ATOM   7904  C  C     . GLU B 1 393 ? 90.535  114.044 86.664  1.00 30.47 ? 393  GLU B C     1 
ATOM   7905  O  O     . GLU B 1 393 ? 91.033  113.225 85.901  1.00 29.87 ? 393  GLU B O     1 
ATOM   7906  C  CB    . GLU B 1 393 ? 91.006  114.365 89.104  1.00 34.71 ? 393  GLU B CB    1 
ATOM   7907  C  CG    . GLU B 1 393 ? 91.153  112.868 89.357  1.00 39.12 ? 393  GLU B CG    1 
ATOM   7908  C  CD    . GLU B 1 393 ? 90.637  112.436 90.723  1.00 41.80 ? 393  GLU B CD    1 
ATOM   7909  O  OE1   . GLU B 1 393 ? 89.467  112.743 91.049  1.00 42.27 ? 393  GLU B OE1   1 
ATOM   7910  O  OE2   . GLU B 1 393 ? 91.402  111.782 91.465  1.00 42.82 ? 393  GLU B OE2   1 
ATOM   7911  N  N     . ALA B 1 394 ? 89.240  114.340 86.654  1.00 27.58 ? 394  ALA B N     1 
ATOM   7912  C  CA    . ALA B 1 394 ? 88.318  113.693 85.731  1.00 26.67 ? 394  ALA B CA    1 
ATOM   7913  C  C     . ALA B 1 394 ? 88.624  114.066 84.275  1.00 26.30 ? 394  ALA B C     1 
ATOM   7914  O  O     . ALA B 1 394 ? 88.602  113.208 83.386  1.00 25.02 ? 394  ALA B O     1 
ATOM   7915  C  CB    . ALA B 1 394 ? 86.877  114.070 86.085  1.00 25.07 ? 394  ALA B CB    1 
ATOM   7916  N  N     . TRP B 1 395 ? 88.917  115.342 84.035  1.00 25.26 ? 395  TRP B N     1 
ATOM   7917  C  CA    . TRP B 1 395 ? 89.220  115.810 82.685  1.00 23.70 ? 395  TRP B CA    1 
ATOM   7918  C  C     . TRP B 1 395 ? 90.375  115.011 82.094  1.00 22.85 ? 395  TRP B C     1 
ATOM   7919  O  O     . TRP B 1 395 ? 90.322  114.576 80.945  1.00 21.23 ? 395  TRP B O     1 
ATOM   7920  C  CB    . TRP B 1 395 ? 89.599  117.294 82.706  1.00 24.01 ? 395  TRP B CB    1 
ATOM   7921  C  CG    . TRP B 1 395 ? 89.744  117.900 81.336  1.00 23.73 ? 395  TRP B CG    1 
ATOM   7922  C  CD1   . TRP B 1 395 ? 88.799  118.601 80.647  1.00 22.89 ? 395  TRP B CD1   1 
ATOM   7923  C  CD2   . TRP B 1 395 ? 90.894  117.832 80.483  1.00 23.63 ? 395  TRP B CD2   1 
ATOM   7924  N  NE1   . TRP B 1 395 ? 89.287  118.975 79.418  1.00 23.83 ? 395  TRP B NE1   1 
ATOM   7925  C  CE2   . TRP B 1 395 ? 90.571  118.515 79.291  1.00 23.15 ? 395  TRP B CE2   1 
ATOM   7926  C  CE3   . TRP B 1 395 ? 92.167  117.257 80.612  1.00 24.39 ? 395  TRP B CE3   1 
ATOM   7927  C  CZ2   . TRP B 1 395 ? 91.474  118.642 78.230  1.00 24.70 ? 395  TRP B CZ2   1 
ATOM   7928  C  CZ3   . TRP B 1 395 ? 93.068  117.382 79.557  1.00 25.20 ? 395  TRP B CZ3   1 
ATOM   7929  C  CH2   . TRP B 1 395 ? 92.714  118.070 78.381  1.00 25.79 ? 395  TRP B CH2   1 
ATOM   7930  N  N     . GLU B 1 396 ? 91.417  114.828 82.895  1.00 22.31 ? 396  GLU B N     1 
ATOM   7931  C  CA    . GLU B 1 396 ? 92.605  114.106 82.463  1.00 22.59 ? 396  GLU B CA    1 
ATOM   7932  C  C     . GLU B 1 396 ? 92.306  112.627 82.283  1.00 22.10 ? 396  GLU B C     1 
ATOM   7933  O  O     . GLU B 1 396 ? 92.692  112.023 81.278  1.00 24.16 ? 396  GLU B O     1 
ATOM   7934  C  CB    . GLU B 1 396 ? 93.735  114.294 83.487  1.00 22.84 ? 396  GLU B CB    1 
ATOM   7935  N  N     . TRP B 1 397 ? 91.626  112.045 83.268  1.00 20.85 ? 397  TRP B N     1 
ATOM   7936  C  CA    . TRP B 1 397 ? 91.280  110.630 83.214  1.00 18.78 ? 397  TRP B CA    1 
ATOM   7937  C  C     . TRP B 1 397 ? 90.542  110.352 81.905  1.00 18.34 ? 397  TRP B C     1 
ATOM   7938  O  O     . TRP B 1 397 ? 90.865  109.410 81.181  1.00 17.94 ? 397  TRP B O     1 
ATOM   7939  C  CB    . TRP B 1 397 ? 90.390  110.258 84.400  1.00 19.50 ? 397  TRP B CB    1 
ATOM   7940  C  CG    . TRP B 1 397 ? 90.055  108.810 84.438  1.00 20.48 ? 397  TRP B CG    1 
ATOM   7941  C  CD1   . TRP B 1 397 ? 90.774  107.816 85.035  1.00 19.53 ? 397  TRP B CD1   1 
ATOM   7942  C  CD2   . TRP B 1 397 ? 88.949  108.174 83.794  1.00 20.00 ? 397  TRP B CD2   1 
ATOM   7943  N  NE1   . TRP B 1 397 ? 90.185  106.600 84.800  1.00 19.94 ? 397  TRP B NE1   1 
ATOM   7944  C  CE2   . TRP B 1 397 ? 89.061  106.791 84.040  1.00 19.73 ? 397  TRP B CE2   1 
ATOM   7945  C  CE3   . TRP B 1 397 ? 87.872  108.641 83.029  1.00 21.24 ? 397  TRP B CE3   1 
ATOM   7946  C  CZ2   . TRP B 1 397 ? 88.135  105.864 83.549  1.00 19.60 ? 397  TRP B CZ2   1 
ATOM   7947  C  CZ3   . TRP B 1 397 ? 86.946  107.717 82.539  1.00 21.78 ? 397  TRP B CZ3   1 
ATOM   7948  C  CH2   . TRP B 1 397 ? 87.088  106.344 82.803  1.00 19.75 ? 397  TRP B CH2   1 
ATOM   7949  N  N     . TYR B 1 398 ? 89.558  111.197 81.622  1.00 17.46 ? 398  TYR B N     1 
ATOM   7950  C  CA    . TYR B 1 398 ? 88.744  111.110 80.416  1.00 18.68 ? 398  TYR B CA    1 
ATOM   7951  C  C     . TYR B 1 398 ? 89.626  111.259 79.169  1.00 19.17 ? 398  TYR B C     1 
ATOM   7952  O  O     . TYR B 1 398 ? 89.552  110.468 78.231  1.00 19.23 ? 398  TYR B O     1 
ATOM   7953  C  CB    . TYR B 1 398 ? 87.697  112.226 80.474  1.00 18.64 ? 398  TYR B CB    1 
ATOM   7954  C  CG    . TYR B 1 398 ? 86.730  112.307 79.314  1.00 19.30 ? 398  TYR B CG    1 
ATOM   7955  C  CD1   . TYR B 1 398 ? 86.008  111.189 78.901  1.00 19.23 ? 398  TYR B CD1   1 
ATOM   7956  C  CD2   . TYR B 1 398 ? 86.482  113.528 78.680  1.00 18.68 ? 398  TYR B CD2   1 
ATOM   7957  C  CE1   . TYR B 1 398 ? 85.058  111.282 77.890  1.00 17.22 ? 398  TYR B CE1   1 
ATOM   7958  C  CE2   . TYR B 1 398 ? 85.534  113.637 77.668  1.00 16.91 ? 398  TYR B CE2   1 
ATOM   7959  C  CZ    . TYR B 1 398 ? 84.824  112.508 77.279  1.00 19.10 ? 398  TYR B CZ    1 
ATOM   7960  O  OH    . TYR B 1 398 ? 83.873  112.606 76.286  1.00 17.49 ? 398  TYR B OH    1 
ATOM   7961  N  N     . TRP B 1 399 ? 90.465  112.283 79.184  1.00 19.59 ? 399  TRP B N     1 
ATOM   7962  C  CA    . TRP B 1 399 ? 91.366  112.573 78.077  1.00 21.70 ? 399  TRP B CA    1 
ATOM   7963  C  C     . TRP B 1 399 ? 92.388  111.451 77.846  1.00 22.82 ? 399  TRP B C     1 
ATOM   7964  O  O     . TRP B 1 399 ? 92.771  111.171 76.701  1.00 21.19 ? 399  TRP B O     1 
ATOM   7965  C  CB    . TRP B 1 399 ? 92.079  113.898 78.361  1.00 22.67 ? 399  TRP B CB    1 
ATOM   7966  C  CG    . TRP B 1 399 ? 93.196  114.229 77.439  1.00 25.45 ? 399  TRP B CG    1 
ATOM   7967  C  CD1   . TRP B 1 399 ? 93.095  114.744 76.182  1.00 27.89 ? 399  TRP B CD1   1 
ATOM   7968  C  CD2   . TRP B 1 399 ? 94.594  114.083 77.705  1.00 26.85 ? 399  TRP B CD2   1 
ATOM   7969  N  NE1   . TRP B 1 399 ? 94.347  114.930 75.643  1.00 28.46 ? 399  TRP B NE1   1 
ATOM   7970  C  CE2   . TRP B 1 399 ? 95.286  114.533 76.558  1.00 27.65 ? 399  TRP B CE2   1 
ATOM   7971  C  CE3   . TRP B 1 399 ? 95.329  113.618 78.801  1.00 27.60 ? 399  TRP B CE3   1 
ATOM   7972  C  CZ2   . TRP B 1 399 ? 96.684  114.531 76.475  1.00 27.65 ? 399  TRP B CZ2   1 
ATOM   7973  C  CZ3   . TRP B 1 399 ? 96.725  113.614 78.717  1.00 28.24 ? 399  TRP B CZ3   1 
ATOM   7974  C  CH2   . TRP B 1 399 ? 97.382  114.070 77.560  1.00 27.16 ? 399  TRP B CH2   1 
ATOM   7975  N  N     . LYS B 1 400 ? 92.816  110.800 78.928  1.00 22.20 ? 400  LYS B N     1 
ATOM   7976  C  CA    . LYS B 1 400 ? 93.804  109.732 78.806  1.00 24.60 ? 400  LYS B CA    1 
ATOM   7977  C  C     . LYS B 1 400 ? 93.230  108.338 78.556  1.00 23.95 ? 400  LYS B C     1 
ATOM   7978  O  O     . LYS B 1 400 ? 93.649  107.647 77.625  1.00 23.96 ? 400  LYS B O     1 
ATOM   7979  C  CB    . LYS B 1 400 ? 94.699  109.674 80.048  1.00 25.87 ? 400  LYS B CB    1 
ATOM   7980  C  CG    . LYS B 1 400 ? 95.906  108.753 79.864  1.00 29.20 ? 400  LYS B CG    1 
ATOM   7981  C  CD    . LYS B 1 400 ? 96.403  108.163 81.175  1.00 30.70 ? 400  LYS B CD    1 
ATOM   7982  C  CE    . LYS B 1 400 ? 96.811  109.227 82.164  1.00 32.36 ? 400  LYS B CE    1 
ATOM   7983  N  NZ    . LYS B 1 400 ? 97.220  108.610 83.456  1.00 34.35 ? 400  LYS B NZ    1 
ATOM   7984  N  N     . LYS B 1 401 ? 92.277  107.927 79.388  1.00 24.70 ? 401  LYS B N     1 
ATOM   7985  C  CA    . LYS B 1 401 ? 91.672  106.602 79.271  1.00 25.13 ? 401  LYS B CA    1 
ATOM   7986  C  C     . LYS B 1 401 ? 90.729  106.427 78.083  1.00 24.43 ? 401  LYS B C     1 
ATOM   7987  O  O     . LYS B 1 401 ? 90.705  105.367 77.457  1.00 25.60 ? 401  LYS B O     1 
ATOM   7988  C  CB    . LYS B 1 401 ? 90.931  106.251 80.564  1.00 25.38 ? 401  LYS B CB    1 
ATOM   7989  C  CG    . LYS B 1 401 ? 91.822  106.194 81.791  1.00 27.95 ? 401  LYS B CG    1 
ATOM   7990  C  CD    . LYS B 1 401 ? 92.876  105.099 81.665  1.00 28.58 ? 401  LYS B CD    1 
ATOM   7991  C  CE    . LYS B 1 401 ? 93.771  105.040 82.900  1.00 28.19 ? 401  LYS B CE    1 
ATOM   7992  N  NZ    . LYS B 1 401 ? 94.743  103.909 82.834  1.00 27.54 ? 401  LYS B NZ    1 
ATOM   7993  N  N     . ILE B 1 402 ? 89.948  107.452 77.767  1.00 24.17 ? 402  ILE B N     1 
ATOM   7994  C  CA    . ILE B 1 402 ? 89.020  107.349 76.651  1.00 23.78 ? 402  ILE B CA    1 
ATOM   7995  C  C     . ILE B 1 402 ? 89.653  107.805 75.336  1.00 23.31 ? 402  ILE B C     1 
ATOM   7996  O  O     . ILE B 1 402 ? 89.557  107.111 74.329  1.00 22.77 ? 402  ILE B O     1 
ATOM   7997  C  CB    . ILE B 1 402 ? 87.742  108.179 76.902  1.00 23.90 ? 402  ILE B CB    1 
ATOM   7998  C  CG1   . ILE B 1 402 ? 87.215  107.919 78.318  1.00 24.27 ? 402  ILE B CG1   1 
ATOM   7999  C  CG2   . ILE B 1 402 ? 86.675  107.812 75.867  1.00 21.63 ? 402  ILE B CG2   1 
ATOM   8000  C  CD1   . ILE B 1 402 ? 86.760  106.494 78.571  1.00 25.36 ? 402  ILE B CD1   1 
ATOM   8001  N  N     . GLY B 1 403 ? 90.305  108.965 75.355  1.00 23.75 ? 403  GLY B N     1 
ATOM   8002  C  CA    . GLY B 1 403 ? 90.926  109.494 74.152  1.00 24.57 ? 403  GLY B CA    1 
ATOM   8003  C  C     . GLY B 1 403 ? 92.353  109.058 73.869  1.00 25.14 ? 403  GLY B C     1 
ATOM   8004  O  O     . GLY B 1 403 ? 92.937  109.478 72.870  1.00 25.25 ? 403  GLY B O     1 
ATOM   8005  N  N     . LYS B 1 404 ? 92.918  108.218 74.735  1.00 25.40 ? 404  LYS B N     1 
ATOM   8006  C  CA    . LYS B 1 404 ? 94.284  107.729 74.560  1.00 25.39 ? 404  LYS B CA    1 
ATOM   8007  C  C     . LYS B 1 404 ? 95.274  108.882 74.392  1.00 25.05 ? 404  LYS B C     1 
ATOM   8008  O  O     . LYS B 1 404 ? 96.307  108.738 73.734  1.00 22.19 ? 404  LYS B O     1 
ATOM   8009  C  CB    . LYS B 1 404 ? 94.353  106.784 73.351  1.00 27.84 ? 404  LYS B CB    1 
ATOM   8010  C  CG    . LYS B 1 404 ? 93.454  105.558 73.497  1.00 29.98 ? 404  LYS B CG    1 
ATOM   8011  C  CD    . LYS B 1 404 ? 93.368  104.719 72.226  1.00 32.55 ? 404  LYS B CD    1 
ATOM   8012  C  CE    . LYS B 1 404 ? 94.586  103.829 72.032  1.00 33.00 ? 404  LYS B CE    1 
ATOM   8013  N  NZ    . LYS B 1 404 ? 94.407  102.930 70.850  1.00 35.11 ? 404  LYS B NZ    1 
ATOM   8014  N  N     . GLU B 1 405 ? 94.944  110.018 75.007  1.00 26.16 ? 405  GLU B N     1 
ATOM   8015  C  CA    . GLU B 1 405 ? 95.760  111.230 74.966  1.00 27.48 ? 405  GLU B CA    1 
ATOM   8016  C  C     . GLU B 1 405 ? 95.909  111.808 73.564  1.00 28.07 ? 405  GLU B C     1 
ATOM   8017  O  O     . GLU B 1 405 ? 96.839  112.567 73.300  1.00 28.29 ? 405  GLU B O     1 
ATOM   8018  C  CB    . GLU B 1 405 ? 97.155  110.954 75.537  1.00 28.50 ? 405  GLU B CB    1 
ATOM   8019  C  CG    . GLU B 1 405 ? 97.163  110.444 76.968  1.00 31.05 ? 405  GLU B CG    1 
ATOM   8020  C  CD    . GLU B 1 405 ? 98.559  110.416 77.571  1.00 31.99 ? 405  GLU B CD    1 
ATOM   8021  O  OE1   . GLU B 1 405 ? 98.707  109.935 78.715  1.00 32.79 ? 405  GLU B OE1   1 
ATOM   8022  O  OE2   . GLU B 1 405 ? 99.511  110.879 76.906  1.00 33.21 ? 405  GLU B OE2   1 
ATOM   8023  N  N     . LYS B 1 406 ? 94.989  111.464 72.669  1.00 28.72 ? 406  LYS B N     1 
ATOM   8024  C  CA    . LYS B 1 406 ? 95.061  111.947 71.296  1.00 29.59 ? 406  LYS B CA    1 
ATOM   8025  C  C     . LYS B 1 406 ? 93.812  112.705 70.854  1.00 28.51 ? 406  LYS B C     1 
ATOM   8026  O  O     . LYS B 1 406 ? 93.727  113.176 69.717  1.00 28.98 ? 406  LYS B O     1 
ATOM   8027  C  CB    . LYS B 1 406 ? 95.297  110.762 70.360  1.00 32.58 ? 406  LYS B CB    1 
ATOM   8028  C  CG    . LYS B 1 406 ? 96.538  109.959 70.698  1.00 35.73 ? 406  LYS B CG    1 
ATOM   8029  C  CD    . LYS B 1 406 ? 96.470  108.551 70.124  1.00 38.28 ? 406  LYS B CD    1 
ATOM   8030  C  CE    . LYS B 1 406 ? 96.426  108.556 68.614  1.00 40.13 ? 406  LYS B CE    1 
ATOM   8031  N  NZ    . LYS B 1 406 ? 96.316  107.173 68.079  1.00 42.92 ? 406  LYS B NZ    1 
ATOM   8032  N  N     . CYS B 1 407 ? 92.845  112.835 71.749  1.00 25.48 ? 407  CYS B N     1 
ATOM   8033  C  CA    . CYS B 1 407 ? 91.619  113.520 71.385  1.00 23.98 ? 407  CYS B CA    1 
ATOM   8034  C  C     . CYS B 1 407 ? 91.370  114.797 72.172  1.00 23.04 ? 407  CYS B C     1 
ATOM   8035  O  O     . CYS B 1 407 ? 91.472  114.821 73.404  1.00 22.67 ? 407  CYS B O     1 
ATOM   8036  C  CB    . CYS B 1 407 ? 90.424  112.584 71.566  1.00 22.70 ? 407  CYS B CB    1 
ATOM   8037  S  SG    . CYS B 1 407 ? 90.578  110.995 70.734  1.00 21.83 ? 407  CYS B SG    1 
ATOM   8038  N  N     . PRO B 1 408 ? 91.070  115.892 71.460  1.00 21.73 ? 408  PRO B N     1 
ATOM   8039  C  CA    . PRO B 1 408 ? 90.800  117.155 72.149  1.00 20.85 ? 408  PRO B CA    1 
ATOM   8040  C  C     . PRO B 1 408 ? 89.471  116.992 72.897  1.00 20.55 ? 408  PRO B C     1 
ATOM   8041  O  O     . PRO B 1 408 ? 88.564  116.319 72.405  1.00 20.66 ? 408  PRO B O     1 
ATOM   8042  C  CB    . PRO B 1 408 ? 90.684  118.156 71.002  1.00 20.13 ? 408  PRO B CB    1 
ATOM   8043  C  CG    . PRO B 1 408 ? 91.526  117.540 69.910  1.00 20.12 ? 408  PRO B CG    1 
ATOM   8044  C  CD    . PRO B 1 408 ? 91.167  116.091 70.004  1.00 20.83 ? 408  PRO B CD    1 
ATOM   8045  N  N     . VAL B 1 409 ? 89.360  117.580 74.086  1.00 19.96 ? 409  VAL B N     1 
ATOM   8046  C  CA    . VAL B 1 409 ? 88.122  117.498 74.864  1.00 19.57 ? 409  VAL B CA    1 
ATOM   8047  C  C     . VAL B 1 409 ? 87.387  118.837 74.829  1.00 19.71 ? 409  VAL B C     1 
ATOM   8048  O  O     . VAL B 1 409 ? 87.857  119.816 75.404  1.00 20.17 ? 409  VAL B O     1 
ATOM   8049  C  CB    . VAL B 1 409 ? 88.392  117.143 76.352  1.00 18.60 ? 409  VAL B CB    1 
ATOM   8050  C  CG1   . VAL B 1 409 ? 87.111  117.289 77.159  1.00 16.49 ? 409  VAL B CG1   1 
ATOM   8051  C  CG2   . VAL B 1 409 ? 88.911  115.730 76.473  1.00 21.01 ? 409  VAL B CG2   1 
ATOM   8052  N  N     . VAL B 1 410 ? 86.238  118.895 74.161  1.00 18.93 ? 410  VAL B N     1 
ATOM   8053  C  CA    . VAL B 1 410 ? 85.496  120.152 74.110  1.00 17.75 ? 410  VAL B CA    1 
ATOM   8054  C  C     . VAL B 1 410 ? 84.508  120.284 75.268  1.00 17.28 ? 410  VAL B C     1 
ATOM   8055  O  O     . VAL B 1 410 ? 83.475  119.609 75.323  1.00 16.84 ? 410  VAL B O     1 
ATOM   8056  C  CB    . VAL B 1 410 ? 84.737  120.340 72.760  1.00 17.66 ? 410  VAL B CB    1 
ATOM   8057  C  CG1   . VAL B 1 410 ? 85.727  120.566 71.642  1.00 18.78 ? 410  VAL B CG1   1 
ATOM   8058  C  CG2   . VAL B 1 410 ? 83.872  119.124 72.453  1.00 18.00 ? 410  VAL B CG2   1 
ATOM   8059  N  N     . ASP B 1 411 ? 84.856  121.158 76.203  1.00 17.74 ? 411  ASP B N     1 
ATOM   8060  C  CA    . ASP B 1 411 ? 84.029  121.428 77.370  1.00 17.43 ? 411  ASP B CA    1 
ATOM   8061  C  C     . ASP B 1 411 ? 83.082  122.567 77.000  1.00 17.46 ? 411  ASP B C     1 
ATOM   8062  O  O     . ASP B 1 411 ? 83.443  123.745 77.084  1.00 18.97 ? 411  ASP B O     1 
ATOM   8063  C  CB    . ASP B 1 411 ? 84.917  121.827 78.546  1.00 16.46 ? 411  ASP B CB    1 
ATOM   8064  C  CG    . ASP B 1 411 ? 84.131  122.100 79.794  1.00 15.89 ? 411  ASP B CG    1 
ATOM   8065  O  OD1   . ASP B 1 411 ? 82.904  121.863 79.777  1.00 15.00 ? 411  ASP B OD1   1 
ATOM   8066  O  OD2   . ASP B 1 411 ? 84.736  122.550 80.792  1.00 16.51 ? 411  ASP B OD2   1 
ATOM   8067  N  N     . THR B 1 412 ? 81.873  122.195 76.589  1.00 17.38 ? 412  THR B N     1 
ATOM   8068  C  CA    . THR B 1 412 ? 80.861  123.145 76.150  1.00 16.35 ? 412  THR B CA    1 
ATOM   8069  C  C     . THR B 1 412 ? 79.946  123.677 77.241  1.00 16.52 ? 412  THR B C     1 
ATOM   8070  O  O     . THR B 1 412 ? 79.233  122.911 77.892  1.00 16.77 ? 412  THR B O     1 
ATOM   8071  C  CB    . THR B 1 412 ? 79.937  122.516 75.075  1.00 18.48 ? 412  THR B CB    1 
ATOM   8072  O  OG1   . THR B 1 412 ? 79.177  121.454 75.663  1.00 18.74 ? 412  THR B OG1   1 
ATOM   8073  C  CG2   . THR B 1 412 ? 80.751  121.963 73.900  1.00 15.50 ? 412  THR B CG2   1 
ATOM   8074  N  N     . TRP B 1 413 ? 79.953  124.993 77.431  1.00 15.74 ? 413  TRP B N     1 
ATOM   8075  C  CA    . TRP B 1 413 ? 79.070  125.606 78.416  1.00 15.22 ? 413  TRP B CA    1 
ATOM   8076  C  C     . TRP B 1 413 ? 77.924  126.286 77.687  1.00 13.68 ? 413  TRP B C     1 
ATOM   8077  O  O     . TRP B 1 413 ? 78.141  126.986 76.702  1.00 12.35 ? 413  TRP B O     1 
ATOM   8078  C  CB    . TRP B 1 413 ? 79.789  126.658 79.263  1.00 15.41 ? 413  TRP B CB    1 
ATOM   8079  C  CG    . TRP B 1 413 ? 78.823  127.395 80.158  1.00 15.15 ? 413  TRP B CG    1 
ATOM   8080  C  CD1   . TRP B 1 413 ? 78.330  126.965 81.357  1.00 16.98 ? 413  TRP B CD1   1 
ATOM   8081  C  CD2   . TRP B 1 413 ? 78.156  128.631 79.873  1.00 13.09 ? 413  TRP B CD2   1 
ATOM   8082  N  NE1   . TRP B 1 413 ? 77.394  127.852 81.834  1.00 15.41 ? 413  TRP B NE1   1 
ATOM   8083  C  CE2   . TRP B 1 413 ? 77.267  128.882 80.943  1.00 14.73 ? 413  TRP B CE2   1 
ATOM   8084  C  CE3   . TRP B 1 413 ? 78.219  129.549 78.814  1.00 13.29 ? 413  TRP B CE3   1 
ATOM   8085  C  CZ2   . TRP B 1 413 ? 76.441  130.015 80.988  1.00 15.66 ? 413  TRP B CZ2   1 
ATOM   8086  C  CZ3   . TRP B 1 413 ? 77.397  130.680 78.857  1.00 12.19 ? 413  TRP B CZ3   1 
ATOM   8087  C  CH2   . TRP B 1 413 ? 76.520  130.899 79.940  1.00 14.60 ? 413  TRP B CH2   1 
ATOM   8088  N  N     . TRP B 1 414 ? 76.709  126.068 78.180  1.00 14.68 ? 414  TRP B N     1 
ATOM   8089  C  CA    . TRP B 1 414 ? 75.492  126.660 77.625  1.00 14.81 ? 414  TRP B CA    1 
ATOM   8090  C  C     . TRP B 1 414 ? 74.313  126.241 78.482  1.00 16.59 ? 414  TRP B C     1 
ATOM   8091  O  O     . TRP B 1 414 ? 74.479  125.535 79.481  1.00 18.06 ? 414  TRP B O     1 
ATOM   8092  C  CB    . TRP B 1 414 ? 75.265  126.255 76.154  1.00 15.26 ? 414  TRP B CB    1 
ATOM   8093  C  CG    . TRP B 1 414 ? 75.158  124.780 75.881  1.00 16.37 ? 414  TRP B CG    1 
ATOM   8094  C  CD1   . TRP B 1 414 ? 76.122  123.836 76.085  1.00 15.81 ? 414  TRP B CD1   1 
ATOM   8095  C  CD2   . TRP B 1 414 ? 74.034  124.091 75.315  1.00 15.60 ? 414  TRP B CD2   1 
ATOM   8096  N  NE1   . TRP B 1 414 ? 75.672  122.603 75.681  1.00 18.30 ? 414  TRP B NE1   1 
ATOM   8097  C  CE2   . TRP B 1 414 ? 74.393  122.728 75.205  1.00 17.58 ? 414  TRP B CE2   1 
ATOM   8098  C  CE3   . TRP B 1 414 ? 72.760  124.489 74.892  1.00 15.78 ? 414  TRP B CE3   1 
ATOM   8099  C  CZ2   . TRP B 1 414 ? 73.521  121.757 74.688  1.00 15.32 ? 414  TRP B CZ2   1 
ATOM   8100  C  CZ3   . TRP B 1 414 ? 71.891  123.519 74.377  1.00 16.87 ? 414  TRP B CZ3   1 
ATOM   8101  C  CH2   . TRP B 1 414 ? 72.281  122.171 74.283  1.00 14.99 ? 414  TRP B CH2   1 
ATOM   8102  N  N     . GLN B 1 415 ? 73.121  126.683 78.101  1.00 17.38 ? 415  GLN B N     1 
ATOM   8103  C  CA    . GLN B 1 415 ? 71.923  126.372 78.876  1.00 16.68 ? 415  GLN B CA    1 
ATOM   8104  C  C     . GLN B 1 415 ? 70.741  126.164 77.946  1.00 17.05 ? 415  GLN B C     1 
ATOM   8105  O  O     . GLN B 1 415 ? 70.799  126.516 76.760  1.00 17.28 ? 415  GLN B O     1 
ATOM   8106  C  CB    . GLN B 1 415 ? 71.594  127.531 79.822  1.00 17.85 ? 415  GLN B CB    1 
ATOM   8107  C  CG    . GLN B 1 415 ? 72.799  128.194 80.483  1.00 17.06 ? 415  GLN B CG    1 
ATOM   8108  C  CD    . GLN B 1 415 ? 72.435  129.474 81.213  1.00 19.03 ? 415  GLN B CD    1 
ATOM   8109  O  OE1   . GLN B 1 415 ? 72.092  130.485 80.597  1.00 19.21 ? 415  GLN B OE1   1 
ATOM   8110  N  NE2   . GLN B 1 415 ? 72.500  129.436 82.537  1.00 20.10 ? 415  GLN B NE2   1 
ATOM   8111  N  N     . THR B 1 416 ? 69.666  125.608 78.497  1.00 14.32 ? 416  THR B N     1 
ATOM   8112  C  CA    . THR B 1 416 ? 68.446  125.366 77.743  1.00 14.38 ? 416  THR B CA    1 
ATOM   8113  C  C     . THR B 1 416 ? 68.053  126.682 77.065  1.00 14.00 ? 416  THR B C     1 
ATOM   8114  O  O     . THR B 1 416 ? 67.597  126.700 75.923  1.00 12.26 ? 416  THR B O     1 
ATOM   8115  C  CB    . THR B 1 416 ? 67.301  124.923 78.684  1.00 16.17 ? 416  THR B CB    1 
ATOM   8116  O  OG1   . THR B 1 416 ? 67.733  123.805 79.475  1.00 14.82 ? 416  THR B OG1   1 
ATOM   8117  C  CG2   . THR B 1 416 ? 66.056  124.531 77.876  1.00 15.35 ? 416  THR B CG2   1 
ATOM   8118  N  N     . GLU B 1 417 ? 68.268  127.782 77.783  1.00 13.35 ? 417  GLU B N     1 
ATOM   8119  C  CA    . GLU B 1 417 ? 67.939  129.121 77.299  1.00 13.46 ? 417  GLU B CA    1 
ATOM   8120  C  C     . GLU B 1 417 ? 68.815  129.675 76.175  1.00 13.02 ? 417  GLU B C     1 
ATOM   8121  O  O     . GLU B 1 417 ? 68.439  130.648 75.532  1.00 11.81 ? 417  GLU B O     1 
ATOM   8122  C  CB    . GLU B 1 417 ? 67.946  130.126 78.455  1.00 11.98 ? 417  GLU B CB    1 
ATOM   8123  C  CG    . GLU B 1 417 ? 66.918  129.830 79.519  1.00 16.70 ? 417  GLU B CG    1 
ATOM   8124  C  CD    . GLU B 1 417 ? 67.487  129.040 80.688  1.00 17.15 ? 417  GLU B CD    1 
ATOM   8125  O  OE1   . GLU B 1 417 ? 68.467  128.287 80.487  1.00 17.41 ? 417  GLU B OE1   1 
ATOM   8126  O  OE2   . GLU B 1 417 ? 66.940  129.167 81.810  1.00 18.36 ? 417  GLU B OE2   1 
ATOM   8127  N  N     . THR B 1 418 ? 69.979  129.084 75.935  1.00 12.38 ? 418  THR B N     1 
ATOM   8128  C  CA    . THR B 1 418 ? 70.827  129.605 74.872  1.00 12.31 ? 418  THR B CA    1 
ATOM   8129  C  C     . THR B 1 418 ? 70.733  128.763 73.595  1.00 13.43 ? 418  THR B C     1 
ATOM   8130  O  O     . THR B 1 418 ? 71.324  129.103 72.571  1.00 15.57 ? 418  THR B O     1 
ATOM   8131  C  CB    . THR B 1 418 ? 72.305  129.740 75.340  1.00 10.91 ? 418  THR B CB    1 
ATOM   8132  O  OG1   . THR B 1 418 ? 72.894  128.446 75.497  1.00 12.44 ? 418  THR B OG1   1 
ATOM   8133  C  CG2   . THR B 1 418 ? 72.365  130.475 76.672  1.00 8.06  ? 418  THR B CG2   1 
ATOM   8134  N  N     . GLY B 1 419 ? 69.971  127.673 73.658  1.00 13.08 ? 419  GLY B N     1 
ATOM   8135  C  CA    . GLY B 1 419 ? 69.791  126.818 72.496  1.00 12.25 ? 419  GLY B CA    1 
ATOM   8136  C  C     . GLY B 1 419 ? 71.007  126.074 71.971  1.00 12.89 ? 419  GLY B C     1 
ATOM   8137  O  O     . GLY B 1 419 ? 70.867  124.966 71.447  1.00 11.73 ? 419  GLY B O     1 
ATOM   8138  N  N     . GLY B 1 420 ? 72.190  126.677 72.087  1.00 11.49 ? 420  GLY B N     1 
ATOM   8139  C  CA    . GLY B 1 420 ? 73.395  126.024 71.609  1.00 11.54 ? 420  GLY B CA    1 
ATOM   8140  C  C     . GLY B 1 420 ? 74.629  126.447 72.378  1.00 12.26 ? 420  GLY B C     1 
ATOM   8141  O  O     . GLY B 1 420 ? 74.552  127.301 73.259  1.00 13.27 ? 420  GLY B O     1 
ATOM   8142  N  N     . PHE B 1 421 ? 75.766  125.851 72.039  1.00 11.44 ? 421  PHE B N     1 
ATOM   8143  C  CA    . PHE B 1 421 ? 77.040  126.156 72.683  1.00 12.93 ? 421  PHE B CA    1 
ATOM   8144  C  C     . PHE B 1 421 ? 77.282  127.668 72.803  1.00 12.88 ? 421  PHE B C     1 
ATOM   8145  O  O     . PHE B 1 421 ? 77.050  128.419 71.857  1.00 13.97 ? 421  PHE B O     1 
ATOM   8146  C  CB    . PHE B 1 421 ? 78.177  125.497 71.893  1.00 11.85 ? 421  PHE B CB    1 
ATOM   8147  C  CG    . PHE B 1 421 ? 78.049  123.998 71.771  1.00 10.36 ? 421  PHE B CG    1 
ATOM   8148  C  CD1   . PHE B 1 421 ? 78.702  123.313 70.749  1.00 11.19 ? 421  PHE B CD1   1 
ATOM   8149  C  CD2   . PHE B 1 421 ? 77.253  123.273 72.660  1.00 11.17 ? 421  PHE B CD2   1 
ATOM   8150  C  CE1   . PHE B 1 421 ? 78.558  121.925 70.610  1.00 11.95 ? 421  PHE B CE1   1 
ATOM   8151  C  CE2   . PHE B 1 421 ? 77.104  121.893 72.531  1.00 9.42  ? 421  PHE B CE2   1 
ATOM   8152  C  CZ    . PHE B 1 421 ? 77.754  121.217 71.504  1.00 9.51  ? 421  PHE B CZ    1 
ATOM   8153  N  N     . MET B 1 422 ? 77.739  128.101 73.975  1.00 12.21 ? 422  MET B N     1 
ATOM   8154  C  CA    . MET B 1 422 ? 78.015  129.516 74.231  1.00 13.56 ? 422  MET B CA    1 
ATOM   8155  C  C     . MET B 1 422 ? 79.512  129.755 74.431  1.00 13.99 ? 422  MET B C     1 
ATOM   8156  O  O     . MET B 1 422 ? 80.129  130.512 73.691  1.00 15.43 ? 422  MET B O     1 
ATOM   8157  C  CB    . MET B 1 422 ? 77.226  129.988 75.456  1.00 12.04 ? 422  MET B CB    1 
ATOM   8158  C  CG    . MET B 1 422 ? 75.723  129.916 75.263  1.00 10.40 ? 422  MET B CG    1 
ATOM   8159  S  SD    . MET B 1 422 ? 75.180  130.935 73.835  1.00 14.41 ? 422  MET B SD    1 
ATOM   8160  C  CE    . MET B 1 422 ? 75.173  132.550 74.580  1.00 13.24 ? 422  MET B CE    1 
ATOM   8161  N  N     . ILE B 1 423 ? 80.093  129.124 75.442  1.00 15.52 ? 423  ILE B N     1 
ATOM   8162  C  CA    . ILE B 1 423 ? 81.527  129.238 75.675  1.00 15.91 ? 423  ILE B CA    1 
ATOM   8163  C  C     . ILE B 1 423 ? 82.062  127.817 75.498  1.00 16.91 ? 423  ILE B C     1 
ATOM   8164  O  O     . ILE B 1 423 ? 81.692  126.893 76.227  1.00 18.72 ? 423  ILE B O     1 
ATOM   8165  C  CB    . ILE B 1 423 ? 81.856  129.762 77.089  1.00 14.91 ? 423  ILE B CB    1 
ATOM   8166  C  CG1   . ILE B 1 423 ? 81.273  131.170 77.266  1.00 15.69 ? 423  ILE B CG1   1 
ATOM   8167  C  CG2   . ILE B 1 423 ? 83.374  129.813 77.274  1.00 15.57 ? 423  ILE B CG2   1 
ATOM   8168  C  CD1   . ILE B 1 423 ? 81.484  131.782 78.642  1.00 13.52 ? 423  ILE B CD1   1 
ATOM   8169  N  N     . THR B 1 424 ? 82.929  127.647 74.514  1.00 15.46 ? 424  THR B N     1 
ATOM   8170  C  CA    . THR B 1 424 ? 83.457  126.332 74.223  1.00 15.94 ? 424  THR B CA    1 
ATOM   8171  C  C     . THR B 1 424 ? 84.689  126.409 73.347  1.00 17.72 ? 424  THR B C     1 
ATOM   8172  O  O     . THR B 1 424 ? 84.894  127.374 72.619  1.00 18.90 ? 424  THR B O     1 
ATOM   8173  C  CB    . THR B 1 424 ? 82.404  125.493 73.464  1.00 15.04 ? 424  THR B CB    1 
ATOM   8174  O  OG1   . THR B 1 424 ? 82.966  124.228 73.090  1.00 16.25 ? 424  THR B OG1   1 
ATOM   8175  C  CG2   . THR B 1 424 ? 81.963  126.224 72.193  1.00 13.66 ? 424  THR B CG2   1 
ATOM   8176  N  N     . PRO B 1 425 ? 85.540  125.384 73.409  1.00 18.52 ? 425  PRO B N     1 
ATOM   8177  C  CA    . PRO B 1 425 ? 86.719  125.448 72.551  1.00 18.90 ? 425  PRO B CA    1 
ATOM   8178  C  C     . PRO B 1 425 ? 86.398  124.775 71.221  1.00 19.50 ? 425  PRO B C     1 
ATOM   8179  O  O     . PRO B 1 425 ? 85.418  124.032 71.115  1.00 18.68 ? 425  PRO B O     1 
ATOM   8180  C  CB    . PRO B 1 425 ? 87.759  124.662 73.345  1.00 19.10 ? 425  PRO B CB    1 
ATOM   8181  C  CG    . PRO B 1 425 ? 86.938  123.600 73.997  1.00 16.86 ? 425  PRO B CG    1 
ATOM   8182  C  CD    . PRO B 1 425 ? 85.717  124.377 74.474  1.00 18.03 ? 425  PRO B CD    1 
ATOM   8183  N  N     . LEU B 1 426 ? 87.200  125.071 70.204  1.00 20.01 ? 426  LEU B N     1 
ATOM   8184  C  CA    . LEU B 1 426 ? 87.055  124.423 68.906  1.00 20.38 ? 426  LEU B CA    1 
ATOM   8185  C  C     . LEU B 1 426 ? 88.295  123.543 68.869  1.00 20.73 ? 426  LEU B C     1 
ATOM   8186  O  O     . LEU B 1 426 ? 89.392  123.994 69.204  1.00 20.11 ? 426  LEU B O     1 
ATOM   8187  C  CB    . LEU B 1 426 ? 87.062  125.437 67.759  1.00 20.75 ? 426  LEU B CB    1 
ATOM   8188  C  CG    . LEU B 1 426 ? 85.661  125.906 67.342  1.00 23.21 ? 426  LEU B CG    1 
ATOM   8189  C  CD1   . LEU B 1 426 ? 85.103  126.858 68.382  1.00 19.16 ? 426  LEU B CD1   1 
ATOM   8190  C  CD2   . LEU B 1 426 ? 85.723  126.591 65.978  1.00 23.76 ? 426  LEU B CD2   1 
ATOM   8191  N  N     . PRO B 1 427 ? 88.133  122.268 68.489  1.00 21.62 ? 427  PRO B N     1 
ATOM   8192  C  CA    . PRO B 1 427 ? 89.242  121.311 68.427  1.00 21.86 ? 427  PRO B CA    1 
ATOM   8193  C  C     . PRO B 1 427 ? 90.517  121.771 67.740  1.00 21.85 ? 427  PRO B C     1 
ATOM   8194  O  O     . PRO B 1 427 ? 91.606  121.614 68.296  1.00 21.60 ? 427  PRO B O     1 
ATOM   8195  C  CB    . PRO B 1 427 ? 88.612  120.084 67.755  1.00 20.90 ? 427  PRO B CB    1 
ATOM   8196  C  CG    . PRO B 1 427 ? 87.497  120.660 66.956  1.00 22.63 ? 427  PRO B CG    1 
ATOM   8197  C  CD    . PRO B 1 427 ? 86.919  121.690 67.891  1.00 21.62 ? 427  PRO B CD    1 
ATOM   8198  N  N     . GLY B 1 428 ? 90.394  122.343 66.547  1.00 23.00 ? 428  GLY B N     1 
ATOM   8199  C  CA    . GLY B 1 428 ? 91.578  122.782 65.829  1.00 23.38 ? 428  GLY B CA    1 
ATOM   8200  C  C     . GLY B 1 428 ? 91.846  124.276 65.855  1.00 25.13 ? 428  GLY B C     1 
ATOM   8201  O  O     . GLY B 1 428 ? 92.513  124.805 64.961  1.00 26.56 ? 428  GLY B O     1 
ATOM   8202  N  N     . ALA B 1 429 ? 91.347  124.966 66.878  1.00 24.11 ? 429  ALA B N     1 
ATOM   8203  C  CA    . ALA B 1 429 ? 91.553  126.406 66.956  1.00 22.13 ? 429  ALA B CA    1 
ATOM   8204  C  C     . ALA B 1 429 ? 91.957  126.911 68.329  1.00 22.96 ? 429  ALA B C     1 
ATOM   8205  O  O     . ALA B 1 429 ? 92.667  127.912 68.439  1.00 23.60 ? 429  ALA B O     1 
ATOM   8206  C  CB    . ALA B 1 429 ? 90.298  127.127 66.505  1.00 21.00 ? 429  ALA B CB    1 
ATOM   8207  N  N     . ILE B 1 430 ? 91.520  126.214 69.374  1.00 22.68 ? 430  ILE B N     1 
ATOM   8208  C  CA    . ILE B 1 430 ? 91.808  126.635 70.739  1.00 22.53 ? 430  ILE B CA    1 
ATOM   8209  C  C     . ILE B 1 430 ? 92.555  125.604 71.584  1.00 23.25 ? 430  ILE B C     1 
ATOM   8210  O  O     . ILE B 1 430 ? 92.116  124.458 71.713  1.00 21.13 ? 430  ILE B O     1 
ATOM   8211  C  CB    . ILE B 1 430 ? 90.489  127.020 71.453  1.00 22.48 ? 430  ILE B CB    1 
ATOM   8212  C  CG1   . ILE B 1 430 ? 89.948  128.322 70.857  1.00 23.64 ? 430  ILE B CG1   1 
ATOM   8213  C  CG2   . ILE B 1 430 ? 90.707  127.148 72.948  1.00 21.31 ? 430  ILE B CG2   1 
ATOM   8214  C  CD1   . ILE B 1 430 ? 88.549  128.667 71.302  1.00 26.03 ? 430  ILE B CD1   1 
ATOM   8215  N  N     . GLU B 1 431 ? 93.682  126.015 72.164  1.00 23.30 ? 431  GLU B N     1 
ATOM   8216  C  CA    . GLU B 1 431 ? 94.452  125.112 73.009  1.00 23.00 ? 431  GLU B CA    1 
ATOM   8217  C  C     . GLU B 1 431 ? 93.626  124.868 74.262  1.00 21.90 ? 431  GLU B C     1 
ATOM   8218  O  O     . GLU B 1 431 ? 93.003  125.788 74.790  1.00 20.47 ? 431  GLU B O     1 
ATOM   8219  C  CB    . GLU B 1 431 ? 95.808  125.716 73.366  1.00 25.68 ? 431  GLU B CB    1 
ATOM   8220  C  CG    . GLU B 1 431 ? 96.699  125.972 72.161  1.00 29.17 ? 431  GLU B CG    1 
ATOM   8221  C  CD    . GLU B 1 431 ? 98.177  126.019 72.524  1.00 31.98 ? 431  GLU B CD    1 
ATOM   8222  O  OE1   . GLU B 1 431 ? 98.549  126.793 73.435  1.00 34.74 ? 431  GLU B OE1   1 
ATOM   8223  O  OE2   . GLU B 1 431 ? 98.970  125.279 71.897  1.00 32.08 ? 431  GLU B OE2   1 
ATOM   8224  N  N     . LEU B 1 432 ? 93.630  123.628 74.738  1.00 21.43 ? 432  LEU B N     1 
ATOM   8225  C  CA    . LEU B 1 432 ? 92.825  123.254 75.896  1.00 21.59 ? 432  LEU B CA    1 
ATOM   8226  C  C     . LEU B 1 432 ? 93.435  123.412 77.290  1.00 21.91 ? 432  LEU B C     1 
ATOM   8227  O  O     . LEU B 1 432 ? 94.636  123.255 77.496  1.00 23.57 ? 432  LEU B O     1 
ATOM   8228  C  CB    . LEU B 1 432 ? 92.353  121.802 75.735  1.00 19.72 ? 432  LEU B CB    1 
ATOM   8229  C  CG    . LEU B 1 432 ? 91.704  121.413 74.403  1.00 17.67 ? 432  LEU B CG    1 
ATOM   8230  C  CD1   . LEU B 1 432 ? 91.397  119.917 74.417  1.00 16.79 ? 432  LEU B CD1   1 
ATOM   8231  C  CD2   . LEU B 1 432 ? 90.433  122.230 74.174  1.00 16.88 ? 432  LEU B CD2   1 
ATOM   8232  N  N     . LYS B 1 433 ? 92.572  123.736 78.241  1.00 20.98 ? 433  LYS B N     1 
ATOM   8233  C  CA    . LYS B 1 433 ? 92.956  123.863 79.635  1.00 21.45 ? 433  LYS B CA    1 
ATOM   8234  C  C     . LYS B 1 433 ? 91.977  122.956 80.366  1.00 20.96 ? 433  LYS B C     1 
ATOM   8235  O  O     . LYS B 1 433 ? 90.762  123.131 80.263  1.00 21.28 ? 433  LYS B O     1 
ATOM   8236  C  CB    . LYS B 1 433 ? 92.801  125.302 80.127  1.00 21.78 ? 433  LYS B CB    1 
ATOM   8237  C  CG    . LYS B 1 433 ? 93.820  126.277 79.555  1.00 23.66 ? 433  LYS B CG    1 
ATOM   8238  C  CD    . LYS B 1 433 ? 93.782  127.594 80.315  1.00 20.87 ? 433  LYS B CD    1 
ATOM   8239  C  CE    . LYS B 1 433 ? 94.751  128.603 79.740  1.00 19.39 ? 433  LYS B CE    1 
ATOM   8240  N  NZ    . LYS B 1 433 ? 94.898  129.791 80.634  1.00 17.16 ? 433  LYS B NZ    1 
ATOM   8241  N  N     . ALA B 1 434 ? 92.499  121.971 81.083  1.00 19.96 ? 434  ALA B N     1 
ATOM   8242  C  CA    . ALA B 1 434 ? 91.645  121.044 81.806  1.00 18.98 ? 434  ALA B CA    1 
ATOM   8243  C  C     . ALA B 1 434 ? 90.699  121.783 82.744  1.00 18.45 ? 434  ALA B C     1 
ATOM   8244  O  O     . ALA B 1 434 ? 91.141  122.487 83.658  1.00 18.96 ? 434  ALA B O     1 
ATOM   8245  C  CB    . ALA B 1 434 ? 92.499  120.054 82.594  1.00 18.94 ? 434  ALA B CB    1 
ATOM   8246  N  N     . GLY B 1 435 ? 89.398  121.625 82.504  1.00 17.08 ? 435  GLY B N     1 
ATOM   8247  C  CA    . GLY B 1 435 ? 88.399  122.264 83.343  1.00 15.25 ? 435  GLY B CA    1 
ATOM   8248  C  C     . GLY B 1 435 ? 87.872  123.605 82.863  1.00 14.30 ? 435  GLY B C     1 
ATOM   8249  O  O     . GLY B 1 435 ? 87.015  124.196 83.509  1.00 15.98 ? 435  GLY B O     1 
ATOM   8250  N  N     . SER B 1 436 ? 88.368  124.086 81.731  1.00 15.54 ? 436  SER B N     1 
ATOM   8251  C  CA    . SER B 1 436 ? 87.933  125.376 81.189  1.00 15.77 ? 436  SER B CA    1 
ATOM   8252  C  C     . SER B 1 436 ? 87.109  125.281 79.898  1.00 15.85 ? 436  SER B C     1 
ATOM   8253  O  O     . SER B 1 436 ? 87.465  124.549 78.968  1.00 15.74 ? 436  SER B O     1 
ATOM   8254  C  CB    . SER B 1 436 ? 89.153  126.265 80.940  1.00 13.30 ? 436  SER B CB    1 
ATOM   8255  O  OG    . SER B 1 436 ? 88.773  127.488 80.335  1.00 21.36 ? 436  SER B OG    1 
ATOM   8256  N  N     . ALA B 1 437 ? 86.005  126.023 79.843  1.00 16.10 ? 437  ALA B N     1 
ATOM   8257  C  CA    . ALA B 1 437 ? 85.149  126.032 78.655  1.00 15.70 ? 437  ALA B CA    1 
ATOM   8258  C  C     . ALA B 1 437 ? 85.841  126.856 77.571  1.00 15.57 ? 437  ALA B C     1 
ATOM   8259  O  O     . ALA B 1 437 ? 85.466  126.807 76.397  1.00 14.81 ? 437  ALA B O     1 
ATOM   8260  C  CB    . ALA B 1 437 ? 83.782  126.628 78.987  1.00 13.26 ? 437  ALA B CB    1 
ATOM   8261  N  N     . THR B 1 438 ? 86.867  127.597 77.992  1.00 16.08 ? 438  THR B N     1 
ATOM   8262  C  CA    . THR B 1 438 ? 87.696  128.459 77.137  1.00 16.68 ? 438  THR B CA    1 
ATOM   8263  C  C     . THR B 1 438 ? 87.073  129.767 76.629  1.00 16.42 ? 438  THR B C     1 
ATOM   8264  O  O     . THR B 1 438 ? 86.604  130.579 77.426  1.00 15.32 ? 438  THR B O     1 
ATOM   8265  C  CB    . THR B 1 438 ? 88.316  127.676 75.923  1.00 16.29 ? 438  THR B CB    1 
ATOM   8266  O  OG1   . THR B 1 438 ? 87.312  127.390 74.943  1.00 17.00 ? 438  THR B OG1   1 
ATOM   8267  C  CG2   . THR B 1 438 ? 88.947  126.370 76.400  1.00 16.18 ? 438  THR B CG2   1 
ATOM   8268  N  N     . ARG B 1 439 ? 87.084  129.981 75.313  1.00 18.60 ? 439  ARG B N     1 
ATOM   8269  C  CA    . ARG B 1 439 ? 86.556  131.221 74.726  1.00 20.61 ? 439  ARG B CA    1 
ATOM   8270  C  C     . ARG B 1 439 ? 85.123  131.134 74.198  1.00 19.15 ? 439  ARG B C     1 
ATOM   8271  O  O     . ARG B 1 439 ? 84.641  130.065 73.837  1.00 18.68 ? 439  ARG B O     1 
ATOM   8272  C  CB    . ARG B 1 439 ? 87.460  131.692 73.579  1.00 23.22 ? 439  ARG B CB    1 
ATOM   8273  C  CG    . ARG B 1 439 ? 88.937  131.761 73.908  1.00 26.16 ? 439  ARG B CG    1 
ATOM   8274  C  CD    . ARG B 1 439 ? 89.733  132.168 72.676  1.00 28.83 ? 439  ARG B CD    1 
ATOM   8275  N  NE    . ARG B 1 439 ? 91.173  132.114 72.902  1.00 32.52 ? 439  ARG B NE    1 
ATOM   8276  C  CZ    . ARG B 1 439 ? 91.821  132.867 73.786  1.00 33.17 ? 439  ARG B CZ    1 
ATOM   8277  N  NH1   . ARG B 1 439 ? 91.153  133.742 74.530  1.00 31.98 ? 439  ARG B NH1   1 
ATOM   8278  N  NH2   . ARG B 1 439 ? 93.137  132.742 73.929  1.00 33.33 ? 439  ARG B NH2   1 
ATOM   8279  N  N     . PRO B 1 440 ? 84.429  132.278 74.124  1.00 17.91 ? 440  PRO B N     1 
ATOM   8280  C  CA    . PRO B 1 440 ? 83.048  132.302 73.631  1.00 15.48 ? 440  PRO B CA    1 
ATOM   8281  C  C     . PRO B 1 440 ? 82.934  131.908 72.162  1.00 14.30 ? 440  PRO B C     1 
ATOM   8282  O  O     . PRO B 1 440 ? 83.875  132.064 71.386  1.00 11.90 ? 440  PRO B O     1 
ATOM   8283  C  CB    . PRO B 1 440 ? 82.624  133.747 73.874  1.00 14.88 ? 440  PRO B CB    1 
ATOM   8284  C  CG    . PRO B 1 440 ? 83.906  134.502 73.649  1.00 15.73 ? 440  PRO B CG    1 
ATOM   8285  C  CD    . PRO B 1 440 ? 84.896  133.644 74.425  1.00 18.25 ? 440  PRO B CD    1 
ATOM   8286  N  N     . PHE B 1 441 ? 81.771  131.389 71.790  1.00 14.09 ? 441  PHE B N     1 
ATOM   8287  C  CA    . PHE B 1 441 ? 81.522  130.987 70.413  1.00 13.86 ? 441  PHE B CA    1 
ATOM   8288  C  C     . PHE B 1 441 ? 81.178  132.239 69.601  1.00 14.02 ? 441  PHE B C     1 
ATOM   8289  O  O     . PHE B 1 441 ? 80.920  133.303 70.175  1.00 13.38 ? 441  PHE B O     1 
ATOM   8290  C  CB    . PHE B 1 441 ? 80.355  130.001 70.358  1.00 11.20 ? 441  PHE B CB    1 
ATOM   8291  C  CG    . PHE B 1 441 ? 80.190  129.348 69.030  1.00 13.60 ? 441  PHE B CG    1 
ATOM   8292  C  CD1   . PHE B 1 441 ? 81.098  128.388 68.602  1.00 12.26 ? 441  PHE B CD1   1 
ATOM   8293  C  CD2   . PHE B 1 441 ? 79.146  129.711 68.188  1.00 12.77 ? 441  PHE B CD2   1 
ATOM   8294  C  CE1   . PHE B 1 441 ? 80.968  127.800 67.359  1.00 14.22 ? 441  PHE B CE1   1 
ATOM   8295  C  CE2   . PHE B 1 441 ? 79.008  129.127 66.938  1.00 13.79 ? 441  PHE B CE2   1 
ATOM   8296  C  CZ    . PHE B 1 441 ? 79.918  128.170 66.522  1.00 14.03 ? 441  PHE B CZ    1 
ATOM   8297  N  N     . PHE B 1 442 ? 81.180  132.114 68.275  1.00 14.13 ? 442  PHE B N     1 
ATOM   8298  C  CA    . PHE B 1 442 ? 80.851  133.233 67.392  1.00 14.95 ? 442  PHE B CA    1 
ATOM   8299  C  C     . PHE B 1 442 ? 79.498  133.816 67.780  1.00 14.40 ? 442  PHE B C     1 
ATOM   8300  O  O     . PHE B 1 442 ? 78.574  133.069 68.112  1.00 14.44 ? 442  PHE B O     1 
ATOM   8301  C  CB    . PHE B 1 442 ? 80.770  132.763 65.938  1.00 16.40 ? 442  PHE B CB    1 
ATOM   8302  C  CG    . PHE B 1 442 ? 81.989  132.037 65.466  1.00 19.18 ? 442  PHE B CG    1 
ATOM   8303  C  CD1   . PHE B 1 442 ? 81.864  130.861 64.737  1.00 18.80 ? 442  PHE B CD1   1 
ATOM   8304  C  CD2   . PHE B 1 442 ? 83.264  132.530 65.734  1.00 19.40 ? 442  PHE B CD2   1 
ATOM   8305  C  CE1   . PHE B 1 442 ? 82.989  130.182 64.279  1.00 19.53 ? 442  PHE B CE1   1 
ATOM   8306  C  CE2   . PHE B 1 442 ? 84.399  131.858 65.279  1.00 20.80 ? 442  PHE B CE2   1 
ATOM   8307  C  CZ    . PHE B 1 442 ? 84.258  130.679 64.549  1.00 19.59 ? 442  PHE B CZ    1 
ATOM   8308  N  N     . GLY B 1 443 ? 79.389  135.143 67.733  1.00 14.47 ? 443  GLY B N     1 
ATOM   8309  C  CA    . GLY B 1 443 ? 78.143  135.817 68.064  1.00 15.84 ? 443  GLY B CA    1 
ATOM   8310  C  C     . GLY B 1 443 ? 77.795  135.884 69.542  1.00 16.61 ? 443  GLY B C     1 
ATOM   8311  O  O     . GLY B 1 443 ? 76.750  136.416 69.916  1.00 17.48 ? 443  GLY B O     1 
ATOM   8312  N  N     . VAL B 1 444 ? 78.663  135.341 70.387  1.00 16.66 ? 444  VAL B N     1 
ATOM   8313  C  CA    . VAL B 1 444 ? 78.439  135.344 71.829  1.00 16.94 ? 444  VAL B CA    1 
ATOM   8314  C  C     . VAL B 1 444 ? 79.386  136.338 72.503  1.00 17.51 ? 444  VAL B C     1 
ATOM   8315  O  O     . VAL B 1 444 ? 80.610  136.194 72.417  1.00 17.67 ? 444  VAL B O     1 
ATOM   8316  C  CB    . VAL B 1 444 ? 78.685  133.933 72.426  1.00 17.23 ? 444  VAL B CB    1 
ATOM   8317  C  CG1   . VAL B 1 444 ? 78.555  133.972 73.944  1.00 17.51 ? 444  VAL B CG1   1 
ATOM   8318  C  CG2   . VAL B 1 444 ? 77.693  132.930 71.826  1.00 18.58 ? 444  VAL B CG2   1 
ATOM   8319  N  N     . GLN B 1 445 ? 78.825  137.344 73.168  1.00 17.87 ? 445  GLN B N     1 
ATOM   8320  C  CA    . GLN B 1 445 ? 79.637  138.348 73.852  1.00 19.00 ? 445  GLN B CA    1 
ATOM   8321  C  C     . GLN B 1 445 ? 79.480  138.209 75.368  1.00 18.00 ? 445  GLN B C     1 
ATOM   8322  O  O     . GLN B 1 445 ? 78.625  138.850 75.974  1.00 18.66 ? 445  GLN B O     1 
ATOM   8323  C  CB    . GLN B 1 445 ? 79.227  139.763 73.417  1.00 21.01 ? 445  GLN B CB    1 
ATOM   8324  C  CG    . GLN B 1 445 ? 79.305  140.023 71.908  1.00 26.79 ? 445  GLN B CG    1 
ATOM   8325  C  CD    . GLN B 1 445 ? 79.110  141.504 71.535  1.00 29.80 ? 445  GLN B CD    1 
ATOM   8326  O  OE1   . GLN B 1 445 ? 79.951  142.354 71.845  1.00 32.78 ? 445  GLN B OE1   1 
ATOM   8327  N  NE2   . GLN B 1 445 ? 77.996  141.809 70.870  1.00 28.80 ? 445  GLN B NE2   1 
ATOM   8328  N  N     . PRO B 1 446 ? 80.309  137.358 75.996  1.00 17.52 ? 446  PRO B N     1 
ATOM   8329  C  CA    . PRO B 1 446 ? 80.233  137.155 77.449  1.00 16.72 ? 446  PRO B CA    1 
ATOM   8330  C  C     . PRO B 1 446 ? 80.814  138.330 78.226  1.00 16.53 ? 446  PRO B C     1 
ATOM   8331  O  O     . PRO B 1 446 ? 81.520  139.159 77.664  1.00 16.65 ? 446  PRO B O     1 
ATOM   8332  C  CB    . PRO B 1 446 ? 81.038  135.880 77.659  1.00 17.37 ? 446  PRO B CB    1 
ATOM   8333  C  CG    . PRO B 1 446 ? 82.125  136.027 76.626  1.00 17.43 ? 446  PRO B CG    1 
ATOM   8334  C  CD    . PRO B 1 446 ? 81.366  136.519 75.400  1.00 16.14 ? 446  PRO B CD    1 
ATOM   8335  N  N     . ALA B 1 447 ? 80.498  138.397 79.514  1.00 16.15 ? 447  ALA B N     1 
ATOM   8336  C  CA    . ALA B 1 447 ? 81.001  139.454 80.390  1.00 15.87 ? 447  ALA B CA    1 
ATOM   8337  C  C     . ALA B 1 447 ? 80.783  139.043 81.836  1.00 14.63 ? 447  ALA B C     1 
ATOM   8338  O  O     . ALA B 1 447 ? 79.870  138.272 82.139  1.00 15.23 ? 447  ALA B O     1 
ATOM   8339  C  CB    . ALA B 1 447 ? 80.283  140.771 80.113  1.00 15.06 ? 447  ALA B CB    1 
ATOM   8340  N  N     . LEU B 1 448 ? 81.631  139.553 82.721  1.00 13.40 ? 448  LEU B N     1 
ATOM   8341  C  CA    . LEU B 1 448 ? 81.526  139.249 84.142  1.00 13.21 ? 448  LEU B CA    1 
ATOM   8342  C  C     . LEU B 1 448 ? 81.213  140.547 84.872  1.00 12.92 ? 448  LEU B C     1 
ATOM   8343  O  O     . LEU B 1 448 ? 81.979  141.500 84.795  1.00 13.26 ? 448  LEU B O     1 
ATOM   8344  C  CB    . LEU B 1 448 ? 82.838  138.658 84.659  1.00 12.81 ? 448  LEU B CB    1 
ATOM   8345  C  CG    . LEU B 1 448 ? 83.367  137.409 83.954  1.00 13.77 ? 448  LEU B CG    1 
ATOM   8346  C  CD1   . LEU B 1 448 ? 84.683  136.963 84.617  1.00 13.46 ? 448  LEU B CD1   1 
ATOM   8347  C  CD2   . LEU B 1 448 ? 82.318  136.299 84.036  1.00 12.77 ? 448  LEU B CD2   1 
ATOM   8348  N  N     . VAL B 1 449 ? 80.079  140.588 85.562  1.00 13.78 ? 449  VAL B N     1 
ATOM   8349  C  CA    . VAL B 1 449 ? 79.670  141.791 86.286  1.00 14.24 ? 449  VAL B CA    1 
ATOM   8350  C  C     . VAL B 1 449 ? 79.494  141.530 87.779  1.00 15.39 ? 449  VAL B C     1 
ATOM   8351  O  O     . VAL B 1 449 ? 79.120  140.430 88.181  1.00 15.90 ? 449  VAL B O     1 
ATOM   8352  C  CB    . VAL B 1 449 ? 78.327  142.347 85.740  1.00 13.40 ? 449  VAL B CB    1 
ATOM   8353  C  CG1   . VAL B 1 449 ? 78.486  142.763 84.295  1.00 12.97 ? 449  VAL B CG1   1 
ATOM   8354  C  CG2   . VAL B 1 449 ? 77.224  141.286 85.873  1.00 12.95 ? 449  VAL B CG2   1 
ATOM   8355  N  N     . ASP B 1 450 ? 79.763  142.544 88.597  1.00 16.28 ? 450  ASP B N     1 
ATOM   8356  C  CA    . ASP B 1 450 ? 79.597  142.410 90.039  1.00 18.08 ? 450  ASP B CA    1 
ATOM   8357  C  C     . ASP B 1 450 ? 78.100  142.407 90.359  1.00 20.40 ? 450  ASP B C     1 
ATOM   8358  O  O     . ASP B 1 450 ? 77.268  142.377 89.451  1.00 21.74 ? 450  ASP B O     1 
ATOM   8359  C  CB    . ASP B 1 450 ? 80.291  143.563 90.771  1.00 17.87 ? 450  ASP B CB    1 
ATOM   8360  C  CG    . ASP B 1 450 ? 79.879  144.931 90.245  1.00 17.38 ? 450  ASP B CG    1 
ATOM   8361  O  OD1   . ASP B 1 450 ? 78.709  145.100 89.837  1.00 17.46 ? 450  ASP B OD1   1 
ATOM   8362  O  OD2   . ASP B 1 450 ? 80.729  145.847 90.257  1.00 17.27 ? 450  ASP B OD2   1 
ATOM   8363  N  N     . ASN B 1 451 ? 77.748  142.445 91.639  1.00 21.87 ? 451  ASN B N     1 
ATOM   8364  C  CA    . ASN B 1 451 ? 76.336  142.438 92.005  1.00 23.61 ? 451  ASN B CA    1 
ATOM   8365  C  C     . ASN B 1 451 ? 75.660  143.777 91.744  1.00 25.20 ? 451  ASN B C     1 
ATOM   8366  O  O     . ASN B 1 451 ? 74.443  143.900 91.877  1.00 25.46 ? 451  ASN B O     1 
ATOM   8367  C  CB    . ASN B 1 451 ? 76.159  142.032 93.469  1.00 23.92 ? 451  ASN B CB    1 
ATOM   8368  C  CG    . ASN B 1 451 ? 76.477  140.570 93.702  1.00 24.75 ? 451  ASN B CG    1 
ATOM   8369  O  OD1   . ASN B 1 451 ? 76.090  139.710 92.917  1.00 24.06 ? 451  ASN B OD1   1 
ATOM   8370  N  ND2   . ASN B 1 451 ? 77.177  140.282 94.788  1.00 26.68 ? 451  ASN B ND2   1 
ATOM   8371  N  N     . GLU B 1 452 ? 76.456  144.773 91.368  1.00 27.09 ? 452  GLU B N     1 
ATOM   8372  C  CA    . GLU B 1 452 ? 75.934  146.099 91.059  1.00 28.78 ? 452  GLU B CA    1 
ATOM   8373  C  C     . GLU B 1 452 ? 75.703  146.206 89.557  1.00 28.41 ? 452  GLU B C     1 
ATOM   8374  O  O     . GLU B 1 452 ? 75.116  147.177 89.079  1.00 29.03 ? 452  GLU B O     1 
ATOM   8375  C  CB    . GLU B 1 452 ? 76.922  147.186 91.493  1.00 32.69 ? 452  GLU B CB    1 
ATOM   8376  C  CG    . GLU B 1 452 ? 76.573  147.879 92.805  1.00 37.50 ? 452  GLU B CG    1 
ATOM   8377  C  CD    . GLU B 1 452 ? 76.715  146.961 94.000  1.00 40.96 ? 452  GLU B CD    1 
ATOM   8378  O  OE1   . GLU B 1 452 ? 77.809  146.376 94.172  1.00 42.36 ? 452  GLU B OE1   1 
ATOM   8379  O  OE2   . GLU B 1 452 ? 75.738  146.825 94.768  1.00 41.97 ? 452  GLU B OE2   1 
ATOM   8380  N  N     . GLY B 1 453 ? 76.179  145.206 88.817  1.00 26.34 ? 453  GLY B N     1 
ATOM   8381  C  CA    . GLY B 1 453 ? 76.007  145.207 87.377  1.00 24.66 ? 453  GLY B CA    1 
ATOM   8382  C  C     . GLY B 1 453 ? 77.177  145.807 86.628  1.00 25.06 ? 453  GLY B C     1 
ATOM   8383  O  O     . GLY B 1 453 ? 77.126  145.957 85.411  1.00 25.29 ? 453  GLY B O     1 
ATOM   8384  N  N     . HIS B 1 454 ? 78.239  146.152 87.346  1.00 25.38 ? 454  HIS B N     1 
ATOM   8385  C  CA    . HIS B 1 454 ? 79.414  146.739 86.709  1.00 25.83 ? 454  HIS B CA    1 
ATOM   8386  C  C     . HIS B 1 454 ? 80.323  145.654 86.160  1.00 25.04 ? 454  HIS B C     1 
ATOM   8387  O  O     . HIS B 1 454 ? 80.683  144.708 86.862  1.00 23.74 ? 454  HIS B O     1 
ATOM   8388  C  CB    . HIS B 1 454 ? 80.189  147.605 87.708  1.00 26.01 ? 454  HIS B CB    1 
ATOM   8389  C  CG    . HIS B 1 454 ? 79.340  148.619 88.404  1.00 29.86 ? 454  HIS B CG    1 
ATOM   8390  N  ND1   . HIS B 1 454 ? 78.540  149.511 87.724  1.00 29.94 ? 454  HIS B ND1   1 
ATOM   8391  C  CD2   . HIS B 1 454 ? 79.148  148.869 89.721  1.00 30.92 ? 454  HIS B CD2   1 
ATOM   8392  C  CE1   . HIS B 1 454 ? 77.887  150.264 88.592  1.00 30.12 ? 454  HIS B CE1   1 
ATOM   8393  N  NE2   . HIS B 1 454 ? 78.238  149.894 89.810  1.00 29.90 ? 454  HIS B NE2   1 
ATOM   8394  N  N     . PRO B 1 455 ? 80.707  145.772 84.885  1.00 25.14 ? 455  PRO B N     1 
ATOM   8395  C  CA    . PRO B 1 455 ? 81.585  144.774 84.276  1.00 25.83 ? 455  PRO B CA    1 
ATOM   8396  C  C     . PRO B 1 455 ? 82.955  144.764 84.942  1.00 26.37 ? 455  PRO B C     1 
ATOM   8397  O  O     . PRO B 1 455 ? 83.478  145.808 85.340  1.00 26.22 ? 455  PRO B O     1 
ATOM   8398  C  CB    . PRO B 1 455 ? 81.637  145.208 82.811  1.00 26.15 ? 455  PRO B CB    1 
ATOM   8399  C  CG    . PRO B 1 455 ? 81.475  146.689 82.895  1.00 26.51 ? 455  PRO B CG    1 
ATOM   8400  C  CD    . PRO B 1 455 ? 80.371  146.833 83.921  1.00 26.50 ? 455  PRO B CD    1 
ATOM   8401  N  N     . GLN B 1 456 ? 83.514  143.567 85.073  1.00 26.52 ? 456  GLN B N     1 
ATOM   8402  C  CA    . GLN B 1 456 ? 84.821  143.373 85.680  1.00 26.57 ? 456  GLN B CA    1 
ATOM   8403  C  C     . GLN B 1 456 ? 85.761  143.087 84.520  1.00 26.65 ? 456  GLN B C     1 
ATOM   8404  O  O     . GLN B 1 456 ? 85.428  142.310 83.627  1.00 28.29 ? 456  GLN B O     1 
ATOM   8405  C  CB    . GLN B 1 456 ? 84.779  142.184 86.643  1.00 25.59 ? 456  GLN B CB    1 
ATOM   8406  C  CG    . GLN B 1 456 ? 83.674  142.248 87.689  1.00 25.15 ? 456  GLN B CG    1 
ATOM   8407  C  CD    . GLN B 1 456 ? 83.724  143.519 88.530  1.00 29.68 ? 456  GLN B CD    1 
ATOM   8408  O  OE1   . GLN B 1 456 ? 82.998  144.487 88.270  1.00 29.64 ? 456  GLN B OE1   1 
ATOM   8409  N  NE2   . GLN B 1 456 ? 84.593  143.526 89.539  1.00 28.03 ? 456  GLN B NE2   1 
ATOM   8410  N  N     . GLU B 1 457 ? 86.928  143.718 84.525  1.00 26.44 ? 457  GLU B N     1 
ATOM   8411  C  CA    . GLU B 1 457 ? 87.872  143.535 83.433  1.00 25.99 ? 457  GLU B CA    1 
ATOM   8412  C  C     . GLU B 1 457 ? 89.109  142.773 83.877  1.00 25.38 ? 457  GLU B C     1 
ATOM   8413  O  O     . GLU B 1 457 ? 89.360  142.630 85.073  1.00 23.74 ? 457  GLU B O     1 
ATOM   8414  C  CB    . GLU B 1 457 ? 88.271  144.905 82.881  1.00 28.91 ? 457  GLU B CB    1 
ATOM   8415  C  CG    . GLU B 1 457 ? 87.091  145.864 82.700  1.00 34.47 ? 457  GLU B CG    1 
ATOM   8416  C  CD    . GLU B 1 457 ? 86.291  145.611 81.422  1.00 38.47 ? 457  GLU B CD    1 
ATOM   8417  O  OE1   . GLU B 1 457 ? 85.963  144.437 81.122  1.00 39.68 ? 457  GLU B OE1   1 
ATOM   8418  O  OE2   . GLU B 1 457 ? 85.982  146.599 80.719  1.00 41.19 ? 457  GLU B OE2   1 
ATOM   8419  N  N     . GLY B 1 458 ? 89.880  142.288 82.905  1.00 24.72 ? 458  GLY B N     1 
ATOM   8420  C  CA    . GLY B 1 458 ? 91.092  141.549 83.207  1.00 24.55 ? 458  GLY B CA    1 
ATOM   8421  C  C     . GLY B 1 458 ? 90.811  140.192 83.817  1.00 23.94 ? 458  GLY B C     1 
ATOM   8422  O  O     . GLY B 1 458 ? 89.691  139.694 83.726  1.00 24.26 ? 458  GLY B O     1 
ATOM   8423  N  N     . ALA B 1 459 ? 91.828  139.587 84.426  1.00 22.87 ? 459  ALA B N     1 
ATOM   8424  C  CA    . ALA B 1 459 ? 91.669  138.286 85.066  1.00 22.70 ? 459  ALA B CA    1 
ATOM   8425  C  C     . ALA B 1 459 ? 90.839  138.528 86.321  1.00 22.25 ? 459  ALA B C     1 
ATOM   8426  O  O     . ALA B 1 459 ? 91.336  139.068 87.309  1.00 24.35 ? 459  ALA B O     1 
ATOM   8427  C  CB    . ALA B 1 459 ? 93.041  137.700 85.429  1.00 22.12 ? 459  ALA B CB    1 
ATOM   8428  N  N     . THR B 1 460 ? 89.576  138.121 86.286  1.00 21.25 ? 460  THR B N     1 
ATOM   8429  C  CA    . THR B 1 460 ? 88.687  138.349 87.418  1.00 21.08 ? 460  THR B CA    1 
ATOM   8430  C  C     . THR B 1 460 ? 87.584  137.291 87.483  1.00 22.87 ? 460  THR B C     1 
ATOM   8431  O  O     . THR B 1 460 ? 87.657  136.268 86.810  1.00 22.66 ? 460  THR B O     1 
ATOM   8432  C  CB    . THR B 1 460 ? 88.070  139.776 87.307  1.00 19.73 ? 460  THR B CB    1 
ATOM   8433  O  OG1   . THR B 1 460 ? 87.176  140.023 88.398  1.00 20.97 ? 460  THR B OG1   1 
ATOM   8434  C  CG2   . THR B 1 460 ? 87.330  139.926 86.000  1.00 15.53 ? 460  THR B CG2   1 
ATOM   8435  N  N     . GLU B 1 461 ? 86.572  137.532 88.311  1.00 25.19 ? 461  GLU B N     1 
ATOM   8436  C  CA    . GLU B 1 461 ? 85.453  136.603 88.450  1.00 26.81 ? 461  GLU B CA    1 
ATOM   8437  C  C     . GLU B 1 461 ? 84.198  137.389 88.790  1.00 26.10 ? 461  GLU B C     1 
ATOM   8438  O  O     . GLU B 1 461 ? 84.269  138.403 89.487  1.00 26.45 ? 461  GLU B O     1 
ATOM   8439  C  CB    . GLU B 1 461 ? 85.719  135.567 89.555  1.00 29.88 ? 461  GLU B CB    1 
ATOM   8440  C  CG    . GLU B 1 461 ? 85.985  136.150 90.944  1.00 37.02 ? 461  GLU B CG    1 
ATOM   8441  C  CD    . GLU B 1 461 ? 87.468  136.393 91.211  1.00 40.61 ? 461  GLU B CD    1 
ATOM   8442  O  OE1   . GLU B 1 461 ? 88.245  135.410 91.214  1.00 43.39 ? 461  GLU B OE1   1 
ATOM   8443  O  OE2   . GLU B 1 461 ? 87.857  137.566 91.416  1.00 41.76 ? 461  GLU B OE2   1 
ATOM   8444  N  N     . GLY B 1 462 ? 83.052  136.925 88.298  1.00 23.60 ? 462  GLY B N     1 
ATOM   8445  C  CA    . GLY B 1 462 ? 81.805  137.611 88.577  1.00 20.02 ? 462  GLY B CA    1 
ATOM   8446  C  C     . GLY B 1 462 ? 80.597  136.884 88.026  1.00 18.24 ? 462  GLY B C     1 
ATOM   8447  O  O     . GLY B 1 462 ? 80.656  135.687 87.752  1.00 16.43 ? 462  GLY B O     1 
ATOM   8448  N  N     . ASN B 1 463 ? 79.496  137.612 87.871  1.00 17.25 ? 463  ASN B N     1 
ATOM   8449  C  CA    . ASN B 1 463 ? 78.267  137.039 87.341  1.00 17.41 ? 463  ASN B CA    1 
ATOM   8450  C  C     . ASN B 1 463 ? 78.376  136.949 85.829  1.00 16.99 ? 463  ASN B C     1 
ATOM   8451  O  O     . ASN B 1 463 ? 78.648  137.945 85.157  1.00 16.74 ? 463  ASN B O     1 
ATOM   8452  C  CB    . ASN B 1 463 ? 77.074  137.898 87.751  1.00 16.84 ? 463  ASN B CB    1 
ATOM   8453  C  CG    . ASN B 1 463 ? 76.885  137.928 89.250  1.00 17.92 ? 463  ASN B CG    1 
ATOM   8454  O  OD1   . ASN B 1 463 ? 76.574  136.909 89.865  1.00 19.52 ? 463  ASN B OD1   1 
ATOM   8455  N  ND2   . ASN B 1 463 ? 77.086  139.093 89.851  1.00 19.16 ? 463  ASN B ND2   1 
ATOM   8456  N  N     . LEU B 1 464 ? 78.178  135.744 85.301  1.00 15.83 ? 464  LEU B N     1 
ATOM   8457  C  CA    . LEU B 1 464 ? 78.277  135.510 83.866  1.00 15.02 ? 464  LEU B CA    1 
ATOM   8458  C  C     . LEU B 1 464 ? 77.039  135.963 83.104  1.00 14.59 ? 464  LEU B C     1 
ATOM   8459  O  O     . LEU B 1 464 ? 75.943  135.434 83.295  1.00 13.00 ? 464  LEU B O     1 
ATOM   8460  C  CB    . LEU B 1 464 ? 78.546  134.024 83.588  1.00 13.77 ? 464  LEU B CB    1 
ATOM   8461  C  CG    . LEU B 1 464 ? 78.686  133.617 82.113  1.00 13.71 ? 464  LEU B CG    1 
ATOM   8462  C  CD1   . LEU B 1 464 ? 79.713  134.484 81.407  1.00 9.25  ? 464  LEU B CD1   1 
ATOM   8463  C  CD2   . LEU B 1 464 ? 79.072  132.154 82.034  1.00 13.43 ? 464  LEU B CD2   1 
ATOM   8464  N  N     . VAL B 1 465 ? 77.223  136.954 82.240  1.00 15.36 ? 465  VAL B N     1 
ATOM   8465  C  CA    . VAL B 1 465 ? 76.129  137.478 81.438  1.00 15.92 ? 465  VAL B CA    1 
ATOM   8466  C  C     . VAL B 1 465 ? 76.573  137.576 79.989  1.00 17.50 ? 465  VAL B C     1 
ATOM   8467  O  O     . VAL B 1 465 ? 77.762  137.481 79.691  1.00 19.30 ? 465  VAL B O     1 
ATOM   8468  C  CB    . VAL B 1 465 ? 75.690  138.884 81.905  1.00 15.81 ? 465  VAL B CB    1 
ATOM   8469  C  CG1   . VAL B 1 465 ? 75.170  138.829 83.337  1.00 16.55 ? 465  VAL B CG1   1 
ATOM   8470  C  CG2   . VAL B 1 465 ? 76.856  139.857 81.788  1.00 17.36 ? 465  VAL B CG2   1 
ATOM   8471  N  N     . ILE B 1 466 ? 75.603  137.754 79.100  1.00 16.38 ? 466  ILE B N     1 
ATOM   8472  C  CA    . ILE B 1 466 ? 75.860  137.894 77.675  1.00 15.74 ? 466  ILE B CA    1 
ATOM   8473  C  C     . ILE B 1 466 ? 75.228  139.235 77.325  1.00 16.03 ? 466  ILE B C     1 
ATOM   8474  O  O     . ILE B 1 466 ? 74.024  139.409 77.470  1.00 14.49 ? 466  ILE B O     1 
ATOM   8475  C  CB    . ILE B 1 466 ? 75.171  136.775 76.866  1.00 16.47 ? 466  ILE B CB    1 
ATOM   8476  C  CG1   . ILE B 1 466 ? 75.406  135.414 77.533  1.00 16.66 ? 466  ILE B CG1   1 
ATOM   8477  C  CG2   . ILE B 1 466 ? 75.702  136.768 75.443  1.00 16.60 ? 466  ILE B CG2   1 
ATOM   8478  C  CD1   . ILE B 1 466 ? 76.847  134.937 77.538  1.00 17.32 ? 466  ILE B CD1   1 
ATOM   8479  N  N     . THR B 1 467 ? 76.046  140.177 76.868  1.00 17.41 ? 467  THR B N     1 
ATOM   8480  C  CA    . THR B 1 467 ? 75.576  141.521 76.554  1.00 16.84 ? 467  THR B CA    1 
ATOM   8481  C  C     . THR B 1 467 ? 74.758  141.687 75.280  1.00 18.52 ? 467  THR B C     1 
ATOM   8482  O  O     . THR B 1 467 ? 74.158  142.739 75.057  1.00 19.31 ? 467  THR B O     1 
ATOM   8483  C  CB    . THR B 1 467 ? 76.756  142.498 76.527  1.00 16.14 ? 467  THR B CB    1 
ATOM   8484  O  OG1   . THR B 1 467 ? 77.719  142.066 75.557  1.00 16.37 ? 467  THR B OG1   1 
ATOM   8485  C  CG2   . THR B 1 467 ? 77.418  142.549 77.906  1.00 16.56 ? 467  THR B CG2   1 
ATOM   8486  N  N     . ASP B 1 468 ? 74.730  140.664 74.436  1.00 18.64 ? 468  ASP B N     1 
ATOM   8487  C  CA    . ASP B 1 468 ? 73.946  140.759 73.215  1.00 19.32 ? 468  ASP B CA    1 
ATOM   8488  C  C     . ASP B 1 468 ? 73.345  139.411 72.848  1.00 17.79 ? 468  ASP B C     1 
ATOM   8489  O  O     . ASP B 1 468 ? 73.730  138.377 73.400  1.00 17.48 ? 468  ASP B O     1 
ATOM   8490  C  CB    . ASP B 1 468 ? 74.797  141.282 72.056  1.00 20.53 ? 468  ASP B CB    1 
ATOM   8491  C  CG    . ASP B 1 468 ? 73.985  142.104 71.068  1.00 22.74 ? 468  ASP B CG    1 
ATOM   8492  O  OD1   . ASP B 1 468 ? 72.831  141.712 70.768  1.00 21.68 ? 468  ASP B OD1   1 
ATOM   8493  O  OD2   . ASP B 1 468 ? 74.502  143.138 70.587  1.00 23.20 ? 468  ASP B OD2   1 
ATOM   8494  N  N     . SER B 1 469 ? 72.395  139.435 71.917  1.00 15.97 ? 469  SER B N     1 
ATOM   8495  C  CA    . SER B 1 469 ? 71.717  138.227 71.469  1.00 14.76 ? 469  SER B CA    1 
ATOM   8496  C  C     . SER B 1 469 ? 72.556  137.419 70.486  1.00 15.05 ? 469  SER B C     1 
ATOM   8497  O  O     . SER B 1 469 ? 73.558  137.895 69.952  1.00 14.83 ? 469  SER B O     1 
ATOM   8498  C  CB    . SER B 1 469 ? 70.375  138.591 70.817  1.00 13.46 ? 469  SER B CB    1 
ATOM   8499  O  OG    . SER B 1 469 ? 69.668  137.435 70.394  1.00 9.20  ? 469  SER B OG    1 
ATOM   8500  N  N     . TRP B 1 470 ? 72.124  136.183 70.274  1.00 15.97 ? 470  TRP B N     1 
ATOM   8501  C  CA    . TRP B 1 470 ? 72.752  135.252 69.354  1.00 16.55 ? 470  TRP B CA    1 
ATOM   8502  C  C     . TRP B 1 470 ? 71.584  134.465 68.755  1.00 17.26 ? 470  TRP B C     1 
ATOM   8503  O  O     . TRP B 1 470 ? 70.548  134.305 69.397  1.00 16.70 ? 470  TRP B O     1 
ATOM   8504  C  CB    . TRP B 1 470 ? 73.735  134.342 70.099  1.00 17.23 ? 470  TRP B CB    1 
ATOM   8505  C  CG    . TRP B 1 470 ? 73.124  133.532 71.183  1.00 17.90 ? 470  TRP B CG    1 
ATOM   8506  C  CD1   . TRP B 1 470 ? 72.767  132.217 71.121  1.00 16.54 ? 470  TRP B CD1   1 
ATOM   8507  C  CD2   . TRP B 1 470 ? 72.783  133.983 72.499  1.00 17.02 ? 470  TRP B CD2   1 
ATOM   8508  N  NE1   . TRP B 1 470 ? 72.224  131.822 72.320  1.00 18.94 ? 470  TRP B NE1   1 
ATOM   8509  C  CE2   . TRP B 1 470 ? 72.222  132.885 73.183  1.00 15.90 ? 470  TRP B CE2   1 
ATOM   8510  C  CE3   . TRP B 1 470 ? 72.899  135.210 73.165  1.00 17.23 ? 470  TRP B CE3   1 
ATOM   8511  C  CZ2   . TRP B 1 470 ? 71.776  132.975 74.500  1.00 16.29 ? 470  TRP B CZ2   1 
ATOM   8512  C  CZ3   . TRP B 1 470 ? 72.456  135.303 74.475  1.00 18.05 ? 470  TRP B CZ3   1 
ATOM   8513  C  CH2   . TRP B 1 470 ? 71.900  134.190 75.129  1.00 18.96 ? 470  TRP B CH2   1 
ATOM   8514  N  N     . PRO B 1 471 ? 71.737  133.968 67.520  1.00 18.31 ? 471  PRO B N     1 
ATOM   8515  C  CA    . PRO B 1 471 ? 70.704  133.207 66.801  1.00 17.77 ? 471  PRO B CA    1 
ATOM   8516  C  C     . PRO B 1 471 ? 69.917  132.133 67.565  1.00 17.99 ? 471  PRO B C     1 
ATOM   8517  O  O     . PRO B 1 471 ? 68.693  132.067 67.459  1.00 17.83 ? 471  PRO B O     1 
ATOM   8518  C  CB    . PRO B 1 471 ? 71.472  132.615 65.616  1.00 17.68 ? 471  PRO B CB    1 
ATOM   8519  C  CG    . PRO B 1 471 ? 72.549  133.624 65.374  1.00 18.75 ? 471  PRO B CG    1 
ATOM   8520  C  CD    . PRO B 1 471 ? 73.010  133.950 66.776  1.00 16.72 ? 471  PRO B CD    1 
ATOM   8521  N  N     . GLY B 1 472 ? 70.612  131.295 68.326  1.00 16.92 ? 472  GLY B N     1 
ATOM   8522  C  CA    . GLY B 1 472 ? 69.931  130.226 69.036  1.00 15.94 ? 472  GLY B CA    1 
ATOM   8523  C  C     . GLY B 1 472 ? 69.311  130.541 70.378  1.00 15.71 ? 472  GLY B C     1 
ATOM   8524  O  O     . GLY B 1 472 ? 68.895  129.631 71.091  1.00 18.40 ? 472  GLY B O     1 
ATOM   8525  N  N     . GLN B 1 473 ? 69.229  131.818 70.724  1.00 14.96 ? 473  GLN B N     1 
ATOM   8526  C  CA    . GLN B 1 473 ? 68.668  132.227 72.009  1.00 14.80 ? 473  GLN B CA    1 
ATOM   8527  C  C     . GLN B 1 473 ? 67.157  132.055 72.160  1.00 14.88 ? 473  GLN B C     1 
ATOM   8528  O  O     . GLN B 1 473 ? 66.392  132.392 71.261  1.00 14.55 ? 473  GLN B O     1 
ATOM   8529  C  CB    . GLN B 1 473 ? 69.037  133.683 72.289  1.00 17.37 ? 473  GLN B CB    1 
ATOM   8530  C  CG    . GLN B 1 473 ? 68.388  134.256 73.541  1.00 18.82 ? 473  GLN B CG    1 
ATOM   8531  C  CD    . GLN B 1 473 ? 68.843  135.667 73.828  1.00 21.07 ? 473  GLN B CD    1 
ATOM   8532  O  OE1   . GLN B 1 473 ? 69.023  136.474 72.910  1.00 22.97 ? 473  GLN B OE1   1 
ATOM   8533  N  NE2   . GLN B 1 473 ? 69.019  135.982 75.107  1.00 18.54 ? 473  GLN B NE2   1 
ATOM   8534  N  N     . ALA B 1 474 ? 66.737  131.549 73.318  1.00 14.62 ? 474  ALA B N     1 
ATOM   8535  C  CA    . ALA B 1 474 ? 65.316  131.344 73.611  1.00 16.50 ? 474  ALA B CA    1 
ATOM   8536  C  C     . ALA B 1 474 ? 64.563  132.668 73.503  1.00 16.37 ? 474  ALA B C     1 
ATOM   8537  O  O     . ALA B 1 474 ? 65.017  133.693 74.021  1.00 15.09 ? 474  ALA B O     1 
ATOM   8538  C  CB    . ALA B 1 474 ? 65.146  130.766 75.009  1.00 13.56 ? 474  ALA B CB    1 
ATOM   8539  N  N     . ARG B 1 475 ? 63.406  132.637 72.845  1.00 16.40 ? 475  ARG B N     1 
ATOM   8540  C  CA    . ARG B 1 475 ? 62.601  133.836 72.640  1.00 16.43 ? 475  ARG B CA    1 
ATOM   8541  C  C     . ARG B 1 475 ? 61.714  134.234 73.821  1.00 16.37 ? 475  ARG B C     1 
ATOM   8542  O  O     . ARG B 1 475 ? 61.378  135.407 73.978  1.00 16.79 ? 475  ARG B O     1 
ATOM   8543  C  CB    . ARG B 1 475 ? 61.719  133.670 71.396  1.00 15.08 ? 475  ARG B CB    1 
ATOM   8544  C  CG    . ARG B 1 475 ? 62.454  133.226 70.146  1.00 12.83 ? 475  ARG B CG    1 
ATOM   8545  C  CD    . ARG B 1 475 ? 63.703  134.057 69.862  1.00 12.48 ? 475  ARG B CD    1 
ATOM   8546  N  NE    . ARG B 1 475 ? 64.056  133.947 68.451  1.00 14.77 ? 475  ARG B NE    1 
ATOM   8547  C  CZ    . ARG B 1 475 ? 65.273  133.701 67.984  1.00 14.42 ? 475  ARG B CZ    1 
ATOM   8548  N  NH1   . ARG B 1 475 ? 66.292  133.535 68.812  1.00 15.79 ? 475  ARG B NH1   1 
ATOM   8549  N  NH2   . ARG B 1 475 ? 65.460  133.605 66.675  1.00 16.86 ? 475  ARG B NH2   1 
ATOM   8550  N  N     . THR B 1 476 ? 61.325  133.267 74.643  1.00 15.98 ? 476  THR B N     1 
ATOM   8551  C  CA    . THR B 1 476 ? 60.460  133.564 75.775  1.00 16.32 ? 476  THR B CA    1 
ATOM   8552  C  C     . THR B 1 476 ? 60.209  132.322 76.616  1.00 17.61 ? 476  THR B C     1 
ATOM   8553  O  O     . THR B 1 476 ? 60.794  131.257 76.382  1.00 19.09 ? 476  THR B O     1 
ATOM   8554  C  CB    . THR B 1 476 ? 59.091  134.098 75.277  1.00 16.66 ? 476  THR B CB    1 
ATOM   8555  O  OG1   . THR B 1 476 ? 58.259  134.449 76.391  1.00 17.55 ? 476  THR B OG1   1 
ATOM   8556  C  CG2   . THR B 1 476 ? 58.381  133.036 74.449  1.00 16.19 ? 476  THR B CG2   1 
ATOM   8557  N  N     . LEU B 1 477 ? 59.339  132.482 77.608  1.00 16.96 ? 477  LEU B N     1 
ATOM   8558  C  CA    . LEU B 1 477 ? 58.928  131.399 78.484  1.00 16.44 ? 477  LEU B CA    1 
ATOM   8559  C  C     . LEU B 1 477 ? 57.462  131.210 78.120  1.00 17.70 ? 477  LEU B C     1 
ATOM   8560  O  O     . LEU B 1 477 ? 56.661  132.134 78.286  1.00 19.09 ? 477  LEU B O     1 
ATOM   8561  C  CB    . LEU B 1 477 ? 59.065  131.807 79.952  1.00 14.28 ? 477  LEU B CB    1 
ATOM   8562  C  CG    . LEU B 1 477 ? 60.481  131.977 80.508  1.00 13.04 ? 477  LEU B CG    1 
ATOM   8563  C  CD1   . LEU B 1 477 ? 60.402  132.153 82.020  1.00 9.86  ? 477  LEU B CD1   1 
ATOM   8564  C  CD2   . LEU B 1 477 ? 61.329  130.744 80.180  1.00 11.43 ? 477  LEU B CD2   1 
ATOM   8565  N  N     . PHE B 1 478 ? 57.111  130.030 77.612  1.00 17.72 ? 478  PHE B N     1 
ATOM   8566  C  CA    . PHE B 1 478 ? 55.736  129.770 77.197  1.00 19.22 ? 478  PHE B CA    1 
ATOM   8567  C  C     . PHE B 1 478 ? 54.659  130.279 78.148  1.00 18.89 ? 478  PHE B C     1 
ATOM   8568  O  O     . PHE B 1 478 ? 54.612  129.900 79.324  1.00 19.97 ? 478  PHE B O     1 
ATOM   8569  C  CB    . PHE B 1 478 ? 55.498  128.280 76.958  1.00 19.99 ? 478  PHE B CB    1 
ATOM   8570  C  CG    . PHE B 1 478 ? 54.148  127.984 76.371  1.00 22.01 ? 478  PHE B CG    1 
ATOM   8571  C  CD1   . PHE B 1 478 ? 53.893  128.236 75.026  1.00 22.87 ? 478  PHE B CD1   1 
ATOM   8572  C  CD2   . PHE B 1 478 ? 53.111  127.511 77.173  1.00 23.40 ? 478  PHE B CD2   1 
ATOM   8573  C  CE1   . PHE B 1 478 ? 52.619  128.022 74.489  1.00 24.18 ? 478  PHE B CE1   1 
ATOM   8574  C  CE2   . PHE B 1 478 ? 51.840  127.294 76.647  1.00 23.16 ? 478  PHE B CE2   1 
ATOM   8575  C  CZ    . PHE B 1 478 ? 51.594  127.551 75.301  1.00 24.45 ? 478  PHE B CZ    1 
ATOM   8576  N  N     . GLY B 1 479 ? 53.796  131.143 77.618  1.00 19.04 ? 479  GLY B N     1 
ATOM   8577  C  CA    . GLY B 1 479 ? 52.699  131.702 78.387  1.00 17.99 ? 479  GLY B CA    1 
ATOM   8578  C  C     . GLY B 1 479 ? 53.077  132.698 79.465  1.00 19.66 ? 479  GLY B C     1 
ATOM   8579  O  O     . GLY B 1 479 ? 52.213  133.139 80.219  1.00 20.83 ? 479  GLY B O     1 
ATOM   8580  N  N     . ASP B 1 480 ? 54.350  133.066 79.549  1.00 19.27 ? 480  ASP B N     1 
ATOM   8581  C  CA    . ASP B 1 480 ? 54.767  134.008 80.581  1.00 18.99 ? 480  ASP B CA    1 
ATOM   8582  C  C     . ASP B 1 480 ? 55.995  134.799 80.157  1.00 18.62 ? 480  ASP B C     1 
ATOM   8583  O  O     . ASP B 1 480 ? 57.094  134.602 80.673  1.00 17.46 ? 480  ASP B O     1 
ATOM   8584  C  CB    . ASP B 1 480 ? 55.070  133.265 81.888  1.00 20.92 ? 480  ASP B CB    1 
ATOM   8585  C  CG    . ASP B 1 480 ? 55.023  134.177 83.104  1.00 22.68 ? 480  ASP B CG    1 
ATOM   8586  O  OD1   . ASP B 1 480 ? 55.158  135.410 82.932  1.00 23.28 ? 480  ASP B OD1   1 
ATOM   8587  O  OD2   . ASP B 1 480 ? 54.861  133.657 84.232  1.00 25.22 ? 480  ASP B OD2   1 
ATOM   8588  N  N     . HIS B 1 481 ? 55.803  135.702 79.211  1.00 17.90 ? 481  HIS B N     1 
ATOM   8589  C  CA    . HIS B 1 481 ? 56.902  136.512 78.737  1.00 18.76 ? 481  HIS B CA    1 
ATOM   8590  C  C     . HIS B 1 481 ? 57.415  137.428 79.849  1.00 19.09 ? 481  HIS B C     1 
ATOM   8591  O  O     . HIS B 1 481 ? 58.617  137.668 79.964  1.00 18.94 ? 481  HIS B O     1 
ATOM   8592  C  CB    . HIS B 1 481 ? 56.450  137.352 77.545  1.00 20.01 ? 481  HIS B CB    1 
ATOM   8593  C  CG    . HIS B 1 481 ? 57.553  138.135 76.914  1.00 19.89 ? 481  HIS B CG    1 
ATOM   8594  N  ND1   . HIS B 1 481 ? 58.573  137.538 76.204  1.00 21.59 ? 481  HIS B ND1   1 
ATOM   8595  C  CD2   . HIS B 1 481 ? 57.810  139.464 76.899  1.00 20.27 ? 481  HIS B CD2   1 
ATOM   8596  C  CE1   . HIS B 1 481 ? 59.409  138.467 75.776  1.00 20.54 ? 481  HIS B CE1   1 
ATOM   8597  N  NE2   . HIS B 1 481 ? 58.969  139.644 76.183  1.00 20.99 ? 481  HIS B NE2   1 
ATOM   8598  N  N     . GLU B 1 482 ? 56.506  137.946 80.671  1.00 18.98 ? 482  GLU B N     1 
ATOM   8599  C  CA    . GLU B 1 482 ? 56.926  138.839 81.752  1.00 19.06 ? 482  GLU B CA    1 
ATOM   8600  C  C     . GLU B 1 482 ? 57.974  138.164 82.624  1.00 18.20 ? 482  GLU B C     1 
ATOM   8601  O  O     . GLU B 1 482 ? 58.983  138.777 82.986  1.00 17.23 ? 482  GLU B O     1 
ATOM   8602  C  CB    . GLU B 1 482 ? 55.735  139.260 82.624  1.00 20.03 ? 482  GLU B CB    1 
ATOM   8603  C  CG    . GLU B 1 482 ? 54.680  140.066 81.885  1.00 25.48 ? 482  GLU B CG    1 
ATOM   8604  C  CD    . GLU B 1 482 ? 53.908  139.225 80.878  1.00 31.45 ? 482  GLU B CD    1 
ATOM   8605  O  OE1   . GLU B 1 482 ? 53.412  139.796 79.877  1.00 31.98 ? 482  GLU B OE1   1 
ATOM   8606  O  OE2   . GLU B 1 482 ? 53.788  137.991 81.093  1.00 35.16 ? 482  GLU B OE2   1 
ATOM   8607  N  N     . ARG B 1 483 ? 57.746  136.898 82.960  1.00 16.02 ? 483  ARG B N     1 
ATOM   8608  C  CA    . ARG B 1 483 ? 58.700  136.193 83.796  1.00 16.78 ? 483  ARG B CA    1 
ATOM   8609  C  C     . ARG B 1 483 ? 60.022  136.048 83.045  1.00 14.55 ? 483  ARG B C     1 
ATOM   8610  O  O     . ARG B 1 483 ? 61.087  136.130 83.639  1.00 13.37 ? 483  ARG B O     1 
ATOM   8611  C  CB    . ARG B 1 483 ? 58.137  134.828 84.218  1.00 18.24 ? 483  ARG B CB    1 
ATOM   8612  C  CG    . ARG B 1 483 ? 59.050  134.071 85.169  1.00 22.87 ? 483  ARG B CG    1 
ATOM   8613  C  CD    . ARG B 1 483 ? 58.300  133.059 86.030  1.00 28.78 ? 483  ARG B CD    1 
ATOM   8614  N  NE    . ARG B 1 483 ? 57.940  133.611 87.337  1.00 34.59 ? 483  ARG B NE    1 
ATOM   8615  C  CZ    . ARG B 1 483 ? 56.737  134.078 87.664  1.00 37.82 ? 483  ARG B CZ    1 
ATOM   8616  N  NH1   . ARG B 1 483 ? 55.746  134.064 86.778  1.00 36.36 ? 483  ARG B NH1   1 
ATOM   8617  N  NH2   . ARG B 1 483 ? 56.531  134.569 88.882  1.00 39.81 ? 483  ARG B NH2   1 
ATOM   8618  N  N     . PHE B 1 484 ? 59.941  135.850 81.734  1.00 14.06 ? 484  PHE B N     1 
ATOM   8619  C  CA    . PHE B 1 484 ? 61.122  135.722 80.892  1.00 15.89 ? 484  PHE B CA    1 
ATOM   8620  C  C     . PHE B 1 484 ? 62.024  136.934 81.076  1.00 17.40 ? 484  PHE B C     1 
ATOM   8621  O  O     . PHE B 1 484 ? 63.211  136.804 81.382  1.00 15.34 ? 484  PHE B O     1 
ATOM   8622  C  CB    . PHE B 1 484 ? 60.707  135.629 79.423  1.00 15.98 ? 484  PHE B CB    1 
ATOM   8623  C  CG    . PHE B 1 484 ? 61.854  135.417 78.467  1.00 15.45 ? 484  PHE B CG    1 
ATOM   8624  C  CD1   . PHE B 1 484 ? 62.635  134.266 78.530  1.00 12.42 ? 484  PHE B CD1   1 
ATOM   8625  C  CD2   . PHE B 1 484 ? 62.105  136.337 77.452  1.00 15.84 ? 484  PHE B CD2   1 
ATOM   8626  C  CE1   . PHE B 1 484 ? 63.639  134.028 77.593  1.00 12.86 ? 484  PHE B CE1   1 
ATOM   8627  C  CE2   . PHE B 1 484 ? 63.112  136.109 76.505  1.00 15.88 ? 484  PHE B CE2   1 
ATOM   8628  C  CZ    . PHE B 1 484 ? 63.879  134.947 76.576  1.00 13.79 ? 484  PHE B CZ    1 
ATOM   8629  N  N     . GLU B 1 485 ? 61.453  138.118 80.877  1.00 18.20 ? 485  GLU B N     1 
ATOM   8630  C  CA    . GLU B 1 485 ? 62.195  139.367 81.005  1.00 21.40 ? 485  GLU B CA    1 
ATOM   8631  C  C     . GLU B 1 485 ? 62.760  139.563 82.410  1.00 20.26 ? 485  GLU B C     1 
ATOM   8632  O  O     . GLU B 1 485 ? 63.907  139.976 82.571  1.00 21.06 ? 485  GLU B O     1 
ATOM   8633  C  CB    . GLU B 1 485 ? 61.287  140.547 80.650  1.00 25.20 ? 485  GLU B CB    1 
ATOM   8634  C  CG    . GLU B 1 485 ? 60.644  140.441 79.273  1.00 30.15 ? 485  GLU B CG    1 
ATOM   8635  C  CD    . GLU B 1 485 ? 59.565  141.493 79.053  1.00 34.98 ? 485  GLU B CD    1 
ATOM   8636  O  OE1   . GLU B 1 485 ? 58.570  141.494 79.818  1.00 36.57 ? 485  GLU B OE1   1 
ATOM   8637  O  OE2   . GLU B 1 485 ? 59.717  142.316 78.117  1.00 36.08 ? 485  GLU B OE2   1 
ATOM   8638  N  N     . GLN B 1 486 ? 61.956  139.263 83.425  1.00 18.83 ? 486  GLN B N     1 
ATOM   8639  C  CA    . GLN B 1 486 ? 62.397  139.424 84.805  1.00 19.52 ? 486  GLN B CA    1 
ATOM   8640  C  C     . GLN B 1 486 ? 63.506  138.460 85.225  1.00 18.31 ? 486  GLN B C     1 
ATOM   8641  O  O     . GLN B 1 486 ? 64.507  138.876 85.811  1.00 16.71 ? 486  GLN B O     1 
ATOM   8642  C  CB    . GLN B 1 486 ? 61.220  139.275 85.773  1.00 19.50 ? 486  GLN B CB    1 
ATOM   8643  C  CG    . GLN B 1 486 ? 61.637  139.357 87.240  1.00 22.51 ? 486  GLN B CG    1 
ATOM   8644  C  CD    . GLN B 1 486 ? 60.462  139.291 88.206  1.00 25.68 ? 486  GLN B CD    1 
ATOM   8645  O  OE1   . GLN B 1 486 ? 59.705  140.251 88.355  1.00 27.72 ? 486  GLN B OE1   1 
ATOM   8646  N  NE2   . GLN B 1 486 ? 60.300  138.147 88.862  1.00 27.78 ? 486  GLN B NE2   1 
ATOM   8647  N  N     . THR B 1 487 ? 63.327  137.180 84.920  1.00 16.26 ? 487  THR B N     1 
ATOM   8648  C  CA    . THR B 1 487 ? 64.296  136.160 85.286  1.00 16.77 ? 487  THR B CA    1 
ATOM   8649  C  C     . THR B 1 487 ? 65.677  136.321 84.654  1.00 18.14 ? 487  THR B C     1 
ATOM   8650  O  O     . THR B 1 487 ? 66.699  136.143 85.321  1.00 18.56 ? 487  THR B O     1 
ATOM   8651  C  CB    . THR B 1 487 ? 63.757  134.753 84.941  1.00 17.44 ? 487  THR B CB    1 
ATOM   8652  O  OG1   . THR B 1 487 ? 62.516  134.544 85.627  1.00 13.39 ? 487  THR B OG1   1 
ATOM   8653  C  CG2   . THR B 1 487 ? 64.761  133.660 85.360  1.00 13.30 ? 487  THR B CG2   1 
ATOM   8654  N  N     . TYR B 1 488 ? 65.724  136.668 83.376  1.00 17.74 ? 488  TYR B N     1 
ATOM   8655  C  CA    . TYR B 1 488 ? 67.012  136.798 82.719  1.00 18.85 ? 488  TYR B CA    1 
ATOM   8656  C  C     . TYR B 1 488 ? 67.464  138.220 82.402  1.00 18.33 ? 488  TYR B C     1 
ATOM   8657  O  O     . TYR B 1 488 ? 68.652  138.444 82.162  1.00 18.04 ? 488  TYR B O     1 
ATOM   8658  C  CB    . TYR B 1 488 ? 67.016  135.974 81.432  1.00 18.78 ? 488  TYR B CB    1 
ATOM   8659  C  CG    . TYR B 1 488 ? 66.440  134.587 81.600  1.00 21.42 ? 488  TYR B CG    1 
ATOM   8660  C  CD1   . TYR B 1 488 ? 65.077  134.355 81.409  1.00 22.56 ? 488  TYR B CD1   1 
ATOM   8661  C  CD2   . TYR B 1 488 ? 67.249  133.514 81.970  1.00 20.46 ? 488  TYR B CD2   1 
ATOM   8662  C  CE1   . TYR B 1 488 ? 64.529  133.089 81.581  1.00 23.46 ? 488  TYR B CE1   1 
ATOM   8663  C  CE2   . TYR B 1 488 ? 66.713  132.241 82.147  1.00 23.27 ? 488  TYR B CE2   1 
ATOM   8664  C  CZ    . TYR B 1 488 ? 65.353  132.036 81.949  1.00 25.23 ? 488  TYR B CZ    1 
ATOM   8665  O  OH    . TYR B 1 488 ? 64.824  130.776 82.115  1.00 26.98 ? 488  TYR B OH    1 
ATOM   8666  N  N     . PHE B 1 489 ? 66.548  139.185 82.420  1.00 17.73 ? 489  PHE B N     1 
ATOM   8667  C  CA    . PHE B 1 489 ? 66.932  140.547 82.070  1.00 16.72 ? 489  PHE B CA    1 
ATOM   8668  C  C     . PHE B 1 489 ? 66.689  141.678 83.058  1.00 15.79 ? 489  PHE B C     1 
ATOM   8669  O  O     . PHE B 1 489 ? 66.887  142.837 82.701  1.00 16.34 ? 489  PHE B O     1 
ATOM   8670  C  CB    . PHE B 1 489 ? 66.296  140.929 80.732  1.00 16.37 ? 489  PHE B CB    1 
ATOM   8671  C  CG    . PHE B 1 489 ? 66.481  139.896 79.656  1.00 16.95 ? 489  PHE B CG    1 
ATOM   8672  C  CD1   . PHE B 1 489 ? 65.548  138.880 79.481  1.00 15.57 ? 489  PHE B CD1   1 
ATOM   8673  C  CD2   . PHE B 1 489 ? 67.595  139.940 78.819  1.00 17.38 ? 489  PHE B CD2   1 
ATOM   8674  C  CE1   . PHE B 1 489 ? 65.718  137.921 78.485  1.00 17.35 ? 489  PHE B CE1   1 
ATOM   8675  C  CE2   . PHE B 1 489 ? 67.774  138.983 77.820  1.00 18.59 ? 489  PHE B CE2   1 
ATOM   8676  C  CZ    . PHE B 1 489 ? 66.831  137.971 77.653  1.00 17.49 ? 489  PHE B CZ    1 
ATOM   8677  N  N     . SER B 1 490 ? 66.279  141.380 84.286  1.00 16.31 ? 490  SER B N     1 
ATOM   8678  C  CA    . SER B 1 490 ? 66.041  142.458 85.248  1.00 16.88 ? 490  SER B CA    1 
ATOM   8679  C  C     . SER B 1 490 ? 67.142  142.614 86.302  1.00 17.15 ? 490  SER B C     1 
ATOM   8680  O  O     . SER B 1 490 ? 67.241  143.660 86.944  1.00 17.40 ? 490  SER B O     1 
ATOM   8681  C  CB    . SER B 1 490 ? 64.690  142.277 85.950  1.00 15.17 ? 490  SER B CB    1 
ATOM   8682  O  OG    . SER B 1 490 ? 64.747  141.244 86.914  1.00 17.30 ? 490  SER B OG    1 
ATOM   8683  N  N     . THR B 1 491 ? 67.962  141.584 86.491  1.00 17.79 ? 491  THR B N     1 
ATOM   8684  C  CA    . THR B 1 491 ? 69.039  141.657 87.480  1.00 18.47 ? 491  THR B CA    1 
ATOM   8685  C  C     . THR B 1 491 ? 70.099  142.640 87.006  1.00 19.12 ? 491  THR B C     1 
ATOM   8686  O  O     . THR B 1 491 ? 70.557  143.497 87.763  1.00 16.99 ? 491  THR B O     1 
ATOM   8687  C  CB    . THR B 1 491 ? 69.722  140.299 87.694  1.00 18.95 ? 491  THR B CB    1 
ATOM   8688  O  OG1   . THR B 1 491 ? 68.724  139.298 87.941  1.00 19.36 ? 491  THR B OG1   1 
ATOM   8689  C  CG2   . THR B 1 491 ? 70.677  140.370 88.892  1.00 14.92 ? 491  THR B CG2   1 
ATOM   8690  N  N     . PHE B 1 492 ? 70.493  142.500 85.747  1.00 19.61 ? 492  PHE B N     1 
ATOM   8691  C  CA    . PHE B 1 492 ? 71.481  143.381 85.148  1.00 20.93 ? 492  PHE B CA    1 
ATOM   8692  C  C     . PHE B 1 492 ? 70.873  143.946 83.874  1.00 21.06 ? 492  PHE B C     1 
ATOM   8693  O  O     . PHE B 1 492 ? 70.766  143.253 82.860  1.00 20.48 ? 492  PHE B O     1 
ATOM   8694  C  CB    . PHE B 1 492 ? 72.758  142.605 84.846  1.00 20.91 ? 492  PHE B CB    1 
ATOM   8695  C  CG    . PHE B 1 492 ? 73.258  141.818 86.014  1.00 21.93 ? 492  PHE B CG    1 
ATOM   8696  C  CD1   . PHE B 1 492 ? 73.234  140.428 85.994  1.00 22.08 ? 492  PHE B CD1   1 
ATOM   8697  C  CD2   . PHE B 1 492 ? 73.709  142.467 87.157  1.00 21.34 ? 492  PHE B CD2   1 
ATOM   8698  C  CE1   . PHE B 1 492 ? 73.648  139.694 87.097  1.00 22.26 ? 492  PHE B CE1   1 
ATOM   8699  C  CE2   . PHE B 1 492 ? 74.125  141.741 88.267  1.00 22.34 ? 492  PHE B CE2   1 
ATOM   8700  C  CZ    . PHE B 1 492 ? 74.094  140.353 88.238  1.00 21.54 ? 492  PHE B CZ    1 
ATOM   8701  N  N     . LYS B 1 493 ? 70.473  145.209 83.940  1.00 20.42 ? 493  LYS B N     1 
ATOM   8702  C  CA    . LYS B 1 493 ? 69.840  145.877 82.816  1.00 23.01 ? 493  LYS B CA    1 
ATOM   8703  C  C     . LYS B 1 493 ? 70.539  145.734 81.472  1.00 23.11 ? 493  LYS B C     1 
ATOM   8704  O  O     . LYS B 1 493 ? 71.759  145.879 81.365  1.00 22.97 ? 493  LYS B O     1 
ATOM   8705  C  CB    . LYS B 1 493 ? 69.647  147.362 83.133  1.00 23.84 ? 493  LYS B CB    1 
ATOM   8706  C  CG    . LYS B 1 493 ? 68.820  147.605 84.371  1.00 26.80 ? 493  LYS B CG    1 
ATOM   8707  C  CD    . LYS B 1 493 ? 67.527  146.810 84.333  1.00 29.15 ? 493  LYS B CD    1 
ATOM   8708  C  CE    . LYS B 1 493 ? 66.832  146.810 85.693  1.00 32.44 ? 493  LYS B CE    1 
ATOM   8709  N  NZ    . LYS B 1 493 ? 65.550  146.031 85.670  1.00 33.67 ? 493  LYS B NZ    1 
ATOM   8710  N  N     . ASN B 1 494 ? 69.741  145.439 80.448  1.00 23.41 ? 494  ASN B N     1 
ATOM   8711  C  CA    . ASN B 1 494 ? 70.228  145.304 79.078  1.00 25.40 ? 494  ASN B CA    1 
ATOM   8712  C  C     . ASN B 1 494 ? 71.119  144.095 78.853  1.00 23.15 ? 494  ASN B C     1 
ATOM   8713  O  O     . ASN B 1 494 ? 71.752  143.971 77.807  1.00 21.74 ? 494  ASN B O     1 
ATOM   8714  C  CB    . ASN B 1 494 ? 70.980  146.577 78.677  1.00 29.10 ? 494  ASN B CB    1 
ATOM   8715  C  CG    . ASN B 1 494 ? 70.186  147.833 78.978  1.00 34.88 ? 494  ASN B CG    1 
ATOM   8716  O  OD1   . ASN B 1 494 ? 69.155  148.094 78.352  1.00 37.13 ? 494  ASN B OD1   1 
ATOM   8717  N  ND2   . ASN B 1 494 ? 70.653  148.614 79.957  1.00 36.42 ? 494  ASN B ND2   1 
ATOM   8718  N  N     . MET B 1 495 ? 71.165  143.197 79.827  1.00 22.10 ? 495  MET B N     1 
ATOM   8719  C  CA    . MET B 1 495 ? 72.005  142.016 79.696  1.00 22.25 ? 495  MET B CA    1 
ATOM   8720  C  C     . MET B 1 495 ? 71.259  140.737 80.028  1.00 22.64 ? 495  MET B C     1 
ATOM   8721  O  O     . MET B 1 495 ? 70.303  140.736 80.811  1.00 22.49 ? 495  MET B O     1 
ATOM   8722  C  CB    . MET B 1 495 ? 73.222  142.115 80.623  1.00 22.31 ? 495  MET B CB    1 
ATOM   8723  C  CG    . MET B 1 495 ? 74.104  143.336 80.416  1.00 24.44 ? 495  MET B CG    1 
ATOM   8724  S  SD    . MET B 1 495 ? 75.515  143.339 81.553  1.00 29.02 ? 495  MET B SD    1 
ATOM   8725  C  CE    . MET B 1 495 ? 75.130  144.726 82.655  1.00 28.46 ? 495  MET B CE    1 
ATOM   8726  N  N     . TYR B 1 496 ? 71.706  139.645 79.420  1.00 20.92 ? 496  TYR B N     1 
ATOM   8727  C  CA    . TYR B 1 496 ? 71.125  138.338 79.672  1.00 20.84 ? 496  TYR B CA    1 
ATOM   8728  C  C     . TYR B 1 496 ? 71.906  137.729 80.834  1.00 21.09 ? 496  TYR B C     1 
ATOM   8729  O  O     . TYR B 1 496 ? 73.120  137.541 80.732  1.00 21.08 ? 496  TYR B O     1 
ATOM   8730  C  CB    . TYR B 1 496 ? 71.282  137.437 78.445  1.00 21.24 ? 496  TYR B CB    1 
ATOM   8731  C  CG    . TYR B 1 496 ? 70.941  135.995 78.727  1.00 21.49 ? 496  TYR B CG    1 
ATOM   8732  C  CD1   . TYR B 1 496 ? 69.611  135.584 78.838  1.00 22.33 ? 496  TYR B CD1   1 
ATOM   8733  C  CD2   . TYR B 1 496 ? 71.951  135.052 78.946  1.00 21.38 ? 496  TYR B CD2   1 
ATOM   8734  C  CE1   . TYR B 1 496 ? 69.287  134.273 79.161  1.00 22.04 ? 496  TYR B CE1   1 
ATOM   8735  C  CE2   . TYR B 1 496 ? 71.645  133.735 79.274  1.00 21.68 ? 496  TYR B CE2   1 
ATOM   8736  C  CZ    . TYR B 1 496 ? 70.307  133.350 79.380  1.00 24.34 ? 496  TYR B CZ    1 
ATOM   8737  O  OH    . TYR B 1 496 ? 69.987  132.050 79.706  1.00 23.33 ? 496  TYR B OH    1 
ATOM   8738  N  N     . PHE B 1 497 ? 71.229  137.432 81.937  1.00 19.81 ? 497  PHE B N     1 
ATOM   8739  C  CA    . PHE B 1 497 ? 71.910  136.824 83.072  1.00 21.08 ? 497  PHE B CA    1 
ATOM   8740  C  C     . PHE B 1 497 ? 71.648  135.316 83.097  1.00 22.25 ? 497  PHE B C     1 
ATOM   8741  O  O     . PHE B 1 497 ? 70.505  134.873 83.200  1.00 21.71 ? 497  PHE B O     1 
ATOM   8742  C  CB    . PHE B 1 497 ? 71.458  137.460 84.391  1.00 19.80 ? 497  PHE B CB    1 
ATOM   8743  C  CG    . PHE B 1 497 ? 72.150  136.895 85.598  1.00 18.79 ? 497  PHE B CG    1 
ATOM   8744  C  CD1   . PHE B 1 497 ? 73.497  136.538 85.541  1.00 19.77 ? 497  PHE B CD1   1 
ATOM   8745  C  CD2   . PHE B 1 497 ? 71.461  136.717 86.791  1.00 19.57 ? 497  PHE B CD2   1 
ATOM   8746  C  CE1   . PHE B 1 497 ? 74.143  136.011 86.654  1.00 20.27 ? 497  PHE B CE1   1 
ATOM   8747  C  CE2   . PHE B 1 497 ? 72.100  136.191 87.913  1.00 20.52 ? 497  PHE B CE2   1 
ATOM   8748  C  CZ    . PHE B 1 497 ? 73.441  135.838 87.844  1.00 20.73 ? 497  PHE B CZ    1 
ATOM   8749  N  N     . SER B 1 498 ? 72.723  134.539 83.003  1.00 21.22 ? 498  SER B N     1 
ATOM   8750  C  CA    . SER B 1 498 ? 72.645  133.086 82.986  1.00 20.67 ? 498  SER B CA    1 
ATOM   8751  C  C     . SER B 1 498 ? 72.420  132.447 84.350  1.00 20.68 ? 498  SER B C     1 
ATOM   8752  O  O     . SER B 1 498 ? 72.009  131.294 84.430  1.00 22.65 ? 498  SER B O     1 
ATOM   8753  C  CB    . SER B 1 498 ? 73.925  132.506 82.376  1.00 20.48 ? 498  SER B CB    1 
ATOM   8754  O  OG    . SER B 1 498 ? 75.053  132.790 83.191  1.00 17.35 ? 498  SER B OG    1 
ATOM   8755  N  N     . GLY B 1 499 ? 72.687  133.184 85.420  1.00 19.64 ? 499  GLY B N     1 
ATOM   8756  C  CA    . GLY B 1 499 ? 72.513  132.616 86.742  1.00 19.13 ? 499  GLY B CA    1 
ATOM   8757  C  C     . GLY B 1 499 ? 73.738  131.812 87.152  1.00 18.91 ? 499  GLY B C     1 
ATOM   8758  O  O     . GLY B 1 499 ? 73.725  131.127 88.172  1.00 19.99 ? 499  GLY B O     1 
ATOM   8759  N  N     . ASP B 1 500 ? 74.789  131.889 86.338  1.00 18.41 ? 500  ASP B N     1 
ATOM   8760  C  CA    . ASP B 1 500 ? 76.051  131.196 86.600  1.00 17.64 ? 500  ASP B CA    1 
ATOM   8761  C  C     . ASP B 1 500 ? 77.125  132.202 86.964  1.00 17.60 ? 500  ASP B C     1 
ATOM   8762  O  O     . ASP B 1 500 ? 77.103  133.334 86.490  1.00 19.54 ? 500  ASP B O     1 
ATOM   8763  C  CB    . ASP B 1 500 ? 76.557  130.453 85.361  1.00 16.49 ? 500  ASP B CB    1 
ATOM   8764  C  CG    . ASP B 1 500 ? 75.907  129.113 85.174  1.00 18.63 ? 500  ASP B CG    1 
ATOM   8765  O  OD1   . ASP B 1 500 ? 75.825  128.349 86.158  1.00 17.27 ? 500  ASP B OD1   1 
ATOM   8766  O  OD2   . ASP B 1 500 ? 75.495  128.825 84.036  1.00 17.72 ? 500  ASP B OD2   1 
ATOM   8767  N  N     . GLY B 1 501 ? 78.067  131.777 87.796  1.00 17.50 ? 501  GLY B N     1 
ATOM   8768  C  CA    . GLY B 1 501 ? 79.173  132.635 88.166  1.00 16.52 ? 501  GLY B CA    1 
ATOM   8769  C  C     . GLY B 1 501 ? 80.352  132.068 87.397  1.00 17.28 ? 501  GLY B C     1 
ATOM   8770  O  O     . GLY B 1 501 ? 80.285  130.934 86.920  1.00 16.63 ? 501  GLY B O     1 
ATOM   8771  N  N     . ALA B 1 502 ? 81.428  132.833 87.262  1.00 17.04 ? 502  ALA B N     1 
ATOM   8772  C  CA    . ALA B 1 502 ? 82.591  132.344 86.530  1.00 17.83 ? 502  ALA B CA    1 
ATOM   8773  C  C     . ALA B 1 502 ? 83.792  133.248 86.697  1.00 18.50 ? 502  ALA B C     1 
ATOM   8774  O  O     . ALA B 1 502 ? 83.674  134.360 87.199  1.00 20.04 ? 502  ALA B O     1 
ATOM   8775  C  CB    . ALA B 1 502 ? 82.253  132.225 85.052  1.00 15.21 ? 502  ALA B CB    1 
ATOM   8776  N  N     . ARG B 1 503 ? 84.949  132.751 86.283  1.00 20.03 ? 503  ARG B N     1 
ATOM   8777  C  CA    . ARG B 1 503 ? 86.167  133.535 86.324  1.00 23.71 ? 503  ARG B CA    1 
ATOM   8778  C  C     . ARG B 1 503 ? 86.811  133.473 84.940  1.00 23.62 ? 503  ARG B C     1 
ATOM   8779  O  O     . ARG B 1 503 ? 86.508  132.590 84.133  1.00 22.61 ? 503  ARG B O     1 
ATOM   8780  C  CB    . ARG B 1 503 ? 87.144  133.034 87.410  1.00 26.78 ? 503  ARG B CB    1 
ATOM   8781  C  CG    . ARG B 1 503 ? 87.801  131.685 87.181  1.00 30.28 ? 503  ARG B CG    1 
ATOM   8782  C  CD    . ARG B 1 503 ? 88.915  131.424 88.226  1.00 32.88 ? 503  ARG B CD    1 
ATOM   8783  N  NE    . ARG B 1 503 ? 89.441  130.060 88.135  1.00 34.95 ? 503  ARG B NE    1 
ATOM   8784  C  CZ    . ARG B 1 503 ? 88.740  128.964 88.435  1.00 35.46 ? 503  ARG B CZ    1 
ATOM   8785  N  NH1   . ARG B 1 503 ? 87.484  129.071 88.853  1.00 31.79 ? 503  ARG B NH1   1 
ATOM   8786  N  NH2   . ARG B 1 503 ? 89.288  127.759 88.304  1.00 35.98 ? 503  ARG B NH2   1 
ATOM   8787  N  N     . ARG B 1 504 ? 87.684  134.431 84.670  1.00 23.43 ? 504  ARG B N     1 
ATOM   8788  C  CA    . ARG B 1 504 ? 88.375  134.510 83.396  1.00 24.47 ? 504  ARG B CA    1 
ATOM   8789  C  C     . ARG B 1 504 ? 89.837  134.740 83.721  1.00 24.47 ? 504  ARG B C     1 
ATOM   8790  O  O     . ARG B 1 504 ? 90.151  135.620 84.515  1.00 27.22 ? 504  ARG B O     1 
ATOM   8791  C  CB    . ARG B 1 504 ? 87.820  135.686 82.591  1.00 24.05 ? 504  ARG B CB    1 
ATOM   8792  C  CG    . ARG B 1 504 ? 88.420  135.882 81.206  1.00 25.19 ? 504  ARG B CG    1 
ATOM   8793  C  CD    . ARG B 1 504 ? 87.728  137.035 80.496  1.00 23.22 ? 504  ARG B CD    1 
ATOM   8794  N  NE    . ARG B 1 504 ? 87.881  138.283 81.238  1.00 22.55 ? 504  ARG B NE    1 
ATOM   8795  C  CZ    . ARG B 1 504 ? 86.900  139.157 81.452  1.00 20.53 ? 504  ARG B CZ    1 
ATOM   8796  N  NH1   . ARG B 1 504 ? 85.683  138.927 80.980  1.00 20.00 ? 504  ARG B NH1   1 
ATOM   8797  N  NH2   . ARG B 1 504 ? 87.135  140.258 82.154  1.00 17.53 ? 504  ARG B NH2   1 
ATOM   8798  N  N     . ASP B 1 505 ? 90.731  133.951 83.133  1.00 24.43 ? 505  ASP B N     1 
ATOM   8799  C  CA    . ASP B 1 505 ? 92.151  134.122 83.406  1.00 23.10 ? 505  ASP B CA    1 
ATOM   8800  C  C     . ASP B 1 505 ? 92.807  135.128 82.465  1.00 24.50 ? 505  ASP B C     1 
ATOM   8801  O  O     . ASP B 1 505 ? 92.145  135.721 81.595  1.00 23.26 ? 505  ASP B O     1 
ATOM   8802  C  CB    . ASP B 1 505 ? 92.894  132.781 83.341  1.00 21.27 ? 505  ASP B CB    1 
ATOM   8803  C  CG    . ASP B 1 505 ? 92.715  132.062 82.014  1.00 20.49 ? 505  ASP B CG    1 
ATOM   8804  O  OD1   . ASP B 1 505 ? 92.625  132.732 80.970  1.00 18.34 ? 505  ASP B OD1   1 
ATOM   8805  O  OD2   . ASP B 1 505 ? 92.690  130.810 82.014  1.00 22.24 ? 505  ASP B OD2   1 
ATOM   8806  N  N     . GLU B 1 506 ? 94.112  135.314 82.649  1.00 25.07 ? 506  GLU B N     1 
ATOM   8807  C  CA    . GLU B 1 506 ? 94.898  136.251 81.848  1.00 25.96 ? 506  GLU B CA    1 
ATOM   8808  C  C     . GLU B 1 506 ? 94.766  136.043 80.340  1.00 26.71 ? 506  GLU B C     1 
ATOM   8809  O  O     . GLU B 1 506 ? 94.866  137.002 79.565  1.00 26.19 ? 506  GLU B O     1 
ATOM   8810  C  CB    . GLU B 1 506 ? 96.368  136.176 82.258  1.00 25.00 ? 506  GLU B CB    1 
ATOM   8811  N  N     . ASP B 1 507 ? 94.541  134.796 79.925  1.00 26.15 ? 507  ASP B N     1 
ATOM   8812  C  CA    . ASP B 1 507 ? 94.405  134.479 78.504  1.00 25.89 ? 507  ASP B CA    1 
ATOM   8813  C  C     . ASP B 1 507 ? 93.001  134.678 77.963  1.00 24.87 ? 507  ASP B C     1 
ATOM   8814  O  O     . ASP B 1 507 ? 92.773  134.531 76.765  1.00 25.03 ? 507  ASP B O     1 
ATOM   8815  C  CB    . ASP B 1 507 ? 94.831  133.038 78.226  1.00 29.19 ? 507  ASP B CB    1 
ATOM   8816  C  CG    . ASP B 1 507 ? 96.310  132.803 78.481  1.00 31.78 ? 507  ASP B CG    1 
ATOM   8817  O  OD1   . ASP B 1 507 ? 97.135  133.635 78.042  1.00 31.97 ? 507  ASP B OD1   1 
ATOM   8818  O  OD2   . ASP B 1 507 ? 96.643  131.778 79.113  1.00 34.06 ? 507  ASP B OD2   1 
ATOM   8819  N  N     . GLY B 1 508 ? 92.055  134.995 78.837  1.00 25.04 ? 508  GLY B N     1 
ATOM   8820  C  CA    . GLY B 1 508 ? 90.690  135.199 78.378  1.00 25.52 ? 508  GLY B CA    1 
ATOM   8821  C  C     . GLY B 1 508 ? 89.805  133.968 78.477  1.00 24.91 ? 508  GLY B C     1 
ATOM   8822  O  O     . GLY B 1 508 ? 88.630  134.020 78.129  1.00 25.75 ? 508  GLY B O     1 
ATOM   8823  N  N     . TYR B 1 509 ? 90.373  132.859 78.943  1.00 24.20 ? 509  TYR B N     1 
ATOM   8824  C  CA    . TYR B 1 509 ? 89.632  131.615 79.105  1.00 22.80 ? 509  TYR B CA    1 
ATOM   8825  C  C     . TYR B 1 509 ? 88.636  131.740 80.245  1.00 22.30 ? 509  TYR B C     1 
ATOM   8826  O  O     . TYR B 1 509 ? 88.981  132.226 81.327  1.00 22.70 ? 509  TYR B O     1 
ATOM   8827  C  CB    . TYR B 1 509 ? 90.586  130.465 79.419  1.00 22.18 ? 509  TYR B CB    1 
ATOM   8828  C  CG    . TYR B 1 509 ? 91.314  129.914 78.218  1.00 23.20 ? 509  TYR B CG    1 
ATOM   8829  C  CD1   . TYR B 1 509 ? 91.972  130.763 77.328  1.00 22.48 ? 509  TYR B CD1   1 
ATOM   8830  C  CD2   . TYR B 1 509 ? 91.378  128.536 77.990  1.00 23.40 ? 509  TYR B CD2   1 
ATOM   8831  C  CE1   . TYR B 1 509 ? 92.680  130.254 76.245  1.00 23.11 ? 509  TYR B CE1   1 
ATOM   8832  C  CE2   . TYR B 1 509 ? 92.084  128.017 76.909  1.00 22.77 ? 509  TYR B CE2   1 
ATOM   8833  C  CZ    . TYR B 1 509 ? 92.733  128.882 76.044  1.00 23.40 ? 509  TYR B CZ    1 
ATOM   8834  O  OH    . TYR B 1 509 ? 93.458  128.374 74.993  1.00 23.16 ? 509  TYR B OH    1 
ATOM   8835  N  N     . TYR B 1 510 ? 87.404  131.302 80.010  1.00 20.66 ? 510  TYR B N     1 
ATOM   8836  C  CA    . TYR B 1 510 ? 86.394  131.367 81.051  1.00 20.13 ? 510  TYR B CA    1 
ATOM   8837  C  C     . TYR B 1 510 ? 86.346  130.071 81.846  1.00 20.62 ? 510  TYR B C     1 
ATOM   8838  O  O     . TYR B 1 510 ? 86.619  128.992 81.317  1.00 21.77 ? 510  TYR B O     1 
ATOM   8839  C  CB    . TYR B 1 510 ? 85.015  131.684 80.462  1.00 19.24 ? 510  TYR B CB    1 
ATOM   8840  C  CG    . TYR B 1 510 ? 84.871  133.121 79.998  1.00 18.73 ? 510  TYR B CG    1 
ATOM   8841  C  CD1   . TYR B 1 510 ? 85.395  133.538 78.773  1.00 18.07 ? 510  TYR B CD1   1 
ATOM   8842  C  CD2   . TYR B 1 510 ? 84.231  134.068 80.797  1.00 18.35 ? 510  TYR B CD2   1 
ATOM   8843  C  CE1   . TYR B 1 510 ? 85.284  134.867 78.355  1.00 20.15 ? 510  TYR B CE1   1 
ATOM   8844  C  CE2   . TYR B 1 510 ? 84.116  135.396 80.391  1.00 21.49 ? 510  TYR B CE2   1 
ATOM   8845  C  CZ    . TYR B 1 510 ? 84.644  135.788 79.169  1.00 21.48 ? 510  TYR B CZ    1 
ATOM   8846  O  OH    . TYR B 1 510 ? 84.530  137.095 78.761  1.00 24.17 ? 510  TYR B OH    1 
ATOM   8847  N  N     . TRP B 1 511 ? 86.021  130.198 83.128  1.00 20.80 ? 511  TRP B N     1 
ATOM   8848  C  CA    . TRP B 1 511 ? 85.933  129.048 84.021  1.00 21.20 ? 511  TRP B CA    1 
ATOM   8849  C  C     . TRP B 1 511 ? 84.622  129.132 84.784  1.00 21.60 ? 511  TRP B C     1 
ATOM   8850  O  O     . TRP B 1 511 ? 84.472  129.962 85.677  1.00 21.41 ? 511  TRP B O     1 
ATOM   8851  C  CB    . TRP B 1 511 ? 87.100  129.039 85.018  1.00 19.62 ? 511  TRP B CB    1 
ATOM   8852  C  CG    . TRP B 1 511 ? 88.467  128.976 84.392  1.00 20.18 ? 511  TRP B CG    1 
ATOM   8853  C  CD1   . TRP B 1 511 ? 89.123  129.985 83.741  1.00 20.66 ? 511  TRP B CD1   1 
ATOM   8854  C  CD2   . TRP B 1 511 ? 89.350  127.850 84.376  1.00 19.95 ? 511  TRP B CD2   1 
ATOM   8855  N  NE1   . TRP B 1 511 ? 90.359  129.557 83.323  1.00 18.79 ? 511  TRP B NE1   1 
ATOM   8856  C  CE2   . TRP B 1 511 ? 90.526  128.250 83.699  1.00 19.79 ? 511  TRP B CE2   1 
ATOM   8857  C  CE3   . TRP B 1 511 ? 89.265  126.540 84.867  1.00 19.71 ? 511  TRP B CE3   1 
ATOM   8858  C  CZ2   . TRP B 1 511 ? 91.610  127.387 83.503  1.00 19.61 ? 511  TRP B CZ2   1 
ATOM   8859  C  CZ3   . TRP B 1 511 ? 90.347  125.680 84.670  1.00 20.86 ? 511  TRP B CZ3   1 
ATOM   8860  C  CH2   . TRP B 1 511 ? 91.502  126.110 83.994  1.00 20.22 ? 511  TRP B CH2   1 
ATOM   8861  N  N     . ILE B 1 512 ? 83.674  128.274 84.426  1.00 21.79 ? 512  ILE B N     1 
ATOM   8862  C  CA    . ILE B 1 512 ? 82.369  128.250 85.075  1.00 23.72 ? 512  ILE B CA    1 
ATOM   8863  C  C     . ILE B 1 512 ? 82.492  127.698 86.493  1.00 25.01 ? 512  ILE B C     1 
ATOM   8864  O  O     . ILE B 1 512 ? 82.957  126.578 86.688  1.00 27.21 ? 512  ILE B O     1 
ATOM   8865  C  CB    . ILE B 1 512 ? 81.375  127.369 84.283  1.00 22.70 ? 512  ILE B CB    1 
ATOM   8866  C  CG1   . ILE B 1 512 ? 81.433  127.726 82.792  1.00 19.82 ? 512  ILE B CG1   1 
ATOM   8867  C  CG2   . ILE B 1 512 ? 79.962  127.556 84.828  1.00 21.65 ? 512  ILE B CG2   1 
ATOM   8868  C  CD1   . ILE B 1 512 ? 81.137  129.181 82.486  1.00 14.57 ? 512  ILE B CD1   1 
ATOM   8869  N  N     . THR B 1 513 ? 82.072  128.481 87.480  1.00 25.54 ? 513  THR B N     1 
ATOM   8870  C  CA    . THR B 1 513 ? 82.160  128.044 88.866  1.00 26.07 ? 513  THR B CA    1 
ATOM   8871  C  C     . THR B 1 513 ? 80.822  127.551 89.418  1.00 26.15 ? 513  THR B C     1 
ATOM   8872  O  O     . THR B 1 513 ? 80.716  127.202 90.596  1.00 27.41 ? 513  THR B O     1 
ATOM   8873  C  CB    . THR B 1 513 ? 82.710  129.174 89.773  1.00 26.69 ? 513  THR B CB    1 
ATOM   8874  O  OG1   . THR B 1 513 ? 81.863  130.327 89.681  1.00 27.54 ? 513  THR B OG1   1 
ATOM   8875  C  CG2   . THR B 1 513 ? 84.124  129.554 89.344  1.00 27.05 ? 513  THR B CG2   1 
ATOM   8876  N  N     . GLY B 1 514 ? 79.800  127.521 88.571  1.00 23.76 ? 514  GLY B N     1 
ATOM   8877  C  CA    . GLY B 1 514 ? 78.509  127.041 89.027  1.00 22.51 ? 514  GLY B CA    1 
ATOM   8878  C  C     . GLY B 1 514 ? 77.468  128.116 89.239  1.00 22.25 ? 514  GLY B C     1 
ATOM   8879  O  O     . GLY B 1 514 ? 77.771  129.307 89.197  1.00 23.73 ? 514  GLY B O     1 
ATOM   8880  N  N     . ARG B 1 515 ? 76.234  127.677 89.475  1.00 21.11 ? 515  ARG B N     1 
ATOM   8881  C  CA    . ARG B 1 515 ? 75.104  128.574 89.691  1.00 20.79 ? 515  ARG B CA    1 
ATOM   8882  C  C     . ARG B 1 515 ? 75.281  129.471 90.911  1.00 20.92 ? 515  ARG B C     1 
ATOM   8883  O  O     . ARG B 1 515 ? 75.750  129.027 91.960  1.00 20.55 ? 515  ARG B O     1 
ATOM   8884  C  CB    . ARG B 1 515 ? 73.810  127.765 89.856  1.00 19.42 ? 515  ARG B CB    1 
ATOM   8885  C  CG    . ARG B 1 515 ? 73.472  126.834 88.698  1.00 19.22 ? 515  ARG B CG    1 
ATOM   8886  C  CD    . ARG B 1 515 ? 73.086  127.574 87.423  1.00 18.36 ? 515  ARG B CD    1 
ATOM   8887  N  NE    . ARG B 1 515 ? 71.856  128.352 87.564  1.00 16.09 ? 515  ARG B NE    1 
ATOM   8888  C  CZ    . ARG B 1 515 ? 71.037  128.630 86.550  1.00 18.86 ? 515  ARG B CZ    1 
ATOM   8889  N  NH1   . ARG B 1 515 ? 71.314  128.187 85.328  1.00 16.35 ? 515  ARG B NH1   1 
ATOM   8890  N  NH2   . ARG B 1 515 ? 69.945  129.359 86.748  1.00 17.98 ? 515  ARG B NH2   1 
ATOM   8891  N  N     . VAL B 1 516 ? 74.895  130.735 90.768  1.00 20.61 ? 516  VAL B N     1 
ATOM   8892  C  CA    . VAL B 1 516 ? 74.985  131.691 91.864  1.00 20.58 ? 516  VAL B CA    1 
ATOM   8893  C  C     . VAL B 1 516 ? 73.581  131.904 92.429  1.00 21.08 ? 516  VAL B C     1 
ATOM   8894  O  O     . VAL B 1 516 ? 73.394  132.577 93.445  1.00 21.16 ? 516  VAL B O     1 
ATOM   8895  C  CB    . VAL B 1 516 ? 75.599  133.042 91.401  1.00 20.10 ? 516  VAL B CB    1 
ATOM   8896  C  CG1   . VAL B 1 516 ? 77.037  132.820 90.954  1.00 19.81 ? 516  VAL B CG1   1 
ATOM   8897  C  CG2   . VAL B 1 516 ? 74.779  133.647 90.271  1.00 17.62 ? 516  VAL B CG2   1 
ATOM   8898  N  N     . ASP B 1 517 ? 72.587  131.327 91.760  1.00 20.55 ? 517  ASP B N     1 
ATOM   8899  C  CA    . ASP B 1 517 ? 71.220  131.427 92.244  1.00 21.22 ? 517  ASP B CA    1 
ATOM   8900  C  C     . ASP B 1 517 ? 70.943  130.120 92.978  1.00 22.32 ? 517  ASP B C     1 
ATOM   8901  O  O     . ASP B 1 517 ? 71.884  129.402 93.331  1.00 23.08 ? 517  ASP B O     1 
ATOM   8902  C  CB    . ASP B 1 517 ? 70.224  131.675 91.093  1.00 20.18 ? 517  ASP B CB    1 
ATOM   8903  C  CG    . ASP B 1 517 ? 70.362  130.686 89.955  1.00 19.66 ? 517  ASP B CG    1 
ATOM   8904  O  OD1   . ASP B 1 517 ? 69.625  130.850 88.962  1.00 20.03 ? 517  ASP B OD1   1 
ATOM   8905  O  OD2   . ASP B 1 517 ? 71.187  129.754 90.035  1.00 23.29 ? 517  ASP B OD2   1 
ATOM   8906  N  N     . ASP B 1 518 ? 69.681  129.792 93.214  1.00 22.15 ? 518  ASP B N     1 
ATOM   8907  C  CA    . ASP B 1 518 ? 69.391  128.572 93.957  1.00 23.70 ? 518  ASP B CA    1 
ATOM   8908  C  C     . ASP B 1 518 ? 69.016  127.393 93.077  1.00 24.50 ? 518  ASP B C     1 
ATOM   8909  O  O     . ASP B 1 518 ? 67.992  126.745 93.274  1.00 25.85 ? 518  ASP B O     1 
ATOM   8910  C  CB    . ASP B 1 518 ? 68.311  128.868 94.991  1.00 22.24 ? 518  ASP B CB    1 
ATOM   8911  C  CG    . ASP B 1 518 ? 68.718  129.991 95.919  1.00 24.39 ? 518  ASP B CG    1 
ATOM   8912  O  OD1   . ASP B 1 518 ? 69.775  129.857 96.570  1.00 24.62 ? 518  ASP B OD1   1 
ATOM   8913  O  OD2   . ASP B 1 518 ? 68.005  131.014 95.983  1.00 25.38 ? 518  ASP B OD2   1 
ATOM   8914  N  N     . VAL B 1 519 ? 69.871  127.130 92.097  1.00 25.24 ? 519  VAL B N     1 
ATOM   8915  C  CA    . VAL B 1 519 ? 69.676  126.042 91.159  1.00 23.84 ? 519  VAL B CA    1 
ATOM   8916  C  C     . VAL B 1 519 ? 70.755  125.007 91.429  1.00 25.39 ? 519  VAL B C     1 
ATOM   8917  O  O     . VAL B 1 519 ? 71.951  125.311 91.396  1.00 26.12 ? 519  VAL B O     1 
ATOM   8918  C  CB    . VAL B 1 519 ? 69.782  126.558 89.710  1.00 22.99 ? 519  VAL B CB    1 
ATOM   8919  C  CG1   . VAL B 1 519 ? 69.671  125.412 88.724  1.00 20.63 ? 519  VAL B CG1   1 
ATOM   8920  C  CG2   . VAL B 1 519 ? 68.688  127.582 89.459  1.00 23.46 ? 519  VAL B CG2   1 
ATOM   8921  N  N     . LEU B 1 520 ? 70.326  123.785 91.715  1.00 25.70 ? 520  LEU B N     1 
ATOM   8922  C  CA    . LEU B 1 520 ? 71.247  122.694 92.004  1.00 26.07 ? 520  LEU B CA    1 
ATOM   8923  C  C     . LEU B 1 520 ? 71.671  121.967 90.735  1.00 25.48 ? 520  LEU B C     1 
ATOM   8924  O  O     . LEU B 1 520 ? 71.035  122.086 89.690  1.00 24.24 ? 520  LEU B O     1 
ATOM   8925  C  CB    . LEU B 1 520 ? 70.587  121.701 92.963  1.00 26.66 ? 520  LEU B CB    1 
ATOM   8926  C  CG    . LEU B 1 520 ? 70.057  122.293 94.269  1.00 27.83 ? 520  LEU B CG    1 
ATOM   8927  C  CD1   . LEU B 1 520 ? 69.282  121.239 95.031  1.00 27.87 ? 520  LEU B CD1   1 
ATOM   8928  C  CD2   . LEU B 1 520 ? 71.220  122.832 95.097  1.00 27.84 ? 520  LEU B CD2   1 
ATOM   8929  N  N     . ASN B 1 521 ? 72.754  121.209 90.837  1.00 26.25 ? 521  ASN B N     1 
ATOM   8930  C  CA    . ASN B 1 521 ? 73.255  120.447 89.706  1.00 27.49 ? 521  ASN B CA    1 
ATOM   8931  C  C     . ASN B 1 521 ? 73.498  119.023 90.188  1.00 27.20 ? 521  ASN B C     1 
ATOM   8932  O  O     . ASN B 1 521 ? 74.622  118.651 90.543  1.00 27.30 ? 521  ASN B O     1 
ATOM   8933  C  CB    . ASN B 1 521 ? 74.557  121.047 89.189  1.00 29.79 ? 521  ASN B CB    1 
ATOM   8934  C  CG    . ASN B 1 521 ? 74.927  120.515 87.825  1.00 32.60 ? 521  ASN B CG    1 
ATOM   8935  O  OD1   . ASN B 1 521 ? 74.810  121.220 86.816  1.00 34.78 ? 521  ASN B OD1   1 
ATOM   8936  N  ND2   . ASN B 1 521 ? 75.357  119.250 87.780  1.00 33.14 ? 521  ASN B ND2   1 
ATOM   8937  N  N     . VAL B 1 522 ? 72.431  118.232 90.202  1.00 26.31 ? 522  VAL B N     1 
ATOM   8938  C  CA    . VAL B 1 522 ? 72.508  116.857 90.669  1.00 25.43 ? 522  VAL B CA    1 
ATOM   8939  C  C     . VAL B 1 522 ? 72.655  115.858 89.528  1.00 25.79 ? 522  VAL B C     1 
ATOM   8940  O  O     . VAL B 1 522 ? 71.717  115.632 88.762  1.00 25.47 ? 522  VAL B O     1 
ATOM   8941  C  CB    . VAL B 1 522 ? 71.255  116.491 91.489  1.00 24.83 ? 522  VAL B CB    1 
ATOM   8942  C  CG1   . VAL B 1 522 ? 71.438  115.125 92.140  1.00 24.22 ? 522  VAL B CG1   1 
ATOM   8943  C  CG2   . VAL B 1 522 ? 70.989  117.563 92.534  1.00 24.30 ? 522  VAL B CG2   1 
ATOM   8944  N  N     . SER B 1 523 ? 73.843  115.266 89.427  1.00 25.93 ? 523  SER B N     1 
ATOM   8945  C  CA    . SER B 1 523 ? 74.142  114.279 88.396  1.00 27.00 ? 523  SER B CA    1 
ATOM   8946  C  C     . SER B 1 523 ? 73.958  114.847 86.998  1.00 27.08 ? 523  SER B C     1 
ATOM   8947  O  O     . SER B 1 523 ? 73.497  114.153 86.095  1.00 28.10 ? 523  SER B O     1 
ATOM   8948  C  CB    . SER B 1 523 ? 73.247  113.050 88.572  1.00 27.46 ? 523  SER B CB    1 
ATOM   8949  O  OG    . SER B 1 523 ? 73.503  112.417 89.812  1.00 30.85 ? 523  SER B OG    1 
ATOM   8950  N  N     . GLY B 1 524 ? 74.322  116.113 86.824  1.00 27.32 ? 524  GLY B N     1 
ATOM   8951  C  CA    . GLY B 1 524 ? 74.181  116.751 85.529  1.00 25.86 ? 524  GLY B CA    1 
ATOM   8952  C  C     . GLY B 1 524 ? 72.754  117.192 85.264  1.00 25.71 ? 524  GLY B C     1 
ATOM   8953  O  O     . GLY B 1 524 ? 72.402  117.518 84.135  1.00 24.84 ? 524  GLY B O     1 
ATOM   8954  N  N     . HIS B 1 525 ? 71.931  117.203 86.307  1.00 26.34 ? 525  HIS B N     1 
ATOM   8955  C  CA    . HIS B 1 525 ? 70.534  117.609 86.175  1.00 27.84 ? 525  HIS B CA    1 
ATOM   8956  C  C     . HIS B 1 525 ? 70.227  118.899 86.928  1.00 26.84 ? 525  HIS B C     1 
ATOM   8957  O  O     . HIS B 1 525 ? 70.458  119.009 88.133  1.00 27.35 ? 525  HIS B O     1 
ATOM   8958  C  CB    . HIS B 1 525 ? 69.610  116.498 86.677  1.00 31.03 ? 525  HIS B CB    1 
ATOM   8959  C  CG    . HIS B 1 525 ? 69.745  115.215 85.921  1.00 34.26 ? 525  HIS B CG    1 
ATOM   8960  N  ND1   . HIS B 1 525 ? 70.053  114.020 86.533  1.00 35.95 ? 525  HIS B ND1   1 
ATOM   8961  C  CD2   . HIS B 1 525 ? 69.631  114.943 84.600  1.00 35.81 ? 525  HIS B CD2   1 
ATOM   8962  C  CE1   . HIS B 1 525 ? 70.123  113.065 85.622  1.00 36.50 ? 525  HIS B CE1   1 
ATOM   8963  N  NE2   . HIS B 1 525 ? 69.871  113.599 84.440  1.00 38.07 ? 525  HIS B NE2   1 
ATOM   8964  N  N     . ARG B 1 526 ? 69.701  119.869 86.193  1.00 24.98 ? 526  ARG B N     1 
ATOM   8965  C  CA    . ARG B 1 526 ? 69.345  121.164 86.740  1.00 23.06 ? 526  ARG B CA    1 
ATOM   8966  C  C     . ARG B 1 526 ? 68.052  121.052 87.554  1.00 23.78 ? 526  ARG B C     1 
ATOM   8967  O  O     . ARG B 1 526 ? 67.004  120.664 87.030  1.00 23.90 ? 526  ARG B O     1 
ATOM   8968  C  CB    . ARG B 1 526 ? 69.187  122.143 85.581  1.00 21.21 ? 526  ARG B CB    1 
ATOM   8969  C  CG    . ARG B 1 526 ? 68.732  123.529 85.946  1.00 20.12 ? 526  ARG B CG    1 
ATOM   8970  C  CD    . ARG B 1 526 ? 68.812  124.405 84.708  1.00 20.27 ? 526  ARG B CD    1 
ATOM   8971  N  NE    . ARG B 1 526 ? 68.151  125.692 84.875  1.00 18.11 ? 526  ARG B NE    1 
ATOM   8972  C  CZ    . ARG B 1 526 ? 68.180  126.657 83.964  1.00 19.58 ? 526  ARG B CZ    1 
ATOM   8973  N  NH1   . ARG B 1 526 ? 68.843  126.477 82.827  1.00 17.56 ? 526  ARG B NH1   1 
ATOM   8974  N  NH2   . ARG B 1 526 ? 67.545  127.798 84.189  1.00 17.64 ? 526  ARG B NH2   1 
ATOM   8975  N  N     . LEU B 1 527 ? 68.138  121.381 88.840  1.00 23.44 ? 527  LEU B N     1 
ATOM   8976  C  CA    . LEU B 1 527 ? 66.985  121.309 89.738  1.00 23.43 ? 527  LEU B CA    1 
ATOM   8977  C  C     . LEU B 1 527 ? 66.760  122.592 90.524  1.00 24.61 ? 527  LEU B C     1 
ATOM   8978  O  O     . LEU B 1 527 ? 67.710  123.282 90.901  1.00 24.66 ? 527  LEU B O     1 
ATOM   8979  C  CB    . LEU B 1 527 ? 67.151  120.157 90.732  1.00 24.81 ? 527  LEU B CB    1 
ATOM   8980  C  CG    . LEU B 1 527 ? 66.967  118.734 90.205  1.00 25.34 ? 527  LEU B CG    1 
ATOM   8981  C  CD1   . LEU B 1 527 ? 67.294  117.733 91.312  1.00 26.60 ? 527  LEU B CD1   1 
ATOM   8982  C  CD2   . LEU B 1 527 ? 65.540  118.555 89.707  1.00 21.36 ? 527  LEU B CD2   1 
ATOM   8983  N  N     . GLY B 1 528 ? 65.492  122.895 90.785  1.00 23.69 ? 528  GLY B N     1 
ATOM   8984  C  CA    . GLY B 1 528 ? 65.161  124.086 91.538  1.00 23.56 ? 528  GLY B CA    1 
ATOM   8985  C  C     . GLY B 1 528 ? 65.154  123.804 93.025  1.00 25.03 ? 528  GLY B C     1 
ATOM   8986  O  O     . GLY B 1 528 ? 64.521  122.854 93.484  1.00 24.26 ? 528  GLY B O     1 
ATOM   8987  N  N     . THR B 1 529 ? 65.879  124.618 93.783  1.00 25.63 ? 529  THR B N     1 
ATOM   8988  C  CA    . THR B 1 529 ? 65.926  124.459 95.231  1.00 25.68 ? 529  THR B CA    1 
ATOM   8989  C  C     . THR B 1 529 ? 64.538  124.736 95.793  1.00 24.23 ? 529  THR B C     1 
ATOM   8990  O  O     . THR B 1 529 ? 64.060  124.029 96.681  1.00 23.25 ? 529  THR B O     1 
ATOM   8991  C  CB    . THR B 1 529 ? 66.926  125.438 95.861  1.00 27.08 ? 529  THR B CB    1 
ATOM   8992  O  OG1   . THR B 1 529 ? 68.257  125.038 95.518  1.00 31.16 ? 529  THR B OG1   1 
ATOM   8993  C  CG2   . THR B 1 529 ? 66.775  125.459 97.373  1.00 28.03 ? 529  THR B CG2   1 
ATOM   8994  N  N     . ALA B 1 530 ? 63.893  125.767 95.254  1.00 22.42 ? 530  ALA B N     1 
ATOM   8995  C  CA    . ALA B 1 530 ? 62.558  126.153 95.690  1.00 21.36 ? 530  ALA B CA    1 
ATOM   8996  C  C     . ALA B 1 530 ? 61.518  125.072 95.406  1.00 21.39 ? 530  ALA B C     1 
ATOM   8997  O  O     . ALA B 1 530 ? 60.712  124.739 96.280  1.00 21.31 ? 530  ALA B O     1 
ATOM   8998  C  CB    . ALA B 1 530 ? 62.143  127.464 95.015  1.00 19.63 ? 530  ALA B CB    1 
ATOM   8999  N  N     . GLU B 1 531 ? 61.530  124.519 94.196  1.00 21.30 ? 531  GLU B N     1 
ATOM   9000  C  CA    . GLU B 1 531 ? 60.554  123.495 93.842  1.00 20.97 ? 531  GLU B CA    1 
ATOM   9001  C  C     . GLU B 1 531 ? 60.631  122.276 94.762  1.00 19.75 ? 531  GLU B C     1 
ATOM   9002  O  O     . GLU B 1 531 ? 59.606  121.743 95.184  1.00 21.62 ? 531  GLU B O     1 
ATOM   9003  C  CB    . GLU B 1 531 ? 60.713  123.075 92.374  1.00 22.43 ? 531  GLU B CB    1 
ATOM   9004  C  CG    . GLU B 1 531 ? 62.012  122.380 92.034  1.00 25.96 ? 531  GLU B CG    1 
ATOM   9005  C  CD    . GLU B 1 531 ? 62.069  121.935 90.575  1.00 29.15 ? 531  GLU B CD    1 
ATOM   9006  O  OE1   . GLU B 1 531 ? 61.246  121.069 90.171  1.00 26.89 ? 531  GLU B OE1   1 
ATOM   9007  O  OE2   . GLU B 1 531 ? 62.933  122.458 89.833  1.00 28.35 ? 531  GLU B OE2   1 
ATOM   9008  N  N     . ILE B 1 532 ? 61.840  121.842 95.097  1.00 17.92 ? 532  ILE B N     1 
ATOM   9009  C  CA    . ILE B 1 532 ? 61.986  120.693 95.982  1.00 17.42 ? 532  ILE B CA    1 
ATOM   9010  C  C     . ILE B 1 532 ? 61.432  121.005 97.373  1.00 16.92 ? 532  ILE B C     1 
ATOM   9011  O  O     . ILE B 1 532 ? 60.834  120.142 98.008  1.00 17.67 ? 532  ILE B O     1 
ATOM   9012  C  CB    . ILE B 1 532 ? 63.459  120.246 96.084  1.00 15.37 ? 532  ILE B CB    1 
ATOM   9013  C  CG1   . ILE B 1 532 ? 63.982  119.910 94.685  1.00 15.23 ? 532  ILE B CG1   1 
ATOM   9014  C  CG2   . ILE B 1 532 ? 63.577  119.035 97.000  1.00 12.97 ? 532  ILE B CG2   1 
ATOM   9015  C  CD1   . ILE B 1 532 ? 65.429  119.467 94.635  1.00 16.65 ? 532  ILE B CD1   1 
ATOM   9016  N  N     . GLU B 1 533 ? 61.619  122.239 97.839  1.00 16.85 ? 533  GLU B N     1 
ATOM   9017  C  CA    . GLU B 1 533 ? 61.103  122.642 99.143  1.00 16.78 ? 533  GLU B CA    1 
ATOM   9018  C  C     . GLU B 1 533 ? 59.584  122.623 99.146  1.00 16.72 ? 533  GLU B C     1 
ATOM   9019  O  O     . GLU B 1 533 ? 58.973  122.122 100.088 1.00 16.46 ? 533  GLU B O     1 
ATOM   9020  C  CB    . GLU B 1 533 ? 61.606  124.036 99.506  1.00 16.25 ? 533  GLU B CB    1 
ATOM   9021  C  CG    . GLU B 1 533 ? 63.113  124.078 99.614  1.00 19.73 ? 533  GLU B CG    1 
ATOM   9022  C  CD    . GLU B 1 533 ? 63.654  125.450 99.926  1.00 18.22 ? 533  GLU B CD    1 
ATOM   9023  O  OE1   . GLU B 1 533 ? 62.965  126.452 99.636  1.00 16.75 ? 533  GLU B OE1   1 
ATOM   9024  O  OE2   . GLU B 1 533 ? 64.783  125.510 100.448 1.00 19.00 ? 533  GLU B OE2   1 
ATOM   9025  N  N     . SER B 1 534 ? 58.973  123.159 98.092  1.00 15.16 ? 534  SER B N     1 
ATOM   9026  C  CA    . SER B 1 534 ? 57.520  123.172 98.003  1.00 17.26 ? 534  SER B CA    1 
ATOM   9027  C  C     . SER B 1 534 ? 56.967  121.748 97.997  1.00 16.60 ? 534  SER B C     1 
ATOM   9028  O  O     . SER B 1 534 ? 55.928  121.479 98.594  1.00 19.13 ? 534  SER B O     1 
ATOM   9029  C  CB    . SER B 1 534 ? 57.061  123.902 96.738  1.00 16.51 ? 534  SER B CB    1 
ATOM   9030  O  OG    . SER B 1 534 ? 57.374  125.278 96.809  1.00 23.00 ? 534  SER B OG    1 
ATOM   9031  N  N     . ALA B 1 535 ? 57.654  120.839 97.313  1.00 15.68 ? 535  ALA B N     1 
ATOM   9032  C  CA    . ALA B 1 535 ? 57.215  119.449 97.255  1.00 16.39 ? 535  ALA B CA    1 
ATOM   9033  C  C     . ALA B 1 535 ? 57.248  118.858 98.659  1.00 17.27 ? 535  ALA B C     1 
ATOM   9034  O  O     . ALA B 1 535 ? 56.302  118.186 99.087  1.00 17.50 ? 535  ALA B O     1 
ATOM   9035  C  CB    . ALA B 1 535 ? 58.117  118.645 96.330  1.00 15.56 ? 535  ALA B CB    1 
ATOM   9036  N  N     . LEU B 1 536 ? 58.335  119.116 99.379  1.00 17.29 ? 536  LEU B N     1 
ATOM   9037  C  CA    . LEU B 1 536 ? 58.469  118.608 100.737 1.00 18.30 ? 536  LEU B CA    1 
ATOM   9038  C  C     . LEU B 1 536 ? 57.377  119.162 101.653 1.00 18.61 ? 536  LEU B C     1 
ATOM   9039  O  O     . LEU B 1 536 ? 56.665  118.400 102.319 1.00 18.93 ? 536  LEU B O     1 
ATOM   9040  C  CB    . LEU B 1 536 ? 59.850  118.955 101.301 1.00 16.71 ? 536  LEU B CB    1 
ATOM   9041  C  CG    . LEU B 1 536 ? 60.995  118.151 100.681 1.00 17.94 ? 536  LEU B CG    1 
ATOM   9042  C  CD1   . LEU B 1 536 ? 62.344  118.770 101.047 1.00 16.85 ? 536  LEU B CD1   1 
ATOM   9043  C  CD2   . LEU B 1 536 ? 60.895  116.707 101.170 1.00 15.53 ? 536  LEU B CD2   1 
ATOM   9044  N  N     . VAL B 1 537 ? 57.234  120.486 101.670 1.00 16.81 ? 537  VAL B N     1 
ATOM   9045  C  CA    . VAL B 1 537 ? 56.236  121.127 102.520 1.00 15.14 ? 537  VAL B CA    1 
ATOM   9046  C  C     . VAL B 1 537 ? 54.808  120.747 102.116 1.00 14.99 ? 537  VAL B C     1 
ATOM   9047  O  O     . VAL B 1 537 ? 53.865  120.940 102.886 1.00 13.05 ? 537  VAL B O     1 
ATOM   9048  C  CB    . VAL B 1 537 ? 56.403  122.673 102.502 1.00 14.90 ? 537  VAL B CB    1 
ATOM   9049  C  CG1   . VAL B 1 537 ? 55.337  123.332 103.366 1.00 12.84 ? 537  VAL B CG1   1 
ATOM   9050  C  CG2   . VAL B 1 537 ? 57.794  123.047 103.013 1.00 13.99 ? 537  VAL B CG2   1 
ATOM   9051  N  N     . ALA B 1 538 ? 54.655  120.202 100.912 1.00 14.20 ? 538  ALA B N     1 
ATOM   9052  C  CA    . ALA B 1 538 ? 53.343  119.789 100.425 1.00 16.04 ? 538  ALA B CA    1 
ATOM   9053  C  C     . ALA B 1 538 ? 52.887  118.573 101.216 1.00 17.89 ? 538  ALA B C     1 
ATOM   9054  O  O     . ALA B 1 538 ? 51.691  118.283 101.297 1.00 17.95 ? 538  ALA B O     1 
ATOM   9055  C  CB    . ALA B 1 538 ? 53.409  119.449 98.935  1.00 13.07 ? 538  ALA B CB    1 
ATOM   9056  N  N     . HIS B 1 539 ? 53.850  117.860 101.796 1.00 18.24 ? 539  HIS B N     1 
ATOM   9057  C  CA    . HIS B 1 539 ? 53.544  116.678 102.585 1.00 20.00 ? 539  HIS B CA    1 
ATOM   9058  C  C     . HIS B 1 539 ? 52.818  117.079 103.869 1.00 21.49 ? 539  HIS B C     1 
ATOM   9059  O  O     . HIS B 1 539 ? 53.238  118.004 104.562 1.00 21.99 ? 539  HIS B O     1 
ATOM   9060  C  CB    . HIS B 1 539 ? 54.826  115.913 102.920 1.00 20.05 ? 539  HIS B CB    1 
ATOM   9061  C  CG    . HIS B 1 539 ? 54.572  114.586 103.562 1.00 22.02 ? 539  HIS B CG    1 
ATOM   9062  N  ND1   . HIS B 1 539 ? 54.239  114.455 104.893 1.00 21.86 ? 539  HIS B ND1   1 
ATOM   9063  C  CD2   . HIS B 1 539 ? 54.528  113.339 103.039 1.00 21.83 ? 539  HIS B CD2   1 
ATOM   9064  C  CE1   . HIS B 1 539 ? 53.999  113.185 105.162 1.00 22.76 ? 539  HIS B CE1   1 
ATOM   9065  N  NE2   . HIS B 1 539 ? 54.166  112.486 104.053 1.00 22.83 ? 539  HIS B NE2   1 
ATOM   9066  N  N     . PRO B 1 540 ? 51.729  116.368 104.211 1.00 22.07 ? 540  PRO B N     1 
ATOM   9067  C  CA    . PRO B 1 540 ? 50.917  116.632 105.403 1.00 23.15 ? 540  PRO B CA    1 
ATOM   9068  C  C     . PRO B 1 540 ? 51.669  116.749 106.729 1.00 23.57 ? 540  PRO B C     1 
ATOM   9069  O  O     . PRO B 1 540 ? 51.274  117.528 107.595 1.00 23.68 ? 540  PRO B O     1 
ATOM   9070  C  CB    . PRO B 1 540 ? 49.929  115.461 105.420 1.00 23.83 ? 540  PRO B CB    1 
ATOM   9071  C  CG    . PRO B 1 540 ? 49.832  115.062 103.990 1.00 23.09 ? 540  PRO B CG    1 
ATOM   9072  C  CD    . PRO B 1 540 ? 51.274  115.135 103.551 1.00 21.92 ? 540  PRO B CD    1 
ATOM   9073  N  N     . LYS B 1 541 ? 52.745  115.983 106.890 1.00 23.29 ? 541  LYS B N     1 
ATOM   9074  C  CA    . LYS B 1 541 ? 53.504  115.998 108.138 1.00 24.20 ? 541  LYS B CA    1 
ATOM   9075  C  C     . LYS B 1 541 ? 54.716  116.935 108.162 1.00 23.18 ? 541  LYS B C     1 
ATOM   9076  O  O     . LYS B 1 541 ? 55.433  117.018 109.164 1.00 22.34 ? 541  LYS B O     1 
ATOM   9077  C  CB    . LYS B 1 541 ? 53.937  114.571 108.490 1.00 24.24 ? 541  LYS B CB    1 
ATOM   9078  C  CG    . LYS B 1 541 ? 52.767  113.626 108.652 1.00 28.55 ? 541  LYS B CG    1 
ATOM   9079  C  CD    . LYS B 1 541 ? 53.213  112.216 108.990 1.00 32.48 ? 541  LYS B CD    1 
ATOM   9080  C  CE    . LYS B 1 541 ? 52.011  111.311 109.248 1.00 34.28 ? 541  LYS B CE    1 
ATOM   9081  N  NZ    . LYS B 1 541 ? 52.437  109.950 109.690 1.00 36.91 ? 541  LYS B NZ    1 
ATOM   9082  N  N     . ILE B 1 542 ? 54.936  117.650 107.068 1.00 22.76 ? 542  ILE B N     1 
ATOM   9083  C  CA    . ILE B 1 542 ? 56.067  118.565 106.986 1.00 20.75 ? 542  ILE B CA    1 
ATOM   9084  C  C     . ILE B 1 542 ? 55.614  120.020 107.042 1.00 20.38 ? 542  ILE B C     1 
ATOM   9085  O  O     . ILE B 1 542 ? 54.782  120.456 106.244 1.00 19.97 ? 542  ILE B O     1 
ATOM   9086  C  CB    . ILE B 1 542 ? 56.875  118.319 105.696 1.00 20.55 ? 542  ILE B CB    1 
ATOM   9087  C  CG1   . ILE B 1 542 ? 57.604  116.973 105.812 1.00 17.87 ? 542  ILE B CG1   1 
ATOM   9088  C  CG2   . ILE B 1 542 ? 57.845  119.479 105.449 1.00 17.77 ? 542  ILE B CG2   1 
ATOM   9089  C  CD1   . ILE B 1 542 ? 58.460  116.614 104.614 1.00 17.77 ? 542  ILE B CD1   1 
ATOM   9090  N  N     . ALA B 1 543 ? 56.176  120.759 107.994 1.00 19.33 ? 543  ALA B N     1 
ATOM   9091  C  CA    . ALA B 1 543 ? 55.841  122.160 108.188 1.00 18.77 ? 543  ALA B CA    1 
ATOM   9092  C  C     . ALA B 1 543 ? 56.752  123.089 107.408 1.00 18.98 ? 543  ALA B C     1 
ATOM   9093  O  O     . ALA B 1 543 ? 56.320  124.130 106.919 1.00 18.89 ? 543  ALA B O     1 
ATOM   9094  C  CB    . ALA B 1 543 ? 55.910  122.508 109.670 1.00 19.42 ? 543  ALA B CB    1 
ATOM   9095  N  N     . GLU B 1 544 ? 58.016  122.720 107.281 1.00 19.60 ? 544  GLU B N     1 
ATOM   9096  C  CA    . GLU B 1 544 ? 58.947  123.586 106.581 1.00 20.75 ? 544  GLU B CA    1 
ATOM   9097  C  C     . GLU B 1 544 ? 60.194  122.809 106.171 1.00 19.33 ? 544  GLU B C     1 
ATOM   9098  O  O     . GLU B 1 544 ? 60.547  121.805 106.795 1.00 18.78 ? 544  GLU B O     1 
ATOM   9099  C  CB    . GLU B 1 544 ? 59.301  124.758 107.504 1.00 23.52 ? 544  GLU B CB    1 
ATOM   9100  C  CG    . GLU B 1 544 ? 59.986  125.933 106.851 1.00 29.41 ? 544  GLU B CG    1 
ATOM   9101  C  CD    . GLU B 1 544 ? 60.205  127.081 107.833 1.00 34.17 ? 544  GLU B CD    1 
ATOM   9102  O  OE1   . GLU B 1 544 ? 60.236  126.820 109.062 1.00 35.03 ? 544  GLU B OE1   1 
ATOM   9103  O  OE2   . GLU B 1 544 ? 60.357  128.238 107.375 1.00 35.07 ? 544  GLU B OE2   1 
ATOM   9104  N  N     . ALA B 1 545 ? 60.847  123.274 105.109 1.00 18.34 ? 545  ALA B N     1 
ATOM   9105  C  CA    . ALA B 1 545 ? 62.054  122.631 104.606 1.00 17.00 ? 545  ALA B CA    1 
ATOM   9106  C  C     . ALA B 1 545 ? 63.007  123.627 103.966 1.00 17.34 ? 545  ALA B C     1 
ATOM   9107  O  O     . ALA B 1 545 ? 62.595  124.671 103.459 1.00 16.60 ? 545  ALA B O     1 
ATOM   9108  C  CB    . ALA B 1 545 ? 61.692  121.554 103.591 1.00 15.11 ? 545  ALA B CB    1 
ATOM   9109  N  N     . ALA B 1 546 ? 64.288  123.288 104.001 1.00 16.59 ? 546  ALA B N     1 
ATOM   9110  C  CA    . ALA B 1 546 ? 65.330  124.110 103.407 1.00 17.62 ? 546  ALA B CA    1 
ATOM   9111  C  C     . ALA B 1 546 ? 66.267  123.130 102.713 1.00 18.36 ? 546  ALA B C     1 
ATOM   9112  O  O     . ALA B 1 546 ? 66.885  122.278 103.358 1.00 18.76 ? 546  ALA B O     1 
ATOM   9113  C  CB    . ALA B 1 546 ? 66.067  124.900 104.485 1.00 15.90 ? 546  ALA B CB    1 
ATOM   9114  N  N     . VAL B 1 547 ? 66.353  123.247 101.393 1.00 19.51 ? 547  VAL B N     1 
ATOM   9115  C  CA    . VAL B 1 547 ? 67.179  122.364 100.578 1.00 18.27 ? 547  VAL B CA    1 
ATOM   9116  C  C     . VAL B 1 547 ? 68.478  123.012 100.101 1.00 18.47 ? 547  VAL B C     1 
ATOM   9117  O  O     . VAL B 1 547 ? 68.479  124.140 99.606  1.00 18.18 ? 547  VAL B O     1 
ATOM   9118  C  CB    . VAL B 1 547 ? 66.388  121.890 99.341  1.00 16.97 ? 547  VAL B CB    1 
ATOM   9119  C  CG1   . VAL B 1 547 ? 67.251  120.998 98.468  1.00 16.44 ? 547  VAL B CG1   1 
ATOM   9120  C  CG2   . VAL B 1 547 ? 65.137  121.168 99.786  1.00 16.82 ? 547  VAL B CG2   1 
ATOM   9121  N  N     . VAL B 1 548 ? 69.585  122.292 100.261 1.00 17.60 ? 548  VAL B N     1 
ATOM   9122  C  CA    . VAL B 1 548 ? 70.883  122.775 99.823  1.00 17.53 ? 548  VAL B CA    1 
ATOM   9123  C  C     . VAL B 1 548 ? 71.605  121.647 99.101  1.00 17.91 ? 548  VAL B C     1 
ATOM   9124  O  O     . VAL B 1 548 ? 71.264  120.474 99.260  1.00 14.87 ? 548  VAL B O     1 
ATOM   9125  C  CB    . VAL B 1 548 ? 71.780  123.238 101.008 1.00 17.89 ? 548  VAL B CB    1 
ATOM   9126  C  CG1   . VAL B 1 548 ? 71.152  124.430 101.714 1.00 17.13 ? 548  VAL B CG1   1 
ATOM   9127  C  CG2   . VAL B 1 548 ? 72.002  122.088 101.979 1.00 17.60 ? 548  VAL B CG2   1 
ATOM   9128  N  N     . GLY B 1 549 ? 72.594  122.018 98.295  1.00 19.00 ? 549  GLY B N     1 
ATOM   9129  C  CA    . GLY B 1 549 ? 73.379  121.037 97.571  1.00 18.48 ? 549  GLY B CA    1 
ATOM   9130  C  C     . GLY B 1 549 ? 74.725  120.901 98.254  1.00 18.95 ? 549  GLY B C     1 
ATOM   9131  O  O     . GLY B 1 549 ? 75.281  121.894 98.724  1.00 20.90 ? 549  GLY B O     1 
ATOM   9132  N  N     . ILE B 1 550 ? 75.241  119.679 98.326  1.00 18.36 ? 550  ILE B N     1 
ATOM   9133  C  CA    . ILE B 1 550 ? 76.531  119.429 98.958  1.00 18.80 ? 550  ILE B CA    1 
ATOM   9134  C  C     . ILE B 1 550 ? 77.410  118.665 97.977  1.00 19.80 ? 550  ILE B C     1 
ATOM   9135  O  O     . ILE B 1 550 ? 76.899  117.970 97.101  1.00 21.25 ? 550  ILE B O     1 
ATOM   9136  C  CB    . ILE B 1 550 ? 76.371  118.576 100.242 1.00 19.56 ? 550  ILE B CB    1 
ATOM   9137  C  CG1   . ILE B 1 550 ? 75.872  117.172 99.891  1.00 19.37 ? 550  ILE B CG1   1 
ATOM   9138  C  CG2   . ILE B 1 550 ? 75.379  119.248 101.194 1.00 20.61 ? 550  ILE B CG2   1 
ATOM   9139  C  CD1   . ILE B 1 550 ? 75.776  116.236 101.085 1.00 18.73 ? 550  ILE B CD1   1 
ATOM   9140  N  N     . PRO B 1 551 ? 78.741  118.784 98.106  1.00 19.68 ? 551  PRO B N     1 
ATOM   9141  C  CA    . PRO B 1 551 ? 79.645  118.075 97.199  1.00 20.14 ? 551  PRO B CA    1 
ATOM   9142  C  C     . PRO B 1 551 ? 79.446  116.563 97.221  1.00 21.46 ? 551  PRO B C     1 
ATOM   9143  O  O     . PRO B 1 551 ? 79.103  115.984 98.251  1.00 21.66 ? 551  PRO B O     1 
ATOM   9144  C  CB    . PRO B 1 551 ? 81.028  118.474 97.709  1.00 18.74 ? 551  PRO B CB    1 
ATOM   9145  C  CG    . PRO B 1 551 ? 80.798  119.852 98.216  1.00 19.48 ? 551  PRO B CG    1 
ATOM   9146  C  CD    . PRO B 1 551 ? 79.500  119.694 98.982  1.00 19.34 ? 551  PRO B CD    1 
ATOM   9147  N  N     . HIS B 1 552 ? 79.652  115.939 96.065  1.00 22.67 ? 552  HIS B N     1 
ATOM   9148  C  CA    . HIS B 1 552 ? 79.532  114.496 95.920  1.00 23.50 ? 552  HIS B CA    1 
ATOM   9149  C  C     . HIS B 1 552 ? 80.531  114.103 94.843  1.00 23.22 ? 552  HIS B C     1 
ATOM   9150  O  O     . HIS B 1 552 ? 80.452  114.585 93.713  1.00 23.81 ? 552  HIS B O     1 
ATOM   9151  C  CB    . HIS B 1 552 ? 78.130  114.100 95.476  1.00 25.04 ? 552  HIS B CB    1 
ATOM   9152  C  CG    . HIS B 1 552 ? 77.873  112.628 95.557  1.00 26.91 ? 552  HIS B CG    1 
ATOM   9153  N  ND1   . HIS B 1 552 ? 77.542  111.994 96.736  1.00 28.46 ? 552  HIS B ND1   1 
ATOM   9154  C  CD2   . HIS B 1 552 ? 77.928  111.659 94.614  1.00 28.00 ? 552  HIS B CD2   1 
ATOM   9155  C  CE1   . HIS B 1 552 ? 77.404  110.700 96.514  1.00 26.13 ? 552  HIS B CE1   1 
ATOM   9156  N  NE2   . HIS B 1 552 ? 77.633  110.470 95.235  1.00 27.52 ? 552  HIS B NE2   1 
ATOM   9157  N  N     . ALA B 1 553 ? 81.465  113.230 95.199  1.00 22.59 ? 553  ALA B N     1 
ATOM   9158  C  CA    . ALA B 1 553 ? 82.504  112.784 94.280  1.00 23.12 ? 553  ALA B CA    1 
ATOM   9159  C  C     . ALA B 1 553 ? 81.990  112.284 92.936  1.00 21.86 ? 553  ALA B C     1 
ATOM   9160  O  O     . ALA B 1 553 ? 82.682  112.399 91.927  1.00 22.67 ? 553  ALA B O     1 
ATOM   9161  C  CB    . ALA B 1 553 ? 83.360  111.705 94.952  1.00 20.22 ? 553  ALA B CB    1 
ATOM   9162  N  N     . ILE B 1 554 ? 80.785  111.728 92.920  1.00 23.67 ? 554  ILE B N     1 
ATOM   9163  C  CA    . ILE B 1 554 ? 80.217  111.215 91.680  1.00 25.04 ? 554  ILE B CA    1 
ATOM   9164  C  C     . ILE B 1 554 ? 79.168  112.142 91.062  1.00 24.84 ? 554  ILE B C     1 
ATOM   9165  O  O     . ILE B 1 554 ? 79.309  112.584 89.916  1.00 25.27 ? 554  ILE B O     1 
ATOM   9166  C  CB    . ILE B 1 554 ? 79.573  109.815 91.897  1.00 26.28 ? 554  ILE B CB    1 
ATOM   9167  C  CG1   . ILE B 1 554 ? 80.630  108.818 92.390  1.00 26.96 ? 554  ILE B CG1   1 
ATOM   9168  C  CG2   . ILE B 1 554 ? 78.956  109.316 90.595  1.00 24.84 ? 554  ILE B CG2   1 
ATOM   9169  C  CD1   . ILE B 1 554 ? 81.761  108.572 91.412  1.00 27.58 ? 554  ILE B CD1   1 
ATOM   9170  N  N     . LYS B 1 555 ? 78.121  112.422 91.834  1.00 24.50 ? 555  LYS B N     1 
ATOM   9171  C  CA    . LYS B 1 555 ? 77.009  113.266 91.396  1.00 24.96 ? 555  LYS B CA    1 
ATOM   9172  C  C     . LYS B 1 555 ? 77.328  114.755 91.226  1.00 22.78 ? 555  LYS B C     1 
ATOM   9173  O  O     . LYS B 1 555 ? 76.589  115.484 90.564  1.00 21.56 ? 555  LYS B O     1 
ATOM   9174  C  CB    . LYS B 1 555 ? 75.847  113.139 92.380  1.00 27.06 ? 555  LYS B CB    1 
ATOM   9175  C  CG    . LYS B 1 555 ? 75.243  111.751 92.492  1.00 30.79 ? 555  LYS B CG    1 
ATOM   9176  C  CD    . LYS B 1 555 ? 74.138  111.748 93.547  1.00 32.27 ? 555  LYS B CD    1 
ATOM   9177  C  CE    . LYS B 1 555 ? 73.442  110.401 93.635  1.00 34.89 ? 555  LYS B CE    1 
ATOM   9178  N  NZ    . LYS B 1 555 ? 72.338  110.422 94.639  1.00 36.24 ? 555  LYS B NZ    1 
ATOM   9179  N  N     . GLY B 1 556 ? 78.425  115.206 91.819  1.00 21.52 ? 556  GLY B N     1 
ATOM   9180  C  CA    . GLY B 1 556 ? 78.765  116.613 91.732  1.00 20.17 ? 556  GLY B CA    1 
ATOM   9181  C  C     . GLY B 1 556 ? 78.097  117.291 92.911  1.00 19.48 ? 556  GLY B C     1 
ATOM   9182  O  O     . GLY B 1 556 ? 78.746  117.955 93.718  1.00 18.04 ? 556  GLY B O     1 
ATOM   9183  N  N     . GLN B 1 557 ? 76.785  117.099 93.014  1.00 20.58 ? 557  GLN B N     1 
ATOM   9184  C  CA    . GLN B 1 557 ? 75.996  117.660 94.109  1.00 21.63 ? 557  GLN B CA    1 
ATOM   9185  C  C     . GLN B 1 557 ? 74.924  116.695 94.593  1.00 22.05 ? 557  GLN B C     1 
ATOM   9186  O  O     . GLN B 1 557 ? 74.060  116.282 93.822  1.00 23.12 ? 557  GLN B O     1 
ATOM   9187  C  CB    . GLN B 1 557 ? 75.304  118.963 93.695  1.00 21.45 ? 557  GLN B CB    1 
ATOM   9188  C  CG    . GLN B 1 557 ? 76.192  120.187 93.660  1.00 21.20 ? 557  GLN B CG    1 
ATOM   9189  C  CD    . GLN B 1 557 ? 75.396  121.461 93.832  1.00 20.83 ? 557  GLN B CD    1 
ATOM   9190  O  OE1   . GLN B 1 557 ? 74.514  121.771 93.035  1.00 21.74 ? 557  GLN B OE1   1 
ATOM   9191  N  NE2   . GLN B 1 557 ? 75.703  122.209 94.887  1.00 21.70 ? 557  GLN B NE2   1 
ATOM   9192  N  N     . ALA B 1 558 ? 74.982  116.328 95.868  1.00 21.86 ? 558  ALA B N     1 
ATOM   9193  C  CA    . ALA B 1 558 ? 73.970  115.446 96.436  1.00 20.53 ? 558  ALA B CA    1 
ATOM   9194  C  C     . ALA B 1 558 ? 72.944  116.386 97.064  1.00 20.48 ? 558  ALA B C     1 
ATOM   9195  O  O     . ALA B 1 558 ? 73.293  117.480 97.521  1.00 19.54 ? 558  ALA B O     1 
ATOM   9196  C  CB    . ALA B 1 558 ? 74.580  114.528 97.491  1.00 20.13 ? 558  ALA B CB    1 
ATOM   9197  N  N     . ILE B 1 559 ? 71.684  115.964 97.077  1.00 20.51 ? 559  ILE B N     1 
ATOM   9198  C  CA    . ILE B 1 559 ? 70.611  116.777 97.628  1.00 19.84 ? 559  ILE B CA    1 
ATOM   9199  C  C     . ILE B 1 559 ? 70.476  116.597 99.131  1.00 20.48 ? 559  ILE B C     1 
ATOM   9200  O  O     . ILE B 1 559 ? 70.219  115.500 99.609  1.00 21.98 ? 559  ILE B O     1 
ATOM   9201  C  CB    . ILE B 1 559 ? 69.280  116.433 96.948  1.00 20.82 ? 559  ILE B CB    1 
ATOM   9202  C  CG1   . ILE B 1 559 ? 69.399  116.704 95.442  1.00 21.37 ? 559  ILE B CG1   1 
ATOM   9203  C  CG2   . ILE B 1 559 ? 68.156  117.260 97.553  1.00 19.55 ? 559  ILE B CG2   1 
ATOM   9204  C  CD1   . ILE B 1 559 ? 68.208  116.264 94.625  1.00 22.62 ? 559  ILE B CD1   1 
ATOM   9205  N  N     . TYR B 1 560 ? 70.650  117.693 99.865  1.00 20.45 ? 560  TYR B N     1 
ATOM   9206  C  CA    . TYR B 1 560 ? 70.572  117.692 101.322 1.00 19.28 ? 560  TYR B CA    1 
ATOM   9207  C  C     . TYR B 1 560 ? 69.376  118.540 101.750 1.00 18.59 ? 560  TYR B C     1 
ATOM   9208  O  O     . TYR B 1 560 ? 69.324  119.732 101.454 1.00 18.91 ? 560  TYR B O     1 
ATOM   9209  C  CB    . TYR B 1 560 ? 71.872  118.271 101.880 1.00 21.91 ? 560  TYR B CB    1 
ATOM   9210  C  CG    . TYR B 1 560 ? 72.047  118.109 103.371 1.00 24.20 ? 560  TYR B CG    1 
ATOM   9211  C  CD1   . TYR B 1 560 ? 71.340  118.907 104.273 1.00 25.58 ? 560  TYR B CD1   1 
ATOM   9212  C  CD2   . TYR B 1 560 ? 72.928  117.157 103.883 1.00 25.62 ? 560  TYR B CD2   1 
ATOM   9213  C  CE1   . TYR B 1 560 ? 71.511  118.761 105.648 1.00 25.01 ? 560  TYR B CE1   1 
ATOM   9214  C  CE2   . TYR B 1 560 ? 73.106  117.002 105.258 1.00 24.33 ? 560  TYR B CE2   1 
ATOM   9215  C  CZ    . TYR B 1 560 ? 72.398  117.806 106.130 1.00 24.06 ? 560  TYR B CZ    1 
ATOM   9216  O  OH    . TYR B 1 560 ? 72.587  117.666 107.481 1.00 23.70 ? 560  TYR B OH    1 
ATOM   9217  N  N     . ALA B 1 561 ? 68.425  117.930 102.452 1.00 16.33 ? 561  ALA B N     1 
ATOM   9218  C  CA    . ALA B 1 561 ? 67.220  118.644 102.867 1.00 16.55 ? 561  ALA B CA    1 
ATOM   9219  C  C     . ALA B 1 561 ? 66.960  118.758 104.371 1.00 17.38 ? 561  ALA B C     1 
ATOM   9220  O  O     . ALA B 1 561 ? 66.793  117.747 105.064 1.00 17.65 ? 561  ALA B O     1 
ATOM   9221  C  CB    . ALA B 1 561 ? 66.003  118.015 102.193 1.00 14.49 ? 561  ALA B CB    1 
ATOM   9222  N  N     . TYR B 1 562 ? 66.915  119.993 104.868 1.00 16.79 ? 562  TYR B N     1 
ATOM   9223  C  CA    . TYR B 1 562 ? 66.613  120.229 106.283 1.00 16.98 ? 562  TYR B CA    1 
ATOM   9224  C  C     . TYR B 1 562 ? 65.090  120.215 106.347 1.00 16.60 ? 562  TYR B C     1 
ATOM   9225  O  O     . TYR B 1 562 ? 64.437  120.971 105.635 1.00 16.26 ? 562  TYR B O     1 
ATOM   9226  C  CB    . TYR B 1 562 ? 67.134  121.593 106.755 1.00 17.27 ? 562  TYR B CB    1 
ATOM   9227  C  CG    . TYR B 1 562 ? 68.642  121.741 106.719 1.00 17.29 ? 562  TYR B CG    1 
ATOM   9228  C  CD1   . TYR B 1 562 ? 69.304  122.093 105.543 1.00 19.24 ? 562  TYR B CD1   1 
ATOM   9229  C  CD2   . TYR B 1 562 ? 69.407  121.538 107.863 1.00 18.26 ? 562  TYR B CD2   1 
ATOM   9230  C  CE1   . TYR B 1 562 ? 70.697  122.245 105.512 1.00 18.71 ? 562  TYR B CE1   1 
ATOM   9231  C  CE2   . TYR B 1 562 ? 70.795  121.683 107.840 1.00 19.70 ? 562  TYR B CE2   1 
ATOM   9232  C  CZ    . TYR B 1 562 ? 71.430  122.038 106.663 1.00 19.37 ? 562  TYR B CZ    1 
ATOM   9233  O  OH    . TYR B 1 562 ? 72.796  122.184 106.644 1.00 20.75 ? 562  TYR B OH    1 
ATOM   9234  N  N     . VAL B 1 563 ? 64.523  119.356 107.189 1.00 16.61 ? 563  VAL B N     1 
ATOM   9235  C  CA    . VAL B 1 563 ? 63.072  119.245 107.287 1.00 16.08 ? 563  VAL B CA    1 
ATOM   9236  C  C     . VAL B 1 563 ? 62.522  119.416 108.694 1.00 17.57 ? 563  VAL B C     1 
ATOM   9237  O  O     . VAL B 1 563 ? 62.935  118.722 109.620 1.00 19.54 ? 563  VAL B O     1 
ATOM   9238  C  CB    . VAL B 1 563 ? 62.607  117.885 106.735 1.00 14.68 ? 563  VAL B CB    1 
ATOM   9239  C  CG1   . VAL B 1 563 ? 61.108  117.760 106.840 1.00 14.65 ? 563  VAL B CG1   1 
ATOM   9240  C  CG2   . VAL B 1 563 ? 63.049  117.744 105.288 1.00 14.33 ? 563  VAL B CG2   1 
ATOM   9241  N  N     . THR B 1 564 ? 61.595  120.356 108.852 1.00 18.22 ? 564  THR B N     1 
ATOM   9242  C  CA    . THR B 1 564 ? 60.981  120.593 110.153 1.00 19.13 ? 564  THR B CA    1 
ATOM   9243  C  C     . THR B 1 564 ? 59.605  119.940 110.153 1.00 19.92 ? 564  THR B C     1 
ATOM   9244  O  O     . THR B 1 564 ? 58.759  120.235 109.304 1.00 20.22 ? 564  THR B O     1 
ATOM   9245  C  CB    . THR B 1 564 ? 60.827  122.095 110.458 1.00 19.25 ? 564  THR B CB    1 
ATOM   9246  O  OG1   . THR B 1 564 ? 62.111  122.728 110.417 1.00 19.82 ? 564  THR B OG1   1 
ATOM   9247  C  CG2   . THR B 1 564 ? 60.225  122.292 111.846 1.00 19.06 ? 564  THR B CG2   1 
ATOM   9248  N  N     . LEU B 1 565 ? 59.387  119.051 111.112 1.00 19.88 ? 565  LEU B N     1 
ATOM   9249  C  CA    . LEU B 1 565 ? 58.119  118.339 111.208 1.00 19.76 ? 565  LEU B CA    1 
ATOM   9250  C  C     . LEU B 1 565 ? 57.097  119.041 112.097 1.00 20.32 ? 565  LEU B C     1 
ATOM   9251  O  O     . LEU B 1 565 ? 57.448  119.753 113.035 1.00 20.29 ? 565  LEU B O     1 
ATOM   9252  C  CB    . LEU B 1 565 ? 58.369  116.925 111.741 1.00 19.56 ? 565  LEU B CB    1 
ATOM   9253  C  CG    . LEU B 1 565 ? 59.282  116.031 110.899 1.00 21.25 ? 565  LEU B CG    1 
ATOM   9254  C  CD1   . LEU B 1 565 ? 59.776  114.850 111.731 1.00 20.33 ? 565  LEU B CD1   1 
ATOM   9255  C  CD2   . LEU B 1 565 ? 58.522  115.565 109.654 1.00 19.63 ? 565  LEU B CD2   1 
ATOM   9256  N  N     . ASN B 1 566 ? 55.824  118.838 111.775 1.00 21.99 ? 566  ASN B N     1 
ATOM   9257  C  CA    . ASN B 1 566 ? 54.740  119.395 112.566 1.00 22.88 ? 566  ASN B CA    1 
ATOM   9258  C  C     . ASN B 1 566 ? 54.761  118.639 113.887 1.00 23.88 ? 566  ASN B C     1 
ATOM   9259  O  O     . ASN B 1 566 ? 55.278  117.522 113.954 1.00 23.51 ? 566  ASN B O     1 
ATOM   9260  C  CB    . ASN B 1 566 ? 53.397  119.167 111.868 1.00 22.60 ? 566  ASN B CB    1 
ATOM   9261  C  CG    . ASN B 1 566 ? 53.183  120.104 110.694 1.00 25.15 ? 566  ASN B CG    1 
ATOM   9262  O  OD1   . ASN B 1 566 ? 53.237  121.323 110.849 1.00 24.87 ? 566  ASN B OD1   1 
ATOM   9263  N  ND2   . ASN B 1 566 ? 52.935  119.542 109.517 1.00 22.46 ? 566  ASN B ND2   1 
ATOM   9264  N  N     . HIS B 1 567 ? 54.205  119.244 114.932 1.00 24.95 ? 567  HIS B N     1 
ATOM   9265  C  CA    . HIS B 1 567 ? 54.160  118.611 116.244 1.00 26.07 ? 567  HIS B CA    1 
ATOM   9266  C  C     . HIS B 1 567 ? 53.394  117.296 116.200 1.00 27.01 ? 567  HIS B C     1 
ATOM   9267  O  O     . HIS B 1 567 ? 52.424  117.155 115.453 1.00 26.87 ? 567  HIS B O     1 
ATOM   9268  C  CB    . HIS B 1 567 ? 53.500  119.543 117.261 1.00 25.27 ? 567  HIS B CB    1 
ATOM   9269  C  CG    . HIS B 1 567 ? 54.329  120.736 117.615 1.00 24.95 ? 567  HIS B CG    1 
ATOM   9270  N  ND1   . HIS B 1 567 ? 53.935  121.661 118.557 1.00 25.00 ? 567  HIS B ND1   1 
ATOM   9271  C  CD2   . HIS B 1 567 ? 55.541  121.143 117.169 1.00 24.33 ? 567  HIS B CD2   1 
ATOM   9272  C  CE1   . HIS B 1 567 ? 54.870  122.584 118.681 1.00 26.16 ? 567  HIS B CE1   1 
ATOM   9273  N  NE2   . HIS B 1 567 ? 55.855  122.293 117.849 1.00 26.36 ? 567  HIS B NE2   1 
ATOM   9274  N  N     . GLY B 1 568 ? 53.832  116.339 117.011 1.00 28.54 ? 568  GLY B N     1 
ATOM   9275  C  CA    . GLY B 1 568 ? 53.169  115.052 117.055 1.00 30.85 ? 568  GLY B CA    1 
ATOM   9276  C  C     . GLY B 1 568 ? 53.831  114.069 116.121 1.00 32.74 ? 568  GLY B C     1 
ATOM   9277  O  O     . GLY B 1 568 ? 53.649  112.858 116.246 1.00 33.20 ? 568  GLY B O     1 
ATOM   9278  N  N     . GLU B 1 569 ? 54.606  114.601 115.183 1.00 34.22 ? 569  GLU B N     1 
ATOM   9279  C  CA    . GLU B 1 569 ? 55.310  113.780 114.211 1.00 35.43 ? 569  GLU B CA    1 
ATOM   9280  C  C     . GLU B 1 569 ? 56.701  113.437 114.739 1.00 35.85 ? 569  GLU B C     1 
ATOM   9281  O  O     . GLU B 1 569 ? 57.483  114.324 115.104 1.00 36.87 ? 569  GLU B O     1 
ATOM   9282  C  CB    . GLU B 1 569 ? 55.435  114.524 112.877 1.00 37.54 ? 569  GLU B CB    1 
ATOM   9283  C  CG    . GLU B 1 569 ? 54.127  115.087 112.337 1.00 39.45 ? 569  GLU B CG    1 
ATOM   9284  C  CD    . GLU B 1 569 ? 53.000  114.066 112.353 1.00 42.11 ? 569  GLU B CD    1 
ATOM   9285  O  OE1   . GLU B 1 569 ? 53.239  112.906 111.945 1.00 43.09 ? 569  GLU B OE1   1 
ATOM   9286  O  OE2   . GLU B 1 569 ? 51.874  114.423 112.768 1.00 42.16 ? 569  GLU B OE2   1 
ATOM   9287  N  N     . GLU B 1 570 ? 57.001  112.145 114.778 1.00 34.28 ? 570  GLU B N     1 
ATOM   9288  C  CA    . GLU B 1 570 ? 58.291  111.681 115.259 1.00 33.76 ? 570  GLU B CA    1 
ATOM   9289  C  C     . GLU B 1 570 ? 59.082  111.011 114.138 1.00 32.25 ? 570  GLU B C     1 
ATOM   9290  O  O     . GLU B 1 570 ? 58.549  110.188 113.386 1.00 31.32 ? 570  GLU B O     1 
ATOM   9291  C  CB    . GLU B 1 570 ? 58.097  110.703 116.423 1.00 33.86 ? 570  GLU B CB    1 
ATOM   9292  N  N     . PRO B 1 571 ? 60.361  111.385 113.988 1.00 30.31 ? 571  PRO B N     1 
ATOM   9293  C  CA    . PRO B 1 571 ? 61.187  110.778 112.942 1.00 28.40 ? 571  PRO B CA    1 
ATOM   9294  C  C     . PRO B 1 571 ? 61.244  109.270 113.169 1.00 26.56 ? 571  PRO B C     1 
ATOM   9295  O  O     . PRO B 1 571 ? 61.438  108.818 114.297 1.00 25.87 ? 571  PRO B O     1 
ATOM   9296  C  CB    . PRO B 1 571 ? 62.547  111.437 113.155 1.00 27.76 ? 571  PRO B CB    1 
ATOM   9297  C  CG    . PRO B 1 571 ? 62.170  112.798 113.635 1.00 29.70 ? 571  PRO B CG    1 
ATOM   9298  C  CD    . PRO B 1 571 ? 61.066  112.510 114.626 1.00 29.28 ? 571  PRO B CD    1 
ATOM   9299  N  N     . SER B 1 572 ? 61.054  108.497 112.107 1.00 25.57 ? 572  SER B N     1 
ATOM   9300  C  CA    . SER B 1 572 ? 61.101  107.045 112.195 1.00 24.56 ? 572  SER B CA    1 
ATOM   9301  C  C     . SER B 1 572 ? 61.585  106.533 110.851 1.00 24.06 ? 572  SER B C     1 
ATOM   9302  O  O     . SER B 1 572 ? 61.601  107.279 109.877 1.00 25.70 ? 572  SER B O     1 
ATOM   9303  C  CB    . SER B 1 572 ? 59.714  106.474 112.506 1.00 24.99 ? 572  SER B CB    1 
ATOM   9304  O  OG    . SER B 1 572 ? 58.838  106.614 111.402 1.00 27.79 ? 572  SER B OG    1 
ATOM   9305  N  N     . PRO B 1 573 ? 61.999  105.260 110.779 1.00 24.11 ? 573  PRO B N     1 
ATOM   9306  C  CA    . PRO B 1 573 ? 62.471  104.731 109.496 1.00 22.14 ? 573  PRO B CA    1 
ATOM   9307  C  C     . PRO B 1 573 ? 61.406  104.883 108.415 1.00 21.88 ? 573  PRO B C     1 
ATOM   9308  O  O     . PRO B 1 573 ? 61.711  105.186 107.260 1.00 20.53 ? 573  PRO B O     1 
ATOM   9309  C  CB    . PRO B 1 573 ? 62.766  103.272 109.819 1.00 22.88 ? 573  PRO B CB    1 
ATOM   9310  C  CG    . PRO B 1 573 ? 63.207  103.341 111.263 1.00 23.18 ? 573  PRO B CG    1 
ATOM   9311  C  CD    . PRO B 1 573 ? 62.170  104.266 111.854 1.00 22.25 ? 573  PRO B CD    1 
ATOM   9312  N  N     . GLU B 1 574 ? 60.154  104.687 108.814 1.00 20.64 ? 574  GLU B N     1 
ATOM   9313  C  CA    . GLU B 1 574 ? 59.017  104.785 107.909 1.00 21.99 ? 574  GLU B CA    1 
ATOM   9314  C  C     . GLU B 1 574 ? 58.822  106.184 107.335 1.00 22.82 ? 574  GLU B C     1 
ATOM   9315  O  O     . GLU B 1 574 ? 58.700  106.346 106.121 1.00 23.35 ? 574  GLU B O     1 
ATOM   9316  C  CB    . GLU B 1 574 ? 57.745  104.338 108.639 1.00 21.48 ? 574  GLU B CB    1 
ATOM   9317  C  CG    . GLU B 1 574 ? 56.475  104.300 107.791 1.00 22.07 ? 574  GLU B CG    1 
ATOM   9318  C  CD    . GLU B 1 574 ? 55.891  105.684 107.538 1.00 23.45 ? 574  GLU B CD    1 
ATOM   9319  O  OE1   . GLU B 1 574 ? 55.896  106.513 108.480 1.00 21.05 ? 574  GLU B OE1   1 
ATOM   9320  O  OE2   . GLU B 1 574 ? 55.420  105.935 106.405 1.00 22.42 ? 574  GLU B OE2   1 
ATOM   9321  N  N     . LEU B 1 575 ? 58.789  107.188 108.207 1.00 23.20 ? 575  LEU B N     1 
ATOM   9322  C  CA    . LEU B 1 575 ? 58.590  108.562 107.771 1.00 22.63 ? 575  LEU B CA    1 
ATOM   9323  C  C     . LEU B 1 575 ? 59.767  109.002 106.902 1.00 23.07 ? 575  LEU B C     1 
ATOM   9324  O  O     . LEU B 1 575 ? 59.602  109.772 105.955 1.00 21.60 ? 575  LEU B O     1 
ATOM   9325  C  CB    . LEU B 1 575 ? 58.439  109.482 108.988 1.00 22.36 ? 575  LEU B CB    1 
ATOM   9326  C  CG    . LEU B 1 575 ? 58.046  110.946 108.750 1.00 24.13 ? 575  LEU B CG    1 
ATOM   9327  C  CD1   . LEU B 1 575 ? 56.772  111.027 107.941 1.00 22.14 ? 575  LEU B CD1   1 
ATOM   9328  C  CD2   . LEU B 1 575 ? 57.855  111.643 110.102 1.00 23.46 ? 575  LEU B CD2   1 
ATOM   9329  N  N     . TYR B 1 576 ? 60.953  108.488 107.217 1.00 23.18 ? 576  TYR B N     1 
ATOM   9330  C  CA    . TYR B 1 576 ? 62.151  108.817 106.459 1.00 23.37 ? 576  TYR B CA    1 
ATOM   9331  C  C     . TYR B 1 576 ? 61.950  108.357 105.018 1.00 22.94 ? 576  TYR B C     1 
ATOM   9332  O  O     . TYR B 1 576 ? 62.171  109.116 104.068 1.00 22.86 ? 576  TYR B O     1 
ATOM   9333  C  CB    . TYR B 1 576 ? 63.367  108.104 107.054 1.00 25.21 ? 576  TYR B CB    1 
ATOM   9334  C  CG    . TYR B 1 576 ? 64.693  108.660 106.576 1.00 26.59 ? 576  TYR B CG    1 
ATOM   9335  C  CD1   . TYR B 1 576 ? 65.351  109.652 107.299 1.00 28.05 ? 576  TYR B CD1   1 
ATOM   9336  C  CD2   . TYR B 1 576 ? 65.276  108.212 105.391 1.00 28.08 ? 576  TYR B CD2   1 
ATOM   9337  C  CE1   . TYR B 1 576 ? 66.560  110.189 106.858 1.00 28.89 ? 576  TYR B CE1   1 
ATOM   9338  C  CE2   . TYR B 1 576 ? 66.484  108.744 104.935 1.00 29.23 ? 576  TYR B CE2   1 
ATOM   9339  C  CZ    . TYR B 1 576 ? 67.121  109.735 105.676 1.00 30.25 ? 576  TYR B CZ    1 
ATOM   9340  O  OH    . TYR B 1 576 ? 68.313  110.279 105.238 1.00 30.65 ? 576  TYR B OH    1 
ATOM   9341  N  N     . ALA B 1 577 ? 61.523  107.105 104.867 1.00 22.00 ? 577  ALA B N     1 
ATOM   9342  C  CA    . ALA B 1 577 ? 61.280  106.524 103.550 1.00 21.06 ? 577  ALA B CA    1 
ATOM   9343  C  C     . ALA B 1 577 ? 60.090  107.187 102.864 1.00 19.79 ? 577  ALA B C     1 
ATOM   9344  O  O     . ALA B 1 577 ? 60.072  107.333 101.640 1.00 21.03 ? 577  ALA B O     1 
ATOM   9345  C  CB    . ALA B 1 577 ? 61.041  105.018 103.672 1.00 19.69 ? 577  ALA B CB    1 
ATOM   9346  N  N     . GLU B 1 578 ? 59.104  107.597 103.653 1.00 18.37 ? 578  GLU B N     1 
ATOM   9347  C  CA    . GLU B 1 578 ? 57.917  108.239 103.103 1.00 17.38 ? 578  GLU B CA    1 
ATOM   9348  C  C     . GLU B 1 578 ? 58.232  109.609 102.507 1.00 16.38 ? 578  GLU B C     1 
ATOM   9349  O  O     . GLU B 1 578 ? 57.748  109.950 101.428 1.00 17.54 ? 578  GLU B O     1 
ATOM   9350  C  CB    . GLU B 1 578 ? 56.842  108.391 104.180 1.00 18.03 ? 578  GLU B CB    1 
ATOM   9351  C  CG    . GLU B 1 578 ? 55.446  108.534 103.606 1.00 22.11 ? 578  GLU B CG    1 
ATOM   9352  C  CD    . GLU B 1 578 ? 54.399  108.814 104.660 1.00 22.99 ? 578  GLU B CD    1 
ATOM   9353  O  OE1   . GLU B 1 578 ? 54.356  108.086 105.668 1.00 24.16 ? 578  GLU B OE1   1 
ATOM   9354  O  OE2   . GLU B 1 578 ? 53.609  109.762 104.475 1.00 26.63 ? 578  GLU B OE2   1 
ATOM   9355  N  N     . VAL B 1 579 ? 59.040  110.393 103.209 1.00 15.09 ? 579  VAL B N     1 
ATOM   9356  C  CA    . VAL B 1 579 ? 59.386  111.714 102.714 1.00 15.11 ? 579  VAL B CA    1 
ATOM   9357  C  C     . VAL B 1 579 ? 60.201  111.621 101.432 1.00 17.53 ? 579  VAL B C     1 
ATOM   9358  O  O     . VAL B 1 579 ? 60.017  112.429 100.519 1.00 18.10 ? 579  VAL B O     1 
ATOM   9359  C  CB    . VAL B 1 579 ? 60.150  112.538 103.781 1.00 13.28 ? 579  VAL B CB    1 
ATOM   9360  C  CG1   . VAL B 1 579 ? 60.736  113.800 103.162 1.00 13.17 ? 579  VAL B CG1   1 
ATOM   9361  C  CG2   . VAL B 1 579 ? 59.192  112.933 104.894 1.00 11.60 ? 579  VAL B CG2   1 
ATOM   9362  N  N     . ARG B 1 580 ? 61.091  110.636 101.340 1.00 19.96 ? 580  ARG B N     1 
ATOM   9363  C  CA    . ARG B 1 580 ? 61.886  110.494 100.124 1.00 21.58 ? 580  ARG B CA    1 
ATOM   9364  C  C     . ARG B 1 580 ? 60.988  110.124 98.946  1.00 21.12 ? 580  ARG B C     1 
ATOM   9365  O  O     . ARG B 1 580 ? 61.049  110.762 97.898  1.00 20.59 ? 580  ARG B O     1 
ATOM   9366  C  CB    . ARG B 1 580 ? 62.982  109.435 100.298 1.00 23.15 ? 580  ARG B CB    1 
ATOM   9367  C  CG    . ARG B 1 580 ? 64.092  109.828 101.268 1.00 27.26 ? 580  ARG B CG    1 
ATOM   9368  C  CD    . ARG B 1 580 ? 65.232  108.805 101.247 1.00 32.26 ? 580  ARG B CD    1 
ATOM   9369  N  NE    . ARG B 1 580 ? 66.188  109.057 100.173 1.00 35.58 ? 580  ARG B NE    1 
ATOM   9370  C  CZ    . ARG B 1 580 ? 66.775  108.109 99.447  1.00 37.11 ? 580  ARG B CZ    1 
ATOM   9371  N  NH1   . ARG B 1 580 ? 66.501  106.833 99.677  1.00 37.60 ? 580  ARG B NH1   1 
ATOM   9372  N  NH2   . ARG B 1 580 ? 67.640  108.439 98.495  1.00 38.77 ? 580  ARG B NH2   1 
ATOM   9373  N  N     . ASN B 1 581 ? 60.143  109.109 99.123  1.00 21.68 ? 581  ASN B N     1 
ATOM   9374  C  CA    . ASN B 1 581 ? 59.250  108.681 98.049  1.00 22.22 ? 581  ASN B CA    1 
ATOM   9375  C  C     . ASN B 1 581 ? 58.216  109.744 97.704  1.00 21.20 ? 581  ASN B C     1 
ATOM   9376  O  O     . ASN B 1 581 ? 57.610  109.694 96.634  1.00 19.93 ? 581  ASN B O     1 
ATOM   9377  C  CB    . ASN B 1 581 ? 58.531  107.374 98.413  1.00 24.98 ? 581  ASN B CB    1 
ATOM   9378  C  CG    . ASN B 1 581 ? 59.492  106.203 98.594  1.00 29.04 ? 581  ASN B CG    1 
ATOM   9379  O  OD1   . ASN B 1 581 ? 60.581  106.177 98.011  1.00 27.81 ? 581  ASN B OD1   1 
ATOM   9380  N  ND2   . ASN B 1 581 ? 59.082  105.220 99.395  1.00 29.44 ? 581  ASN B ND2   1 
ATOM   9381  N  N     . TRP B 1 582 ? 58.008  110.698 98.609  1.00 19.69 ? 582  TRP B N     1 
ATOM   9382  C  CA    . TRP B 1 582 ? 57.057  111.774 98.363  1.00 18.81 ? 582  TRP B CA    1 
ATOM   9383  C  C     . TRP B 1 582 ? 57.637  112.699 97.293  1.00 19.80 ? 582  TRP B C     1 
ATOM   9384  O  O     . TRP B 1 582 ? 56.945  113.089 96.351  1.00 19.52 ? 582  TRP B O     1 
ATOM   9385  C  CB    . TRP B 1 582 ? 56.783  112.551 99.656  1.00 18.85 ? 582  TRP B CB    1 
ATOM   9386  C  CG    . TRP B 1 582 ? 55.848  113.721 99.489  1.00 15.73 ? 582  TRP B CG    1 
ATOM   9387  C  CD1   . TRP B 1 582 ? 56.191  115.038 99.409  1.00 14.64 ? 582  TRP B CD1   1 
ATOM   9388  C  CD2   . TRP B 1 582 ? 54.425  113.665 99.356  1.00 15.50 ? 582  TRP B CD2   1 
ATOM   9389  N  NE1   . TRP B 1 582 ? 55.068  115.811 99.234  1.00 15.82 ? 582  TRP B NE1   1 
ATOM   9390  C  CE2   . TRP B 1 582 ? 53.969  114.994 99.198  1.00 15.83 ? 582  TRP B CE2   1 
ATOM   9391  C  CE3   . TRP B 1 582 ? 53.488  112.621 99.355  1.00 16.41 ? 582  TRP B CE3   1 
ATOM   9392  C  CZ2   . TRP B 1 582 ? 52.615  115.309 99.040  1.00 13.03 ? 582  TRP B CZ2   1 
ATOM   9393  C  CZ3   . TRP B 1 582 ? 52.140  112.935 99.198  1.00 15.19 ? 582  TRP B CZ3   1 
ATOM   9394  C  CH2   . TRP B 1 582 ? 51.719  114.272 99.042  1.00 14.84 ? 582  TRP B CH2   1 
ATOM   9395  N  N     . VAL B 1 583 ? 58.911  113.046 97.435  1.00 21.14 ? 583  VAL B N     1 
ATOM   9396  C  CA    . VAL B 1 583 ? 59.560  113.894 96.448  1.00 22.60 ? 583  VAL B CA    1 
ATOM   9397  C  C     . VAL B 1 583 ? 59.573  113.134 95.130  1.00 23.00 ? 583  VAL B C     1 
ATOM   9398  O  O     . VAL B 1 583 ? 59.376  113.714 94.060  1.00 23.73 ? 583  VAL B O     1 
ATOM   9399  C  CB    . VAL B 1 583 ? 61.010  114.228 96.844  1.00 22.59 ? 583  VAL B CB    1 
ATOM   9400  C  CG1   . VAL B 1 583 ? 61.681  115.022 95.733  1.00 22.88 ? 583  VAL B CG1   1 
ATOM   9401  C  CG2   . VAL B 1 583 ? 61.021  115.026 98.136  1.00 23.29 ? 583  VAL B CG2   1 
ATOM   9402  N  N     . ARG B 1 584 ? 59.805  111.828 95.217  1.00 22.41 ? 584  ARG B N     1 
ATOM   9403  C  CA    . ARG B 1 584 ? 59.839  110.977 94.036  1.00 23.27 ? 584  ARG B CA    1 
ATOM   9404  C  C     . ARG B 1 584 ? 58.478  111.027 93.329  1.00 22.71 ? 584  ARG B C     1 
ATOM   9405  O  O     . ARG B 1 584 ? 58.403  111.015 92.098  1.00 22.02 ? 584  ARG B O     1 
ATOM   9406  C  CB    . ARG B 1 584 ? 60.157  109.542 94.448  1.00 24.97 ? 584  ARG B CB    1 
ATOM   9407  C  CG    . ARG B 1 584 ? 60.475  108.602 93.298  1.00 26.74 ? 584  ARG B CG    1 
ATOM   9408  C  CD    . ARG B 1 584 ? 60.491  107.158 93.773  1.00 28.27 ? 584  ARG B CD    1 
ATOM   9409  N  NE    . ARG B 1 584 ? 61.154  106.268 92.818  1.00 32.52 ? 584  ARG B NE    1 
ATOM   9410  C  CZ    . ARG B 1 584 ? 60.762  106.073 91.561  1.00 32.48 ? 584  ARG B CZ    1 
ATOM   9411  N  NH1   . ARG B 1 584 ? 59.697  106.709 91.088  1.00 34.89 ? 584  ARG B NH1   1 
ATOM   9412  N  NH2   . ARG B 1 584 ? 61.436  105.239 90.777  1.00 31.77 ? 584  ARG B NH2   1 
ATOM   9413  N  N     . LYS B 1 585 ? 57.412  111.090 94.123  1.00 21.30 ? 585  LYS B N     1 
ATOM   9414  C  CA    . LYS B 1 585 ? 56.044  111.142 93.612  1.00 22.99 ? 585  LYS B CA    1 
ATOM   9415  C  C     . LYS B 1 585 ? 55.675  112.541 93.115  1.00 22.72 ? 585  LYS B C     1 
ATOM   9416  O  O     . LYS B 1 585 ? 54.998  112.695 92.099  1.00 21.91 ? 585  LYS B O     1 
ATOM   9417  C  CB    . LYS B 1 585 ? 55.068  110.706 94.714  1.00 24.04 ? 585  LYS B CB    1 
ATOM   9418  C  CG    . LYS B 1 585 ? 53.583  110.782 94.356  1.00 27.57 ? 585  LYS B CG    1 
ATOM   9419  C  CD    . LYS B 1 585 ? 52.744  110.122 95.457  1.00 31.11 ? 585  LYS B CD    1 
ATOM   9420  C  CE    . LYS B 1 585 ? 51.248  110.127 95.148  1.00 32.31 ? 585  LYS B CE    1 
ATOM   9421  N  NZ    . LYS B 1 585 ? 50.640  111.486 95.267  1.00 34.24 ? 585  LYS B NZ    1 
ATOM   9422  N  N     . GLU B 1 586 ? 56.132  113.556 93.836  1.00 21.94 ? 586  GLU B N     1 
ATOM   9423  C  CA    . GLU B 1 586 ? 55.841  114.934 93.474  1.00 23.89 ? 586  GLU B CA    1 
ATOM   9424  C  C     . GLU B 1 586 ? 56.625  115.456 92.269  1.00 23.41 ? 586  GLU B C     1 
ATOM   9425  O  O     . GLU B 1 586 ? 56.054  116.075 91.376  1.00 24.47 ? 586  GLU B O     1 
ATOM   9426  C  CB    . GLU B 1 586 ? 56.084  115.843 94.682  1.00 24.52 ? 586  GLU B CB    1 
ATOM   9427  C  CG    . GLU B 1 586 ? 55.118  115.602 95.826  1.00 26.81 ? 586  GLU B CG    1 
ATOM   9428  C  CD    . GLU B 1 586 ? 53.674  115.830 95.412  1.00 30.35 ? 586  GLU B CD    1 
ATOM   9429  O  OE1   . GLU B 1 586 ? 53.341  116.978 95.056  1.00 31.48 ? 586  GLU B OE1   1 
ATOM   9430  O  OE2   . GLU B 1 586 ? 52.873  114.867 95.437  1.00 31.91 ? 586  GLU B OE2   1 
ATOM   9431  N  N     . ILE B 1 587 ? 57.926  115.195 92.238  1.00 22.79 ? 587  ILE B N     1 
ATOM   9432  C  CA    . ILE B 1 587 ? 58.768  115.672 91.148  1.00 22.13 ? 587  ILE B CA    1 
ATOM   9433  C  C     . ILE B 1 587 ? 59.413  114.543 90.341  1.00 22.90 ? 587  ILE B C     1 
ATOM   9434  O  O     . ILE B 1 587 ? 59.342  114.528 89.113  1.00 22.90 ? 587  ILE B O     1 
ATOM   9435  C  CB    . ILE B 1 587 ? 59.875  116.608 91.695  1.00 21.39 ? 587  ILE B CB    1 
ATOM   9436  C  CG1   . ILE B 1 587 ? 59.230  117.833 92.348  1.00 19.36 ? 587  ILE B CG1   1 
ATOM   9437  C  CG2   . ILE B 1 587 ? 60.816  117.029 90.572  1.00 17.92 ? 587  ILE B CG2   1 
ATOM   9438  C  CD1   . ILE B 1 587 ? 60.226  118.769 93.012  1.00 21.88 ? 587  ILE B CD1   1 
ATOM   9439  N  N     . GLY B 1 588 ? 60.053  113.607 91.033  1.00 22.93 ? 588  GLY B N     1 
ATOM   9440  C  CA    . GLY B 1 588 ? 60.693  112.495 90.351  1.00 21.00 ? 588  GLY B CA    1 
ATOM   9441  C  C     . GLY B 1 588 ? 61.891  111.968 91.118  1.00 20.33 ? 588  GLY B C     1 
ATOM   9442  O  O     . GLY B 1 588 ? 62.395  112.643 92.007  1.00 18.92 ? 588  GLY B O     1 
ATOM   9443  N  N     . PRO B 1 589 ? 62.379  110.762 90.789  1.00 21.06 ? 589  PRO B N     1 
ATOM   9444  C  CA    . PRO B 1 589 ? 63.534  110.194 91.492  1.00 21.67 ? 589  PRO B CA    1 
ATOM   9445  C  C     . PRO B 1 589 ? 64.797  111.055 91.448  1.00 23.04 ? 589  PRO B C     1 
ATOM   9446  O  O     . PRO B 1 589 ? 65.603  111.013 92.377  1.00 23.61 ? 589  PRO B O     1 
ATOM   9447  C  CB    . PRO B 1 589 ? 63.721  108.833 90.815  1.00 20.49 ? 589  PRO B CB    1 
ATOM   9448  C  CG    . PRO B 1 589 ? 63.179  109.043 89.447  1.00 22.35 ? 589  PRO B CG    1 
ATOM   9449  C  CD    . PRO B 1 589 ? 61.931  109.865 89.711  1.00 21.98 ? 589  PRO B CD    1 
ATOM   9450  N  N     . LEU B 1 590 ? 64.968  111.842 90.387  1.00 22.53 ? 590  LEU B N     1 
ATOM   9451  C  CA    . LEU B 1 590 ? 66.151  112.693 90.264  1.00 23.40 ? 590  LEU B CA    1 
ATOM   9452  C  C     . LEU B 1 590 ? 66.216  113.825 91.288  1.00 21.65 ? 590  LEU B C     1 
ATOM   9453  O  O     . LEU B 1 590 ? 67.283  114.386 91.522  1.00 23.11 ? 590  LEU B O     1 
ATOM   9454  C  CB    . LEU B 1 590 ? 66.239  113.288 88.857  1.00 26.20 ? 590  LEU B CB    1 
ATOM   9455  C  CG    . LEU B 1 590 ? 66.518  112.320 87.702  1.00 30.59 ? 590  LEU B CG    1 
ATOM   9456  C  CD1   . LEU B 1 590 ? 66.467  113.087 86.391  1.00 30.86 ? 590  LEU B CD1   1 
ATOM   9457  C  CD2   . LEU B 1 590 ? 67.883  111.654 87.883  1.00 32.14 ? 590  LEU B CD2   1 
ATOM   9458  N  N     . ALA B 1 591 ? 65.087  114.164 91.900  1.00 20.24 ? 591  ALA B N     1 
ATOM   9459  C  CA    . ALA B 1 591 ? 65.070  115.240 92.888  1.00 22.65 ? 591  ALA B CA    1 
ATOM   9460  C  C     . ALA B 1 591 ? 64.975  114.726 94.319  1.00 23.21 ? 591  ALA B C     1 
ATOM   9461  O  O     . ALA B 1 591 ? 64.888  115.510 95.259  1.00 21.81 ? 591  ALA B O     1 
ATOM   9462  C  CB    . ALA B 1 591 ? 63.907  116.188 92.608  1.00 23.13 ? 591  ALA B CB    1 
ATOM   9463  N  N     . THR B 1 592 ? 64.986  113.407 94.472  1.00 24.43 ? 592  THR B N     1 
ATOM   9464  C  CA    . THR B 1 592 ? 64.882  112.786 95.786  1.00 27.01 ? 592  THR B CA    1 
ATOM   9465  C  C     . THR B 1 592 ? 66.035  113.148 96.712  1.00 26.81 ? 592  THR B C     1 
ATOM   9466  O  O     . THR B 1 592 ? 67.201  112.957 96.377  1.00 28.37 ? 592  THR B O     1 
ATOM   9467  C  CB    . THR B 1 592 ? 64.802  111.250 95.668  1.00 27.55 ? 592  THR B CB    1 
ATOM   9468  O  OG1   . THR B 1 592 ? 63.587  110.894 94.997  1.00 27.50 ? 592  THR B OG1   1 
ATOM   9469  C  CG2   . THR B 1 592 ? 64.828  110.598 97.047  1.00 27.29 ? 592  THR B CG2   1 
ATOM   9470  N  N     . PRO B 1 593 ? 65.716  113.679 97.899  1.00 27.20 ? 593  PRO B N     1 
ATOM   9471  C  CA    . PRO B 1 593 ? 66.756  114.059 98.857  1.00 27.75 ? 593  PRO B CA    1 
ATOM   9472  C  C     . PRO B 1 593 ? 67.674  112.892 99.199  1.00 27.93 ? 593  PRO B C     1 
ATOM   9473  O  O     . PRO B 1 593 ? 67.212  111.802 99.542  1.00 27.15 ? 593  PRO B O     1 
ATOM   9474  C  CB    . PRO B 1 593 ? 65.953  114.536 100.062 1.00 27.03 ? 593  PRO B CB    1 
ATOM   9475  C  CG    . PRO B 1 593 ? 64.714  115.104 99.425  1.00 27.03 ? 593  PRO B CG    1 
ATOM   9476  C  CD    . PRO B 1 593 ? 64.382  114.054 98.397  1.00 26.91 ? 593  PRO B CD    1 
ATOM   9477  N  N     . ASP B 1 594 ? 68.976  113.122 99.087  1.00 28.23 ? 594  ASP B N     1 
ATOM   9478  C  CA    . ASP B 1 594 ? 69.952  112.088 99.406  1.00 28.25 ? 594  ASP B CA    1 
ATOM   9479  C  C     . ASP B 1 594 ? 70.131  112.070 100.916 1.00 27.34 ? 594  ASP B C     1 
ATOM   9480  O  O     . ASP B 1 594 ? 70.546  111.072 101.499 1.00 27.71 ? 594  ASP B O     1 
ATOM   9481  C  CB    . ASP B 1 594 ? 71.292  112.381 98.722  1.00 29.16 ? 594  ASP B CB    1 
ATOM   9482  C  CG    . ASP B 1 594 ? 71.235  112.174 97.228  1.00 32.37 ? 594  ASP B CG    1 
ATOM   9483  O  OD1   . ASP B 1 594 ? 70.926  111.043 96.800  1.00 33.91 ? 594  ASP B OD1   1 
ATOM   9484  O  OD2   . ASP B 1 594 ? 71.489  113.139 96.478  1.00 34.50 ? 594  ASP B OD2   1 
ATOM   9485  N  N     . VAL B 1 595 ? 69.797  113.185 101.549 1.00 26.08 ? 595  VAL B N     1 
ATOM   9486  C  CA    . VAL B 1 595 ? 69.931  113.289 102.992 1.00 24.57 ? 595  VAL B CA    1 
ATOM   9487  C  C     . VAL B 1 595 ? 68.799  114.102 103.617 1.00 23.90 ? 595  VAL B C     1 
ATOM   9488  O  O     . VAL B 1 595 ? 68.524  115.231 103.206 1.00 23.22 ? 595  VAL B O     1 
ATOM   9489  C  CB    . VAL B 1 595 ? 71.268  113.950 103.373 1.00 25.54 ? 595  VAL B CB    1 
ATOM   9490  C  CG1   . VAL B 1 595 ? 71.422  113.990 104.891 1.00 26.43 ? 595  VAL B CG1   1 
ATOM   9491  C  CG2   . VAL B 1 595 ? 72.411  113.198 102.736 1.00 25.63 ? 595  VAL B CG2   1 
ATOM   9492  N  N     . LEU B 1 596 ? 68.138  113.508 104.603 1.00 22.22 ? 596  LEU B N     1 
ATOM   9493  C  CA    . LEU B 1 596 ? 67.062  114.183 105.313 1.00 20.76 ? 596  LEU B CA    1 
ATOM   9494  C  C     . LEU B 1 596 ? 67.579  114.523 106.704 1.00 20.39 ? 596  LEU B C     1 
ATOM   9495  O  O     . LEU B 1 596 ? 67.994  113.640 107.452 1.00 18.67 ? 596  LEU B O     1 
ATOM   9496  C  CB    . LEU B 1 596 ? 65.826  113.287 105.407 1.00 20.04 ? 596  LEU B CB    1 
ATOM   9497  C  CG    . LEU B 1 596 ? 65.076  113.071 104.094 1.00 19.71 ? 596  LEU B CG    1 
ATOM   9498  C  CD1   . LEU B 1 596 ? 63.893  112.133 104.312 1.00 19.18 ? 596  LEU B CD1   1 
ATOM   9499  C  CD2   . LEU B 1 596 ? 64.595  114.411 103.569 1.00 20.00 ? 596  LEU B CD2   1 
ATOM   9500  N  N     . HIS B 1 597 ? 67.568  115.809 107.037 1.00 20.92 ? 597  HIS B N     1 
ATOM   9501  C  CA    . HIS B 1 597 ? 68.040  116.282 108.337 1.00 22.67 ? 597  HIS B CA    1 
ATOM   9502  C  C     . HIS B 1 597 ? 66.883  116.897 109.137 1.00 22.43 ? 597  HIS B C     1 
ATOM   9503  O  O     . HIS B 1 597 ? 66.499  118.049 108.904 1.00 21.25 ? 597  HIS B O     1 
ATOM   9504  C  CB    . HIS B 1 597 ? 69.155  117.317 108.129 1.00 25.17 ? 597  HIS B CB    1 
ATOM   9505  C  CG    . HIS B 1 597 ? 69.703  117.894 109.399 1.00 28.87 ? 597  HIS B CG    1 
ATOM   9506  N  ND1   . HIS B 1 597 ? 70.612  118.932 109.410 1.00 31.50 ? 597  HIS B ND1   1 
ATOM   9507  C  CD2   . HIS B 1 597 ? 69.454  117.598 110.697 1.00 31.16 ? 597  HIS B CD2   1 
ATOM   9508  C  CE1   . HIS B 1 597 ? 70.895  119.251 110.661 1.00 31.02 ? 597  HIS B CE1   1 
ATOM   9509  N  NE2   . HIS B 1 597 ? 70.207  118.457 111.460 1.00 33.38 ? 597  HIS B NE2   1 
ATOM   9510  N  N     . TRP B 1 598 ? 66.330  116.124 110.075 1.00 22.08 ? 598  TRP B N     1 
ATOM   9511  C  CA    . TRP B 1 598 ? 65.223  116.595 110.906 1.00 22.79 ? 598  TRP B CA    1 
ATOM   9512  C  C     . TRP B 1 598 ? 65.711  117.694 111.834 1.00 22.94 ? 598  TRP B C     1 
ATOM   9513  O  O     . TRP B 1 598 ? 66.763  117.558 112.464 1.00 22.27 ? 598  TRP B O     1 
ATOM   9514  C  CB    . TRP B 1 598 ? 64.651  115.462 111.763 1.00 22.36 ? 598  TRP B CB    1 
ATOM   9515  C  CG    . TRP B 1 598 ? 64.503  114.174 111.045 1.00 22.66 ? 598  TRP B CG    1 
ATOM   9516  C  CD1   . TRP B 1 598 ? 65.306  113.075 111.162 1.00 22.70 ? 598  TRP B CD1   1 
ATOM   9517  C  CD2   . TRP B 1 598 ? 63.502  113.838 110.082 1.00 21.35 ? 598  TRP B CD2   1 
ATOM   9518  N  NE1   . TRP B 1 598 ? 64.866  112.074 110.331 1.00 22.19 ? 598  TRP B NE1   1 
ATOM   9519  C  CE2   . TRP B 1 598 ? 63.760  112.515 109.656 1.00 23.38 ? 598  TRP B CE2   1 
ATOM   9520  C  CE3   . TRP B 1 598 ? 62.411  114.526 109.533 1.00 23.40 ? 598  TRP B CE3   1 
ATOM   9521  C  CZ2   . TRP B 1 598 ? 62.966  111.863 108.707 1.00 22.48 ? 598  TRP B CZ2   1 
ATOM   9522  C  CZ3   . TRP B 1 598 ? 61.621  113.879 108.589 1.00 22.99 ? 598  TRP B CZ3   1 
ATOM   9523  C  CH2   . TRP B 1 598 ? 61.903  112.560 108.186 1.00 24.24 ? 598  TRP B CH2   1 
ATOM   9524  N  N     . THR B 1 599 ? 64.944  118.774 111.934 1.00 23.29 ? 599  THR B N     1 
ATOM   9525  C  CA    . THR B 1 599 ? 65.334  119.876 112.796 1.00 25.65 ? 599  THR B CA    1 
ATOM   9526  C  C     . THR B 1 599 ? 64.198  120.853 113.030 1.00 27.41 ? 599  THR B C     1 
ATOM   9527  O  O     . THR B 1 599 ? 63.189  120.826 112.329 1.00 28.56 ? 599  THR B O     1 
ATOM   9528  C  CB    . THR B 1 599 ? 66.535  120.653 112.187 1.00 25.51 ? 599  THR B CB    1 
ATOM   9529  O  OG1   . THR B 1 599 ? 67.000  121.636 113.120 1.00 25.14 ? 599  THR B OG1   1 
ATOM   9530  C  CG2   . THR B 1 599 ? 66.125  121.356 110.898 1.00 24.52 ? 599  THR B CG2   1 
ATOM   9531  N  N     . ASP B 1 600 ? 64.374  121.704 114.036 1.00 30.12 ? 600  ASP B N     1 
ATOM   9532  C  CA    . ASP B 1 600 ? 63.404  122.740 114.371 1.00 33.36 ? 600  ASP B CA    1 
ATOM   9533  C  C     . ASP B 1 600 ? 64.195  124.039 114.476 1.00 34.02 ? 600  ASP B C     1 
ATOM   9534  O  O     . ASP B 1 600 ? 63.676  125.066 114.905 1.00 35.85 ? 600  ASP B O     1 
ATOM   9535  C  CB    . ASP B 1 600 ? 62.733  122.444 115.711 1.00 36.03 ? 600  ASP B CB    1 
ATOM   9536  C  CG    . ASP B 1 600 ? 61.955  121.138 115.701 1.00 40.23 ? 600  ASP B CG    1 
ATOM   9537  O  OD1   . ASP B 1 600 ? 61.143  120.931 114.766 1.00 43.62 ? 600  ASP B OD1   1 
ATOM   9538  O  OD2   . ASP B 1 600 ? 62.148  120.321 116.633 1.00 39.51 ? 600  ASP B OD2   1 
ATOM   9539  N  N     . SER B 1 601 ? 65.460  123.976 114.072 1.00 33.42 ? 601  SER B N     1 
ATOM   9540  C  CA    . SER B 1 601 ? 66.345  125.128 114.135 1.00 32.71 ? 601  SER B CA    1 
ATOM   9541  C  C     . SER B 1 601 ? 66.715  125.732 112.780 1.00 30.64 ? 601  SER B C     1 
ATOM   9542  O  O     . SER B 1 601 ? 67.895  125.958 112.514 1.00 31.60 ? 601  SER B O     1 
ATOM   9543  C  CB    . SER B 1 601 ? 67.627  124.746 114.882 1.00 34.22 ? 601  SER B CB    1 
ATOM   9544  O  OG    . SER B 1 601 ? 67.339  124.214 116.166 1.00 35.58 ? 601  SER B OG    1 
ATOM   9545  N  N     . LEU B 1 602 ? 65.725  126.007 111.931 1.00 27.46 ? 602  LEU B N     1 
ATOM   9546  C  CA    . LEU B 1 602 ? 66.012  126.608 110.625 1.00 24.44 ? 602  LEU B CA    1 
ATOM   9547  C  C     . LEU B 1 602 ? 66.383  128.083 110.757 1.00 22.78 ? 602  LEU B C     1 
ATOM   9548  O  O     . LEU B 1 602 ? 65.626  128.880 111.297 1.00 22.19 ? 602  LEU B O     1 
ATOM   9549  C  CB    . LEU B 1 602 ? 64.817  126.473 109.679 1.00 21.52 ? 602  LEU B CB    1 
ATOM   9550  C  CG    . LEU B 1 602 ? 64.545  125.081 109.103 1.00 20.75 ? 602  LEU B CG    1 
ATOM   9551  C  CD1   . LEU B 1 602 ? 63.438  125.187 108.063 1.00 18.40 ? 602  LEU B CD1   1 
ATOM   9552  C  CD2   . LEU B 1 602 ? 65.817  124.517 108.476 1.00 16.30 ? 602  LEU B CD2   1 
ATOM   9553  N  N     . PRO B 1 603 ? 67.563  128.464 110.258 1.00 22.99 ? 603  PRO B N     1 
ATOM   9554  C  CA    . PRO B 1 603 ? 68.020  129.856 110.333 1.00 23.62 ? 603  PRO B CA    1 
ATOM   9555  C  C     . PRO B 1 603 ? 67.157  130.831 109.526 1.00 24.15 ? 603  PRO B C     1 
ATOM   9556  O  O     . PRO B 1 603 ? 66.809  130.570 108.373 1.00 24.77 ? 603  PRO B O     1 
ATOM   9557  C  CB    . PRO B 1 603 ? 69.453  129.771 109.818 1.00 21.55 ? 603  PRO B CB    1 
ATOM   9558  C  CG    . PRO B 1 603 ? 69.389  128.645 108.831 1.00 23.03 ? 603  PRO B CG    1 
ATOM   9559  C  CD    . PRO B 1 603 ? 68.562  127.619 109.580 1.00 23.10 ? 603  PRO B CD    1 
ATOM   9560  N  N     . LYS B 1 604 ? 66.806  131.950 110.148 1.00 22.22 ? 604  LYS B N     1 
ATOM   9561  C  CA    . LYS B 1 604 ? 65.994  132.955 109.482 1.00 22.34 ? 604  LYS B CA    1 
ATOM   9562  C  C     . LYS B 1 604 ? 66.420  134.344 109.902 1.00 21.28 ? 604  LYS B C     1 
ATOM   9563  O  O     . LYS B 1 604 ? 67.035  134.516 110.953 1.00 19.11 ? 604  LYS B O     1 
ATOM   9564  C  CB    . LYS B 1 604 ? 64.509  132.768 109.815 1.00 22.75 ? 604  LYS B CB    1 
ATOM   9565  C  CG    . LYS B 1 604 ? 63.890  131.477 109.277 1.00 26.55 ? 604  LYS B CG    1 
ATOM   9566  C  CD    . LYS B 1 604 ? 62.373  131.549 109.318 1.00 26.87 ? 604  LYS B CD    1 
ATOM   9567  C  CE    . LYS B 1 604 ? 61.728  130.183 109.181 1.00 28.96 ? 604  LYS B CE    1 
ATOM   9568  N  NZ    . LYS B 1 604 ? 61.912  129.341 110.411 1.00 31.46 ? 604  LYS B NZ    1 
ATOM   9569  N  N     . THR B 1 605 ? 66.096  135.328 109.069 1.00 21.35 ? 605  THR B N     1 
ATOM   9570  C  CA    . THR B 1 605 ? 66.414  136.720 109.366 1.00 22.53 ? 605  THR B CA    1 
ATOM   9571  C  C     . THR B 1 605 ? 65.301  137.193 110.296 1.00 23.70 ? 605  THR B C     1 
ATOM   9572  O  O     . THR B 1 605 ? 64.291  136.505 110.447 1.00 24.66 ? 605  THR B O     1 
ATOM   9573  C  CB    . THR B 1 605 ? 66.412  137.587 108.088 1.00 21.09 ? 605  THR B CB    1 
ATOM   9574  O  OG1   . THR B 1 605 ? 65.090  137.624 107.534 1.00 19.74 ? 605  THR B OG1   1 
ATOM   9575  C  CG2   . THR B 1 605 ? 67.365  137.010 107.055 1.00 18.97 ? 605  THR B CG2   1 
ATOM   9576  N  N     . ARG B 1 606 ? 65.475  138.351 110.923 1.00 24.50 ? 606  ARG B N     1 
ATOM   9577  C  CA    . ARG B 1 606 ? 64.452  138.860 111.829 1.00 25.76 ? 606  ARG B CA    1 
ATOM   9578  C  C     . ARG B 1 606 ? 63.158  139.111 111.070 1.00 26.82 ? 606  ARG B C     1 
ATOM   9579  O  O     . ARG B 1 606 ? 62.081  139.170 111.657 1.00 25.00 ? 606  ARG B O     1 
ATOM   9580  C  CB    . ARG B 1 606 ? 64.939  140.139 112.507 1.00 25.87 ? 606  ARG B CB    1 
ATOM   9581  C  CG    . ARG B 1 606 ? 66.166  139.895 113.349 1.00 28.43 ? 606  ARG B CG    1 
ATOM   9582  C  CD    . ARG B 1 606 ? 66.617  141.114 114.123 1.00 31.72 ? 606  ARG B CD    1 
ATOM   9583  N  NE    . ARG B 1 606 ? 67.814  140.797 114.900 1.00 35.64 ? 606  ARG B NE    1 
ATOM   9584  C  CZ    . ARG B 1 606 ? 68.983  140.438 114.367 1.00 37.84 ? 606  ARG B CZ    1 
ATOM   9585  N  NH1   . ARG B 1 606 ? 69.119  140.355 113.045 1.00 36.76 ? 606  ARG B NH1   1 
ATOM   9586  N  NH2   . ARG B 1 606 ? 70.015  140.151 115.156 1.00 37.19 ? 606  ARG B NH2   1 
ATOM   9587  N  N     . SER B 1 607 ? 63.282  139.242 109.754 1.00 29.08 ? 607  SER B N     1 
ATOM   9588  C  CA    . SER B 1 607 ? 62.143  139.465 108.875 1.00 30.00 ? 607  SER B CA    1 
ATOM   9589  C  C     . SER B 1 607 ? 61.399  138.153 108.621 1.00 30.34 ? 607  SER B C     1 
ATOM   9590  O  O     . SER B 1 607 ? 60.239  138.158 108.210 1.00 29.99 ? 607  SER B O     1 
ATOM   9591  C  CB    . SER B 1 607 ? 62.627  140.052 107.553 1.00 30.00 ? 607  SER B CB    1 
ATOM   9592  O  OG    . SER B 1 607 ? 61.580  140.095 106.609 1.00 35.67 ? 607  SER B OG    1 
ATOM   9593  N  N     . GLY B 1 608 ? 62.080  137.034 108.862 1.00 30.10 ? 608  GLY B N     1 
ATOM   9594  C  CA    . GLY B 1 608 ? 61.472  135.730 108.665 1.00 29.40 ? 608  GLY B CA    1 
ATOM   9595  C  C     . GLY B 1 608 ? 61.947  134.999 107.421 1.00 30.41 ? 608  GLY B C     1 
ATOM   9596  O  O     . GLY B 1 608 ? 61.488  133.892 107.138 1.00 31.72 ? 608  GLY B O     1 
ATOM   9597  N  N     . LYS B 1 609 ? 62.865  135.608 106.678 1.00 29.51 ? 609  LYS B N     1 
ATOM   9598  C  CA    . LYS B 1 609 ? 63.378  134.997 105.457 1.00 29.18 ? 609  LYS B CA    1 
ATOM   9599  C  C     . LYS B 1 609 ? 64.384  133.891 105.754 1.00 29.55 ? 609  LYS B C     1 
ATOM   9600  O  O     . LYS B 1 609 ? 65.158  133.983 106.709 1.00 28.86 ? 609  LYS B O     1 
ATOM   9601  C  CB    . LYS B 1 609 ? 64.019  136.064 104.568 1.00 28.57 ? 609  LYS B CB    1 
ATOM   9602  N  N     . ILE B 1 610 ? 64.366  132.848 104.928 1.00 29.98 ? 610  ILE B N     1 
ATOM   9603  C  CA    . ILE B 1 610 ? 65.276  131.717 105.082 1.00 30.09 ? 610  ILE B CA    1 
ATOM   9604  C  C     . ILE B 1 610 ? 66.700  132.119 104.706 1.00 30.17 ? 610  ILE B C     1 
ATOM   9605  O  O     . ILE B 1 610 ? 66.913  132.908 103.785 1.00 29.10 ? 610  ILE B O     1 
ATOM   9606  C  CB    . ILE B 1 610 ? 64.812  130.551 104.209 1.00 29.63 ? 610  ILE B CB    1 
ATOM   9607  N  N     . MET B 1 611 ? 67.672  131.575 105.430 1.00 31.50 ? 611  MET B N     1 
ATOM   9608  C  CA    . MET B 1 611 ? 69.080  131.865 105.178 1.00 33.87 ? 611  MET B CA    1 
ATOM   9609  C  C     . MET B 1 611 ? 69.797  130.564 104.817 1.00 34.60 ? 611  MET B C     1 
ATOM   9610  O  O     . MET B 1 611 ? 70.199  129.797 105.698 1.00 35.12 ? 611  MET B O     1 
ATOM   9611  C  CB    . MET B 1 611 ? 69.715  132.497 106.421 1.00 35.67 ? 611  MET B CB    1 
ATOM   9612  C  CG    . MET B 1 611 ? 69.192  133.886 106.749 1.00 38.20 ? 611  MET B CG    1 
ATOM   9613  S  SD    . MET B 1 611 ? 69.778  135.153 105.591 1.00 45.49 ? 611  MET B SD    1 
ATOM   9614  C  CE    . MET B 1 611 ? 71.185  135.822 106.516 1.00 41.18 ? 611  MET B CE    1 
ATOM   9615  N  N     . ARG B 1 612 ? 69.961  130.324 103.519 1.00 34.37 ? 612  ARG B N     1 
ATOM   9616  C  CA    . ARG B 1 612 ? 70.595  129.098 103.048 1.00 34.19 ? 612  ARG B CA    1 
ATOM   9617  C  C     . ARG B 1 612 ? 72.119  129.059 103.000 1.00 33.97 ? 612  ARG B C     1 
ATOM   9618  O  O     . ARG B 1 612 ? 72.700  127.976 103.011 1.00 34.52 ? 612  ARG B O     1 
ATOM   9619  C  CB    . ARG B 1 612 ? 70.046  128.719 101.672 1.00 33.55 ? 612  ARG B CB    1 
ATOM   9620  C  CG    . ARG B 1 612 ? 68.583  128.345 101.687 1.00 35.20 ? 612  ARG B CG    1 
ATOM   9621  C  CD    . ARG B 1 612 ? 68.152  127.714 100.372 1.00 38.51 ? 612  ARG B CD    1 
ATOM   9622  N  NE    . ARG B 1 612 ? 67.005  128.405 99.790  1.00 40.33 ? 612  ARG B NE    1 
ATOM   9623  C  CZ    . ARG B 1 612 ? 65.827  128.537 100.390 1.00 41.99 ? 612  ARG B CZ    1 
ATOM   9624  N  NH1   . ARG B 1 612 ? 65.633  128.024 101.599 1.00 43.45 ? 612  ARG B NH1   1 
ATOM   9625  N  NH2   . ARG B 1 612 ? 64.842  129.188 99.783  1.00 41.53 ? 612  ARG B NH2   1 
ATOM   9626  N  N     . ARG B 1 613 ? 72.766  130.219 102.942 1.00 33.53 ? 613  ARG B N     1 
ATOM   9627  C  CA    . ARG B 1 613 ? 74.225  130.246 102.884 1.00 34.21 ? 613  ARG B CA    1 
ATOM   9628  C  C     . ARG B 1 613 ? 74.846  129.420 104.012 1.00 33.49 ? 613  ARG B C     1 
ATOM   9629  O  O     . ARG B 1 613 ? 75.675  128.542 103.766 1.00 34.03 ? 613  ARG B O     1 
ATOM   9630  C  CB    . ARG B 1 613 ? 74.745  131.684 102.944 1.00 36.61 ? 613  ARG B CB    1 
ATOM   9631  C  CG    . ARG B 1 613 ? 76.255  131.781 103.088 1.00 40.36 ? 613  ARG B CG    1 
ATOM   9632  C  CD    . ARG B 1 613 ? 76.744  133.226 103.076 1.00 45.14 ? 613  ARG B CD    1 
ATOM   9633  N  NE    . ARG B 1 613 ? 76.740  133.798 101.732 1.00 48.44 ? 613  ARG B NE    1 
ATOM   9634  C  CZ    . ARG B 1 613 ? 77.268  134.980 101.420 1.00 51.49 ? 613  ARG B CZ    1 
ATOM   9635  N  NH1   . ARG B 1 613 ? 77.843  135.721 102.362 1.00 51.71 ? 613  ARG B NH1   1 
ATOM   9636  N  NH2   . ARG B 1 613 ? 77.230  135.417 100.163 1.00 51.68 ? 613  ARG B NH2   1 
ATOM   9637  N  N     . ILE B 1 614 ? 74.446  129.697 105.247 1.00 32.28 ? 614  ILE B N     1 
ATOM   9638  C  CA    . ILE B 1 614 ? 74.976  128.950 106.382 1.00 31.25 ? 614  ILE B CA    1 
ATOM   9639  C  C     . ILE B 1 614 ? 74.552  127.488 106.299 1.00 29.67 ? 614  ILE B C     1 
ATOM   9640  O  O     . ILE B 1 614 ? 75.333  126.589 106.617 1.00 28.19 ? 614  ILE B O     1 
ATOM   9641  C  CB    . ILE B 1 614 ? 74.490  129.535 107.721 1.00 32.26 ? 614  ILE B CB    1 
ATOM   9642  C  CG1   . ILE B 1 614 ? 73.015  129.912 107.616 1.00 32.43 ? 614  ILE B CG1   1 
ATOM   9643  C  CG2   . ILE B 1 614 ? 75.338  130.732 108.109 1.00 33.49 ? 614  ILE B CG2   1 
ATOM   9644  C  CD1   . ILE B 1 614 ? 72.450  130.481 108.889 1.00 35.13 ? 614  ILE B CD1   1 
ATOM   9645  N  N     . LEU B 1 615 ? 73.313  127.257 105.868 1.00 28.90 ? 615  LEU B N     1 
ATOM   9646  C  CA    . LEU B 1 615 ? 72.798  125.897 105.737 1.00 28.58 ? 615  LEU B CA    1 
ATOM   9647  C  C     . LEU B 1 615 ? 73.627  125.106 104.744 1.00 28.79 ? 615  LEU B C     1 
ATOM   9648  O  O     . LEU B 1 615 ? 73.891  123.922 104.949 1.00 29.94 ? 615  LEU B O     1 
ATOM   9649  C  CB    . LEU B 1 615 ? 71.337  125.907 105.285 1.00 28.07 ? 615  LEU B CB    1 
ATOM   9650  C  CG    . LEU B 1 615 ? 70.312  126.333 106.333 1.00 28.35 ? 615  LEU B CG    1 
ATOM   9651  C  CD1   . LEU B 1 615 ? 68.914  126.334 105.709 1.00 28.58 ? 615  LEU B CD1   1 
ATOM   9652  C  CD2   . LEU B 1 615 ? 70.366  125.384 107.520 1.00 28.56 ? 615  LEU B CD2   1 
ATOM   9653  N  N     . ARG B 1 616 ? 74.047  125.769 103.673 1.00 29.66 ? 616  ARG B N     1 
ATOM   9654  C  CA    . ARG B 1 616 ? 74.851  125.122 102.643 1.00 33.19 ? 616  ARG B CA    1 
ATOM   9655  C  C     . ARG B 1 616 ? 76.244  124.792 103.166 1.00 33.99 ? 616  ARG B C     1 
ATOM   9656  O  O     . ARG B 1 616 ? 76.826  123.767 102.809 1.00 34.93 ? 616  ARG B O     1 
ATOM   9657  C  CB    . ARG B 1 616 ? 74.963  126.028 101.417 1.00 34.27 ? 616  ARG B CB    1 
ATOM   9658  C  CG    . ARG B 1 616 ? 75.709  125.401 100.256 1.00 37.15 ? 616  ARG B CG    1 
ATOM   9659  C  CD    . ARG B 1 616 ? 75.751  126.332 99.053  1.00 40.51 ? 616  ARG B CD    1 
ATOM   9660  N  NE    . ARG B 1 616 ? 74.415  126.778 98.655  1.00 43.35 ? 616  ARG B NE    1 
ATOM   9661  C  CZ    . ARG B 1 616 ? 73.806  127.857 99.138  1.00 42.90 ? 616  ARG B CZ    1 
ATOM   9662  N  NH1   . ARG B 1 616 ? 74.418  128.610 100.042 1.00 43.82 ? 616  ARG B NH1   1 
ATOM   9663  N  NH2   . ARG B 1 616 ? 72.588  128.182 98.720  1.00 43.04 ? 616  ARG B NH2   1 
ATOM   9664  N  N     . LYS B 1 617 ? 76.777  125.665 104.014 1.00 35.66 ? 617  LYS B N     1 
ATOM   9665  C  CA    . LYS B 1 617 ? 78.103  125.453 104.583 1.00 36.16 ? 617  LYS B CA    1 
ATOM   9666  C  C     . LYS B 1 617 ? 78.106  124.306 105.592 1.00 35.63 ? 617  LYS B C     1 
ATOM   9667  O  O     . LYS B 1 617 ? 78.944  123.405 105.521 1.00 35.16 ? 617  LYS B O     1 
ATOM   9668  C  CB    . LYS B 1 617 ? 78.597  126.735 105.251 1.00 38.06 ? 617  LYS B CB    1 
ATOM   9669  C  CG    . LYS B 1 617 ? 78.655  127.920 104.309 1.00 39.84 ? 617  LYS B CG    1 
ATOM   9670  C  CD    . LYS B 1 617 ? 79.532  129.021 104.867 1.00 41.18 ? 617  LYS B CD    1 
ATOM   9671  C  CE    . LYS B 1 617 ? 79.798  130.078 103.811 1.00 43.13 ? 617  LYS B CE    1 
ATOM   9672  N  NZ    . LYS B 1 617 ? 80.842  131.039 104.259 1.00 45.21 ? 617  LYS B NZ    1 
ATOM   9673  N  N     . ILE B 1 618 ? 77.160  124.340 106.524 1.00 35.25 ? 618  ILE B N     1 
ATOM   9674  C  CA    . ILE B 1 618 ? 77.061  123.301 107.540 1.00 34.91 ? 618  ILE B CA    1 
ATOM   9675  C  C     . ILE B 1 618 ? 76.895  121.926 106.901 1.00 34.06 ? 618  ILE B C     1 
ATOM   9676  O  O     . ILE B 1 618 ? 77.596  120.978 107.256 1.00 35.70 ? 618  ILE B O     1 
ATOM   9677  C  CB    . ILE B 1 618 ? 75.868  123.568 108.491 1.00 34.79 ? 618  ILE B CB    1 
ATOM   9678  C  CG1   . ILE B 1 618 ? 76.135  124.832 109.315 1.00 35.50 ? 618  ILE B CG1   1 
ATOM   9679  C  CG2   . ILE B 1 618 ? 75.651  122.376 109.414 1.00 36.36 ? 618  ILE B CG2   1 
ATOM   9680  C  CD1   . ILE B 1 618 ? 74.963  125.271 110.174 1.00 36.22 ? 618  ILE B CD1   1 
ATOM   9681  N  N     . ALA B 1 619 ? 75.972  121.824 105.953 1.00 34.60 ? 619  ALA B N     1 
ATOM   9682  C  CA    . ALA B 1 619 ? 75.708  120.559 105.273 1.00 33.93 ? 619  ALA B CA    1 
ATOM   9683  C  C     . ALA B 1 619 ? 76.958  120.014 104.599 1.00 33.75 ? 619  ALA B C     1 
ATOM   9684  O  O     . ALA B 1 619 ? 77.276  118.832 104.724 1.00 32.86 ? 619  ALA B O     1 
ATOM   9685  C  CB    . ALA B 1 619 ? 74.601  120.742 104.243 1.00 32.61 ? 619  ALA B CB    1 
ATOM   9686  N  N     . ALA B 1 620 ? 77.664  120.884 103.887 1.00 34.38 ? 620  ALA B N     1 
ATOM   9687  C  CA    . ALA B 1 620 ? 78.877  120.493 103.183 1.00 35.69 ? 620  ALA B CA    1 
ATOM   9688  C  C     . ALA B 1 620 ? 79.913  119.963 104.158 1.00 36.54 ? 620  ALA B C     1 
ATOM   9689  O  O     . ALA B 1 620 ? 80.725  119.104 103.815 1.00 36.50 ? 620  ALA B O     1 
ATOM   9690  C  CB    . ALA B 1 620 ? 79.439  121.681 102.417 1.00 34.97 ? 620  ALA B CB    1 
ATOM   9691  N  N     . GLY B 1 621 ? 79.871  120.477 105.381 1.00 37.56 ? 621  GLY B N     1 
ATOM   9692  C  CA    . GLY B 1 621 ? 80.817  120.056 106.395 1.00 38.34 ? 621  GLY B CA    1 
ATOM   9693  C  C     . GLY B 1 621 ? 81.895  121.103 106.587 1.00 39.23 ? 621  GLY B C     1 
ATOM   9694  O  O     . GLY B 1 621 ? 82.884  120.864 107.281 1.00 40.53 ? 621  GLY B O     1 
ATOM   9695  N  N     . ASP B 1 622 ? 81.709  122.264 105.961 1.00 38.79 ? 622  ASP B N     1 
ATOM   9696  C  CA    . ASP B 1 622 ? 82.667  123.356 106.064 1.00 38.51 ? 622  ASP B CA    1 
ATOM   9697  C  C     . ASP B 1 622 ? 82.343  124.223 107.276 1.00 38.58 ? 622  ASP B C     1 
ATOM   9698  O  O     . ASP B 1 622 ? 81.970  125.388 107.134 1.00 39.08 ? 622  ASP B O     1 
ATOM   9699  C  CB    . ASP B 1 622 ? 82.639  124.201 104.793 1.00 37.96 ? 622  ASP B CB    1 
ATOM   9700  N  N     . GLY B 1 627 ? 79.603  133.347 109.245 1.00 42.53 ? 627  GLY B N     1 
ATOM   9701  C  CA    . GLY B 1 627 ? 79.976  134.692 108.848 1.00 43.77 ? 627  GLY B CA    1 
ATOM   9702  C  C     . GLY B 1 627 ? 78.787  135.635 108.834 1.00 45.53 ? 627  GLY B C     1 
ATOM   9703  O  O     . GLY B 1 627 ? 78.940  136.857 108.919 1.00 46.04 ? 627  GLY B O     1 
ATOM   9704  N  N     . ASP B 1 628 ? 77.594  135.062 108.723 1.00 45.96 ? 628  ASP B N     1 
ATOM   9705  C  CA    . ASP B 1 628 ? 76.362  135.840 108.698 1.00 45.96 ? 628  ASP B CA    1 
ATOM   9706  C  C     . ASP B 1 628 ? 75.436  135.324 109.796 1.00 45.58 ? 628  ASP B C     1 
ATOM   9707  O  O     . ASP B 1 628 ? 74.242  135.129 109.575 1.00 47.30 ? 628  ASP B O     1 
ATOM   9708  C  CB    . ASP B 1 628 ? 75.688  135.705 107.332 1.00 46.66 ? 628  ASP B CB    1 
ATOM   9709  N  N     . THR B 1 629 ? 75.997  135.107 110.980 1.00 42.85 ? 629  THR B N     1 
ATOM   9710  C  CA    . THR B 1 629 ? 75.228  134.595 112.107 1.00 40.73 ? 629  THR B CA    1 
ATOM   9711  C  C     . THR B 1 629 ? 74.485  135.683 112.876 1.00 40.75 ? 629  THR B C     1 
ATOM   9712  O  O     . THR B 1 629 ? 73.325  135.507 113.255 1.00 40.99 ? 629  THR B O     1 
ATOM   9713  C  CB    . THR B 1 629 ? 76.145  133.830 113.079 1.00 39.22 ? 629  THR B CB    1 
ATOM   9714  O  OG1   . THR B 1 629 ? 76.862  132.823 112.355 1.00 37.64 ? 629  THR B OG1   1 
ATOM   9715  C  CG2   . THR B 1 629 ? 75.326  133.162 114.175 1.00 38.34 ? 629  THR B CG2   1 
ATOM   9716  N  N     . SER B 1 630 ? 75.158  136.805 113.104 1.00 40.35 ? 630  SER B N     1 
ATOM   9717  C  CA    . SER B 1 630 ? 74.573  137.923 113.838 1.00 39.13 ? 630  SER B CA    1 
ATOM   9718  C  C     . SER B 1 630 ? 73.311  138.488 113.168 1.00 38.35 ? 630  SER B C     1 
ATOM   9719  O  O     . SER B 1 630 ? 72.467  139.092 113.835 1.00 38.16 ? 630  SER B O     1 
ATOM   9720  C  CB    . SER B 1 630 ? 75.615  139.036 114.000 1.00 38.71 ? 630  SER B CB    1 
ATOM   9721  O  OG    . SER B 1 630 ? 75.986  139.567 112.740 1.00 39.60 ? 630  SER B OG    1 
ATOM   9722  N  N     . THR B 1 631 ? 73.185  138.290 111.857 1.00 37.09 ? 631  THR B N     1 
ATOM   9723  C  CA    . THR B 1 631 ? 72.024  138.784 111.116 1.00 35.97 ? 631  THR B CA    1 
ATOM   9724  C  C     . THR B 1 631 ? 70.773  137.929 111.334 1.00 36.26 ? 631  THR B C     1 
ATOM   9725  O  O     . THR B 1 631 ? 69.658  138.354 111.036 1.00 36.79 ? 631  THR B O     1 
ATOM   9726  C  CB    . THR B 1 631 ? 72.298  138.821 109.601 1.00 36.03 ? 631  THR B CB    1 
ATOM   9727  O  OG1   . THR B 1 631 ? 71.123  139.262 108.912 1.00 38.35 ? 631  THR B OG1   1 
ATOM   9728  C  CG2   . THR B 1 631 ? 72.668  137.442 109.094 1.00 35.01 ? 631  THR B CG2   1 
ATOM   9729  N  N     . LEU B 1 632 ? 70.966  136.719 111.847 1.00 34.78 ? 632  LEU B N     1 
ATOM   9730  C  CA    . LEU B 1 632 ? 69.855  135.812 112.092 1.00 33.63 ? 632  LEU B CA    1 
ATOM   9731  C  C     . LEU B 1 632 ? 69.048  136.245 113.304 1.00 33.73 ? 632  LEU B C     1 
ATOM   9732  O  O     . LEU B 1 632 ? 69.596  136.787 114.263 1.00 34.77 ? 632  LEU B O     1 
ATOM   9733  C  CB    . LEU B 1 632 ? 70.379  134.399 112.317 1.00 32.22 ? 632  LEU B CB    1 
ATOM   9734  C  CG    . LEU B 1 632 ? 71.205  133.809 111.177 1.00 34.51 ? 632  LEU B CG    1 
ATOM   9735  C  CD1   . LEU B 1 632 ? 71.719  132.435 111.592 1.00 32.97 ? 632  LEU B CD1   1 
ATOM   9736  C  CD2   . LEU B 1 632 ? 70.365  133.733 109.908 1.00 32.78 ? 632  LEU B CD2   1 
ATOM   9737  N  N     . ALA B 1 633 ? 67.743  135.999 113.262 1.00 31.54 ? 633  ALA B N     1 
ATOM   9738  C  CA    . ALA B 1 633 ? 66.860  136.357 114.362 1.00 30.76 ? 633  ALA B CA    1 
ATOM   9739  C  C     . ALA B 1 633 ? 67.219  135.542 115.605 1.00 29.98 ? 633  ALA B C     1 
ATOM   9740  O  O     . ALA B 1 633 ? 66.893  135.921 116.729 1.00 28.66 ? 633  ALA B O     1 
ATOM   9741  C  CB    . ALA B 1 633 ? 65.403  136.113 113.963 1.00 31.43 ? 633  ALA B CB    1 
ATOM   9742  N  N     . ASP B 1 634 ? 67.874  134.407 115.397 1.00 29.92 ? 634  ASP B N     1 
ATOM   9743  C  CA    . ASP B 1 634 ? 68.309  133.558 116.501 1.00 31.67 ? 634  ASP B CA    1 
ATOM   9744  C  C     . ASP B 1 634 ? 69.583  132.820 116.116 1.00 33.77 ? 634  ASP B C     1 
ATOM   9745  O  O     . ASP B 1 634 ? 69.539  131.707 115.573 1.00 32.51 ? 634  ASP B O     1 
ATOM   9746  C  CB    . ASP B 1 634 ? 67.235  132.542 116.898 1.00 30.54 ? 634  ASP B CB    1 
ATOM   9747  C  CG    . ASP B 1 634 ? 67.727  131.572 117.965 1.00 30.73 ? 634  ASP B CG    1 
ATOM   9748  O  OD1   . ASP B 1 634 ? 68.704  131.912 118.667 1.00 28.39 ? 634  ASP B OD1   1 
ATOM   9749  O  OD2   . ASP B 1 634 ? 67.139  130.478 118.110 1.00 31.18 ? 634  ASP B OD2   1 
ATOM   9750  N  N     . PRO B 1 635 ? 70.716  133.453 116.409 1.00 34.47 ? 635  PRO B N     1 
ATOM   9751  C  CA    . PRO B 1 635 ? 72.030  132.901 116.108 1.00 36.75 ? 635  PRO B CA    1 
ATOM   9752  C  C     . PRO B 1 635 ? 72.280  131.558 116.803 1.00 37.48 ? 635  PRO B C     1 
ATOM   9753  O  O     . PRO B 1 635 ? 73.296  130.911 116.564 1.00 38.40 ? 635  PRO B O     1 
ATOM   9754  C  CB    . PRO B 1 635 ? 73.109  133.909 116.512 1.00 36.09 ? 635  PRO B CB    1 
ATOM   9755  N  N     . GLY B 1 636 ? 71.351  131.147 117.658 1.00 38.45 ? 636  GLY B N     1 
ATOM   9756  C  CA    . GLY B 1 636 ? 71.500  129.893 118.374 1.00 38.27 ? 636  GLY B CA    1 
ATOM   9757  C  C     . GLY B 1 636 ? 71.247  128.631 117.564 1.00 38.17 ? 636  GLY B C     1 
ATOM   9758  O  O     . GLY B 1 636 ? 71.665  127.544 117.969 1.00 39.65 ? 636  GLY B O     1 
ATOM   9759  N  N     . VAL B 1 637 ? 70.564  128.757 116.430 1.00 36.26 ? 637  VAL B N     1 
ATOM   9760  C  CA    . VAL B 1 637 ? 70.287  127.593 115.595 1.00 34.98 ? 637  VAL B CA    1 
ATOM   9761  C  C     . VAL B 1 637 ? 71.566  127.047 114.972 1.00 34.57 ? 637  VAL B C     1 
ATOM   9762  O  O     . VAL B 1 637 ? 71.678  125.851 114.704 1.00 34.12 ? 637  VAL B O     1 
ATOM   9763  C  CB    . VAL B 1 637 ? 69.294  127.931 114.458 1.00 33.45 ? 637  VAL B CB    1 
ATOM   9764  C  CG1   . VAL B 1 637 ? 67.953  128.331 115.040 1.00 30.74 ? 637  VAL B CG1   1 
ATOM   9765  C  CG2   . VAL B 1 637 ? 69.856  129.038 113.589 1.00 31.36 ? 637  VAL B CG2   1 
ATOM   9766  N  N     . VAL B 1 638 ? 72.531  127.929 114.752 1.00 35.17 ? 638  VAL B N     1 
ATOM   9767  C  CA    . VAL B 1 638 ? 73.801  127.542 114.151 1.00 35.94 ? 638  VAL B CA    1 
ATOM   9768  C  C     . VAL B 1 638 ? 74.490  126.411 114.921 1.00 36.62 ? 638  VAL B C     1 
ATOM   9769  O  O     . VAL B 1 638 ? 74.834  125.368 114.349 1.00 36.14 ? 638  VAL B O     1 
ATOM   9770  C  CB    . VAL B 1 638 ? 74.754  128.750 114.067 1.00 35.20 ? 638  VAL B CB    1 
ATOM   9771  C  CG1   . VAL B 1 638 ? 75.979  128.395 113.232 1.00 34.95 ? 638  VAL B CG1   1 
ATOM   9772  C  CG2   . VAL B 1 638 ? 74.024  129.937 113.471 1.00 33.64 ? 638  VAL B CG2   1 
ATOM   9773  N  N     . GLU B 1 639 ? 74.682  126.613 116.220 1.00 36.53 ? 639  GLU B N     1 
ATOM   9774  C  CA    . GLU B 1 639 ? 75.335  125.611 117.054 1.00 36.22 ? 639  GLU B CA    1 
ATOM   9775  C  C     . GLU B 1 639 ? 74.532  124.319 117.113 1.00 35.77 ? 639  GLU B C     1 
ATOM   9776  O  O     . GLU B 1 639 ? 75.100  123.227 117.055 1.00 36.72 ? 639  GLU B O     1 
ATOM   9777  C  CB    . GLU B 1 639 ? 75.554  126.159 118.462 1.00 37.56 ? 639  GLU B CB    1 
ATOM   9778  N  N     . LYS B 1 640 ? 73.210  124.445 117.225 1.00 35.47 ? 640  LYS B N     1 
ATOM   9779  C  CA    . LYS B 1 640 ? 72.336  123.275 117.291 1.00 33.87 ? 640  LYS B CA    1 
ATOM   9780  C  C     . LYS B 1 640 ? 72.370  122.488 115.982 1.00 34.61 ? 640  LYS B C     1 
ATOM   9781  O  O     . LYS B 1 640 ? 72.446  121.253 115.988 1.00 34.59 ? 640  LYS B O     1 
ATOM   9782  C  CB    . LYS B 1 640 ? 70.909  123.697 117.608 1.00 31.81 ? 640  LYS B CB    1 
ATOM   9783  N  N     . LEU B 1 641 ? 72.316  123.206 114.862 1.00 33.38 ? 641  LEU B N     1 
ATOM   9784  C  CA    . LEU B 1 641 ? 72.347  122.567 113.553 1.00 32.87 ? 641  LEU B CA    1 
ATOM   9785  C  C     . LEU B 1 641 ? 73.655  121.822 113.350 1.00 33.21 ? 641  LEU B C     1 
ATOM   9786  O  O     . LEU B 1 641 ? 73.692  120.797 112.669 1.00 33.70 ? 641  LEU B O     1 
ATOM   9787  C  CB    . LEU B 1 641 ? 72.163  123.602 112.442 1.00 31.81 ? 641  LEU B CB    1 
ATOM   9788  C  CG    . LEU B 1 641 ? 70.772  124.223 112.307 1.00 31.08 ? 641  LEU B CG    1 
ATOM   9789  C  CD1   . LEU B 1 641 ? 70.771  125.197 111.138 1.00 28.91 ? 641  LEU B CD1   1 
ATOM   9790  C  CD2   . LEU B 1 641 ? 69.732  123.128 112.092 1.00 31.03 ? 641  LEU B CD2   1 
ATOM   9791  N  N     . LEU B 1 642 ? 74.727  122.341 113.939 1.00 34.98 ? 642  LEU B N     1 
ATOM   9792  C  CA    . LEU B 1 642 ? 76.037  121.706 113.832 1.00 37.03 ? 642  LEU B CA    1 
ATOM   9793  C  C     . LEU B 1 642 ? 76.013  120.346 114.517 1.00 37.94 ? 642  LEU B C     1 
ATOM   9794  O  O     . LEU B 1 642 ? 76.308  119.323 113.892 1.00 38.04 ? 642  LEU B O     1 
ATOM   9795  C  CB    . LEU B 1 642 ? 77.108  122.590 114.472 1.00 37.00 ? 642  LEU B CB    1 
ATOM   9796  C  CG    . LEU B 1 642 ? 77.446  123.861 113.689 1.00 38.61 ? 642  LEU B CG    1 
ATOM   9797  C  CD1   . LEU B 1 642 ? 78.470  124.694 114.452 1.00 36.94 ? 642  LEU B CD1   1 
ATOM   9798  C  CD2   . LEU B 1 642 ? 77.990  123.473 112.315 1.00 37.30 ? 642  LEU B CD2   1 
ATOM   9799  N  N     . GLU B 1 643 ? 75.651  120.343 115.798 1.00 38.54 ? 643  GLU B N     1 
ATOM   9800  C  CA    . GLU B 1 643 ? 75.576  119.114 116.581 1.00 39.15 ? 643  GLU B CA    1 
ATOM   9801  C  C     . GLU B 1 643 ? 74.719  118.060 115.886 1.00 39.98 ? 643  GLU B C     1 
ATOM   9802  O  O     . GLU B 1 643 ? 75.122  116.900 115.782 1.00 40.42 ? 643  GLU B O     1 
ATOM   9803  C  CB    . GLU B 1 643 ? 75.016  119.415 117.958 1.00 40.13 ? 643  GLU B CB    1 
ATOM   9804  N  N     . GLU B 1 644 ? 73.540  118.462 115.412 1.00 40.36 ? 644  GLU B N     1 
ATOM   9805  C  CA    . GLU B 1 644 ? 72.643  117.538 114.718 1.00 40.71 ? 644  GLU B CA    1 
ATOM   9806  C  C     . GLU B 1 644 ? 73.367  116.967 113.499 1.00 41.70 ? 644  GLU B C     1 
ATOM   9807  O  O     . GLU B 1 644 ? 73.293  115.772 113.221 1.00 41.51 ? 644  GLU B O     1 
ATOM   9808  C  CB    . GLU B 1 644 ? 71.369  118.260 114.257 1.00 40.76 ? 644  GLU B CB    1 
ATOM   9809  C  CG    . GLU B 1 644 ? 70.560  118.926 115.360 1.00 39.68 ? 644  GLU B CG    1 
ATOM   9810  C  CD    . GLU B 1 644 ? 69.321  119.631 114.824 1.00 39.79 ? 644  GLU B CD    1 
ATOM   9811  O  OE1   . GLU B 1 644 ? 69.450  120.403 113.850 1.00 39.84 ? 644  GLU B OE1   1 
ATOM   9812  O  OE2   . GLU B 1 644 ? 68.220  119.422 115.379 1.00 39.36 ? 644  GLU B OE2   1 
ATOM   9813  N  N     . LYS B 1 645 ? 74.066  117.839 112.776 1.00 43.21 ? 645  LYS B N     1 
ATOM   9814  C  CA    . LYS B 1 645 ? 74.822  117.447 111.587 1.00 44.34 ? 645  LYS B CA    1 
ATOM   9815  C  C     . LYS B 1 645 ? 75.981  116.516 111.941 1.00 45.39 ? 645  LYS B C     1 
ATOM   9816  O  O     . LYS B 1 645 ? 76.385  115.674 111.130 1.00 45.19 ? 645  LYS B O     1 
ATOM   9817  C  CB    . LYS B 1 645 ? 75.360  118.697 110.881 1.00 43.57 ? 645  LYS B CB    1 
ATOM   9818  C  CG    . LYS B 1 645 ? 76.440  118.440 109.833 1.00 43.33 ? 645  LYS B CG    1 
ATOM   9819  C  CD    . LYS B 1 645 ? 75.938  117.571 108.691 1.00 43.20 ? 645  LYS B CD    1 
ATOM   9820  C  CE    . LYS B 1 645 ? 77.015  117.388 107.627 1.00 44.04 ? 645  LYS B CE    1 
ATOM   9821  N  NZ    . LYS B 1 645 ? 78.250  116.735 108.167 1.00 43.48 ? 645  LYS B NZ    1 
ATOM   9822  N  N     . GLN B 1 646 ? 76.511  116.666 113.153 1.00 46.10 ? 646  GLN B N     1 
ATOM   9823  C  CA    . GLN B 1 646 ? 77.627  115.841 113.606 1.00 47.12 ? 646  GLN B CA    1 
ATOM   9824  C  C     . GLN B 1 646 ? 77.169  114.432 113.989 1.00 46.91 ? 646  GLN B C     1 
ATOM   9825  O  O     . GLN B 1 646 ? 77.976  113.598 114.404 1.00 46.64 ? 646  GLN B O     1 
ATOM   9826  C  CB    . GLN B 1 646 ? 78.327  116.499 114.808 1.00 47.95 ? 646  GLN B CB    1 
ATOM   9827  C  CG    . GLN B 1 646 ? 79.740  115.972 115.051 1.00 50.68 ? 646  GLN B CG    1 
ATOM   9828  C  CD    . GLN B 1 646 ? 80.234  116.245 116.449 1.00 53.06 ? 646  GLN B CD    1 
ATOM   9829  O  OE1   . GLN B 1 646 ? 80.260  117.371 116.926 1.00 53.61 ? 646  GLN B OE1   1 
ATOM   9830  N  NE2   . GLN B 1 646 ? 80.653  115.179 117.123 1.00 53.37 ? 646  GLN B NE2   1 
ATOM   9831  N  N     . ALA B 1 647 ? 75.875  114.164 113.839 1.00 46.74 ? 647  ALA B N     1 
ATOM   9832  C  CA    . ALA B 1 647 ? 75.329  112.852 114.170 1.00 47.62 ? 647  ALA B CA    1 
ATOM   9833  C  C     . ALA B 1 647 ? 74.950  112.052 112.919 1.00 48.47 ? 647  ALA B C     1 
ATOM   9834  O  O     . ALA B 1 647 ? 75.066  112.600 111.799 1.00 49.07 ? 647  ALA B O     1 
ATOM   9835  C  CB    . ALA B 1 647 ? 74.115  113.010 115.079 1.00 47.27 ? 647  ALA B CB    1 
HETATM 9836  MG MG    . MG  C 2 .   ? 62.771  150.515 69.333  1.00 15.24 ? 902  MG  A MG    1 
HETATM 9837  N  N1A   . COA D 3 .   ? 52.691  163.449 46.658  1.00 35.44 ? 990  COA A N1A   1 
HETATM 9838  C  C2A   . COA D 3 .   ? 53.154  163.796 47.854  1.00 36.17 ? 990  COA A C2A   1 
HETATM 9839  N  N3A   . COA D 3 .   ? 52.448  163.770 49.026  1.00 36.29 ? 990  COA A N3A   1 
HETATM 9840  C  C4A   . COA D 3 .   ? 51.127  163.341 48.869  1.00 36.49 ? 990  COA A C4A   1 
HETATM 9841  C  C5A   . COA D 3 .   ? 50.577  162.960 47.662  1.00 35.42 ? 990  COA A C5A   1 
HETATM 9842  C  C6A   . COA D 3 .   ? 51.429  163.033 46.479  1.00 34.92 ? 990  COA A C6A   1 
HETATM 9843  N  N6A   . COA D 3 .   ? 50.988  162.692 45.270  1.00 33.88 ? 990  COA A N6A   1 
HETATM 9844  N  N7A   . COA D 3 .   ? 49.243  162.584 47.848  1.00 35.95 ? 990  COA A N7A   1 
HETATM 9845  C  C8A   . COA D 3 .   ? 49.041  162.734 49.132  1.00 37.24 ? 990  COA A C8A   1 
HETATM 9846  N  N9A   . COA D 3 .   ? 50.146  163.191 49.828  1.00 37.80 ? 990  COA A N9A   1 
HETATM 9847  C  C1B   . COA D 3 .   ? 50.275  163.466 51.228  1.00 40.44 ? 990  COA A C1B   1 
HETATM 9848  C  C2B   . COA D 3 .   ? 49.824  164.880 51.656  1.00 42.32 ? 990  COA A C2B   1 
HETATM 9849  O  O2B   . COA D 3 .   ? 50.889  165.836 51.444  1.00 42.40 ? 990  COA A O2B   1 
HETATM 9850  C  C3B   . COA D 3 .   ? 49.361  164.662 53.121  1.00 44.14 ? 990  COA A C3B   1 
HETATM 9851  O  O3B   . COA D 3 .   ? 50.484  164.816 54.004  1.00 46.45 ? 990  COA A O3B   1 
HETATM 9852  P  P3B   . COA D 3 .   ? 50.705  166.046 55.007  1.00 48.03 ? 990  COA A P3B   1 
HETATM 9853  O  O7A   . COA D 3 .   ? 51.795  165.545 55.907  1.00 48.61 ? 990  COA A O7A   1 
HETATM 9854  O  O8A   . COA D 3 .   ? 51.159  167.165 54.185  1.00 45.53 ? 990  COA A O8A   1 
HETATM 9855  O  O9A   . COA D 3 .   ? 49.415  166.274 55.707  1.00 46.91 ? 990  COA A O9A   1 
HETATM 9856  C  C4B   . COA D 3 .   ? 48.839  163.249 53.152  1.00 44.60 ? 990  COA A C4B   1 
HETATM 9857  O  O4B   . COA D 3 .   ? 49.476  162.605 52.005  1.00 42.86 ? 990  COA A O4B   1 
HETATM 9858  C  C5B   . COA D 3 .   ? 47.325  163.138 53.034  1.00 45.52 ? 990  COA A C5B   1 
HETATM 9859  O  O5B   . COA D 3 .   ? 46.892  163.723 51.800  1.00 47.33 ? 990  COA A O5B   1 
HETATM 9860  P  P1A   . COA D 3 .   ? 45.355  163.877 51.394  1.00 49.51 ? 990  COA A P1A   1 
HETATM 9861  O  O1A   . COA D 3 .   ? 45.247  165.099 50.581  1.00 48.12 ? 990  COA A O1A   1 
HETATM 9862  O  O2A   . COA D 3 .   ? 44.459  163.709 52.611  1.00 49.21 ? 990  COA A O2A   1 
HETATM 9863  O  O3A   . COA D 3 .   ? 45.281  162.624 50.329  1.00 50.10 ? 990  COA A O3A   1 
HETATM 9864  P  P2A   . COA D 3 .   ? 44.102  161.593 50.170  1.00 53.11 ? 990  COA A P2A   1 
HETATM 9865  O  O4A   . COA D 3 .   ? 43.916  161.025 51.522  1.00 53.14 ? 990  COA A O4A   1 
HETATM 9866  O  O5A   . COA D 3 .   ? 44.401  160.711 49.006  1.00 51.97 ? 990  COA A O5A   1 
HETATM 9867  O  O6A   . COA D 3 .   ? 42.851  162.453 49.813  1.00 50.38 ? 990  COA A O6A   1 
HETATM 9868  C  CBP   . COA D 3 .   ? 41.461  163.933 48.451  0.00 46.04 ? 990  COA A CBP   1 
HETATM 9869  C  CCP   . COA D 3 .   ? 42.865  163.475 48.743  0.00 47.61 ? 990  COA A CCP   1 
HETATM 9870  C  CDP   . COA D 3 .   ? 41.554  165.022 47.329  0.00 45.86 ? 990  COA A CDP   1 
HETATM 9871  C  CEP   . COA D 3 .   ? 40.836  164.555 49.719  0.00 45.86 ? 990  COA A CEP   1 
HETATM 9872  C  CAP   . COA D 3 .   ? 40.617  162.682 47.960  0.00 44.95 ? 990  COA A CAP   1 
HETATM 9873  O  OAP   . COA D 3 .   ? 39.242  162.993 47.831  0.00 44.68 ? 990  COA A OAP   1 
HETATM 9874  C  C9P   . COA D 3 .   ? 41.123  161.973 46.675  0.00 43.95 ? 990  COA A C9P   1 
HETATM 9875  O  O9P   . COA D 3 .   ? 40.870  162.383 45.552  0.00 43.71 ? 990  COA A O9P   1 
HETATM 9876  N  N8P   . COA D 3 .   ? 41.873  160.849 46.877  0.00 43.10 ? 990  COA A N8P   1 
HETATM 9877  C  C7P   . COA D 3 .   ? 42.461  160.014 45.799  0.00 42.25 ? 990  COA A C7P   1 
HETATM 9878  C  C6P   . COA D 3 .   ? 43.609  159.084 46.260  0.00 41.55 ? 990  COA A C6P   1 
HETATM 9879  C  C5P   . COA D 3 .   ? 43.392  157.645 45.835  0.00 41.12 ? 990  COA A C5P   1 
HETATM 9880  O  O5P   . COA D 3 .   ? 42.630  156.891 46.501  0.00 41.00 ? 990  COA A O5P   1 
HETATM 9881  N  N4P   . COA D 3 .   ? 44.004  157.181 44.738  0.00 40.83 ? 990  COA A N4P   1 
HETATM 9882  C  C3P   . COA D 3 .   ? 44.016  155.874 44.040  0.00 40.56 ? 990  COA A C3P   1 
HETATM 9883  C  C2P   . COA D 3 .   ? 43.225  156.075 42.737  0.00 40.42 ? 990  COA A C2P   1 
HETATM 9884  S  S1P   . COA D 3 .   ? 43.017  154.370 41.990  0.00 40.31 ? 990  COA A S1P   1 
HETATM 9885  O  "O2'" . PRX E 4 .   ? 41.207  144.775 48.595  1.00 17.28 ? 999  PRX A "O2'" 1 
HETATM 9886  C  "C2'" . PRX E 4 .   ? 41.148  145.002 47.203  1.00 13.22 ? 999  PRX A "C2'" 1 
HETATM 9887  C  "C1'" . PRX E 4 .   ? 41.106  146.596 46.957  1.00 14.05 ? 999  PRX A "C1'" 1 
HETATM 9888  O  "O4'" . PRX E 4 .   ? 42.475  147.012 46.677  1.00 12.85 ? 999  PRX A "O4'" 1 
HETATM 9889  C  "C4'" . PRX E 4 .   ? 43.388  145.851 46.611  1.00 12.61 ? 999  PRX A "C4'" 1 
HETATM 9890  C  "C5'" . PRX E 4 .   ? 44.375  146.031 45.458  1.00 11.79 ? 999  PRX A "C5'" 1 
HETATM 9891  O  "O5'" . PRX E 4 .   ? 45.209  147.146 45.846  1.00 12.61 ? 999  PRX A "O5'" 1 
HETATM 9892  P  P     . PRX E 4 .   ? 46.324  147.716 44.804  1.00 14.72 ? 999  PRX A P     1 
HETATM 9893  O  O1P   . PRX E 4 .   ? 47.209  146.555 44.610  1.00 15.11 ? 999  PRX A O1P   1 
HETATM 9894  O  O2P   . PRX E 4 .   ? 46.979  148.857 45.516  1.00 12.90 ? 999  PRX A O2P   1 
HETATM 9895  O  O3P   . PRX E 4 .   ? 45.570  148.133 43.550  1.00 15.43 ? 999  PRX A O3P   1 
HETATM 9896  C  C1P   . PRX E 4 .   ? 44.719  149.333 43.452  1.00 14.23 ? 999  PRX A C1P   1 
HETATM 9897  C  C2P   . PRX E 4 .   ? 43.798  149.427 42.255  1.00 13.02 ? 999  PRX A C2P   1 
HETATM 9898  C  C3P   . PRX E 4 .   ? 43.327  148.068 41.802  1.00 9.18  ? 999  PRX A C3P   1 
HETATM 9899  C  "C3'" . PRX E 4 .   ? 42.449  144.499 46.408  1.00 12.64 ? 999  PRX A "C3'" 1 
HETATM 9900  O  "O3'" . PRX E 4 .   ? 43.227  143.368 47.021  1.00 12.41 ? 999  PRX A "O3'" 1 
HETATM 9901  N  N9    . PRX E 4 .   ? 40.237  146.932 45.780  1.00 15.87 ? 999  PRX A N9    1 
HETATM 9902  C  C8    . PRX E 4 .   ? 40.636  147.329 44.485  1.00 16.79 ? 999  PRX A C8    1 
HETATM 9903  N  N7    . PRX E 4 .   ? 39.661  147.584 43.586  1.00 17.21 ? 999  PRX A N7    1 
HETATM 9904  C  C5    . PRX E 4 .   ? 38.542  147.326 44.388  1.00 15.27 ? 999  PRX A C5    1 
HETATM 9905  C  C4    . PRX E 4 .   ? 38.880  146.919 45.713  1.00 14.64 ? 999  PRX A C4    1 
HETATM 9906  N  N3    . PRX E 4 .   ? 38.039  146.600 46.730  1.00 14.83 ? 999  PRX A N3    1 
HETATM 9907  C  C2    . PRX E 4 .   ? 36.736  146.680 46.369  1.00 13.66 ? 999  PRX A C2    1 
HETATM 9908  N  N1    . PRX E 4 .   ? 36.291  147.051 45.146  1.00 14.08 ? 999  PRX A N1    1 
HETATM 9909  C  C6    . PRX E 4 .   ? 37.148  147.387 44.095  1.00 14.43 ? 999  PRX A C6    1 
HETATM 9910  N  N6    . PRX E 4 .   ? 36.733  147.771 42.830  1.00 16.38 ? 999  PRX A N6    1 
HETATM 9911  C  C1    . EDO F 5 .   ? 55.565  151.548 44.466  1.00 22.82 ? 801  EDO A C1    1 
HETATM 9912  O  O1    . EDO F 5 .   ? 56.698  151.494 43.582  1.00 24.05 ? 801  EDO A O1    1 
HETATM 9913  C  C2    . EDO F 5 .   ? 55.091  152.959 44.592  1.00 23.12 ? 801  EDO A C2    1 
HETATM 9914  O  O2    . EDO F 5 .   ? 54.671  153.595 43.350  1.00 20.27 ? 801  EDO A O2    1 
HETATM 9915  C  C1    . EDO G 5 .   ? 41.588  141.749 17.694  1.00 44.08 ? 802  EDO A C1    1 
HETATM 9916  O  O1    . EDO G 5 .   ? 40.668  141.873 18.791  1.00 44.47 ? 802  EDO A O1    1 
HETATM 9917  C  C2    . EDO G 5 .   ? 41.554  142.992 16.864  1.00 45.71 ? 802  EDO A C2    1 
HETATM 9918  O  O2    . EDO G 5 .   ? 41.916  144.227 17.559  1.00 46.37 ? 802  EDO A O2    1 
HETATM 9919  C  C1    . EDO H 5 .   ? 56.586  163.165 52.046  1.00 36.70 ? 803  EDO A C1    1 
HETATM 9920  O  O1    . EDO H 5 .   ? 57.424  162.006 51.931  1.00 36.06 ? 803  EDO A O1    1 
HETATM 9921  C  C2    . EDO H 5 .   ? 56.870  164.110 50.925  1.00 37.70 ? 803  EDO A C2    1 
HETATM 9922  O  O2    . EDO H 5 .   ? 56.646  163.587 49.575  1.00 39.10 ? 803  EDO A O2    1 
HETATM 9923  MG MG    . MG  I 2 .   ? 52.527  120.335 104.886 1.00 21.91 ? 901  MG  B MG    1 
HETATM 9924  N  N1A   . COA J 3 .   ? 63.680  107.523 82.793  1.00 30.41 ? 991  COA B N1A   1 
HETATM 9925  C  C2A   . COA J 3 .   ? 63.108  107.200 83.949  1.00 29.93 ? 991  COA B C2A   1 
HETATM 9926  N  N3A   . COA J 3 .   ? 63.737  107.128 85.163  1.00 32.05 ? 991  COA B N3A   1 
HETATM 9927  C  C4A   . COA J 3 .   ? 65.096  107.445 85.107  1.00 32.88 ? 991  COA B C4A   1 
HETATM 9928  C  C5A   . COA J 3 .   ? 65.762  107.787 83.945  1.00 31.60 ? 991  COA B C5A   1 
HETATM 9929  C  C6A   . COA J 3 .   ? 64.983  107.831 82.708  1.00 31.51 ? 991  COA B C6A   1 
HETATM 9930  N  N6A   . COA J 3 .   ? 65.534  108.150 81.538  1.00 29.49 ? 991  COA B N6A   1 
HETATM 9931  N  N7A   . COA J 3 .   ? 67.104  108.041 84.227  1.00 32.22 ? 991  COA B N7A   1 
HETATM 9932  C  C8A   . COA J 3 .   ? 67.207  107.841 85.513  1.00 32.92 ? 991  COA B C8A   1 
HETATM 9933  N  N9A   . COA J 3 .   ? 66.024  107.469 86.124  1.00 34.11 ? 991  COA B N9A   1 
HETATM 9934  C  C1B   . COA J 3 .   ? 65.782  107.171 87.504  1.00 38.06 ? 991  COA B C1B   1 
HETATM 9935  C  C2B   . COA J 3 .   ? 66.294  105.779 87.931  1.00 41.35 ? 991  COA B C2B   1 
HETATM 9936  O  O2B   . COA J 3 .   ? 65.326  104.756 87.590  1.00 42.58 ? 991  COA B O2B   1 
HETATM 9937  C  C3B   . COA J 3 .   ? 66.592  105.971 89.440  1.00 44.28 ? 991  COA B C3B   1 
HETATM 9938  O  O3B   . COA J 3 .   ? 65.408  105.648 90.186  1.00 47.17 ? 991  COA B O3B   1 
HETATM 9939  P  P3B   . COA J 3 .   ? 65.272  104.440 91.226  1.00 47.44 ? 991  COA B P3B   1 
HETATM 9940  O  O7A   . COA J 3 .   ? 64.172  104.914 92.126  1.00 47.49 ? 991  COA B O7A   1 
HETATM 9941  O  O8A   . COA J 3 .   ? 66.544  104.353 91.938  1.00 48.00 ? 991  COA B O8A   1 
HETATM 9942  O  O9A   . COA J 3 .   ? 64.928  103.239 90.428  1.00 46.41 ? 991  COA B O9A   1 
HETATM 9943  C  C4B   . COA J 3 .   ? 66.950  107.425 89.593  1.00 44.24 ? 991  COA B C4B   1 
HETATM 9944  O  O4B   . COA J 3 .   ? 66.454  108.053 88.369  1.00 40.22 ? 991  COA B O4B   1 
HETATM 9945  C  C5B   . COA J 3 .   ? 68.442  107.682 89.753  1.00 48.28 ? 991  COA B C5B   1 
HETATM 9946  O  O5B   . COA J 3 .   ? 69.132  107.434 88.511  1.00 53.95 ? 991  COA B O5B   1 
HETATM 9947  P  P1A   . COA J 3 .   ? 70.344  106.383 88.378  1.00 57.84 ? 991  COA B P1A   1 
HETATM 9948  O  O1A   . COA J 3 .   ? 69.781  105.147 87.807  1.00 57.85 ? 991  COA B O1A   1 
HETATM 9949  O  O2A   . COA J 3 .   ? 71.137  106.305 89.674  1.00 58.36 ? 991  COA B O2A   1 
HETATM 9950  O  O3A   . COA J 3 .   ? 71.163  107.121 87.156  1.00 56.96 ? 991  COA B O3A   1 
HETATM 9951  P  P2A   . COA J 3 .   ? 71.904  108.516 87.234  1.00 58.42 ? 991  COA B P2A   1 
HETATM 9952  O  O4A   . COA J 3 .   ? 72.652  108.483 88.501  1.00 58.84 ? 991  COA B O4A   1 
HETATM 9953  O  O5A   . COA J 3 .   ? 70.928  109.591 86.949  1.00 57.31 ? 991  COA B O5A   1 
HETATM 9954  O  O6A   . COA J 3 .   ? 72.919  108.515 86.069  1.00 55.43 ? 991  COA B O6A   1 
HETATM 9955  C  CBP   . COA J 3 .   ? 74.775  107.705 84.708  0.00 49.62 ? 991  COA B CBP   1 
HETATM 9956  C  CCP   . COA J 3 .   ? 73.752  107.340 85.745  0.00 51.61 ? 991  COA B CCP   1 
HETATM 9957  C  CDP   . COA J 3 .   ? 75.459  106.372 84.267  0.00 49.38 ? 991  COA B CDP   1 
HETATM 9958  C  CEP   . COA J 3 .   ? 75.830  108.645 85.329  0.00 49.37 ? 991  COA B CEP   1 
HETATM 9959  C  CAP   . COA J 3 .   ? 74.009  108.375 83.480  0.00 48.22 ? 991  COA B CAP   1 
HETATM 9960  O  OAP   . COA J 3 .   ? 73.408  107.429 82.615  0.00 47.88 ? 991  COA B OAP   1 
HETATM 9961  C  C9P   . COA J 3 .   ? 74.767  109.451 82.665  0.00 46.94 ? 991  COA B C9P   1 
HETATM 9962  O  O9P   . COA J 3 .   ? 75.534  109.168 81.747  0.00 46.65 ? 991  COA B O9P   1 
HETATM 9963  N  N8P   . COA J 3 .   ? 74.506  110.750 83.038  0.00 45.86 ? 991  COA B N8P   1 
HETATM 9964  C  C7P   . COA J 3 .   ? 75.101  111.954 82.411  0.00 44.76 ? 991  COA B C7P   1 
HETATM 9965  C  C6P   . COA J 3 .   ? 74.387  113.272 82.777  0.00 43.84 ? 991  COA B C6P   1 
HETATM 9966  C  C5P   . COA J 3 .   ? 73.248  113.586 81.848  0.00 43.26 ? 991  COA B C5P   1 
HETATM 9967  O  O5P   . COA J 3 .   ? 72.139  113.014 81.982  0.00 43.11 ? 991  COA B O5P   1 
HETATM 9968  N  N4P   . COA J 3 .   ? 73.425  114.474 80.886  0.00 42.85 ? 991  COA B N4P   1 
HETATM 9969  C  C3P   . COA J 3 .   ? 72.555  115.003 79.831  0.00 42.48 ? 991  COA B C3P   1 
HETATM 9970  C  C2P   . COA J 3 .   ? 73.129  116.372 79.465  0.00 42.27 ? 991  COA B C2P   1 
HETATM 9971  S  S1P   . COA J 3 .   ? 71.781  117.618 79.851  0.00 42.10 ? 991  COA B S1P   1 
HETATM 9972  O  "O2'" . PRX K 4 .   ? 75.410  125.822 85.622  1.00 12.58 ? 998  PRX B "O2'" 1 
HETATM 9973  C  "C2'" . PRX K 4 .   ? 75.597  125.614 84.240  1.00 11.09 ? 998  PRX B "C2'" 1 
HETATM 9974  C  "C1'" . PRX K 4 .   ? 75.637  124.025 83.976  1.00 13.76 ? 998  PRX B "C1'" 1 
HETATM 9975  O  "O4'" . PRX K 4 .   ? 74.307  123.632 83.548  1.00 15.47 ? 998  PRX B "O4'" 1 
HETATM 9976  C  "C4'" . PRX K 4 .   ? 73.413  124.802 83.436  1.00 12.27 ? 998  PRX B "C4'" 1 
HETATM 9977  C  "C5'" . PRX K 4 .   ? 72.502  124.661 82.209  1.00 13.84 ? 998  PRX B "C5'" 1 
HETATM 9978  O  "O5'" . PRX K 4 .   ? 71.592  123.572 82.547  1.00 16.06 ? 998  PRX B "O5'" 1 
HETATM 9979  P  P     . PRX K 4 .   ? 70.544  123.031 81.427  1.00 17.23 ? 998  PRX B P     1 
HETATM 9980  O  O1P   . PRX K 4 .   ? 69.791  124.247 81.072  1.00 12.86 ? 998  PRX B O1P   1 
HETATM 9981  O  O2P   . PRX K 4 .   ? 69.716  122.000 82.121  1.00 14.56 ? 998  PRX B O2P   1 
HETATM 9982  O  O3P   . PRX K 4 .   ? 71.382  122.477 80.287  1.00 19.12 ? 998  PRX B O3P   1 
HETATM 9983  C  C1P   . PRX K 4 .   ? 72.354  121.392 80.394  1.00 18.28 ? 998  PRX B C1P   1 
HETATM 9984  C  C2P   . PRX K 4 .   ? 73.211  121.149 79.169  1.00 19.65 ? 998  PRX B C2P   1 
HETATM 9985  C  C3P   . PRX K 4 .   ? 73.785  122.442 78.624  1.00 20.61 ? 998  PRX B C3P   1 
HETATM 9986  C  "C3'" . PRX K 4 .   ? 74.387  126.149 83.340  1.00 10.50 ? 998  PRX B "C3'" 1 
HETATM 9987  O  "O3'" . PRX K 4 .   ? 73.567  127.273 83.911  1.00 8.82  ? 998  PRX B "O3'" 1 
HETATM 9988  N  N9    . PRX K 4 .   ? 76.616  123.694 82.913  1.00 14.90 ? 998  PRX B N9    1 
HETATM 9989  C  C8    . PRX K 4 .   ? 76.363  123.285 81.597  1.00 12.51 ? 998  PRX B C8    1 
HETATM 9990  N  N7    . PRX K 4 .   ? 77.435  123.035 80.817  1.00 17.00 ? 998  PRX B N7    1 
HETATM 9991  C  C5    . PRX K 4 .   ? 78.451  123.315 81.734  1.00 13.44 ? 998  PRX B C5    1 
HETATM 9992  C  C4    . PRX K 4 .   ? 77.977  123.724 83.007  1.00 13.92 ? 998  PRX B C4    1 
HETATM 9993  N  N3    . PRX K 4 .   ? 78.703  124.068 84.114  1.00 14.65 ? 998  PRX B N3    1 
HETATM 9994  C  C2    . PRX K 4 .   ? 80.035  123.996 83.891  1.00 12.58 ? 998  PRX B C2    1 
HETATM 9995  N  N1    . PRX K 4 .   ? 80.604  123.620 82.724  1.00 11.91 ? 998  PRX B N1    1 
HETATM 9996  C  C6    . PRX K 4 .   ? 79.863  123.267 81.595  1.00 12.95 ? 998  PRX B C6    1 
HETATM 9997  N  N6    . PRX K 4 .   ? 80.397  122.881 80.390  1.00 16.14 ? 998  PRX B N6    1 
HETATM 9998  C  C1    . EDO L 5 .   ? 61.870  117.728 80.632  1.00 17.72 ? 800  EDO B C1    1 
HETATM 9999  O  O1    . EDO L 5 .   ? 62.189  117.114 79.367  1.00 18.43 ? 800  EDO B O1    1 
HETATM 10000 C  C2    . EDO L 5 .   ? 61.456  119.146 80.417  1.00 19.28 ? 800  EDO B C2    1 
HETATM 10001 O  O2    . EDO L 5 .   ? 60.283  119.353 79.564  1.00 19.73 ? 800  EDO B O2    1 
HETATM 10002 C  C1    . EDO M 5 .   ? 63.979  94.567  79.080  1.00 44.74 ? 804  EDO B C1    1 
HETATM 10003 O  O1    . EDO M 5 .   ? 65.140  93.713  79.113  1.00 44.54 ? 804  EDO B O1    1 
HETATM 10004 C  C2    . EDO M 5 .   ? 63.217  94.438  80.361  1.00 45.28 ? 804  EDO B C2    1 
HETATM 10005 O  O2    . EDO M 5 .   ? 63.946  94.801  81.582  1.00 46.11 ? 804  EDO B O2    1 
HETATM 10006 C  C1    . EDO N 5 .   ? 59.932  108.080 86.785  1.00 32.79 ? 805  EDO B C1    1 
HETATM 10007 O  O1    . EDO N 5 .   ? 59.496  107.025 85.909  1.00 33.52 ? 805  EDO B O1    1 
HETATM 10008 C  C2    . EDO N 5 .   ? 58.745  108.736 87.416  1.00 31.91 ? 805  EDO B C2    1 
HETATM 10009 O  O2    . EDO N 5 .   ? 57.890  107.871 88.226  1.00 33.69 ? 805  EDO B O2    1 
HETATM 10010 O  O     . HOH O 6 .   ? 19.502  146.314 30.450  1.00 26.47 ? 1000 HOH A O     1 
HETATM 10011 O  O     . HOH O 6 .   ? 19.022  148.361 27.018  1.00 17.70 ? 1001 HOH A O     1 
HETATM 10012 O  O     . HOH O 6 .   ? 19.351  156.608 26.007  1.00 20.55 ? 1002 HOH A O     1 
HETATM 10013 O  O     . HOH O 6 .   ? 21.939  157.492 29.044  1.00 10.79 ? 1003 HOH A O     1 
HETATM 10014 O  O     . HOH O 6 .   ? 25.498  158.659 24.405  1.00 36.61 ? 1004 HOH A O     1 
HETATM 10015 O  O     . HOH O 6 .   ? 25.598  157.238 28.845  1.00 9.22  ? 1005 HOH A O     1 
HETATM 10016 O  O     . HOH O 6 .   ? 29.737  146.744 27.154  1.00 14.00 ? 1006 HOH A O     1 
HETATM 10017 O  O     . HOH O 6 .   ? 32.130  147.235 25.563  1.00 13.02 ? 1007 HOH A O     1 
HETATM 10018 O  O     . HOH O 6 .   ? 38.034  134.732 20.127  1.00 24.86 ? 1008 HOH A O     1 
HETATM 10019 O  O     . HOH O 6 .   ? 39.996  144.232 20.115  1.00 18.67 ? 1009 HOH A O     1 
HETATM 10020 O  O     . HOH O 6 .   ? 50.818  142.260 14.479  1.00 19.86 ? 1010 HOH A O     1 
HETATM 10021 O  O     . HOH O 6 .   ? 55.294  145.842 18.485  1.00 13.61 ? 1011 HOH A O     1 
HETATM 10022 O  O     . HOH O 6 .   ? 50.863  137.602 16.819  1.00 13.44 ? 1012 HOH A O     1 
HETATM 10023 O  O     . HOH O 6 .   ? 53.112  131.507 26.201  1.00 14.06 ? 1013 HOH A O     1 
HETATM 10024 O  O     . HOH O 6 .   ? 55.224  128.225 32.021  1.00 17.85 ? 1014 HOH A O     1 
HETATM 10025 O  O     . HOH O 6 .   ? 54.416  123.583 37.191  1.00 14.50 ? 1015 HOH A O     1 
HETATM 10026 O  O     . HOH O 6 .   ? 54.363  121.541 42.753  1.00 21.98 ? 1016 HOH A O     1 
HETATM 10027 O  O     . HOH O 6 .   ? 58.398  147.491 24.948  1.00 12.75 ? 1017 HOH A O     1 
HETATM 10028 O  O     . HOH O 6 .   ? 59.189  145.744 26.956  1.00 10.64 ? 1018 HOH A O     1 
HETATM 10029 O  O     . HOH O 6 .   ? 48.949  175.492 41.951  1.00 21.56 ? 1019 HOH A O     1 
HETATM 10030 O  O     . HOH O 6 .   ? 43.930  170.566 42.641  1.00 9.82  ? 1020 HOH A O     1 
HETATM 10031 O  O     . HOH O 6 .   ? 46.250  173.050 26.555  1.00 15.73 ? 1021 HOH A O     1 
HETATM 10032 O  O     . HOH O 6 .   ? 40.315  170.309 25.917  1.00 20.89 ? 1022 HOH A O     1 
HETATM 10033 O  O     . HOH O 6 .   ? 57.136  162.394 15.956  1.00 33.08 ? 1023 HOH A O     1 
HETATM 10034 O  O     . HOH O 6 .   ? 72.475  162.841 23.880  1.00 38.37 ? 1024 HOH A O     1 
HETATM 10035 O  O     . HOH O 6 .   ? 69.931  148.335 25.313  1.00 19.66 ? 1025 HOH A O     1 
HETATM 10036 O  O     . HOH O 6 .   ? 72.449  149.855 24.397  1.00 30.89 ? 1026 HOH A O     1 
HETATM 10037 O  O     . HOH O 6 .   ? 63.578  144.225 29.790  1.00 25.71 ? 1027 HOH A O     1 
HETATM 10038 O  O     . HOH O 6 .   ? 65.574  142.211 30.405  1.00 28.35 ? 1028 HOH A O     1 
HETATM 10039 O  O     . HOH O 6 .   ? 53.662  160.254 41.990  1.00 8.12  ? 1029 HOH A O     1 
HETATM 10040 O  O     . HOH O 6 .   ? 56.375  158.520 40.336  1.00 8.97  ? 1030 HOH A O     1 
HETATM 10041 O  O     . HOH O 6 .   ? 53.376  168.233 40.077  1.00 9.73  ? 1031 HOH A O     1 
HETATM 10042 O  O     . HOH O 6 .   ? 46.624  164.183 40.331  1.00 6.22  ? 1032 HOH A O     1 
HETATM 10043 O  O     . HOH O 6 .   ? 47.540  162.011 41.992  1.00 11.82 ? 1033 HOH A O     1 
HETATM 10044 O  O     . HOH O 6 .   ? 51.965  162.673 42.645  1.00 20.47 ? 1034 HOH A O     1 
HETATM 10045 O  O     . HOH O 6 .   ? 60.942  146.689 29.033  1.00 14.50 ? 1035 HOH A O     1 
HETATM 10046 O  O     . HOH O 6 .   ? 63.950  149.921 21.079  1.00 17.33 ? 1036 HOH A O     1 
HETATM 10047 O  O     . HOH O 6 .   ? 58.561  150.527 41.503  1.00 15.39 ? 1037 HOH A O     1 
HETATM 10048 O  O     . HOH O 6 .   ? 57.087  151.182 37.522  1.00 15.24 ? 1038 HOH A O     1 
HETATM 10049 O  O     . HOH O 6 .   ? 67.280  157.505 54.323  1.00 24.88 ? 1039 HOH A O     1 
HETATM 10050 O  O     . HOH O 6 .   ? 64.373  141.750 45.844  1.00 18.65 ? 1040 HOH A O     1 
HETATM 10051 O  O     . HOH O 6 .   ? 61.054  143.070 45.821  1.00 20.79 ? 1041 HOH A O     1 
HETATM 10052 O  O     . HOH O 6 .   ? 68.562  145.704 39.012  1.00 21.27 ? 1042 HOH A O     1 
HETATM 10053 O  O     . HOH O 6 .   ? 71.576  150.346 45.475  1.00 18.11 ? 1043 HOH A O     1 
HETATM 10054 O  O     . HOH O 6 .   ? 71.438  147.813 45.590  1.00 25.49 ? 1044 HOH A O     1 
HETATM 10055 O  O     . HOH O 6 .   ? 72.464  156.583 35.682  1.00 9.12  ? 1045 HOH A O     1 
HETATM 10056 O  O     . HOH O 6 .   ? 73.812  155.220 34.011  1.00 29.04 ? 1046 HOH A O     1 
HETATM 10057 O  O     . HOH O 6 .   ? 62.815  169.094 46.493  1.00 22.34 ? 1047 HOH A O     1 
HETATM 10058 O  O     . HOH O 6 .   ? 65.089  173.906 40.697  1.00 17.69 ? 1048 HOH A O     1 
HETATM 10059 O  O     . HOH O 6 .   ? 51.379  166.377 40.837  1.00 15.35 ? 1049 HOH A O     1 
HETATM 10060 O  O     . HOH O 6 .   ? 72.178  163.025 47.935  1.00 21.93 ? 1050 HOH A O     1 
HETATM 10061 O  O     . HOH O 6 .   ? 72.968  166.076 47.636  1.00 38.51 ? 1051 HOH A O     1 
HETATM 10062 O  O     . HOH O 6 .   ? 74.856  161.106 48.600  1.00 35.77 ? 1052 HOH A O     1 
HETATM 10063 O  O     . HOH O 6 .   ? 75.008  156.241 49.887  1.00 31.72 ? 1053 HOH A O     1 
HETATM 10064 O  O     . HOH O 6 .   ? 64.356  170.630 33.181  1.00 6.91  ? 1054 HOH A O     1 
HETATM 10065 O  O     . HOH O 6 .   ? 59.859  177.694 43.175  1.00 22.00 ? 1055 HOH A O     1 
HETATM 10066 O  O     . HOH O 6 .   ? 72.249  169.748 33.211  1.00 21.31 ? 1056 HOH A O     1 
HETATM 10067 O  O     . HOH O 6 .   ? 69.292  173.310 26.966  1.00 35.12 ? 1057 HOH A O     1 
HETATM 10068 O  O     . HOH O 6 .   ? 53.780  138.114 27.802  1.00 14.45 ? 1058 HOH A O     1 
HETATM 10069 O  O     . HOH O 6 .   ? 52.628  140.696 33.662  1.00 11.22 ? 1059 HOH A O     1 
HETATM 10070 O  O     . HOH O 6 .   ? 53.349  144.797 56.136  1.00 31.23 ? 1060 HOH A O     1 
HETATM 10071 O  O     . HOH O 6 .   ? 54.405  145.610 52.950  1.00 30.32 ? 1061 HOH A O     1 
HETATM 10072 O  O     . HOH O 6 .   ? 52.909  140.224 30.705  1.00 5.63  ? 1062 HOH A O     1 
HETATM 10073 O  O     . HOH O 6 .   ? 47.343  144.149 32.319  1.00 6.88  ? 1063 HOH A O     1 
HETATM 10074 O  O     . HOH O 6 .   ? 30.316  154.715 25.217  1.00 46.21 ? 1064 HOH A O     1 
HETATM 10075 O  O     . HOH O 6 .   ? 43.487  159.353 32.294  1.00 11.83 ? 1065 HOH A O     1 
HETATM 10076 O  O     . HOH O 6 .   ? 44.623  162.380 36.533  1.00 7.88  ? 1066 HOH A O     1 
HETATM 10077 O  O     . HOH O 6 .   ? 44.579  162.897 39.104  1.00 13.22 ? 1067 HOH A O     1 
HETATM 10078 O  O     . HOH O 6 .   ? 33.587  168.154 41.524  1.00 15.42 ? 1068 HOH A O     1 
HETATM 10079 O  O     . HOH O 6 .   ? 39.648  172.691 35.792  1.00 8.72  ? 1069 HOH A O     1 
HETATM 10080 O  O     . HOH O 6 .   ? 31.739  175.609 39.227  1.00 15.91 ? 1070 HOH A O     1 
HETATM 10081 O  O     . HOH O 6 .   ? 34.853  174.206 33.406  1.00 11.82 ? 1071 HOH A O     1 
HETATM 10082 O  O     . HOH O 6 .   ? 32.046  174.615 35.045  1.00 36.49 ? 1072 HOH A O     1 
HETATM 10083 O  O     . HOH O 6 .   ? 30.635  168.279 30.425  1.00 19.70 ? 1073 HOH A O     1 
HETATM 10084 O  O     . HOH O 6 .   ? 29.486  170.094 29.214  1.00 17.34 ? 1074 HOH A O     1 
HETATM 10085 O  O     . HOH O 6 .   ? 27.926  169.037 27.008  1.00 25.20 ? 1075 HOH A O     1 
HETATM 10086 O  O     . HOH O 6 .   ? 33.796  165.197 24.167  1.00 14.98 ? 1076 HOH A O     1 
HETATM 10087 O  O     . HOH O 6 .   ? 35.387  150.797 43.728  1.00 12.01 ? 1077 HOH A O     1 
HETATM 10088 O  O     . HOH O 6 .   ? 31.507  153.880 50.307  1.00 11.87 ? 1078 HOH A O     1 
HETATM 10089 O  O     . HOH O 6 .   ? 26.665  163.400 33.453  1.00 15.71 ? 1079 HOH A O     1 
HETATM 10090 O  O     . HOH O 6 .   ? 25.904  162.151 31.119  1.00 18.30 ? 1080 HOH A O     1 
HETATM 10091 O  O     . HOH O 6 .   ? 25.121  158.187 35.779  1.00 11.72 ? 1081 HOH A O     1 
HETATM 10092 O  O     . HOH O 6 .   ? 29.235  149.504 38.983  1.00 17.44 ? 1082 HOH A O     1 
HETATM 10093 O  O     . HOH O 6 .   ? 31.965  144.849 44.937  1.00 8.02  ? 1083 HOH A O     1 
HETATM 10094 O  O     . HOH O 6 .   ? 23.333  146.490 24.971  1.00 10.35 ? 1084 HOH A O     1 
HETATM 10095 O  O     . HOH O 6 .   ? 23.497  146.263 22.214  1.00 13.22 ? 1085 HOH A O     1 
HETATM 10096 O  O     . HOH O 6 .   ? 29.426  148.833 42.517  1.00 21.51 ? 1086 HOH A O     1 
HETATM 10097 O  O     . HOH O 6 .   ? 41.617  132.780 35.331  1.00 19.85 ? 1087 HOH A O     1 
HETATM 10098 O  O     . HOH O 6 .   ? 42.639  133.527 30.521  1.00 25.22 ? 1088 HOH A O     1 
HETATM 10099 O  O     . HOH O 6 .   ? 43.498  125.861 39.690  1.00 26.21 ? 1089 HOH A O     1 
HETATM 10100 O  O     . HOH O 6 .   ? 56.618  133.216 35.921  1.00 20.72 ? 1090 HOH A O     1 
HETATM 10101 O  O     . HOH O 6 .   ? 49.987  126.193 44.482  1.00 10.07 ? 1091 HOH A O     1 
HETATM 10102 O  O     . HOH O 6 .   ? 46.910  130.050 47.220  1.00 13.16 ? 1092 HOH A O     1 
HETATM 10103 O  O     . HOH O 6 .   ? 48.705  131.895 49.303  1.00 15.53 ? 1093 HOH A O     1 
HETATM 10104 O  O     . HOH O 6 .   ? 25.164  139.571 48.286  1.00 32.34 ? 1094 HOH A O     1 
HETATM 10105 O  O     . HOH O 6 .   ? 32.869  138.237 52.537  1.00 35.34 ? 1095 HOH A O     1 
HETATM 10106 O  O     . HOH O 6 .   ? 41.552  146.402 54.826  1.00 20.87 ? 1096 HOH A O     1 
HETATM 10107 O  O     . HOH O 6 .   ? 64.807  151.196 67.845  1.00 22.57 ? 1097 HOH A O     1 
HETATM 10108 O  O     . HOH O 6 .   ? 35.493  154.029 63.621  1.00 36.65 ? 1098 HOH A O     1 
HETATM 10109 O  O     . HOH O 6 .   ? 57.638  162.282 76.936  1.00 20.10 ? 1099 HOH A O     1 
HETATM 10110 O  O     . HOH O 6 .   ? 55.378  167.693 75.222  1.00 10.58 ? 1100 HOH A O     1 
HETATM 10111 O  O     . HOH O 6 .   ? 48.312  149.331 79.818  1.00 27.78 ? 1101 HOH A O     1 
HETATM 10112 O  O     . HOH O 6 .   ? 19.219  152.969 35.464  1.00 24.28 ? 1102 HOH A O     1 
HETATM 10113 O  O     . HOH O 6 .   ? 23.596  150.971 33.381  1.00 17.17 ? 1103 HOH A O     1 
HETATM 10114 O  O     . HOH O 6 .   ? 23.297  153.510 34.160  1.00 19.91 ? 1104 HOH A O     1 
HETATM 10115 O  O     . HOH O 6 .   ? 21.477  155.028 33.182  1.00 21.86 ? 1105 HOH A O     1 
HETATM 10116 O  O     . HOH O 6 .   ? 34.349  134.246 21.421  1.00 25.97 ? 1106 HOH A O     1 
HETATM 10117 O  O     . HOH O 6 .   ? 37.195  128.165 20.651  1.00 21.45 ? 1107 HOH A O     1 
HETATM 10118 O  O     . HOH O 6 .   ? 37.093  132.394 17.368  1.00 27.58 ? 1108 HOH A O     1 
HETATM 10119 O  O     . HOH O 6 .   ? 40.277  127.107 31.678  1.00 32.67 ? 1109 HOH A O     1 
HETATM 10120 O  O     . HOH O 6 .   ? 41.149  130.999 31.647  1.00 29.71 ? 1110 HOH A O     1 
HETATM 10121 O  O     . HOH O 6 .   ? 37.404  125.620 33.165  1.00 37.75 ? 1111 HOH A O     1 
HETATM 10122 O  O     . HOH O 6 .   ? 43.066  126.510 25.466  1.00 25.44 ? 1112 HOH A O     1 
HETATM 10123 O  O     . HOH O 6 .   ? 38.862  136.975 20.887  1.00 33.42 ? 1113 HOH A O     1 
HETATM 10124 O  O     . HOH O 6 .   ? 50.535  139.247 14.702  1.00 25.35 ? 1114 HOH A O     1 
HETATM 10125 O  O     . HOH O 6 .   ? 46.903  145.422 16.096  1.00 22.17 ? 1115 HOH A O     1 
HETATM 10126 O  O     . HOH O 6 .   ? 48.811  126.346 30.502  1.00 19.85 ? 1116 HOH A O     1 
HETATM 10127 O  O     . HOH O 6 .   ? 47.638  127.715 35.112  1.00 17.90 ? 1117 HOH A O     1 
HETATM 10128 O  O     . HOH O 6 .   ? 49.810  123.118 37.753  1.00 28.32 ? 1118 HOH A O     1 
HETATM 10129 O  O     . HOH O 6 .   ? 47.729  124.530 39.334  1.00 22.19 ? 1119 HOH A O     1 
HETATM 10130 O  O     . HOH O 6 .   ? 46.912  125.882 36.916  1.00 28.12 ? 1120 HOH A O     1 
HETATM 10131 O  O     . HOH O 6 .   ? 41.108  125.724 35.985  1.00 33.23 ? 1121 HOH A O     1 
HETATM 10132 O  O     . HOH O 6 .   ? 53.768  127.848 46.601  1.00 24.70 ? 1122 HOH A O     1 
HETATM 10133 O  O     . HOH O 6 .   ? 52.917  125.915 48.303  1.00 20.85 ? 1123 HOH A O     1 
HETATM 10134 O  O     . HOH O 6 .   ? 51.270  124.981 50.116  1.00 15.20 ? 1124 HOH A O     1 
HETATM 10135 O  O     . HOH O 6 .   ? 60.159  127.007 44.052  1.00 23.36 ? 1125 HOH A O     1 
HETATM 10136 O  O     . HOH O 6 .   ? 48.124  155.341 12.427  1.00 11.62 ? 1126 HOH A O     1 
HETATM 10137 O  O     . HOH O 6 .   ? 72.920  152.482 26.453  1.00 22.45 ? 1127 HOH A O     1 
HETATM 10138 O  O     . HOH O 6 .   ? 71.254  145.076 27.635  1.00 36.92 ? 1128 HOH A O     1 
HETATM 10139 O  O     . HOH O 6 .   ? 68.987  142.028 28.614  1.00 35.24 ? 1129 HOH A O     1 
HETATM 10140 O  O     . HOH O 6 .   ? 70.579  144.981 31.787  1.00 28.99 ? 1130 HOH A O     1 
HETATM 10141 O  O     . HOH O 6 .   ? 73.899  147.991 32.057  1.00 29.85 ? 1131 HOH A O     1 
HETATM 10142 O  O     . HOH O 6 .   ? 52.121  165.637 43.275  1.00 35.66 ? 1132 HOH A O     1 
HETATM 10143 O  O     . HOH O 6 .   ? 54.595  165.384 44.398  1.00 35.05 ? 1133 HOH A O     1 
HETATM 10144 O  O     . HOH O 6 .   ? 59.878  149.653 30.644  1.00 29.10 ? 1134 HOH A O     1 
HETATM 10145 O  O     . HOH O 6 .   ? 63.044  159.556 55.496  1.00 14.79 ? 1135 HOH A O     1 
HETATM 10146 O  O     . HOH O 6 .   ? 69.481  148.049 37.335  1.00 28.02 ? 1136 HOH A O     1 
HETATM 10147 O  O     . HOH O 6 .   ? 52.971  175.713 44.544  1.00 29.18 ? 1137 HOH A O     1 
HETATM 10148 O  O     . HOH O 6 .   ? 51.894  176.780 42.464  1.00 23.10 ? 1138 HOH A O     1 
HETATM 10149 O  O     . HOH O 6 .   ? 63.534  165.556 52.441  1.00 32.36 ? 1139 HOH A O     1 
HETATM 10150 O  O     . HOH O 6 .   ? 64.507  162.975 55.335  1.00 33.91 ? 1140 HOH A O     1 
HETATM 10151 O  O     . HOH O 6 .   ? 74.284  148.283 44.140  1.00 29.52 ? 1141 HOH A O     1 
HETATM 10152 O  O     . HOH O 6 .   ? 74.196  155.232 44.441  1.00 32.22 ? 1142 HOH A O     1 
HETATM 10153 O  O     . HOH O 6 .   ? 66.523  175.715 39.451  1.00 21.70 ? 1143 HOH A O     1 
HETATM 10154 O  O     . HOH O 6 .   ? 63.171  178.312 46.816  1.00 40.02 ? 1144 HOH A O     1 
HETATM 10155 O  O     . HOH O 6 .   ? 69.045  158.876 16.213  1.00 28.10 ? 1145 HOH A O     1 
HETATM 10156 O  O     . HOH O 6 .   ? 69.060  156.408 18.051  1.00 23.32 ? 1146 HOH A O     1 
HETATM 10157 O  O     . HOH O 6 .   ? 67.722  154.428 16.433  1.00 34.28 ? 1147 HOH A O     1 
HETATM 10158 O  O     . HOH O 6 .   ? 59.864  156.211 14.894  1.00 16.36 ? 1148 HOH A O     1 
HETATM 10159 O  O     . HOH O 6 .   ? 61.941  158.059 15.286  1.00 24.41 ? 1149 HOH A O     1 
HETATM 10160 O  O     . HOH O 6 .   ? 52.782  138.776 53.038  1.00 29.65 ? 1150 HOH A O     1 
HETATM 10161 O  O     . HOH O 6 .   ? 45.254  160.626 42.383  1.00 13.78 ? 1151 HOH A O     1 
HETATM 10162 O  O     . HOH O 6 .   ? 32.085  174.541 44.332  1.00 26.04 ? 1152 HOH A O     1 
HETATM 10163 O  O     . HOH O 6 .   ? 34.868  173.495 26.632  1.00 26.76 ? 1153 HOH A O     1 
HETATM 10164 O  O     . HOH O 6 .   ? 30.685  161.594 52.364  1.00 25.34 ? 1154 HOH A O     1 
HETATM 10165 O  O     . HOH O 6 .   ? 28.371  162.222 52.955  1.00 24.57 ? 1155 HOH A O     1 
HETATM 10166 O  O     . HOH O 6 .   ? 33.587  147.108 45.028  1.00 17.16 ? 1156 HOH A O     1 
HETATM 10167 O  O     . HOH O 6 .   ? 24.679  152.386 51.669  1.00 36.48 ? 1157 HOH A O     1 
HETATM 10168 O  O     . HOH O 6 .   ? 27.419  147.333 39.525  1.00 9.07  ? 1158 HOH A O     1 
HETATM 10169 O  O     . HOH O 6 .   ? 20.429  151.083 44.438  1.00 33.00 ? 1159 HOH A O     1 
HETATM 10170 O  O     . HOH O 6 .   ? 25.311  149.176 32.276  1.00 22.76 ? 1160 HOH A O     1 
HETATM 10171 O  O     . HOH O 6 .   ? 50.208  149.835 42.486  1.00 10.05 ? 1161 HOH A O     1 
HETATM 10172 O  O     . HOH O 6 .   ? 33.363  129.246 44.420  1.00 24.54 ? 1162 HOH A O     1 
HETATM 10173 O  O     . HOH O 6 .   ? 51.062  166.497 69.848  1.00 12.46 ? 1163 HOH A O     1 
HETATM 10174 O  O     . HOH O 6 .   ? 50.111  166.062 67.516  1.00 32.32 ? 1164 HOH A O     1 
HETATM 10175 O  O     . HOH O 6 .   ? 21.672  149.032 42.430  1.00 22.70 ? 1165 HOH A O     1 
HETATM 10176 O  O     . HOH O 6 .   ? 24.882  144.893 20.090  1.00 29.16 ? 1166 HOH A O     1 
HETATM 10177 O  O     . HOH O 6 .   ? 29.608  152.001 17.813  1.00 32.78 ? 1167 HOH A O     1 
HETATM 10178 O  O     . HOH O 6 .   ? 27.673  145.116 20.038  1.00 14.20 ? 1168 HOH A O     1 
HETATM 10179 O  O     . HOH O 6 .   ? 24.565  140.285 19.317  1.00 15.37 ? 1169 HOH A O     1 
HETATM 10180 O  O     . HOH O 6 .   ? 37.527  139.105 22.270  1.00 22.40 ? 1170 HOH A O     1 
HETATM 10181 O  O     . HOH O 6 .   ? 50.195  134.688 16.373  1.00 31.79 ? 1171 HOH A O     1 
HETATM 10182 O  O     . HOH O 6 .   ? 53.786  126.026 32.740  1.00 29.26 ? 1172 HOH A O     1 
HETATM 10183 O  O     . HOH O 6 .   ? 60.025  133.755 31.172  1.00 24.68 ? 1173 HOH A O     1 
HETATM 10184 O  O     . HOH O 6 .   ? 59.720  133.051 28.410  1.00 17.28 ? 1174 HOH A O     1 
HETATM 10185 O  O     . HOH O 6 .   ? 59.591  136.255 25.493  1.00 18.02 ? 1175 HOH A O     1 
HETATM 10186 O  O     . HOH O 6 .   ? 50.336  176.426 39.934  1.00 28.40 ? 1176 HOH A O     1 
HETATM 10187 O  O     . HOH O 6 .   ? 72.028  161.874 27.742  1.00 25.44 ? 1177 HOH A O     1 
HETATM 10188 O  O     . HOH O 6 .   ? 70.962  163.433 26.023  1.00 32.03 ? 1178 HOH A O     1 
HETATM 10189 O  O     . HOH O 6 .   ? 75.590  151.708 27.052  1.00 22.17 ? 1179 HOH A O     1 
HETATM 10190 O  O     . HOH O 6 .   ? 65.991  142.183 33.105  1.00 22.87 ? 1180 HOH A O     1 
HETATM 10191 O  O     . HOH O 6 .   ? 53.676  165.259 51.102  1.00 36.98 ? 1181 HOH A O     1 
HETATM 10192 O  O     . HOH O 6 .   ? 69.919  167.786 49.745  1.00 20.63 ? 1182 HOH A O     1 
HETATM 10193 O  O     . HOH O 6 .   ? 67.474  169.325 47.078  1.00 25.71 ? 1183 HOH A O     1 
HETATM 10194 O  O     . HOH O 6 .   ? 66.046  173.648 32.850  1.00 25.03 ? 1184 HOH A O     1 
HETATM 10195 O  O     . HOH O 6 .   ? 67.190  151.466 17.282  1.00 29.88 ? 1185 HOH A O     1 
HETATM 10196 O  O     . HOH O 6 .   ? 67.936  151.445 19.902  1.00 28.03 ? 1186 HOH A O     1 
HETATM 10197 O  O     . HOH O 6 .   ? 55.225  142.546 51.835  1.00 28.05 ? 1187 HOH A O     1 
HETATM 10198 O  O     . HOH O 6 .   ? 33.835  159.325 20.304  1.00 19.33 ? 1188 HOH A O     1 
HETATM 10199 O  O     . HOH O 6 .   ? 37.673  174.810 41.806  1.00 23.93 ? 1189 HOH A O     1 
HETATM 10200 O  O     . HOH O 6 .   ? 36.208  152.198 50.524  1.00 30.80 ? 1190 HOH A O     1 
HETATM 10201 O  O     . HOH O 6 .   ? 24.894  173.740 37.612  1.00 30.98 ? 1191 HOH A O     1 
HETATM 10202 O  O     . HOH O 6 .   ? 24.781  174.972 39.714  1.00 31.25 ? 1192 HOH A O     1 
HETATM 10203 O  O     . HOH O 6 .   ? 23.301  169.982 33.618  1.00 20.99 ? 1193 HOH A O     1 
HETATM 10204 O  O     . HOH O 6 .   ? 33.295  141.275 33.170  1.00 25.70 ? 1194 HOH A O     1 
HETATM 10205 O  O     . HOH O 6 .   ? 63.775  133.540 45.889  1.00 28.02 ? 1195 HOH A O     1 
HETATM 10206 O  O     . HOH O 6 .   ? 44.989  124.090 49.782  1.00 18.93 ? 1196 HOH A O     1 
HETATM 10207 O  O     . HOH O 6 .   ? 21.165  136.952 46.163  1.00 34.48 ? 1197 HOH A O     1 
HETATM 10208 O  O     . HOH O 6 .   ? 63.141  147.802 69.478  1.00 30.03 ? 1198 HOH A O     1 
HETATM 10209 O  O     . HOH O 6 .   ? 63.202  145.185 68.979  1.00 23.97 ? 1199 HOH A O     1 
HETATM 10210 O  O     . HOH O 6 .   ? 64.221  149.788 71.624  1.00 33.62 ? 1200 HOH A O     1 
HETATM 10211 O  O     . HOH O 6 .   ? 58.966  144.326 68.906  1.00 30.72 ? 1201 HOH A O     1 
HETATM 10212 O  O     . HOH O 6 .   ? 59.886  162.179 64.269  1.00 18.03 ? 1202 HOH A O     1 
HETATM 10213 O  O     . HOH P 6 .   ? 62.499  146.984 73.372  1.00 28.06 ? 999  HOH B O     1 
HETATM 10214 O  O     . HOH P 6 .   ? 95.423  121.381 81.128  1.00 23.96 ? 1000 HOH B O     1 
HETATM 10215 O  O     . HOH P 6 .   ? 94.222  117.154 72.914  1.00 16.80 ? 1001 HOH B O     1 
HETATM 10216 O  O     . HOH P 6 .   ? 93.773  119.908 72.228  1.00 26.75 ? 1002 HOH B O     1 
HETATM 10217 O  O     . HOH P 6 .   ? 91.953  121.762 71.161  1.00 18.86 ? 1003 HOH B O     1 
HETATM 10218 O  O     . HOH P 6 .   ? 86.218  122.984 63.490  1.00 14.69 ? 1004 HOH B O     1 
HETATM 10219 O  O     . HOH P 6 .   ? 88.478  123.594 65.026  1.00 17.20 ? 1005 HOH B O     1 
HETATM 10220 O  O     . HOH P 6 .   ? 81.961  138.312 54.924  1.00 27.97 ? 1006 HOH B O     1 
HETATM 10221 O  O     . HOH P 6 .   ? 81.458  135.290 57.123  1.00 36.00 ? 1007 HOH B O     1 
HETATM 10222 O  O     . HOH P 6 .   ? 71.191  128.667 51.570  1.00 34.37 ? 1008 HOH B O     1 
HETATM 10223 O  O     . HOH P 6 .   ? 68.092  132.638 53.195  1.00 36.42 ? 1009 HOH B O     1 
HETATM 10224 O  O     . HOH P 6 .   ? 63.449  124.874 54.842  1.00 16.95 ? 1010 HOH B O     1 
HETATM 10225 O  O     . HOH P 6 .   ? 65.158  138.969 62.073  1.00 17.20 ? 1011 HOH B O     1 
HETATM 10226 O  O     . HOH P 6 .   ? 70.495  145.009 69.292  1.00 26.02 ? 1012 HOH B O     1 
HETATM 10227 O  O     . HOH P 6 .   ? 71.880  146.262 70.869  1.00 36.51 ? 1013 HOH B O     1 
HETATM 10228 O  O     . HOH P 6 .   ? 61.445  137.540 72.035  1.00 20.98 ? 1014 HOH B O     1 
HETATM 10229 O  O     . HOH P 6 .   ? 64.445  132.742 64.136  1.00 17.76 ? 1015 HOH B O     1 
HETATM 10230 O  O     . HOH P 6 .   ? 58.959  134.721 61.231  1.00 24.89 ? 1016 HOH B O     1 
HETATM 10231 O  O     . HOH P 6 .   ? 59.866  123.086 60.853  1.00 15.61 ? 1017 HOH B O     1 
HETATM 10232 O  O     . HOH P 6 .   ? 59.008  125.042 62.878  1.00 11.43 ? 1018 HOH B O     1 
HETATM 10233 O  O     . HOH P 6 .   ? 71.053  115.522 48.690  1.00 20.88 ? 1019 HOH B O     1 
HETATM 10234 O  O     . HOH P 6 .   ? 73.434  116.357 52.159  1.00 25.59 ? 1020 HOH B O     1 
HETATM 10235 O  O     . HOH P 6 .   ? 75.402  117.145 53.858  1.00 35.50 ? 1021 HOH B O     1 
HETATM 10236 O  O     . HOH P 6 .   ? 76.066  105.342 56.483  1.00 22.07 ? 1022 HOH B O     1 
HETATM 10237 O  O     . HOH P 6 .   ? 77.573  97.992  73.061  1.00 23.14 ? 1023 HOH B O     1 
HETATM 10238 O  O     . HOH P 6 .   ? 72.691  99.982  79.345  1.00 15.89 ? 1024 HOH B O     1 
HETATM 10239 O  O     . HOH P 6 .   ? 73.176  94.339  67.363  1.00 22.95 ? 1025 HOH B O     1 
HETATM 10240 O  O     . HOH P 6 .   ? 66.043  91.440  67.522  1.00 32.40 ? 1026 HOH B O     1 
HETATM 10241 O  O     . HOH P 6 .   ? 50.196  114.571 52.655  1.00 29.71 ? 1027 HOH B O     1 
HETATM 10242 O  O     . HOH P 6 .   ? 49.675  112.026 51.280  1.00 17.53 ? 1028 HOH B O     1 
HETATM 10243 O  O     . HOH P 6 .   ? 60.634  111.960 76.309  1.00 6.51  ? 1029 HOH B O     1 
HETATM 10244 O  O     . HOH P 6 .   ? 63.307  110.667 78.071  1.00 17.48 ? 1030 HOH B O     1 
HETATM 10245 O  O     . HOH P 6 .   ? 63.696  102.006 76.023  1.00 10.99 ? 1031 HOH B O     1 
HETATM 10246 O  O     . HOH P 6 .   ? 65.541  104.347 77.125  1.00 16.16 ? 1032 HOH B O     1 
HETATM 10247 O  O     . HOH P 6 .   ? 70.376  106.561 76.933  1.00 14.29 ? 1033 HOH B O     1 
HETATM 10248 O  O     . HOH P 6 .   ? 58.039  121.245 66.293  1.00 21.36 ? 1034 HOH B O     1 
HETATM 10249 O  O     . HOH P 6 .   ? 57.383  123.788 64.640  1.00 16.86 ? 1035 HOH B O     1 
HETATM 10250 O  O     . HOH P 6 .   ? 54.536  126.440 64.966  1.00 13.85 ? 1036 HOH B O     1 
HETATM 10251 O  O     . HOH P 6 .   ? 60.381  119.678 73.539  1.00 11.01 ? 1037 HOH B O     1 
HETATM 10252 O  O     . HOH P 6 .   ? 58.765  120.122 77.302  1.00 21.26 ? 1038 HOH B O     1 
HETATM 10253 O  O     . HOH P 6 .   ? 53.114  111.541 90.569  1.00 3.79  ? 1039 HOH B O     1 
HETATM 10254 O  O     . HOH P 6 .   ? 48.984  125.240 73.555  1.00 21.44 ? 1040 HOH B O     1 
HETATM 10255 O  O     . HOH P 6 .   ? 44.788  114.232 69.946  1.00 30.06 ? 1041 HOH B O     1 
HETATM 10256 O  O     . HOH P 6 .   ? 53.474  101.825 81.798  1.00 15.11 ? 1042 HOH B O     1 
HETATM 10257 O  O     . HOH P 6 .   ? 48.851  101.689 81.770  1.00 20.15 ? 1043 HOH B O     1 
HETATM 10258 O  O     . HOH P 6 .   ? 47.834  103.680 86.780  1.00 29.61 ? 1044 HOH B O     1 
HETATM 10259 O  O     . HOH P 6 .   ? 46.760  103.086 84.347  1.00 19.17 ? 1045 HOH B O     1 
HETATM 10260 O  O     . HOH P 6 .   ? 45.290  120.356 79.838  1.00 26.21 ? 1046 HOH B O     1 
HETATM 10261 O  O     . HOH P 6 .   ? 45.719  123.162 79.776  1.00 22.95 ? 1047 HOH B O     1 
HETATM 10262 O  O     . HOH P 6 .   ? 53.173  99.996  68.569  1.00 3.00  ? 1048 HOH B O     1 
HETATM 10263 O  O     . HOH P 6 .   ? 55.824  98.774  67.688  1.00 34.60 ? 1049 HOH B O     1 
HETATM 10264 O  O     . HOH P 6 .   ? 56.911  93.433  79.093  1.00 12.61 ? 1050 HOH B O     1 
HETATM 10265 O  O     . HOH P 6 .   ? 58.977  114.601 50.510  1.00 17.15 ? 1051 HOH B O     1 
HETATM 10266 O  O     . HOH P 6 .   ? 57.110  112.830 50.811  1.00 25.29 ? 1052 HOH B O     1 
HETATM 10267 O  O     . HOH P 6 .   ? 65.617  121.831 84.806  1.00 18.70 ? 1053 HOH B O     1 
HETATM 10268 O  O     . HOH P 6 .   ? 60.957  128.149 87.741  1.00 33.50 ? 1054 HOH B O     1 
HETATM 10269 O  O     . HOH P 6 .   ? 63.240  131.907 88.966  1.00 23.59 ? 1055 HOH B O     1 
HETATM 10270 O  O     . HOH P 6 .   ? 61.537  131.859 86.124  1.00 29.81 ? 1056 HOH B O     1 
HETATM 10271 O  O     . HOH P 6 .   ? 63.701  130.261 84.483  1.00 35.58 ? 1057 HOH B O     1 
HETATM 10272 O  O     . HOH P 6 .   ? 65.220  130.028 69.867  1.00 14.88 ? 1058 HOH B O     1 
HETATM 10273 O  O     . HOH P 6 .   ? 65.115  130.712 66.876  1.00 8.16  ? 1059 HOH B O     1 
HETATM 10274 O  O     . HOH P 6 .   ? 70.760  126.552 68.942  1.00 21.06 ? 1060 HOH B O     1 
HETATM 10275 O  O     . HOH P 6 .   ? 88.017  115.873 62.657  1.00 27.21 ? 1061 HOH B O     1 
HETATM 10276 O  O     . HOH P 6 .   ? 74.461  111.284 69.041  1.00 17.42 ? 1062 HOH B O     1 
HETATM 10277 O  O     . HOH P 6 .   ? 72.653  108.204 73.313  1.00 10.40 ? 1063 HOH B O     1 
HETATM 10278 O  O     . HOH P 6 .   ? 72.532  107.972 75.865  1.00 18.97 ? 1064 HOH B O     1 
HETATM 10279 O  O     . HOH P 6 .   ? 69.268  108.716 78.608  1.00 10.80 ? 1065 HOH B O     1 
HETATM 10280 O  O     . HOH P 6 .   ? 83.295  102.141 79.301  1.00 20.08 ? 1066 HOH B O     1 
HETATM 10281 O  O     . HOH P 6 .   ? 86.882  102.380 68.585  1.00 10.92 ? 1067 HOH B O     1 
HETATM 10282 O  O     . HOH P 6 .   ? 81.780  119.706 81.261  1.00 11.79 ? 1068 HOH B O     1 
HETATM 10283 O  O     . HOH P 6 .   ? 79.981  118.558 88.294  1.00 17.72 ? 1069 HOH B O     1 
HETATM 10284 O  O     . HOH P 6 .   ? 84.357  122.724 83.963  1.00 30.51 ? 1070 HOH B O     1 
HETATM 10285 O  O     . HOH P 6 .   ? 87.353  121.372 80.484  1.00 32.29 ? 1071 HOH B O     1 
HETATM 10286 O  O     . HOH P 6 .   ? 92.261  112.471 74.330  1.00 7.78  ? 1072 HOH B O     1 
HETATM 10287 O  O     . HOH P 6 .   ? 84.785  126.055 82.834  1.00 12.95 ? 1073 HOH B O     1 
HETATM 10288 O  O     . HOH P 6 .   ? 69.597  129.857 83.324  1.00 9.21  ? 1074 HOH B O     1 
HETATM 10289 O  O     . HOH P 6 .   ? 84.651  129.335 70.781  1.00 23.13 ? 1075 HOH B O     1 
HETATM 10290 O  O     . HOH P 6 .   ? 89.409  123.148 78.018  1.00 13.86 ? 1076 HOH B O     1 
HETATM 10291 O  O     . HOH P 6 .   ? 76.283  137.780 72.388  1.00 18.83 ? 1077 HOH B O     1 
HETATM 10292 O  O     . HOH P 6 .   ? 83.776  141.323 81.985  1.00 16.54 ? 1078 HOH B O     1 
HETATM 10293 O  O     . HOH P 6 .   ? 79.199  143.888 94.602  1.00 31.05 ? 1079 HOH B O     1 
HETATM 10294 O  O     . HOH P 6 .   ? 74.251  144.854 77.130  1.00 21.64 ? 1080 HOH B O     1 
HETATM 10295 O  O     . HOH P 6 .   ? 76.800  139.760 68.064  1.00 34.07 ? 1081 HOH B O     1 
HETATM 10296 O  O     . HOH P 6 .   ? 75.455  137.190 67.486  1.00 26.76 ? 1082 HOH B O     1 
HETATM 10297 O  O     . HOH P 6 .   ? 55.479  134.513 75.389  1.00 24.18 ? 1083 HOH B O     1 
HETATM 10298 O  O     . HOH P 6 .   ? 67.848  138.751 85.509  1.00 19.65 ? 1084 HOH B O     1 
HETATM 10299 O  O     . HOH P 6 .   ? 69.969  140.636 83.753  1.00 9.02  ? 1085 HOH B O     1 
HETATM 10300 O  O     . HOH P 6 .   ? 60.634  127.418 98.786  1.00 37.29 ? 1086 HOH B O     1 
HETATM 10301 O  O     . HOH P 6 .   ? 66.450  121.433 115.715 1.00 25.36 ? 1087 HOH B O     1 
HETATM 10302 O  O     . HOH P 6 .   ? 101.718 122.640 76.157  1.00 37.33 ? 1088 HOH B O     1 
HETATM 10303 O  O     . HOH P 6 .   ? 92.497  112.887 67.490  1.00 29.74 ? 1089 HOH B O     1 
HETATM 10304 O  O     . HOH P 6 .   ? 79.888  133.360 58.282  1.00 27.90 ? 1090 HOH B O     1 
HETATM 10305 O  O     . HOH P 6 .   ? 68.575  128.454 50.604  1.00 17.55 ? 1091 HOH B O     1 
HETATM 10306 O  O     . HOH P 6 .   ? 69.412  144.304 66.836  1.00 31.76 ? 1092 HOH B O     1 
HETATM 10307 O  O     . HOH P 6 .   ? 62.682  142.436 67.836  1.00 31.97 ? 1093 HOH B O     1 
HETATM 10308 O  O     . HOH P 6 .   ? 70.314  143.472 72.103  1.00 24.95 ? 1094 HOH B O     1 
HETATM 10309 O  O     . HOH P 6 .   ? 60.181  117.009 50.211  1.00 20.08 ? 1095 HOH B O     1 
HETATM 10310 O  O     . HOH P 6 .   ? 71.716  97.467  63.390  1.00 31.72 ? 1096 HOH B O     1 
HETATM 10311 O  O     . HOH P 6 .   ? 68.466  98.375  60.845  1.00 35.14 ? 1097 HOH B O     1 
HETATM 10312 O  O     . HOH P 6 .   ? 46.141  109.087 62.400  1.00 15.48 ? 1098 HOH B O     1 
HETATM 10313 O  O     . HOH P 6 .   ? 45.123  118.595 60.659  1.00 26.70 ? 1099 HOH B O     1 
HETATM 10314 O  O     . HOH P 6 .   ? 46.529  108.018 58.494  1.00 41.24 ? 1100 HOH B O     1 
HETATM 10315 O  O     . HOH P 6 .   ? 47.044  125.265 66.794  1.00 27.84 ? 1101 HOH B O     1 
HETATM 10316 O  O     . HOH P 6 .   ? 47.820  123.041 72.000  1.00 29.67 ? 1102 HOH B O     1 
HETATM 10317 O  O     . HOH P 6 .   ? 53.769  119.469 77.880  1.00 26.44 ? 1103 HOH B O     1 
HETATM 10318 O  O     . HOH P 6 .   ? 55.592  105.913 88.648  1.00 26.86 ? 1104 HOH B O     1 
HETATM 10319 O  O     . HOH P 6 .   ? 49.306  104.393 90.112  1.00 20.56 ? 1105 HOH B O     1 
HETATM 10320 O  O     . HOH P 6 .   ? 48.254  126.562 78.293  1.00 30.71 ? 1106 HOH B O     1 
HETATM 10321 O  O     . HOH P 6 .   ? 55.947  127.749 80.889  1.00 15.91 ? 1107 HOH B O     1 
HETATM 10322 O  O     . HOH P 6 .   ? 52.058  97.186  76.041  1.00 25.17 ? 1108 HOH B O     1 
HETATM 10323 O  O     . HOH P 6 .   ? 44.032  108.381 82.719  1.00 27.11 ? 1109 HOH B O     1 
HETATM 10324 O  O     . HOH P 6 .   ? 39.055  121.121 84.752  1.00 43.55 ? 1110 HOH B O     1 
HETATM 10325 O  O     . HOH P 6 .   ? 44.109  104.199 85.017  1.00 32.48 ? 1111 HOH B O     1 
HETATM 10326 O  O     . HOH P 6 .   ? 41.051  103.463 71.214  1.00 34.65 ? 1112 HOH B O     1 
HETATM 10327 O  O     . HOH P 6 .   ? 51.629  116.472 50.964  1.00 25.00 ? 1113 HOH B O     1 
HETATM 10328 O  O     . HOH P 6 .   ? 56.799  119.286 48.751  1.00 33.06 ? 1114 HOH B O     1 
HETATM 10329 O  O     . HOH P 6 .   ? 60.280  135.335 68.444  1.00 25.27 ? 1115 HOH B O     1 
HETATM 10330 O  O     . HOH P 6 .   ? 61.721  124.970 88.954  1.00 27.01 ? 1116 HOH B O     1 
HETATM 10331 O  O     . HOH P 6 .   ? 62.826  126.354 91.951  1.00 21.39 ? 1117 HOH B O     1 
HETATM 10332 O  O     . HOH P 6 .   ? 58.580  121.045 90.422  1.00 16.09 ? 1118 HOH B O     1 
HETATM 10333 O  O     . HOH P 6 .   ? 78.660  126.209 57.456  1.00 20.94 ? 1119 HOH B O     1 
HETATM 10334 O  O     . HOH P 6 .   ? 77.506  127.884 55.090  1.00 28.21 ? 1120 HOH B O     1 
HETATM 10335 O  O     . HOH P 6 .   ? 74.848  111.830 79.042  1.00 29.33 ? 1121 HOH B O     1 
HETATM 10336 O  O     . HOH P 6 .   ? 79.071  95.772  79.305  1.00 28.68 ? 1122 HOH B O     1 
HETATM 10337 O  O     . HOH P 6 .   ? 91.948  95.652  78.187  1.00 30.62 ? 1123 HOH B O     1 
HETATM 10338 O  O     . HOH P 6 .   ? 84.980  94.908  76.760  1.00 27.07 ? 1124 HOH B O     1 
HETATM 10339 O  O     . HOH P 6 .   ? 90.815  106.879 71.937  1.00 23.09 ? 1125 HOH B O     1 
HETATM 10340 O  O     . HOH P 6 .   ? 92.044  107.907 69.762  1.00 15.17 ? 1126 HOH B O     1 
HETATM 10341 O  O     . HOH P 6 .   ? 88.215  121.045 77.466  1.00 27.33 ? 1127 HOH B O     1 
HETATM 10342 O  O     . HOH P 6 .   ? 97.218  129.260 72.680  1.00 16.74 ? 1128 HOH B O     1 
HETATM 10343 O  O     . HOH P 6 .   ? 93.664  129.691 84.491  1.00 24.83 ? 1129 HOH B O     1 
HETATM 10344 O  O     . HOH P 6 .   ? 85.286  137.683 76.166  1.00 31.42 ? 1130 HOH B O     1 
HETATM 10345 O  O     . HOH P 6 .   ? 83.583  142.857 79.861  1.00 22.26 ? 1131 HOH B O     1 
HETATM 10346 O  O     . HOH P 6 .   ? 72.489  142.003 92.515  1.00 35.99 ? 1132 HOH B O     1 
HETATM 10347 O  O     . HOH P 6 .   ? 73.060  139.316 92.101  1.00 28.03 ? 1133 HOH B O     1 
HETATM 10348 O  O     . HOH P 6 .   ? 87.211  145.811 86.852  1.00 32.49 ? 1134 HOH B O     1 
HETATM 10349 O  O     . HOH P 6 .   ? 77.518  143.721 73.666  1.00 19.47 ? 1135 HOH B O     1 
HETATM 10350 O  O     . HOH P 6 .   ? 68.480  146.023 88.042  1.00 17.28 ? 1136 HOH B O     1 
HETATM 10351 O  O     . HOH P 6 .   ? 50.496  119.411 103.487 1.00 24.89 ? 1137 HOH B O     1 
HETATM 10352 O  O     . HOH P 6 .   ? 78.007  121.764 96.765  1.00 25.49 ? 1138 HOH B O     1 
HETATM 10353 O  O     . HOH P 6 .   ? 56.735  108.172 112.522 1.00 28.88 ? 1139 HOH B O     1 
HETATM 10354 O  O     . HOH P 6 .   ? 64.038  104.312 105.852 1.00 17.46 ? 1140 HOH B O     1 
HETATM 10355 O  O     . HOH P 6 .   ? 59.294  103.161 111.098 1.00 23.25 ? 1141 HOH B O     1 
HETATM 10356 O  O     . HOH P 6 .   ? 55.396  108.657 100.101 1.00 21.95 ? 1142 HOH B O     1 
HETATM 10357 O  O     . HOH P 6 .   ? 70.033  111.243 107.630 1.00 28.98 ? 1143 HOH B O     1 
HETATM 10358 O  O     . HOH P 6 .   ? 61.625  118.100 113.227 1.00 23.51 ? 1144 HOH B O     1 
HETATM 10359 O  O     . HOH P 6 .   ? 67.689  132.285 113.085 1.00 17.60 ? 1145 HOH B O     1 
HETATM 10360 O  O     . HOH P 6 .   ? 56.667  125.089 119.415 1.00 31.69 ? 1146 HOH B O     1 
HETATM 10361 O  O     . HOH P 6 .   ? 57.992  123.548 117.017 1.00 29.88 ? 1147 HOH B O     1 
HETATM 10362 O  O     . HOH P 6 .   ? 50.734  121.183 107.099 1.00 35.65 ? 1148 HOH B O     1 
HETATM 10363 O  O     . HOH P 6 .   ? 48.864  119.045 107.885 1.00 24.76 ? 1149 HOH B O     1 
HETATM 10364 O  O     . HOH P 6 .   ? 51.855  123.443 103.587 1.00 44.12 ? 1150 HOH B O     1 
HETATM 10365 O  O     . HOH P 6 .   ? 81.309  142.665 57.863  1.00 29.87 ? 1151 HOH B O     1 
HETATM 10366 O  O     . HOH P 6 .   ? 83.461  143.186 59.700  1.00 27.97 ? 1152 HOH B O     1 
HETATM 10367 O  O     . HOH P 6 .   ? 74.777  122.485 55.221  1.00 28.09 ? 1153 HOH B O     1 
HETATM 10368 O  O     . HOH P 6 .   ? 75.746  125.510 52.482  1.00 30.25 ? 1154 HOH B O     1 
HETATM 10369 O  O     . HOH P 6 .   ? 68.679  121.011 49.047  1.00 34.28 ? 1155 HOH B O     1 
HETATM 10370 O  O     . HOH P 6 .   ? 67.035  144.652 80.682  1.00 23.68 ? 1156 HOH B O     1 
HETATM 10371 O  O     . HOH P 6 .   ? 67.322  115.576 48.582  1.00 19.17 ? 1157 HOH B O     1 
HETATM 10372 O  O     . HOH P 6 .   ? 67.762  117.751 46.849  1.00 30.65 ? 1158 HOH B O     1 
HETATM 10373 O  O     . HOH P 6 .   ? 71.243  108.041 47.584  1.00 32.73 ? 1159 HOH B O     1 
HETATM 10374 O  O     . HOH P 6 .   ? 73.396  107.739 49.060  1.00 22.70 ? 1160 HOH B O     1 
HETATM 10375 O  O     . HOH P 6 .   ? 67.845  95.195  78.573  1.00 25.67 ? 1161 HOH B O     1 
HETATM 10376 O  O     . HOH P 6 .   ? 65.073  108.580 48.229  1.00 28.61 ? 1162 HOH B O     1 
HETATM 10377 O  O     . HOH P 6 .   ? 47.881  127.307 75.245  1.00 31.29 ? 1163 HOH B O     1 
HETATM 10378 O  O     . HOH P 6 .   ? 46.023  96.393  67.174  1.00 25.94 ? 1164 HOH B O     1 
HETATM 10379 O  O     . HOH P 6 .   ? 84.008  105.434 61.710  1.00 23.99 ? 1165 HOH B O     1 
HETATM 10380 O  O     . HOH P 6 .   ? 80.690  103.178 86.512  1.00 29.71 ? 1166 HOH B O     1 
HETATM 10381 O  O     . HOH P 6 .   ? 91.584  103.942 85.638  1.00 24.09 ? 1167 HOH B O     1 
HETATM 10382 O  O     . HOH P 6 .   ? 67.081  121.506 82.069  1.00 34.87 ? 1168 HOH B O     1 
HETATM 10383 O  O     . HOH P 6 .   ? 53.174  136.200 77.647  1.00 26.66 ? 1169 HOH B O     1 
HETATM 10384 O  O     . HOH P 6 .   ? 71.877  146.590 86.478  1.00 19.41 ? 1170 HOH B O     1 
HETATM 10385 O  O     . HOH P 6 .   ? 54.106  123.455 99.383  1.00 22.91 ? 1171 HOH B O     1 
HETATM 10386 O  O     . HOH P 6 .   ? 62.237  105.466 87.244  1.00 30.20 ? 1172 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS ALA A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 L